4OUUA

Anti-mt1-mmp monoclonal antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVGLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti_MT1-MMP Heavy chain
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 47
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuA01
5H2BB 4RX4D 4J8RB 2H8PB 5D2LF 5I8KL 3STZB 1SJEA 4QRTA 5E2VL 5DJCA 3G6JB 2HVKB 1TTGA 2F8XC 1BJ1H 1T0NB 2CSPA 3SBWC 3CD4A 1OPGL 1K2DA 5DLMH 4XP9L 5J6GA 4I4WA 3C87A 1P84K 4MCZA 3ARDC 5D5ME 2XWBB 3MCKA 4PREA 4YIQA 3G9AB 1VFMA 3BEVA 3KPSA 4UIKH 3BGMB 4LLUB 2UWEF 3VXRA 3VDBA 4HK0B 3QHZL 4EI6A 5JDSB 2LQRA 3MV9E 2Q7NA 1FHGA 2RFXA 3PUCA 2B0SH 4NUGH 1DVFD 3C6LD 4MHHI 5DSCA 4U1IB 4M5YL 1FORH 4NOBA 4X6EB 3G5XB 5DD1H 3FN0H 2VZTA 3FHQA 4QRPA 5LWYH 1SBSH 4PJCA 1XGUA 2Y9RT 1OTTC 1JZ7A 2QQNL 3KYNB 3VD5A 4ZUUA 2EE3A 5C6WH 5BCAA 1A7RL 2BOBB 1JWSB 2BDNH 5IIEA 4G8IA 4DKAA 2IPKB 2ITCA 2G9HA 4PGDB 3L3OB 2HFGH 3QBTB 3QEQA 1MWAB 3VE0B 3M17A 1RIUL 4LLMB 4H26A 2AI0H 2CLVB 2NY5H 4NM8L 35C8L 5JHDE 2Y06L 4M7LL 2AQ3A 2IH3B 2DQUH 1H15A 1MI5D 4UT7L 2JELL 1NMAH 4JANB 1RK0B 4WNQA 3P9WB 4ZMAT 2EKSB 3FT2B 5GSRB 5E2TH 5TGBA 1X6NA 3TF7C 3HE7B 3PWNA 4X7SH 4IBLT 3E6FB 3CSYB 1PG7W 1FNSL 3MLRH 1CXFA 5D6CA 3SJVB 1AD0B 2FCBA 4DWHA 5AUMA 2ADFH 3SPVB 1BIHA 3MOBL 5TF0A 2HTKC 1AP2B 3KYKL 3H9SB 3UO1H 1FL5B 5E94B 4GMTH 1MRDL 1EO5A 3IKCA 1HQ4B 1WBZB 4QNPF 5FM5O 4G8GD 1GGBL 1I8IB 3KLHC 1X3DA 1PKQB 1U3HA 1XGRA 2XTLA 1CICC 3TZVD 1L9NA 3DLQR 5F1NA 1ZEAL 4OI7A 5FYKD 5BV7L 1FC2D 3H2WA 1RV6X 2XN9D 2HN7A 4HBQA 1R3JA 1HHGA 5DC0A 3JV6A 2NLJA 1TETL 3QIUC 1NFDB 4CKVX 3CSPA 4XI5C 1ACYL 2VQUA 5D5MA 4GG8B 2ZCHH 5EFIB 1BMGA 3MRJB 1BVLB 3QDMA 2IBZY 5CD5D 4HHAB 4ONOA 3GMOA 5L0QC 4WFGD 5TPWL 4FQCL 4DGVL 3CDYA 2BNRD 3T09A 1IM3B 4PJ7A 1EUUA 3MBXH 3NN8B 4C56D 1T1YB 4LBEB 4RGMB 3RL1A 3OAYH 3HMWH 4N8CL 3SCMA 3VG0L 1A47A 5GJSL 3STBA 1WBYA 5EU4A 1J7VR 1N5AA 3BHBB 3GRWL 4MVBC 4WEUD 1CU4H 4ZOAA 2FL5B 4BSWA 3MRLA 3RGVB 3JUYA 4J3SA 2FZ3B 2FLRT 3FQNB 3MO1B 4HWUA 4R0LA 4YUEL 4Z7VF 3LMJH 3CXDH 3OKNA 4HF5L 3HC0A 3V6OA 1Q72H 5AD0B 2KZ1B 5MEOA 5CD3B 3RWHA 5DJ8A 4M9PA 5FOBA 3GBNL 4K3DL 5TE4L 3E3QC 1A6AA 1RUMH 5E6IC 5F6IC 4PJFE 1Z5LB 3VI3E 4F15B 3D18A 5A2IH 2OR9L 5BXFB 1KEML 2YRLA 4HC1A 4PGEB 4EQ2A 1IKNA 1CF8L 4M1DH 4PJ8D 5EA0H 1JWMA 4QF1A 4XP1L 3O3UN 2V5SA 1U8LB 1AHWB 3CVIH 3VWJB 4POZD 2O5ZL 4HIXH 2CR3A 4LCUB 1MH5A 4L1HA 3QULA 4OQTH 3NFPB 4N0FB 3U36B 1MLBB 1DLFH 3RIFK 1QFUL 2X4QA 4MX7B 5GGRY 4ALAH 4X80H 4E41B 1DE4B 1T2JA 3HE7D 1Z3GL 2VE6A 4HMCA 3RVWD 3KNBA 4NZJA 3GO1L 3HNSL 3S35H 1S7TA 3SJVD 2MKWA 1C8PA 5D1XA 1CDJA 2XYCA 4XMPL 5FUOL 1CFNB 2PKDA 3GSWA 3MPCA 4Y5YA 3H9SD 5D1QB 4HUVB 5A2LH 3QIBB 3TJHD 4FQ2H 4JPVH 3FKUS 4X6CB 5FAAA 1CZ8H 1I8KB 4R7NA 1XR9B 1AO7E 4TRPL 5GGQH 3WJLC 2B2XH 5CWSA 3QNZB 3W0WE 4JQIH 3X13B 3H42L 4QTHA 3OQ3B 3VXSB 5GGTL 3BEWB 2E7LC 3MLTB 3V7AE 3EYUL 3UTSD 1CD0A 5DFTA 5CEYB 1QEWA 3GI8H 2VXSH 5C2BH 2HJKA 3V6ZA 1E6OL 1UM6L 2R4SL 5JLZB 1LO3H 1Q0YH 5ISZA 4K3JH 4KKAC 1HYRC 3AM8C 4OCNC 4FXKB 2EIZB 5IB4B 2IPUK 4AIZA 2HFTA 1LO0L 4GAGL 3GM8A 5DS8B 4MD4B 1ZLSL 4X6DF 1A4KB 1YEHL 4RQQA 3RPIA 3C08L 3SKJL 4MWFA 2VQ1A 1B4RA 2DBLL 3WNLA 2AJSL 3B9KC 2P48B 2ZJSH 5ID0B 1PKOA 1URLA 4GRLA 3QDHA 4UTBL 4P2QB 1QRNE 5FM4A 3H6JA 1G9NH 4HSQA 4L4VD 2H3NB 3SE3C 1XAUA 5GS2D 4DGYL 3DWTA 2YD2A 2OK0L 1HH6A 1ZHKA 3FQWB 4LIQE 2VDKL 3ULUE 4P5TB 1F97A 5HVWA 2F5AH 2PW1A 5FGCB 5F1SA 4TUKL 1U58B 1YUHA 4JPIA 4TUJA 2V6HA 1EAJA 1CFTA 3IFLH 1JPFB 4U6VL 3RWDA 5I18L 3L7EB 3AU1B 1JI2A 5E4IA 3VGHA 1WT5A 3LSOA 3TA3C 3WL9A 1S9YA 2X9WA 4UNVA 2ATPA 2X4UB 5FGRA 4ZNEA 1FC1A 2BMKB 1OAQL 1OAYH 4KDTC 3IFPB 2DQJL 1AGDB 3I6KA 2J4WL 1OARH 4HS3A 2R69H 2ZOLA 4HWZA 4N0RA 5I15L 3VWJD 3QUZC 1JWUA 3O6MH 3QEGL 2Z8VC 5HYJB 5FGBC 4Z5RA 4M5ZL 1MJJA 2R8SL 1LE5A 1SJHB 5I1AB 4XCYB 4LSVH 3WYRA 1I7TB 1R5WA 5KAQG 1CLOL 3U83A 3JTSA 1IE5A 1RURL 2BHZA 4Z9KB 5E5MB 3LRHA 3P30H 4BZ2H 2F54D 4XH2B 3OF6D 1YDPB 2XTJC 5D1QD 3IU4L 2HVKA 3QIBD 4PJXA 4NWTL 1SEQH 2A0LD 3TP4A 2ATKB 5KS9B 1JNLL 1RZIB 4QGTA 5C07E 1BX2B 4K9EC 2IF7A 1IC4L 2D9CA 4HIJB 1LO4H 4RA3A 3ARGA 3KXFA 2BNRA 3VXSD 5JTWA 1V05A 3QO1A 4NO3B 5DK2B 4ZUSB 2DOCA 5J9PA 4WCYH 4KHTL 3TO2B 4BQCA 1G7MB 4C56A 1FLRH 2YK1H 1TFHA 3F58H 2PO6B 2VAAA 1EA9C 2YUZA 3MRFA 3P4NB 4H8WC 4U1JA 2Q87A 5JDSA 2J12B 4EUPA 5ITBH 1MCOH 1MSPA 3CDGA 4QTIH 2WBJA 5DO2D 1A1MB 2VNCA 1NAKH 1YEKL 1T5XB 4I0PC 4AENB 5F88B 2VQTA 4L5FL 4WVRA 1RUQH 5ESAB 2R0ZH 1NLBL 3F7RA 2ARJB 1EO8H 3D39B 4X6EA 3O81A 1S7QA 1KIQA 3QDGB 1OCWH 2D0HA 3VFOB 1G0DA 2HLAA 3CK0H 1EEZB 3WSQH 5C0DB 3OAUL 4ETQA 5J12C 3TH3T 3TBVA 2Y07H 3ZTJH 3Q48A 2X4SB 4PJ8A 3B6SB 1BOYA 3MACH 1OAXH 2CLVA 4OF5A 4FFYL 1A21A 4MQXD 5INCA 1MY5A 2IH3A 4MNHB 3H3PH 1MHCB 3MRBB 2UZXB 1P4BH 2EKSA 3FT2A 4MXQC 1O0VA 5GSRA 43C9A 3E6FA 4F7PB 1KCRH 3LKPA 3I85A 3Q1SH 1OW0C 4ZG1A 4Y5XA 2Q3AA 3SPVA 4O4YL 3SO3B 4BH8A 1EXUB 1AP2A 1CD1B 1ZVSB 2XFXB 3BPNC 4HUMB 4TNWK 3H9SA 1UZ6F 2GFBB 1DEEB 2EXYD 4CBPA 4HFWB 3SQOH 4NQXA 1WBZA 1GC1H 4UILL 2IAMD 3F5WA 1E6JH 5ALCL 2EH8H 1F42A 3BKCL 2KL6A 5BQ7B 1RMFL 4U33A 2FD6L 3L5JA 1NCBH 5HDOA 4MAYB 1FFRA 4NNPL 5K33A 3O2DH 4PR5B 5C09B 2DLHA 2PUQT 3V7AG 3GB7B 4JREC 2MSPA 1NFDA 1WAAE 4LSRL 1L7IL 4NFDA 4XNXL 3GSUB 4PJHF 4Y1AB 1GAFL 1HHJB 4RFEB 1H0DA 4XPHH 3AREB 2CRIA 4X4YA 4PGBB 1PD6A 3RUGA 1UENA 3ZTNL 5ACMA 5F7MC 5GRWA 2I07B 4EUPG 3NN8A 1DN0B 3SDAB 4OM0L 4NKDA 3LQZB 3S88H 4XP4H 1I7RB 5D1ZB 2NY2B 4POYA 1JHTB 3EOAA 4HC1L 4YO0B 4L4VA 4CVXB 1PLGL 2QQLH 3G6JF 5ABDE 1BZ7B 4LU5H 1KIPA 4OFKA 4YC2C 4MA8L 1G6RA 2IG2L 1C12A 1R3LA 1X5HA 2XKNA 4ONHB 5I9QC 1S7XA 3UZQA 4LDLB 3VFPA 3D39D 3L3DB 2HH0L 1FVDA 1TNMA 1UXSA 1CFSB 3QDGD 4OKVB 3T0BA 3V4PH 4HIIB 2GK2A 2O5XH 1IVLA 1TJHL 3CMGA 4HAFA 3IDXL 1XIWB 4NZTL 1NH6A 4IMLB 4A6YL 4RGOL 1AXTL 3WLBA 4XTRD 5MP6H 1U8JB 4HMEA 4ZS7L 2A9MH 4X9FA 3LKOB 1FFNB 5A2JH 1R3HB 1EHLH 3TLRA 3U36A 2W9LA 3MLZH 2Q86B 2PYFA 4AG4H 3CFCL 3O8XB 5DMGC 3R8QA 4ZOEA 4YAQA 4YHKH 2G5BA 5EO0A 1EFXB 3LKSA 4M93B 2B7DT 4OQ1A 3IYLW 5E2UL 1TCMA 5GS1B 3ZDXE 1NAMA 3W2DL 2F54A 5FDWB 3OF6A 3PWLB 1RJZB 4R7DA 3QIBA 4ZFFA 1ZXQA 3FO9B 4JFDB 4XNQB 1P5UA 3QUYD 4WW2A 1NBYB 1XR9A 3WFBH 5C0FB 1WAAA 1J8KA 4PY7B 4RFOH 1TZHA 5F1KC 3FN3A 3GMLB 2YD9A 1O7VA 1HOCB 4MAYD 4NM4H 5DK3A 1G1YA 3ARSA 3DSFL 1PEWA 4NHCH 5C09D 5E00A 4QGYA 3U4BH 4XC1L 3P0YL 5C08E 3KYAA 4QO1A 4Y1AD 3MCLH 4LCYB 3DX6A 2DWDB 5D7LB 4XZUB 1SYVA 3GI9L 3ARED 3DVNB 1D5BB 4NZUL 3CZFB 1MPAH 1Q9KA 2HG5B 1DQML 3NH7L 4Y4FC 5HHOB 3ULUH 2QQKL 3MA9L 3SDAD 3NBNA 4IIQA 1TJIL 2AK1L 5KVEL 1X5GA 3EO9H 4NKOA 4OIIH 5EZIH 4YPJA 3QH3B 2P8LA 4D0BB 1X4ZA 1U8IA 3JWDL 3OXRA 5E8OA 3TJEH 5D71H 3T3PE 4MQ7A 1U3JA 4I18A 3PGFH 1S78D 4ZFGL 5K59F 4LCCB 1CGVA 2I9TA 5BVPH 1BF8A 3BD5A 3MRHB 4APQC 3HPLB 1UT9A 3L7EA 4L9DA 5CZKA 1T1WA 1XIWD 4F9LC 2A38A 3GMQB 3MBEB 5FYKL 1JGDB 1INDL 5HYFA 3QXAA 4V2CB 1WC7B 1U8MB 4FS0A 1HHKB 4FQHA 3FOLB 1DQDL 4L3CA 4XCCL 5IBTL 2E27H 1AXIB 4Y4HA 1DLHB 3JBG7 1QLRA 4RISH 4PRAA 2IAMA 1BZ9B 4NN5B 3O8XD 2C3GA 5C6TH 3MUY1 4FNLL 3PV6A 4N0CD 3MCG1 1MFDL 4LVHB 5I8OL 4HJ0D 4P2OA 1MJ8L 1WWCA 1DQQB 4H25B 2W9EL 4UV7H 1EFXD 3LCYA 1YMMB 5IVXA 5TE7L 5E4EB 2WUBH 2YHGA 3F62A 2AK4E 1WVZA 1JIBA 5CFHA 1JGEB 3IU3A 5LGHH 1BJMA 1D5XB 1HSBB 1RZKL 4F7CB 4NQVA 2ATKA 1UFUA 3BMWA 5KS9A 3CVHA 1GPOH 5DJZA 5SX4I 4KAQH 2Q3ZA 5B22A 3Q6FB 5C08A 2R2HB 3DV4A 5BW7A 4JHBA 1ADQH 3G5YB 1YPZA 4JZJB 5I1EH 5FYLE 4YHPB 3ULVC 4PGZA 3DIFA 3P4NA 1U8PB 5CMAB 4X5XB 3MXVL 3LEXB 4CGTA 1QSVA 1NPUA 2IALB 3FHAA 3C2AH 4L1DA 3ZE2E 4OF0A 4UBDC 5D7LD 5SX4H 1ZA6B 5JHLL 1MELA 2HWZL 4LLQA 4CVZA 5CZXC 4YWGL 4X8JA 5HVHB 5KN5B 1UM4L 4X6CF 5LGJB 4HEPG 5E8EA 2VZSA 4NO5B 3DURA 2OTWB 3D39A 4WFHE 4KI5E 5HHOD 1BAFH 1FIGL 2NYYC 1FJ1B 2DRUA 2C26A 3VFOA 3KHQA 3ALPA 2JKXA 4RMUA 5I8CB 1IAIL 4K2UL 4XBEH 3OB0H 1UJ3B 1UWEH 2DDQL 5EIIA 3NZ8B 4XNZC 5HGHA 1T83C 4UTAH 5JXAL 5IEKB 2X6MA 1RUKL 1WISA 5AEAA 1HEZB 2J8UE 4JFFE 3GSXA 1N26A 3U0WL 3OR7B 3TBWA 2MPAL 4DKEH 4GKOA 3LH2H 1Y0LA 3MRBA 3MUGB 4HUUA 4I0KA 3ECBB 3VJ6A 4ODSL 5C0BE 4D8PA 3AFLA 4M8VA 2DL2A 2JJVA 1QRKA 4ZOCA 4IRJC 5HYEA 4OGXH 3K8LA 3HR6A 1VACB 4Z76A 1OAUL 2PW2A 3WNMA 5H94B 3FB8B 4AEEA 2LU4A 3IJSA 3MUJA 3D0LB 4MNQB 3EYOB 2AGJH 2X10A 1MJUL 5ACZA 3QUYA 4NC1C 1I8MA 5C0IB 3VMNA 5BQ7A 4O58L 5GGUB 5BOZG 2X1QA 1ZTXL 5JW5A 1KCSL 1ZHNB 1BQLL 3LVEA 1B2WH 3GHBH 3MV9B 1CIDA 2DQGL 3EOBA 4P9HC 4MJ5B 4R4BB 1L0QA 3Q0HA 4NQSB 3O6FB 4OCXL 1INEH 1ZHLB 2BVTA 4M7KH 2X70A 3AREA 1G6RL 1BVZA 5JNYB 4JZNA 5TDOB 3EZJB 4OLEA 3CFJB 3FFCB 5GGSA 3DARA 4R2GC 3FONB 2M2DA 4PTTA 2VDNL 1PBYA 4WEBL 3NIDE 1JFQL 4V1DE 2EYRA 1D6EA 3QWRD 1NCTA 2PR4L 4NQUA 1E4KA 5JOPD 4NT6B 4JFZL 3KR3H 3X12B 4KTEH 4WFED 4LEXL 6FABL 1ZWIB 4XNMB 3KPRB 1Q0XL 3KG5A 2VXTH 2J8UA 2H6PB 1NDMA 3KPNA 1TJGL 2F74B 4MB3A 2YPKB 3N85L 1J0IA 4NUJA 2VUOA 4Z7WE 5AYUH 5IW1A 5IUSA 2P42B 4NO2A 1DFBH 4PG9B 3IETB 1NAML 1ONQA 4PJDE 4YHMH 3GNML 5T1LB 1T0MA 2J88L 4TSCH 4RMQA 5A43C 1YNKH 4FXGA 4PRBB 2V7HB 4LOUD 1M71B 3G5ZA 1U91A 4OI8A 5E1AA 2FO1A 3QG7H 5CP7B 1UVQB 1HHIA 1N0XH 2JLLA 3QWQB 2QV2A 1ETZA 4KKBD 5I2IB 2XWTA 1NJ9A 4K8RL 4WU5A 5DD5H 3PHOB 3SGKC 4WO4D 4OZFB 3VCLA 3CXHJ 3VFWA 3NABH 3NIGE 4L8SB 4MD0B 1VFAB 4MNQD 3X11A 3BD4A 5EC2A 1A0QL 2R29L 4G8FB 2FHBA 4XNQA 5IMOB 3P9MA 2FBJL 1IQDA 3R06A 2C3VB 5C0FA 4GH7B 5IFAL 3HMXA 3NACL 5IFHH 4V2BA 2R1WA 4HWBH 4NNYA 1RPQA 1D3CA 1D9KC 1CI5A 4E42A 3EYVA 3CH1A 4K23H 4KWUA 3LQMA 2BVQA 4S0SD 1L7TL 1LNUB 4I9WD 3UP1A 5C0RH 3L9RB 5DJDA 5BMFL 2JB6B 2HMIC 1IAIM 3ALWA 3OG6B 5DYOA 5EU5B 3G04B 2NZ9D 5EZOL 2WQRA 3O6FD 1U41A 2W91A 3VH8B 1XEDA 4LMQE 5C2UB 3HI6H 2CPCA 4KJWD 5DRWA 4HXAH 1Q9WB 5HHNB 3FFCD 2X41A 2F5BH 2X9YA 3DBXA 1G9MC 1TQCC 1UQSB 3VMPA 4YEFA 2VMFA 3HS0B 4HJGA 4M03A 3IF1A 1KJ3L 4PJFB 3HZMB 2K7QA 2HRPH 2GQHA 1T6VN 5D7JB 5F97E 1Q94B 3REVB 3WN5B 5C0GA 1F6AB 1A3RL 2UV3A 3C60B 5EN2A 1INQA 1NLDH 4LRIA 1VFBB 3K3QA 2DB8A 1XH3B 3K4DA 2FX7L 2W65A 1QSFA 3NAAH 1SY6A 4PJGE 5D8JH 3KJ4C 3KPRD 2EECA 1UA6H 3EGSA 3I3BA 3EJYC 4X99B 1BOGB 4PJIE 1OP3K 2X89D 2B39A 3BAEL 4C58B 3PDOB 2CIIB 25C8H 4YBQC 4ZSOE 1CFVH 1DUYA 4JDVB 3W39B 3OKDA 4ZFOB 4JFPA 5JR1L 1PSKH 2APTA 4Y4KB 5EH1A 5T1LD 5CIPA 5E6YA 3PL6C 3KPMB 4HCRH 4I5BB 3MREB 4W4OA 3PGDA 4Z7UA 3RI5K 3CVHL 1C5CL 3MODH 1AO7B 4NJ9H 1H8OA 2EE9A 3W0WB 4JCMA 4YHNB 2RQ8A 3IKKA 3QQ3B 4PJAE 1AC0A 2VKXA 2XZQL 3H3KA 4PBWD 2FGWH 5HHMD 5J13B 3Q3GB 5JZ7D 1A9BB 1W8OA 3E6HB 4CUCA 5IKCA 4EVNB 2BRQA 3KLAB 3MA7B 3EYSL 4JDTH 2V5RA 1HSBA 3KPOB 3C09C 3PDDA 1KTKE 4JG0H 2ZSWA 3QPXH 1HH9B 4K7FB 5KSAD 4L29B 1AKJD 3OKKA 4GS7C 3MV11 4WI2A 1WF5A 3VXQA 5FO9B 3BGAA 3JWOL 4JZJA 5GRJL 4G42A 4F57H 3FZUD 4B0MM 3TWCH 4YHPA 4MQSB 4WHTB 3BKML 5C0EA 4HUKB 1QRNB 4OAWA 1KTRL 5CMAA 2BY1A 2A74A 2IALA 3QXVA 1WUNT 1M7IB 3KPQA 3BH8B 3MJ9H 3QWRA 4KTDH 2DJSA 4N8PA 5E08H 3DSNA 3WHE1 3R1GH 2WP3T 4GKNB 3C6SA 1L0XA 1UXWA 4D3CH 4ZXBA 3OKEB 1SVCP 5LGJA 2YWYA 3O4LE 3VWKD 4KRPB 1G7PA 2NXYB 2OR8A 3OZ9H 5F3BB 1AGCB 3VXUE 4ODVH 3SGEI 3QNYA 4ELKB 4ZD3L 4N1EA 1S7SA 4R96A 5DK0B 4UQ2A 3FQTB 5L7XL 1QFWL 5J4MA 3P77B 3V2AR 3UJTH 4PJIA 4JO3L 1R6VA 4LSTH 2Q8AL 1D5IL 3CNKA 4M1CC 5E7FA 2PXYD 1NGZB 4URTB 3HTLX 4QRRB 1FVEB 4AEIH 3SGEH 5D4QA 4OGYH 5J0BA 3AROA 1LK3H 4KPHL 3STLB 2H9GB 1OGTA 3K2MC 5KSBE 1FYHB 2YRPA 5GZNC 1GRWA 5C7XH 5IQ9B 1FGVH 5L6YL 3TFKC 4Y7MA 3LS5H 4QYOA 1KT2B 5EU6D 5HYIA 4OSUH 4GFTB 4CJ1A 1PQZA 2CJUL 1JGUL 4Y4KD 4CN1A 3VFUA 1ZLWH 4WO4A 3C5SB 4LSSH 4M3JA 2GAZA 5ICXB 3T2OA 4PJAA 3MRQA 2PCPA 3MRDB 5FYLL 4JY4A 5C07B 1C1EH 2VLJB 1AO7D 3RY6A 1IBGL 5KVMC 4UIKL 5I1JH 3W0WD 5CJXA 2D3VA 4LGPB 2OXGA 2DQIH 3QXTA 4Q9RL 2WBWB 2VR5A 3HI1A 1TVHB 2WWMC 3EOYG 3S35X 3EDFA 2V2TA 2I5YH 4JFED 4U05A 3CMOL 5JW4Q 3BPLB 1KC5L 4Z7QF 1ZVYA 1J8HB 2BY3A 3PGCA 2FR4A 3QEUB 4MJ5A 1DP0A 5F93C 1I4FA 5BJTA 1OTTD 5E8NA 4R26H 5BO1H 5CSBA 4G6FB 1X5LA 1XGPA 4QXGL 2HLFC 4LSPL 2R0WL 3FFCA 1KENH 3NCJL 4RGNE 2BDNL 4PTUB 3CPLB 5L2KA 2Z31A 2E3VA 1BD2E 2N4IA 5TQ2L 3GUTA 2ICWA 1CGSL 1LVEA 5TF1H 3UTTE 4LSQH 1Q9LB 2VLKD 2CDEA 5F44A 4NRZB 1OP9A 2JK5B 1NMAL 1T0PB 1JTOA 4BSJA 1CYGA 4ZUVA 3TT3H 1DR9A 3EO1A 4N9GB 3S7GA 4YPGB 1NFIA 3QHTC 2NXYD 1LQSR 2VLMD 3CXHK 3CJJA 4GAYA 4NQDE 4WJ5B 5M94B 4XP6H 2F74A 2R2BA 2YPKA 4XNUL 5DQJB 3CFDB 5DVNA 3MFFB 4K3EH 3TGXA 4WY7L 4ONFL 4P4KC 2H2PC 1KTDB 3LZFH 2BERA 4AL8H 4JRYE 3UO1L 3QHFL 2OR7A 3BT2H 2OI9B 1J0KA 2IH1A 2FH8A 5C0JB 5IF0A 2BFVL 1SEBA 1QBLH 3DX7B 3ULSA 1HZHH 3VDCA 4FQQA 1KCUL 4ORGB 4MZ2A 4S11A 5DEZA 1UB5B 3DNKA 4QRRD 4UB0H 4X8XA 1C08B 3EYQC 1CDHA 2YPLB 4XI5D 4LMQI 5FB8B 4LLDB 3G08A 2CDFA 2ZCHL 3BWAB 3DYPA 4OLVH 3RTQC 1LMKA 3WV0A 4D2NA 4OZFA 4JHAH 3MX0A 4KY1H 4X4XA 2J6EH 2DQCL 5JUEL 3D9AH 4DAGH 3ARFC 1IEBA 5C07D 1TPXB 2VLJD 4WTWA 2ED8A 3MBXL 5F7KC 1CIUA 5IMOA 1L9MA 4RAVA 2DQHH 4BJLA 3L3JA 4ZUTA 1YEEL 4GUPA 3T77A 2AEIT 2C3WA 5JXED 5KSAA 1NMBH 1AKJA 5FO7A 3UTQA 2GKIA 4P3CH 1IFHL 4S1QL 5KOVC 1GOGA 1AXSA 2WUCL 4Q0XL 3TPKA 4GAFB 5DJ6A 5IB3B 4YXKH 5J6HA 1NUGA 4RWYH 1J8HD 4OJFL 1UB6A 5EUKB 4QWWD 4LFHD 3D2UB 2FHFA 1RU9L 3D87B 4WV1A 2ZPKL 3MLXH 4LLWB 3RWEB 4G6FD 2UUDH 1LO2H 1VENA 4YFEA 2PTTB 4KUZL 1QFWM 1K5NB 4K07A 1SY6L 3LN5B 2XWJB 3KPTA 4UT9H 3VWKA 4DOHE 4RBPK 4LSUL 3LB6D 5T1DL 3LRSA 3V0AC 3HS0A 1B4JH 1GIGH 2NY0B 1J1PL 3FFDA 1AQKL 1NGXB 1U3YA 2WLYA 1ZT4B 4XP5H 1Q94A 4YXLH 3IAQA 3MJ7B 1H3TA 1F6AA 4FABH 5ICYB 1I1FA 4JO1L 4OQTL 5SV3A 4YDJB 2GY7B 4JPKL 1Q1JH 1DBMH 1RFDH 4NRXB 3TIEA 1VFBA 5IMMB 2H2SC 5E9DE 4AQ1B 3RY4A 1JNNH 3WO4C 4BKLA 1KLFA 3WS6C 2Y7QA 4Q2ZB 3SDXE 2PXYA 4JRYA 4ELMA 3O3AB 4JR9H 3L1OH 1HILB 2XI9A 1BEYL 1HYSD 3L5XL 4QOKE 3AMLA 3MXWL 5GGVL 1N5YH 1IC7H 3MRNB 5CUSH 3Q6GL 3UYRH 4HIHA 3QZWB 1BLNA 2AEQH 3BUYB 1OVZA 1RZJH 3K8KA 1CWVA 1B90A 3V4VH 1OWRM 4OGZA 5EU6A 1RIVL 1WZ1H 4X7FC 1W0WB 3QISA 2X7LA 3U30C 3DX9B 4TULH 3KWWA 3UC0H 4Y4KA 1FFQA 4KKLC 3QWOA 4OUUB 1VA9A 5IG7A 2H32H 2C3XA 4U3CA 4WU7A 3BKYL 3QAZB 2GJZA 3PP3H 4P46B 3DHMA 1DL7L 4S1DD 2QEJA 2YPLD 2HVJB 3KPLB 3OR6B 5D7KE 2V2XB 5IMKA 1A7QH 3QQ3A 4RNRA 2I25N 3CX5J 1S9KC 5MEPB 3WFHA 3T65B 5CEZE 2VR9A 2VN4A 3X3GH 1NANI 4JFEA 1A9BA 1I7UA 1LO3L 4DEPC 3PIQB 3SQBA 3GK8H 3RVXC 1DTUA 5ADPL 1AR2A 2AXHA 2OMBA 1GGIH 2EKJA 3GSNH 4TSBH 2X1WL 3PQYE 1T7VA 2XKUA 4HQQH 2P46B 2QHLA 3TBYA 5C0AE 2QR0B 12E8L 3QQ4B 3INUL 1I1CA 3ZHDA 1L6XA 1ORQA 4RIRB 5FO9A 5GSVB 4CU6A 1NANH 1ZS8B 5FCUH 5J3HC 1G9NL 5T1KB 4UNUA 1V3KA 1MREH 4UOW1 3RIAF 5F7DA 4EBQH 3E3QE 1G7HB 5JO5A 5T3XH 3D2UD 5LXGL 3SDCC 2P1YA 5F7YC 1WTGT 3MRGA 4PRIE 4JO2H 4R0LC 5LBSH 1FFOB 5HDQL 2VLKA 4RDQG 4UAOC 2ESVD 1HI6A 1YYLL 1VADB 3OXSB 3V6OC 3OKEA 2DYPB 5GRYA 3WBDA 4HGWB 4W6WB 2DQTH 5HDBE 4KI1A 4PUBH 5IESH 2IPUG 5I1LB 2CUIA 3KJ6L 4DZ8A 3FTGA 4EIGB 5IJVB 3ZKND 5E9DA 3TN0B 1CTOA 3SDYH 1U6AH 3S96A 3T0EE 3SDXA 1T4KA 4UINH 3MV7E 3HI5H 1DDHB 4AH2A 4OCRH 1EFQA 1F11B 4GXVL 4Q58C 3P77A 2H41A 4JFHD 1AGBA 1FL3B 3I2CH 1P7QA 4NQEE 1AGEA 2VLRA 1CICA 5DMKA 3T3MF 3ARVA 4OF3A 3FO1A 4WW1A 3G6AB 2WIMA 3EHBD 3D85D 4XB7A 1M7DB 5DQDH 5J7CC 1FAKT 4MD5B 2H9GA 5HGAA 3O41A 3QIUA 4PJFF 2Z9TA 3VI3F 2DQFB 2OM5A 4DGIH 4K3GA 5EOTB 4GG6E 1TITA 4KFZC 2ID5A 1SEQL 2AK4B 4Y5YC 3ARQA 1QQDA 3AS2A 4MDIA 4NN6B 1JN6B 3BDBA 2A6KB 2YOCA 1G7LA 4J1UB 4I48A 3MRCB 3QUMA 4S0TD 2WM0A 3BJLA 1FGNH 2A6JB 3QDJE 1IEAA 4PJ5E 2VLJA 5JW3L 4P46D 2AXGA 2I27N 2BVOA 5CHNB 3V5HB 3TV3H 4GMSL 4YXHH 1OGAE 2X1PA 4P23D 3HRZB 1ZLUK 1XF1A 1A1OA 2XZAL 1FLTX 3FB6A 1DBKH 1MCOL 1B88A 5HBBA 3C5JA 3ROOA 3D25A 2BSSB 2A83B 5CBAA 1TTFA 5DDHA 4FMKA 5JPNA 2R1XB 4ZOBA 3WDIA 4CMMB 1DVFC 2OLDA 4YZFE 3C6LC 1MCPL 1P7KA 4M6OH 5D7IE 1M05A 1YN6B 2JF1A 4JEGB 4G7VL 4UI2A 1N7MH 3BSZL 3HG1E 3MOAH 1WEJL 2BNQD 1MF2H 1YN7B 2GTWA 5T33L 5E8DH 5ILTL 4JHWL 1U0QA 3PXJA 2N56A 4PTUA 5GRVK 1EV2E 4X4ZA 1OD9A 5CLTA 3NCFB 4OZ4A 1KJ2H 1A9EA 3I6LD 3ZKSD 1GGTA 4JLRB 1PG7H 1IZJA 1A2YA 5HPMB 1DSFL 3A6BH 3LN4B 2W59A 1AE6L 3U0PB 5A16B 2CUHA 3GEWB 3V0VA 2DYPD 3LPGA 4MAUH 1K9TA 4YHYC 4MJ4A 3UZVB 3ZKMD 2L7UA 4WHYH 1YJDH 1WT5C 4C54A 1YY8B 3ZL4L 5DGRA 1QYGL 2HFEA 1I75A 3K2UH 4XMLL 4YDVB 4NQEA 2YN5A 1YEFH 3VXME 2A6DA 5FHAL 4EN3B 1OY3B 5J1SC 4GKSA 2ZNXA 4LRNH 1KN4L 1W72H 2XV6B 1IRAY 3L7FA 1MEXL 4UU9B 1FCGA 3ULUF 1GC1L 1TMCB 2AAVA 1XF3A 4G9FE 3WJLA 5TQ0L 5KW9L 1B0RB 4XX1E 2XTJE 5CGYD 1MCWM 3WXWH 1OD7A 1MIEL 1X6LA 4KXZI 4TOYH 2E7LA 3TZVC 5I71B 2FB4H 2O61B 1RVFL 2ZUXA 2LV4A 1F3JA 5HGBB 4H0IA 2BOCA 2VZUA 2FJFA 1KJMB 3QDJA 3BMVA 3P9LB 2AK4D 5F3HB 5DJ2B 5DRXB 3AM8A 3HLAA 1IGYB 3KS0J 3QRGL 2BSRA 4NDMB 1ZANH 3VXPB 3RY5A 5CD5C 2YXFA 1EGJA 4KXZH 3L3GB 2E9BA 4GBXB 1FIEA 3A6OA 1QPPA 3VGEA 1I9JL 3V5KA 3B9KA 4F33B 1BIIA 4XAKD 2R0LH 1JGLH 1T22A 2X1OA 5EULV 4XVSH 5ERWB 2CLZB 3SE3A 4OT1L 4JRXE 2QQLL 3B5TA 3AY4C 4LU5L 4Q9QL 5I0DA 1QLEH 4JFXA 3DUSB 4JAMA 1ZT1A 1CFQB 5EUKA 1RZKC 4V1DB 2AKRB 3LEYH 4WUKH 1R3IH 4NCC2 5D70H 3SKOA 2CK0H 3HNTL 5CEXA 4ZPVB 2ESVA 2PTTA 4R97B 1WGOA 3K46A 3DO7B 2J5LB 4KI5D 1JF1A 3TA3A 3S34L 4AJ0A 4NZRH 4ZYKA 5CJ5A 3GIZL 3NFNA 1MCRA 3FO2A 3HUJE 4TSAL 3ZYJA 3FQXA 1X5YA 2D0GA 1QNZH 3REWA 3UTZB 2ADIB 3OJDA 3QUZA 4PJ8C 4RFNB 5IHUH 1WIUA 4Z7WB 4QXUH 4Z7NE 4N90E 1QHOA 4BUGA 2CO6B 1I9RH 4YDJA 1S9WB 3VXMA 2EIBA 3CX5K 4I3RH 5I1CH 4WDIA 1P4LB 5DMGD 4PJEE 2I60L 1EX0A 1JRHH 4Q2ZA 3U7WL 4B5EA 3PV7A 1P2CB 4UV4H 1QR1B 4I0CC 5FYJU 3HE7C 3BPCA 2CIKA 4WHCA 3D85A 3S97C 3RVWC 2AV1B 4BQ9A 32C2B 4YNYA 1I3RB 4EN3D 4K94H 3M45A 3QZWA 5KVFH 4FFZL 1MNUL 3I6GB 1PY9A 4IDLA 1ED3B 4QT5A 4PG2A 3GHEH 3HZYB 3TJHC 1F90H 5CEZH 4HGMA 1IQWL 1PZUB 3WFBL 3DXAE 5I66A 4OFPA 5BOPA 4MZ3A 1FVCB 1JP5A 4MS8D 2W60A 4P2RE 2VXQL 4I3SL 2XICA 1A5FH 3VFNA 4NHCL 4P23A 3RAJL 3KPLA 2VZVA 3DV6A 3FB7B 4WUUB 3B2UC 4X5WB 3IDGA 1UZ8B 4I0PA 4M1GL 2DI7A 3B8SA 3S36X 5IB2A 1MPAL 4X6FA 4F9PC 1JV5B 2Z93B 4GBXD 4HS6A 1FCCA 1FFPA 1BF2A 5IVNA 5JQ6H 5ALBH 3ALXA 5K9QI 5IFJA 4GKZB 2A77H 3LEVH 1BM3H 2BC4A 4ZFZB 1FYTB 1RJLA 3EO9L 2D7TL 4OZHA 5T5FH 2KUTA 4RGMC 1FP5A 2BNQA 2FBOJ 4O5LH 4BFIB 4ONGH 4NFBA 1UACH 4G80A 3UCRA 3AB0C 1X5KA 3TJEL 2P5EA 2NY7H 1E4XI 3RGVC 3WUWB 1GZPB 2F9BT 4J3VA 3HUJA 2NY3B 1JGVH 1FSKC 4HKXA 2DQDH 2ZSVB 2FATL 5C9JA 2R9HD 1OSZB 1T1XA 3B83A 3O3EB 1WICA 4L8CB 2FIKB 3RDTB 4Q6YA 1VADA 4MXWH 3OXSA 5DURB 1JHLL 5GISH 4EDWL 4PJGB 2K7PA 3IGAB 2X09A 2VZ3A 4BELD 3MRKB 4I2XA 1KGCD 1UJTA 3NIFE 5E7BA 1E4XH 4F15C 4C83B 1J5OL 1K6QL 4CU8A 2AJYH 3IFNL 5F96H 2YXMA 1KXVC 5F9JA 2FEEL 1DDHA 1AHWC 2RR3A 3VWJC 3V6FA 1F11A 2Z4QA 2E27L 4U1KB 4CNIB 1IGTA 4MCYA 3T2NH 3GGWB 3QUML 3GSOA 4Q74A 1CLYH 2BRRL 3CUPA 3T0XA 5DUBB 1V7MH 5SWZA 4LNVA 5DC4B 4IOIA 1T7YA 1Y6MR 4GW1B 2OJEB 4G8EB 4UV7L 2YEZB 5D7SH 4UNTA 1EVUA 3VFTB 3OX8B 3DXAA 4OGAD 2RHEA 1E27B 5LGHL 1MQKH 3VD9A 4HZLA 1KB5H 1I1AB 5D1QC 1CVRA 2H32B 3QIBC 1D5MA 4G3YH 4KRNA 1A22B 5E2WL 3ZO0A 2A0LC 1OAZL 5AAWA 2VXVH 5I16B 2C9AA 4S1RL 1JJUA 3BIBX 4HBCH 4MA7L 3D0VB 3HAEB 2P8MA 4M00A 3U4EA 3UX9B 1WWAX 1XGTA 4XC3L 3FO0H 4KMLB 5DHYA 1HINH 1ND0B 4AIOA 2R4RH 3DGGB 4WUUD 3GSQA 1F13A 1XR8B 4YDIH 1HWHB 4XVTH 5GIRB 3GSNB 1H3XA 3VFMA 3WIFA 3ZDXF 5IJKC 3CLEL 4JG1L 5L2JA 5DO2C 4YEEA 4O9HH 1LP9E 3IXTA 2IGFL 2CKBA 5LVEA 5GPRA 5GGRB 1F4YH 3OKLB 3TBTB 4N68A 3IRPX 4GRWE 1YN6A 4NFCA 1UKQA 2NX5E 3T0DA 1FYTD 4XBPB 1NCNA 3L6FB 1ZE3C 1CBVH 2ZCLL 4F58H 1J1OH 1RUAH 4LCWE 1RULH 4NSKA 4LHJB 3VXUB 1NUDA 1EJ6A 2CLRA 2MQ3A 1QBMH 2D03L 1K4CA 3ZE1E 4P5MA 3SDDB 5TE6H 1R3KB 1XF5A 3BP6B 1UWXH 2VWEC 1KB9J 2NY3D 1T1ZA 3ZMRA 43CAA 2VXUH 3ORJA 3HE6B 1MAMH 1TCRB 3SOBL 3RDTD 1T3FA 1IILE 4MQXC 3WKML 5E5UB 4IDJL 3H8NA 5TDPB 3TT1L 1H3UA 3RJQB 1EMTH 2EICA 4HPOH 4OCSH 2BY0A 2JE8A 4OGXL 4YDVA 1PZ5B 3D69B 3S36L 1MIMH 5DEFB 4LL9A 3V52L 3WFCH 1F4XH 4K9EH 5D96B 2JCCA 2NW3B 1FNLA 2A9NH 3IDNA 3TIDB 2CKNA 3CH8A 3T3PF 1EEUA 4JJ5B 3OTTA 2AGJL 2VL4A 3FT4B 2EXYC 4KVCH 4PRDA 3V0WH 5LQBH 5F21B 1X9QA 5HVGB 3C5ZB 1EGJL 4HPYH 1FE8L 4XVUD 5EG6C 3ZDYF 5SWQB 4QY8B 2MCG1 4PJBE 2VH5L 4WIQA 4K7PH 5HGBA 1OOAA 1A6WH 3EO0B 1FZKB 2E8YA 1IL1A 1A6TB 1NBVH 1ZA3B 1MCNA 5F3HA 1I1AD 1INEL 3QI9B 2Y5EA 4F7TA 3ULVE 5K9OA 4DJMA 2AJ3B 3ZYIA 4N8VA 4PRHE 3WEXB 1IT9H 4PGCA 4WEMB 3BGFC 4Y4FA 3L3GA 4R4FL 5JORA 1YEIH 2EC9T 2IQAB 4MA3A 3MV8D 4U6XA 1I3GH 2N7BA 4Q7DA 4R2GD 5I1GL 2Q76B 4OLUL 3BH9B 4O51A 4MJ2A 5ITFA 2P49B 2PO6C 4RGNB 2Z8RA 4G6KH 1I9EA 2HT4D 3DUSA 4WWKB 1M1SA 1BD2B 1MCBA 3MYJB 1OLLA 5LAXB 4OZIE 1A7PL 1JPST 4U1HA 2B4CL 1AFVL 1E4WL 3UTTB 5IHZB 3MLWL 3T2PA 4MJIE 4OBRA 3OGCB 4APQA 1RJYB 4ZUWB 3A6CH 2X1XR 4QHKI 3PHQB 4ZPVA 3V5DA 1R5IB 2ZUUA 4O2FA 1JYXA 5CSZB 1FZJA 4F9LA 2X4OA 3NCYS 5DI8B 3HR5A 1KJ2B 5T3XD 4FFVD 1U8OA 4M48H 4NQDB 5FOJA 2Z35B 3VXUD 1VGEH 2PTUA 1RIHH 2ADIA 5HXMA 3SDDD 4XTRC 2CH8A 4YHML 2C4FT 5C0CB 3MRIB 1U8QB 4GAJH 3ZE2F 2QADB 4R8WL 1HSAB 5KTEL 2C1OA 3HE6D 1PDKA 2BNUA 2VSCA 3SE8H 4RZCA 5FYJD 1J0ZA 4IRSB 4X7DC 3AVEA 5ETUA 4Z0XB 4KI5F 4ZTPH 3D3VB 2FJGA 5B8CB 2Y36H 1U95B 1YY9D 3K8MA 3GMNA 3LN9A 2QSVA 2OCFD 4LARL 1W72B 1O7SA 5A3ID 3F12B 4H8WL 3LQAH 4JQVA 4C4KO 5GQBA 2VL5A 4HV8A 4NC1E 5EBWB 5T5NF 2IMMA 4LLYB 4QEGA 1KXQE 1U93A 3U6RB 3SO3C 3C5ZD 2GITA 1IAKB 4OIAA 5FM8A 3OB8A 3OKMB 1VPOH 1JNHB 1BJ1J 4P3DB 1DCLA 3CC5A 3IDIA 4K23L 4MAYC 3IJYA 3N1PC 4OZGE 4PRPE 2XG4A 4N8VG 4PB0L 4F7MA 1LO5B 3VRIA 1A3QA 3O0RL 4YHLL 5EZLA 5HSFA 1CK0H 1HKLL 5DRNA 5IT2H 2VDRL 4KJQD 3OGOE 3QUKB 4HXBH 4WI5A 4QLRA 3QG6A 4DVBA 3AREC 3MLSH 3RU8H 5FA4B 2Q1EA 2GJ6B 4GW5B 1NCAL 1A6ZA 1NGQH 3T8XA 5IW6B 2ZKHH 3RWJB 3IS1X 5DD6A 4G9DA 3RVVC 1OHQA 4JGJA 4DOHB 3SDAC 4I13B 1A4JA 3MNZB 1T83A 4KHXH 4XBGB 5D1ZC 2NY2C 2QSTA 4BH7B 4F8QA 1KLUA 5BZDA 4WWKD 1MLCB 1KNOB 2BY2A 3GKZA 2W0FB 3ABZA 4N0UA 4KZDL 3LD8B 5MERB 3FT3A 4JO4H 3UTTD 3DOSA 4GW4B 4NWUL 3RA7H 1YC8A 3AAZA 1S78C 3EW3B 2WAHA 5D8JL 5EU3B 1VGKB 1ZSDB 3RDTA 5A2FA 3GIVA 3QIWB 1BVKA 1YA5A 1MVFA 3O3DA 5HHVL 5HJ3B 4AIXA 1SJXA 3VFVB 1D6VH 2ITDA 1EZVX 3MRKA 4NQDD 4J3OC 4RMVA 1XIWC 4IRJA 1KOAA 4C83A 3S98A 5C6PB 2AJXH 2HKHL 3QCUH 2D7NA 4ODHH 5HHXL 4U1NA 1W0VB 1WK0A 2GTZB 2LE9A 3WDJA 1PSKL 5C0CD 4UUJA 2QADD 4EZMA 3HC4L 5I6XB 2F53E 1GZQB 4KQ3L 4LLVA 4U1KA 4MLIA 4IRSD 4CL7A 4DVRL 4ZS6D 5IOPA 3D3VD 3UAJD 2G60H 5DUBA 4IRZL 3O8XC 4OCYH 5I1IH 1J1XL 3D6GA 4P59L 4X0KA 4N0CC 1A3LH 1T2QH 1WZMA 3GJFK 4HJ0C 1ORSB 3UDWC 4OTXH 5EZJA 1C16B 5JA8B 1HXYA 4NKMA 3VFTA 1LWRA 4M93C 5EUOE 5F89B 2E6PA 3ZYOA 4Z7WF 1RZGA 4LNRB 3VA2C 4CN4A 3OAZK 1FZOB 3TCLB 4PJDF 3MROA 1MRFH 4M6NH 4JG0L 4PRPA 4HX1B 1MFCL 2CKBL 3PQYB 4G6MH 3HAEA 5EOCH 3GJEB 3B2VH 3JV5A 3MV8A 5C0AB 4F57L 1QA9A 1Y6NR 2Q7YB 2R15A 1KB9K 3CLFL 4XPTL 4GRWH 3DGGA 2Z92B 1JPGB 2X4RB 2I9LB 1XMWA 4X6BB 2O5YL 2WMPA 3MJ9L 1F3RB 5KSVA 2QHRH 2HKFL 2AXFB 4JHZA 4PP2B 2AEPL 3LIZL 4PRIB 5FF6B 3NIGF 5IMLA 1KIRA 2JB5H 5IM7B 1VKXA 2BK8A 5FECA 1KJVB 2GJ6D 3UTOA 5HY9B 5DD0H 3VFRB 5L88H 1EH9A 3FMGH 2EDWA 4CN6A 2R56H 1XF4A 3HRPA 4LHQB 4ODVL 4O2EB 4ERSL 4X7TA 1BQHB 5IR1A 4D9LH 4GOSA 4TQEL 2APFA 3NZHL 3SKNB 3VW3L 4W6YB 5TH2A 2DLFH 4KK8C 1YYMH 4IOFD 4J3WA 3T0EB 3IDMB 5F9OH 5K93A 3THML 2XACC 5E99L 4LCCC 3UYOD 1LEIB 1P9MC 4W81A 4FXLA 1F6FB 3KDMB 3QIWD 5E8PB 1IKFL 3RL2B 4H5SA 3BO8A 5DMIH 3AMKA 4LKXB 4LEOB 1AI1H 4DK3A 1U8KA 1A6PA 2CRMA 2F53A 2FO4A 1A8JH 2APWA 3QCTH 1I1YB 2DKMA 1Z9OA 2NY4D 1JHKH 5F7FA 2QQQA 4HG4J 4UDUA 1ROWA 5AWNH 4GG6B 3CFBA 4XPGH 5DRZB 1FZMA 1ZVHA 4LVEA 1H3VA 1S5HA 3TIDA 3U1SL 3E0GA 1JZ2A 4BZ1L 1HE7A 3IAGC 1AIFB 1A02N 2ZCKL 2A73B 5EORL 4XCEB 2BVPB 3FT4A 5F1OB 5I1JL 1GXEA 5HPOA 1FG2A 4FQJH 1EJOH 3C5ZA 2VTFA 5F71A 4PJGF 3ULVH 3BDYH 4PJ5B 4NN5C 1D9KA 4YX2L 1FO0H 2V9QA 1GGCH 2AJVL 2OL3A 1CCZA 5SWQA 3VXNA 4BSVB 1WTLA 4PRNB 1KB5B 3FL7A 1OP5K 1MRCL 5AZEH 5E4EC 1U92B 3EO0A 1KPRB 5CEZD 3F8UB 5HHQB 4KZEH 4KRMB 2APBA 1AD9A 2AJZB 3FQRB 1LEGB 2OS7A 4R26L 3O11A 4Z8FH 4HKBA 4JDZA 3QXWA 5CKAA 2Y5TB 3WE6A 1MHEA 1CGXA 3PQYD 2NY6D 1EIBA 3DRTB 3HNVH 5D7IB 4YE4L 5DT1H 3DGCR 2F19H 4IS6A 1DQTA 3WUZA 3BXNB 3HG1B 3MRRB 1TDQA 3U4AA 4M4RA 4YDKL 4JKLA 4JZJC 3BH9A 3LPFA 4Z77A 1AQDB 3ZDZE 2NW2B 1ZGLA 4FTVB 4KK5D 2LVEA 2BSTB 2WBKA 4MNGE 2BCKA 4L3EA 4XXDB 4Y19B 2ZUWA 4WWKA 3VXTA 1MJ7H 3BQUB 1B0GB 2EYSA 4PRID 5GJTH 2X9XA 4ODWA 4JPWH 3HC3H 1RZ7L 5D2LE 4OCLC 1OB1A 3L3KB 3WD5H 2NXZB 4LHUB 1N64L 2YKLH 3QPQD 1WBXB 3BZ4A 1G9NC 2YC1B 4K3EL 1JK8B 1Z0MA 3HB3D 2X4NB 4EDXB 4NYLB 3LZFL 2IMNA 2ERJB 5DHVH 3MGTA 1CLZL 4M61A 3T0ED 3U7YL 4I77L 1FL6A 5CS7A 4K3HA 3PL6A 1HZHL 2UWEE 2X4TB 2AV7B 2XQYK 4X9BA 3ES6A 2JIXB 3L3HA 4G9FB 1PEZA 3C8KB 5J06A 2EO1A 4IRSA 2IANE 3UTPE 4LOUC 1V8HA 1JZ6A 1PW3A 1RK1B 4XPBH 4Z0XA 3RWCB 5JW4R 1J86A 3D3VA 3NCEB 3SE9H 1REIA 4OLWL 4G5ZL 1N4XL 3I75B 5EWIL 2DMKA 3N0PB 2V17H 3CFKA 1YECL 2VDOH 4KMTL 4KKBC 3RJDA 3BX7C 5EU7C 1KPUA 1KCVL 2V9RA 4ODTH 3WNNA 2AJUH 2J6EL 3BP4A 1F2XK 1R0AH 4PFEA 1QO3A 3SGDI 3HCVA 1BFSA 2G2RB 2ZG2A 4FQ1H 4HD9A 4U1LA 3I02B 3FRUB 4YK4B 3SY0A 1F8TL 1ZOXA 5CJXC 4PJ5D 5DR5L 4XNYL 3ISWA 4P3CL 1MFBH 4CRPA 2P5WE 4G7YL 1JPTH 4XCFH 3GJFH 1IGIL 2EO9A 2LFGA 3SGJA 1FBIH 4YXKL 5KSBF 1LEKA 3VMOA 5DJXA 5KANG 1WFNA 3SGDH 2NCMA 1DBAH 5BS0A 4JRXB 4TUOA 1KLGB 3CFEB 1Z9SA 4Q6IB 1JVKA 3UBXG 2FHCA 3MMEB 3PWPE 4YHOL 3O6FC 1XCQA 3ZKQD 4KJWC 4GRMB 2GHWB 5J12B 4TVPD 5FA4A 4QRSA 1MCWW 4DKFL 3LHPH 3QFJB 4QXWA 3HG1D 5JW4M 3MRMB 1LD9B 2DWEB 4J4PD 4ZTOL 3DO3A 3P73A 4QNPE 4OLXL 4XP5L 5D2LA 4FTVD 1M4KA 5FM5M 4M7JH 2E6QA 4FABL 2Z0BA 4L4TD 1S7VB 4Y19D 1KELL 5CP3A 1RZFL 3BQUD 1BWMA 1KYOK 1RFDL 4JN1H 5GGSY 4LQFH 1KBGH 4Y2OA 4AEHL 1W2KT 4S1SH 4D9RD 1EEYB 2MMXA 3PP4L 2NXZD 4LHUD 5I1DA 4PJEB 1BGXH 3BN9D 5IGXH 1N5YL 1G7IB 2EDDA 4LAQL 5CUSL 3BVNB 2UWEA 3VFVA 1KPVA 5SWSB 3RWIA 4Z78B 1G6VK 5ANME 1LE9B 2C1PB 5F7NC 3DYOA 3V4VL 4J2XA 4HEME 3LS4H 4Q9CA 3BW9A 2Q6WB 4OF8A 4P9HL 3I9GL 4U6HA 4KKLD 4DK6A 3MQIA 4OFYD 1GOFA 3QRFM 4M62L 2PYEE 1CDGA 2JIXD 4BA8A 5HGDA 1RD6A 2XY1A 3MNVB 5I8KH 1XF2A 3UBXI 4KVNL 3TNNA 5E2VH 4Z7VE 4P2RB 8FABA 1S7UA 3M07A 3OAYK 4M7ZB 1NBZA 5DJAB 1OPGH 1ORSA 1QSEA 5HHPB 4XP9H 3KPSE 5F89A 1CDCA 5JZ7C 4LNRA 2EC9U 1GC1C 1XGYL 3VXRE 5F72S 4D0CB 2VDML 4KQ4H 4OB5H 1NCWL 3GMMA 2R23A 1NDGB 4LLAA 1J10A 5ICZA 4E0RB 3QHZH 5GGTA 6CGTA 4PV8A 1NQBA 4HLZG 3P4OB 5J3HD 2EDYA 3KPPA 4X9GA 3MZTA 3ARRA 3GMPB 3T4AA 3TH2T 1ITBB 3GMRB 3T1FA 3HFML 1UH4A 3PWPA 1MREL 3MJ8A 4BK5A 3FZUC 5I19L 4EBQL 5J8OA 4JRXD 2DM3A 5ENWB 1VSCA 2E8ZA 2HJLB 2OTUA 2QQNH 3TYFA 2D7MA 3EYFA 5IEHA 4PP2A 2C7UB 5DWUH 1H5BB 5K9KB 4NP4L 3K1KC 4JM2B 1A7RH 2NZIA 4TPRL 4YBLB 3FQUA 3QEQE 3ARXA 4L8BB 9CGTA 1QFOA 3QFJD 5FYJL 4HG4K 2GCYA 1QSZA 2HA1A 4F3FA 2VAJA 2CDGB 1JE6A 2C4FU 3SDYL 4P4KA 1RIUH 4ZAKB 4EXKA 3F7YA 5BRZB 4NM8H 3BIKA 35C8H 5KG9B 5JOFB 2Y06H 2VSDA 4M7LH 2FEDD 5D7JC 3WJJC 4G6AD 4UT7H 3WN5C 1IM9B 1S3KL 2ARJQ 2JELH 1QLFA 1KACB 1J11A 4ZDHA 1MAKA 5EBLB 3GDBA 1P1ZA 2HAZA 1MHHB 3ARBB 3JTTA 3I3DA 5EOQH 3EFDL 5J1AB 1FNSH 5FDYA 2CRYA 3VGAB 3LKQB 4KV5E 5INDB 4YH6A 2EDKA 3RL2A 1BBJB 2E9WA 1IGML 5SWSD 3MOBH 4Y5VB 4RA0C 1CQKA 4DGIL 2OL3L 3KYKH 3UTSA 5JA9A 2ENYA 1MRDH 4P57B 1YQVL 3RTQA 1CE6B 3QA3A 1GGBH 1S7WA 3ARFA 1SYSA 4Z7VA 2IADA 3GSRA 5TJWK 1ZEAH 4POUB 2VITA 4Y4KC 5BV7H 1T5WA 1DANT 4ZO7A 4G6JH 1AIFA 4XWGL 3ILQD 1MCSA 1G9ML 3QDME 1ACYH 2EXWD 5B39B 3F7VA 5DJ0B 4HLZH 4P5KB 3VRJA 3LV3B 2J1KA 1A7NL 3O45B 1A14L 1N3NB 2XZCL 5J13C 4IEFB 4PJ7E 5TPWH 1U92A 4FQCH 4DGVH 3WXVL 4NJAL 3DROB 5GGVY 3FQRA 5IB1A 1LP9B 3VG0H 4N8CH 5GJSH 4XCNB 4ZQKA 3DVGA 3MOAL 4HKJB 3GRWH 4GSDL 5E8DL 4XXCC 4OLZL 2NX5B 3MRRA 2VLLB 1FNGA 3V6OE 2X4PB 3MNWA 3VFSB 4YUEH 1PFCA 5T3ZH 4LCWB 4HF5H 1ES0A 3HPJA 5BVJA 3VXOA 2FWOA 4FTVA 4G43A 3QO0A 4IHOB 5MHSE 4XPFL 4L4TA 3GKWL 1IC5H 1DUZA 2AABL 3GBNH 3P40A 1F3DH 1CE1L 5TE4H 4EI5D 4JM2D 3ULUC 5IB5B 4M6ML 3WS6A 3QT2A 1V3LA 1HNGA 4OD2A 5BZWB 3CSGA 2OR9H 1F4WL 1KEMH 1CF8H 4KRPC 3JVGC 5CJOL 4XP1H 2G75B 2NXYC 1C5DB 3EDKA 2Z91B 2F15A 2YC1A 5BRZD 1PAMA 2EC8A 4PJ9B 3IJHB 2VIRB 4RAUA 4EDXA 1QOKA 5I30L 3TVMD 3OKYA 4CVUA 4QHUB 4NQCE 4R4ND 5C86A 4KMQA 4HH9B 3IDJA 1DN2A 4HDIB 4OFYA 4UIMB 3ARBD 3P4MB 2AV7A 3GO1H 2GW5A 2Y72A 5SV4A 3HNSH 4CADB 3WIIH 2VN7A 3CIQA 2FJHB 4X6DA 4Z95H 4XGZB 2FB4L 4QHNB 5HDBF 4NHUA 5FUOH 1IGJA 4WI6A 1P53A 5C70A 4JQXA 1R24A 2NNAA 4F2MA 4PJBB 3T4YB 1U36A 1UCBL 4JCLA 4TRPH 4NNXA 4KKCD 1JTPA 3L3IB 3L95A 1H8SA 3IXAB 4I1NB 1CG9B 5L8KB 1NL0L 2G2RA 3PABB 1FO0B 5MENA 4PRHB 1F58L 4EOWL 1IAOB 3QEHB 4O2CA 1G1CA 2OJZL 4JKPL 3EFFA 5ISZE 4C4KT 1HHHB 1LILA 3TPUB 4D0DB 5JXEC 4XVSL 5I17B 1E6OH 1UM6H 2R4SH 4NO0B 2HYMA 2ILLA 4KC3B 2NTFB 2KDGA 3SDCA 3BPLC 3DPBA 1LO0H 4GAGH 3EOTL 4GG6F 3I3EA 3CFEA 1ZLSH 4QWWC 1ZMYA 1YEHH 4R90L 4OZIB 3C08H 3SKJH 1I7ZB 2DBLH 2AJSH 2EYTB 5EPMA 2HFFB 4XNZB 4UTBH 4MJIB 1TXKA 5IWLC 3DUUB 2R2EB 2NX5D 4DGYH 3OKOA 3LB6C 2GSGB 5IVZB 5B38B 2VDKH 4U7SA 2QKIA 1WLHA 4AMKL 5L9DL 2FNBA 4FZ8H 3WMSA 4TUKH 2MQCA 2YA1A 1I9RL 4U6VH 3H7BA 2ADGA 5I18H 4ZNEE 2OSLA 4I3RL 3RIAK 4MDJB 4PV9B 1N6QH 1JBJA 1S7RA 4YZFF 1JRHL 1FV1A 3QJHB 1K4DA 5D7IF 4DZBB 1OAQH 1KEGL 1DBJL 2J4WH 5H35A 4NQCA 2OXHA 5DHVB 1G7IA 5I15H 1BFOA 1J05A 2WINB 4A6YA 1HYSC 3QEGH 5SWSA 2R1YA 4PJ9D 2UZYB 4M5ZH 5KVFL 4QXTB 4G8GE 1NC2B 1U8NB 1Z9LA 2F8VA 4RX4A 2AEWA 3FRPA 3S4SA 1JTTA 3JUZA 1X5ZA 5FYKE 2A6IA 2CXKA 1YNTB 5FA3B 2OI9C 1CLOH 4PB9L 2RGSA 1HXMB 3B3IA 3FOMB 1ZGLM 5KVDH 1RURH 3RNQB 5FO8B 2KPNA 4P9ML 5L8LB 4PJXE 2XQBL 1A5FL 4R3SB 2ADJB 2FECL 1ZT7A 3V8OA 2H1PH 2CRZA 3B2UD 3L5WA 4S1DC 5ESVA 5D2NB 3IU4H 3RRQA 4NWTH 4HJJL 2VB5A 3O6KH 1JNLH 3KXFE 2BNRE 1U8HA 3CGTA 1CR9H 1J0JA 1TIUA 1HDMA 1IC4H 2LABA 4C56E 1DVFA 3W9EB 5DD3L 1JF5A 1TZIB 3GZKA 3C6LA 1K8IA 1JZ8A 4U1SB 3OHXA 4KHTH 3HZVA 2DTML 2CXGA 1DQJA 5JPMA 5T1MB 1NEZB 1NDGA 1TPXC 1JCKA 3ARWA 3GJFB 3B5HA 2E6JA 3D1MC 2RAMA 3E2HB 3MLPA 3N1FC 3OL2A 4HUWA 4NO0D 3DTXA 1T20A 3KVQA 1YEKH 3MLYL 1AJ7H 1G7JA 3NTCL 1D5ZB 1NGWB 3VDAA 3RGVD 4K7PX 4L5FH 3PJSB 5DF0A 1ZKAA 4QRQA 1YEDA 1NLBH 5EIVA 1MHPL 1UYWL 5ENWA 3U0TB 2A2QT 2DQDL 3OV6A 4KROB 4UDTB 1G7QB 4LGSB 4EI5A 1MI5A 5C8JA 2YD8A 3OAUH 3D48R 3KYOA 1AGFB 1LDSA 2OQJA 3P11L 3TNMB 2D7OA 2VABB 3BYTA 3IFOB 5GRVL 1F02I 4CMHB 4CW1A 2NY0C 1L6ZA 4KK6D 4EJ1C 4U1MA 5BRZA 4FFYH 3ZKNC 3QNXA 4BYHA 5JOFA 1FAIL 3IVKB 2CMRL 4PJHA 1FH5L 1JL8A 1Q38A 2VERN 3NFSL 3TVMA 1X5FA 2B4CC 4ISVB 1WCBB 5DTFB 5DQ9A 4E41D 4OKDA 4G8GA 4WGWB 1QD0A 4LP4A 2XNAB 1M6OB 1V7ML 4N5UA 3TZVA 1TTUA 5INDA 1NCDL 3S4SG 3H9SE 5C3TA 4N1HB 5D7SL 1H3GA 1XGQA 4KJYB 2XN9A 3EHBC 4O4YH 1S8DB 4H1LA 1AC6A 4LK4A 4AM0A 5H2BA 1PYWB 1NC2D 3H9YA 4J8RA 2H8PA 2YD4A 3STZA 3DI2B 3U9PL 1A7OL 3G6JA 4HFUH 4UILH 1SJVA 1CE6A 4LP5A 5EUOB 4MGXA 1T0NA 2D31B 5ALCH 3SE4C 3BKCH 4MQTB 4PG2C 4Z7NF 1RMFH 1KXTB 2FD6H 4JFQB 5FKPB 4KDVA 1NFDE 3BRGC 2E5EA 2XWBA 4NNPH 4JFOB 4YGVB 4B7IA 4PJEF 2WP3O 3N1MC 4MLSA 4Y0GA 3BGMA 3QAZC 3FO0L 4LLUA 4P46C 4TVPL 4LSRH 4LF3B 1L7IH 1TVBB 1T04B 4M43H 4P23C 4JFYB 4XNXH 3RUGE 4HK0A 1GAFH 3AY4A 5C0ND 2DIAA 2V2WB 1XZ0B 3MFGB 4LCIL 1ZGLP 3ZTNH 3W11D 1IARB 3UBXB 1DBBL 1LDPL 4H20L 4U1IA 3AXLB 2IQ9L 4OM0H 3G5XA 3N50A 2ZP0T 4L4VE 5GZOC 4XCNA 4OV6F 2R0KL 2ICCA 3KYNA 2IBGA 5CJBA 2EDTA 4HC1H 5HYSB 1PLGH 1B3JA 4P2QD 2BOBA 1JWSA 2VDPL 4MA8H 5IBUG 1CT8B 2H45A 1S9XB 2IPKA 2C3HA 5FV1L 1NMCC 3I50L 4XPAL 4XVJL 1FNEB 1WITA 4PGDA 3L3OA 4Y16B 3MLUL 3U9UB 1MWAA 2HH0H 5GHWH 3VE0A 4P5TD 4LLMA 1RHHB 1I3VA 1MAML 4KROD 5KOMC 1RUPL 2DMBA 3KYMB 5AG8A 3JWNC 1HN1A 1K8DB 2BP3A 3IDXH 3NVQA 1CXKA 4JANA 1RK0A 4NZTH 5DUPL 5E03A 1EMTL 2VYRE 1TQBB 3CU1A 4JN2B 3HE7A 4RGOH 5IK3B 5EB9A 3ZKMC 3CSYA 3QXDB 4PLJD 1EHXA 4ZS7H 5I8EB 2Z91A 3MLVL 5DVLA 3V8CA 2OYPA 4KRLB 3SJVA 1AD0A 4PJ9A 3TN0C 1MUJB 2VIRA 5HYJD 5H8DA 1FL5A 5E94A 2XRAL 5CINH 5C9KA 1FN4B 1HQ4A 3CFCH 4X7EC 5ADOL 3K0WA 3O9WB 4JM2F 2WIIB 1CXHA 1I8IA 4UIMA 1PKQA 1WZKA 4H1LG 2E7HA 2F54E 5CGYC 5FFLA 3M8OL 1KG0B 1K85A 4XRCB 5E2UH 4K7PL 3P0VH 3W2DH 3W81A 4DQOL 1QVOB 4NPYB 2WWKT 3UPRB 4GG8A 5A1AA 5BV7B 4FFWD 3VXSE 5EFIA 5F9AC 2XA8L 3MRJA 1BVLA 4FZEL 4HHAA 4F9PA 5TFSH 1IT9L 4NN6C 5DZOA 3SKMB 3DSFH 2FRGP 2MCPL 5GRUL 1I3GL 1IM3A 4XMKL 3QP3A 1T1YA 2PO6D 2LAAA 4LBEA 3VGGA 3S5LB 3P0YH 4Y2DB 4HWEH 3F65A 1G0XA 3OB0K 4NO0A 1A6UL 3GI9H 2AXJA 3E8UL 3BHBA 4HW6A 4NZUH 2FL5A 2JJUA 3RGVA 5ID1B 2FZ3A 3MRPB 1MCKA 3BP5B 3WHXB 1DQMH 3FQNA 3MO1A 3T1WA 2ICEB 2QQKH 3MA9H 3FB5B 4HIEB 3KLDA 5GRZA 2AK1H 5KVEH 4P3WA 5AD0A 1FRGH 1S5IL 2HFFA 3K4ZA 4NBXB 5DVKA 5CD3A 5KBNC 5ESQB 3RGHA 2FYYB 5D9SB 1CD8A 2VWEE 2Z8WC 5EO1B 3NA9L 4KI5C 1UM5L 1Z5LA 3JWDH 5FGCE 1EAPB 1VGEL 5BXFA 5IVZA 4PGEA 3WFEH 4ZFGH 4Y16D 5DFWH 2V7NB 2W9DL 1U8LA 1AHWA 4LKCB 4M6AA 3VWJA 4LCUA 1QG3A 2OZ4A 1UKSA 3NFPA 4N0FA 3SE8L 1LP9F 1MLBA 5EDXA 1Y18B 4MX7A 5I75B 5FYKH 4E41A 1INDH 1DE4A 2Y36L 4W6XB 5KVGL 4GRWF 4JKWA 2IANB 3RWGB 4J23A 5HGGS 3WO3B 1SMAA 4LQ1A 3BE1L 1DQDH 1DANU 3MGOB 1CFNA 4EN3C 5K9JL 5IBTH 1CFBA 5D1QA 4HUVA 3ILPB 1BP3B 3ZE1F 5GS0H 3T0VA 3O9WD 5IVXE 4FNLH 4X6CA 4BZYA 1I8KA 1MFDH 5I8OH 1MJ8H 3QNZA 3X13A 4FQIL 1LK2B 5TE7H 3VXSA 5IV2B 4MS8C 4UOJA 3BEWA 5KS9E 3MLTA 1UC6A 4EUPH 5I71C 4MSWB 2P5WB 5E95B 5D2NA 5CEYA 3H9HB 5AZ2H 2ZWLT 1MFEL 1G84A 1RZKH 2WNGA 2DI8A 7FABL 2KH2B 5IJKA 2BVYA 3PWJB 5JLZA 1YPZE 3O6LL 2B20A 2YSSB 4OD1L 3W9EA 3S37H 4RRPA 4FXKA 3RU8L 2EIZA 3NOIA 5IB4A 3DX8B 4JZOB 4LIQH 5H37G 5DS8A 3HN3A 4MD4A 3RVVD 4GBXC 1L4IA 5FUZL 1A4KA 1E28B 1OF2B 2DD8L 3DRQB 1NKRA 1IAII 3LY6A 4Y2DD 1B9ZA 3P0GB 1YZZA 4HUXB 4D94A 2F58L 5F70A 5ID0A 3IDUA 5D1ZD 3K74B 2NY2D 4P2QA 5JHLH 4KHXL 2HWZH 3D39E 4Q9BA 1N8ZB 1Q9OB 2H3NA 4PJBF 1NGWA 4YWGH 3DI3B 3QDGE 1UM4H 2CR6A 1JYWA 2SEBB 1X5IA 3FQWA 5EO9B 4JO4L 1A6VL 1FIGH 4P5TA 2VDLL 3N06B 1U58A 3ULVF 4ETYA 3S6CA 1IAIH 3OPZL 4K2UH 3F7PC 1JPFA 2R9HC 4F7EB 3LKRB 3TO4B 1CVSC 3AU1A 4R97C 3WIHA 3ROLB 1D6VL 5T3ZD 1N59B 3RZCB 3U2SB 4M3KB 5JXAH 1KV3A 1RUKH 2X4UA 4P48A 4OV5B 2P4AB 1XCTB 1QZ1A 2BMKA 3K7UA 2AJXL 3IFPA 1AGDA 1YEJL 2HJFB 3U0WH 5ANMB 4YQXL 2MPAH 5HYJA 4RFNC 3IAPA 5AG9A 4OZIF 3PNWB 3QCVL 1SJHA 5I1AA 4XCYA 1KFAL 1AY1L 4ODSH 1AR1C 1I7TA 4D9QD 1SJEB 4QRTB 5DJCB 3VD3A 2EH7L 1WSST 2GK0B 3UTPD 2QBWA 2YRZA 1OAUH 3RFZC 4PPTA 4OTXL 5E5MA 5J6GB 4TYUA 4I4WB 5E56A 4MCZB 1GGUA 4JQVC 4XH2A 3MCKB 1ITCA 4PREB 1YDPA 4OGAC 4YIQB 3DECA 2EDQA 1MJUH 3BEVB 3IDYB 3KPSB 4OI9A 4JFDD 1RZIA 4U2ZA 5FKAB 1BX2A 4O58H 1QTYT 4EI6B 4JB9H 1ZTXH 2FIRT 4HIJA 1KCSH 4F37K 2DKUA 5J56B 4QKXB 1BQLH 1EBPA 2RFXB 2ZG1A 4OF6A 4NO3A 4ZUSA 5DK2A 3TO2A 1G7MA 5H37H 2OP4L 2DQGH 2PO6A 3QQ9D 5DSCB 4RRPG 2MHAB 4OCXH 2YBRB 4QRPB 1G6RH 2YD3A 1XGUB 4PJCB 3T2QA 1A1MA 4X9IA 5E0QA 2QHRL 1MWAL 4ZUUB 1T5XA 4AENA 5F88A 3H0TB 4KK9D 5ESAA 2ARJA 5IIEB 5DD0L 5L88L 4G8IB 1X44A 2ITCB 2G9HB 3QDGA 2UZIL 3QEQB 3M17B 1EEZA 2ZUQB 4H26B 4WEBH 5C0DA 1BJ8A 1JFQH 3O2WL 2PR4H 4KK8D 1IGCL 4OZGF 4WNQB 2X4SA 3B6SA 4JFZH 4OIBA 2BJMH 5TGBB 1J18A 3PWNB 4LEXH 6FABH 1Q0XH 4C57C 1EDQA 2NY3C 4R6UA 5ACLA 4MNHA 1TJGH 5D6CB 2GYSA 1MHCA 2VC2H 3RDTC 5AUMB 1V7NL 5SX5K 2WW8A 3RZCD 4RMTA 3MBED 1CDBA 3U30B 1TENA 5DVOA 4F7PA 5MI0B 3IKCB 3RVTC 1NAMH 2W38A 3GNMH 5DFVD 2J88H 5CLWA 1U3HB 1XGRB 3T04D 4XPGL 5F1NB 2VDQL 3X17A 1EXUA 1CD1A 1ZVSA 2XFXA 2GFBA 1DEEA 2HN7B 4HFWA 1R3JB 3AS0A 1HHGB 3JV6B 1UH3A 1MFNA 2NLJB 2YUXA 1WJ3A 5D5MB 1X7QB 4K8RH 2QSQA 1KG0A 4AY0A 4MAYA 3QDMB 4XVUC 4Z0BL 1YMMD 1RZJC 1JPSL 4ZODA 3GMOB 4DN3L 4PR5A 5C09A 3ELAT 4IM8A 3GB7A 3DYMA 1A0QH 2R29H 3KPSD 3GSUA 3O2VL 4PJ7B 4Y1AA 2ORBL 2FBJH 3UJIL 1HHJA 4RFEA 3RL1B 5IFAH 1I1AC 3SCMB 3NACH 2AQ1A 4PGBA 4H88L 1WBYB 5EU4B 2R2CA 1N5AB 2ZG3A 5F7WC 4WI8A 5F9WB 2MNUA 3A67H 2I07A 1L7TH 3MRLB 2F19L 1DN0A 3SDAA 5BMFH 5IP4A 1BZQK 4LVNB 3LQZA 3OKNB 1I7RA 3HC0B 1MCCA 5D1ZA 1OWWA 5EZOH 3RBGA 1JHTA 2IPTL 4QRPD 4YO0A 4CVXA 5MEOB 1BZ7A 2HT4C 3RWHB 1MJ7L 5DJ8B 5FOBB 5EUOF 5DUML 1A6AB 3BISA 1S9VB 4PP1D 4ONHA 4FMFA 5JHDB 3D18B 2OZ4L 3L3DA 2ICWJ 1CFSA 4OKVA 4M02A 3WD5L 1KJ3H 2GEEA 4JY5L 1JWMB 3NGBB 1DEDA 4HIIA 4QF1B 3ZT7A 4ACPA 1XIWA 1MH5B 4IMLA 3QULB 1QSFE 1PGRB 4FFVC 5IW3A 4YHZL 1GHFL 4GO6B 2X4QB 1U8JA 1CDIA 2FX7H 4PS4L 3LKOA 2VE6B 1FFNA 3ARZA 3BD3A 3SDDC 3KNBB 1ZLWK 4JJHA 1OM3L 1R3HA 4GT7A 4NKIL 1S7TB 3HE6C 2Q86A 5D1XB 3BAEH 3VRLF 1IGFL 1QR4A 3GSWB 3O8XA 4Y5YB 4A2LA 3UDWA 2V17L 4Z7UE 5KZCB 4J3TA 1YY9C 15C8L 1EFXA 3VGFA 4R7NB 4PBVC 5GS1A 2AQ2A 5A3IC 5CWSB 4JM4L 1R0AL 3CVHH 5FDWA 4QTHB 1IC1A 1MAJA 3PWLA 3EJJX 1RJZA 3BFOA 5D96C 3FO9A 2DIJA 4JFDA 1NBYA 1QEWB 5CCKH 3C5ZC 4PY7A 3QR2A 2EEBA 2HJKB 3V6ZB 3GMLA 1CDYA 2PNDA 2XQYG 1HOCA 3QDMD 2K3TA 1FBIL 1ZLVH 5ISZB 3RX5A 3EYSH 4AIZB 3H9HA 3MV9D 3UMTA 2P7TB 2GJJA 2D0FA 4RQQB 3PWJA 4LCYA 5D7LA 2DWDA 4DN4L 1DQLL 4XZUA 1L0YA 4MWFB 2VQ1B 3QI9C 3DVNA 1D5BA 3IT8D 3CZFA 4KJQC 3PF2A 4HS8L 4GRLB 3JWOH 1EBAA 5GRJH 2HG5A 2EDRA 5HHOA 2NPLX 1JZ3A 2EE2A 3BKMH 4U3XA 1HH6B 3DRQA 1ZHKB 3WIHL 5F6HI 1P6FA 3MZGB 2DN7A 2PW1B 2M26A 1II4E 3X3FL 3MSPA 3QH3A 4JPIB 4TUJB 4D0BA 4RGNC 3VG9B 1CTNA 4WFEE 1QFWI 3RWDB 3GBML 4IJ3B 5LCVL 2YWZA 1W0YT 4WWKC 3LSOB 3VD7A 1RZ8B 1S9YB 1KBGL 4LCCA 3TYGL 5JHDD 4NRYB 3UJJL 2ATPB 1WFTA 1P9MA 3UPAA 4MHHG 3MRHA 4HS3B 4F7EA 2YPVL 2ZOLB 5IGXL 3HPLA 4HWZB 3WFDH 5I0ZA 1JWUB 4ZD3H 4GQ9L 4RSVA 4Z5RB 2DQEL 3RZCA 3GMQA 4XAWL 3MBEA 5L7XH 1QFWH 1JGDA 4F80A 5LJYH 4OV5A 1XCTA 4KUCD 1WC7A 5ECJE 4JO3H 1U8MA 4OQTA 1HHKA 5C3LD 1TZGH 3ZDZF 1R5WB 1F00I 3FOLA 3JTSB 4DW2H 2P24B 1R5VB 5IBLD 2DM2A 4GLRI 2QADC 3G6DL 2UYLB 1FPTL 1YJDC 4NN7B 5D1XD 5EU7E 1DLHA 5SX5H 5L6YH 1BZ9A 4IRSC 2RB8A 4M8QB 2GK0A 4ZS6C 4PJXB 3RBSA 5B8CC 2LVCA 3UAJC 5KZCD 2CJUH 1JGUH 1DQQA 4H25A 4MNQE 2B5IB 1YMMA 5I1KL 4WI4A 1QP1A 3JSSA 4DTGL 1T66D 4OLYL 3CDCA 1MY7A 5FYLH 4GLRH 1JGEA 3ARGB 3KXFB 2BNRB 2AERT 3QO1B 4QHMB 1KN2L 1IBGH 4OM1L 5J9PB 1D5XA 4KQ4L 4OB5L 8CGTA 4F7CA 4C56B 3D5OF 2VAAB 5FKAA 3ZKXB 4ESKA 1BFVL 4Q9RH 2UUDK 3MRFB 4I9WE 4U1JB 1CGYA 4EUPB 2DLEA 3Q6FA 3CDGB 2R2HA 2WBJB 3G5YA 1HIML 3NCMA 3CMOH 5ISZD 1KC5H 3MV01 5F9DC 3SGJC 1U8PA 1GYAA 3BPOB 1C5BL 2MHAA 4X5XA 5JIHA 5J11B 3LEXA 1S7QB 4BQBA 1KIQB 2YBRA 3FFCE 4WFFE 2NY1B 2PN5A 2GSIB 1NCCL 1ZA6A 1OT2A 2HLAB 2EDOA 4QXGH 5DWUL 1YNLL 4LSPH 4GRLD 2R0WH 1SBBA 3H0TA 3NCJH 5KN5A 5L2KE 4NO5A 4ETQB 2OTWA 1FJ1A 2W1NA 2XT1B 3BWUC 3TBVB 4PJ8B 3LOWA 4PY8I 1CDUA 4MB4A 2XPGB 5I8CA 2Q20A 5TQ2H 1NGPL 1CGSH 5INCB 5D7JD 1UJ3A 1U42A 1CGWA 2HRLA 3NZ8A 5IEKA 3KPRE 2RCSL 5D93B 4Y88A 1HEZA 3C60D 3Q5YA 4IOFC 1CL7L 2DLGA 2A1WL 43C9B 3LD8C 3OR7A 5CZVL 1WQVT 5EOQL 4ZO9A 1OTSD 3LKPB 1T03L 4XNUH 4Y5XB 3CZJA 3MUGA 4WY7H 4ONFH 2IFFL 3ECBA 3QIWC 3PP3K 4BH8B 1F2QA 5I74C 3QHFH 4KKNA 4P2CG 4NQXB 4AT6B 1VACA 2BFVH 3F5WB 2NY4C 4N0YH 5H94A 3FB8A 1KCUH 5DLML 3A0OA 3J7HA 3D0LA 4G6JL 5I6XC 3S8WA 4MNQA 2DIBA 1EK3A 3EYOA 4J6RH 3HMXH 5HHME 3ZLQC 3GBLA 3HKFA 5C0IA 4N1CA 1X7QA 5GGUA 5F7EH 4K94C 1H0DB 4X4YB 1ZHNA 3IB4A 3RUGB 5JUEH 2B0SL 2DQCH 5GS0D 4JKKA 3DMMB 4NUGL 5TDNB 3ARGD 1PX3A 3KXFD 3MV9A 1JZ4A 4AQOA 4R4BA 3TCXA 2BHUA 1FORL 2HT2D 4NQSA 3O6FA 4NKDB 5DD1L 1YEEH 1ZHLA 2VUYA 3FN0L 5LWYL 1SBSL 1KSRA 5JNYA 3NPZB 4TNVF 1IFHH 3AB0B 4S1QH 5TDOA 5J1TC 2WUCH 4Q0XH 3EOAB 4KJPD 2WBJD 4L4VB 3CFJA 5HI5D 5B3JE 2NY6C 1KIPB 1IEHA 4OJFH 5HTSA 1G6RB 3FONA 1FSKB 1C12B 1R3LB 2XKNB 3RHWK 1RU9H 5T3ZL 1S7XB 1QRND 2HFGL 3VFPB 4OCWH 2ZPKH 4CU7A 1FVDB 1UXSB 3T3ME 1MCFA 2AI0L 2NY1D 2NY5L 4GXUM 1IC5L 2PF6A 4KK5C 2NQCA 4KUZH 3ULUD 2DQUL 3O4OB 1SY6H 1S9VA 2DM7A 4NT6A 2EZ0D 4J7RA 4LSUH 5T1DH 5JHDA 5E2TL 3X12A 4KRPD 3NCYP 4X7SL 1ZWIA 1J1PH 3WLBB 4XNMA 1AQKH 4ODBD 1I1RA 3KPRA 1TLKA 2QTEA 2H6PA 3AS1A 3MLRL 2DAVA 3K80A 3QPQC 1KCKA 1BBDH 2ADFL 2X89A 4QRUB 4JO1H 2X5PA 3SKUD 4JPKH 1I9IH 3HB3C 1P6AB 2QLVB 4PJCF 4BK4A 4ELME 5CIPH 2PYFB 4GMTL 1TVDA 4PG9A 3IETA 3T0EC 4YAQB 2G5BB 5T1LA 5EO0B 1HCVA 3WIIL 1BEYH 5DA0B 3L5XH 3MXWH 4PRBA 2V7HA 5GGVH 3LKSB 1M71A 4Z95L 5EU6E 3Q6GH 2GI7A 1NAMB 5CP7A 1UVQA 2F54B 1KULA 1RIVH 4R7DB 3MGAA 2EIDA 4ZFFB 5I2IA 4WW2B 5LGKA 3DETD 2W0LA 2C4XA 3PHOA 2V5MA 2EDXA 1TZHB 4PD4J 3PHSA 4L8SA 4MD0A 1VFAA 2YD7A 2VZOA 3BKYH 1DL7H 4N5ED 5FUCC 5C71A 4LVOB 4G8FA 5E00B 1EO7A 4JFEE 2MWCA 4HGKC 2C3VA 3HMWL 4NKQB 3O2DA 4KV5F 4TTDD 4BFEA 3DX6B 4X83A 1SYVB 4B53A 1CU4L 1ULVA 1LNUA 3DJ9A 5ADPH 3DMMD 3L9RA 1Q9KB 2JB6A 2P7TA 5EU5A 3G04A 3LMJL 4U49A 3CXDL 4AK1A 3QQNA 3VH8A 4IIQB 12E8H 3INUH 1Q72L 2RBLA 4NKOB 1CXIA 1Q9WA 2P8LB 5D5MF 5HHNA 1RUML 1QKZH 1UQSA 1U8IB 3OXRB 5E8OB 3DVFA 3SN6N 4MQ7B 2VLKE 4I18B 5LXGH 5I1HH 4M1DL 4Z7OE 4O00A 3HZMA 4FZ8L 4PJFA 5EA0L 2J8HA 5HI3C 4J4PC 5D7JA 2I9TB 3REVA 4S2SB 3CVIL 5HDQH 3WJJA 3WN5A 4HIXL 1YYLH 4PJ7F 1T6WA 2CK2A 5EBGA 2VLME 3C60A 1DLFL 1T1WB 1RZ8A 3BQUC 1XH3A 4ALAL 1N6QL 4X80L 4NRYA 2VZ1A 1PY4A 3RX7A 3EDDA 2YD6A 3ZTJG 2KBGA 3QXAB 3KJ6H 3X14B 4X99A 2Q8BH 3S35L 2NXZC 1BOGA 4FQHB 3BN9C 4L3CB 2VLRE 2Z8SA 3PDOA 2CIIA 1PX4A 4GXVH 1W8NA 3OWEA 4Y4HB 2ERJC 1QLRB 4JDVA 4PRAB 2IAMB 3W39A 4QRRE 4ZFOA 4FQ2L 4JPVL 1Q8MA 3QJFB 3F7QA 4LPTA 1CZ8L 3PV6B 5GGQL 3KPMA 2P24A 1R5VA 2B2XL 4I5BA 3MREA 4P2OB 4JQIL 5KVDL 5IVXB 1T7WA 2UYLA 1AO7A 1IAMA 3W0WA 5DEGB 5FXCH 2H1PL 3IU3B 4YHNA 4M8QA 5GRXG 4OZFG 2WANA 4NQVB 3GI8L 4JQXC 2VXSL 3O6KL 3CVHB 4CAGA 5C2BL 3Q3GA 5DJZB 3BGFB 4KUCF 1CR9L 2VLJE 1NSNH 1Q0YL 4K3JL 5C08B 2ICWI 3DV4B 4XWOD 4W68A 3E6HA 4EVNA 5JW3H 4QHMA 3KLAA 2VO5A 1YPZB