4OUUA

Anti-mt1-mmp monoclonal antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVGLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti_MT1-MMP Heavy chain
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 47
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuA01
5DVMA 2PYFB 2MTPA 1A3LH 4L4JA 4P5MA 2DBLL 3DVNB 4Z7NF 4WCYH 1RZJL 3OHXA 2VQUA 4X80L 5IMKB 3PWNB 1JGVH 4R90H 4ZO6A 5IQ9B 3DARA 2JJUA 4TULL 5CD3A 1MQKL 4RRPG 3NPSC 3WN5A 4OD1H 1YEDA 3B5GA 2X7LB 5D1QD 4P23D 1UH3A 4RGMC 4HJJH 2KH2B 3VGBA 3LKPA 2NTFB 4TQEH 4LFHG 2J4WH 2GUOB 1ZV5A 2VZSA 2VABB 4GRWE 3WDHA 2IAMB 4X9GA 2ORBH 4GO6B 4JZNA 2ENYA 4Q6IC 4TSCL 4YXKH 4DGIH 5DA4A 4OCYH 4G43A 4RWYH 3B9KB 1YN6A 5GSRA 2E7MA 1MJJA 1RIHH 3TBTA 4S1QH 1E6OH 4KTEL 5EZOL 3S3SA 2X70A 3VFRA 1DQJB 1SBBA 4G6MH 4B53A 1CK0L 2DDQH 4XHJD 1HKLL 1BF8A 2YA2A 3GBNH 1RZJC 4NDMA 5JDSB 5F7DA 4M9OA 4OSUL 2I5YH 3TYGH 5DJ0B 4M1GH 4G5ZL 2DKMA 1LILA 3UJIH 4OFYA 2F54E 4P2RE 4PRPA 1G7JA 5EU6E 5IFAL 4DGVL 1ZVYA 4KHTH 5I75C 5IB1B 1FL3B 3RTQD 4F9LA 2BNQA 1CGXA 4HWZB 4OLXL 1IGCH 4HUXA 4YPGB 4AJ0A 1OGTB 1PKQE 4L9DA 4FQXB 2I60H 2A1WL 3VFUB 3MFFA 5AYUL 3RA7H 4WI5A 3D25A 2FIKB 1BFVH 1L0YA 1A14L 3PV6B 3C60A 5AAMA 1ZGLM 3IU3A 4YHIB 1DBJH 2JB5H 1HEZA 2OS7A 2L7JA 1T5WB 4MJIB 4OV6F 2V5MA 1D3CA 1X5IA 1KIQB 4L4TD 4Y2DA 3C9NA 1GPOH 3MUJA 1OHQA 1V7MH 2AJVH 1TNMA 4HUUB 5DJ6A 5KSUB 1L7IL 1QG3A 1IC5H 4HT1H 2HH0L 4NQCB 3V95A 4QTIL 4ZOCA 5DC9B 4JGUA 4I2XE 3VD9A 2K7PA 4TUKH 1OAQH 1O7SA 2R0LH 3BX7C 4UOJA 4ZTPL 4GKZB 3MGTA 1ZEAH 5F1NB 4Y16B 3MXVH 4J3OC 3GSRA 1F3JA 1A3RL 2IALB 2MPAL 4J7RA 1ZLSL 4K3DL 4R4BA 4PRIA 5EH1A 5F71A 4RNRA 3TBVA 1ETZB 3VXSB 2HLAB 3IJSB 3KHQA 4HLZG 1R3LB 5MEQA 1TFHA 5JMRA 5ID0B 1I3UA 1S7UA 1IM9B 3QI9B 2I24N 4HULB 1CDGA 3L3DB 1IEHA 3RWDB 3SDAA 3HC4H 4KPHL 5IB2B 1CBVL 5EG6C 4N90D 3P30L 1YQVH 4Z0XA 1OAZH 2GJJA 3PWLA 3L7FA 2BHYA 2Y07H 4JPWL 1J1OH 3IDGB 3SE9L 2B0SH 1VCAA 2H45A 4QHNA 4YIQB 1F6FB 3BZFA 1NFIA 2YZ1A 5JIKA 4PJ5D 3OL2A 3QULA 2O5YL 4WVRA 1HHGA 2A83A 4HAGA 1AXTL 4LLYB 2XA8L 4EIGB 4WGWB 1HH9B 4CNIB 1SJEB 3QYCA 3PDDA 4FQXC 1HXYA 1UZ6F 3U9UB 2VLKA 4LEXL 3PV7A 1C7TA 4PREB 5I1EL 3F6LA 1J10A 2GTWA 2VDQH 2VC2L 1CN4A 2FX9H 5ADOL 4R26L 5I19L 1A6VL 4PJDF 1AJ7H 1XF4B 1Y0LB 3QG6A 3LHPL 3VFWB 2JK5A 4RGNB 4PD4J 4XCNB 2X4PB 2P5WA 2E27H 1J9CT 4BFGA 6FABH 1M71A 1QRKA 4QNPE 3EJJX 3GEWB 1CS6A 2EE3A 1JPTH 4GKSB 4Y16C 4KI5F 3V5KA 1QLEH 4AG4L 1N26A 1U3YA 5C8JB 1P2CB 1MJ8H 5E2UL 1FL6A 4JFZL 2YD7A 5T3XD 3WXWH 3JZ7A 3ILQD 3GSQA 1L6ZA 1K2DB 1KCLA 3IYLW 4P59H 4PYGA 5LKNA 1XMWA 3BGFB 4HKJA 3MA7B 3U30B 2X4QB 1DN2A 3QI9C 1RQ5A 3MLWH 2XFXB 2DI7A 3BI9X 2VAAB 2UY7A 4OIIH 3EYSH 3J7HA 3UTTE 3HAEH 3TPKA 4Z77A 2Q86A 1KJ2H 2GITB 1MF2L 1OAKH 1ONQA 1OW0A 3ZE0E 4M4PA 4J2XA 2ZCLL 3PWPE 4PJIE 3WMSA 1IGIL 3PGFL 2VQ1B 3GNML 4XVJL 3WHXA 1EHLL 1A64A 4FN0A 4OLUH 4V1DA 3RFZC 3G6JA 3WFHB 2D7TH 4OD3L 1KCUL 4R4FH 4PYHA 3E1F1 4JFPA 1YMHB 1NL0H 4KJYB 4ZS7L 2CKNA 3LV3A 3SE3A 5BV7B 5E6IB 2ATPB 3MRKA 3WFCH 1LGVA 1LO5A 2ZUSA 5DMGC 5E2WL 1CLYL 3OZ9L 4RBPK 1CGYA 4N8CL 1BMGA 3DXAB 1YMMD 4WO4B 4OFKA 5FXCH 1HHJB 1GGCH 3MJGX 3F7PC 3OWEA 3MV7B 4ODBD 3VXUA 3EZJB 1RFDH 5FYJU 4YEFA 4MA8H 4L5FL 2RBLA 2PW2A 5F21B 4J3VA 4RGNC 1J0ZA 5I15L 1I7ZA 3I02A 3ELAT 3QUXD 4AM0A 1EHAA 5HYQA 1CCZA 1K3ZA 4O2CB 4XPTL 4LLVB 4LCUB 2F9BT 1U8IB 4UAOB 4WDIA 4NZDA 4G42A 5E8PA 1UM5L 4J3SA 4G9FD 3DIFB 1P4BH 1S9WB 4PJGA 1T66D 3BGFC 3S37L 4BQ9A 3U30C 2FJGA 5JPNB 1YEFL 1I7TA 3GHBL 4M03A 2C4XA 2P8LA 5IVXF 1B88A 4HK0B 3ZZ1A 3O41A 1JYXA 5JO5A 2VDOH 2ZCKH 5TE4H 4FFYH 3CZFB 4IRSD 4QEGA 5MI0B 4H26A 2X2YA 5L8KB 4BKLB 4I1NB 2IQAA 4RMTA 1AXSA 1BFOA 4GAGL 1E27A 4AMKL 3L3IB 4HWEH 1I7UA 4JVWA 3V7MA 1S7VB 1JF1B 2GI7A 3ARGC 1KCSL 1DJSA 4PUBL 4X6BB 3V52H 2XZQH 2QQKL 2BNUA 2VDRL 4I13B 1AY1L 1D5ZB 1ZHNA 3S4SA 1MRCL 5DUPH 4HDIB 1TETL 2B1AL 3L3OA 3H0TA 1MCWM 1MCNA 5E6IC 4NQSA 5BV7C 4OZGE 1VFBA 3RL1B 5F97E 5TPWL 5GZNC 2B1HL 3NCJL 1FDLH 4NO5B 1JGDB 4XCYA 2QR0A 1AGEB 1DDHA 4K9EC 4D0CB 1UXSA 4I48A 1OGAE 1U8OB 3D3VD 2E8YA 4KTYA 1YC7A 2NY7H 5ADPH 2W07A 5J12B 5MENA 1WCQA 5CJ8A 2ZUXA 1MCOH 3QIUB 1ZGLA 2GTZA 3CJJA 4GRWF 1VSCA 4KROD 2XXCB 4N1CA 1OD9A 1CR9L 4KK9C 5GS1B 3WE6A 4ZFZB 2PXYB 1OAUH 4U1SB 4NBYB 1JN6B 4JZOB 3QQ9D 2BMKB 4UAOC 4L3EB 2R8SH 4MS8D 3MRBA 2QEJA 4QRUB 1CDCA 1EO7A 3CFCL 4FABL 1ROWA 5I1DA 2CXGA 5DFWH 4LLUB 5D96C 5DC4B 4JFFA 1KTLA 4PJEE 2EYTB 1MFNA 3QEQB 3OXSB 4BQ8A 3GGWA 5IVXB 3IRZA 3ISWA 1IGJB 1FRGL 3SCMB 2HRLA 4X4XB 1QNZL 1ZGLP 4RISL 3MRHB 3LKSB 3QUYD 5E9DB 1U41A 3FB7B 3IXAA 2YBRA 3FOMA 3GMQB 4XCEB 5I73B 5E1HB 2WNGA 5HDLA 3QEUB 3VXME 4DQOH 1EJOH 3MUGB 2QBWA 3ZLQC 5HI5C 3FZUC 3NIDE 5LXGH 1BD2D 2A6JB 3U9PL 4BSVB 2GEEA 5C2UB 5FCUH 3C5JA 3EDDA 3HNVH 5HYEA 2D9CA 1KV3A 4EI5B 1CIUA 3HI1B 5JTWA 4UTAH 1KEGH 4GMTL 3EJYD 2X89D 1IGFL 2AXFA 1ITBB 2YXMA 1FVDB 1C5BH 2HVKA 1QBLL 4HIJB 2IAMD 4KXZH 1A4JA 3B9KD 4JN1L 4DCQB 4LPVA 3HMXA 4LCYA 5IHLB 3BH9A 1MCIA 1E28A 4NCC1 5J12C 4JFYA 5HHMD 1F90H 3QIUC 2H1PL 2YA1A 3P0YL 1X7QB 1ZHBA 2WW8A 5H2BA 4GRWB 1CXEA 5FO8A 4XX1E 3BKCH 2ZKHH 4Z7WE 4QXTB 3BGAA 4N8VB 8CGTA 5GS1C 2PN5A 1OTTC 2PXYC 5IV2A 3QWQB 3N9GL 3MRRB 4LBEB 4U6XB 3T77B 1MRFH 2DQJL 2J6EH 4UUJA 5CSBA 1A47A 1M7XA 1TJHL 3CUPA 5TE6L 3U4EA 1TENA 4W4OC 4Y4FB 3IETA 3ZHKA 1NCTA 3DECA 2X4SA 4XBEL 3QXUA 4XCFL 3KG5A 4YLQT 3C87A 4UQ2B 5FCSH 3QUZB 2A77L 2AVGA 1T1XB 1ZTXL 3S3PA 5D7JD 5IVZA 5T3XH 4WUKH 1RZ8B 1FG9C 4H20L 4XXCC 5E1AA 3GRWH 2Z8VC 4HX1A 2F54B 4P2RB 1D5XA 5EU6B 2RIKA 4JFQB 2OBGA 4WEBH 5AUMB 3GUTA 4NM4H 4IRJD 1BZ7B 5I73C 4X7DC 3WJLA 1T1ZA 1YNKL 4NHUB 2QL1A 3OGCA 2VRAA 2F53E 5L7XL 3ZYOA 5HDQH 4WWKB 4RQQA 1PKQB 2PTTB 1YJDH 4HK3N 1M6OA 2YK1H 2Y5TB 2ICEB 2QQLH 1AR2A 3MV8D 1KG0B 4ALAH 4HPYH 4PFEA 5EUOA 3CCHB 3ZDZE 1DSFH 5I1AB 3K2MC 4IMKA 4BFIB 3MV9E 1HH6A 4JFEE 1AKJB 4YBQC 5E08L 1YEJL 1G7PA 4NKQB 3TIDB 3QQNA 5HHXL 3MYJB 3BUYA 3C6LA 4I2XB 4U3CA 3VMNA 2N4IA 2V7NA 4X6CE 2GSIA 1AHWA 1ZHLB 5KVEL 1MAMH 2R1YB 3F12A 2HMID 5AZEH 2Q76A 4PS4H 5KOVC 1L0QA 1FCCA 3DMMA 5DTFA 3AAZB 1NDGA 1J11A 1WFNA 4QYOB 1UH4A 4X99B 1O7VA 5T5NF 3KVQA 2ADGA 4RX4D 1P5VA 2NXYD 3TA3A 3BH8B 4J4PD 3PHQB 4UINH 2FRGP 4Y4FC 3C5SA 3VRJB 4PTTA 5J3HC 3VXPB 2Y9RT 4V2CB 5I1IH 3EYOB 4Z95H 3QUZC 3MRLB 5E94A 5FHAH 4R8WH 3S35X 1T22A 3PABA 4OLZL 4YHPA 1RUMH 1MWAH 3GKWH 4YBLB 3ZE0F 2W91A 3HAEA 4PJIF 4RMVA 4JRWA 3CLEL 1PZUB 4P2OD 3EJZD 1HILB 5DVNA 4F3FB 5KSBA 3PQYE 4KRMB 3DUSA 3DRQA 4JFHE 4LKXA 2WBJB 1NCBL 1LO0L 4PGDA 1MCRA 1MI5E 5I1GL 3MLTA 4D0BB 4LSSH 2GJ6E 4OZFA 4E42A 1HHKB 2W9DH 5CJQH 5EBMA 3UTZA 4OBRA 5IB5A 4L8SA 3P0GB 2P24A 1CXHA 4YXLH 5DD5H 4JFOA 1UQSB 3M8OH 4UB0L 2HVJB 3KPSE 2OQJB 1OARL 4KXZI 4F7PA 2XWTA 5DEFB 4X6FA 3AS0A 1PGRB 3ZE1E 1QR1A 5F7MC 1X6NA 3F7YB 4RWHA 5GGQL 3KPMB 4DN4H 2FHBA 3QUML 2X1XR 5MERA 3ARBB 5IB4B 4HKBB 3X3GH 4HGKC 1NGXA 2Q8AH 3FFCE 3VFNB 5JORB 1T7ZA 1AD9B 4F37F 2W9EH 1A5FH 5HPMB 2AK4E 4RAVA 1WZLA 1LO4H 5FDYA 4PV9A 4DAGH 2HLFD 4MNHB 1UB5A 2XKNA 3KLSA 1FCGA 2YA0A 2VUYA 3QO0B 3VFMB 4C55A 1MHPH 4HH8A 1IGML 4IS6B 5JHLL 3T04D 3MGOA 2XPGB 2OXGA 3H9YA 4XXDA 2NZ9D 5A2LH 2ADFL 1EHXA 3FAWA 4XMLL 1DL7L 2YD4A 1G9EA 3NFPB 4KDTA 5I1LB 2D2OA 43CAA 4XT1C 1IMHC 1NLDL 3ROOB 3UTTB 2VXUL 1RZJH 1HOCB 4YBLC 3MRGA 4PG9B 4L3AA 3PWPB 4X80H 1C5CL 3BVNB 4PJIB 1PY9A 1R6VA 3GIZL 4LCIL 1J0HA 4JLRB 3F65A 4TULH 5GGSB 1I3RA 1MQKH 3VDBA 4WFHD 1PY4A 3BP7A 3L3KA 2IC2A 2C5DC 3KPTA 2BOBA 2EDHA 3LVEA 4WO4D 2QHRL 4YR6B 5F1OB 4R0LB 2IANE 2R0KL 4P3DB 3ZO0A 2FBOJ 1XGTA 4TSCH 1MUJB 2R2BA 2NY4C 2XQBL 3VMPA 3S88L 4UIKL 5EC1B 4NIKB 1UWGL 4ZUUA 1MPAL 2ZG1A 4NZJA 3QPXL 1CZ8L 1I1YA 1L9NA 5F9JA 1FJ1B 1GGUA 1WC7B 5EULV 1HXMA 5EZOH 4Y5YA 4LQ1A 1BZ9B 3LS4L 5F7KC 4NKDA 3ARVA 1CK0H 1KBGL 4J1UA 4KI5D 3CH1B 2MKWA 1HKLH 5BVPL 3BQUD 1ZMYA 2O5ZL 4HGMA 5BS0A 1TVBB 4LNVA 1I7RB 3ARBC 3FTGA 4OSUH 4PV8A 4PY8J 2ERJB 1GZPB 4U1JB 1SEBA 2GT9A 2EXYC 3SGDH 4G5ZH 3UBXI 1J12A 2BNRE 4E5XA 2X4RB 5IFAH 4DGVH 4JJ5B 5EU3A 3WKNA 4Q97A 3O0RL 4N8VG 1KELL 4HIXH 4U1MA 2DQHL 4OLXH 5KN5B 4NKMA 2QSCL 4P5TB 5GISL 1WT5C 2I9TA 3PP3H 4HF5L 4NO2B 4ISVA 2A1WH 3REVB 4KZDH 5AYUH 5I8EB 1IJ9A 4PJEF 1U2HA 1A14H 2YD9A 4IHOB 3OX8A 4Y89A 2VYRE 4NRYB 1KEMH 2EDRA 3SJVA 1KTRL 4MNQE 1ZT4A 2Y06L 4HBCH 5D7IE 1NH6A 4QOKA 1MAJA 3MSPA 3ECBA 5MEOA 5D7LD 1IQDA 5K59E 1L7IH 3LSOA 1MCBA 4ERSL 2HH0H 4QTIH 4YC2C 2B5IC 2CRZA 4LRIC 1N59A 2CDGB 1H3TA 1JIBA 4QKXB 3L3HB 4UQ3A 4ZQKB 4ZTPH 3G5YA 2P4AB 3NIDF 5E6ZA 4HJ0D 3QDMD 4N0CC 4B0MM 4P9HL 1FZMA 3KDMA 3UAJC 4R0LC 1I8KA 4JRXE 1A3RH 2MPAH 2R23B 4IOIA 1ZLSH 5C70A 4K2UL 1GC1C 4K3DH 1T1WA 2OR9L 5GGSY 3RWHA 1EMTH 4N8PA 5IIEA 5FO9A 4OZGB 4Z5RB 5KW9L 5JIPA 4RAUA 5ESQA 2R69H 2FJHA 1FAKT 2AAVA 1IAIL 1U58B 5DHVH 5ALBL 3O6KL 3I6KA 3ZKSD 1LP9A 1FZJA 3P11L 3RPKA 4U3XA 1G0XA 3O9WB 3BZ4A 4KPHH 1CBVH 4JQXA 1NUFA 2HRPL 2XICA 3Q0HA 3P30H 1ITCA 4RMRA 3M1BA 4XVUD 4OZ4B 1EEYA 3AXLB 5DK3A 3EOAA 1V3LA 4L3ED 2GSGA 3AM8C 4JPWH 2F58L 2VAJA 3O11B 3SE9H 5J6GB 1DBAL 3VWJA 2ERJC 3KPNA 4YFDB 5I17A 4RRPA 2VLLA 2O5YH 1BEYL 5I8CA 1U8NA 4Z7WF 1BGXL 3JUYA 2BOCB 1P7QD 3BPCB 1P5UA 1S7QB 3MJ8A 2HFEA 3WD5L 3SCMD 4GS7B 4GW5B 5I8OL 4OF8A 2X40A 2M2DA 3BP4A 3T0WA 1HSBA 5IHZA 3V6OC 3SGEI 4R7NB 4LGRB 1Z9MA 1A1OB 4LEXH 4PJEB 3E6FA 1CICB 5CD5C 3ZTJH 4CVXA 3BN9D 4P57A 5I1EH 4HG4K 2VSDA 4WIQA 2VC2H 3LDBB 1RK0B 4C56A 3ULSA 5ADOH 5FM8A 3TO2A 4EDWL 3O3DA 2VLRA 1A0QH 3MREA 4R26H 5I19H 1IL1B 4EI5D 3LHPH 1WTLA 4HXAL 5HI3D 1FIGH 1KB9K 2VZUA 5IQ7L 1W8OA 4O2FB 3VXMB 5F9DC 1R5WB 1S8DA 4NP4L 4G80A 3BZDA 4L8DA 5DD1H 1QEWA 1DEDA 5CINL 1U3HB 5EIQA 5DJYB 4R96B 2A38A 3D69B 1D6EB 2YMXL 2W65A 3T1FB 3V5HB 4RZCA 4AG4H 3MRIB 2NNAB 2ARWA 1M4KA 5E2UH 4TNVK 1NC4B 2EYRA 1OWRM 4OAWA 3RWCA 1ZHKA 3DX8B 1AR1D 3ZDZF 3BESR 5ESAB 1LVEA 3QO1A 4F58L 1K5NA 5H37G 3KYOA 4MXWL 3AS2A 3O9WC 3LKNA 3MMEB 4LSTL 1HHIB 1A1NA 3WDJA 2ZOLB 4Y19E 1MF2H 3EOTL 1GGIL 1QRNE 4GRLD 2ZCLH 1KIRA 3SGDI 1IGIH 3PGFH 5F1SA 3GNMH 4XVJH 2XG5A 1XF1A 4Z7WB 5BXFA 1EHLH 4MGXA 3TH4T 3MFGB 2JKXA 4OD3H 1KCUH 3WLBB 5T5NG 2X9WA 5JW4R 4PJ9A 4ZS7H 1YQ2A 1EFXA 4DK6A 3RHWK 3RIAF 4OM1L 4ELMA 1QKZL 5E2WH 2WWMD 4P5KA 3OZ9H 3ET9F 4N8CH 1CICC 4DEPB 1NCNA 4ZDHB 2X5PA 5E5RB 3JV0A 4J6RH 5F72S 4EKXA 3RL2A 1WLHA 2ARJB 4XPFL 2NPLX 2PYED 1RIUL 2FWOA 5ABDE 3QR2A 5I18L 1MH5A 5CAYB 5CZVL 5F7YC 2H41A 2IMMA 4L5FH 5JZ7C 3NIFE 2M26A 5T1KA 2R2HA 5I15H 4C59B 1HNFA 5CBEB 2W59A 5CZXC 1TITA 1NAMB 2F53B 2KL6A 2XZAL 4XPTH 1U3HC 4QRRE 1QLFB 5D1ZB 1EPFA 1Q8MA 4TUOA 1I9IL 4X7FC 4PJXE 1UM5H 3IGAA 2A9NH 1JTOA 3JWDL 4P0DA 5KANI 5DRWB 2GHWB 3ES6B 2ZOKA 1G9ML 3MV9B 4JFEB 3S37H 3SGJC 4Z7UA 1FVEB 1YEFH 3CDGB 3GHBH 1G7LB 3S96B 3ZE1F 4LVOB 4K3EL 3AMLA 5FYLD 1FO0A 2ED8A 2YRZA 4M4RA 1Q9KA 1V7NL 4X6CB 1BLNA 3ARDB 4UT7L 1I8IA 5IBUG 4S0SD 3BEWA 1UWXK 5CGMA 3QPQD 5GIRA 1NBQA 3Q5OA 3D87B 4AMKH 3L3JA 1FLRL 5SWSE 4GG6B 2JB6B 1KCSH 4M00A 2AW2A 1ES0A 2QQKH 3MZTA 1KC5H 2VDRH 2YXFA 1A6TB 3HG1D 1AY1H 2G60L 3BAEL 1MRCH 1R3HB 1EZVX 1K4CB 4DOHE 1MY5A 1TETH 2B1AH 3E2HB 2AJXL 1YYLH 4P2QE 4OCSL 2VLMD 5TPWH 4Z76B 4S1DC 2B1HH 1WFTA 3NCJH 4F33A 2WBJD 4ODHL 4GUPB 4DEPC 1QSFE 3QRGL 3LPWA 1ADQA 1A9EB 4XC3L 3OKOA 3DURB 1I3VA 2YPVL 4J3XA 4JE4B 1U2CA 1X5HA 2XZCL 3MJ6A 3PQYB 5DYOB 5C09A 4MD0B 4PY8I 3B2UC 3L95A 5K33A 3V6FB 1KGCD 5BJTA 4OCXL 5KVDH 4JRYA 4OTXH 3AC0A 3TH3T 1E4KC 1I1AB 1OD7A 4WFFE 5GRVL 5C0GB 1MI5B 2XN9A 1OAYL 1CR9H 4A2MA 2LTQB 5I0ZA 3ARRA 2GJ6B 1JF5A 4Q9BA 4DJMA 1OP5K 1UACL 4PJFE 3IDUA 2OJZL 1ND0A 4QRSB 1A6AB 4ZFFB 1U91A 4MSWB 3FO9A 4HWBL 4FABH 3CFCH 3QDGA 2HN7B 3KPSB 1Q9LB 3T3PF 5IMMB 2P8PB 2PYFA 2BX5A 3GJEB 1IM3A 4LVOC 1A6UL 3DVNA 5IHBA 4YUEL 1FRGH 3GJFB 3ARDC 3P4NB 3BW9B 2G5BB 5IMKA 3PWNA 5TE7L 3FFCB 1YDPB 4RISH 2X89A 4JKLA 5E4IA 5EZIL 5DMJB 1KTDA 3QJFB 2AK4B 3B5HA 2NTFA 3QHTC 3KPPB 3BP5B 3RIFF 2GUOA 1T2QL 1VERA 2VABA 5B21A 4FXLA 4I0KA 2YPLD 3RWJB 1WVZA 1YEHL 4LSPL 3U9PH 1XIWD 4JHAL 2VISB 3SN6N 3WUWB 2FO1A 4GMTH 5IWLC 1IGFH 3E2HC 4WW1B 4KQ4L 3TBWB 5D7IF 4NZRL 1L9MA 1FYTE 3OJ2C 1QBLH 1UH2A 5K59F 4NFCA 1SEQL 4NYLA 1SVZA 1JWUB 3EDKA 5HHVL 1ZS8A 1WJ3A 3NN8B 3ZHLA 4JN1H 2BXYA 3KXFE 5JDSA 3RX5A 1F4YL 5DJ0A 1TTGA 2A6DB 3UJJL 1T7XA 3VGFA 2H1PH 3P0YH 4NZUL 2W0KA 5SX4H 2IANB 2X4UB 5IB1A 1I1AC 2UUDK 4XMKL 3ZT6A 4UIMB 2EDOA 4HWZA 4TTDD 3QEHB 2YUWA 3GI8L 3TPUB 3WL9B 3N9GH 4OFVA 1OGTA 3U79A 4FQXA 3VFUA 4YGVB 2DQJH 5I30L 2FIKA 4HUNB 4Z9KB 2BY3A 4AT6B 3PV6A 4GAJL 5D93B 5F7UA 1S78C 2P1YA 3ULUC 4LNRA 3QIWB 5C0BD 5DDHA 4XBEH 4OGYL 4XCFH 1T5WA 4MJIA 1KIQA 4P2CG 4XBPB 4HUUA 1WZKA 2VDNL 5KSUA 1ZTXH 4NQCA 2X1WL 5DT1H 1S7SB 2P5EE 4NN6B 4H20H 3CDCA 2BNRB 4CADB 4XX1G 1KB5H 3K2UL 1JFQL 3IDYB 4GKZA 4GRWH 1P4LB 5EO9B 1YNKH 5F1NA 4Y16A 4H25B 2WK2A 2XTLA 4X9IA 2IALA 5L7XH 4H1LH 4O58L 2P43B 3HC3L 1CQYA 1ETZA 1MFEL 3VXSA 2HLAA 3IJSA 5L2KD 4ODTL 4MD4A 5CGYD 5DHYB 2I26N 1R3LA 5ID0A 1FHGA 1IM9A 3QI9A 4FFVC 4MNQB 4HGWB 2XZZA 3RWDA 2H8PB 4M61B 3MJ9L 4N68A 3KPQB 4JM4L 5IB2A 1XGQB 1YEJH 5GS2D 4IMLA 5I1HL 5CSGA 1X44A 2C3VB 2CDFA 4U0RB 4K94C 4P4KB 2MMXA 1RZ7L 3IDGA 3NH7L 3KS0J 2WBWB 4DGYL 4YIQA 5HYJD 5KVEH 1BQLH 5JW3L 1G9NL 3V8OA 4OF3A 3WNMA 4YK4B 3K74B 1MFDL 3RJQB 3BWUC 2EC8A 3CFEB 2XKUA 3HUJE 4LEOB 1OGAD 4JRXB 3ZKNC 5JW5B 3ILPB 3LB6C 4K7FB 3VA2C 5HY9B 4RFEB 5A43C 4LLYA 5D70L 3EYQD 5FGRA 4RMSA 4CNIA 1SJEA 1CT8B 3IKCB 1KCKA 2H2PD 4KRPD 3U9UA 2Y1VA 5D93C 1EEZB 4PREA 4Y2OA 2V17H 2JCCA 3I84A 2J8HA 4D94A 1CXIA 1INQB 3X11B 1KPRB 1X5JA 2UWEB 3HPLB 2V5SA 4OLZH 1XF4A 1Y0LA 1AH1A 4L9LC 4LARL 4GW4B 5EZLA 4OZIE 3CLEH 3F5WA 4I0PB 4NN6C 5CEYB 1VESA 1CFNB 4XCNA 2X4PA 3EO1B 2WUBH 1BP3B 3GDBA 3I85A 4POZD 4CU8A 3ZDYE 1TZHB 4Y4KB 1NCBH 3F8UB 1FV1B 4U1HB 4GKSA 1DQLL 5FYLH 1CDUA 4GBXD 1A7PH 1FNAA 4MJ6B 5I1GH 5C8JA 1P2CA 4CMMA 3FMGL 5C0DB 5F9OL 3LMJL 3ARWA 4X5WA 4ODVL 3BEVB 4DVRH 1QFUL 1K2DA 4PGBB 3GSVB 5LCVL 2V6HA 3MA7A 2X4QA 4X4YB 2AJ3B 4LLMA 2WZPD 4UB0H 1LHZA 3RVWC 15C8L 3GIVB 1I8MB 2XFXA 2VAAA 4PGZA 3G6AB 5JNYB 1OARH 5DVOA 1WQVT 3VMOA 1MOEA 4U0RC 5GGQH 2A9ML 3NIFF 3QUMH 2GITA 1QR4A 3VI4E 5CIPB 1I9EA 1JNNL 4LQFL 1CD8A 2VQ1A 3D1MC 4YK4C 3F62A 1VFUA 1CL7L 2FGZA 5BO1L 3ARGA 5T1MB 4G6AD 2G9HB 2D3VA 2WWKT 3CVHB 2C4FU 3TVMD 3T0AA 2JJTC 5E99L 4PJXF 2YOCA 3U7WL 1JYVA 5BOZG 2ZNXA 1YMHA 4KJYA 1IEAA 5E6IA 2ATPA 3MBEC 5H8DA 5JHLH 3O3BB 4OBSA 1HDMB 1W2KT 4J3UA 1FAIL 2XQYK 2ADFH 2O61B 4M3JA 3DXAA 4XMLH 1HHJA 5KSAD 5KS9E 3MV7A 3M45A 4FXGA 1JGLL 4MQ7B 5DJ8A 3SPVB 2ATKB 4Y19B 4IOFD 3QEGL 5IW6B 1QRNB 1WTGT 1KXQE 1C5CH 4ZXBB 1DQQB 2ZNWA 3GIZH 4LCIH 4I0PC 4HS8L 2QHRH 4O2CA 4Y4KC 2HKHL 4LLVA 1LK2A 4LCUA 3UZVB 3WUWG 3T65B 1DE4B 3RGVB 1U8IA 2XQBH 4LCCB 3QCVL 4A6YB 2APWA 4W81A 2VKXA 1HIML 1MPAH 3DIFA 4HC1L 2R9HC 1CZ8H 3QPXH 4JM2F 4U4BA 5GRYA 3AGVA 1V3JA 5JPNA 1Z3GH 1NSNL 3B3IB 2F53D 5FYKD 5EO1B 2AJUL 3Q6FB 2XTJD 4GH7B 4HK0A 3N1PC 5T1DL 4WTXA 1OP3K 3LS4H 2GCYB 1KBGH 1BQHB 3NTCL 2GK0B 5D1ZD 2Y7QB 5BVPH 2O5ZH 4N0RA 1OY3B 3BKML 1OCWL 3O3EB 4XP6L 3DETC 1T04B 4YXHH 4BKLA 4DW2L 3MV9D 1W72L 2N56A 1DFBL 4QXGL 5GGVY 3G08B 2FH8A 3L3IA 3QHFL 1S7VA 1JF1A 3S8WA 2XG4A 4X6BA 4M5YL 3O0RH 4PJFF 1KELH 1P4IL 1RUPL 1T5XB 4A6YL 1D5ZA 3GI9L 4U1KB 2DQHH 4PJXB 1BJ1H 2O5XL 1VENA 2QSCH 1OLLA 1QFOA 4ONGL 5J9PB 1OP9A 4HDIA 4HF5H 3DSNA 4NWTL 3JWOL 3VH8G 4BZ1H 3RL1A 4OI9A 4U33A 4H5SB 5MHSE 4JHWL 4EOWL 1AO7E 1JGDA 5T1LB 3MLVH 1WFOA 2HJFA 1FH5L 1AGEA 2Q3ZA 4D0CA 1N8ZB 2Y06H 1AGDB 3FQUB 4LMQI 1U8OA 1JHLL 4WNQA 5DA0B 2DI9A 3LQZB 3PIQB 4Q74A 4ERSH 3O2DA 3O6LL 2KDGA 1W8NA 3W0WD 2V2TB 3QIUA 4MX7B 4LHUB 5DFTA 5SWSB 3ZT7A 1NC2A 1J18A 4P9HH 4RCAA 4NKIL 5GS1A 4JG0L 4ZFZA 2SEBB 2PXYA 4TNWK 4K2UH 3HB3C 2OR9H 1JN6A 4JZOA 4WRLA 3RGVC 4DOHB 4LCCC 2BMKA 4L3EA 5D5ME 4MD5B 4P2QB 5KW9H 1DUYB 4QRUA 1H5BB 4W4OA 5I9QB 1IAIH 5ALBH 1BX2B 1YEDB 3O6KH 4JM2B 4LLUA 1T80A 2VUOA 1QSFB 2EYTA 3MNVB 3P11H 3QEQA 4MA1B 3SOBL 5IVXA 4G6FB 4MXQD 3DGGB 4OF0A 2HRPH 1ZLVK 1IGJA 2GJ6D 3WFBL 1NPUA 3FQXA 4JZNB 4X4XA 3H2WA 4XXCA 1YN6B 1QFPA 2OZ4L 5C0ND 2F58H 5DFVC 3PL6D 3MRHA 1DBAH 3LKSA 5E9DA 5EIIB 5ACLA 3FB7A 1BWMA 3TBTB 4XCEA 3GMQA 2JELL 3INUH 5DGRA 3QEUA 1BEYH 3MUGA 2EZ0D 1BGXH 2A6JA 4J8RB 4M1CD 4R2GB 4BSVA 5I1CL 4PJFB 3OGOE 1SJXA 4M6NL 5I8OH 5ESVB 3I50L 4LSRL 3KLHC 1JL8A 3HI1A 3RVVC 4X5LA 3OAYK 2F74B 1JI1A 1EEUA 1FVDA 2Z92B 3ALWA 3IXTB 4HIJA 4WI6A 4ONFL 2XWBB 4AIZA 5AWNL 2YD3A 2Q6WB 4HIHA 4QRPD 4DCQA 2Z91B 3U36B 1HYSC 5C0EB 1G6RH 4HXAH 4HMEA 3MRDB 4F15B 3O6ML 3MNZB 4N0FA 3MFFB 2VDKL 1EV2E 3KPRE 1SY6L 2AV7B 1IAIM 3BPLC 3QFJE 1CD9B 4S1RL 1EERB 5CINH 4KHXL 2X4OA 5B3NA 2YMXH 4Y2DB 4N8VA 4JDVB 4BQCA 2KZWA 4LBEA 4U6XA 3WO3B 3T77A 1U95B 2EO1A 5E4EB 3KPLB 1HZHL 1H5BC 4Y4FA 4DZBB 1FYTB 5I9QC 4I3GA 2IAND 4JM2C 1TJIL 5IBLC 4OGXH 4UQ2A 3TFKD 1CTNA 1UZ8B 1QSED 3K1KC 3QUZA 2P47B 2DIBA 4LSTH 4YHML 1T1XA 3PNWB 3KXFB 3D39E 1QHOA 5T5FL 1PJ9A 2EC9U 3EOTH 1GGIH 1N4XL 5SWZE 2WWKO 2F54A 4P2RA 3HUJF 5EU6A 4JFQA 3EDJA 3QIWD 4MLIA 2B4CL 5AUMA 1YA5A 1BZ7A 3L9RB 4BH7B 1J87A 3FQTB 4NHUA 5A3ID 2JJVA 4XPBL 4R2GC 3BIAX 4WWKA 3UC0L 1PKQA 2BSTA 2PTTA 2EIZB 5J56B 2DJ4A 3CXHJ 2E7LC 5GQBA 4AEHL 1CGSL 5EORL 2FR4B 3O6FD 2ICEA 2E5EA 1F2XK 3BZFB 1KG0A 3OKKB 1LD9A 1QKZH 4JPKL 5D2LA 3MBXL 4BM7A 4PJ7E 2FSEB 1AKJA 1NBZB 1FSKB 4N5EC 3IVKA 3TIDA 3T0DA 3MYJA 3VXOB 3C08L 1F6AB 1MCEA 4OZIF 5ICXB 2P5EB 4I2XA 1RIUH 5I18H 1BBDL 4JFDD 5I16B 5JMOC 4F15C 1SJHB 1H3PL 1T0NB 4APQD 3HRZB 1EO5A 1MCQA 2XZAH 3AAZA 1PZ5B 1IAOB 2OR7A 2NY2B 5C7XL 4QYOA 3T2NH 1T7VA 4XNUL 3VRIB 4X99A 4NQEE 4XWOD 4PD4K 5HYSB 3JWDH 3BH8A 3CNKA 2J8UA 3GBML 5E4EC 4FZEL 4MJ2A 1CDIA 2LQRA 3PHQA 4GT7A 3RVTC 4CGTA 2W1NA 3S35L 1G9MH 3VRJA 3QQ3B 3VXPA 4D9QD 4K3EH 2FGWL 2KKQA 3WNPA 2QSTA 1BQHG 4D0DB 1BECA 4ZD3L 5HGBB 4X7EC 1V7NH 3VI4F 2LAAA 4UT7H 4OF6A 3AREB 1FL6B 1Z9SA 1HILA 4F3FA 3GSQB 1NANH 1YN7B 5F96L 3HUJB 1AI1L 1E0OB 5FYKH 2WBJA 2ICES 1FLRH 1K3IA 2HJKB 3ARPA 4OFDA 2XYCA 3GO1L 3DRTB 3TESA 2G60H 4D0BA 1ZE3C 3BAEH 2EDDA 2Y6SD 2CR3A 4HKXB 4YGAB 1HHKA 4Z77B 2AJXH 1MCDA 4QXWA 1M1SA 2FO4B 2HVJA 4WEMB 2D0FA 3CH8A 4ODHH 2YRPA 4MVBC 4HD9A 4NSKB 2ICWB 4ZPVB 1FSKC 3D2UB 5CJXC 5EBLB 3QRGH 5DEFA 3F7YA 2APBA 4OZIB 1ZA6A 3KPMA 1CDJA 2YPVH 3ARBA 5KBNC 5IB4A 2XZCH 4HKBA 5C92A 2OM5A 4G8IB 1JPSL 4JR9H 4LHUG 1LE5B 1JNJA 1SYVA 3BZEA 3VFNA 2EKJA 5JORA 1AD9A 4OCXH 3EUUA 3CC5B 3B83A 1OAYH 4MNHA 4TUJB 4LDOB 3RU8L 2NY2C 1DVFB 4BZ2L 1Q94B 2PO6C 3QO0A 3VFMA 1PG7X 1UACH 2ADIB 1JPFA 1GIGH 3KJ6L 2OJZH 4IS6A 2XPGA 4P46C 4EUPH 1WISA 2RGSA 4CDGC 4HWBH 1M05B 4M6OL 1I7ZB 2Z31D 5JOEA 1JRHL 3NFPA 5I1LA 5JR1L 1A9BB 5JXAL 3CDFA 1A6UH 4FRWA 3ROOA 3UTTA 2R2EB 1NUNB 1IGTB 4LRIA 43C9B 3PWPA 3HLAB 1Z9LA 3AREC 3BVNA 4FG6C 4PJIA 4UZGA 5TE7H 4WFED 1YEEH 4JLRA 4JPIB 1BVLB 5EZIH 5GGSA 2DYPB 2AKRB 3O4LB 2FJGB 4YR6A 1T2QH 4R0LA 4P3DA 1YEHH 4LSPH 4FMKA 3SE8L 3MLUL 4JHAH 2RJMA 3PWUB 4HH9B 3V0AC 5IHUL 2ZUUA 4LVNB 4ZXBD 4NRXB 3FT3B 2YWZA 2PTVA 3NCCB 3NGBB 1GZQB 2DKSA 3TN0C 1FJ1A 4X9BA 1UM6L 5DUBA 4NZRH 3D48R 3QXAA 5KS9B 5CEZE 1BZ9A 4OI8A 5C71A 1SEQH 2V7HB 4LSUL 3D5OF 3CH1A 5HHVH 2BNUB 2CPCA 3AM8A 3RWEB 3S4SB 1I7RA 4YX2L 1F4YH 1GZPA 3L3OB 4D9LH 4I4WB 1VFBB 2R15A 3U2SA 4LKCA 3UJJH 4NZUH 2X4RA 3RVXD 1E4XL 5ICZA 4JJ5A 1BAFL 2H2SD 2OL3B 1YEKH 4I48B 5D5MF 4L4VE 5DRNB 5KN5A 4ZFOB 5D1XB 1DVFC 4IJ3B 4P5TA 4YE4L 3GI8H 3CU7A 1EK3A 2PUQT 4W68A 4ZODA 1Q0YH 4NO2A 3REVA 2FBJL 4Z18A 5I8EA 3W82A 5I30H 5BRZE 4LASH 4GAJH 4IHOA 2HA1A 4NRYA 4OGYH 1EGJH 4QRRD 4PRDB 3N1QC 5JXEC 5C08D 2VDNH 1AE6L 5IGXH 1UWEL 5BW7A 4OI7A 5EZJB 4AQ1B 2W0FA 3L3HA 4ZQKA 4ZAKC 1JFQH 1NANI 5T3ZL 4TSBL 3DI2B 4ZUTA 3C6SB 1OTSC 4JQIL 2R23A 3H9ZA 4NKOB 5IR1A 1IQWL 4O58H 4C56E 3ZTNL 4Y4HD 3TLRA 4OZGA 1GGBH 1MFEH 4U1GC 4Z5RA 4LVNC 1BF2A 4TN9A 5DEGB 2VR5A 4ODTH 5FGBC 2EKSA 3NGBC 4LHUD 2IGFL 1AO7B 5SWSD 1X9QA 2YBRB 1WAAE 3HE6B 3NCYS 3DO3A 3HC0B 3MJ9H 3SHSA 1KLGB 3O9WA 4JM4H 4JKWA 3I9GL 5I1HH 4WI3A 5D2NC 3NCBB 3NPZB 4OZ4A 3AXLA 2HT3C 3RZWA 1CFVL 1RZ7H 3NH7H 4OZHE 3O11A 5GZOD 4IDLA 4M7LL 5J6GA 4DGYH 1G9NH 1VFMA 1MFDH 4MWFB 1RZGA 4EN3B 4I0CC 4JB9L 4M02A 5F7HA 2D03L 2BOCA 2P45B 3W11D 5EU5A 1QOKA 3RNQB 4GW5A 3W9EB 4KK5C 5D5MB 5D1XC 4IJ3C 5HYSG 4Y1AE 4C83A 3QXWA 2EXWC 3T2QA 2IH1A 5J89A 3GM8A 3BIKB 1A1OA 2MKLC 4PJEA 1CICA 2CUMA 4XAKD 1WIOA 4AY0A 4QF1B 4FOMA 1LE9A 1F42A 2D4DA 2C1PB 1EIBA 1JMZA 2E6QA 1IL1A 3DO7B 1NFKA 4Z7OE 4LARH 1SM3L 2HFGH 4LSQL 1EA9C 4MJ4A 2D0HA 1IARB 4YBHA 3WJJC 4X83A 1AQKL 5GGRA 3VXMA 1R5WA 3BUTA 3IETB 4OFYD 1S7WB 4ETQB 5EBGA 4PRPD 1U3HA 5DJYA 4R96A 3UJTL 3D69A 5T33L 1DQLH 4W70A 4CUCA 1D6EA 5IMOB 4JDZB 5ITFB 3T1FA 3V5HA 2BNQD 2NNAA 1JWSB 1MEXL 3HMXL 1O0VA 1XEDA 3FMGH 1NC4A 4FFWC 5F9OH 3LMJH 3HTLX 1ZA3B 4ODVH 4PJ7F 1PBYA 5KZCD 5ESAA 2DM4A 2OYPA 2NMSA 3C60D 5LCVH 5IK3B 3TZVB 3CFKB 1X5KA 4UBDD 4XPGL 5C2BL 4FTVE 1GRWA 3HE6C 3GMLB 3OKDB 3MMEA 4Y2DD 1HHIA 5CP7A 2P7TB 5E8DL 1MJUL 4HZAA 2ZOLA 2A9MH 1SHMA 5E6YA 3WFZA 3VD3A 3KPRB 1Y6NR 3VXQB 1UCTA 2L7UA 3O8XB 3A67L 5IB3B 1INDL 3OKEB 3QFJB 1JNNH 3F7RA 4LQFH 4Y5VB 1YUHB 1CL7H 4MYWB 4EN3C 3H3KA 3A6CL 4Z7WA 1HH6B 1X5XA 2IPUG 1TTUA 1X3DA 4HIEB 1G7PB 4XZUB 5E99H 3U7WH 4KMTL 3WLBA 3MACL 3RBGA 4PRID 2ITCA 1QUNA 3FT4B 3HE7B 3LN5B 1MVUB 4KKBC 4LLAA 1JI2A 1H8SA 3NVQA 5HPOA 4WY7L 3FN3A 4UT6L 1RZFL 3SDAD 5C1MB 2JJWA 4ZDHA 3LKOA 2HT4C 5DTFB 5ENWB 5F7WC 3D39B 1LNUA 2ARJA 4KUZL 2D7OA 1ZXQA 3QEGH 2NY5H 5SWZB 3EOBB 5KVGL 4PLKC 1AD0B 2VLJE 1II4E 4HS8H 1JF6A 5CBEA 5C07A 1E4KA 1NAMA 2P46B 5GJTH 1I85C 2VXTL 2DAVA 2HKHH 5ALCH 3O45A 2FECI 5ACZA 4ZSOE 4J23A 5E94B 1QLFA 5D1ZA 3PABB 3QCVH 3VFOB 2J8OA 3H6JA 3OG6B 4H8WL 1I1FA 1HIMH 2AJYL 4PJ7B 3HI5L 5DRWA 4HC1H 3ES6A 2VLKD 4YDJB 2HG5B 4JFEA 5C09E 4XNXL 1FVEA 3G04B 3TZVC 1NSNH 3CDGA 3S96A 1G7LA 2AJUH 3B9EA 3MJ7B 5T1DH 1HYRC 4JRYE 4ACPA 4KC3B 5A2JH 4X6CA 3NTCH 3ARDA 3IFPB 2DJUA 2FB4L 3MLTB 3K80A 1JVKA 3BKMH 3EYFA 1OCWH 3WS6A 2XY2A 4XP6H 2CQVA 3O8XC 4L8SB 4DW2H 3ZKMD 5L2JB 5F1KC 1G1CA 2P5WD 2EDJA 1W72H 4QXGH 4BELD 1KN4L 2NY6B 1T83C 2B39A 3QHFH 4Y5VC 5IBTH 4XTRD 3QDGE 4GG6A 1YPZB 2RB8A 3FAXA 4M5YH 4HWNA 1P4IH 1RUPH 4KKAC 1A6TA 4A6YH 3C5ZC 4X6FB 1R3KB 3GI9H 2O5XH 4NQEB 3QA3A 5EUKB 1R3HA 4ONGH 3WSQL 1K4CA 4NWTH 2R0WL 5MERB 5IWLA 5BZWB 3JWOH 1KACB 4H8WC 3HE7C 4XNQB 5GRWA 4Z76A 5GS0L 4JHWH 4PJ8B 1KPVB 1LEGB 2EH7L 5HHPA 1FH5H 4AEEA 1D5IL 5HD8C 1YECH 4JKPL 1KPUB 1A9EA 3O2WL 1HE7A 3VXRE 3LN4B 3O6LH 5CSZB 3BO8B 1WUNT 3PQYA 5DYOA 2OCFD 4MD0A 3MGOB 1NEZA 1MFBH 3V6FA 5HVWA 2BVYA 4GXVL 1HHHB 3VG9C 1I1AA 5C0GA 1MI5A 1A7RL 3ARFB 4V1DD 3RY4A 3AS1A 3UTQA 4JG0H 2DLHA 1RJZB 2DWDB 2YD8A 3MO1B 3MRMB 4ZYKB 3OAUL 3T0XA 5L0QB 4QRSA 2JF1A 1UKQA 5H35B 3TJHC 2KPNA 4ZFFA 5C0CE 4MSWA 4Q9QL 4JO3L 3BGMB 1FNHA 1EZVY 2HN7A 3KPSA 1Q9LA 5IMMA 2BOBB 2OTUB 2P8PA 4L29A 4NZTL 1JYNA 3GJEA 3FHAA 1KNOB 3WFBH 3GJFA 3F7QA 3P4NA 3VXUD 3BW9A 2G5BA 2OZ4H 1H3VA 3FFCA 1YDPA 4LHJB 1F2QA 3ZDXE 5SX5H 1RI8A 4OFIA 3RDTC 4G8FA 3QJFA 1I1YB 1KIPB 2AK4A 3OJMB 3CXDL 2JELH 4LDEB 1LP9F 1TQCB 1CVSC 3BP5A 5B38B 2NY6C 4Z78B 5JW4N 4Y88A 3LY6A 3RWJA 5I1CH 3H9SE 5DK0B 5J0BA 1B0RB 2VISA 4DKEL 3WUWA 4ZUWB 4M6NH 3L5XH 2L0DA 3I50H 4LSRH 1P7KB 1FFOB 1QHPA 4P2YA 5F3BB 4HMDA 3BHBB 3TBWA 1UM4L 3ZYJA 4PJ8C 4JO4L 2C1OB 3U82B 1IRAY 4ONFH 4YQXL 4F9PC 1JWUA 3L3GB 3ESUF 5AWNH 2BVQB 3NN8A 3DSFL 3QUKB 1T6WA 1A7OL 4ZNEE 4LVEA 3O6MH 4PGCB 3R1GL 4DTGL 2A6DA 2VDKH 4JG1L 1SY6H 1QBAA 3VXSE 4ZG1A 1N64L 5D7KE 4OB5L 1J0JA 1PAMA 2X4UA 4S1RH 4M8VA 3EHBD 2VXSL 4KHXH 2B7DT 3FB8B 1MCPL 3ARFC 4M1DL 2QSQA 5FDWB 1R0AL 4GKNB 3QEHA 32C2B 3IU4L 2F8OA 3TPUA 3WL9A 4GMSL 2EH8L 1J86A 3LSOB 4FQLL 4YGVA 3U7AA 4XB7A 1XGYL 1DQDL 1WAAF 4AT6A 5LVEA 2XIDA 2IBZX 3VH8A 1UA6L 1OVZA 4WENB 5T3ZD 4ZNCD 4C4KT 4HUMB 4LPTA 1EBAA 5GS3A 1FZMB 3KDMB 4XBPA 1Y6MR 4Q58C 4OZHF 4L9LA 1C12B 4TSAL 2H32B 5T5FH 4HEPG 1K85A 2APTA 4PP1D 2UZXB 5K93A 5MEND 1SBSL 1N4XH 2BNRA 4CADA 9CGTA 3ULVE 2B4CH 1P4LA 3MLZL 1TQCC 5EO9A 1FZJB 4H25A 4L4VB 1MFCL 2JCCE 4MZ3A 5KSVB 4XPBH 5D72L 4TVPE 3ARSA 3UC0H 3K1DA 5C3TA 4WU7B 1P9MC 2BP3A 4F7EB 5BRZB 4UV7L 1F4WH 1CGSH 5EORH 2CGRL 5DHYA 1NCDH 4RIRB 3BIBX 5CEZL 3LZFL 4JPKH 3KPNB 4MNQA 4HGWA 4JFFD 2H8PA 4YZFF 4M61A 5I8CB 1U8NB 3KPQA 3C2SA 1XGQA 1NUGA 3OXRB 3TIEB 4TNVF 4UV4L 2C3VA 4LSVH 1VHPA 4Z7OF 2YN5A 3C08H 4P4KA 1NGQL 3K4ZA 3RJDA 5TFSL 5FM5O 4ZS6C 4ZO9A 5IHZB 5J6HB 3VRLF 5MHSD 1FFPB 4QLRA 2PCPB 3RI5K 2D4FA 4U05A 4CVXB 4LEOA 3CMOL 4JRXA 5JW5A 3ILPA 4K7FA 1U8QB 2JJTA 5J4MA 5HDBE 3VXNB 2EDYA 3TO2B 4MAYB 1H8NA 4XNUH 2BC4B 4WHTB 3X17A 4K8RL 2B20A 1CT8A 3IKCA 1XR9A 4QCIB 1I9RL 3MBEA 4IOSD 4Y8DC 4F7MA 3FB5B 2JIXA 4QWWD 3GBMH 1DQMH 4ORZC 4FZEH 2AS5M 1EEZA 3V6ZB 4BZYA 2HTKC 4G80B 3BKYL 7CGTA 1OAXL 1IGYB 3WS3A 2CO6B 4U1NB 4NT6B 3X11A 1INQA 3GSXB 2FGWH 1KPRA 1BIIB 2UWEA 1NBVL 2GQHA 3RHWF 4ZD3H 5F1IB 3HPLA 3BPOB 4OZHB 4OF5A 3QG7L 1UKTA 4GW4A 4OAWB 4I0PA 1CFNA 3I3BA 3EO1A 3KWWB 4U0QB 1F6LL 1HKFA 3AB0B 5FA4B 1TZGL 1TZHA 4Y4KA 2I07B 2R2CA 4U1HA 3OKNB 4BJLA 3DXAE 3BXNB 4JY5L 4XP4L 5H94B 1WBYB 2FEDD 3GO1H 4L8CB 4MJ6A 4Y1AB 3MNWB 2DMKA 5C0DA 2BRRL 1WIPA 3V79C 4PGBA 3GSVA 3I75B 4MHHI 4HV8B 3WBDA 1BBJB 2AJ3A 2Z35B 5L6YL 1QBBA 3FKUS 3CAFA 1QFHA 3ARQA 3GIVA 1I8MA 2HTLD 3WEXB 3SKJL 5ERWB 2EO9A 4OM0L 4HFWB 3DNKA 2COQA 1T03H 4BUHA 1NFDA 4PJ9B 5CIPA 1JPSH 5DXWA 5CUSL 2CLZB 2F8VA 2X9YA 1MHEB 4POYA 4YFEA 2OR8A 2G9HA 2CLVA 3CVHA 3B9VA 1RZKC 3EAKA 1RU9L 5A2KH 3RU8H 2ITDB 4BZ2H 4RFOL 4MAYC 4OD2B 4QHUB 4XHQA 2Z31C 3KJ6H 3RKDD 1MHHB 3O3BA 2NY3D 1EHNA 1HDMA 2Z4QB 3TT3L 5T1KB 3U6RB 4Q9RL 2O61A 4FTVB 4M6OH 3M17A 5DMYA 1JRHH 2MWCA 5JR1H 4F8TA 1OQOA 4NUJB 4CU6A 4MQ7A 3SPVA 1C7SA 4Y19A 1YZZA 1CGTA 5IFJB 3C6LD 1QO3A 1QRNA 2A0LD 5IMLB 1J0KA 1DQQA 1C5DB 3PHOB 3WHE1 4LDLB 3B8YA 5B38G 3TWCH 3AB0C 1R3JB 3RUGE 3MODL 3AFLA 3P4LA 3DMMD 5TF0A 4IM8A 3IJHB 3VFSB 3T65A 1DE4A 3RGVA 5EA0L 3SE8H 3MLUH 4LCCA 4A6YA 3K46A 4BH8B 2H9GB 5IHUH 4HZLB 1I8IB 2J88L 3QIBC 4KJPC 1NCWL 3NPSB 1QFWL 2Y25A 3B3IA 1CGWA 2KBGA 2OMNA 5EO1A 1JZ6A 3Q6FA 3T09A 1BVKB 4ODUB 4GFTB 2FL5A 2V9QA 4Q6IB 5B8CB 4LSUH 4JN2B 4GQ9L 1UEMA 1URLA 4KJQD 4KUCF 2Y7QA 3STZA 1FG2B 2VLJB 2E8ZA 1IBGL 3O3EA 5JHDE 1T04A 3SE4C 1CWVA 4NJ9L 3O2VL 4NBXB 4D3CH 3G08A 2DIAA 5E5MB 1E4XH 1N7MH 5GS0D 4EJ1C 4ZSOB 1FO0L 1NCUA 1T5XA 1CE1H 3BD5A 4R7DB 3C09B 3QEQE 1TPXC 1YY9D 4U1KA 3OKOB 1MQ8A 4YO0A 5F6IC 5J9PA 2YEZB 4ZO8A 4OLWL 4LLQB 1U3ZA 2A6KB 2FBJH 5C09B 2Y23A 2WIIB 4YHLL 4H5SA 2DM7A 4LCWA 5BJTB 5E2TL 5I75B 3VGGA 4JRYB 5T1LA 3CPLB 4HKZB 4MQSB 5F8RC 2Z93B 1XF3B 1N8ZA 3L5JA 4R97B 1AGDA 5JW4M 3FQUA 4M7KH 3UPRB 1AE6H 3LQZA 3ZDXF 1H15B 1JZ5A 3PIQA 1IZKA 3TO4C 2AEPH 4CBPA 1IC4L 1V5JA 2V2TA 1S5HA 2X42A 2OZ4A 3RY5A 5HHOE 4OGAC 4MX7A 2C3GA 4LHUA 4KAQL 1U91B 3LEYL 5F7EL 4NPYB 5LBSH 5SWSA 5T3ZH 4TSBH 3HZKB 3X13B 1MIEL 3BMVA 2O93L 1IM3B 4JQIH 1NAKL 2SEBA 1ADQL 1X6LA 1IQWH 2AEWA 2LU4A 3ZTNH 4MD5A 4P2QA 4UILL 2DQGH 4R4NC 1DUYA 1H5BA 4E41E 1KTDB 2IGFH 3SKOA 1BX2A 2VITB 4JM2A 4O02L 5E7BA 3V8CA 4NGHL 4KKNA 1QSFA 3MNVA 1VFAB 2YSSB 1TZIA 4KJWD 4U49A 3DGGA 2EDXA 3MV01 2QADD 3I9GH 2UYLB 4G8GE 5B8CC 3VXRB 2NR6C 1MVFA 4DUXA 1A7NL 3UYRH 4M7LH 5EIIA 3PDOB 4U7MA 3EW3B 1SY6A 4JCLA 4JB9H 4CMHC 2D03H 3TCXA 1UVQB 3D85B 4J8RA 4HBQA 4PJFA 3MPCA 4NYLB 4G7VL 4X0KB 2E7LA 3C09C 1CD1B 3WIHA 5ESVA 1ZS8B 3QBTB 2VN7A 4Z7QE 5DZNA 4WHCA 5C0CB 5FOBB 1NUDA 2F74A 2VDLL 3ZL4L 5DO2D 4PP2A 2P49B 3DROB 2Z92A 3LPGA 3IXTA 1AGCB 3QDJA 1GOGA 1FGNL 1CYGA 5BMFL 2XWBA 4R97C 4YPJA 5DJ2B 2Q6WA 3ARTA 2Z91A 3U36A 1TXKA 3ULVF 2FYYB 5C0EA 4OUUA 4IIQB 5BS0D 3MRDA 3VFGL 3UTSE 3MNZA 4LSQH 4JPVL 1NMBL 1AQKH 3O3UN 2AV7A 2JCCF 4JVUA 4LNRB 3VD7A 3LD8C 1IE5A 5DDHB 5D2LE 4NNXB 3H9SB 4FA8A 1GSMA 3UJTH 5ISZA 5T33H 2QLVB 3HMWL 4JDVA 3OKLB 4ENEC 3F7VA 4NQDE 5HI4D 1MEXH 3HMXH 1U95A 4RMWA 3KYMB 4D9RE 3KPLA 4XNYL 3OAZK 3DX9B 4DZBA 4QTHB 1FYTA 2GW5A 3MGAA 2R4SL 2YD5A 1T1YB 4XPGH 3SJVD 1UZ8A 3DJ9A 4EEEA 4QOKD 1UB6B 3PNWA 3KXFA 3IFOB 5E8DH 1MJUH 3CX2A 3UX9B 5GSVB 2EDWA 4F57L 4WHYG 3A67H 2X05A 1INDH 4MD4B 3SDCB 2QV2A 4CL7A 1GYAA 5B22A 5DQDH 1UXWB 5CEZD 2J8UE 3L9RA 4BH7A 4Z7VA 3FQTA 1QYGL 5C0RL 4XP1L 1FORL 4LAQL 4LL9A 2FD6L 3RY6A 1A8JH 4IMLB 1FVCB 4KMTH 3MACH 2CDFB 2EIZA 1B4RA 3DVFA 4WI7A 2FR4A 1RUKL 3BT2L 3CK0H 2ZSVB 3OKKA 3Q1SL 2OMBA 4JHBA 4PLJC 4WY7H 2FSEA 4MA7L 1NBZA 4UT6H 1RZFH 5CJXA 5FM4A 4XGZB 4P3WA 5D4QA 1LEKB 3VXOA 2X9XA 4NJAL 1F6AA 3KNBB 3IFNH 5ICXA 2P5EA 1U92B 1SJVA 4K8RD 4IIQC 5I16A 5KVGH 1SJHA 3VWJD 5INCA 1T0NA 1VB9A 3HRZA 1F4XH 2JCCB 3QWRA 1PZ5A 4LFHD 3VDCA 1IAOA 2C7UB 4H0GA 2PO6A 1I8LC 3VRIA 3STBA 1NCAL 5TH2B 3KYKL 4YEEA 4H8WH 3HFML 5HYSA 5EZLB 5AAWA 1FPTL 3F5WB 2AJYH 4S1SL 3Q5TA 3GSOA 3QQ3A 4XNXH 1QSZA 1KN2L 1S9XB 4JY6B 4C56D 4D0DA 2X44D 3VCLB 5HGBA 2VLRD 3NCMA 3UYPA 2ZG3A 5IG7B 3C8DA 3AREA 2FB4H 3G5VB 5AG9A 4CMMB 1EBPA 4X5WB 4WUUA 3BDXA 1YN7A 12E8L 3HUJA 4NO0A 4YDLB 3SDCC 1KN4H 4L4TE 4M43L 4TVPL 4LLMB 1U8JB 2HJKA 4I77L 5IJVB 5FEBA 2QKIB 3DRTA 4JY4B 5CMAB 4HKXA 3OSKA 3WSQH 4ODXB 1OF2B 2IPUK 3OB0H 2R0WH 5E70A 3QHZL 1G6VK 3QFDB 5B4MC 3TN0A 4LRNH 3S37X 2FO4A 2NYYC 5GS0H 2FX7L 3ARGB 1XF5B 4NSKA 1OT2A 2ICWA 4ZPVA 3D2UA 2MFNA 1D5IH 1OWWA 5EBLA 4JKPH 1N2RB 4Y1AD 1M7DB 4XPHH 3O2WH 4OZIA 1J1XL 4AEFA 4OZFH 2K7QA 1DCLA 3ULVC 1LE5A 4G8IA 4YHZL 1IEAB 3RUGF 4MMZC 3TM6A 5FYKU 4GXVH 1PG7W 1PG7L 2BCKB 3CC5A 4N90E 4B5EA 3QISA 3Q3GB 1A7RH 4OFPA 3DUUB 4TUJA 1CXFA 2A74B 4BA8A 3FN0L 1DVFA 4XWGL 4FXGB 1Q94A 5DJ8B 2V5TA 2ADIA 1J8KA 4PJ9D 1EFXD 3OAUH 2NXZD 1JNHB 4PJ5E 4UT9L 4KKLC 4KZEL 4Q9QH 4JO3H 1M05A 2IADB 3QB7C 4NZTH 1A9BA 5DVKA 1T4KB 5JXEA 4JHZA 1N5YH 4LOUD 4BSWB 5FK9A 1LK2B 1D7FA 2R2EA 2HJLB 1IGTA 2CKBA 4HS6B 2R56L 4Z0BL 43C9A 3HLAA 5BV7L 4NFBA 3WLWD 5I66B 4JPIA 3V6OE 1BVLA 1FYHB 2AV1B 2DYPA 5T1KD 1SYSA 2AKRA 3PXHA 1Z0NA 4YDLC 5D96B 3O4LA 4I8DA 4K9EL 3EIFA 1NQBA 2C4FT 2V2WB 3WFEL 4ZMAT 2NY1B 3O3AB 3S7GA 2NY0D 4DKEH 2VXVL 4HH9A 3PWUA 1Q0XL 1WSST 1LEIA 4NRXA 3VJ6B 5FGBA 1HCFX 3FT3A 1G7MB 1GZQA 1YEGH 5DJZB 3KYAA 4TNWF 5EOTB 4Z8FL 5KS9A 3VWKC 4JO4H 5D2NA 2V7HA 4YQXH 1P7HL 5I2IB 4YHYB 4OD1L 1TVHB 3DSFH 1EEQA 4X7SL 5GHWL 1A7OH 3RWEA 3MLXL 4GRMB 2X41A 1T20B 4CN4A 4DTGH 2NX5A 3R1GH 4I4WA 4JG1H 3H3BC 2AQ1A 2VOTA 4K7PX 4YXKL 3RUGB 3PE9A 1N64H 1CVRA 4OB5H 3RZCB 1J05B 3QNZA 1S7XB 2OL3A 2VXSH 2HJFB 1YNTB 4H88L 4ZFGL 1MCPH 4M1DH 5DRNA 1QTYT 1R0AH 4ZFOA 3CVIL 5D1XA 3IU4H 5DMKA 4WNQB 4X8JA 2F5AL 4GMSH 2EH8H 4FQLH 2YN3A 1XGYH 1WZ1L 4L1HA 1ODAA 1X4XA 5D9SB 4KK6C 1UA6H 3V0VB 1NC2B 2X6MA 5DJAA 4PRDA 5F3HB 3QQ4A 4AEIH 5EBWA 1KJVB 4TSAH 3FFDB 4PY7B 5JHDB 1UJ3B 4LPXA 5EZJA 5C09D 3WJJA 1SBSH 1YMME 3BP6B 3BISA 3SKMB 4JRYD 3B6SA 3MLZH 3UO1L 3C6SA 2X09A 1Q1JH 2XN9D 1KB9J 1MFCH 4NKOA 1HCVA 5D72H 2NY1C 2VTFA 3FQXB 2YRLA 5KVMC 3VXTB 3O2DL 2VH5L 4UV7H 1FBIL 5DEGA 2CGRH 4FQ2L 1V7ML 1AO7A 3RRQA 2HT2D 5CEZH 3QDGD 1BQSA 3LZFH 4PJBE 3B9AA 4RA3A 3HE6A 5DGQA 3HC0A 3WNKA 1KLGA 4GAFB 5AG8A 4UV4H 1J8HB 3T0EC 5SV3A 4YHYC 1NGQH 4G9FE 1HINL 4AH2B 5TFSH 2FATH 3WHE0 5HHOB 3AY4C 1FIEA 4NQXB 4ONHB 5D2LF 4MWFA 4EN3A 3RZCC 2FHCA 3CMOH 5FUOL 4QXUL 1RD6A 4AIZB 4POUB 3RNQA 3W9EA 5D5MA 4KUCD 4HIHB 4K8RH 1I9RH 1KENL 4E41B 3HC4L 4N0FB 3BIKA 4NNPL 1QBML 2GAZB 4WI2A 2ID5A 4HMCA 3BKYH 1OAXH 1J1OL 4G8GB 1AQDB 2LABA 4QF1A 1BVZA 4C58B 1FNSL 2EDFA 1NBVH 2C1PA 2X4OB 4MQXC 3TBYB 4HSQA 2FHFA 5IROA 4HPOL 3DO7A 4BSJA 3QG7H 2IJ0C 1JV5B 1OTUC 3V5DA 1UJ3C 4P3CH 2J8UF 4NQUA 1HQRB 2R0ZL 4ZUVB 3THML 1YC8A 5EU4A 1S7WA 4ETQA 1A4KB 1TZGH 1I85A 2WINB 1ZVHA 4N0UE 2GJZB 4KKCC 3D3VE 4HEME 5IMOA 4JDZA 1S9VA 5ITFA 1GL4B 3FO1B 2FDBP 5JOFB 2MHAB 5EB9A 1JWSA 4JO2L 1GVIA 3T1WA 4KVCL 4FQXD 1ZA3A 2BRRH 3IDNB 1UJTA 5FGCE 1KT2B 1Q9WB 1XGPB 2WM0A 2YZ8A 4PBXA 5IK3A 3RVUC 3TZVA 1JTPA 5TQ2L 3CFKA 3H8NA 1JCKA 5HHNB 4MJID 3GMLA 3OKDA 4OCMC 5C07E 3SKJH 1JNLL 2P7TA 2ZSWA 3IB4A 4XH2B 3CXHK 4QY8A 3RQ3A 1S9YA 4OM0H 2BSTB 3UTSB 3EDEA 4NQCD 1BJMA 3KPRA 3VXQA 2AJZB 1KXTB 3O8XA 5IB3A 3OKEA 3QFJA 1U8PB 1MRDH 1T83A 4Y5VA 5EFIB 1LD9B 1YUHA 5D2LB 1CFSB 1MJ8L 3V0WL 1Q9OB 2XWJB 4Y16D 4K07A 4QT5B 4HIEA 2BVPB 3RKDC 1RU9H 2EICA 4NQDB 3IVKB 1DEEB 3C5ZA 4XZUA 1DUZB 4RFOH 4URTB 3VXSD 1JMXA 3FT4A 3L5HA 3HE7A 3LN5A 1MVUA 3OG4B 1FZKB 4QNPF 3RWGB 3QI9D 1IM9D 2CDEB 1BD2E 4YHOL 4O4YL 3SDDB 3NBNA 1S7TB 3WNNA 1B4JL 5ENWA 4U7SA 3D39A 4GG6E 2F5BH 2VXQL 1FGVL 2XQYG 4E9LA 5SWZA 1RJYB 2RQ8A 2EC9T 3EOBA 4OLUL 1DLFH 4YDIL 4XVTL 1AD0A 2J8UB 4HLZH 3CFBB 2D7TL 1N3NA 3S3JA 4GXUN 3MODH 1OPGL 4EI6B 3GBLA 1B6UA 4LK4A 4ZPTB 3TA3C 1Y18B 5D1QB 3VFOA 4P23B 4OGZA 2H26B 2J88H 1PW3A 4PJ7A 5DMGD 4YDJA 1QFWH 2HG5A 5K9QI 5F89B 4G9DB 3G04A 3JSSA 4GLRH 3OV6A 4TVPD 2CIIB 3MJ7A 4QRQB 2AXGB 2NY4B 1XFPA 4GQ9H 3IFPA 4NO3A 4DWHA 4G6JL 4PJHE 5GGUB 3TNMB 3KPOB 1IBGH 3RDTA 1IAKB 4KI1A 2VL5B 3LEXB 4RGND 1T89C 5L2JA 1ZWIB 1JZ7A 1AXIB 3O2VH 2P44B 2JE8A 3ULUE 1YPZA 1V3MA 5DWUL 1FO0H 2QSVA 4AQOA 1R3KA 4NQEA 1D9KC 2XI9A 5EUKA 1ZA6B 1EXUB 4OLWH 5BZWA 1XR8A 5CLWA 2E6JA 1M7IB 3RTQB 4XNQA 2DWEB 1SYVB 2D7MA 3BZEB 4YHLH 2VDOL 2ZCKL 5E2TH 4PJ8A 1KPVA 5J11C 1LEGA 3P9WB 3SDDC 2Y4SA 2WQRA 1KPUA 4HS3B 1REIA 1W0VA 1RUQL 4XI5C 3LN4A 1JPFB 1IC4H 3BO8A 5CSZA 3MV8E 2Z9TA 3NFNB 3BPNB 1I4FA 4HK3J 4L4TB 2AXJA 4KAQH 4KFZC 5F7EH 1QFWM 4AL8L 1HHHA 3TNNB 3ARGD 1N6VA 1BOGB 2ZUWA 3ARFA 5F7FA 1UWXH 1NAKH 3HRPA 1ADQH 2DBLH 3QP3A 1VPOL 1RJZA 2DWDA 1FDLL 5D1QC 4YC2B 3MO1A 3MRMA 2B5IB 4P23C 5DK2B 3RPIA 4F7CB 4ZYKA 4UILH 5E6ID 1DLHB 1EFQA 5H35A 1NKRA 5GZND 3BGMA 4F8QA 3DV4A 4O02H 4NGHH 1LDPL 1V3KA 2OTUA 3DXAD 2NY7L 3GKZA 4QRTB 4EQ3A 3MV7D 1KNOA 4M5ZL 2OTWB 4OZGF 2E7BA 3H42L 1A7NH 3MCKB 4WW2C 3K8MA 3QAZB 3VE0B 3MX0A 3EO0B 1KIPA 4KK8D 3JV5A 5B38A 4Z78A 3IAPA 5DUBB 4XHJC 4KTEH 1CDYA 1LQSR 3QXAB 3NCFB 5DK0A 2DRUA 4U6TA 1B0RA 5E8EB 1P9MA 4ZUWA 1PEZA 1N5AB 4K23L 4PJ5B 1P7KA 1FFOA 2BY0A 5F3BA 3JTSB 2CRYA 3ORJA 5IBUB 3BHBA 3RTQC 2VDLH 3ZL4H 2HWZL 2DMBA 2D7NA 2AEIT 3U2SB 4LKCB 1OP5H 4FZ8L 1AGBB 2C1OA 1FGNH 2G75B 1HWHB 5ICZB 5BMFH 4UU9B 1GC1L 2Y36L 4YDKL 3L3GA 2BVQA 4FQHB 3QUKA 3CZJA 4WFGD 3IDMB 1ERNA 2VNCA 4DQOL 1EJOL 3VFGH 2HKFL 3UTPD 4PGCA 1QQDB 4JPVH 3BPNC 5INDB 5HJ3B 2WP3O 2VZ1A 5HI5D 3FZUD 3FB8A 4W4NA 3TT1L 1BM3L 3HMWH 4M6AA 5F6HJ 5FDWA 1L7TL 4GKNA 32C2A 4KVNL 3QCUL 1RAMA 5AD0B 4M7ZB 4AK1A 3UZEA 5C3LD 4XNYH 2W0FB 2R1WB 1JJUA 2QJDA 3C8KA 2CO7B 1QFWI 2R4SH 4GLRI 4YHNB 4Y5XB 2UY6A 4L1DA 2DF3A 4ZUTB 2V9TA 4CW1B 1MCFA 3T0BA 2AJSL 5E95B 1C12A 5IR1B 2H32A 4N9OB 1KUMA 1DZBA 1NMCB 3ARZA 4F57H 5E2JA 3U7YL 3QAZC 1TCMA 1XZ0B 3QIUD 2EKSB 1NC2D 4I3SL 2H6PB 1EAPB 25C8L 4L4VA 4X6DA 1FORH 4LAQH 4XP1H 5KSVA 1BIHA 2ESVE 5DLML 1OTTD 1VGEL 4IDJL 2PXYD 4K3JL 5KJRL 4WU7A 5JHDD 4NC1E 2UWEE 4F7EA 1E6JL 2APVA 5BRZA 1T7YA 2E7HA 4FQ1L 4WFHE 1RUKH 4HLJA 4LLWA 2UUDH 3BT2H 4RIRA 3TBSA 1WGOA 3PWJB 3LRHA 3Q1SH 3UPCA 2ZUQB 3VGEA 1WEJL 1RZGB 1IKFL 3BDYL 4WUKL 2VIRB 1SVCP 2WMPA 5DJXB 1ACYL 2IBZY 2XY1A 1ULVA 3OXRA 3QEQD 1T6VN 3TIEA 3GRWL 4PJDE 1AXTH 4NJAH 3ZYZA 2XA8H 5EU5B 3UBXB 2J7LA 1NGZB 3KLAA 5J6HA 1IC7L 4C83B 2MQ3A 1YMMB 7FABL 2IH1B 5D6DC 1FFPA 5E9DD 4S0TD 5DRZB 2DJSA 2Q7YA 2PCPA 2V9RA 1KYOJ 5KG9B 2GY7B 1EVUA 4KQ3L 2P8MB 1U8QA 2DLEA 5IJKC 2R39A 3VXNA 1R5IA 2OTPA 3H3PL 4MAYA 1LE9B 4ALAL 4IEFB 3ZKXB 2BC4A 4WHTA 1A6VH 1NCAH 1P84J 3KYKH 4QCIA 1EUUA 3QUXB 5DI8B 4PR5B 3FB5A 1DBBL 3HFMH 4M7ZC 2DQUL 3SY0A 1FPTH 4RSVA 4PJBB 1WAAA 4QHMA 1NFDE 1S9KC 3V6ZA 5GGRB 1QZ1A 4YBQD 1IGYA 4U1NA 2VSCA 4NT6A 3GSXA 4Y5XC 3T0VA 1KFAL 1BIIA 2CLRB 4YH6A 4G9FB 5F1IA 3TF7C 4ZOBA 3ILQC 4OZHA 2AP2A 4NN7B 1F8TL 1K8IB 3L1OL 4OUOA 4JFZH 3QJHB 3NAAL 3KWWA 1NMCC 12E8H 1OT1A 5FA4A 1FE8L 5L88L 4M43H 2D31A 4TVPH 2I07A 5D7LE 4IRSB 4MB5A 4UOW1 3OKNA 1YJDC 4LPUA 4M8QB 3BXNA 5H94A 1WBYA 2HP4A 3MCLL 4L8CA 4X6CF 4Y1AA 1GGYA 3MNWA 5CP7B 1CFTB 1A7BA 4U31A 4RDQF 2L4OA 3QHZH 5TQ0L 3I75A 4HV8A 3QDME 4Y4FD 1BBJA 5FHAL 2Z35A 1F02I 1KLUA 2ZUQC 4U1LA 1R24A 2FX7H 4GG6F 3OF6A 4TPRL 4GXUM 4Q6YA 2EE2A 2EE9A 3WEXA 3QUZD 2Q8BL 3O81A 4UDTB 5ERWA 3B4NA 3N50A 3TGXA 5E2VL 3MRJB 1P1ZB 3IJYB 4HFWA 1D5MB 4WI9A 4P48A 2ITCB 3EO9L 4YHZH 3SE4A 1A6ZA 1RY7B 2CLZA 2F54D 4P2RD 2VZTA 5CHNB 5EU6D 4NCC2 1F97A 1X4YA 1T21B 1MHEA 1CLYH 4N0UB 4QO1A 3D3VB 3NA9L 3P2TA 3LKOB 2DLGA 1CE6B 4XRCA 4BYHA 2ITDA 4WWKD 2DL9A 4WV1B 1LNUB 1L6XA 4OD2A 4S2SB 5FGCB 3ZKXC 4QHUA 3RWFB 3L5IA 3QUXC 4KROB 1MHHA 5B39B 4UT9H 4KU1A 4AYFA 2Z4QA 4KZEH 3U6RA 3MRQB 1U6AL 4FTVA 2GFBB 3QXTA 5C07B 4MA3B 1AKJD 4V2BA 1MLCB 2VL4A 4NUJA 3FRUB 4PJHF 3O45B 4JO1L 1LDSA 3K4DA 5ACZB 5IFJA 3ZT5A 4ZUSB 4D9RD 1X4ZA 4HQQL 4NN7C 5J1TC 1T66C 5GGRY 2EDLA 4Z0BH 5IMLA 5BV7H 1A5FL 5F93C 1DANU 1C5DA 3PHOA 1I1FB 1ZLUK 3RWIB 3ULUF 1KSRA 2DBJA 1U8KB 5EN2A 1R3JA 3V2AR 4K9EH 1MHPL 4Q2ZA 1JZ4A 4FQPA 1WCBA 4LCWE 2YC1B 3PJSB 4IRSC 3IJHA 1LWRA 3WFEH 2BJML 3VFSA 3GK8L 3QUYB 2VXVH 3TYFB 2CIKB 4BH8A 2H9GA 1Q0XH 4HZLA 1NCCL 3EYFB 4ELKB 1FFRA 1BD2B 2MCG1 4GAGH 1NAML 4Z8FH 3HZVA 4TVSa 1KLFA 1BVKA 4ODUA 4PUBH 2BFVL 1NGWB 3OJDB 4Q6IA 5B8CA 1WBZB 4OCLC 4JN2A 3PGDB 1FG2A 3QA3B 4X7SH 5GHWH 3MCG1 3MLXH 2VLJA 3F58L 3EGSB 5DQJB 5E5MA 2P42B 5HHPB 4ZSOA 4H88H 4ZFGH 1ZT7B 4R7DA 2NY4D 3DLQR 3CVIH 4LIQE 1JWMB 5HHMB 4WV1C 2F5AH 2YEZA 4LLQA 2A6KA 3LRSB 1TJGL 2AABL 4KROC 1WZ1H 5ILTL 2WIIA 3QDHA 1NEZB 5DF0A 4UDUB 4CDHA 5JA9A 3WNOA 3CPLA 5CFHA 4HKZA 5I1JL 2Z93A 1XF3A 1H3XA 3QQ9C 3UPRA 3QRFM 3FONB 4MS8C 4WWID 3UTQB 3K81A 3R4DA 4PJHB 1H15A 1MCKA 3LCYA 2NW3B 3ARBD 3KHOA 2EXYD 1CI5A 3GMMB 1OP3H 4HIXL 4NPYA 3G5ZB 3PXJA 5D7JB 3HZKA 5A2IH 3UO1H 3X13A 4L29B 3QXVA 4KZDL 2PYEE 3EYVB 3CU1A 1Z5LB 3QDJE 5F6HI 3QUYC 2HT2C 3O2DH 5DHVB 1DBKL 4IRJB 2VH5H 1KEML 1QNZH 1FBIH 1JBJA 3RGHA 4HBCL 4FQ2H 5HDOA 1T7WA 2VITA 4G8FB 4P4RB 1FP5A 4LMQE 3K4AA 1VFAA 2YSSA 2EDTA 3EYUL 3BFOA 2UYLA 1WBXB 3UBXG 3UTTD 3EJYC 3VXRA 5ISZE 1ZKAA 4CRPA 3MV8B 3WUZA 1HINH 1AP2B 3PWPD 4JDTL 1HWGB 1XCQB 3MYZA 3PDOA 3ULUL 2IAMC 1CDBA 4N0CD 5FYLE 1EMTL 2GYSA 5FV1L 3JV4B 3RP1A 3B9KC 2F15A 1UVQA 3D85A 3UAJD 5FUOH 1VEOA 2E9JA 1H3WM 2R69L 3E0GA 4QXUH 3DGCR 4X0KA 4OLYL 1CD1A 4X7TA 1D6VL 5C0CA 1KENH 5IM7B 5EWIL 5FOBA 3X3FL 1Q38A 2AGJL 5TGBB 5ELIA 4NNPH 1QBMH 3DROA 5CJOL 1J88A 1AGCA 5FF6B 3HG1E 5DC0A 3L6FB 4Z7VE 1FNSH 2NXYB 5DJ2A 4HPOH 3LQAL 3VFTB 2FYYA 4IIQA 4NWUL 5IEHB 2VLME 4XP9L 4KMLB 3FRPG 1TJHH 5TE6H 2R0ZH 3THMH 1ZLVH 3VH8B 2ICCA 3G9AB 3P4MB 5GGTL 2RFXB 5D7JC 4NNXA 3H9SA 2VN4A 4K94L 2UWEF 1I8LA 1DBML 1XT5A 3QNYB 4ODWB 4P2OB 3OKLA 4E0RA 2A77H 4S11A 5IVOA 4L9LB 4P5TD 4WI8A 4JO2H 5TJWK 1FNGB 4DFIA 3RI5F 4KVCH 3KYMA 1KGCE 4IRJC 1A2YB 5I8KL 3DX9A 1U8MB 5BQ7B 4QTHA 5CD5D 1GJIA 2W0LA 1A0QL 3AMKA 5L8LB 5TQ2H 2VJXA 1T1YA 4KV5E 5I76B 1FIGL 1EDQA 5HVGB 1QPXA 1YNLL 3I3DA 1UB6A 5EOCL 5I74B 2ILLA 1TCRB 3OAYH 1JNLH 3IFOA 4N0YL 4ZNEA 2AQ3A 5DD1L 5GSVA 4M6ML 3LQAC 5I0DA 1VADB 2LE9A 3SDCA 1P53A 1TIUA 3K7UA 5D6CB 5C0IB 1UXWA 2HAZA 1VACB 4K3HA 3DV6B 4ONOA 4KY1L 3V0WH 1RJCA 5E08H 1FC1A 4PRHE 5EU7E 4MNGE 1PX3A 1FVCA 5HHXH 5DD6B 2EEDA 5B39G 2HMIC 4OCNC 1NFDF 4HCRA 2W38A 5CP3A 5HGHB 1JK8B 4EBQL 2ZSVA 4WU5B 1RURL 2YPLE 4WUUE 1H0DA 5JPMB 4YHOH 4O4YH 3O9WD 4XGZA 1B4JH 1LEKA 3KNBA 3SKNB 1RZIB 3HR5B 2NXYC 4DKAA 1U92A 1L4IA 1FGVH 2V2XB 2VXQH 4J4PC 1A21A 3LKQB 1XR9B 1TVDA 3MBEB 4F7MB 1JYWA 4YDIH 4WI4A 2JIXB 4XVTH 3S98A 5E00B 1F5WA 5KAQF 2I9LB 2H3NB 5IW1B 3L5WB 4QGYA 1SMAA 5JLZB 2ESVB 1OPGH 3X14B 3OBAA 3WS3B 3P4OB 3TCLB 4Q0XL 2C7UA 4HXBL 4PBVC 4P2OC 4HUVB 3EJZC 5TH2A 5J8OA 4BFBD 3UZQA 4RDQG 2DM3A 4XNMB 1QD0A 4NBZB 2BSRB 1NGYA 4J6RL 3R06B 1EH9A 1CICD 5LWYL 1F11B 4PJDB 1S9XA 2W92A 4JY6A 4XMPL 1LO0H 3VCLA 1CLOL 5C6PB 1MCSA 3IDIB 5I74C 5IG7A 1IVLA 2A73A 1BJ1J 4G6JH 2XNAB 3G5VA 3G9VA 5J06A 4LU5L 1K8DB 5JZ7D 4YNYB 1F4AA 5C0BE 3QXDA 1UENA 4GG8B 2O26U 4PLNC 3JVGC 1MLBB 3VXMD 3W9DB 5CZXD 2M1KA 1U8JA 3BQUB 1T0MB 1U3HD 4XNZB 5IJVA 2A9NL 5DWUH 2QKIA 4JY4A 4N1EA 5LQBL 5CMAA 2IPKB 2X10A 3MOBL 1KOAA 3HNSL 3PGCB 4LGSB 1NC4D 4ODXA 5HGAB 1OF2A 2K1MA 1NEZG 1NFDB 2I27N 3QFDA 1XAUA 3NACL 3U0PA 2X4NB 2HLFC 3MROB 4L8BB 3VWKA 4DK3A 2DOCA 2J2ZA 1XF5A 5SX4I 2NW2B 2CLVB 3O4LE 4MCYB 4LF3B 1N2RA 2G2RA 1M7DA 2DB8A 5FKAB 4X98B 2Y72A 5L2KE 1RUQH 2NZ9C 1WFUA 4Y0GA 5BZDB 5I1KL 3LOWA 3V6BR 3NOIA 1IGMH 1KC5L 3LS5L 2V5YA 4AL8H 4JAMB 4CU7A 5D7LB 1TQBB 5H37H 2BCKA 4S10A 3M17B 1DL7H 3Q3GA 5KANG 1H3GA 5F70A 5GGVL 3DUUA 5B3JE 1YYLL 2A74A 3I3EA 1NLDH 4D8PB 2VXUH 1VPOH 4NC1C 5D2NE 3W81A 5HYJE 2AK1L 1QO3B 1CG9B 2X1OA 3OTTA 1JNHA 3QDMB 4WO4C 5TDOB 4HUWB 1ZK9A 4S1DD 2IADA 2NX5E 3HPJB 1LDPH 2WSKA 3CVHL 4B7IA 4CVUA 3CFJB 1T4KA 4BSWA 2R0KH 3VFPB 3P9MB 2LVCA 1VA9A 2HJLA 4M5ZH 4HS6A 5KVDL 4OTXL 1MCLA 3TC9A 1JHTB 4KK8C 5I66A 3S88H 3H42H 4UIKH 3B2UD 1UWGH 2AV1A 3LAFA 5C07D 4KI5C 4FQJL 4DVBB 3BQUC 4X4ME 2V2WA 4XNZC 3L7EA 3MOAL 1CDHA 3O3AA 3KAAA 2FL5B 3ZTJG 4K23H 3STZB 3VJ6A 1G7MA 5ECJE 5CBAB 4O00A 4F7TA 1P7QB 4MQTB 4OT1L 5DJZA 2ZG2A 4JFED 2HWZH 4YFLF 5EOTA 4JFXB 4FZ8H 5MI0C 5I2IA 5DMIL 1GC1H 2Y36H 4YDKH 3T0EA 2E7CA 3IAGC 1J0IA 1PYWB 3QZWB 1TVHA 4K7PL 4NNYB 3WO4B 4LHQB 3ARDD 5LGJB 2EE6A 3AY4A 2UZYB 4YO0B 5GISH 4GRMA 2HKFH 1T20A 3D6GA 1CFBA 4UNTA 3FN9A 3RUGA 5E8OB 3RZCA 1J05A 4UOW0