4OUUA

Anti-mt1-mmp monoclonal antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVGLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords anti_MT1-MMP Heavy chain
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuA01
5FM4A 1U8KA 3KPOB 3LH2H 4Z7VB 3SY0A 4M1CD 4J3OC 1KOAA 3K2UH 4ZNEE 2XQBH 5EU5B 5GS1B 5HY9B 3HNSH 5IW6B 2CKBH 1YY8A 5F3BB 3UTSA 5ID0B 2J12B 2IJ0C 4PBWD 4OZGB 2EH7L 3V4VH 2X4PB 1FVEB 2QQQA 4KKCC 1HXMA 5GGRA 4EDWL 3PQYA 3F7YB 5DQDL 1X7QA 4J7RA 4PJEB 5FKAA 3I75B 5C0EA 3FO2A 4KQ3H 3W0WE 4Y16A 5LGJB 3S3PA 1RAMA 4AEFA 5FYJU 2NY3B 3MLWL 2E9IA 1G7PA 3SGKA 1CLYL 1CXFA 3L3JB 2VXVL 1H3UA 5HHXL 3LQZB 3OKYA 1S8DA 3QJFB 3BXNA 1C5BH 1F58H 4FQHA 4XPFL 5DZOA 1OCWL 2A74A 4M6ML 2OJEB 3QWRA 2E9BA 1RZKH 1TZGH 2BHZA 4I3SH 4L3EE 2E5EA 5IBTL 1HYSD 3I6LE 1HQRA 3FTGB 1RZ8A 2WSKA 4K7PY 3WIFB 5CD3A 4OIAA 1T6WA 4QWWC 3O11B 4JGJA 5D7LA 4ZPVA 1CDCA 1DUYA 5T1LD 5IHZB 4WEBL 1T66D 1HHGB 1PQZB 5E2TH 3V6BR 1SJEA 2C3VA 5IB5A 4XXCC 4RGND 4FQCH 3B9KD 5EA0H 4G8EA 3T2NL 2UYLA 2X4OB 1CDGA 5I76A 3L3HA 5ICXA 3BSZL 4Q6IA 3TNNA 2ZUQC 1DSFL 4YLQT 4KHTH 3TA3D 4IIQA 4BUHA 2YD9A 5DTFA 5I18L 5CMAA 2VZ3A 1DBKH 5MP6H 5EZOH 3WO4B 1RHHB 3FFCA 5BMFL 1BVZA 4M5YH 3UBXG 4CDHA 2VLME 2Q3ZA 4AL8H 4YHLL 3BKCH 2I25N 3V5DB 5T3XE 3N1FC 5JPNB 1EO8L 3UMTA 3VXSD 4KZEL 5F7UA 1EPFA 3WN5A 4R3SB 1NCDH 3I6KA 3F7PC 5D6DC 2NZIA 1CGXA 3RI5F 2VLKA 5MEQA 1NGXB 1FBIL 3IDIB 5AD0A 4M3JA 3LB6D 4U7SA 4JDVB 3KNBB 3V6ZB 3MBXL 4JFEA 4L8DA 5J7CC 1KB5L 5E70A 5C0RL 2N1KA 3NH7L 4BQBA 2CSPA 2MWCA 1CFVH 3OKMB 5DJ0A 3STZA 4K07A 3T1FB 3QDMD 2G60H 2QLVB 1JGVH 3NIGE 2Y5EA 3G6DH 3LPGA 1X44A 3PWVA 4J4PD 4PG9A 4G42B 2EC9U 1KYOK 5CZXC 1ZKAA 1KT2A 3CVHA 5H2BA 4ZS7H 1FFRA 5EU7C 3U1SL 4YDVB 3LKNB 2DMKA 4X8JA 5A3IC 3NIGF 5BOPA 1DZBA 1M6OA 2ITDA 4WRLA 3PWUA 1XGTB 1SJHA 2X6MA 4UIMA 2IBBA 3LN9A 3NAAH 3WFHB 1IEHA 4RWYL 5ID1B 4K3JL 1TCMA 1QFWI 3IB4A 5DC0A 2WBJA 4L4TD 3DBXA 1H8SA 3LEVL 3VFUA 1MH5A 2XQYG 3TO4C 4TVPH 5HJ3A 1BBJA 2BVOB 4A6YA 3LEYH 4DN4L 1SY6H 1IMHC 3BP4B 4CW1A 5DHYB 4DEPB 2ZUQB 4GW1A 1JNNL 1NCWL 2EE2A 3QDJE 1MVUB 4ZNEA 1NPUA 5I1IH 3MV8E 3RKDD 3HLAB 3WFZA 1IL1A 1W72L 2F5AH 1UWXK 2EIDA 1UGNA 2ZSWB 3HZYB 1YEHL 3QZWA 1MCPH 3IFLL 3LV3A 5F7EL 3ARBB 4M6OL 2IFFL 1IGMH 5JO5A 5J06A 3B43A 3CDFA 4NO5B 1DBMH 3Q0HA 3W0WA 1G6VK 5C0AE 3BDYH 5DUPH 1K5NA 2HN7B 3PGFH 3DVNB 3FONA 2DYPD 5JXEA 1WF5A 3SBWA 4IRJC 4LQFH 4PRHB 5ETUA 3S37H 3INUH 4L29A 4QRTA 1UENA 2GK2A 5MERB 1R3KB 5KVDL 4RFOH 3HAEG 4WUUB 4J12A 4HIHB 4MA7L 1YNKL 3NMEA 4XBPA 3NFNA 4QKXB 1A6TA 4L3EA 4XVUD 5IWLC 3LQAL 2PN5A 2G9HA 2AJZB 4KC3B 5D5MB 1GVIA 4OCSH 5JLZB 4I4WB 4DTGH 3MROB 1CG9A 1QRND 3GBML 1J0JA 1Q72H 3TH2T 1F8TL 3UX9B 4TRPH 1EH9A 3MRGB 1TZIA 3ZO0A 1A6VL 1NBYB 4DKFH 4XX1E 3HHRB 2QADD 2Y07L 3DSFL 5IEHA 2AABL 5DUMH 4ZTOL 5ACZB 1BQSA 2M1KA 1NAKL 3QNXA 3MBED 5DVOA 3SE3A 2BNQB 4DUXA 3K3QA 3GI8H 1N2RB 3TO4B 4WW2F 4Z0XB 1V8HA 1Q9WA 1F3DJ 3RWDA 4XWOC 4CAGA 3VFMB 1NFDB 5L9DL 3BJ91 1AC0A 2AV1B 5GGUB 2WWMD 3V4PH 2EDBA 3BO8B 2IADB 2R9HC 1EXUB 4NN6C 1A8JH 3F12B 4NQXA 5EOCH 1ZANL 5I1AB 3GSNH 4X7DC 4YXHL 3GJEA 3O45B 3F65A 2HRPH 3DX6B 4MWFB 5LQBH 3VXMB 3S34L 5CP3A 1BVKA 2ZJSL 1HHJA 3IGAA 1FLTX 2EIZA 2C26A 4D94A 5D1XA 4CGTA 4JEGB 2A0LD 3PHOB 1JZ6A 3T2QA 5FAAA 1S9VA 2HT2D 2NY5H 3DPBA 5KVGH 1B90A 4S1RH 1IAOA 1RK1A 3CSBA 1JNHB 5HYIA 1ND0A 4R4ND 1DDHA 3C5JA 3QEQD 5C9JB 4W4OA 1NLDL 5IQ9B 3TBWA 3KYOA 1CK0H 3QI9A 1L7IH 2NY2D 2R1YA 3MV01 2W0FA 4IRJB 3ILPA 1MAMH 3FB7A 5BO1H 2BDNL 4BELD 3QAZB 4AEIH 1F6LL 1OLZA 1KYOJ 4Y19B 4BH8B 3RZCA 4IRSC 3K2UL 1FZMA 1ITCA 1T04B 3RTQB 2XQBL 4LLYB 4L1DA 4PTUA 2Y72A 3GIVB 4WWKD 2CKBL 2NPLX 5CEYB 3OGCB 4MVBD 3N06B 4OFPA 1U8LA 3DROA 4NO3A 4KRMB 4YHPB 1J8HE 2YPKB 3V4VL 3UJIH 4QHKJ 1BIHA 2VISA 4N90E 2DD8H 5F7KC 4MDIB 5C8JA 5DMJB 1DVFC 1LO0H 3TCLB 2Q20A 3QUYD 4DKAA 2R1WA 3QNZB 3MV8A 5BQ7B 2AJUH 2IAMD 3L3GB 4JHBA 5D7KE 3KS0J 4HKBA 5FECB 4JQXA 4NN6B 4JG1H 1XGQA 3BT2H 4E41D 3KPLB 4MAYB 3MGOB 5C7XH 1A1MB 1C5BL 1F58L 2HVKA 4B5EA 3VCLB 5GXBB 1MJJA 4OKDA 2MJWA 2XICA 4PJ5B 1CLOH 1RZKL 1TZGL 4I3SL 3IFPA 2O5YH 4QRRE 4JFOB 2UY7A 1YY9C 1JHTB 2XN9E 2DN7A 4HBQA 5JPMB 4GKZB 3REVA 1C5DB 4I1NB 3TN0C 5L0QC 5JA8B 2ZG3A 3O9WD 3T65B 1I8LA 1BD2E 3KWWB 4ZAKB 5E2TL 1U8HA 3DVIA 1CGUA 4FQCL 3C60D 5HPMA 5EA0L 4LK4A 4OCYH 3PL6C 2VDPH 2AQ1A 1E4KA 2ADGB 2KL6A 3TPKA 3CFKB 4NZJA 3GHEL 2NLJA 4KHTL 4F7MB 3RGVD 4LRNH 1G7JB 1U58A 5MP6L 4LOUC 5EZOL 2JCCF 4M5YL 4WW2A 4IRSB 3V7AG 4AL8L 3BKCL 3CFBB 2JJUA 3KJ4C 3WLBB 1L0XA 1UQSA 2HMID 1CFTA 1HSAA 4O9HH 3DO7A 1NCDL 1Q0XL 1UH3A 3U9PH 1WV7T 5EZLB 2C9AA 1JUFB 2FIRT 1LDSA 1U3YA 1CFQA 4LBEA 4MLIA 5T3ZH 5BZDB 3QG7H 3NFSH 2Q87A 2EKSB 1JGLL 1FDLH 2Q3AA 1CFVL 4PGCA 1DVFB 4PS4L 4P5TC 2AGJH 5DJYA 3PP3H 3CH1B 1WBZB 4NQEE 5H37G 2FJHA 1JGVL 3G6DL 4RZCB 3HMXA 3MV7B 1JV5A 3I50H 4U6XB 5JOFB 2OL3H 1I7RA 1MIMH 3WDHA 1S7RB 1S9XA 2HG5B 4ZS7L 3U0TA 3EFFB 5KANI 1JHLH 3T0EE 4RWHA 3GO1H 2X1XR 2C5DC 1RZGB 4QHNB 3NAAL 2YD6A 1QFHA 1SMAA 1Y6MR 2VLRB 4OZHE 3W9DB 1F42A 4Q9RH 3PE9A 5AWNH 4UTAH 3UDWA 3ZKXC 5B38G 3ARFC 4ODSH 4TVPL 4OIIL 2UZYB 2BNRE 1A1NB 1JWMB 2HWZH 2X89A 5HHPB 1EEQA 1U3ZA 2FBJH 3LEYL 2N7AA 4OZHF 4Y4KC 1XMWA 3TM6A 3VFSB 2FECI 4J1UA 4P2QB 4LLMB 5DRXB 3L3OA 5DMYA 4KDWA 1YUHA 1NDMB 3CU7A 3KXFE 4M9PA 4PGDB 1QHPA 5I1IL 2ZNXA 1G9MH 1NEUA 1U91A 5FO9B 2F5AL 3N0PB 5F1OB 4PR5B 3BKYH 1MCPL 3MV9E 5B8CC 1UH2A 1J8HA 2W60B 3AU1B 4ZSOB 3NIDE 5EO1B 1UYWH 2QJDA 4OLWH 3BOVA 1IGML 1CDIA 3NCFB 4G8IB 3LCYA 1T7VA 3LKOA 2E7BA 3GJFH 1OTSD 1DBML 1HN1A 3WIHA 3BDYL 5DUPL 1BFTA 3NIDF 1QSFB 1L6ZA 3B9EA 2GCYA 4HWBH 1R3JA 4H20H 4QCIB 2AVGA 4LQFL 2CIIB 2F74A 1D9KC 3S37L 4FFZH 2DQUL 3INUL 1CGYA 1LMKA 3VH8B 1U95B 3VXRD 4P5TB 5DQJB 3PWPD 5KSAD 4RFOL 1I7UA 3HR5B 2GKIA 5ALBH 2DJUA 4EQ2A 1KCRH 1TTUA 1FO0H 4WFFE 5IMMB 3FB5B 2ICWA 4PRBA 3S7GA 4HGMA 1M71A 4QRRA 4DTGL 5F1NB 2XN9A 1Q72L 1A7QH 3WFBH 4U1IB 1UEYA 4DKFL 4MB5A 2HA1A 1BD2A 3QIUD 2R8SH 1EFXD 3QCVH 5DUML 2H3NA 4A2MA 2OX5A 3WLWC 1GOGA 3GI8L 3MMEB 4ZFZA 4PJAB 2P42B 2C1PA 1KJ2A 4ETQB 2JCCA 1RD6A 3LY6A 3D6GA 1Q9OB 2FEEI 2LU3A 4U3HA 3I3EA 2GTZB 4ZUUB 2FX9H 2K7PA 5TDNB 3FMGH 3AY4A 1KXQE 4HK0B 1S5IH 2DLFH 3SOBH 5JDSA 3GFUA 4PJFE 2H2SD 4S0TD 4I5BB 3RWJA 3GSNL 5JIPA 3P3YA 3MV11 1MWAB 2EDTA 4LLDA 2ICEB 2HRPL 3A0OA 5LQBL 3NCMA 1KGCD 1YEIH 3ISWA 1HH6A 4FTVB 4KKBC 4KGJA 4O51B 4PJFF 3IFOB 2NY5L 5KVGL 3QQ3B 5D1QB 2DKSA 5HD8C 1AHWC 4S1RL 1YMMD 43CAA 3TT1L 3NCJH 4PJ8C 3VDCA 1MJ7H 4JN1H 1CK0L 2JLLA 1L7IL 3QQ9C 3ARSA 1NDGB 2XTJD 5C0GB 1G7IA 1J0ZA 4ZDHB 4NQEA 3IXAA 2VH5H 4MXVE 1ETZA 4H8WC 4BSVB 1MAML 1D9KB 2X4NA 2XKNA 5T33H 3BWUC 5BO1L 2IPTH 4X6BA 1D5XB 1QBAA 1A9EA 2AXGA 1NBZA 1FLRH 3IDJB 4AEIL 2QSVA 4MXVF 4H5SA 3ULSB 1JN6B 3T0EA 2DLTA 3CGTA 4NQSB 3GJFB 3U30B 3BP6B 5LG1A 1A7RH 1YEDA 5C0FB 2JTDA 4C83B 4OZHA 4D8PA 5C0DB 4M4RA 5ESAA 5IF0A 2ADIB 4R97B 1OPGH 2FYYA 4LLUB 4TTGA 3DMMC 2WBWB 4ETYA 2A6IB 3UJIL 1VEOA 2BNRA 3DNKA 4LPYA 1A6AA 2DD8L 5C0BB 3QNYA 1LO3H 4IOFC 3RWCA 4OQTH 5LXGH 1LO0L 2QKIB 1CFSA 1FGNH 1NC2B 4MA3A 1BQLH 2JK5B 3SGEI 5I1CH 3KXFA 2Z0BA 1CZ8H 5D4QA 1YYMH 2AJUL 1RK0B 2AXJA 4R7NB 1ERNA 5I1GH 1ZGLP 3TVMB 3TZVA 4Z5RB 4KDTC 4OZFH 3QBTB 5C09B 3HI5L 1R3IH 4BFGA 5C7XL 1R24A 4LLVB 4YDKH 2DMCA 4P49A 3RWIB 1CLOL 4RISH 1UFUA 3QB7C 5M95B 4ODUA 3ROLA 3BUYA 1ZT1A 4PJDB 5EU3A 1DBAH 4N5EC 4Y8DC 1I9JH 3SDDD 3D3VE 3EBAA 3QO0A 43C9B 5IB2A 4PJIB 2EDEA 4G80B 4QF1A 4PJ8B 2DMBA 3O6FB 3RUGB 1I1AD 2APWA 3JWDC 4F7TB 5AZ2L 4LKXA 2DICA 1GPOH 1UWGH 4OGYL 2BVYA 4OCYL 4ELKB 3JUYA 5E1AA 5D2NC 2W0PA 5AAMA 2DWDA 2APTA 3DV6A 2YN3A 4OAWB 1JWSB 4LRNL 2CH8A 1I8KA 3EOAB 3LN5A 1FNHA 1DE4A 1ORSB 3ZHLA 4PYGA 1JPSH 2IANE 4KRLB 2E8YA 2MMXA 2D7TH 3E3QE 4O2FA 1P4BH 3RL1B 4U7KA 4G5ZH 4WIQA 5MEPA 1A9BA 2EXWC 4O9HL 1NMCB 3BFOA 3EZ8A 4K2UH 3U9PL 3SDCC 4WV1C 4JPVH 3TWCH 4XVJH 1HEZA 3CDCA 5J3HC 3PWNB 1BOGB 5T3ZL 3QG7L 3NFSL 2MKLC 4UNVA 4F37K 1YN7B 3MA7A 1U8JB 4GRLA 1BPVA 4EDXB 4EVNA 1FDLL 2B2XH 3BQUC 1CVRA 2VYRE 4JPKH 1XIWD 4TOYH 4U6HB 4PJFA 2XZCH 2ORBL 2AGJL 4POZD 3GGWA 3MJ7B 4FN0A 3BISA 3BHBA 4F7PA 1K8IA 2X1OA 5D8JH 2OQJB 1QBMH 3OAUH 5IJKC 3FT4A 1LGVA 1ZSDB 3I50L 3H2WA 2VC2H 1EUUA 1H9VA 2OL3L 1MIML 3QXDB 1P2CB 5DGRA 1WEJH 1VESA 2DQGH 1ADQH 2X4QB 3ZSTA 4AM0B 4YDJA 2J4WL 5DRZA 1I7ZA 1LP9B 3GO1L 4KI1A 1VFAB 5CWSB 1FFQA 1MWAL 5D93B 1DQLH 4KK5D 1BF8A 4Q9RL 4FG6D 5AWNL 4QNPE 4UTAL 4HIEB 2EDYA 4PD4K 4U4BA 4U6YB 1OGAD 4OI7A 1YN6A 4YHNA 3BGMB 1I4FA 1JZ2A 4KRPD 4Y5YA 2HWZL 3UTZA 4PYHA 3ULUD 2FBJL 1F6FB 3UJJH 1XZ0A 3KPNB 3QDGE 3CFIC 1WC7B 5T1LB 4K8RC 4H88H 2NY6D 4TYUA 5E24E 3JWNC 3WFCH 1RZJH 2JJWA 1Y0LB 3MO1A 5BS0D 4RGNB 3MZTA 1R3LA 3B9KB 4WJ5A 1QR1B 4NPYA 1G9ML 3GSQA 3OGOE 1DP0A 3WL9A 5FGCE 3TYFB 4XB8A 1HILB 3BKYL 5ANMB 2IC2A 3CPLB 3RIAK 4OLWL 4F8QA 2RFXA 5I2IA 2XRAH 4FMFA 4CADA 3R06A 4LCWD 2Z31A 5HHMD 5J12B 2BOCB 3X12B 4FQXD 2R0WL 4ODBD 3VXSB 1FN4B 1V7MH 4MJ2A 2O61A 2EO9A 3DECA 1XCTA 4HWBL 5CJ8A 5I8CB 3P9WB 4H20L 5DFVD 2V2XA 3OKDA 35C8H 4E0RB 2R4SH 2X7LA 3DV4B 3BQUB 2VXTH 1VCAA 4FFZL 4J3SA 3SE4C 4AIZB 5DQ9B 3O8XC 2IBZY 1R5VB 1KCRL 3GMNB 1FO0L 5I8EA 4WU5A 4L4VD 1OAZL 4K94C 4HS6A 5AUMA 4PJHB 1BZQK 3B2UC 1D7FA 4I0PC 2ICCA 5C1MB 2D31A 1E27B 2H8PB 5L2JB 2MSPA 2NY4D 3JUZA 2EEAA 4GQPH 3D3VA 2XXMB 1A7QL 4MAUH 1A7NH 5E9DD 3WFBL 1JE6A 2AV7A 3GIZH 1T1ZB 3LQMA 3UTPD 4P46A 4YIQB 2X4TA 4BQ8A 3FRUB 3LMJH 4D9QD 3JV0A 1TCRB 3REWB 4V2BA 2V7HB 4Y2DA 1I3RB 1MCRA 4M02A 3VWKC 3MJ9A 5M94B 3DHMA 4LVEA 3SCMD 4Y8AA 1K4CA 3LKSB 3WNMA 4DUWA 2FX9L 3FMGL 1S5IL 2DLFL 4XAWH 3SOBL 3VA2C 2IANA 5DHXB 4XH2A 3C5ZA 4PLOB 1T4KB 5ACLA 3E6HA 2CO7B 2FO4A 4Z7NE 3U2SA 4P2RE 1RY7B 5HVHC 1J87A 1YEIL 4HHAA 1NQBA 3K2MC 4YFDB 2AJ3A 1IGYB 4PIRF 3L6FB 3DUSB 1JYVA 3MR9B 2VQTA 4Z7NF 5B39B 4QYOB 3T77A 3CVIH 3NCJL 2ERJB 1SM3H 1VGEH 2P8MB 4KTDH 3ME0A 4JN1L 3UP1A 1EGJH 3OR7B 5KANG 2ESVE 3V2AR 2A83B 4GQ9L 2VH5L 5TQ0L 2DM7A 5SWQB 4X9BA 2VNCA 1PKQE 5T33L 1JWUB 3VFWB 2IPTL 4OB5H 4Y4HD 4YFLI 4Z95H 4TPRH 5DSCB 4DAGH 5E8OA 2DYPB 2D7NA 5E2VL 4YDLC 1UXSB 2LFGA 1FLRL 4PJXE 1QEWA 3V6FA 4Z6AT 1AGCB 3BN9C 2H41A 4YGAB 1IM3B 4ZXBC 5MHSD 4K7PH 3KLAB 1HHHA 1A7RL 5DDHA 4XB7A 2OTWB 3O0RL 1L4IA 5FOBA 3MRHA 4PJXF 1FNGB 3TC9A 3BZ4A 4NO2B 4HJGB 2I9TA 2GAZB 1OPGL 3EDFA 4KY1H 2PUQT 1ACZA 2P5WD 1FZJA 1MNUH 4NRYB 4PD4J 1J9CT 1MF2L 5C0IB 4YX2H 2JB6A 5DHVB 3QDGA 3VWKB 4HUUA 2WZPD 4UQ3B 2MQCA 4OQTL 2AKRB 1W0WB 2EEDA 2QADB 2WLZA 5LXGL 1FGNL 2YHGA 2OSLA 1B4JL 3V4UL 5I1CL 1CZ8L 1YYML 1BQHG 3IDMA 3NZ8A 4M6NH 4EUPH 5KSVA 5EU6D 4ZS6C 5I1GL 1OSZA 1MPAH 3OKNB 1Q0YH 2OXHA 1MJUH 2F54E 5IVZB 3MRPA 2EE6A 1R3IL 1ZWIA 5D2LE 2BSTA 3HC0B 4JREC 2VDML 5HVHB 4RISL 4CN1A 5HBBA 3MGAA 2XKUA 2A6JA 4KQ4L 3Q6FB 1QLEH 5E6IA 1DBAL 3BWAB 5DRNA 1I9JL 3D18B 3WJJA 4JY5H 4GAYA 3PNWA 5D2LF 5LAXB 3L5WA 4X5XA 5JHDD 3R1GL 2GSGB 1FORH 3HUJE 5I1DB 1CD1B 4M8QA 3SGKC 3N1PC 2X4SB 4OBRA 5IMOA 1GPOL 1UWGL 4YK4B 5F89B 4PGBA 4U1JA 3BH9A 3RA7H 3C9NA 1H15B 3RDTA 3LOWA 4BUGA 5EZJA 1Z9LA 1SYVA 3HUJF 4I8DA 5IK3A 2ZKHH 4YNYA 2NY2B 1MFCH 4YDLB 2V2TA 2AAVA 1KJVB 3GBNH 1J05B 3S88H 5BZWA 1JPSL 1G7MA 1F4XH 4ZXBB 2D7TL 1P4BL 3X14B 3PP4H 4G5ZL 4LDEB 1T0MA 2EC9T 4NWTH 3RPIB 3OG6B 1A21A 3BZFA 3F7VB 4QHMA 7CGTA 3R0NA 4N0UB 5AEAA 4A2LA 1FFPA 2BVQA 2FNBA 2ZCKH 4UBDD 3UTQA 4JPVL 3G04A 3TWCL 1RU9H 1U93A 3S37X 4XVJL 4XZUB 2I24N 3B5HA 3EJZD 4CRPA 2P43B 4LSRH 1N5AB 3BP5A 4WWKB 1HINL 2N4IA 4KPHH 4JFQA 4QTHA 5F44A 3WKNA 4FQLH 2B2XL 2ARJB 2Q8BH 3P4OA 4JPKL 2NXYC 4TOYL 2XZCL 5ELIA 3V5HA 2VAAB 1QVOB 1FL3A 4HIIB 3GSRA 4S2SB 5D8JL 3LKRA 1U0QA 3VXNA 5C86A 4P2RA 2VLJD 1QBML 2Y9RT 3OAUL 4WFGD 1ZVHA 2P7TA 1MAJA 5JW4N 3FRPA 1UB6A 2VC2L 5EC2A 3RVXD 3PXHA 5DR5H 3ABZA 4KKLD 4UOW1 4QEGA 5SX4I 4P2OA 3LAFA 1HXYA 1N64L 4DKDC 2IAMB 2P8LB 2BFVH 3FZUD 4TNVK 3VFRB 5T1KD 1ZLUK 4JFYB 5GGRY 2OS7A 4E41B 4ONFH 1DQLL 3IJSB 1KCVL 4LAQH 3S36H 2ESVA 3HE6A 4OF3A 3E6FB 1TTFA 4RQQB 2EYSA 3GRWH 5I30H 1PKQA 5KTEH 2VABB 3AAZB 3VI4E 4CU6A 3L9RB 4TTDD 4N1CA 3HN3A 5B3NA 1CE6B 1H3XA 2R2BA 5L2KD 4BZ1L 3UJJL 4PJXA 2IH3B 5DD0H 3O9WB 4QRPE 4H88L 3B2VH 5TF1H 4XPGH 4WHYG 1RZJL 4AEEA 3VI4F 1MCDA 1RUKL 1GIGH 3C60B 3MRMB 5TPWH 3TBYB 4RBPH 1PEWA 3VWJD 3F5WB 1XGUA 4M93B 4QXWA 3MLZH 3JV6B 3DIFA 2WBJC 4XGZA 4FABH 1D6EA 2VSCA 3RGVB 1JPST 2H2PC 2XRAL 1T80A 4GRWH 4P3CL 1S9KC 5EOTB 5D9SA 4B7IA 1PZUB 3AREC 1I8IB 4IHOA 4YBHA 4J3UA 5EBMB 3CSYB 1F2XK 1V7ML 2Y23A 2ZPKH 3BYYA 4RMSA 3RQ3A 1YQ2A 2CLRA 2IALB 2P46B 3DUUB 4GBXA 2R4SL 3GBLA 3RWEA 4JDZB 2VXTL 2F54A 5GSVA 2GT9B 5E0QA 2IBGA 1RIHL 2Q76A 4R0LB 1FC2D 1JPFA 5E8EB 1WBXB 5D2LA 3Q6GH 5F97E 4N9OB 2B7DT 4EI5D 3PDOB 2R69H 4PP2A 3DJ9A 3TGXA 1H5BA 5I1LA 3ARGD 3MYJB 1FAKT 5D7IB 1MCWW 3IDXH 2PW2A 2AXHA 5GHWH 1HCFX 2ATPA 4MAUL 5IKCA 1A7NL 3EYQD 3B9DA 3GIZL 4O00A 3VDBA 4F33B 1CQKA 5IOPA 3HUJA 4HUXA 3O3AA 1IEBB 2V2WA 4PB9H 3VGAB 5C6TH 1DLHA 4U0RC 4X7TA 1MCLA 1KSRA 5IB3B 3MCKB 1KPUB 3RX7A 4RIRB 1CFNB 3MOAH 5E8NA 2VR9A 3HG1E 5CP7A 1AGBB 4XAWL 4NN7B 4XVTH 4YO0A 2D0GA 3QIBA 1OAYL 1QQDA 3MLVH 3A6BH 3IS1X 4LNRA 2APFA 2XNAA 2X05A 1VA9A 4HS8H 5IBLD 2DS4A 4O2EA 3SDXE 1T20A 1K9TA 4TN9A 4PTTB 1WCBB 5IR1A 1J88A 1A3QA 4JFPA 4R2GD 1ZT4A 1Y6NR 1H3VA 2L4OA 2VWEC 3JXAA 4HKJA 1XH3B 3GMRB 4M43H 4MNGB 4NRXB 3CVIL 1SM3L 2D03H 3HPLB 3QUXA 3SDXF 1JFQH 5CILH 1W8OA 3IVKB 1R3HA 2IQ9H 3UTTE 2ZWLT 1A6PA 3BIBX 1EGJL 1NEZA 4OT1H 2FHCA 4HKZA 4ONHB 3D69A 2HJKB 4OB5L 4WW1B 1FVCA 3O41A 5SV3A 1ED3A 4Z95L 4TPRL 4V1DE 4DAGL 4OBSA 5DJDA 4HWNA 3FO1A 2OMBA 1M7XA 3L3KB 4GRWB 3U36B 4K7PL 3VXRB 5B38B 5IM7A 2ZCLH 3PWPB 4JO3H 5KSAB 3MX0A 1T1XB 5FEBA 4PJCE 1OQXA 2VR5A 3OB0K 1FG2B 3GSUB 4KY1L 1J8KA 3PGCB 1OARH 1I1YB 4FFVD 1MNUL 4YX2L 4BSWB 5JORB 5EWIH 4QRPA 4U0RB 4PJCF 3S9DB 3TYGL 2EDHA 1EFXB 4FNLH 4NBZB 4YHZH 2EDQA 3EO9H 1QSED 3VJ6B 1NAMH 1IGTB 4M6NL 2OTUB 4U1LA 2QQKH 1MPAL 2AEWA 5GQBA 1U36A 1Q0YL 1JNLH 1KXVC 3CDGB 3ARTA 4JFFD 1MJUL 3O3DA 4ISVA 1NSNH 2Z92A 1V05A 2GY5A 4PRAA 3P9MA 3EYUH 2APVA 1GGBH 5C9KA 3BP7A 1QKZH 1QLEL 4PV8B 1A47A 4RAHA 5EG6C 3TJHC 4JY5L 5D7JC 2BMKB 4JAMB 5MEOA 4QRSA 3K1DA 1ES0A 4GAGH 4AIOA 5C6WH 4Y5VC 4XCCH 3G5YA 2Z93B 4ZUWB 2NX5E 1FORL 1LK2B 1HQ4A 4XXDA 3IJHA 4ORZC 2GTWB 4LSVH 2GHWB 1JK8A 5GRXG 5CCKH 1YMMB 1IBGH 3RA7L 5J0BA 5DRWA 1MIEH 4TVSa 4DZBB 4MX7A 3QCTL 1N7MH 1HI6B 1WTLA 2ZKHL 2AJSH 1MFCL 1AP2A 1T5WA 4P23C 5D7SL 4OZGE 1AKJA 2B5IC 3QXAA 3C8DA 5FF6B 1Y6KR 3S88L 1CICA 1WUNT 3PV6A 5ICZA 1F4XL 4UV7H 3PP4L 4PJEE 1KTDA 3G08A 1I3GL 4DCQA 3BESR 1VKXA 2EXYD 4NWTL 5IIEA 2W0LA 3FRPG 1EAJA 4OZGF 4P5KB 1FRGH 5F7MC 2ZCKL 1BJ8A 4X6CB 1KTLA 1D5MA 2RCSH 4PJEF 5HVWA 4LSRL 2EYTA 1WICA 3ULVF 2L7UA 5TDOA 3IT8D 5DJ8B 4KPHL 2VMFA 4Q9BA 2VKWA 4LPVA 4KK6C 1QUNA 4R6UA 4NUGH 4WNQA 3DRTB 4Y16D 4GW4B 3O4LD 1QO3A 5CIPH 1E4XI 2WP3T 3P9LA 5DA4A 5DS8A 3HI1A 3CFCH 4P4KA 2P44B 3ARZA 3AM8A 4TUJB 2R2CA 3SDXA 1T2JA 3RX8A 4BH7B 2DTSA 2J8HA 3RWHA 1YEFH 5DR5L 4R4BA 1JGDB 5CSBA 4GFTB 3CFEB 3MOQA 3QWRD 2E7LA 3HS0A 1YECH 4X6EA 3ULUH 3OAZK 3TO2B 2H6PA 1O5DT 3UTTA 4ONFL 4JFZH 5D7LD 4LAQL 3S36L 5LWYH 2OLDA 3O2WH 2HRLA 4HG4J 3W2DL 4KROD 3GRWL 3LS5L 4X7FC 1MCOH 5KTEL 2AXFB 1MCIA 1NCAH 1EBPA 3HPJA 4V1DA 3SDDB 4PV9B 5D6CA 3D1MC 5DD0L 3ZKMC 3B2VL 5TF1L 4XPGL 4JANB 5IMKB 3MLYH 3FQWB 1I1AB 3UEZA 1QFOA 2F19H 2PXYC 1GIGL 4NWUH 3GMLB 4P23B 1Q94B 2DL9A 3BI9X 5TPWL 4D0DA 5ABDE 4UINH 5I15H 2JJVA 2R23B 2HTKC 1S7QA 1DQJB 3G5XB 4NZRH 4PJCA 3MLZL 4OLYH 3S5LA 1G7LA 4FABL 3X3FL 4LLQA 4OD2B 3UDWC 3VRIA 3QFDB 4Y4FC 5HGAA 3WYRA 2VLKD 5CEZE 4DW2H 2PR4H 1A6ZA 3OHXB 1QLFB 5FK9B 2R15A 4WFHD 5GZND 2DI7A 2MTPA 3RWFB 2ZPKL 2BOBA 1KV3A 4JFED 2VQUA 1KEGH 1LK3H 3MRCB 1NFIB 4WDIA 4ENED 3OF6A 3WD5H 1P6FA 3IETB 4CN4A 4CKVX 1Z9OA 2YUVA 3STLA 1K6QH 3I2CH 5IVXB 2NW2B 4XBEH 2V5YA 4LCCA 3Q6GL 5JIHA 1UJTA 3HNTH 3B8YA 2R69L 3UZEA 1GJIA 3IDXL 5TDPB 5GHWL 1W72A 3EO1B 2NNAB 4YGVB 2RHEA 3T2OA 3VW3H 1VGKA 3QFJE 4GG8A 1T0NB 1N59A 1G84A 1TVBB 3N50A 4XRCB 2NX5A 4LEOB 3VXTA 2FO1A 2IPUK 3BPCB 3VD4A 1GC1C 2DIBA 4PB9L 1K2DB 4HSQA 5L88H 1KCLA 5C6TL 1EERB 4H0IA 3VDAA 2I60H 4F2MA 5GS1A 5D1ZD 5IW6A 2K9UA 4O4YH 5F3BA 1YEKH 3NPSB 4PRNA 3ALWA 1ZS8B 1FE8H 1ZHBA 4JKMA 4O5LL 3MOAL 4OZGA 1CGSL 2CRIA 2X4PA 1FVEA 3B5GA 4BQCA 1JYWA 4XVTL 4YHYC 1RULL 3F7YA 4WTZG 4OM0H 3HE7C 4PJEA 2PXYB 5HSFA 3I75A 4CMMB 3MLVL 5ICYA 3K8KA 3A6BL 5I74C 1Y18B 1UC6A 4HS8L 2B0SH 4QXTA 2NY6B 2JE8A 2H32A 2EDDA 5BS0B 4OD1H 5DJCB 4Z18A 4F3FB 4PRHE 4JFDB 2WQ8A 1KULA 4Y4FB 5JQHC 3ECBB 4M43L 4KAQH 5DK0B 3QJFA 2D03L 1P4IH 4WUUE 1SEQH 3H9YA 4X6FB 4PLKC 3W0WD 4CMHB 1JFQL 3CFJB 2IQ9L 2OJEA 4RX4A 5JHLH 5H35B 4OT1L 5JXED 1GOHA 3WIFA 5D5ME 4OKVA 5M7QA 5HHMB 4FQXB 4QGYA 3MRQA 1CI5A 1GZPB 1HHIA 4ZUTA 1U8MA 1HHGA 5GZOD 3EJYD 4KWUA 5D5MF 4L3ED 5C07E 4XHQA 1B9ZA 5EIIB 2BNQE 2ZCLL 4JO3L 4WI7A 2WV3A 5FFLA 2X4OA 2E9WA 3EJJX 4L4VB 5C2BH 1ZLWK 5BW7C 2CJUH 3VFVB 1B0RA 2V6HA 1LQSR 1ZGLB 1X4XA 3AS3A 1KCSH 1OARL 1I1RA 2NY4B 1RHHA 3FQTB 1CD9B 5FYKE 4LPUA 5EWIL 3V5DA 3NBNA 4XCFL 3EYSH 4R3SA 2IWGA 4FNLL 4M5ZH 4YHZL 5IFAH 3V8CA 1NL0H 3EO9L 3VXME 1U6AH 1NAML 1WCQA 5F7YC 1LD9B 1NGXA 3E0GA 3GNML 4LSQH 5I66B 3QDAA 1MCFA 4JDVA 3KNBA 4HWZA 1JNLL 3V6ZA 4YHYB 4M61B 1NSNL 5T3XD 2A6DB 3U48A 1IKFL 4HGWB 3OKMA 15C8H 1Q38A 3EYUL 4HWEH 3QUZC 1GGBL 5CBEB 2LTQC 4X83A 3MJ8B 5LCVH 2YPVH 3T1FA 5D1XD 4G8GE 1QKZL 2AK4B 4DFHA 3FT3B 5GJSH 3DURB 2RQ8A 1BJ1H 2F53D 2YD2A 4GAGL 3ZDXF 5HYQA 4PP1D 2I9LB 1TQCC 4XCCL 3IJYB 3NTCL 5E5RB 5LBSH 3TIEB 4YDVA 3QI9D 1KB9K 4LSVL 2OI9C 5CCKL 2NW3B 3DWTA 1IBGL 1MIEL 4C56E 2QSTA 3WFHA 5I16B 1XF2B 1PEZA 1N7ML 4WY7H 1RIVH 4IRZH 5MENE 2J5LC 2AJSL 3VG0H 1JHKH 2FEDC 4EXPX 3BRGC 2NYYD 1AGEB 4JPIB 2BVOA 3QFJA 4LQ1A 4XXCA 4UV7L 3RZCD 3DARA 2O5XH 4ZNCD 4ZYKA 1A2YA 1DFBH 3T0AA 3LS4H 3BD3A 5C0CE 1J12A 1FG9C 2DB8A 2CDEB 4HKXA 1ZLSH 3H3KA 1FRGL 3UPRB 5HGBB 4NZUH 1YEGH 1VPOH 2PCPB 1JF1B 1HHKB 3ZT5A 1JGEB 1M05B 2EH8L 3HZYA 2FATL 4UT7H 1U8NB 2BRQA 5F88B 4YDIH 4NUGL 5GRZA 2IPUG 4NQDA 1AQDA 5D6DA 3DHJA 2P5WB 3MRLB 4PJ5E 4WENB 4PY8I 3MV8D 4NO5A 2LAGB 4LMQI 3GMPB 1Z0MA 4M62H 2HN7A 1NGZB 1FFOB 1U92B 3DVNA 1M1SA 1YEFL 3ALXA 3HMWH 2A1WH 3RPKA 4PRHA 4HXAH 2ARWA 5EU6B 3BVNA 5MERA 1R3KA 1LILA 2LTQB 4WUUA 1YECL 3ULUL 4HIHA 3SDAD 4JFZL 4HEME 5LWYL 2GQHA 2P24A 3O2WL 2AJZA 5D5MA 2BRRH 1TQCB 5JLZA 1MCOL 1VADB 4OI9A 1NCAL 5KG9B 4BM7A 3MRGA 2E6PA 4FQJH 1G6RB 2OI9B 3EYVB 1NCBH 5BRZB 4XPBH 1A6UH 5JHDB 5ACZA 2CLZB 5C07A 4XCEB 3MLYL 3KDMB 4AEHH 1WZKA 2BNQA 2J5LB 1N2RA 3LD8C 4NWUL 4TSAH 3TO4A 4MYWB 2BXYA 4Z0XA 4UINL 4LCYB 3IAQA 4X99B 4OLYL 3VFMA 4YPGA 3MLSH 3GSVB 2AV1A 2A73B 5TE6H 3BO8A 2J8UB 1EXUA 4ODTH 2QQLH 3L7FB 4ZO7A 1BFVH 3T4YA 5I1AA 4DW2L 1VFBB 2PR4L 5A2IH 2CGRH 1YNLH 3DX6A 4MWFA 5DT1H 4IEFB 1XGYL 3VXMA 5INCA 3NGBC 5J1TC 3MV7E 4XVSH 2XWTB 1KEGL 2DQHH 2EDNA 3MREB 5HGHB 1OF2B 1K6QL 3I2CL 1FZOB 4MJ5B 1JNHA 4AT6B 4XBEL 4X0KA 2XFXB 3T04D 5C9JA 1UEMA 4JRYB 3HNTL 3MODH 1TQBB 4YXKH 5ADOH 3ARDC 3VGHA 2VLRE 2ZG1A 4G8GA 4IRJA 2ITCB 2Z31C 1HH9B 1QA9B 4OZIB 1BAFH 3WXWH 1B4RA 3U4EB 2VXQH 4MLSA 1J0IA 4HCRA 3STBA 5IWLA 5L88L 4JGMA 4XWGH 1T04A 2I60L 4JO2H 1KB9J 3RTQA 4C56A 3HKFA 4LLYA 4TSCH 5FKPB 5MENA 4O4YL 2A9NH 1YEKL 4GMTH 5I0ZA 2X89D 1EV2E 4PY7B 4MCZA 1FE8L 2DQFB 3PWJB 3LEXB 3KPTA 1QFUH 4BK5A 2Q6WB 4XAKE 5L8KB 1T3FB 5DLMH 1NGPH 4OM0L 3UCRA 3OKKA 4F7CA 5I0DA 3LD8B 2FH8A 5C0CA 5ENWA 5DK2B 5I9QB 1QSFE 3OKLB 3QNZA 1J8HD 3L3GA 4OD1L 4Y2DC 3N1QC 4HIJA 5FECA 4J3WA 2Y06H 4WCYH 4IMLA 4X9GA 4KAQL 4HFWB 3VWJB 3AXLB 4L9LC 1T6VN 1P4IL 3KPLA 1A1MA 2GFBB 2OP4H 3VCLA 4N9GB 5A40E 3NGBB 4PJ5A 5JHLL 1G0XA 4JFOA 2IFGA 5D7KD 3TFKC 1EFQA 3OJVC 1ONQB 1JHTA 1JI2A 3EDKA 4LVHC 1NC4D 3BZEB 4GKZA 1C5DA 4EEEA 2SEBB 4JFHE 3S6CA 3T65A 5ITBH 2B4CC 1INQA 1SEBB 3C8KB 1HK6A 1KG0A 1RSFA 2AI0H 1GGIH 5F1KC 2ZOLB 2HFFA 4EI5B 4HJ0C 3CFKA 2CJUL 1N6QL 1XF4B 1CLZL 3ARGB 1K8DB 3X13B 5AYUH 4F7MA 4JY4B 1RUQH 1BD2D 2OMNA 1G7JA 1OP3H 3AS0A 3F58H 3S96B 3G5VB 4IRSA 5E4EC 1UCBH 3CFBA 2DJ4A 1MLCB 1R5IB 3KYKH 1YJDC 3EYSL 5H94B 5IFAL 1RZ7H 4M5ZL 2F8XC 1NL0L 1U6AL 1EAPB 5EZLA 4LNVA 4LSQL 3M17A 4KKNA 3FT2A 1JUFA 3SGDH 1C12B 4ALAH 5BZDA 3P4LA 1OM3H 3S36X 1DVFA 3P0YH 3PJSB 4P2YA 1I85C 3CLEH 5LCVL 2YPVL 3CH1A 4P99A 1WBZA 5GJSL 1B88A 5T1MB 4RZCA 3GSOB 1ZHNB 3MV7A 4TUOB 1UWEH 2DTMH 5JOFA 2MCPH 1JZ5A 4L9LB 1MCKA 1S7RA 5LBSL 1UJ3C 2PYED 4P0DA 1I7TA 1A64A 3EFFA 1CXHA 1W0VA 2NR6C 4NQED 2QBWA 3TNMB 2GI7A 1B6UA 2VLRA 1RIVL 3QIWC 4IRZL 4WY7L 4Y1AE 3W9DA 3TN0A 1PGRB 1WIPA 1SBSH 4HH9B 5FYJE 1BWWA 32C2A 3CNKA 5I1EH 5MI0C 4JB9H 3MRDA 3VG9C 1QPXA 2XWJB 5DD1H 5E6IC 3E1F1 3T0ED 5HHPA 5CHNB 2O5XL 3BAEH 3VFSA 3I3DA 1DFBL 3M1BB 3LS4L 5GIRB 2Z35A 3FN9A 4QO1A 4TNWF 1NDMA 3GMQB 4PGDA 4UNUA 4NZUL 3DXAB 1YEGL 4XNMA 5HYSA 5JZ7C 1ZHKA 1VPOL 1UM5H 5FO9A 5SWZE 4D3CH 2BNRD 4MD5B 1FNAA 4M1GH 3AB0B 4WFEE 4JM4H 4UT7L 3T0BA 2W60A 3BH8B 3AU1A 3K4ZA 4UB0L 5E4EB 3S97C 3LRGA 5C09E 1SJXA 4JG0H 5EO1A 4YDIL 1X5KA 5IJVB 3W81A 3TT3H 4G8IA 5I8OH 1QRKA 3V5KB 5IEKB 3KXFD 2D7OA 1NGQL 3ZSSA 4FFWD 5JMRA 1U8QA 3KPSD 4RA3A 5F70A 3TZVD 1QSFA 2R0KH 1MHEB 3BEVB 5E5MA 4J3VA 1S7VA 1QSEB 5I75B 3FCTB 3HMWL 2A1WL 2ZUWA 4HXAL 3IFNH 3VH8A 4AQOA 1U95A 3RUGE 2GJZA 4P5TA 5DQJA 2CXKA 3HR5A 5GGTA 4AY0A 4WEMB 4JFFB 3ROOB 3F62A 3X3GH 3FB5A 2Y6SD 4J23A 2UWEB 1L9MA 2AEPH 4LFHD 3RUGF 2BRRL 1NBQA 2EO1A 2JJTC 5F1NA 1N26A 5F9JB 3PF2A 4U1IA 3R8QA 3AVEA 4FQJL 1GOFA 1NCBL 4WFFD 4XPBL 4F15B 1A6UL 3HTLX 1T83C 4JM2C 3QIWB 4AEHL 2WLYA 2HLFD 4X6DB 4XNZB 3G5ZA 4TSAL 4PJGE 5MI0B 4K3DH 5HI4D 5FCSH 2GTZA 2DDQH 3BPNB 5TDNA 5IMLB 3MLSL 4Y4KA 4S1DD 5TE6L 1FCCA 2MQ3A 4ODTL 4PJGF 3NOIA 2QQLL 2V17H 1BFVL 4I5BA 1MHCA 1WT5C 4M7LH 1TNMA 1MWAA 2CGRL 2ICEA 3T0DA 4N0FB 1YNLL 1M7DB 1IC5H 1PG7W 4RDQF 5B8CA 1YY8B 4XVSL 4LIQH 5FYLD 4O51A 4GRLD 3AS2A 3KLSA 3THMH 3EDEA 2AJVH 2MNUA 1A3RH 3CVHH 4NQCA 3QQ3A 2C4XA 1HXMB 5GGRB 1JBJA 5F9WB 2P1YA 2FZ3B 4OLEA 3UJTH 5C0EB 3MODL 4YXKL 5BV7C 5HYJE 2WUBH 2FGWH 4Y16B 5GS0C 1NDGA 5C0GA 2VL5A 2WANA 3O4LB 2Z8WC 4BSVA 5ISZE 1D9KA 1G7PB 3EGSA 1EHLH 5TF0A 1MOEA 1BAFL 3WXWL 4IDJH 4QOKB 2LAAA 4NKOA 2VXQL 4A6YH 2X1PA 1S8DB 5DD3H 4NYLB 4FQHB 5JA9A 3B83A 4OGZA 5E56A 1JN6A 4XWGL 2ZSVB 3OB0H 3DI3B 3BP6A 5CJOH 2CMRH 5SV4A 3VMOA 5C0FA 5HI3C 1AO7D 4TSCL 4C83A 4OLZH 1A5FH 4Y1AA 5CD3B 2A9NL 3BPLC 3GDBA 3H3PH 4GMTL 5C0DA 1F3RB 4UDTB 2EDWA 1T7XA 3BW9A 1TVHB 2XG4A 5ANME 5F9OH 1H5BC 4LLUA 4PY8J 2A6IA 1QFUL 3PP3K 4JM2B 1WVZA 5DLML 1NGPL 3OTTA 3O81A 3G6AA 4G8EB 2UYLB 2QKIA 5I76B 3CK0H 3BKMH 2JK5A 2Y1VA 3VXSE 4LKCA 4XTRD 3NACH 1RK0A 1RMFH 5SWZA 3WJLC 1WK0A 4IMKC 2XACC 3MNVA 4Z5RA 2CPCA 4N0CD 3SGJC 5CMAB 4ESKA 3C5SA 2Y06L 3EHBD 4Z8FH 2NY0C 3SO3C 4WCYL 4ZPTB 1ZXQA 4M00A 1SYSA 4APQC 4LLVA 3BKJH 3SQBA 4LPCA 3I6KB 4PJHE 3GSXB 2VLKB 3QIBC 1U3HC 1N5YH 3WFDH 1F00I 3TF7C 43C9A 1AHWA 5JIKA 2ATKA 3PUCA 4KK9D 4PJ8A 3OR6B 4JFEB 4L8DB 4R9HA 5ITBL 4JHAH 2CIKB 4PJHF 4WHCA 3K8LA 3RUGA 5I8KH 4P57A 1K3ZA 3U7YH 3TBVA 4F7TA 2VZTA 3B6SB 3ZE2E 4EN3C 3WS6C 2AJXH 2NY1D 4EOWH 4ELKA 4C58B 1EJ6A 3G6JE 3FOLA 1GGIL 5DO2D 4ZFOL 3D3VD 4ODHH 4D9RE 3QUXC 3VFGH 4B53A 4HT1H 5FXCH 4P46D 4OAWA 5AYUL 1H8NA 2HT4D 1JWSA 1RUQL 2GITB 4NCDA 3ZE2F 3GJFK 1KT2B 1ORSA 3CVHB 3G6JF 4JRXB 3DYOA 1S5HB 3F58L 1D5ZA 4XPAH 3P40A 3SO5A 4XMLH 3T09A 1UCBL 3RL1A 1M6OB 5HXMA 3PWUB 5T3XH 3KYKL 1CQYA 1RZ7L 1SJHB 5EU4A 4FXLA 5CP3H 3DBXB 1D3CA 4PJGA 2OZ4A 2QSCL 3S35L 2E7MA 3VFUB 3DMMA 3MXWL 1C1EH 5GRYA 5D1ZB 4ALAL 1BOGA 1A1OA 1BBJB 3C5ZD 1YN7A 4RFEB 1U8JA 1OM3L 3W5NA 4A6YB 1XGRB 2JB5H 1RUPH 4GS7C 5FCUH 4CW1B 4OF6A 5HDQH 3MJ7A 5KZCD 3CLEL 1G9NH 2NCMA 1OQOA 2OQJA 4V2CB 1KTKE 4G6AD 4KDTA 1UWEL 2DTML 3ARPA 2DLHA 5DA0B 2MCPL 5BCAA 3QXDA 1P2CA 4XC1H 1VEMA 1P69B 2G5BB 4XPTH 3MRIB 4AM0A 1W2KT 1IAKA 4RNRB 3B5TA 2G75A 5JR1L 4WHTA 4L5FH 5CWSA 1BJMA 4MHHI 1U3HB 5HYJA 3W0WB 4PLNC 2YSSA 3BEWB 4D9LH 2X70B 2Q1EA 1A7BA 5TE7H 1MREH 4HIEA 2VB5A 4U6YA 1SBSL 1U3JA 5ISZA 1PLGH 1XF5B 4ZQKA 5I1EL 4JB9L 4U2ZA 5EBWB 2J88H 4PJ9D 5DD1L 3V0WH 1D6VH 3JWOH 4L29B 3B3IA 4EN3B 5T1LA 1BP3B 1QFWH 4E5XA 3BAEL 5D72H 5KS9B 3GMMA 3UZVB 4R7DB 2NY7L 3CCHA 3NFNB 4NUJA 5GGSA 3MRBA 3GK8H 4OGAD 3KPQA 3B9KA 5ADPH 1QR1A 2G9HB 1CE1H 3ZT7A 3DLQR 4UV4H 4M1GL 1HILA 1K3IA 3QEGH 1MSPA 3C6LC 3QDGD 1LO5B 4HH8A 3CPLA 4HUNB 3RWGB 5FB8A 4JG0L 4O02H 3C2AH 4F7EA 5IEHB 3TT3L 5EO9A 2YZ1A 5I8OL 5J6HB 2RAMA 3QNXB 4WV1A 4AENA 4YWGH 2Z8VC 3HZMB 3X12A 4GAFB 2GIYA 2KH2B 1IZKA 3VXSA 2R0KL 4XPHH 5I6XB 1FN4A 1OTTC 2KUTA 1CL7H 3ARXA 4LPXA 5CSZB 3FO0H 3RWDB 2XPGA 4E0RA 2IGFH 3DV4A 3BQUA 3IFNL 3V7MA 3H9SB 5DQ9A 1EEUA 1XGPB 4RMWA 5D70H 1OD9A 3ILQD 4NQXB 5T1DH 2IMNA 3X3GL 1FVDA 3GJEB 3NABH 5IJKA 2AEPL 5K33A 1KELH 4PJHA 1P53A 1A02N 1EMTH 3I02B 1E27A 5L2JA 4BYHA 1GAFH 5HYFA 3IKCB 5D1XB 4HIXH 1FV1B 5A43C 1T1ZA 1S9VB 3QCUH 4BZ2H 5CJBA 3KLHD 2F53B 1IAOB 2OR9H 4N1EA 4EI6B 1ND0B 2WNGA 3FRUA 4AIXA 2ZUXA 2NQCA 4NFCA 3RDTD 4Y5XB 1TCRA 3REWA 3CDYA 4YAQB 1I3RA 4X98B 4IS6B 3G6JA 4NNYB 2CKNA 1XT5A 2J7LA 3AUVA 4PJBB 4K3DL 3FB7B 3LKSA 2DDQL 1UZ8A 1GXEA 1IILE 3QPQD 1ITBB 2J1KA 2A77H 2X44D 2A2QT 3OL2A 2FHFA 2FWOB 2V17L 4M7LL 4U1MB 3RZCB 1FZMB 3RNKA 2NXZC 1IC5L 3HMXH 4LIQL 1IGYA 4AH2B 3MLPA 3THML 1U8LB 3DROB 3L6FA 4NO3B 3T0VA 3CVHL 3MR9A 3VGBA 4KKAD 1OAKH 2VISB 1CWVA 4OLVH 4E9LA 5I17B 4OLUH 4N8VB 3X11B 3UJTL 2P8MA 3DRQB 5C8JB 4P2RD 4QHLB 1S78D 4E41E 2FLBT 2WUBL 2FGWL 2GJ6D 1FNFA 4RRPG 2R1WB 4P2OD 1QPPA 3O4OC 5EC1A 2HAZA 3SE4A 1EHLL 4U1KB 3VFWA 4IDJL 2X2YA 1QOKA 1DN0A 3O8XA 2VDOL 2ZG2A 4U6VH 4NFBA 5DSCA 4HV8A 1RZFH 1KCUH 4A6YL 1UXSA 5DD3L 5DI8B 4PBVC 4EKXA 4PGEA 2HVKB 3GKZA 1AGCA 4KUCD 5HHOB 3TEUA 3HRPA 2ESVD 1MJJB 3HE6D 2EDLA 4I0PA 1RUAH 5CJOL 3KLAA 2D0FA 3IFPB 1KPRB 2OTWA 4OLZL 1A5FL 3SDAB 1FNSH 1IEAA 5JW3H 3H3PL 1FIGH 4QHKI 2OR8A 5INDB 2UY6A 1FNGA 3REVB 4NO2A 5F9OL 4HJGA 2GAZA 3QG6B 1JL8A 4KJWC 1BX2B 5FUOH 2DLEA 5C0IA 4F8TA 5DHVA 5CD5D 4WI9A 2KKQA 4Z7UE 3VWKA 2X41A 4UQ3A 3O3EB 5HI5C 3WIHH 2AKRA 1W0WA 3O6MH 1JTOA 3CK0L 4GOSA 4UAOB 2BX5A 3NACL 5IFJB 1J86A 4OCRH 1RMFL 1P4LB 4Z7UF 1UT9A 5DWUH 3RY6C 1U58B 2VIRA 2C7UB 4FXGB 4H1LB 4Z8FL 3P73B 5EZIL 2BERA 2EIBA 3QT2A 4WW2B 3N85H 3F7RA 3HC0A 2RR3A 2J6EA 1KB5B 3BKJL 3SKNB 1E28B 3OZ9H 4KVCH 1TFHA 2NXZB 5GGQL 1HSAB 5C0JB 2CRYA 1KACB 5D7IE 4TULH 4M7LT 2AW2A 1OGTA 3GSWA 4GBXD 3U4BL 1CT8B 1N5YL 3D18A 3WFDL 3HAEA 5LAXA 3RX5A 1BECA 2F54D 5C08B 1EIBA 3LQAC 1C7TA 4JHAL 2GSGA 7FABH 5D7IF 5I8KL 2XWBB 2VDRH 3BD4A 3U7YL 2X4SA 2LVCA 1KPVB 2AJXL 3DETD 4EOWL 5E8DH 3CX2A 1KJ2H 1FSKC 2DLIA 3O4OB 3VFGL 5F1IA 3QUMA 4HT1L 4LCIH 3V7AE 3GHBH 3VD5A 1JV5B 1AXSB 1I7RB 1EJOH 1KJVA 1TPXB 5EUOE 1J05A 1S9XB 4XPAL 3TJEH 4ZXBA 4L3AA 4XMLL 4HXBH 3X14A 4OFYA 5T3XL 3TBTA 3F7VA 4MJIB 1NGYA 5EUOF 3RVVC 1GYAA 1PZ5B 1KENH 4ODVH 1RJCA 4XZUA 3OKEB 1C1EL 4XI5D 4KDVA 1N5AA 4WWKA 4XHJC 5CBAB 4KK8C 4LF3A 3DSNA 5K9OB 4WTXA 2ARJA 4KFZC 4HUKB 2JB5L 1MFBL 4DJMA 4WTWA 3RY4A 5FCUL 4MXQC 1QVOA 5I19H 5HDQL 4NKMA 1G9NL 3L3OB 6CGTA 3WO4C 4HIIA 4WHDA 1YUHB 4S2SA 1AGFB 1X4ZA 3IF1A 1N8ZA 5TQ2H 3BDXA 3ZMRA 2Y36H 4I13B 1G0DA 3BJLA 4FZ8H 5IBUG 5DMGD 4XC1L 2FR4B 4OV5B 1S7SA 4XPTL 2IAMA 3VRJB 2WBKA 1FNLA 1KJMB 1Q9KB 4CU7A 4GRWE 1AD0B 4L5FL 4JFYA 3VXRE 2FX7H 4E41A 4HC1A 3H7LA 3VGDA 2YEZB 1Q8MA 3IJSA 4D9LL 1PFCA 4OF5A 4YR6A 5TE7L 3QA3A 4YHIA 5E1HB 2ZUUA 3E6FA 4RQQA 1PLGL 3HZKA 1R3JB 1X5JA 1IGCH 2VABA 3AAZA 4RMRA 2F74B 2J88L 4MQSB 3V0WL 4NKDB 1D6VL 1NC4B 1V7NH 3JWOL 4XNUH 1CE6A 3LRHA 1I7UB 4ORGA 1QFWL 2IH3A 4YEEA 4RSVA 2VJXA 4HQQH 5F8RC 1XCQB 4PG2C 1RJYB 3VGEA 1FSKB 1OTUC 3DGGB 4PLJD 1XAUA 1EVUA 2R1XB 2ICWB 3D0VB 1OLLA 3GK8L 1AR1D 1M71B 5ADPL 5JIIA 1CE1L 3MRMA 3R4DA 1XR9B 3RVTD 4CNIB 3TBYA 4UV4L 3WIIH 1EA9C 3F5WA 3QEGL 1AE6L 2Q7YB 1DL7H 2BNUB 3JV6A 4QRPD 4O02L 1J1OH 5IB1A 3C2AL 5C0NC 1BD2B 4Z7UA 2H3NB 1FYTD 3MOBH 5EOTA 3F8UB 2X5PA 5EBLA 4YWGL 1I8IA 3WS3B 2HTLD 2C1PB 4QRQA 5DJ2B 2JCCB 1YNTA 2R4RH 4XPHL 1H0DB 2VWEE 5C70A 1CL7L 3QISA 4Y88A 1RJZB 4DEPC 1KGCE 2W91A 3HCVA 1RZKC 3DUUA 1Z5LA 3T08A 2DQJH 4JDZA 1RJLA 5FA3B 1WITA 2GT9A 5JDSB 1KBGH 1BLNA 1WLHA 3PDGA 5D70L 5E8EA 4ZFGH 2AK1L 3D39B 5IFHH 4W6YB 5ALCH 1B6DA 4E42B 5L7XH 2KZ1B 3PDOA 3NABL 4LLDB 3RP1A 4KJQC 3ARBC 1KELL 3MYJA 5D7IA 4XBGA 1ZT7A 1EMTL 4GRMB 1CU4H 1GAFL 4DVRH 2UUDH 3MLUH 2VXUL 4F9PC 4HIXL 1WIOA 1KFAH 4F33A 4ZTPH 3IRZA 3QHFH 1RHFA 4ZOCA 2HFEB 4BZ2L 3UYRH 43CAB 4NSKB 3CXHK 1LDPH 1IEBA 2PYEB 2MQ0A 3RVUC 1JPTL 4EIGB 4NQEB 3IXAB 3TPUB 3MCKA 4OM1L 4X6CE 2PTTA 3AMKA 5B39G 2XKNB 1CICD 3WDIA 2BC4B 3PXJA 4MNQD 1MCWM 2CKBB 4MQ7B 1CFNA 5FYLH 5EUOA 1AGBA 4Z77A 4X8XA 5TH2A 2B1HH 3L3DB 4X6CF 3MTRA 3PHQB 2YD1A 4FOMA 1I3VA 3HMXL 1F4HA 3OKOA 5ESAB 4YQXL 5IF0B 1WCBA 5JQ6H 4FMKA 4HLJA 3AS1A 5F93C 3FB8B 1XH3A 3GMRA 2AQ2A 5CZVH 1OAKL 4GKNA 4NRXA 3AREA 3QYCA 4U1HA 4OLVL 4KVNH 1HNFA 1A3LH 4P4KD 1X4YA 3O3BB 5E2UH 1JZ3A 1F02I 1CFSB 4MA3B 4X5LA 3RY5A 5HTSA 4MHHG 1EHAA 1LE9B 3JTSB 3KPSB 3TZVB 4UT9H 3TIDB 4U6VL 3W11C 2X9YA 3FFDB 1KCUL 4CVZB 3EO0A 4BK4A 2R2HB 2C4FU 5K9QG 3UTTD 1R24B 1NUFA 4JZOB 1AGDA 1WWCA 2CRZA 3VXUD 3U36A 5B38A 3S35X 1RUAL 4ODUB 2KQMA 1T1XA 2AEIT 3BUYB 1ZT1B 1FNSL 5JW3L 3KHOA 4K9EH 4V1DD 2EZ0D 1FIGL 3QO0B 5IB2B 2PO6C 1FG2A 3GSUA 3RIFK 4X7CC 4WWID 4QF1B 1I1YA 4NIKB 12E8H 4MS8C 5CGYC 5FUOL 4BSWA 5JORA 5JMOC 2V5SA 4NQVB 3WIHL 3O6ML 3CAFA 3QAZC 4JO4H 5EIVA 3MLRH 4X4XB 5HVGB 4YZFE 3S4SB 3DV6B 2OTUA 5DWUL 2FCBA 2XZAH 3RTQC 2K1MA 3CDGA 3LN5B 4IBLT 1DE4B 4X4ZA 5IVXE 3EOBB 4J3TA 1KIPB 3V6OE 3N85L 1R5WB 4YZFF 5MEPB 1IC7H 4PUBH 1A9BB 3OZ9L 4KVCL 1P84K 4NNPH 1F2QA 4TULL 4K3EL 4PV8A 5IVXF 4Z76B 3OF6D 3U6RA 4K71C 1YA5A 2BMKA 4JAMA 5LGHH 1VB9A 4M7ZC 2WP3O 1A6WL 2XOTA 2Z93A 4HUWB 1AXIB 7FABL 4GRLB 3PABB 1MCBA 2NZ9C 2VDRL 2GTWA 2G5RA 4HULB 3DO3A 1MCNA 5E8DL 4RBPK 4JRWA 3MJ9H 1KJ2L 2YPLE 4DZBA 4F7PB 4XC3H 3VI3E 4U05A 4MAYC 4NOBA 4LCIL 3GHBL 1MAKA 2VTFA 2NX5D 3UYPA 3UAJC 1EJOL 4P9HH 5FF6A 5F3HB 4M7JH 5B4MC 3VI3F 4YUEH 4DUVA 5DRZB 4HXBL 1I7ZB 3KPPB 1OB1B 4HFUH 4ZAKC 1KENL 3AGVA 4ODVL 2PO6B 4DZ8B 1JF6A 2XY1A 4X6CA 1TZHA 1AO7B 4JFDE 1YN6B 2H9GB 4YHNB 1CLCA 1Q9LB 4N8PA 5DJ8A 1UACL 4Y5YB 3FN0H 3ULVD 1J18A 4GW4A 1I1FA 5I19L 2NY3D 3LH2L 2NY5C 4KJPC 3GSQB 1JTPA 4TUJA 5HHME 5TQ2L 2Y36L 3HNSL 4BH7A 3HZVA 4FZ8L 4G8FA 1FFNA 3IRPX 4Z9KB 1JGDA 1YEJH 3DX7A 3SKMA 1YJDH 4I3GA 5J1AA 4G6AC 4B50A 3WHE0 2FX7L 1MI5E 3TO2A 1NKRA 1PD6A 2GSIB 4K71B 5D7JA 1NBVH 4L8CB 4KQ3L 4L4VE 5DZLA 4M7ZB 4M48H 5IG7A 4Y5VA 2O61B 3QDJA 3T3ME 4PGJA 1XCTB 3HC4H 3HB3C 2AXFA 2V2XB 1U2CA 1V7NL 1UXWA 4XNUL 3SDDA 3RRQA 4RCAA 5DK3A 3S8WA 1OAUH 1T89C 3UTPE 4HQQL 1IGIH 3T3MF 4KJYB 5I8EB 4JANA 3QH3B 4D9QE 4HS6B 5AUMB 4UDUB 3ALPA 3MSPA 3GMLA 2HT3C 4MSWB 1Q94A 2D31B 4P23A 5C0AA 3EOYG 1DQJA 4MXWH 3WIIL 4YBQC 4MGXA 3V9FA 3V0VA 2FECL 1DL7L 4JFXA 2BSRA 4P46B 1TJGH 1J1OL 2X4TB 3NFPB 4OD2A 4HAFA 3TLRA 3QFDA 2VQ1B 4KHXH 3MOBL 5T5NG 5BJTA 3LHPH 1QLFA 3FQRB 2AK4E 3GSNB 4DWHA 3A6OA 4KKCD 2R4RL 3RWFA 1SVZA 4QT5B 3VU2A 3BIKA 2DQDH 5FHBH 3RHWK 3V79C 1OP5H 4LGPB 2DQJL 3IETA 4X7SH 4NNXB 5IVXA 1D5IH 2NW2A 1KBGL 1YYLH 1DBKL 4XH2B 5CEZD 2VUYA 4ZFGL 1B0WA 3DVGB 5IFHL 5ALCL 2ZUSA 4QLRA 3U7WH 3M07A 2X4UB 4JJ5B 5L7XL 1GGCH 1T5XA 3E6HB 4OSUH 1EX0A 1CU4L 5KZCB 2AJ3B 5EBGA 4DVRL 3MLUL 3EO1A 3SQOH 2NNAA 4YGVA 1KFAL 4ZTPL 3QHFL 5GISH 1DQQB 1T0NA 1B0GA 3UYRL 1TVBA 4XRCA 4LEOA 3Q5OA 1BMGA 1LDPL 1UVQA 4QWWD 1Z2KA 3BPCA 4JVWA 3RVWC 3CSPA 4BFBD 3L1OH 3G9AB 4WU7A 5DMKB 3PIQB 2YPLA 2DKMA 2HVJA 4CJ0A 4K7FB 2G60L 4LEXH 3QFJD 3QXUA 2AEQH 3EW3B 3RBSA 5FYLL 5E8OB 2MKWA 5AAWA 1O0VA 2D4FA 4Q74A 2B1HL 4LHQB 4PJ9B 1MCJA 2P5WE 3LRSA 2PXYA 3HR6A 1S7WA 5DC4B 4CMMA 5DFTA 3E2HB 3L5JA 1HHHB 2BSSB 2VUOA 2R2EB 3NVQA 3K4DA 3WHXB 1QR4A 5FO7B 5JOPE 5JQ6L 3BZ4B 4MQXC 2QSQA 4JFDA 4XP5H 4NQDD 5EU6E 3C08H 4Y4FA 4JZJC 3ECBA 1FZJB 5CZVL 4KV5E 4KVNL 3O2DA 3QDGB 4X6FA 1A3LL 3CFJA 4Z78B 3J8F7 5E2UL 1SY6L 2YBRA 3FL7A 5FUCC 5TGBB 4FXKA 5DEFA 3BGFC 4PRHD 3IDMB 2YD4A 1BZ9B 4KV5F 2XT1B 5FGCB 4UT9L 2AP2A 4WUUD 1GZPA 3OXSA 3Q48A 5BRZE 3MRPB 4F37F 1FZKA 1CXIA 4GXUN 4G9FD 3VFPA 5L8JB 1MI5A 5D1QC 1GZQA 5CZXD 5K93A 1C08B 4L4VA 2F8VA 4NJ9H 5A3ID 1PY4A 4K9EL 4L3CA 3BE1H 3VFVA 3PNWB 5IW1A 3KYMB 2VERN 3PGFL 4NO0A 12E8L 5C07D 4BFIB 1G9MC 3VE0B 2BNQD 2J8UE 2VAJA 3OBAA 3UO1H 5IHLB 1FNEB 4Z7WB 3TO4D 4MJ6B 4PGBB 4U1JB 3BH9B 4F80A 4JO4L 3C9NB 3MLRL 3RDTB 2RJMA 3QJHB 3ZKNC 1SYVB 4G6KH 4WI4A 1MFEH 2J8UF 3U30C 4OCSL 5FYKD 1FJ1A 2YWYA 1IKNC 4M61A 3HE7A 4GAJH 4TRPL 2A6DA 2V5TA 3KPMB 4R97C 1OHQA 1IC7L 1T0MB 4JRYE 4K55A 4PUBL 4QHMB 1J5OH 4NNPL 3TV3H 3L5XH 2YK1H 2I07B 5C71A 2AK4A 2Q86A 3FT3A 2IQAB 3G04B 3KPRB 1CGWA 1KIUA 4YEFA 4GG6E 5CJ5A 4WI3A 5LGHL 2XV6B 4JZJB 4OZIE 3IJYA 1EK3A 3MFGB 1O7VA 2OL3B 4LL9A 3RIAF 5AG9A 1I8MA 3TIEA 3TVMC 3V4PL 1OW0C 4GG6F 4G8GD 4NC2B 2IH1A 3MJ9L 1FL3B 3BGFB 4IRJD 5EOCL 3GSRB 4XC3L 4PRIE 3IU4H 1P9MC 3CC5B 5KJRH 2GJ6B 2XKSA 4YHMH 4ODWB 4IDLA 4KI5C 1UB6B 2EIEA 4P9HL 4I77H 1HXYB 1S7XA 1C5CH 4M7JL 3MRKB 4YUEL 3K4AA 4C56D 1MLBB 5MEND 2X1QA 4Y2OA 1TIUA 3O6FC 2YRLA 2CDEA 3H0TB 4HFUL 3WE6B 5BW7A 3UPRA 3RFZC 1I1CA 3EAKA 3WXVH 5AZEH 4H25B 1HHKA 5IHBA 4ZO8A 3U9UB 3U4AA 3S3JA 3HFMH 1U8NA 1ZLVH 3FN0L 1KC5H 5F88A 1W8NA 4NC1C 4PJXB 5D71H 5C0CD 3MRLA 4JY6B 4XWOD 4UQ2B 1WGOA 5I71B 4FQPA 2XZQH 4LSDA 4MNHB 4JCMA 1FGVH 1NGZA 1FFOA 1YQVH 1U92A 2R9HD 1NMCC 2MPAH 1ZEAH 2OXGA 5DUBB 5EU6A 4M1CC 3NZHH 2JIXD 3J7HA 4PJ5D 3QUZA 3EOTH 5HHNB 3ZHDA 1P7QB 3TP4A 5D9SB 5FDWB 4IHOB 4NHCH 1PY9A 3L95B 3QXVA 1NBVL 1FO0B 4R96B 5SX4H 2Z91A 4XNQB 4M48L 2BCKB 3BMWA 5J4MA 1VADA 2MCG1 4DQOH 5KG9A 4GBXB 3RWEB 4POUB 5FYKU 1G6RA 3EYVA 2VRAA 5BRZA 3MV9A 5F6HI 1OAUL 2QHRH 1JPFB 2DIAA 4JG1L 1IGIL 4MDJA 2CLZA 3BT2L 4XCEA 3KDMA 4JCLA 4NCC2 5I1LB 5F96H 5BVJB 5JXAH 2Y25A 1HWHB 2Y5TA 4Q2ZB 5EPMB 2O5YL 4LCYA 4MXWL 4G9DB 4NT6B 5D93C 1M4KA 2QR0A 2P5EB 4IRSD 5E8PB 2DF3A 5IHUH 3GSVA 4Q97A 2A73A 5IOPB 5CFHA 4QRUA 1HYSC 4HUXB 1BQHA 1INEH 2J8UA 2V2WB 4MCYA 3L7FA 4P4RB 3RVTC 4KHXL 3S3SA 1VFBA 3LHPL 3MRFB 1BBDH 2VITB 1II4E 2EE9A 1YZZA 1T66C 3HI6H 2VDPL 1PW3A 2XWTA 4CBPA 2DQDL 2LABA 5FHBL 2O5ZH 2QL1A 1LHZA 1PSKH 3V52H 3MREA 1DVFD 4RGNC 4X7SL 5HGHA 3B9KC 1OF2A 3B4NA 5C2UB 1FZOA 1YYLL 4QHUB 3Q3GA 2XFXA 3QWOB 1X5ZA 5J9PA 2W59A 4JRYA 1GGCL 1KIQB 1MFDH 3MV7D 3TA3C 2ARJQ 3TCXA 1JVKA 4LPTA 4O2EB 1T20B 4HMCA 5ESQA 2N7BA 4X80H 4GG6A 1LEKA 2ITCA 3SQOL 1CLYH 3FB6B 4LLAA 1QA9A 2P8PB 5J12C 1ZT4B 3U4EA 5IVNA 4NC0B 1YY9D 1MFNA 3KLDA 3OAYH 1R3HB 2BP3A 2FSEA 4FQ2H 3TN0D 1QHOA 1ZVSA 3L1OL 4Q9QH 4S10A 3LB6C 4WO4D 4HKZB 4P5MA 3DXAE 1BEYH 4PRIA 1GHFH 1BFOB 5DD6A 3EDDA 5A16B 5DYOB 2AEQL 2DQFA 1JZ8A 3PL6D 3LEXA 2P49B 2Q6WA 1T3FA 4HPOH 2V7NA 3FO1B 2D9QB 4FQQA 2XZZA 4G6JH 4J4PC 1JHLL 1H3TA 2R29H 3CMOH 4LOUD 1DANU 4K23H 4X5WB 4LARH 3ARRA 4XAKD 5EIQA 3C08L 1JNJA 3VWJA 4HFWA 4ODSL 3AXLA 4IM8A 3SGDI 4JFFE 3VXOA 3QQNA 4N9GA 4YH6A 4OZFB 5FA4B 5A2FA 4NHUB 2WQRA 5CINH 1QSFD 4PPTA 5IBUB 5E00B 2UWEE 4QNPF 1KXTB 1E6JH 4NM8H 1FYTB 5C92A 5GGSY 5HDBE 4HK3J 4ZFFB 3BZEA 1XF1A 4P5TD 3D5OF 4Z7QE 1G7QB 2SEBA 2UWEF 3MBXH 4ISVB 3D2UA 3WCYA 5DGQA 3X17A 3ARDA 1SEBA 2VR4A 3NH7H 1BHGA 1UYWL 4JDTH 5EORH 5HDBF 3TA3B 3RKDC 4PRAB 3P9MB 4X6DE 4ZMAT 4J2XA 3MRRB 5E94B 3BP7B 4Z7QF 3FAWA 2ERJC 4EI5A 3BE1L 4JFHD 5MEOB 1ZGLM 4QRSB 1ES0B 1K8DA 3X13A 1RZJC 3WSQH 4X7EC 1BFSA 2W9EH 4XXDB 3G5VA 2C3HA 1MEXH 1RI8A 1WAAE 3UO1L 1CDBA 1MCSA 3N1MC 3WUZA 4TNVF 1MLCA 1R5IA 5ALBL 4LGRB 3ARFD 2VN7A 5H94A 4MX7B 1HSBB 2WUCH 4K3JH 4RMTA 4G6KL 4ZG1A 1WQVT 4RMVA 4Y4KD 1U8PA 4LVOB 1WAAF 4CVXB 1T5WB 1C12A 2PF6A 3QDMB 5E08H 5CGTA 1CICB 3M8OH 4GAJL 5ICZB 1K85A 4UOJA 4MNQB 2ADJB 4XVUC 3PJSA 2R8SL 1JYNA 4BA8A 3QCVL 1MRFH 1J5OL 3TV3L 4YE4H 3SJVE 4B41A 2Y7QA 3O4LE 2YK1L 3C6SA 4X4YA 3IKKA 2WWKT 3L3IA 4MZ3A 5T1MA 3GSOA 1MUJB 4NQCD 1W72H 4TUOA 5F7DA 3R8BB 2QADC 3BZDA 4L9LA 4QOKE 2VZOA 3RJDA 1LEGB 2HKFH 1GRWA 2GK0B 3MBEC 1P5UA 4L4TB 5F7EH 3ZDZE 1BIIB 3PHSA 3P9LB 3TNMA 1D9KD 3HI1B 1NFKA 4KMTH 3FQNB 3IU4L 5KJRL 2XTLA 3SDXB 3ZDZF 1V3KA 2WWMC 4HH9A 3S98A 4F58H 4JLRB 4I77L 1C5CL 2XWJA 2YD8A 3DYMA 5CHNA 3HS0B 4CN6A 5EULV 1D5BB 4X6EB 3M1BA 4MA7H 4U49A 2FB4H 4Y1AD 3ULVH 4ACPA 3UTTB 4EJ1C 1T22B 5GIRA 1EBAA 3VFOB 3C09C 4UTBH 1INDH 4QXGH 1MJ7L 2A0LC 4JM2F 3VXUB 2H32H 5FYJD 2XI9A 3DXAA 2HT2C 3WXVL 5FGBC 4YK4C 2WIMA 4MD5A 4R4NC 5CKGA 3N9GH 3WLWD 3HPJB 4V1DB 3WNOA 3BH8A 3HFML 3I6GA 4B0MM 3OJ2C 1A6VH 5D6CB 1KC5L 5IJVA 4HPYH 2NY2C 5IEKA 3NA9H 4LPWA 4NM4H 4MA1C 4ZO6A 2ZUYA 3L5HA 1YDPA 2XZQL 4R90H 5SWZD 1CXEA 3QEUB 2VLKE 1QP1A 1FGVL 4WGVB 3P77A 4D0DB 1CXKA 1MHEA 3BEVA 4WFED 1BJ1J 2YRZA 3RAJH 1ZEAL 3FCTA 2UV3A 4IOIB 3S5LB 5L9DH 1E4XH 3NZHL 4LLQB 3KJ6H 3OV6A 1I85A 3EOTL 3VRIB 1QRNB 4YFLF 4JFFA 1EEZB 3ROOA 4KKBD 4WWKC 1ZANH 4NHCL 1LO3L 5J6GA 3H42H 4MVBC 2UWEA 1A6ZB 5HD8D 2P4AB 1BQLL 4PJ8D 2BOBB 1JI1A 3MBEB 1UJ3A 3ETBF 1QFPA 4JRXE 1F11B 3QQ9D 1A14H 5KSBB 2QHRL 1BZ7A 1RURH 4LCCB 3QUYC 5EUKA 3QIWA 5B22A 1E0OB 4YDKL 2IAMC 2VDQH 4FQIH 4X6DA 5F96L 4YC2C 5E2WH 5JXAL 3EZJB 3JSSA 2HJLB 3MNWB 4YJZL 2I5YH 5IHUL 2GUOA 3RNQB 5IMLA 3PWLB 4MD0A 2APBA 4EQ3A 1VGKB 4GG8B 5CS7A 1AIFB 2PYFB 4H0GA 2DIJA 2NX5B 4LHUD 4MB3A 5E6YA 1INEL 5K9JH 3C09B 1WAAA 2P47B 2FX8H 5JUEH 5FGRA 3WMSA 5CEZH 1BBDL 3DMMD 4N0FA 4F2MB 3LDBC 1M7DA 3O9WC 3BRDA 3QEQB 3HI6L 2O5ZL 4IOFD 4PRNB 1PSKL 1ZHBB 3V52L 3C60C 4X9HA 4MA1B 5E5UB 2WIIA 5CSGA 2CK0H 2FZ3A 3I84A 4M93C 4FHBD 5ICYB 1MFDL 4TSBH 3SJVA 4QXTB 1OP3K 3RGVC 3O4LA 1CGVA 2H32B 3ZLQC 4K2UL 1LEIA 1HDMB 1I3UA 1J0KA 4X80L 2V9QA 3NCYP 3UPAA 3DGCR 5BXFB 4QOKA 1MQ8A 4EBQH 1NGWA 4ZO9A 2HMIC 1GL4B 1PKOA 4N5ED 4NYLA 1Z9SA 5HYJD 1MHHA 5BVPH 5KS9E 3D9AH 4NDMB 1MJ8H 4FQ2L 5KBNC 4Q9QL 2ZSVA 3TBSB 4GMSH 5ISZD 2JJTA 2YUXA 4RGOH 4R0LC 1BEYL 1V5JA 4OKVB 4C4KT 1GHFL 3U0PB 4UDTA 5KS9F 3D0LB 3MRQB 1TVHA 5SWSE 3MNZA 1HHIB 1T83A 3QUYB 4JM2A 1HKFA 1U8MB 3OX8A 4ZUTB 4HPOL 3MUGA 1WEJL 1P5VA 2YC1A 2DQGL 4G43B 4FS0A 1ADQL 5DJAA 1YMHB 4YC2B 4HZAA 2KQNA 1KIRB 3CD4A 3CUPB 3K80A 4G6JL 3ESUF 4ZUVA 2R29L 2R39A 3CMOL 2C4FT 2PNDA 1ORQB 5SX5H 4K23L 2V9TA 2CDGB 3D85A 1K4DB 1EVTC 4I18B 4LARL 1B0RB 3GHEH 3VGAC 5LGKA 2OCFD 4HUVB 1WWAX 2EXWD 4PBXA 4EUPB 3T8XB 3H9SE 4Y89A 4ZPTA 4BSJA 3SDCD 1VSCA 1KF9B 1WT5A 1LO2H 2HP4A 3LDBB 5CINL 3C87A 3D25A 5J3HD 1Q0XH 4NN7C 3GSXA 1E6JL 3WFCL 1Z0NA 1JJUA 4NM8L 4XCYB 3BQUD 5CEXB 5F6HJ 2D4DA 4DGVH 4HWZB 3OR6A 1CFBA 2F53E 2CIKA 2O26U 1N4XH 3QDHA 4JKLA 2Z4QA 1JGLH 1HCVA 4OLXH 4JDTL 5EORL 5FM8A 3B6SA 4I0CC 4PS4H 4U1SA 3FOMB 4PJBE 2IF7A 3Q5TA 3WEXA 1KUMA 4LP4A 4RAVB 2PW1B 3CZFA 1CIUA 5CUSH 1KEMH 4C54A 5IB4B 2GITA 4HZLB 5HYQB 3WSQL 2BY1A 4JRXA 4EZMA 35C8L 1S5HA 1OTSC 2W9EL 4PJBF 2BVTA 1A4KA 1MEXL 5FYKH 8FABA 3V0AC 3IXTA 1QSVA 1NLBH 1P7KB 1A4JA 4D9RD 2VOTA 2WUCL 4K8RD 4MMXC 2LE9A 4NRZB 2A6KB 1G9EA 5D1ZA 5KSAC 1IAMA 3K1KC 1IE5A 4KU1A 4DKEH 3EYFA 4OIIH 2X1WL 5E08L 5E95B 3M8OL 3QFJB 3QO1A 4RFEA 4Q58C 1H3WM 1XGRA 1XR8B 3C8HA 4U6TA 1A2YB 4ZYKB 1IM9A 1MRFL 3LMJL 2H26B 1CF8H 4YE4L 4HKXB 4OI8A 3P4MA 3WJLA 4XP6H 4IMKA 2COQA 1E4WH 2FBOJ 3SGJA 1YPZB 3QIUC 4NP4H 4I2XB 3H9HA 2CD0A 3MRJB 2G5BA 4APQA 2HKFL 3MRIA 1NH6A 4RNRA 1CL7I 4R26H 4NQDB 5HHOE 1AQDB 4HCRH 2YUZA 2LU4A 1U8OB 2BVPB 1DTUA 3MQIA 1U3HA 1EO7A 2YA2A 3ARQA 4N5UA 3BEWA 5ERWA 4KMTL 3O8XD 4JZNA 1ZA6A 2X70A 5LJYH 1XF5A 2GW5A 4F58L 2H2SC 5EBWA 5GRVL 3BVNB 2DQUH 3ZTNH 3B2UD 4I0PD 3WS6A 4EN3A 4I9WE 3GMOB 2IPKB 5KS9A 4PRPD 4R4FH 3ULVL 2FB4L 1VGEL 2DJSA 4PRDA 4R7DA 1OSPH 4UTBL 1INDL 4QXGL 4KTDL 1TJIH 2P24B 4IOSD 4G9FB 2V5MA 4ODXB 1ZVYA 4WTZA 4G6MH 1L7TH 3N9GL 1DQMH 5SWSA 5DMIH 1LO5A 2EYRB 3VWKD 3RWGA 1GGYA 1X5YA 1PYWB 4OFKA 4HPYL 2XTJC 5J6HA 5EFIB 5C07B 3A6CH 3NA9L 4NM4L 2JELH 4L8SC 1X6NA 3HZMA 1S7TB 4R90L 3LKPA 5JTWA 4HS3B 3OJDA 4OZ4B 4XCNB 3RAJL 5CSZA 5C08E 5FHAH 3JTTB 4YPGB 1E4XL 2V9RA 3H9SA 4NN5C 3KJ6L 5CJXA 2W07A 1XGPA 4OUUA 1S7UA 5EN2A 1N3NB 5FGSA 3T4YB 3QUKB 2YN5A 2OK0H 3H42L 3FQUB 5INCB 2Q7NA 3QIUB 1WZMA 1Q1JH 3I02A 3IKCA 2P48B 1CXLA 2XG5A 1FV1A 5KN5A 1A14L 2JJSA 2VLLB 2F53A 1UM6H 1MRDH 4EI6A 3TT1H 1RURL 3VFNB 4X0KB 2IMMA 5ITFA 4Y5XA 4YAQA 3SEPA 2VDQL 4FQIL 4MJIE 4X98A 4IS6A 5E2WL 1F4YH 4NNYA 1UG9A 4PJBA 4G8GB 1L9NA 3L7EB 3U46B 2I5YL 3BN9D 1REIA 4ZXBD 4F9LC 3H7BA 4OFYD 2XA8H 3JZ7A 5GSRB 5K9JL 1DQTA 2FWOA 1XF3B 5D96C 2FX8L 3IAPA 5JUEL 4U1MA 1J11A 4Z7VE 3SDDC 5CEZL 3MFFB 4C56B 3BYTA 5MENB 3C6LA 4AH2A 3P0VH 1I1AC 4MCZB 3W9EA 3DVFA 2XTJB 4Z7VF 1VACA 4O58H 2F5BH 4YFEA 5DEGA 3GBNL 4L8SB 5I17A 3KYNB 2CK0L 4N8VA 3X11A 4ZS6D 1TENA 3OKKB 3DRQA 4QHLA 4F7CB 4DOHB 5C0CB 2ENYA 5ENWB 4TSBL 2CK2A 4AZ8A 3LSOB 3GUTB 1WWWX 3RI5K 2L7JA 3UTSD 1N0LA 2WMPA 1HE7A 1RU9L 2ICWI 4NN5B 4U1KA 4HIJB 2E27H 4EBQL 4IMLB 3PQYD 3HI5H 5DI8A 1RZIA 3ZYZA 5BVPL 4FQLL 3HG1A 3D9AL 5HHOA 1MJ8L 3VXQA 4CDGC 2JIXB 2Q8BL 3MRNA 4GMSL 1KPRA 1TETH 4HMEA 4RGOL 3V6OC 3SDAA 3QQ4B 4M03A 4RMQA 5INDA 3NN8B 1OOAA 1E6OH 3QG6A 1XIWC 3WUWB 3WKMH 4WO4C 4D0CB 5HGDA 5J1SC 4POZC 1BX2A 3SKJH 3D48R 1INQB 3HRZB 5AZ2H 2GEEA 2BFVL 4OGYH 3O3EA 1IGJB