2IPKB

Crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipkB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2ipkB01
4GW1A 3WUWB 1K8DB 3BJLA 1NCDL 5HGAB 1WCBA 1OGTA 3TT1H 1F90L 1MI5E 4JRXE 4F7CA 4JM4H 5DXWA 2VXUH 1JGDA 1EHAA 1EPFA 1DL7H 3KHOA 4X8XA 4FQHA 2X4PA 3LRHA 5I1JH 1DBAL 3HUJA 4MJ6A 1QEWA 4DN4L 1SM3L 4QRTB 4J6RH 4L4TB 1CDYA 3PL6C 3QUZD 2ADFL 4JLRA 1ZLUK 1INDH 2MWCA 1Q72H 4YNYB 2PW2B 4NQSB 2JJVA 5I1LA 1A9EB 3OF6D 3FT3A 4BFGA 4YO0B 3MGAA 2DQDL 4O9HL 4ZD3L 1DANU 3IDIA 2EH8H 5D2LA 1MLBA 3DYOA 4RMQA 1LK2B 1F3DJ 1ZS8A 1AI1H 1AE6L 4IRJC 5DYOA 5IR1A 3B3IB 1CGUA 2V5RA 3LS5L 4QHLA 4NSKB 5I75C 2Y23A 2V7HB 3LKRA 1TJHL 4DAGL 5ANME 4GRMB 4AY0A 3NFPA 5HHOE 2B0SH 3GNML 3MV8E 2B4CH 8CGTA 3IAQA 4XVSH 1QTYT 4XAKD 5L2JB 2GSGA 2BFVL 4PY8J 4JQVA 4LPVA 2D2OA 5KANI 1IGYB 4XPHL 1Y6NR 4IRSB 4ORGA 1NBYA 1MCIA 3BN9C 2QQNH 5D8JH 3VFUA 1M7DA 4ZO6A 1S7VB 4PJ9A 3WD5H 1ZT4A 4OQ1A 1RUQL 4EUPG 2DMCA 3DX9B 5DRXB 5D6CA 1DBKH 3LPFA 2DF3A 5IOPA 3BKYH 2WBJC 3QT2A 3BJ91 2I26N 2R29H 3RX7A 3CFBB 1EFXA 4UT7L 4M6OH 4QT5B 1WBYA 4PD4J 5I74C 3V4VH 5CBAB 3UPRA 4EN3C 4P23C 1A6ZB 3WS6C 5IQ7H 1IC4H 4YHLH 4UDTA 3H3PL 3RI5K 4OT1L 4LLYB 2GHWB 3FHAA 3ULUH 5MERB 2R39A 5D7SH 3NFNA 3D69A 4GMSL 4JFEE 1PKQB 4JZJB 5E9DB 2F19H 4ETQB 2BNQE 5E8NA 4JHZA 4G8EB 1OB1B 5AD0B 2VERN 2Q86B 3ULUE 4LSRL 1U8QB 3VH8B 1ZLWH 1MWAB 2X5PA 5TQ2H 3UJJH 4EDXB 3QUYB 3VRIB 2OBGA 4UTBL 1N0XH 5LWYL 5DDHA 5MEQA 4H0HB 1QSFA 1T03H 3HLAB 3H9SB 1CLCA 3ESVF 3VXPB 4J3VA 3B9AA 4XC1H 1CE6A 4JPVL 1E4KA 5DS8B 3ARGA 4GKNA 4KC3B 2Y36L 4U7KA 4ZUSB 3IDUA 4EXPX 3CD4A 3EFDH 4Z7OE 4UBDD 1XGRB 4P4KA 2FIKA 2AJUL 3MLWH 4LCWA 4OQTA 3AM8C 2ILLA 3RZCC 1JTPA 1GC1L 1G7HA 5DD0H 2O93L 3MGTB 1OTSD 1NSNH 4XAWH 4U1HB 1VSCA 4WUUA 1R5WB 1V7ML 3MJ9H 2HRPL 4TPRH 5BJTB 1VEOA 3WDIA 3QXVA 5IJVB 3HRZA 1YEJL 4Q0XL 4OZGE 3ZL4L 5A16A 4L4TD 3O2WH 4PJ8A 3IJSA 4M61B 1NBZB 1UGNA 3BGAA 2FL5A 1KJMB 1NCCH 2RB8A 2HFEB 4PRHA 5DJAB 4LEOA 5HY9A 4HXAL 2BJMH 5DWUL 4HKBA 3PIQB 4OZHB 3PV6B 4MD0A 2F53D 3MCLH 4TQEL 2EDHA 3RU8H 4ORZC 1RZ7L 3HI5L 1G9EA 1SEBB 4URTB 2E8YA 3GMMA 5IEHB 1UZ8B 2WM0A 3HI1A 5BO1L 4GXVH 2HYMA 1AO7B 5JA8B 4ZTPH 4L1DA 3GDBA 3V79C 1Q9LA 2KUTA 4JKMA 4HUMB 3O41A 1REIA 4CDGC 4KK5C 4PJFF 4FQXC 4HCRA 5JLZB 3V6ZA 1ADQA 3GIVA 3U1SH 4EI5C 4IMLA 5FM5O 2ZCLH 3ARYA 3D0VA 1D6EB 3KYOA 3H7LA 1JZ5A 1CU4H 4LVEA 2D31A 2VL5B 3T3PE 4GRLC 5TE4H 1ZWIB 1PX3A 5KS9A 3HE6C 5JA9A 1OQXA 5KSBF 3UO1L 4X4YA 3AU1A 2DBLH 4PIRF 5DF0A 4ONGH 5GZNC 3JSSA 3R8QA 4HV8A 3BRFA 3VXSE 1YPZA 5I1CL 5EU4B 2J8HA 5D1QB 5DFVD 5EOCJ 1LEIA 2GKIA 4L8SC 5HI4D 4O51A 4TSCH 43C9A 1CN4A 4KFZC 4LLDB 4P99A 1ZLUH 4S10A 1DSFH 1CLOH 3N1FC 2FEDD 2ESVA 4HPYL 2Z8SA 1S5IH 2GK2A 1NGPL 2OR8A 1H0DA 3RNKB 1BZ7A 5BOPA 2CDEB 4JFYB 4P5TA 1DCLA 2AK4A 5E9DD 3VE0B 4WTWA 4KKLD 4N0UB 2ZSVA 4PJGE 3H9YA 1I7TB 4PJ7B 4Y5XC 3D48R 1KN2H 1WSST 4NZJA 5F9WC 5CEXA 4PY7B 2DL9A 1ITBB 1MI5A 4LF3B 4X9IA 3MLRL 3D3VE 4OD2A 4JRXA 4GG8A 3QNYA 3AS3A 3GMNB 2VSCA 5HHQA 5E08H 3QUYD 3RVVC 1S8DB 4PP2A 1QRNE 5F1SA 3N0PB 3SCMB 3H9SD 3CDYA 4G3YL 2D7TL 5L0QB 1URLA 5CILL 4DKFH 4M7KH 1UKTA 4JKWA 4YXLL 5TDOA 5EBMA 3ZT7A 4P4RB 3I6GB 4JVUA 3O3EA 4MWFA 3BP6B 3ECBA 3MGOA 5EIIB 4RAVA 3G08B 4NFCA 2D9CA 3VDAA 4A2MA 4TUKL 3GRWH 3D25B 2IG2H 5ANMA 4HIEB 3MRNA 2C3HA 5F1NB 5HHOA 4WWKA 4C57C 3RTQA 4OJFL 2A38A 3MV8A 2H1PL 1IQDA 3KS0J 5J56B 3KYNB 3IT8D 1LE9A 4GXUN 1S9WA 2LU7A 3OKEA 1B2WH 2OTPA 2EECA 3TT3H 1RULH 4FZEL 3SDCB 4MAYC 3RVTC 4PUBL 2IPTH 1PVHA 3GSWB 5J12C 3NAAH 4QO1A 5DVNA 4RRPA 3OKYA 4YBLB 3SPVA 2AI0L 1EFQA 3JZ7A 1GOGA 2BSED 3QO0B 1QYGH 1YMHB 4KAQH 1JHTB 1KUMA 1MFCH 1SBSL 2F15A 2I60H 3V95A 4JFOB 4PBXA 5EU6B 2ICWI 4WU7A 4YAQA 3ZDZE 1NANI 1HXMA 1NCBH 2OK0L 4WVRA 3WUZA 1AD0B 2HLFD 4LLVB 4D0DA 3V4PH 2VZTA 3HPJB 5L6YL 2GTZB 3ARDA 4JG0H 4MQSB 4JFEA 1G9MH 1NPUA 1SEQH 1OTTC 3EGSA 1H15A 2H3NA 3QHFH 4XRCA 4NUGH 4V2BA 1E6OL 3HR5B 1DQJA 2M1KA 4MJIB 4LVOB 5K9OB 3NABH 1T6VN 3P73A 1N59A 2ZNXA 4LGSB 5D1QD 2XOTA 1FNSL 3DPBA 2LABA 2DBJA 3IJYA 2VZ3A 4LCUB 2NLJB 1FYTB 5MHSD 4MNGA 2DWEB 4FMKA 1RZKC 1A22B 4WW2C 4XTRD 3WS3A 5T1LB 4JJ5B 2MQ3A 3O4OB 1MQKH 5L2KB 3MRGA 1PG7H 3BZFA 5C0GB 3WO4B 2YUWA 5AG8A 4CN6A 1YDPB 2K7PA 1TZHA 3DRTB 4JO3H 1CFTA 4FQ2H 3DSFL 3GUTB 3GI8L 4O5LH 4WU5B 5DRZA 1G0DA 1QFPA 3GMLB 1FN4A 1UA6L 1U6AL 1FSKB 3B2UD 3KNBB 5EA0H 4DOHE 1BFOA 2X4NB 3IXAA 5E1AA 3C8HA 1H3XA 2IAMB 2G2RB 5FA4B 5H35B 4DK3A 4G8GB 5D93B 4RWYL 4QCIB 3B9VA 4OZGA 3UTSE 1VACB 3K1DA 5D7LA 1K6QL 4OCWL 5BXFA 1PLGL 1EMTL 3MCKB 3OKNB 5D7KD 4X83A 5EN2B 4M1GL 5T1KB 3S36H 1A1OB 4ODVL 1AR1C 3ESUF 4N90D 5BQ7A 1MFEL 4WFFD 1HI6B 2YUXA 1S7SA 3IS1X 3TPUA 3MODL 5HD8D 1JE6A 3CU1A 2HA1A 4PV9A 1BBDH 2VDOH 1U91A 1A6AB 4XXDA 1QPPA 4LOUD 1EUUA 3VD5A 1BVKB 4JO4L 1WF5A 2XTJB 5F1OB 4WGVB 4C55A 4YDLC 4QLRA 3GJEB 4JR9L 3B8SA 4K7FB 3P4NB 2NX5B 4OF3A 3RHWF 1TZGL 2DQHL 2FNBA 4MX7A 3SDCD 1YEEL 5CUSL 3WLWD 4EUPH 1CT8A 3LEYL 3MUGB 4CADA 4OGXH 2GTWB 3LH2H 3IDMB 5KSAB 4TUJA 2W38A 1RUPL 5SX5K 1U93B 4WEMB 4AG4L 3X3FL 4I48B 3BPOC 4MZ2A 1CD1A 3QUZC 4K23H 1I7ZB 2VTFA 3U30B 2BCKB 2YD3A 4KKBD 4KI5D 3VFMB 1M05B 2ZKHL 1NCWL 2P45B 4U4BA 5F21B 4O4YH 3U36B 2N7AA 4KROB 5EU6D 5CHNA 3L7EB 4U2YA 3VFTA 2V9RA 1CGSH 2DQUH 5DQJB 2EDJA 3O6FB 2CLRA 4XNQB 1MIEH 2VLJE 5E6IA 1RVFH 4HIJB 3TM6A 2B1AH 4K3DL 1B9ZA 1A6UL 4WCYH 1IQWL 3QUML 3T65B 5JXED 4JFQB 1D5IL 3RY6C 4JZOB 4V1DB 1HCFX 3K8MA 4EI6B 2EDYA 2VQ1A 3O6MH 1P4IH 4MJID 1OAYH 2BVYA 1LO4L 4BFEA 5M7QA 4X6FB 4JRWA 3QHZH 1LDPH 3GSXA 4X7TA 5FECA 3T2QA 4E0RA 1EJOH 4JFPA 5IROC 5J6GA 4ZNEA 5EFIB 1TVDA 4ZODA 4ZQKA 1PDKA 3WL9B 1HH9B 1PZ5B 1EEQA 4ODXB 2D9QB 4PGDB 3NZ8A 1T66D 5KN5B 5T1LD 3S35X 5C6PB 5L2KD 4WJ5A 2I25N 3L3IB 4P3CL 2H26A 2G60L 5DVMA 3TH4T 1KLUA 1UYWL 1TVBA 3W5NA 3KWWB 4UZGA 1UQSB 1QSVA 4XMLL 4PJHF 3INUL 2E8ZA 3O9WB 5MEOB 3WIIH 4CJ0A 3BD4A 3C6LB 5DEGB 4KQ4H 1QRKA 3GZKA 4IHOA 3BPCB 3F65A 2IAMD 2JKXA 5CD5D 4R0LC 4NN6B 2LTQC 4U3XA 5K9QI 3LV3A 2RCSL 2X4RA 4G8GD 5CSZB 2YK1H 1H5BC 3B43A 4RX4D 5HPOA 3MLPA 3GRWA 1A02N 4KWUA 5HYJE 1HHKA 2XA8L 3A6BH 4Q58C 3X13A 2JTDA 4Y5YB 1LVEA 5TQ0L 4ZMAT 5ADPH 2VXVH 4JDZA 4KKCD 4X6BB 1F3RB 1MHHB 3QDMA 1UENA 3OXRB 4CL7A 1T4KA 3LKOA 2X1QA 1JNNH 3KPQB 2XFXA 5ERWA 1I3GL 3BSZL 3KJ6L 4G9DA 4OGYH 1LP9A 3V6OE 4BH7B 3MLVH 4Z7QF 5CJXC 1QBLL 3MREB 3QEHA 1V3JA 4JRYD 4XPFH 2GY7B 2R2BA 4ELKB 5FHBL 4UBDC 4PRPB 5CLWA 5IF0A 2XTJD 5JW4R 2Y06L 3ZE1F 5KSBB 2AEPL 5EO1B 4X4XA 1OM3L 1R24A 1C12A 3DBXA 1II4E 1GIGH 2NX5D 5H2BB 1OTSC 1TMCB 2SEBB 4HIXL 5A3ID 1A7PH 3CPLA 5FYKH 3LN4A 4L3AA 3HZVB 2FATL 3MRCB 3REWA 5J1AB 4HZLB 5DMIL 2IH1A 3PL6A 4G6FD 3I2CH 5IKCB 2XQYG 5KSAD 1N4XH 2DQCL 4Z5RB 3QULB 4RMUA 4EOWH 5C70A 4XP9L 3FN3A 5E8PB 1T04B 4R3SB 3ALPA 5FYKE 4B41A 1R3IH 3MNVB 1EV2E 4BKLA 2O5YL 3R8BB 2YKLL 5B39B 5DD1H 2Y5EA 1TJGL 2QSQA 3U6RA 4IRJA 3FQXA 3UAJD 4NBXB 5I8KH 2AW2A 3NCFB 1JGVH 3P4MA 2R56H 2JB5H 3O6FD 1UFUA 2H2SD 3VXOB 3FONB 3QFDA 1QR1B 5JHLL 1JL8A 4X9BA 2X4SB 3KJ4B 4PJEF 1KLGA 1MAKA 4PPTA 3VH8G 2FJGB 1MUJA 1ND0B 3AUVA 1IBGH 1D7FA 1Y0LA 5EH1A 3D0LA 1LK3H 1DE4B 4V1DD 5J6HB 4OLZL 1XIWA 1RUAL 4Y19E 4EBQH 4OM0L 3HCVA 1J1PH 3U79A 4QKXB 5F6IB 4W70A 4WENB 4M5YH 1L7IL 3QWRA 2WBJA 1XZ0A 3T0VA 2AV7A 1Y6MR 2WWKT 5D1ZB 1VB9A 5IT2H 2W9EL 2Q8AH 4U6XB 1BP3B 4EN3A 4P23A 5CIPA 3T1WA 1NDMB 2XQBL 3WS6A 1NCNA 3GMRA 4M6MH 3S37L 3LN5A 5DFVC 5SX5H 5GISH 2EEAA 3IJHA 3PHQA 5HI4C 1C08B 4Y2DB 1QFWI 2QSCH 3UTZA 4OLUL 1KEML 3BP5A 3CZJA 4NP4L 2FEDC 4UNUA 4M48L 4OZIF 1RSFA 4HQQL 4J3OC 3O9WD 4GAJH 3B4NA 3W2DH 2IFGA 4RMRA 3CLEH 1EEYA 2A6IB 4YH6A 4MQ7A 3C6LD 3UTQA 1B90A 4K7PH 2AJVH 4H8WC 4IOSD 1ZT1B 4ZXBB 4MAUH 1RIUH 4JZJC 4KQ3L 3ILQD 2EE2A 4YHPB 5JOFA 4KKLC 4NM4H 3VGAB 3T4YB 4WEBH 3UDWC 1LHZA 1YYML 5GQBA 4ZOAA 1W8OA 4FNLL 2R1WB 3P3YA 2VXQL 1U36A 4QXGL 1IGCH 5K93A 2DICA 3OAUL 3T0EE 1UXSA 3QUYC 2NZIA 2WW8A 3MRRB 1Z0MA 1EO7A 3T1FA 2JJSC 3P30L 2X4UB 1V8HA 1EEUA 1X3DA 1KJ2A 2E7HA 4EDWH 1KG0B 3BFOA 5FYJL 4EUPA 5IGXL 4WFGE 3ROOB 4LRIA 1CS6A 4OCRH 1I4FB 2GK0B 1U3HA 3AM8A 1FGVH 3RZCA 1EA9C 1CL7I 1MLCB 1I75A 4FS0A 4PRPD 1NMBH 3QXTA 5CEZD 5I1IH 1VPOL 5T3ZL 1PY9A 4X5WA 1A1NA 2VLJA 3OB8A 1NEZB 1G7PA 5ID1A 5E8EA 4M5ZL 1SYVB 2Q7YB 2BNRD 4JO2H 1JZ6A 3MLUL 4PJXF 2DWDB 3ARFD 4M02A 3F62A 5EZLA 5CAYB 1FPTH 1JPFA 4ODSH 1JHKL 2ATPB 2GJJA 1KTLA 4H20H 1MHEA 2QR0B 1T1ZB 4ODWA 2C5DC 4OIIL 2QHRL 1A47A 4CVXA 4K94C 4LSQH 4DGIH 2CRZA 4AIZA 3ZLQC 4NQCE 1Q9KB 5I76A 5BW7C 4KVCH 3TBYB 1E6JH 2XTLA 3MRJA 1HQ4B 4PTTA 3PWNB 5IP4A 1BD2B 1T89C 2ZP0T 4C4KT 2XQYK 4NNXB 3EFFB 4FQXA 4O2FA 4GG6B 1H8NA 4NUJB 2HLFC 4EI5A 3L6FB 1Q9OB 2ZOLA 1OWRM 4LU5L 3MRHA 3O2VH 1PEZA 1K4CB 6FABH 3HE6A 4R9HA 4JM4L 5GGVY 2D0GA 2AXFA 3OJMB 3V5DB 4D3CH 2J8UE 3QXDB 1DL7L 3SY0A 1FYHB 2BY2A 4IRZH 4M6AA 4XPTH 1GRWA 2A6JA 5D1ZD 5ITFB 2FYYB 3MRFA 4L8SA 4AL8L 2LV4A 2WUBH 3FQUA 3O3BB 4J6RL 5HYJA 5ICZA 1IL1B 5GJSH 3RAJL 5HJ3A 3LEVH 3VFGH 5T1DL 4LK4A 2D0HA 1Q72L 1FJ1B 1OY3B 4LKCB 5F7WC 5D1QC 2YC1B 4NYLB 5E2WH 2L0DA 2A73B 4J3UA 4Y2DD 1BJ8A 2EH8L 4LCCB 4XTRC 1BOGA 1FL5A 4C83A 3MACH 1AI1L 4OBSA 4FQIH 5C7XL 3VRLE 1FZJA 4C56E 3V6OA 5IEKA 1I1FB 4R4FL 4Y5XA 2H32B 5J0BA 1AC0A 4ZXBD 5D71H 3EYSL 2Z0BA 1CXLA 3RY4A 5HVGB 2B0SL 3CMGA 4L1HA 4J8RB 4LNVA 4OZFB 5DJ6B 2P4AB 3B9KD 3B2UC 3OGOE 1FNEA 4P5KA 5SWSE 2GUOA 3QWQB 1RZ8B 1ZLSH 4CVZB 2YSSA 4D8PA 4S11A 3SKJH 1IAKA 2YA2A 5GGSB 5D8JL 4EQ2A 4C54A 4HAGA 4ERSL 3U4BL 3WD5L 3QAZB 3C6SA 2VQTA 1C16B 2C4XA 5IFHH 5L0QC 2NY3D 1JP5A 4XGZB 1BQHG 4GW4B 2L4OA 3BXNA 5IVXF 4OCNC 2WNGA 2R29L 4XHQA 1JV5A 1XH3B 5C9JB 4NBYB 5FF6B 4PTUA 1FVDA 2CIKB 1IAOA 2HRLA 5IQ7L 2BNUB 4LAQH 4YHLL 2OSLB 3LPWA 1DUYB 43CAB 5HD8C 4YEEA 2V5SA 4JE4B 3RWCA 5LQBH 5F3HA 2JCCB 1J8HB 4ODBD 1LNUA 5ITBL 3K8LA 3MRMB 4GAGH 4H1LG 5INCB 3UTPE 4LOUC 2H45A 4MAYA 5TFSH 3AFLA 1FFNB 3DX7A 2DM7A 2HVKA 1W0WA 3MOBH 2DOCA 4GFTB 1J0YA 1D9KB 2VE6A 2ADJB 3SDCC 3WLWC 3X14B 5F9JB 2OQJA 5TQ2L 3UJJL 4JQIH 4O2EB 4UILH 2D4DA 3GGWA 3I85A 1N0XL 3OR6A 1U8MB 1JUFB 3OKDA 3ZTNH 3T09A 4KKBC 4KI5C 2VITA 3EDFA 4TOYL 5HHMB 1AP2B 1FIGH 5GJTH 1BD2D 2WP3O 3TBWA 3GKWH 3BVNA 1PD6A 4GAYB 3FB6A 3EFDL 1U92A 4P9ML 1AKJB 1HQRA 3RIAF 3ZO0A 3Q3GA 4NT6B 4MLSA 4CMMB 1NBVH 1T0MA 1XGYL 5IWLA 1AGBB 4KHXL 4PJCE 4X6EA 4L4TE 4YFEA 5JXEC 1IC5L 2NTFA 3KYKL 1CFVH 3VCLB 2FB4L 4TPRL 5IFAH 2HT2D 4ELMF 1EHNA 5HPMB 4N0YL 3U7AA 2CO7B 1FZKA 2P49B 1HKLH 1QLFA 25C8L 1YN6A 5EOCH 1JNHB 1IZKA 3TA3D 1UM6H 2YEZA 3DV4A 4LSSH 1B0GB 4WW2A 1NAKH 3OAYK 4RGND 2F53E 4CAGA 1I9IH 2ICWJ 5EUOE 2QBWA 3SE3C 1XT5A 4YK4C 2EDXA 1KGCE 4TTDD 4NQEB 4CMHB 4MJ2A 4UV4H 2F54E 2NY4B 1T66C 5HYFA 4IEFB 3WSQL 3MCLL 4BQ6A 5DMKA 3VDCA 3IB4A 4PJAE 3WO4C 4ZUUB 2BY0A 4GXVL 4NRYB 3F7YB 5IESH 4QXUL 3KGRA 1F4HA 5DJYB 3TIEB 4YHYB 1DLFH 5HXMA 4PJIF 5DRNA 3LRSA 5E0QA 5D5MB 1FSKC 1YNLL 1FL3B 3GB7A 1KN4L 5JUEH 1WLHA 4J3WA 3D18A 4PRNB 3RWHA 3EOYG 1DQLH 2IAMC 5CD5C 1D5ZB 1ULVA 2QQKH 4A2LA 2X4OB 4WIQA 5TH2B 5BV7C 5FK9A 2E6JA 3PHSA 5D93C 2BP3A 3N1PC 1FE8H 3PWJA 4Z7VF 1ZGLP 3L3DB 1ORSA 3V6FB 2VXSH 1OL0A 1JF6A 1WIOA 3QUKA 4AENB 3FN0H 4H8WH 2LQRA 1K3ZA 3ARQA 4ONGL 3EO9L 5EOTB 2PTUA 5I1EH 1MY7A 2ARWA 3WFZA 4KKCC 3UTOA 3PWUB 4KJPD 1KCUH 4K9EC 3PGCA 4NQCA 4TSCL 1FL6A 1DSFL 1CLOL 1LGVA 1PKQE 2QSTA 3BIAX 5E9DE 1KIRB 3RPIA 1MWAH 1DN0A 3AS1A 4S1RL 1J8HD 4NKMB 4U1MB 3E6FB 3KS0H 5T1MA 1S7UA 4Y1AE 4ONHB 3VDBA 4UIMA 5A2LH 3O3AA 2XTJC 3OKKA 1ZHBB 1MRCH 1JCKA 3OR7A 3VI4F 5A3IC 3TYFB 1JGLL 2Z91A 3H9SE 4KGJA 2WLYA 3N9GL 2J5LB 3MA7B 1KB5L 3QUZA 4LCYB 5HYSB 4HUXA 5KSAC 3UC0L 5IG7B 5E08L 3NCYP 1JN6B 1MAJA 3FB5A 3OF6A 4ZUVB 2MSPA 1JRHH 2IWGA 3ARPA 4PJBE 1YC7A 5F9DC 4OZIB 4X80L 1MRDH 5IK3A 3IVKB 3U30C 4PB9L 2R2HA 3IRZA 1IC7H 1I3VA 5T33L 2GSIA 4M7KL 5I0ZA 1N8ZA 2CDGA 3UAJC 3I6LE 4MCZB 2YXFA 3PWLA 3CJJA 3PABA 5JO5A 4NZUL 4YHKH 3D39B 4X8JA 1JYVA 5DFWH 2AQ1A 3MTRA 1CR9H 2P7TB 5EBWB 1MQ8A 2Q6WA 2HKHH 3O6FC 5IHZB 2H2SC 1WTLA 4QHMB 1KBGH 1OW0C 4C56A 4R7DA 5DEFA 4HIHA 4DVBB 2EDLA 3D85D 3NIFE 4HWNA 5E5UB 3RY6A 1A8JH 1HXYB 1QD0A 2VAAA 3EYVB 3S3SA 2QKIA 3KXFB 3DARA 3MFFB 3L7FA 1CFSA 3RUGF 2PN5A 2GITB 5GGTH 2PNDA 4PP1D 1Q0XH 3MXVL 5SWSA 3TT3L 5IROA 2F5BH 1T1XA 1ZVYA 5HI3D 1G6RB 3K4DA 1GGUA 2YWZA 3P4OB 4BK5A 2B1HH 3QR2A 3HZMA 2K7QA 1ZHNB 4G80B 4L8CB 5ESVB 4J7RA 2ADGA 1NLDL 1IGFL 5DJ8B 1P2CB 1X5ZA 3RGVA 4NQED 4ZFOL 1INEH 2NY4D 4KAQL 4PREA 4YJZL 2DKUA 1MFCL 5I1KH 4RMWA 4U1LA 3N1GC 3DMMA 5AWNL 2W07A 1T1YB 2IC2A 2Z93B 4FABH 5CLTA 4U1IB 3BZEA 4LCIL 2YUVA 4CRPA 1A4KB 5DK0B 4ZFGL 3K81A 1NCBL 1IMHC 4WNQA 2H2PD 1DDHB 4OB5H 3RWFA 3O9WC 4XNUH 4Z7WB 1T22B 3GSQA 5JQHC 5D7IB 3WKML 2RBLA 4NKOB 5E4EB 1PQZA 2P8PA 3GI9L 3C6LC 1P1ZA 1H5BA 3VXQA 4XMPL 2UZYB 1Z5LA 1G0YR 5EU3A 4ODTH 3ILQC 5JDJA 3ARRA 5LKNA 1OARH 1S5HA 4NN6C 4MJ5A 1J1OH 4MDIA 3NFSL 2FECI 2A83B 1P84J 1T83C 3LS4H 3PDGA 3DRQB 2VISA 4IOIB 1HILA 2JB6A 1GCFA 4BZ2L 2XPGA 1BREA 3QO1A 1OWWA 4DW2L 2V9QA 4TSAL 5IW6A 4N5ED 5FFLA 5MEPA 1R3JA 8FABA 3LKQB 5GS0D 4BFBD 1UM4H 4JZNA 4NO5B 4JFXA 4LGRB 5CJXA 1VFAA 2KPNA 4RSVA 3RGHA 4NN7B 4NZDA 2EYSB 3OAYH 4NRZB 4HMCA 1OD7A 4LSPH 2GCYB 1YZZA 2Z31B 3WEXB 1K8DA 4K55A 1CQKA 1MCNA 4QHNB 1ZE3C 4DGYH 4JO3L 3ZE2F 4FQ2L 4NCDA 2VZ1A 1ZANH 4HS8L 3SEPA 1OAQL 3WN5B 4X0KB 1ZT7A 2HTKD 1MCHA 5ESAA 4PBVC 3QPXL 1GSMA 5F1IB 3V52H 5JDSB 3S34L 1RMFH 2CLVB 1HN1A 1HE7A 2B8OT 1YY8B 2OCFD 4QRTA 4HS6B 4L4TA 3H7BB 5DLMH 2F58H 3ARFC 5B8CC 3WFEH 2EDDA 4NQSA 4QF1B 1A9EA 5D7KE 1DBMH 5IW1B 4BQ9A 4YO0A 3CXHJ 4F7CB 3D5OF 5GS3A 3QJHB 4WFFE 4HJGB 5IJKC 1IVLA 4LLWB 4O2CA 2M2DA 2F53A 4O00A 2X4PB 2A6DA 4POYA 3HUJB 5F7UA 1Q94B 1MRFL 3D39D 3PWVB 4NSKA 3RA7L 2V7HA 5HHVH 5JW3H 2ZZUT 4GRMA 5I1HH 1BM3H 1JPST 3KPTA 3PQYB 5JOPD 1IE5A 15C8L 4X6DF 4AEEA 2F8XC 4PJAA 1BECA 4LRNH 2AEWA 3GMOB 4YBQD 5D2LB 3IKKA 1MLBB 3H6JA 2I9TA 1IGYA 4RFOH 5DYOB 1RFDH 4Z0BH 2YD1A 5SWZD 1IT9H 1S7VA 1KJ2L 1J88A 1IKNC 2OTWB 5F6IC 3MR9B 3DX9A 3OKMB 4C58B 5DRXA 2I5YL 4OGXL 2YMXL 4M43H 2D7OA 4R26H 2GSGB 4RMTA 3CFBA 4ZUTB 5D1ZC 4KJYA 4QT5A 4NQXB 2XWBB 3IDXL 5EU6E 4N8CL 5FYLL 5CBAA 3C5JB 4Y8AA 4PJDF 1U8NB 1NEZG 4ORGB 4W6YB 3LHPL 4WI3A 2DIJA 1WC7B 2XXCB 2HVJB 4O4YL 4LLYA 3SE8L 4Y2DC 5HVHB 5MERA 4LMQI 1YJDC 2OR9L 5D6CB 3BRDA 1SJXA 1CGSL 1J05B 1PKQA 5E9DA 4H1LH 5EULV 1OSPH 3GBNL 3TBSA 1U9KA 5IB4B 2X4TA 4G8EA 1OB1A 1RVFL 5AD0A 3UDWA 3V4UH 4TNWF 3SO3C 3UJTH 2B1AL 4ZXBC 4LLQB 5FYJU 3B9DA 4MJIE 4Y1AA 3UPRB 3EIFA 5DRWB 4WCYL 3VH8A 3VD4A 1NGYB 1MWAA 1J87A 3G6DL 3NCMA 5HGBB 3EDJA 3QUYA 4PJ5E 3B9KC 1MH5A 2JJSA 3O6ML 1QUNA 3H9SA 3SDXF 3C5SB 1X5AA 1CF8L 5I15L 4JFHE 2D7QA 5L2KE 4PJBA 5DS8A 1EJOL 5AAWA 2O5XH 4ZUSA 2NY3C 2OX5A 4ISVA 2EDNA 4YBHA 3MV01 1QVOA 1GHFH 4WFHD 5BV7H 4BQCA 4PG9A 3DROB 5F7DA 2Z31D 4LAJH 1TPXB 4EZMA 4JEGB 1QSFB 1HHJB 2QJDA 3MGTA 3HI6L 4FQLH 4U1HA 2FX8H 5CP7B 1BJ1J 3U2SB 1R5WA 2VDQH 2EDBA 5C0JB 5BJTA 5M95B 1G0XA 5IJVA 5F9OH 5C0RH 3WIIL 4K9EH 2DM3A 1RAMA 4M61A 2QTEA 1NBZA 4TSBH 2WV3A 4LCWB 1L7TH 4KZDL 1KJMA 4KH2A 5IB1A 1JGUH 2AV1A 4MS8D 3DSNA 3EAKA 3T2NL 4XPBH 3PIQA 4K8RH 5GGTA 2Y5TB 4MVBD 4I9WE 5A16B 5AG9A 2V17L 1UZ8A 1CK0L 3STZB 4JRYE 4P0DA 5LCVL 3IJSB 1TQBB 5DQDL 1QA9A 3PQYD 5J11B 2XZCH 1CDJA 4OCSH 3P0VL 3IFNH 3RWGA 3VGHA 4OGYL 1QHOA 1X5JA 1GH7A 3GIZH 1A0QH 1JPTH 5LAXB 4K3JH 2VXTH 2VMFA 2ZUUA 4OCYL 2WMPA 4HKBB 5JLZA 1WIUA 4Z7VB 1D6EA 2PETA 2DQTH 3BZDA 1N26A 3Q5YA 2VL5A 3HI1B 3AROA 4G6JH 1ZWIA 3CX5J 4G6KH 1I9RH 3GMQA 2K1MA 1Q9LB 3BP7B 4QRSA 3ILPA 2HT2C 3S35H 1IGTA 4LVHB 2EDRA 3G9VA 5D1QA 4EOWL 5MENB 5EWIH 5F7MC 2R0WH 4P3DB 4LSUL 3GIVB 4LLDA 4IMLB 3DETD 3TA3C 4WO4D 3KYOB 4RGNC 3LEXB 2D31B 4XCCH 3HZYB 3TIDA 1KENL 4KDTC 3BAEL 1VENA 3SDYH 1T20B 2QQQA 2C9AA 3AU1B 4LCCC 3RNKA 1X5KA 1S3KH 4TTDC 3V8CA 2R56L 3VE0A 1YPZB 4N0UA 1N5YL 5KJRH 2P43B 3DVFA 1HSBB 1NUDA 3BGFB 1FV1A 4Q6IB 4BELD 4O51B 43C9B 1LEKA 1PJ9A 2F5AL 2RAMA 3DVGB 4X6CF 2WZPD 3DO7B 1JPSL 4FMFA 1S8DA 3U7WL 1B3JA 1BZ7B 2J6EH 1UT9A 4P5TB 1J1PL 3CSGA 1V7NH 4M5YL 3ZHKA 4U33A 1KLFA 4OLVL 3QAZC 5CEXB 1GPOL 4XP6L 3K8KA 5JW4M 2DQJH 4JRXB 5K9KA 1KELL 5FXCH 3WFBL 3QNYB 1LO5B 4XP1H 3JWNC 4EKXA 3CFKA 2X1XR 1MF2H 5EC1B 5HHQB 2APTA 2VDPL 2L7JA 4PP2B 1JHLL 3BP6A 1K3IA 1EERB 4OF6A 3SQBA 3MV11 4KJPC 3ULVF 1YEGH 1V3KA 4HFUL 3D25A 5IVZB 2CMRL 2J4WL 3OPZH 2VLMD 5F1NA 3EO0B 4PLKD 4RGMB 5TDOB 2EEBA 3KYNA 2I24N 1KFAH 1QNZL 4YZFF 4K7PL 4HLJA 4MAUL 3SDCA 3O3EB 4MWFB 1RZKL 3GSWA 4NKQB 3ECBB 3MGOB 1MCPL 4I4WA 2EKSB 2W0KA 4QHKJ 3WIHH 2Y1VA 3F5WA 2QSVA 4DN3H 3TV3L 5ANMB 5HHOB 3RTQB 3WHE1 3U0PB 4U7SA 2D4FA 1YMHA 4ZOBA 3C2AL 5CEZH 4OD1H 4HJJL 1IQDB 4PJFE 3TJHD 4RMSA 4W81A 1MCOH 1FZMB 2XNAB 5EU6A 4XMKH 4EDWL 4XT1C 4OUUB 2XZAL 3K4AA 2DLEA 1AD0A 5F7LB 4OI8A 1I8IB 4LLVA 4WUKH 1BQHA 5KSBE 3UJIH 3HPJA 5AYUL 1FGVL 2XN9B 3G04A 4W6XB 1U3ZA 3MNZB 4M8QA 2BNRE 2XG4A 3BKCH 4JQXC 2J1KA 2EH7L 5K9QG 2LAGB 1B6UA 1ED3B 1J1XL 3SHSA 5CGTA 4HF5H 1BOYA 4X9FA 1EO8L 3RHWK 4WU7B 3HR5A 5FO8A 3B5GA 1HXMB 4HH9B 4MJIA 3UMTA 5K9OA 3BUTA 4NQTA 3CFIC 4M62L 4H1LA 4HWBH 5AAMA 5J89A 4PJ5A 2GJ6E 3ARDB 3D1MC 4Z7NF 5T5NF 5MEND 4PP1C 1E27B 4JFEB 3GK8H 2DWEA 4I77L 4HLZG 4HWEL 4H25B 1TJIH 5HI3C 3SE3A 5C0BE 1H15B 2BNQB 2H3NB 4H20L 3NTCH 1SMOA 5T1LA 4JJ5A 5GHWL 5FIEA 3VFWB 5CJQH 3KPLB 1GXEA 5L2KA 3NCCB 3CLFL 2NW3B 4LSQL 5C0GA 1YDPA 4CMHC 2NY4C 1DQTA 3P73B 5FDYA 1N59B 4KVCL 4WU5A 4KUCF 1W2KT 2VN7A 1WFNA 3ARVA 3GMLA 3MMEA 3MRBB 3QRGH 4ALAH 3WS3B 4YXHH 2H2PC 1I7RB 2IAMA 4YHYC 5FA4A 4G8GA 2D7PA 5IB5B 3O2VL 4XVJH 1VACA 1CFTB 6FABL 5DRZB 5C0AE 1BFSA 3KPMA 3KPOA 3OKNA 3QG7L 3SOBL 4D3CL 4IRZL 1A1MB 3BO8B 1DBJH 3PF2A 2ZUVA 2R69H 1IC1A 1BFOB 3IXAB 5E1AB 4N5EC 1FVEB 1HI6A 2WUBL 3VFGL 3P0YH 5GS0C 2HMID 3EYFA 1T7YA 4F15B 4MSWB 2FX9H 3VFSB 5E2WL 2HN7B 4YX2H 5ETUB 3VGBA 3O6LH 4JRYA 2UZIH 5F7HA 2Q3AA 4I8DA 35C8H 1P4LA 1BVKA 3F8UB 4JDTL 3M1BA 2BHUA 1J8KA 3E0GA 3RL2A 3GJEA 4K7FA 3TCXA 3P4NA 5D71L 1T2XA 2IBGA 4Q2ZA 1EJ6A 1S7SB 4F7TB 3MUGA 2HTKC 2GTWA 2CQVA 3DX8A 3IDMA 4QRRB 1FG9C 4K3GA 5KSAA 4PJDB 1MREL 1IARB 1U91B 5TE7L 5CEYA 5HHOD 5B21A 2J5LC 3U46B 3CUPB 3VFMA 2FRGP 1A7BA 1IFHL 3SKJL 4KRNA 3KYMA 4YPJA 1NJ9A 4KXZI 1BZQK 5C07B 4EJ1C 2IQ9L 2CXKA 4Z78B 3L7EA 1K4DB 5IFHL 1FC1A 3AB0B 5DQJA 3O6FA 4KUZH 2I27N 4J2XA 4XNQA 1OW0A 4TUJB 2JJTC 1P7HL 3OBAA 2AJSL 1JK8A 5DVOA 5TPWL 2XN9D 3C60B 3DVNB 3S88H 1CD1B 1XGPB 1P84K 3P4LA 1CLZL 3VXSB 5D7JB 3T65A 3B5HA 5E2TL 5IQ9A 3TVMB 4JZOA 4EI6A 3VW3H 5LQBL 1AQDB 2BVUA 4YBQC 4OKDA 3VFTB 4O58H 4IBLT 3WXVH 4I0CC 1G7QB 4Q9RL 2CLRB 4X6FA 3WHE0 2F8OA 3S4SG 4MA3B 4TVSa 5E6IB 2APWA 4FA8A 3ARDD 3QBTB 5IB3B 4FTVB 4L9LC 4PRBA 5EFIA 4DKDC 5KG9B 3LVEA 3HMWH 3WL9A 2J12B 2J8OA 4U3HA 3S3PA 4Z8FL 3BEWB 3EBAA 4PJGB 2BNQD 4ODXA 4CU7A 2IFFH 2CJUH 5KN5A 3ZE0F 1CXKA 3L3IA 3D3VB 4HPOH 2X41A 2J6EA 3KR3H 4ZG1A 1A3QA 3KWWA 1BIIB 1UQSA 4XP5L 3GSXB 3O9WA 1QRNB 3OXSB 1I9JH 2CIIB 2F74B 4XCNB 1J86A 1ES0B 3C6LA 5DEGA 1UWGH 2BC4A 1WAAA 3BPCA 3L5XH 3CXHK 3ETBF 3BHBA 4MLIA 1TDQA 1B88A 3DV6B 3CU7A 4WJ5B 5EZOH 2DLFL 2GT9B 4IOFD 5E4EC 2V6HA 2HWZH 1AXTL 1KLUB 1T83A 3MLZH 1X9QA 4F57H 1N5AA 1HCVA 1UJ3A 2VR4A 3BWAA 4RGNE 4HUNB 3IDYB 1HKLL 4X6BA 3GO1L 3H2WA 2H32H 2ZUSA 1MHHA 4YFLI 3OXRA 4AIOA 1UM6L 4LSSL 2X4RB 1G7MB 4ODHH 1NAKL 4PJFA 3RVUD 3WIHA 4BH7A 4NN5B 1HINH 1QBML 4FQJH 4NC0B 3U82B 3K46A 3ZZ1A 2AJYL 4NN7C 1XCTB 1HHKB 4XP4L 1CICD 2EICA 2AERT 4HXBH 1ONQA 4YWGL 4UV7H 5KSBA 2V5MA 2Z31C 3JWDH 4HHAA 3GHBH 3RDTB 4KTDL 3DI2B 5H2BA 2SEBA 4YHIA 2BNRA 3HZVA 3MRCA 1KC5H 4NNYA 3WN5C 4R90L 5ERWB 3BP4A 4MZ3A 5J1TC 2M8XA 3LZFH 3ARFA 4G9DB 3MO1B 1A7OH 3UYRH 2AK1H 4QRRD 5B8CA 4ACPA 4V2CB 3QEHB 3SE9H 3ZKSD 2VNCA 4NJAL 4TYUA 5E8PA 4R3SA 5IFJA 2H8PA 3OAZK 1TXKA 2QQKL 3L5JA 5BS0E 1C12B 2P24A 5ICYB 3DBXB 5LGHH 1YYLL 1DFBH 2FSEA 5C07D 3DTXA 4MS8C 4NOBA 3CPLB 2VXSL 3LN4B 3REWB 3HC4H 2A1WL 3FN0L 2EEDA 3Q48A 4H8WL 2IH1B 1I1CA 5H37G 2XWJA 1MJ7L 5I1EL 3FONA 4MVBC 3K74B 4ZS7H 4D9QD 4JG1H 4I3RH 3VXRE 3C60D 3SGKC 1J8HE 2ZUXA 4BKLB 1JYWA 1NMAH 2FJGA 1OD9A 5J13B 3BW9B 3VXSD 1NC2D 2FHFA 5D7JD 2ARJQ 5DUML 1I8MB 4YFLF 4IRJB 3TVMD 1T21B 5HBBA 5J6HA 1KXTB 3H9HB 5E94A 4J4PD 5E8OA 4LKXA 2YA0A 1P4BL 1IKNA 5DK2B 3NZHH 1N64L 4LVNB 3RKDD 1HOCB 3JWOH 3J8F7 5JR1H 3OZ9H 1KLGB 2HFGL 4FTVD 1NFDF 1CGXA 5MI0C 4YHZH 4YEFA 5D1ZA 3DYMA 1PGRB 1Y0LB 4PJHE 1EHLH 2DQEL 3D0LB 1EBPA 3N85L 1WFTA 2EDFA 2AEQL 1A21A 1XIWB 2FEEI 4LPWA 1JRHL 3D3VD 4RNRB 3JV4A 3HCVB 1C08A 3AVEA 5IHUH 3DETC 1MRDL 5HVWA 4WO4C 1LO2L 1ROWA 4TULH 1IC7L 4NCC2 1QRND 3PP4H 3UTSB 2N1KA 2MNUA 5HVHC 3X3GL 3KPPB 2A6IA 4GXUM 2P8MA 5ACMA 4QTHB 2HFTA 4ZXBA 1CR9L 2BDNH 4EN3B 4YDIH 1NCAH 4YHPA 1DBBH 3GMRB 1OAZH 3R1GL 4UOW0 3T4YA 1A7QH 3VD9A 4BUHA 2X10A 4PS4L 3B9KA 4FQPA 3BP5B 4K94L 4KRPD 1EAJA 5T3XL 1MIML 5DT1H 3VXTB 4Z7QE 2ZOKB 3MRRA 1EEYB 4JGUA 1MHPH 5GGTL 4MQ7B 3Q1SH 4AEHH 2OJEB 1CXIA 1KPRB 2OP4H 5DO2D 1HEZB 4HD9A 2YPLB 5JOFB 5FAAA 5J3HD 1KG0A 3ZE1E 5LXGH 3MOQA 4POUB 2DQFB 4DQOL 3ZHDA 1WK0A 2UY6A 1J0JA 1UJTA 1PZUB 1LO3H 1MLCA 1ZHKA 2Y7QB 4LDLB 1SJEA 4BZ1L 4EVNB 1QACA 1OAXL 1INEL 3F58H 1MEXH 3HG1B 3CX5K 4XVTL 1NEZA 1T0PB 1TPXC 3RDTD 3QDGB 5A2KH 5FEBA 1SYVA 1F6LL 4UB0L 1KACB 4KMTH 3H3KA 4PLKC 4RFEB 4XNUL 5GS0H 4DGVH 4HT1L 1U3HB 2B39A 1CFNB 1FO0H 3RZCB 3HPLB 3THMH 2ATPA 3KLAB 4TTGA 4PYGA 5CZVH 2FBOJ 1OARL 1A1NB 2VLJB 2QR0A 1T1ZA 5FO7A 4OCXH 4PJEE 5KVEL 2VB5A 3LS4L 3WJLA 1FH5H 4NPYA 2ENYA 1OGAE 2GJZA 2X09A 4U6VL 1A3RL 5CCKH 4OAWA 2HJKA 1MFDH 2HT4D 1Q9KA 1RJLB 1C1EH 1CL7L 3TBYA 3UBXB 3TJHC 3PJSB 1NQBA 4NJ9L 5DGRA 1UM4L 5JMOC 1MELA 2DDQH 3UCRA 1GGYA 4RCAA 1FDLL 3PWNA 3TH2T 1BD2A 4GH7B 2CKBB 3VGGA 4NNXA 3EFFA 2JJUA 3A6CH 5IMKB 1HHHB 4JKPL 4ODWB 1MPAL 4Z95L 5J11C 4NUJA 1T5XB 2CO6B 4G5ZL 1RIHL 1O0VA 1Q9OA 2EC8A 5FO9B 1XCQA 3SKOA 1RURL 4P46D 5DMYA 4ZOEA 4KMQA 4QOKB 4HULB 4KY1L 2OZ4A 4HG4J 1G1YA 5KS9F 5HGHB 4G8FB 4GSDL 5I76B 3SN6N 5J57B 1ZANL 3IFLL 5HYQA 3V5DA 1WEJH 5JIHA 4O2FB 1YECH 3H42L 4AMKH 4OZIE 4XI5D 5I1DA 2D7NA 4OFDA 3MZTA 1IL1A 5DLML 3TA3A 1HZHL 4JM2F 4AEIL 2ZOLB 3ULVD 1XIWD 4LVHC 3WFEL 5C0FB 5CWSA 1G6VK 2E9IA 4KDTA 1DR9A 1U3YA 4R8WL 3DUHA 2FX7L 3SQOH 1P5VA 2WIIB 3OAZH 4LCCA 4M6NH 4H5SB 2HFFB 3HRPA 3ARXA 1RK1A 3SY0B 3R4DA 5JOPE 3NCJL 1I1FA 5FUZH 3UTSD 2DLHA 2IBBA 1BIHA 5FV1L 2H32A 2R1YA 1AH1A 3FQUB 5HYJB 1XF3A 3TH3T 3MA9L 5L8LB 2J88H 5KW9L 4DTGH 1Y18A 3DHMA 4J8RA 3BGFC 4Q6IC 5DJ6A 1VFUA 3U0TB 5SWZE 2MCPH 1OAUH 5IMMB 1JI2A 1DUZA 1FL5B 1DTUA 1RZ8A 4FRWA 4CVZA 3S96B 1SY6H 1FZJB 5IEKB 5FGCB 4JY4B 4Z0BL 2VZOA 2BY1A 3MJ7B 1IT9L 4FQ1H 1C16A 2YPLD 3BZ4A 4FXLA 1MCWM 3VFPA 3HZKA 4XGZA 3IU4H 3G9AB 4GW4A 1F6FB 2MKWA 1QHPA 4FFZL 3LB6D 3FRUA 4NWTH 4Y5VC 4R26L 1XH3A 1ZEAL 5EBLA 4PJXE 2MPAL 4MA8L 2PTTB 1JWUB 2HP4A 2IEPA 5FF6A 3TJEL 5BVPH 2CIKA 2HMIC 3HG1D 1GGTA 5C2BH 3WYRA 2BNUA 4YGVB 3NH7L 4PYHA 1BJ1H 1DUYA 4W68A 3MYZA 5JQ6L 1MNUL 4NIKB 2PYEB 3QDGD 1J8HA 1R5IB 3FFDB 2ZUYA 1JGEB 4OCMC 4U1JA 2EYTA 5JNYA 4KRMB 4QRPE 3BXNB 3WKNA 5GSRB 4NNPH 2VDLH 4RGMC 1U3HD 1FFNA 1JV5B 2DQGL 3V4UL 4NGHL 5ALCL 3MV7E 4PTUB 4ONFL 4JN1H 3X14A 5F70A 4R96B 4R2GB 5F9JA 3CGTA 1CDHA 4AM0A 4XPAL 1V3LA 3ME0A 1U8MA 1JUFA 1ZMYA 4OD3H 1RZJH 1BEYL 2DKSA 3BYTA 3WLBB 1W0WB 4WFHE 1AP2A 4Y19B 3QIWD 1X7QB 4F37F 3BH9A 3QUMB 2ORBH 4N0FB 1H8OA 1NKOA 1C7TA 2CRMA 3TYGH 3WDHA 4U6HB 4JQXA 1G9NL 5LVEA 3GGWB 1NEUA 2EXWD 4NT6A 3D85A 4CMMA 1I1AB 2W9DH 4M7ZB 4S1DD 4LSTL 4QOKD 3QYCA 5DA0B 3OKDB 1JNLH 3JV6B 2QQLH 3VI3F 4CN4A 2IPUG 2VDQL 5C86A 1HDMB 3VCLA 1GGBL 5HDQH 5HPMA 5C0RL 4LPXA 1JJUA 2RJMA 1OCWL 1J0ZA 1RK0B 3BIKB 1UB5A 2VLLA 2QADB 4HZAA 2GEEA 4K9EL 3MJ6A 5E99H 5E2UH 1QKZL 3PV7A 1T0MB 2WUCH 3ARDC 4KHTH 2CR3A 2DN7A 2ITDB 4BSWB 1CFQA 4X6EB 2VQUA 5EORL 5ILTL 2O5ZH 3C08L 4NQEA 3LMJH 2H9GA 2A77L 4N0RA 5I71B 1QLFB 2AVGA 3O0RL 3AMKA 3MOAH 1NFKA 4MHHG 2UUDK 2PYFB 1A2YA 5HYJD 3P9MA 3DV4B 4NRYA 3T0EB 4WW2B 3DECA 4WDIA 4U7MA 2YD4A 5DJYA 2K3TA 4I3SH 4K3JL 1RIVH 4PRNA 5C0ND 5IVXE 3HC3H 3CMOL 1D5ZA 1VGEH 4YHNA 2E7CA 2OS7A 2X4OA 5DEZA 3F7RA 5L88H 4IOFC 2ZCHL 3NBNA 3B2VH 2XRAL 3L3DA 3HS0A 3CK0H 3F7PC 3VWKB 1EBAA 4P59H 3RWJB 1CD0A 1OAKL 2BZDA 5D2NC 2WINB 3BD3A 4JO1L 4K3EH 4OSUL 3S35L 3T8XB 5H37H 1G1CA 1FO0A 3D18B 1DEDA 4PGJA 1OGAA 3PWUA 4YQXH 2R0WL 4N9GB 5BMFH 2DD8L 4LGPB 2MHAB 1FCCA 1KIRA 4F15C 1NBQA 1GGCL 3RVUC 5JXAH 1XF4B 3EOAB 1ORSB 4G7YL 2PYED 3VWJB 5E8DH 4F8TA 4NKMA 4N8VG 4U1MA 3E6FA 5KOVC 1S3KL 2CK0L 1CICC 1X4XA 3FTGA 4AEFA 1CQYA 4ONHA 3QCTH 3I84A 5KJRL 4JGJA 1Z9LA 4NQCB 3L95A 5DFTA 3TYFA 4X99B 4DKEL 4Z77A 1X44A 3RPIB 4R2GD 7FABL 4LCYA 3BPNB 1TCRA 2Y07H 3NA9L 1JF1B 5IG7A 3ALWA 1JN6A 4ZUVA 1NUNB 5KSVB 1N6QL 3KPNB 5GGRY 1PSKL 4NKDA 1B4JL 3P9LB 2QHLA 4OZIA 4UIMB 4FQQB 5KVGL 3OKKB 2O26U 1VADB 3ISWA 1V7NL 1WQVT 3I3BA 3MV9E 3QG6A 3OR7B 1CDCA 2P48B 4Y19D 3EDEA 3LIZH 2JJTA 4DVRH 3NN8B 2BOCA 4NRXA 2Q8BH 4OIBA 3BPOB 3AB0C 5GSVA 5I18L 5EBWA 2P7TA 3QUZB 1QBAA 4ELME 1J0IA 1IAMA 2J8UB 5FOJA 4DVBA 2B7DT 2X44D 3DLQR 1I1AD 2MQCA 1HXYA 3C60C 1PY4A 1F5WA 3U4EB 3EYVA 2R2HB 5D7JC 5KSUA 2CPCA 5A40E 3TVMC 3MFFA 2ED7A 2GITA 5LGKA 2ADIA 3UTTE 4NO0B 4HGWA 4PV8A 2IADA 4J4PC 4X8JB 5SWZA 4L9LA 3DURB 2QADD 3BN3B 4DFHA 1KJVB 4X7SH 1RZIA 2R0KH 3RKDC 4C56B 4R7DB 5DEFB 4HIHB 2CDFB 3LKNA 2IJ0C 1LILA 5CZXD 3P4OA 3BE1H 4KVNH 1OPGH 5DHXB 1EH9A 1U42A 3NGBB 1VKXB 4PRIE 2DQIH 1ZHNA 4D9RD 5ESVA 1CVSC 4DN3L 5L7XL 2HH0L 2QKIB 3OGCA 1P2CA 3M45A 2ARJA 3U0WL 3QDHA 1N7MH 1SY6A 4PJIE 5CEZL 4OD1L 1IGIH 1U2HA 2VH5H 1L0QA 4N68A 1T1YA 2IPUK 4U1IA 5SV3A 2AJXL 1A4JB 1S7RA 5SWSB 5DJZB 5E1HB 1A4KA 5DK0A 3TWCL 4MXWL 3T0ED 4MB3A 1FHGA 1BAFH 3L3KB 1S7WB 4WFED 4Z7VE 1K5NB 5EUKA 1CBVH 4UNVA 1BGXH 3QEGL 4L5FL 3RGVB 3MLXL 4QRPA 3S37X 5ESQB 3DMMB 3O6KH 3RI5F 4JFFB 3MZGB 5IBUG 2A83A 4MNQE 3DRQA 3HNTH 4IOIA 3MV7A 1A6WH 3VWKD 4KRPC 4E42B 1CLYH 2LTQB 3LKQA 2A9ML 1PQZB 2P8PB 3CZFB 3IDYC 3S4SA 1LP9F 2IAND 5DO2C 4NO5A 1Z5LB 5KTEH 1L9MA 1KOAA 3U9PL 1S9YB 5J3HC 4ZAKB 5F7FA 4ZO8A 1TJIL 1JI1A 2C1OA 4MDIB 2EYSA 4XB7A 5AUMA 4D94A 3FT2A 1MCDA 3VI4E 1MCCA 3QQ9D 2GCYA 4NN5C 3PGFH 3VWJD 1HILB 2AABL 2Z31A 1DQDH 3S8WA 4XC3H 5MEPB 1RUKL 1G7IB 4K2UL 2EYRA 2XZQL 1HIMH 3WN5A 1Z3GH 4X0KA 2GIYA 5K9JH 2HT3D 3RDTC 3I75B 4J1UB 4TNWK 5JDSA 5F1IA 1E4XL 4NQCD 1VFAB 2UUDH 5D4QA 3QRGL 2MKLC 4HS6A 5I66A 3QDJD 3N06B 2COQA 1MJ8L 2BRQA 4JKKA 1YC8A 4QF1A 4NZRH 5IW1A 2OXGA 3MRIB 4XVJL 2Y4SA 5FCUH 2X42A 3QJHA 2VLRB 4HJGA 1YJDL 5IBTL 4LLWA 1ZT7B 4NDMB 3VG0L 3VGFA 5ESAB 3FMGL 1F4AA 4PJCB 1AJ7L 3U48A 4IS6A 1Q94A 2NY5C 2V5TA 3PWVA 4JFDE 3SGKA 3F12B 2HT4C 3BESR 3RUGE 3SBWC 2DRUA 3C5ZB 4ZFFA 1UCBH 2DLTA 3PQYA 4PBWD 2YA1A 4XCFH 1P7KB 1G9MC 3SGEH 5F1KC 2GFBA 3GMOA 3QZWG 2JK5A 5J13C 1KCRL 3LKSB 4TVPD 5EIQA 4O2CB 3TZVB 2F53B 2A6DB 4P46C 1NGQL 4IMKC 1SJHA 4JN2B 5DR5L 5EUOB 4NO0D 1KCSL 4UT9L 1UACL 4G6MH 2F54B 5IVXA 2OTWA 4LHQB 4JB9H 3MR9A 4LVNC 3OKMA 1H3PL 4C56D 3DO3A 4PJAB 4DZ8A 2KZWA 1GAFL 4PLOB 5D1XB 2JELL 2NQCA 2VR5A 4HK0A 5TE6H 4ZUTA 1PKOA 4NQXA 4XI5C 2XWBA 4JFZL 4A6YH 2B2XH 4MXQD 3C5JA 2I9TB 1FAIL 1U8NA 4WO4A 3ULVC 4OTXH 1XIWC 5HDLA 4MGXA 3HAEB 1WC7A 1I85C 2HVJA 2ZPKL 4DK6A 5SWSD 1KJ3H 4YE4H 1LMKA 2XN9E 1A7RH 3UPAA 1IM9B 3CIQA 1J05A 1S9XB 2WBKA 1FZOB 4KUZL 5IB4A 1PG7W 5GXBB 1D5BB 2VC2H 1NH6A 3F6LA 1R3KA 2ZUTA 3CFEB 4KJYB 3QPQD 4QY8B 3VXNB 2PUQT 3RGVD 3KPSD 4LLQA 3OKOB 5DRWA 1IM3A 3TO2B 3DMMD 3BRGC 3E8UH 1OP3K 1NGYA 4XXCC 4JFFD 5HGBA 4GRWF 5GGSY 1F2QA 1BLNB 1SBBA 3C09C 5FYJD 4HS3A 4O58L 2ZUQC 1T1WB 3UBXG 3C5SA 4BJLA 4Y88A 3TBSB 5FGSA 2X4TB 3CFCL 3RL1B 2MCG1 4OGZA 1SHMA 2VDRH 2VO5A 4XNMA 3ZE2E 4Y1AB 3UTPD 5T3ZD 4ZAKD 2BVPA 1KCVH 1ZHLB 1LE5B 3Q5OA 3G5ZB 3LB6C 4BSJA 1UWEH 5DUBB 4WEUD 1MH5B 3DROA 4OFPA 4H26B 2FJFB 2XT1B 3KVQA 4Y4HB 4HPOL 2OZ4L 1HHJA 3D9AH 4ETYA 1KSRA 4ELMA 4JY5H 1W72H 5CP7A 3ZT6A 3U2SA 5GRVL 4UUJB 5C0JA 4CDHA 2DJSA 2FO4A 4PJBB 4QTIH 2LAAA 1U95B 4K07A 4JM2D 4ISVB 5D72L 2AGJH 4LRIC 5SWQB 3L5XL 1QVOB 4F3FB 4PG9B 1U3HC 5F7DB 4PGZA 5DJDB 1NCDH 5D2NE 1DLHA 2HWZL 3Q5TA 1HH6A 4FZ8L 3MLZL 5ICXA 4F57L 2YD6A 2VLRD 4P9HC 3NACH 3LQAC 3I02A 2R15A 1DBAH 3PDOB 2Y5TA 5SX4H 5FDWA 2E7LA 1SM3H 1Q1JH 3CXDH 4QNPF 3STZA 5JORA 3C5ZD 3FFCD 1JFQL 3FO2B 3QIWC 2DQDH 4ZD3H 5IB1B 2AV1B 5LAXA 4B50A 4QYOB 2EIZB 2FGWL 3Q6FB 1F4WL 3TZVD 4Z7VA 2EXWC 3LS5H 4UV7L 1DANT 4S1DC 3JXAA 3RQ3A 4CW1A 4QRRE 4NCC1 3G6JF 3GHBL 1TJHH 4XHJD 3DHJA 4PJDE 4UU9B 5DGQA 1KGCD 5F96L 2F54D 5C3LD 3IFPB 1QA9B 5EBGA 2IALB 2BRRL 3BP7A 3RWGB 1EO5A 3H9ZA 3O2DL 2BFVH 1A7OL 5D1XD 3SO5A 5BZDB 5IIEA 3SE9L 1CWVA 2PF6A 5MENA 4G43B 5C07E 4P3DA 4XPHH 4D9LL 5DMGD 3MRDB 1SYSB 3LSOA 3EDDA 2ERJB 3TNNA 3CH8A 3LEXA 3VXUD 3HZYA 4S2SA 1YUHA 4ZYKB 1RUQH 5LGHL 4D9QE 1T20A 2CLZB 1F8TL 1EK3A 3GMQB 1IM9D 3IAGC 4F2MB 4QRSB 3ILPB 5IMLA 4UINL 4JHWL 2MMXA 1IGTB 4MXVF 4JG1L 5E2JA 1HSBA 5I73B 4Q6IA 1AGEA 3SDXE 1CDUA 5HYIA 3NMEA 5BVJA 1XR9B 3H3PH 3DVGA 3TIDB 4OT1H 3PDDA 5DSCA 2FHBA 4DJMA 1ZGLA 4U31A 4XCEA 3DO7A 3CCHB 1Z6JT 4GMSH 4XB8A 1IGML 4FTVE 1JZ7A 3CH1B 5C0NC 1UG9A 1WITA 3TBVB 2WWKO 1CIDA 3V6OC 4NKIL 1HK6A 5JIKA 5LGJB 5C08E 3SDDD 2FH8A 4AZ8A 1FV1B 4Y5VA 1YEKL 4Y1AD 4ZPTB 1LEKB 4YHZL 3FT4B 4KI1A 4YHML 3V7AG 4X7EC 1EHLL 2YD2A 1LO5A 1HYRC 5EC1A 5LWYH 4Q9CA 3HHRB 5LBSL 4Y4HD 4M7JH 4M8VA 5IVZA 3WE6A 1B6DA 2CKNA 1QFHA 2E3VA 5E2VL 3EO0A 3NPSB 1JYXA 2Y36H 5K9KB 3CFKB 4DFIA 1BFVL 1YEDA 4E5XA 4YDIL 1ERNA 3I6LD 3GMPA 4TRPL 4WI7A 5IM7A 1GC1H 2FD6H 5IMOA 2EKSA 3FQNA 3QSKB 1V7MH 2B5IB 2PKDA 4I13B 2HRPH 3E3QE 4QWWD 4R2GC 1OP3H 3U0PA 5JZ7D 3W11D 4Q0XH 4RISL 1MHPL 3ZL4H 3F7VB 1FZMA 2XNAA 4GKSB 2J7LA 4HUKB 4AQ1B 2OP4L 5IHBA 1FFQA 4OUUA 1RJYB 1BMGA 1TZIA 4I4WB 1I8IA 2ZCKL 3F5WB 3QB7C 4HXAH 5DWUH 5C0IA 3Q2CA 2XN9A 4A6YA 1YEHH 3MNZA 4JPWL 3MCG1 3L5IA 4NM8L 4TQEH 1MEXL 3SE4C 1RZ7H 3HI5H 1ED3A 3MFGB 3M8OH 2IGFL 1I1AC 4M7ZC 4HW6A 1T7ZA 4FQCL 4U6TA 3GEWB 2DYPB 4HH9A 3ARZA 5GRJH 2NY5H 1L0YA 1R3LB 1AGCB 3L9RA 3CC5A 4KMTL 3CVHB 4HKJA 1BQHB 1UEYA 4UT6L 4DGVL 1NMCC 3T3MF 3G04B 4ZO9A 3A6OA 5TGBA 3THML 4M4RA 3QRFM 1E27A 2QADC 4M8QB 5CZVL 3FZUD 4H25A 2APXA 3DUSB 2BNQA 5IWLC 5CZXC 4OCXL 3QUXB 3VFWA 3KPLA 3UO1H 5FO8B 2NW3A 3FOLB 4LNRB 4X6CE 4H1LB 4C4KO 5I1CH 1C1EL 4PJ5B 1GVIA 5I71C 1UB6A 5D70L 1TVHB 1U58B 4MCYA 1F11B 2R0LL 1OVZA 3CX2A 1FFOB 3MRBA 1W0VA 4YK4B 3T0EC 1F58H 3A6CL 3FQWB 5E7BA 1I7RA 4HPYH 4LQFL 1NGPH 3V5HB 5IV2A 3ULVH 4P3WA 3P11L 4YPGB 2O61B 5IB5A 1J0HA 32C2A 4RDQG 2GAZB 2BY3A 1W72A 4LHUB 2MTPA 1XR8B 4GLRI 4NZTL 5D2NA 3ULVE 4DZBA 1WEJL 3MLRH 4R7NA 3MMEB 1A1MA 3BO8A 3VWKC 1MOEA 1MCQA 4AMKL 1U8PA 2LE9A 1FVEA 4XCYA 5BV7B 2A74A 1TQCB 3TBTB 4YZFE 4MSWA 3VFSA 3WIFB 4N1HB 1EX0A 2HN7A 4G3YH 3U83A 4X9HA 5ETUA 1I8KB 3VA6A 2APBA 1U8OA 3KPMB 1CICA 3KPOB 3MJ9A 1R0AL 1C5CL 5EU5B 4XVUD 1KF9B 3QQ9C 1LQSR 3VWJC 3DWTA 4Q9QL 4WV1B 1YQVH 3EOTL 1FVCA 5FGBA 3EYFB 4F7TA 1G6RL 1QSED 3KG5A 2HT3C 4TUKH 4K3HA 4QRRA 5J8OA 4PJDA 4JRYB 3WNPA 4YGAB 4F7EB 4PLJD 2RIKA 4E9LA 4OJFH 2YPLE 2H1PH 4OI9A 1P4LB 3STLB 3BPNC 1SY6L 3M1BB 5EOQL 3U46A 3CUPA 4S1SL 3KPRD 4OZ4B 3RL2B 4FZEH 4NQDE 5C07A 4PUBH 4FQ1L 2W65B 3ZKMD 4Z78A 1K4DA 4Q2ZB 1FNLA 1YMME 3IU4L 4G6FB 1M6OA 2DI8A 3HG1E 5DURD 3DX8B 1TTFA 4NWTL 4F7MA 1FCGA 3RKPA 4O02L 2FCBA 5CEYB 3C60A 3DVNA 3QDGE 1ZTXL 4L8DA 3G5XB 4XBEL 1XGPA 2C3GA 2N7BA 1X5GA 3VXSA 1NC2A 1RD6A 5D7JA 3O8XB 4Z7NE 4P9HH 5JOEA 3KYMB 3LQAH 1NJ9B 3TVMA 5E7FA 5E56A 1AQDA 1YNKL 2DYPD 2I9LB 2FZ3B 4J4PA 2OK0H 4G6AD 1FLRH 1G7QA 4N8VA 5C0EB 1NCTA 2X05A 4L3EB 2D03H 4NNPL 4XH2A 1MFBL 4MA3A 2UWEF 2NXYB 4JANA 1INQB 1JK8B 2CGRL 4HWZB 4UMGA 3SJVD 2EDWA 4FTVA 5IB3A 4OI7A 3L1OL 3ULSB 4WY7L 1OSZA 2CKBH 5KG9A 3OB0K 3ARBB 4HBCH 2YOCA 3BEWA 4PJGA 5IQ9B 5C08A 5F7KC 1E6OH 3OMZA 3NGBC 3QUXD 2XG5A 3QEUB 3D3VA 4MD5B 3T4AA 4DUWA 5E4IA 4U05A 1T7XA 4MXQC 2OJZH 1IJ9A 5L9DL 4LFHD 1UXWB 4PJ5D 1BIIA 1FNSH 4KK8D 2C3WA 3OXSA 1QRNA 4LASL 5DUPL 2CIIA 2F74A 2Z8RA 3GSUB 4PRBB 4XCNA 3TP4A 2R1XA 1ES0A 1RU9H 4QOKE 2ORBL 3OKLA 1JMZA 3IS0X 4P2QE 3TYGL 1HYSD 4JPKH 2V2WB 4WI6A 4JFHD 3DV6A 1DQML 4UQ2B 1F2XK 1AD9B 1G7LA 2GT9A 5CINH 3QPQC 3L5WB 2VL4A 3MC0A 3RGVC 3DSFH 3QNZA 2P5WB 4KTYA 3GI8H 1ORQA 2QQLL 4LHUD 4TN9A 3DMMC 1Z2KA 2DS4A 3UYPA 4KZEL 4PRDA 2HJLA 1OOAA 4UTAL 5HDQL 4HDIB 1UA6H 2X6MA 4GBXB 3TCLB 4G9FE 4P49A 5D96B 2BC4B 3U9UA 3E6HB 1D5XB 3BHBB 3OJVC 5E99L 1ACYL 4RWYH 1G7MA 3FO9B 5FKAB 2C4FT 3MRLA 1BPVA 3MBXL 4KHTL 3GSNB 3K80A 1KIQA 4GT7A 1K6QH 4OCWH 1CYGA 5KVMC 3GKZA 1N5AB 4ZAKC 1PLGH 1UJ3B 2VAJA 1XCTA 3CFJB 3BWAB 4M1GH 1QQDB 3FAWA 4ODVH 3WFDL 1EXUA 2YD8A 4KMLB 1I8LC 1MFEH 1A6PA 2WLZA 3MOAL 1X5FA 3F6IA 3RDTA 4GUPB 4U1GB 3WNMA 1S7XB 4KKNA 1NDGB 1TETH 3MODH 2R2EB 3HNVL 4PJFB 3X12B 2LU3A 5FGCE 3MO1A 4I9WD 3CDFA 4P2OB 4I3SL 2VABA 1F3JA 1ZXQA 4JM2C 5ENWA 2D7MA 2G75A 1QSZA 4KPHH 5IB2B 4JO4H 4K8RD 5CKGA 5C0CB 1FC2D 1ONQB 2BOBB 3HAEG 1WJ3A 4HHAB 4XPGL 5ICYA 3ES6A 2DQHH 3WNLA 3EYOA 4YHIB 3WO3B 5CUSH 3LPGA 2BNRB 5EIVA 3AY4C 2YHGA 4NNYB 3BP4B 4PD4K 2N4IA 3ARFB 3SBWA 5B8CB 3OHXB 4K3EL 2Q87A 5KOMC 4AG4H 3X3FH 4XNZC 5DD5H 1D3CA 2PYEE 4YQXL 3VMOA 5IFJB 3G6AA 4X6CA 3DGCR 2H8PB 2VLKB 2ZKHH 4GS7B 3C5ZC 3ZSTA 3BW9A 2PO6A 3O8XD 4B7LA 1I8MA 2GJ6B 2P24B 2Y72A 1T21A 2BVOA 2FSEB 3QDAA 3DTXB 3FCTA 4P46A 4IMKA 3H9HA 1R3HA 3O4LB 1IAIM 2XWTB 5C0BB 3ZE0E 2IPKB 5DK2A 2WIMA 2XWJB 3TZVC 1JRHI 4L3ED 1KXVC 1HOCA 1AIFA 3TO4B 1C8PA 4Z7UF 2NXYD 4CBPA 5AEAA 4K3DH 3PG2A 5FYLD 4XHJC 1A6UH 2DL2A 3I50L 1IQWH 3QUMH 4LEXL 1GYAA 2ZSWB 1D5IH 3ARBD 1MCFA 4IDJH 2XYCA 1E4JA 4N0CD 1BWWA 1R6VA 3PWPB 5LG1A 5D1XC 2H6PB 5E94B 2QEJA 4OLWH 1I85A 1LO4H 5E8OB 3QCVL 4LKXB 4LPUA 4RNRA 1DZBA 5FUOH 1WZ1L 2ENSA 2YBRB 4OM1H 3CFDA 4OFIA 5HVFB 5F9AC 5HSFA 5DMGC 3LKPB 4DCQB 3V7AE 3IDNB 5J06A 5I17B 3LIZL 3L3GB 3UTSA 3KPPA 1BX2B 4TUOB 5C0AB 3RIFF 2P5EE 2OMBA 4QTHA 3LY6A 4I2XE 3X17A 3DIFB 1UH4A 1CG9A 4P3CH 2G60H 4RMVA 4XXCA 4OQTL 2HAZA 3JV4B 4P5MB 1E4WL 1UYWH 2P5WD 2R8SL 4XMLH 3KLHD 4NFBA 1EHXA 1FFPA 3QZWA 5I8EB 4MA7H 1JIBA 3VXTA 4GBXD 3RZWA 3UZQA 5CSGA 4Y89A 1U8HB 2ZOKA 3I9GL 2P8MB 1QLEH 1RI8A 2OJEA 4LSVL 3SO3B 1KPRA 2FEEL 4D9RE 1HEZA 2YPLA 1JZ8A 4X7SL 5DHVH 2ZJSL 2RCSH 1KIPB 3SDDC 3VD7A 1HHGB 1C5BL 1RZGB 2DQFA 3T0AA 3QJFB 5FKPA 2DQIL 3B9KB 5K59F 2XA8H 4AYFA 3OB0H 2Y7QA 4EVNA 2DMKA 1YMMA 2QLVB 4N1EA 3HG1A 4WFEE 4F7PA 1UZ6F 3B83A 4Y4HC 2P47B 3IFOB 2FR4B 3QDGA 1WWBX 4YIQB 3LCYA 2NY3B 5EB9A 2VDKL 1YN7B 1QZ1A 4RFEA 1QBLH 4JY6A 4P2OD 5DJ2B 1CFNA 3T2PA 3HPLA 3V2AR 4HCRL 5FHBH 4U2ZA 1ZHKB 1SJEB 3KLAA 1J5OH 2Z4QB 1ADQL 4CVUA 5C0CD 2Y06H 2AEPH 4HFWB 1LEGB 3BDYL 1CD9B 4OZHF 4IJ3B 2EDEA 4HIXH 3FQRB 2IANE 3HNTL 2FATH 2OLDA 2R23B 5GRWA 2DTMH 5BOZG 1JNJA 4QWWC 1T3FB 1FRGH 5JZ7C 2DB8A 3JTSB 3W11C 4ZNCD 1I9EA 3MRPB 2V2XA 1RJLA 4FFYL 2DQCH 3MXWL 3UBXA 1KTDB 3PJSA 3L5HA 3JUYA 4PG2C 3QIWA 4G42B 1PBYA 5KTEL 5C2UB 2O5YH 3T77A 1IRAY 2CKBA 2VLKD 2YKLH 4L8BB 1X6NA 2Z92A 5IMKA 1HHHA 1A3LH 1TJGH 3QXAB 5FO7B 5F93C 2GJ6D 1T5XA 4L9DA 1F3DH 1RJZB 1NFDE 5FO9A 4PGBA 2JJWA 4D0CB 4NPYB 1HKFA 2GJZB 4QOKA 3MQIA 3O4LD 3VFNB 4OAWB 1ZOXA 4DEPB 3BEVB 2HJKB 3BT2H 3R06B 5C0BD 1CVRA 5HGHA 4G8FA 4CN1A 2XY1A 3QDJE 5HDBF 3TO4D 4QRUA 5K9JL 3DXAE 3ELAT 1V05A 1XF2B 2ICWB 1JWSB 4QRQA 1A6TA 4JPIB 3ZSSA 5FM5M 5C6TL 5GGQH 4OLZH 1XCQB 3SKOB 3PWPD 5C0FA 4G9FA 4OM0H 4Z76B 1KXQE 1SJVA 3TT1L 1I1YB 4Y0GA 1XGUA 4R4BB 4U3CA 3FZUC 2WIIA 1G7JA 2VXUL 4H5SA 2HFFA 2ERJC 4TVPH 5HYQB 1J9CT 2KZ1B 4PJ7F 2UYLB 3VFOB 3EHBD 4F37K 2W9EH 5I1JL 4UAOC 1M71B 5C0AD 5I1DB 4S0SD 2XQBH 4L29B 3TA3B 1INDL 5JMRA 4LP5A 3S37H 1WZKA 4TVPE 4PGEA 4RGNB 5CWSB 2X2YA 1UM5H 5I73C 3O3DB 1IAIH 4OLUH 1KEMH 2XXMB 5EO0B 5IW3A 3U0TA 5EU7C 4M48H 2RR3A 4HQQH 5IMMA 1U41A 2IBZY 1T5WB 3D6GA 3S96A 2A6KB 1RK1B 4YUEH 4JY4A 3OQ3B 5GS2H 2R1YB 4KQ3H 3MJ7A 1WBXA 1XF3B 5C8JB 1FIEA 1Y18B 2W1NA 1JMXA 3DOSA 1U8KA 3RWIA 5DTFA 2B4CL 1YYMH 2A2QT 2KQNA 4I18B 4XVSL 3QXWA 3ZDXF 4FNLH 3BYYA 1DUZB 2PTTA 1JWUA 3OAUH 3RNQB 2B2XL 2GQHA 1OF2B 3BGMA 4U0QB 3P30H 4OTXL 4YGVA 4M7LH 4PRHE 2QQNL 1GJIA 2PYEA 5FYJH 2UVFA 3BZ4B 4OF7A 4YE4L 1R5IA 3VFPB 1T80A 2DIAA 3FFDA 3NCBB 3HZKB 3LN9A 1JGEA 3KPSE 1DBKL 4XVUC 5BS0B 3BKYL 4WHTB 5GSRA 3NPSC 2EC9T 3FRUB 2AKRB 4MQXD 4LHJB 4JFFE 5EBLB 1QR4A 3HTLX 4M6OL 1OP9A 4OLXH 3V4VL 5FYJE 3OJDA 5CJ8A 1VPOH 5T3ZH 2E6PA 3WNKA 4BFIA 4ZDHB 4M1DH 5H8DA 1TLKA 1IC4L 4R96A 4M5ZH 4KI5F 3VXRB 1WWCA 3ULUL 2B5IC 4WHCA 5D7SL 4PLJC 3GFUA 4U1JB 3R0NA 1A14H 5DD6B 2EYTB 2P1YA 4LFHG 5T3ZE 4NC2B 5JNYB 1WBZB 2F19L 4B7IA 1NCUA 4CNIB 4FG6D 1DEEB 4LLAA 4DUXA 3WLBA 4Y19A 5KS9E 4PLNC 4FP8H 1X7QA 3ZKMC 2E9BA 3QUMA 1HWGB 2F8VA 4N0FA 4I0KA 1KCVL 4OIIH 2QHRH 1S7QB 2YZ8A 4U6HA 3SE4A 4AM0B 1I1AA 5BCAA 1T03L 4PJHB 4LHUG 3JV6A 4M93B 4JY5L 4I2XA 4XC1L 1HDMA 5M94B 3HA0A 4G8IA 3BH9B 3BIKA 1RK0A 3IKCA 4G6AC 1CFBA 2AGJL 4IDLA 2VLRE 2MJWA 2YRZA 3AAZB 1IILE 4LU5H 2XICA 5F3BA 3D85B 3MLWL 2I07A 3T0DA 4NO3A 4HWUA 2ITDA 5DD0L 2HKFH 4BSWA 1NSNL 4XAWL 1FFRA 3IDJB 3MJ9L 1AHWB 2XKSA 3NACL 3FFCE 3QUXC 2N56A 3BX7C 2EKJA 1UB5B 4AL8H 5JPMB 5F44A 1Q1JL 2VLLB 3CXDL 4CJ1A 3RAJH 1YEIH 2X4QA 5T1DH 4WTZG 2PYFA 3O2WL 4M03A 5DHVA 1FNFA 3T0EA 4KK8C 4WTXA 1NCCL 4D0BA 1CGYA 2OL3B 3QIUB 1CFQB 3MUY1 2CH8A 2Q76A 1Y6KR 2BJML 3RVXD 5C7XH 2H9GB 1HYSC 2EIDA 4R4FH 1NGWB 5I8OH 1VESA 1TENA 4N9OB 3RU8L 3HAEH 2R4SH 3EYSH 1ZA3A 3T0WA 1A2YB 2W59A 3P9MB 3VWKA 3C87A 5E6YA 4ZTPL 4WDIB 3RWJA 3EJJX 1NC4B 2WINA 2AJ3A 3T8XA 3VXUE 4LSDA 3K2MC 1CCZA 2IANA 3UP1A 3SKMA 4N9GA 2W60A 3U1SL 2MHAA 4YHNB 2ZCLL 5C0DB 2FDBP 1TQCC 1CU4L 3U4BH 4ERSH 1XF4A 3EOAA 5TE4L 1MJJB 3HS0B 4HIIB 3VWJA 4LARH 5C92A 2DBLL 4Z7UB 5BS0D 4PJEB 3PE9A 2FHCA 3JUZA 4JCLA 1NFDA 3QH3B 1FO0B 5GRZA 1OGAB 4WV1C 5HHNA 4X99A 5I8CB 1DN2A 2IQAA 2ZUWA 5ISZB 1F4XH 4LDOB 3QDJA 3GJFK 4Z0XB 4U0RB 3FOMA 5CD3A 2KDGA 1S5IL 3DXAA 4RZCA 3VXRD 1JF1A 5ITBH 2NYYD 5KSVA 3KPNA 3FTGB 3ARTA 3P9LA 5GGVH 5KANG 4K8RC 2W0FA 1YNTB 4FQQA 2ED8A 1ETZB 4PFEA 2NY2B 1VADA 1SVZA 1UWXK 1KN2L 4HGKC 3L95B 3NN8A 1P6AB 2A0LD 3VI3E 4Z77B 2BERA 4JREB 1TCRB 2ATKA 5FHAH 1XGTB 1GZQA 2J8UA 1FGNH 1PYWA 2CRIA 4MNGE 4NKDB 2ED9A 4M7JL 2XKUA 3KDMB 3VXMB 3U4EA 4TOYH 4PGCA 3NCEB 2YPVH 3O8XC 3QG6B 1F42A 4RWHA 4DKFL 3L3OA 2KBGA 3NIGF 4P2CG 2BOCB 4NRXB 5E5RB 3HN3A 4PRAB 4P2RE 4NO0A 3TESA 5GSVB 3FJTA 4P9MH 3LQMA 3DURA 1KPVB 1KJVA 3OJ2C 3DUUB 1T2QH 1XGYH 2CDFA 2NXYC 4KHXH 2FD6L 1VKXA 3WFHA 1WUNT 3GRWL 5I19H 1IC5H 2IG2L 3KYKH 2X1PA 2FB4H 3ARBC 5KSUB 4N0YH 4N0CC 3BDBA 25C8H 2ADIB 3VGDA 4HGWB 3QEQE 2IADB 3GSVB 4PV8B 1B2WL 5SWZB 4L9LB 5D7LE 1UVQB 1X5XA 5DJ0A 5HGDB 1A4JA 1MCLA 1RULL 5DJZA 1RZIB 4MDJA 1WAAF 2IPTL 4XZUB 2C1PB 3PNWB 3L3KA 3LKNB 4LLMA 1S7WA 4K71C 3NAAL 4S1QH 1K5NA 3QIUD 1LD9B 3W0WB 3OGCB 1QYGL 1A9BA 2ARJB 1JTOA 1YEHL 3KPSA 3WSQH 1CGWA 4OF0A 5ESQA 1BVLB 3M8OL 4JFFA 2FO1A 2I60L 4PJXB 1S7RB 4JCMA 3RFZC 3QIBA 3MUHL 1IKFH 1FQ9C 4QXUH 5GRJL 5A2FA 2NY5L 3KLHC 4E42A 4XBGA 4R4ND 5A43C 1NC4D 2C7UB 4GBXC 1HNFA 5EUKB 3V4PL 1YNLH 1KN4H 2NZ9D 3CZFA 4JHBA 4JG0L 5D96C 1BVZA 4QRPB 1G9ML 1S9YA 1SEQL 4IRSD 4ZAKA 3PHOB 5HGGS 3RX5A 1E4XI 1F4YH 3QHFL 2VDNH 1U0QA 1WWWX 4NUGL 3BPLB 3E2HC 1I8LA 3MV7B 3JTTB 1UJ3C 2X7LB 3NABL 3EO9H 5CJOH 3HC0B 5EU7E 1G7IA 3G5YB 4U6YB 3S4SB 3D87B 4L3CA 3I75A 1OGAD 4J1UA 3MRQB 4U1GC 4Y4KB 4JM2A 2C1OB 1F58L 5ISZD 5AUMB 2C3VB 4S1RH 1U8LA 3FT2B 5DQ9B 4AT6B 3BDXA 1MQKL 4IM8A 3ULVL 4P2OC 1PG7L 3KYAA 4GW5A 3MRIA 2EYRB 4TNVF 3AY4A 2VLRA 4O5LL 2NY2D 4NDMA 4OFYD 5ID0A 2HLAA 4PJCA 1JGLH 4IIQA 3EO1B 3N9GH 5EA0L 1KB5H 4GAFB 5I66B 3F12A 3UC0H 1P69B 3C5ZA 3FFCA 4NQVB 2EDTA 1I1RA 5IBLD 4X80H 4ZNEE 1X6LA 2CR6A 1P7KA 1T7VA 4PB9H 3VXMD 4UQ3B 4GS7C 5T33H 5CP3H 3LKSA 1UC6A 3TZVA 5IUSA 1JZ4A 3S36L 1QSEE 3T0BA 1BF8A 4NZUH 4JN2A 4IS6B 3WDJA 3ALXA 5EUOA 5KVDH 3W39A 1YQVL 2F54A 5C1MB 2BSTB 4ZFFB 3TO4C 5TF1H 4KJQD 1VGKB 3KPRE 4EXKA 4HKXB 5D1XA 4JHAH 2GFBB 2JK5B 1BBDL 2VDOL 2ZG3A 3GJFH 4CVWA 2HJFB 2RFXB 4KDVA 1MJUH 1SJHB 3VXUA 1RZFH 3IGAA 5EO9B 3HAEA 3MXVH 2BMKB 3J7HA 5MI0B 5IVXB 4QXWA 1TNMA 1X5YA 3EYQD 5ALBH 1IM9A 5ACZB 1H3VA 3HMXH 4DZ8B 3CVHH 1UWXH 1S9XA 3LH2L 3G5VB 1FZOA 3EHBC 1D5BA 4HK0B 2X1WL 1NLDH 1IGFH 3CFEA 3QDME 2PW1A 2H41A 4QY8A 5T3XD 3W0WD 3FAXA 4HK3J 3VXNA 4BYHA 4K23L 3OKOA 4WO4B 5DHYB 5AWNH 2NY6B 3TO2A 3F7QA 1LP9E 3QCUH 4P9HL 2YXMA 2R0ZH 3LQAL 4LCIH 4ZFGH 2DJ4A 3KLSA 1BLNA 3BH8A 3SJVE 1AO7D 1JTTA 4Q6YA 3MJGX 2DQUL 1FLRL 1T1WA 4DWHA 5I16A 3WKMH 2D03L 1MIEL 3GI9H 1R3KB 3RL1A 3SDDA 4XMPH 4Z6AT 1N2RB 2YD9A 4QRPD 2VZUA 2CKBL 3I6KB 1IM3B 3BMVA 4HBCL 3NFSH 3L3JA 1ZHLA 1LE5A 3OG4B 2W92A 3DVIA 3G5ZA 5DUBA 4BZ2H 1G84A 3MV7D 4H26A 4DW2H 1P4IL 2FJFA 4Y4HA 1OAYL 12E8H 4HS3B 4TSAH 1K9TA 2OJZL 4M3KB 4HKZB 3OG6B 4UUJA 3QHZL 1LDPL 4EIZC 2BK8A 2PR4H 4XNMB 1U95A 4Y4KD 1RU9L 4QHUA 2BVPB 1A6VH 3RWDB 5SWQA 3MV9B 4H88H 3V9FA 1BJMA 4JPKL 3ZT5A 4MQXC 4F3FA 2X9WA 5DJDA 5CINL 4P2RA 2DIBA 4F33B 5CZKA 4HS8H 1NAMB 4ELMB 1OAQH 2FO4B 3QPXH 4IJ3C 3S34H 1CDBA 3QFJB 4MNHA 3PDOA 2C4FU 2Y25A 3UZVB 1T6WA