1Q9LB

S25-2 fab unliganded 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) heavy chain
total genus 42
structure length 222
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB01
3MFGB 2HKFL 5T5NF 32C2A 3I02A 1WIPA 4XMLL 3TIEA 1MFEH 1T1WA 3GMQA 3HG1E 2OI9C 5F1SA 1U6AH 5EOQL 4KK9C 3PWUA 1KN4L 2ICEB 4MA7H 4P2RD 3JWOH 2EC9U 4L1DA 4KKLC 1CXIA 3EHBC 4OD3H 4HCRH 4C83B 1BQLH 1QSEA 1NCAH 3BW9A 4L3AA 3IKKA 3WYRA 3TWCH 3GSWB 3QULA 2P44B 4XRCB 1KB5B 4XXCA 3TH2T 4PG9B 4EN3C 1A7NH 4ETQB 4X4YA 2YPKA 3FO9B 4O58L 1GPOL 3AY4A 1MVUB 5C0AD 4XMPL 2B0SL 5J4MA 3M07A 5HDBF 2BSED 1C5DA 3P4MB 3QUZB 2CJUL 5HHNA 1OHQA 4XC3L 3WFBL 1CE6B 1JMXA 4CMHB 3SDCA 3OBAA 3GBML 5GHWL 5BRZE 1V3JA 2J8UB 5AZ2L 3LOWA 3K4AA 1NCAL 4A6YB 4OD3L 1C5CL 3I6LD 1JHLL 5K33A 4IHOB 3OZ9H 2IAMA 2VITB 5I1HL 1J0KA 1ZGLP 2XZAL 4HUKB 4D0CA 3V0AC 2L7UA 3KDMA 1NFIB 3Q6FA 2PYEA 5EUOA 3MV7E 3VCLA 5ISZE 1WTLA 4NJAL 5EUOF 2A2QT 4PP1D 5A40E 1SJHB 4CJ1A 2WBKA 2X4SA 2HG5B 3NFNB 1MCSA 1R24B 4HEME 3OF6A 3QI9B 4YEEA 5GGRB 3UTTB 5D1ZB 4L3EA 2XT1B 4D0DB 4HKJA 2R56L 5JLZA 2EDDA 4RRPG 1HZHH 1X6NA 4QRPD 4JO2L 4EN3A 3SGKA 4OFIA 1DBML 3RGVA 1OARH 2WANA 4PJ7F 4S1QH 1JV5A 4N0YL 5IM7B 4JHWH 1F2QA 1WAAF 4UUJA 2X4TA 3BE1H 3GI9H 1QA9A 1R3KB 4GQ9L 3DI3B 5CKGA 4EVNB 1HQ4B 3P9MB 3NCFB 4M8VA 5F9DC 2I9LB 3RY6A 1XGTB 1MHEA 2CLVB 3DUSB 3MOBH 3TVMB 3L1OL 2ZNXA 4JM4L 3V4VH 4NJ9H 3V9FA 3WFHA 4NUJB 3IFNL 2X4RA 3U4AA 4JZNA 3TVMD 1YYML 2ZOKA 3RWIA 3QWQB 2XXMB 4CW1A 4DEPC 1B9ZA 1W0VA 3K8KA 5I8CA 3T2NL 4WFGE 1I1CA 1ZLSH 4POZD 3QQNA 4U1JB 5TF0A 3MX0A 4OBRA 1X5JA 3KLAB 5I8KH 2OBGA 4MXWL 1C08A 5BVPL 5I6XC 2A9MH 4XP5L 3UEZA 5BMFH 5LBSH 3LS4L 5T5FL 4C57C 4EZMA 3EJYD 5JDSB 1MJJB 4YC2C 3BHBB 4Y2DC 1NFDE 4QO1A 1S9KC 3A6BL 5C0BA 3V7AE 5GJSL 2OZ4L 5JO5B 1FV1B 2B5IC 2DI9A 1XGUB 4OCWL 3RVWD 7CGTA 1LILA 5B4MD 1JGVH 3P4MA 4LMQI 1IE5A 4BUGA 3P0YL 1A7PH 2GJ6D 1MFCH 3W0WA 5CD3B 3LEYH 1E4KC 4DCQB 5HDQL 1UWXH 3RWCA 5HGHA 4NKIH 3JV0A 3ARBC 1T3FB 3VXTA 3BRGC 5GHWH 2YN5A 4OSUL 4LPTA 3MLSH 4HEPG 5CHNB 1JNHB 1D9KA 4FXKB 4UIKH 1T21B 1U8LA 5B4MC 5FDYA 2XIDA 1JRHI 1ODAA 3SDXB 1WWBX 2MQ0A 3BEVB 2X09A 3WDJA 1NGWB 2YA0A 4P5TD 4OQ1A 4FQXA 4JFDD 4RFEA 1SY6A 3RZCD 5TPWL 1TFHA 1LNUA 3LSOB 1IC1A 1GHFH 2ZWLT 5IIEB 1FGVH 5DURD 4AG4L 4P2RB 4K2UH 1JPGA 2YSSB 1WK0A 3V7MA 4DUVA 1HHIB 3QRGL 1BIHA 2ZCHH 3MA7B 4YR6A 1EEUA 1OM3H 5A16A 5FB8A 3VD9A 2R0LH 3TNNB 4FA8A 4WJ5A 3MRMB 4DZ8A 1P7KA 5CIPA 2OXGA 3SN6N 1PX3A 4OLXH 5IHBA 1JGLL 4FOMA 4NC2B 2YPLA 3TEUA 2MOVA 4L8BB 3D39D 5EOQH 5ENWA 2H8PB 2OSLB 3W11D 3D85B 3VJ6B 5CEZH 3VXSD 3O6FD 1ZGLM 5CIPB 3G6JB 4HJ0C 3BP4A 3I50H 3MPCA 5TPWH 2P48B 1JHTA 4PREB 5JIHA 1Z0NA 2F19L 1DSFH 1L9NA 1UWEH 3FFDB 3NFSH 4KKLD 3PWVB 1TVDA 1HN1A 4PPTA 2ED7A 1NGQL 4QRQB 1W8NA 2WBWB 5FGCB 4Q6IB 3UYRH 3HAEB 5E6IA 3IKCA 3X11A 3O41A 1OSPL 3RWGB 2XWJB 3HI6H 4DVRL 2HT3C 3VFWA 2JTDA 4YHKH 3JWDC 4JKPL 3GJFH 5I19L 1FDLH 4NPYA 4HK3J 3W81A 4Z76A 4LSVL 3BMWA 5DWUH 2DRUA 4OD1L 3BIKB 3MV9A 3TP4A 4PYHA 1JHTB 2R0KH 1K4CA 3IT8D 4PREA 2ARJB 1EAJA 4PGCB 3FB5A 3N1FC 1LO2H 4MA8L 1BWWA 3BZ4A 2NYYC 1QPPA 4RMWA 5INDA 5HXMA 2AJUL 3ARVA 1KGCD 3PWLA 5J8OA 3HC0B 3LB6D 2VZ3A 3QDJB 4L9LB 1DFBH 1GHFL 5F8RC 4O9HH 4LEOB 3VXSE 1G7IA 4JZOB 3F7YB 5C0BB 4PJHA 1TENA 3HN3A 4NC1C 3O3AB 4D0BA 2FEDC 2WK2A 5L7XH 1WWWX 5I2IA 1PSKH 3TGXA 1HCFX 1J11A 3EYOA 4AK1A 2GJZA 1HXMA 4F33B 1U95B 4OLZH 1ORSA 2HKHL 3LIZH 4R2GC 3K80A 1R3HA 3LH2L 4PJAA 2ADIB 5KSAC 1MVFA 1A2YA 4TTDD 5F96L 1OAYH 1NFDA 4NKIL 4XP4H 3WNLA 2HRLA 2X70B 3MYZA 4F7MA 5SV3A 1S5HA 3I9GL 3O81A 4APQD 3P0YH 5IV2A 2EXYC 1AGEB 3S34L 3RKDD 3C2SA 2YD1A 1NCDL 4K3GA 1B4RA 1S7RA 4NM8H 4G3YH 4K94C 2Y7QA 4AENB 4HS3A 4KGLA 4S1RH 4XI5C 3WDIA 1LK2A 1GL4B 3WXWH 1H5BA 4QHUA 4JCLA 1ITBB 4QHNB 2YEZB 3FOMA 3JTSA 3NFPB 4PS4H 1R5IA 4LLWB 2ITDA 3BN9D 3AMKA 4F2MA 1KJVB 4GG8A 4KJPD 4NNYA 2DLHA 5T5NG 2D3VA 1JZ5A 5C0FB 5IBLD 2FZ3A 4J3VA 4TVPL 5ERWB 3S96A 4Y16C 4ZG1A 3CGTA 5C0ND 2DBLL 3K81A 4XBGB 4EOWL 3NCJH 5FGCE 5DK2B 4PJIF 4TNWK 3VFPB 1QR1A 4M03A 4KZEL 3SKUD 1MWAB 5C0DB 4TVPH 2EYRA 3REWA 4PRHD 4S1RL 1G6RB 4I8DA 3V5KA 1RU9H 1VKXB 1FGNH 4FFYL 1ZSDA 5E99L 5ICYA 3QIWB 4U05A 5HDBE 4HDIA 1NFDB 4HQQH 3KLSA 1EPFA 2DKUA 3QIWD 5EBGA 3W82A 2IF7A 3FO1A 4M1GH 2E7BA 4ZUWB 1U91A 4FXGB 3D3VB 3GK8L 3RGVB 3NZHL 3BP6B 1ZANL 2FJHB 3HNSH 4LLQA 1DUYA 1A1NB 2AABH 4KDWA 2DLFL 3ZL4H 3QWOA 3O8XC 1XIWD 4NZDA 1PEZA 2D7NA 2BC4B 2IAMC 5DA0B 4JR9H 4PGEB 3HZKB 5HHNB 4O4YL 3ECBA 1TVBA 2MHAA 1JE6A 3BVNA 4PRIA 1GH7A 3ARDD 1NFKA 6FABH 3MYJB 4HV8B 3F65A 1H15A 1IM9A 3QFJB 1DE4A 2QQNL 1RZJH 2UZIL 4XVSL 4LSTL 3EO1B 3BP5A 3VMPA 4QGTA 5KBNC 1ND0A 3MJGX 4K55A 5JOFB 4EXKA 1KPRB 3ROLB 3HE7A 3KS0J 5DJ0A 4NN6C 4MA7L 3S4SA 2NX5D 1TVHB 1UJTA 4NWTH 2NW3B 4ZO9A 2GTWB 5EOTB 1ZLUK 1BX2B 4Q0XL 4FQQB 1DQJA 1IGCH 2R2EB 1ZAGA 3HNVL 2WIIB 5J1TC 3ZKMD 1S5HB 5E6YA 3X13A 1F6AB 1HI6A 4PJAE 3OXRB 2J12B 43CAB 2UZIH 1EGJL 1FDLL 3SDAB 2BFVH 5L9DH 1S9XB 3IGAB 3SKJH 4YHMH 3VCLB 1BJ8A 6FABL 3NA9H 2BOBB 4KTDL 1K4CB 3BMVA 5HY9A 5T1LD 2CK0L 1E4XI 2AXJA 1CGVA 5HI3D 5C9JA 3STLA 5ABDE 2C7UB 3ESVF 3TYGL 3PV6B 4OFVA 3HZYA 5E08H 2L4OA 3MODL 3EUUA 5IB2A 2XV6B 2XWBB 3UC0L 1DANT 1J8HA 5KTEH 3QI9D 4YDIL 2EDLA 5JW4M 1FNFA 3BGMA 4S11A 1QSED 1O7VA 2YPLB 1NUGA 5F6IC 3FT3A 4XNZB 3SKMA 2AKRA 5KANG 2HTKC 1I9RH 4HK3N 1AKJD 5CD5C 1PW3A 2IALB 2A83B 3MBED 2AEIT 1FG2B 1JGDA 3JWNC 1G6RL 1U6AL 2AGJL 1BGXL 4PD4K 3R4DA 1IT9H 2H32H 2EEBA 4JJHA 1AR2A 1FC1A 1I1RA 2BSTA 3K4ZA 3R06A 4NRXA 1NH6A 1LO4H 3D85A 4Y4FD 3BZDA 5BXFB 5HHQB 2JJVA 2F54E 4QCIA 1K3IA 4K8RH 5C09E 1ZVHA 1CFVH 4FFVC 1FFPA 1C5BL 3TT1H 3TC9A 3MRMA 3WN5C 1TCMA 1QOKA 1IILE 1GOFA 3BGFB 2BY1A 5J7CC 4EI5C 3KPPA 5L88L 3QCVL 4FQXD 1FNLA 1LO5B 3CXDH 1K4DB 2D31B 3L3KB 4KRLB 1S7TB 3J7HA 2NY6C 4PLKC 5EU6A 3UTTE 2WP3T 5C09B 1ZHNB 3VXNB 4IRJA 3MXWL 2P8PA 2LVCA 3DXAB 1C12B 4WEUD 4NQCD 5EPMA 5A43C 1KCKA 4OT1H 5MEQB 1PDKA 3CDFA 4DZ8B 5HYFA 5MEND 3C6LA 4JANA 1GGBL 3PGCB 1TJGH 1A7QH 2FH6A 1MPAH 4U6VL 3F6IA 2BY0A 3R8BB 2BNRA 1X9QA 1T7XA 2DF3A 2XN9D 5DQ9B 1MNUH 3MRHB 4XVJH 4MXWH 1OAUH 3FTGA 2Y6SC 2ORBL 5I8KL 2VQTA 4RFEB 1DQJB 2NY3D 3C8KB 2YMXL 4NT6B 1BX2A 4O02L 5K9KA 4JFXB 1HIMH 5D7JC 2WW8A 2P8MB 1OP9A 4HWBA 5E8PB 1UZ6F 4UUJB 1N5YL 4PJEF 2ZUTA 4XPBL 5LBSL 4DWHA 4RMSA 2B7DT 3KYKH 2FR4B 3QFDB 1BAFH 2BVQB 4MNHA 2CKNA 1HIML 4RMVA 3BGAA 3CFDB 4DOHB 5CINH 3C9NA 1FZMA 5DK3A 1GGCL 5KVFL 1CU4H 3KPRB 4HLZG 4YWGH 3GNML 4MXQC 1J9CT 2P49B 5JW4N 2VLJD 4X8XA 5FYJU 3VWJA 2VXQH 4G42B 2YD3A 1BEYH 5DJDB 3UPRA 4Z7NE 3UTZA 1NGPH 2VZUA 3B9AA 2DJ4A 3PABB 4UMGA 3X13B 4Z7NF 2EXWC 3OGCB 4DKAA 4KH2A 5C3TA 1H3PH 4WWKA 3U7YL 1RHHA 3OJDB 5JO5A 4PJBA 1MIML 4RBPH 2DQUL 5DS8B 2Z8VC 4JFFA 2V9RA 1FRGL 3IJYB 1BOGA 1IL1B 4N0UA 5IUSA 4JN1H 4OZIB 3I2CH 4F7TB 3BPLC 1YEHH 3UO1H 4P9HL 4PJBB 4FQIL 4Y4KC 3ZKMC 4IMKC 1IEAB 3RKDC 3MQIA 4UAOB 4ZPTA 2KL6A 4TUJA 4C4KO 1H0DA 1UM5L 5ESVA 5I1IL 5JOEA 4WEBH 3T09A 4J7RA 2EKSA 4YHLL 4CRPA 4WHYG 4NFBA 1IVLA 1UM4H 4E5XA 5IBUG 3W0WD 5GRWA 4Y5XB 5D7LD 1Z5LA 5GGTH 1FC2D 1ZT4B 2VYRE 4X6CB 3G5YB 5EO9A 4RWHA 3FO9A 4B53A 3D39B 4OCSL 1QFWI 3RWJB 5F97E 2CRMA 2M1KA 3MRRA 4XBGA 3G08B 3HAEG 4GMTH 4L29B 1XR9A 2VR5A 3VXMA 1RIHH 5HI4D 1AXIB 4I5BA 1KIQB 3D3VA 4R7DA 4K07A 5A2FA 2XACC 2BNUA 3LDBB 3MLWL 3Q48A 5F89B 3RNQA 1IGJA 1KENL 1PKOA 4H8WH 4PTTB 1MCWM 5I74C 3N9GL 5DUPL 3GFUA 4WFFD 2OTPA 1MAML 1FN4A 2C3GA 1H0DB 1BVKB 4UV7H 1E6JL 2Q86A 4BFGA 2AXFA 2GIYA 4U7KA 1WCBA 4XVUD 1CXLA 4L3ED 1IRAY 4WI2A 3LN4B 3U0PB 5KAQG 5MI0C 4G8IB 4XBPA 2ADFH 3S5LA 1JYWA 1AP2A 4E9LA 5EOCH 5H37H 1RZ7L 5F7LB 4F9PC 3V5KB 3EYUL 4JFEA 1NGZB 4UNVA 2V5RA 1YEGH 1AGFB 3UTTD 1N6QL 4IMLB 1QSEB 1JVKA 2VL4A 3TYGH 3ARPA 1V3LA 2NY2C 3SQOH 4M5YL 5FOBA 4P4KA 3ELAT 5D2NC 4PV8B 1U8NA 4PB9H 3W5MA 3KXFB 3MBEB 3SBWA 1AD9B 4H8WL 4I0PB 1H3TA 1HXMB 3CFIC 4PRHA 4TTDC 4XNQB 1F58H 1R3IL 3HS0A 1RI8A 2ZG1A 4RSVA 4N8PA 5C07A 1CFQB 3VFTB 5IFJA 1FPTH 2W65B 4C55A 1F4AA 4HGMA 1SY6H 1KSRA 4PJXA 4A2LA 3W9DB 3MACL 1U8IB 4ZOAA 3MRLB 2P8MA 1LE9A 1WAAA 2ZCKL 5GSRA 3SCMA 2K7QA 4R0LA 1CDUA 2AQ3A 1SJEB 5LWYH 2XQYG 5I8OL 3GSUB 2Q76A 3IDMA 1A2YB 1BIIB 3S3SA 2JB5L 5CILH 1R3HB 1XF4B 3QCUL 3N85L 4G9FD 5DJZB 3VFSA 3QEGH 5TE7L 4X7CC 5HDLA 4KROC 2H2PC 2R1WA 3QJHB 1ED3B 3BAEH 3LKQA 1RJYA 3MV9D 2ICES 2A73A 2NR6D 1AI1L 4LMQE 3GGWA 4CU8A 3MV8D 3T3PF 3MUGA 3B5TA 4PJDB 4N0UE 3F7QA 4WW1A 4XMKH 5CBEA 1JNLH 4DQOH 4NZUH 1MCLA 2FHCA 3SKOA 4I4WB 4UV7L 1NGYA 4YGAB 1JI1A 2FGZA 2LTQB 5FHAL 2CMRL 4W6WB 1G9ML 1RU9L 1X5FA 2BNQA 1CDCA 5IB4B 2R9HC 1IC4L 2ZJSL 3VI4E 5DC0A 1KPVA 2FD6H 4YFDB 4Q6IC 5TDPA 3NAAH 1QRNB 5C0CB 5BJTB 2VERN 4JHWL 2DLIA 3PQYE 1V7NH 1DUZB 1RUPL 2GFBA 1GXEA 3SJVB 2VH5L 5EBLB 1INQA 3LQAC 1UKTA 4NP4H 5EC2A 2HVKB 2HLAB 1BHGA 3UTSE 3WD5H 5T1LA 1TCRB 5JMRA 4J4PC 4XCFL 3KVQA 4OCRH 4NNPL 1UKSA 2W0FB 4LDOB 2A1WH 1T0MB 1IC5H 1AHWC 1Q9LA 3D25B 4XWGH 3DHMA 3TZVB 5E6ZA 5D7KE 4BSVA 4KRPC 3CMOH 3NCYS 4JPIA 4FQIH 3REVB 1REIA 3C2AH 4JHAH 5JNYA 4Y4HA 2FSEB 4LOUC 1H5BC 3ROOB 1OCWH 2YK1H 3ZHLA 3MLYL 2V7HB 3WUWB 1A14L 4IRSA 3AS3A 4G8EB 4TNVF 1JHLH 3KAAA 3A67H 3DMMA 4EUPA 2R2BA 3G6AA 4QRRA 4PBVC 3LKNB 1FNEA 3MNZA 3OHXA 3RTQC 3U1SL 3U48A 2VDOH 3OKMB 1MQKL 2UYLA 4R2GB 2EDNA 3MOAL 4M4PA 2NZ9D 5J12C 2ZOLB 2W9DH 2XNAA 1WZ1H 4M93C 4OGZA 2B4CL 1MF2H 4UILH 3MRQB 1BOYA 2EDTA 3WNPA 2R2HB 1F3DH 5GIRB 3CX5K 5T1MB 4CU7A 1Z9MA 5TQ0H 5DT1L 4X7EC 2VLJE 4MCZB 1D5ZB 5T3XL 1Q9WA 3R8QA 4EDWH 2GYSA 2XQYK 3L3DA 5C08D 5GSRB 2AP2A 1LEGA 3DSFH 1OF2B 1QLRA 3KR3H 2IBGA 4DKFL 4XNYH 3RWDB 5ECJE 1F42A 2NW3A 4M6MH 1P6AB 1RZGB 2Y36H 4JLRB 1JFQL 2R1XA 4H20H 1GGYA 1IAIH 3JWOL 3QXAB 1WC7A 1Y6KR 4MSWB 4XGZB 3QDMA 3DVFA 4RISL 4NO3A 1YQ2A 2OQJB 5DUML 1C08B 1TJGL 2NY5C 3DVNB 3M1BB 5B22A 2ZUQC 1LK2B 5JW5B 2ID5A 4FXLA 3CVHH 3WIFB 4GKOA 1RZGA 4JLRA 3IAQA 4YDVA 4XXCC 4NM4H 5DHVB 3WL9A 4QTIL 1S7VB 4LSUL 2H6PB 1A6TA 1DEEB 1FHGA 4K7PH 2VLLA 1R5WB 2BJML 3GSNB 3EOTL 2N1KA 4HJGA 1UB6A 4UT6L 5IVNA 4PJAF 4NO2B 1HH6A 4OKVA 3HMXH 3QEGL 4QT5A 3QDHA 4JGJA 1WFUA 4YDKL 5KVGH 3JV6A 1T1YA 3EFDL 2NY0B 4LVOB 2A0LC 3TT1L 5FUOL 2EYRB 4XCFH 3REWB 1QSVA 3DX9B 1QBLH 9CGTA 4GXUN 1B2WH 3ARFD 4KQ3L 4LEOA 4BQBA 5F3BB 1SMOA 5SWSD 3V4UH 5F9WC 4F57L 1HCVA 3MRFA 1S9WA 3RNKB 3OJVC 1D9KD 4HS8L 4IRSB 1YJDL 1NBYA 2ITCB 5C86A 1UCBL 4M1DL 3WIIH 1BGXH 4JN2B 4KK6D 6CGTA 1PG7H 2MCPH 3Q6GL 2YEZA 2CLZA 2VC2H 4JPWH 2E8YA 1P4IH 1DLHB 1I4FA 3SDDD 2MWCA 1JNJA 4I77H 4JQXA 1J1OH 1XR8A 4OLYL 2W0FA 2X1PA 2HP4A 2WUBH 1GRWA 3GSOA 2I07A 1S7RB 1KB5H 4LARH 4U1IB 1FNAA 2RB8A 3FOLB 1EVTC 2EKJA 5T3XH 2ICWJ 3QQ4A 1CLYH 5CZXD 5IFHL 4QRQA 4N5UA 1CGSH 1WT5C 1ZT1B 4TRPL 3O9WD 1CLZL 5CUSL 3ULUC 5JHLL 1FAKT 5IKCA 2OR7A 3QZWB 4Y4FB 5CILL 5C6WH 3QJFB 1DEDA 1UWXK 5BRZD 1EGJH 2R8SH 1QQDA 2CLRA 5F70A 5IVXF 3B2UC 3VWKB 3X11B 2BVEA 2X4NB 4RRPA 3RPKA 4I13B 1IFHH 1MFBH 5FYKH 4PG2C 1I7RB 4Z6AT 2DWEA 4D9LH 4Z18A 5JW3L 4ALAH 3KWWA 3OKKA 1U36A 5GRJL 2HJLA 5EU5B 1LHZA 1OWRM 4NQUA 3FO0L 2NY2B 1KJ2B 4P48A 3KPLA 5DZOA 4OZHE 5GGVH 2Q6WA 4JREC 4IHOA 4LBEB 4RA3A 1UXSA 3L7EA 4Z76B 2YKLH 3QT2A 4U1KB 5FYKE 5EH1A 1N3NA 5CGMA 3UPCA 4NN7B 1OOAA 2CPCA 3WHXB 2XY2A 3D0LB 3MRGB 1EH9A 3LKNA 3RWHB 5I71C 3ARGA 4JRXD 4XNUH 3SE4A 3FMGH 1NJ9B 4XI5D 3ZKQD 2IMNA 2WLZA 1W72B 4UZGA 1J7VR 1E28B 1IAIM 3C8KA 3PV7A 3TNNA 1VESA 5T1KA 1S7QA 3BP7B 4F7CA 4BZYA 4ZSOE 4FTVA 4NJ9L 4C54A 4FQ1L 2GCYB 4GOSA 1T2QH 3OF6D 2PR4L 4FQPA 3ES6B 1V05A 4KXZI 5F7UA 2Q76B 3IDMB 2OZ4A 3MXVL 4M6OL 1JUFA 1NGPL 4Y1AB 1B0RA 4GAFB 3T2NH 3KHQA 1J1PL 4PRHB 3TH3T 2Z92B 4QNPF 2J8OA 2W1NA 4L4TD 3FT2A 4F7PB 3O6MH 3ULUE 4APQB 3FCTA 1UC6A 1MFAH 4M7JL 4PRBB 1JNHA 2P47B 5JXEA 2AV1A 3HI5L 4B7IA 1OW0A 2Z8WC 2QSTA 3V8OA 5DGRA 2VLJB 4PD4J 3FO2A 2O61A 4DCQA 1RUMH 3W0WB 5CD3A 1FGNL 1HZHL 3T1WA 2DLTA 4U1GB 3T0EE 3IU3B 1DBJH 3WJJC 4U6TA 3QG7H 5TH2B 4DK3A 3GSXA 4TUKH 4L8DB 4PJ5A 2AXFB 3UZQA 2ADGA 5EZOH 5HGGS 4NRXB 2H41A 2OS7A 3L3OB 2CIKB 1YPZE 3MJ9L 5JMOC 4XC1H 1M7DA 4JKWA 4GRWH 5HYSA 4EUPG 3V6FA 3PJSB 4TVPD 4H0IA 5JW3H 1E4XH 4NQDD 5ID0B 1IQWH 4WI3A 4HWBH 4JO4H 3ZHKA 2EDEA 3RPIB 4WO4A 4XVTH 2GUOA 1UH3A 5I15L 1B3JA 4GG6B 1P7QD 2NY3C 1BEYL 5I6XB 1HILB 4ZAKB 4CMMA 5B38B 3DARA 3MLXH 4XCNA 1JWSA 3F62A 4J3UA 4H8WC 3U2SB 4OI9A 3UBXB 4UV4L 5C0AB 1UJ3C 4KUZH 2EICA 5D7IE 3N1PC 3CVHA 1AGDA 4W68A 2I27N 4UTBL 5D1XA 4NQXB 5HJ3B 4RGNE 4QRRE 4MD5A 4Y0GA 3QUYC 3ZYOA 4XWGL 5GGQL 4XPBH 5TDNB 4GMSL 3VMNA 5C6PB 3EOAA 1RZFH 2CRYA 1MCFA 4R4BB 1AP2B 4PLNC 4JDZA 5EU5A 1OAQH 1U8MB 2AJZB 4V2BA 3BZEA 3T0ED 3Q5OA 2V7NA 3PABA 4UOW0 4G9FB 3WMSA 3PGDB 3UTZB 5IVXA 4R90L 1HYSC 3RUGF 5KG9A 3MRNA 3DSNA 2QSVA 3UMTA 1YJDH 1A8JH 3RRQA 4GMTL 3BHBA 3CFBA 4LCIL 4N0UB 4X9HA 1KCLA 2NX5B 1NANH 5DEFA 3QQ3B 1BQHA 3Q3GB 3VXRD 1FYHB 4F9PA 4JO1H 2ATPA 3VRLF 2PTTA 5D2NB 2ARJQ 1YY9D 3QI9A 4AG4H 3MGAA 2XN9E 2F8VA 4BZ2H 3BKYL 1IARB 5K9OB 2VIRB 1J1XH 4IRZL 3GSNA 4M5ZL 3C6SB 1UA6L 3W9EB 4CDHA 1NMAL 3U46A 4DN4L 5LGKA 1K8DA 3HI6L 5T3XD 5J89A 1KB9K 2FX9H 2DM2A 5DI8A 5DHVA 1W0VB 5ESAB 4YX2H 2D9QB 5DQ9A 4EXPX 4ETQA 4G8GD 1R3LB 3ZT6A 4XP1H 2DQFB 5HJ3A 1I3GL 1JPSL 5D2NE 1K2DA 3U9UB 1T66D 1N7MH 4ZUWA 3KPMA 1T04A 4NUGL 1X5GA 3ZYZA 3SCMD 3IF1A 3QNXA 1IGTB 3C08L 3SE9H 3MJ8A 1NEZG 3RZCC 3HMWL 5AWNL 1KG0A 3MTRA 5ISZD 4YXKH 4LKCB 1AO7D 2FX7H 2X4SB 3CPLB 4NOBA 5GJSH 1SY6L 2HYMA 3QEQB 1LO0L 1D6VL 5F7KC 2A0LD 5BS0D 1NFIA 3Q6FB 3V6FB 1VGKB 1IFHL 1IKNA 1MFBL 3ZZ1A 1CTNA 1H3GA 1CT8A 4P46C 4M62H 4KVCL 3U6RB 1HSAB 4IOFC 1U8HB 4JRYE 3B6SB 2P8PB 5DK2A 5TQ0L 4JG1L 4Z0BL 2BOCA 3OJDA 2JKXA 5HGDB 1XIWA 5HBBA 2Q8BL 1FFNB 5EIIB 1XF2A 5EU6D 4LIQH 1NAML 4P5KA 3K0WA 1MF2L 3O11A 2F53E 2HG5A 2M2DA 2AABL 1I85C 2YA1A 1MAKA 2AXGB 2WIMA 3HNSL 3NMEA 4HD9A 3C6LD 4GG6A 4CDGC 5E8NA 3MCLL 3BRFA 4G6FB 4PY7A 5BVJA 3RWEA 1LEKA 3U83A 5L6YH 4MD5B 3EOTH 3QDGD 2VO5A 4UT9H 3LMJL 2YWYA 3DWTA 3UTPD 1VFBA 2LFGA 1MCOH 2NX5A 1Z6JT 5IMOB 5SWZA 2WWMC 4KI5D 5ACMA 5MENE 3MLXL 2VC2L 4JPWL 1A14H 5IMMB 3D3VD 2GJ6A 1F4YL 3MA9H 1NUDA 1BJ1J 3V0VB 3JWDH 3IDJB 2VDKH 4JKKA 5HHVH 1TITA 1BQUA 3HI1B 3PGDA 4Y2OA 4NBZB 12E8L 1F2XK 4P2QA 3FFCB 4OD2A 4P46A 1CXEA 4WEMB 1MUJB 4XCEB 5D7KD 4PGBB 5GS0C 3W2DL 1RZJL 4XVSH 5IEHB 4LHUA 2A6IA 1T4KA 3C6LB 1IGFL 2OR9L 4HBQA 4JANB 5LKNA 1CFTB 1QBLL 5J1AA 3T2QA 1S9XA 3IGAA 2ZUVA 2R0ZH 1MCQA 5D9SB 4KI5F 3FQWB 3QCTH 1G7HA 1AGDB 2FD6L 1I3RB 1DN0B 1RZKH 1YEJH 1RY7B 1ADQL 3QG7L 4U1KA 1S7XA 1ADQA 2HA1A 4CBPA 5HHOD 5EOTA 4H25B 35C8H 3ZE1F 1SM3H 1M7XA 2VDLH 4DUXA 2DWDB 3FHAA 5DQJA 4ZAKD 5C6TL 3RA7H 3EO0A 1EMTL 3MLZL 1NBQA 3FO2B 4NZUL 4I0KA 3HPJA 1DANU 4K9EC 4KI1A 2PO6B 4KPHL 1X4YA 4IOIA 5GS2D 5DVKA 5FXCH 3RJQB 1HKFA 2IALA 1JTTA 2UWEA 5E2VL 2UZXB 2GITB 4HIJA 3T3MF 2W91A 5CEZE 3VRIB 1T7WA 3UX9B 2VNCA 1EEYB 4NO0B 4ZSOB 1G7QA 1ORQB 2APXA 1BECA 5C6TH 2A6DB 2JIXB 4R3SB 1XGPA 2EDYA 3EOYG 2UWEB 2GTZA 3QH3A 1RZKL 3KS0H 3CDGB 5EUKB 1T2QL 4MHHG 2OM5A 2P5WA 2DL2A 4ZTOH 5I74B 5A2KH 5J12B 5INCA 1A7NL 3NCJL 3AY4C 2DQIH 3MV01 5D6DC 3HC4L 1W72H 1BREA 1IAKA 5D2LE 4MVBC 4P59H 1CXKA 3NIFF 3SKJL 4Z7WB 3UJIH 4OGXH 4HH8A 3DUHA 4KY1H 1KEMH 1KJMB 1PKQA 1A9EB 4PRDB 4FZEH 1DDHA 5IF0B 1EV2E 5HYQB 3HNVH 5AYUH 1NCBL 2AJXL 2X10A 2VABB 2VDQL 5IMLA 4XZUA 5CEXA 5DRNB 1I9JL 1MLBB 3U4EB 3BEWB 1ZLVH 4MZ3A 1G6RA 4PGDB 2F53A 4ZYKA 3A67L 1KTKE 1CT8B 4PUBL 5JUEL 2HFTA 4I2XA 4OB5L 4ERSL 2RIKA 4NKOA 2V17H 1PQZA 4X6EA 4FZ8L 4CL7A 3TBVA 3O4LB 1NQBA 1Z2KA 2Y5TA 4HDIB 5DJ6A 3HR5B 1RPQA 4AZ8A 5F1IB 4MNQB 3QIWC 1N4XH 3MRBA 4I9WE 3IDJA 4WTZG 3VFMB 4AMKL 3IJHB 2IWGA 2LVEA 1XGRB 2OR8A 1QQDB 2CLRB 4ZS7H 3IU4H 2ED9A 4NO5B 1UXWA 3A6CL 4LCWA 5EU3A 3CX2A 5JHDA 2NY3B 3OKOB 5D93B 3GMPA 2EH8L 2AJSL 1ULVA 5C0GA 4NRYA 4MA1B 4O2CB 1XH3B 1B0GB 1YNLH 5FYJE 3C5SB 3PQYD 5HYJE 3KPLB 1AGEA 2FJFB 1H15B 4MNQE 3LRSA 3KXFA 5FKPA 1JZ6A 3IDIA 2DTMH 3PWPE 2LU4A 5IBLC 2ZJSH 4ZFFA 3E6HA 1A7RL 1U92A 4WHYH 4HS8H 1UJ3B 2H32B 5IW6B 4UDUA 4LAQL 3T0XA 3RDTD 3LHPL 5EC1B 1K6QL 3JUZA 1YEDA 3QWOB 1Y0LA 3HLAB 4ODXB 5BV7H 2ICWB 1R3JA 3WJLA 4P59L 3FQXA 4JFYA 3EYOB 4F9LA 2V2WA 2VXTL 1W72L 5AWNH 1FNGA 1OSPH 3P11L 1NPUA 1J8HE 1T5XA 3FB7A 1I9RL 3HLAA 3UYRL 3M17B 5E7BA 2N4IA 3OG6B 1OY3B 2EDKA 1W0YT 1UB6B 1VFOA 4XPGH 1HNFA 1J18A 4U1JA 5INDB 1TTFA 1GSMA 4UT6H 4U1NA 3VWKC 1AH1A 4MD0A 4HWZA 1VSCA 2BJMH 3HAEH 2ERJC 4OF3A 4HC1L 2ITDB 2VR9A 4HC1A 4JM2D 3RKPA 1VKXA 2BSRA 4X5LA 4RFOH 3U30B 4ONGH 1MIMH 5KOMC 25C8H 4MNHB 4U1GC 3JUYA 5D7JB 2IANA 4CVWA 3A6OA 2CLZB 3AAZB 1X5XA 3OAZK 2J88H 4JRXA 5AEAA 3R1GL 4KMQA 5E9DA 3BSZH 1GGCH 1JTPA 2C1PB 3PP4H 4FRWA 1KCSH 2VQUA 4F9LC 1ZHLA 2DJSA 3O3DA 1P1ZA 1Q9LB 1UM4L 1X6LA 5IESH 4BELD 1JFQH 2NPLX 1DVFD 2F5AH 3FKUS 3EGSB 3VD4A 4YK4C 1KELL 3ARDA 3LN5A 5IQ7L 4YHNB 2X5PA 3T4YB 3AXLB 3BEWA 1SEBA 2BHYA 1INQB 5EC2B 3HB3C 3VJ6A 5EU6E 3B83A 1ZLWH 3UTTA 1CLOH 5EWIH 1SEQL 3QIUA 5JDJA 4KUCF 5F1IA 3MLTA 1DUZA 4KKBD 4J1UB 1UQSA 2YUXA 4PBXA 4Z8FH 2V5MA 4QOKE 1E6JH 2NY1B 4ZPVA 4ZXBB 4KAQH 3N9GH 1GGBH 3QUXD 5HPMA 2BHUA 3P9WB 4HUXA 5JNYB 5F44A 4XPHL 1EAPA 1VGEL 5C0GB 1R3JB 35C8L 4JKPH 3OKMA 4NZRL 2Z35A 4LLYA 4MD4B 3G6DH 2D03H 3AVEA 5HSFA 2E6QA 2PF6A 1X5AA 2OK0L 1T1ZB 4NSKA 1H9VA 3A6BH 4JFPA 4YBHA 5K9KB 4WU5A 4FQJL 1TZIA 1HILA 1Q0XH 5ALBH 5EZIL 2DMCA 4ZXBC 1QYGL 4JY6A 3DTXA 1TDQA 4CVXB 1PZ5A 4FFYH 4HWEL 5C0RL 4ISVB 2R1YB 1WZLA 1Q9WB 2APVA 3MJ6A 4IOSD 3MGTB 3P4NA 3ESUF 4P23B 4G43A 3ZT5A 2C26A 2EEAA 2EXWD 2ED8A 4OLZL 5I1IH 4WHCA 1UWEL 3VD3A 2F8XC 4WO4D 4Q74A 4KZEH 1A7OH 1DBAH 2ICCA 4PB0L 4K7FB 2G75A 1BJ1H 5DD5L 1LO4L 4MLIA 4KDVA 1QRNE 3BN3B 3GKZA 1NFDF 4NQCB 4UTAH 1C12A 5HHVL 1XGRA 1J1OL 1W72A 4OGYH 3SQBA 3IKCB 4RNRB 5DZNA 3VRIA 1XF5B 1RUML 4PJXB 4J8RB 4CJ0A 1KCSL 3KPSE 5C0IA 2Y72A 1MHHB 3CFEA 4J23A 3S98A 1OAZL 4WW1B 4OF5A 2EDJA 2FHFA 5DFVC 3RWCB 3HFMH 5HHMB 4RAUB 2B1HL 3EO0B 3O2WL 3RUGE 5C9JB 3FZUD 4X5XB 2YA2A 4RCAA 4KZDL 3NTCL 4DKEH 4Z7OF 5E0QA 2QSCL 1AI1H 2F9BT 3BI9X 1OAXH 3LKRB 3THML 1F4WH 2JCCE 3F8UB 2O5ZL 4RA0C 4YX2L 2QEJA 4XMKL 4LIQL 3NIGE 2LAGB 1JN6A 2A6DA 2JIXA 5IF0A 3S36X 2WBJB 2ZSVA 3I75B 2PW2B 4JRXE 1K8IA 4HC1H 2ADJB 3BKYH 4JEGB 5F3HA 5J13C 4AMKH 5I17A 4J3WA 3V52L 4EI6B 4R0LC 2EYSB 3B8SA 4FXKA 4I3RH 4YR6B 5JA8B 4O02H 4AYFA 3P3YA 2C3XA 5TGBA 1EJ6A 2VISB 2DL9A 4XCYA 3DBXB 1CFNA 4RAVB 3UYPA 1U8OA 5E2WH 1GGIH 2ZCKH 2DAVA 5TE6L 1KJ2L 3G5VB 3TCLA 4R3SA 3O2VL 3FO0H 3KJ6H 4RZCA 2VDKL 4IRSD 3EYQC 4R7NA 3NH7L 2VN4A 3ZE1E 4M1DH 1BF2A 4CW1B 3FQRA 3QDGB 4ESKA 3MRRB 5GZND 2BOCB 3AMLA 5CLTA 4GLRH 4ZOCA 3TVMC 5J1AB 2FATL 3DGGA 2OI9B 1EGJA 4XP5H 1MHEB 2CLVA 3C8HA 5GZNC 1J5OL 5L8LB 1ZLVK 2W0PA 4GRLB 4Y5YA 1FGVL 1LDPH 3UC0H 3CUPA 4LSRH 3FT4A 4P2QB 4UT7H 3SQOL 3G6JE 4MQSB 4E42B 1MCWW 1N64L 4Y5VA 5IR1A 1ES0A 2FNBA 4QOKB 4UU9A 1RIUH 2Q8BH 3MLVH 5GISL 1NCNA 3OPZH 2F54D 4KZDH 1UKQA 1AC0A 1Z3GH 3QO1B 3KYNA 1MQKH 4P2YA 3BIBX 4UAOC 2HRPL 1LMKA 3NFSL 4WW2C 1OAZH 4JFOA 4JFYB 3BH8B 4JFDE 2MQCA 1IT9L 4TNWF 3RWEB 3ZE0E 4UNUA 3NVQA 5FA4B 5HI5D 1XCTA 3RBGA 1LE5B 1DQMH 5B3JF 2XPGA 3O4OB 1HQRA 3E6HB 1Q72L 5IROA 4GT7A 4RQQB 3W9EA 5KJRH 3PIQA 1Q9OA 5IMMA 3KPQB 3KPRA 4TSAL 3GKWH 4P5KB 4LSPL 1SVZA 4N1EA 4UTAL 3X17A 3OXSA 4MB5A 5FYLE 3ZDXF 4ONHB 5KN5A 3NABH 3CFCH 2H3NA 4JZJB 5DLML 1BZQK 4X9BA 2DQFA 1UT9A 4AH2B 1LP9E 5T1DL 1PG7W 1R3LA 2NNAA 4GKZA 4OF0A 2WP3O 3SDCB 3OXSB 1YPZB 3B9KB 5MP6L 4O4YH 3UJIL 3L95A 4WHDA 2Z93A 5EFIA 3RVUD 4HWEH 3RVTC 2VRAA 4TSBH 1I7TA 4YDKH 5K9OA 3T0EA 3D69A 4WWKB 4JPKL 5FYLL 3O2DA 4E42A 5JXED 1NCCH 4HUUB 3UJJL 3LKSB 4S10A 3GSVB 5CZKA 4Z95H 3NN8B 2A77L 5IEKB 5F7FA 3C60D 1DJSA 1QD0A 4HF5H 1T2JA 3MBXL 5CMAA 4WFHE 2CMRH 5KSUA 5ITBL 2W38A 5DJ2A 3ULUD 5HVHB 3GSNH 4Q9RL 2AEQL 3KJ4C 3MC0A 3S34H 1F3JA 4NN5C 3SDAC 5DUBA 5J6HB 1MCOL 4NQSA 5HDOA 4HAGA 4NWTL 4FTVD 5IVXB 5LGJA 3CCHB 3F7YA 1U2HA 5L6YL 3O8XD 5DSCB 1T2XA 2ESVA 5EORH 2EE2A 2DB8A 1KG0B 4Y19E 2OXHA 2Y36L 4M8QB 4E5XB 4PJ9A 3S7GA 2YPVH 1Z9OA 3FZUC 4DKFH 3KR3L 4P57B 5LJYH 4MZ2A 4NNPH 1A0QH 3T2OA 4M6ML 3KDMB 2FECI 3CH8A 4ZNEA 4F15B 1U3HB 3QDAA 1BAFL 2D0FA 5FK9B 4PG9A 2XKSA 4NCC1 2H45A 4OZGE 5F7MC 1MCKA 3AB0C 1ONQB 5IW3A 3BYTA 3BSZL 3A0OA 1WZ1L 4U3CA 1HOCB 2EDWA 5B8CA 4XCNB 3MOAH 5C07D 5ITFA 2J5LC 3EYSH 2B4CH 1MCDA 5GRUH 4TSCH 2W9LA 1SBSL 3TPUB 3LV3A 3IDNA 4GKSB 4HHAA 2VISA 4NQDB 4U1HB 2IAMD 4WW2B 4IRJC 4OBSA 5CJXC 3JWDL 4LKXA 1CVSC 4HLJA 3MRQA 1CZ8H 2OTWA 3DXAE 3VU2A 8FABB 2VZOA 2V5YA 4NZJA 4BQ6A 4XPGL 3RVXD 1YNKH 3KPTA 3VXNA 2MTPA 4XAWL 3B5HA 4JQXC 3FQRB 4Q97A 3ULVE 1U41A 2DQCL 4OIBA 1K4DA 2D31A 1QEWB 4WNQB 2EDQA 4LCWE 4RDQF 4Z77B 1WWAX 4L3EE 4HULB 1MELA 1M6OB 3KNBB 2QQQA 32C2B 2GHWB 1CWVA 2UVFA 3KPSD 3OKNA 5KJRL 2MKWA 3SDCC 1FSKC 1TNMA 1MLCA 5F7EH 2DD8L 4X8JA 3RDTB 3AFLA 4X4ME 3SDDB 4GW4A 2A74A 3FRPG 4RFNC 4GSDL 1CD0A 3NPSC 3UJTL 5KSAB 1WTGT 4GFTB 1KXQE 1RK1A 1KBGL 4E0RA 4IJ3C 4NQEE 4X80H 5TFSH 4M61B 2R8SL 3RWHA 1BD2E 4Y7MA 3D0LA 3MRGA 1FL6B 1G7MB 2ZCHL 2IANE 3GMMA 4KQ3H 1T83A 1VB9A 4P2QD 3MXVH 4M6OH 3VXTB 4NBYB 4EJ1C 2UY6A 3BISA 3IDYC 3QQ9C 2C7UA 3OAUL 5FUOH 4FQ1H 3GO1L 1ZWIB 2E7MA 4KDTA 1Q1JH 4CVZA 1IAII 1KEGH 5GRZA 3RUGA 5F3HB 3W11C 3RGVC 3WEXA 4MA1C 2P24B 3OXRA 3SKMB 3MUY1 3PWPD 3FRUB 3N1MC 4AL8H 2BFVL 5L9DL 5DURB 2FO4B 3VXOB 1D5XA 5L2JB 3UBXI 5J3HC 1MFCL 5C70A 1CCZA 4EEEA 2MPAL 2GTWA 1L4IA 3GGWB 1UYWL 3P9LA 5JDSA 3Q6GH 2A6KA 2FYYB 3T1FA 5MEOA 1PY4A 4R2GD 2L7JA 2D0HA 3ULVC 2GSGA 5F1KC 4K94H 2NR6C 4O2FB 4HIXL 1CGTA 2GCYA 5DO2C 3H7BB 5I75C 4H20L 4FZEL 1N6UA 2DLGA 1YECL 4P3DB 4F7PA 5C0EB 4YHNA 1YNTB 1YNLL 1FORH 1SYVA 2HMID 1TQCB 5C0DA 3TJHD 2HT4D 1T7ZA 1V3MA 3GIZH 2QJDA 5FV2A 4U49A 5CP7B 3SOBH 4WEBL 1MHCA 2IAND 4ODSH 3WE6A 4PRNB 3ZE2F 2VE6A 1ZHLB 1OWWA 4UILL 4LLQB 2JIXD 5IJKC 1CF8H 4X6BA 1D5BA 4CVXA 4NWUL 3D87B 5E9DD 1UZ8B 1OAUL 4N68A 5ELIA 3IAPA 1KJVA 3GK8H 4M9PA 5IOPA 1B6UA 4A2MA 4ZFOA 5CWSA 4K7PY 3KWWB 2H2SD 5I1JH 3TJEH 1S7WA 5D6CB 3O3BB 4XH2A 1EXUB 4P23D 3HFML 5DHYA 1KACB 3RVTD 3CFKB 2AERT 1GZQB 2DI7A 3MRIA 4J12A 1DLHA 1X5KA 1HINH 2XA3A 2ZCLL 1OGTB 4M9OA 4HBCH 3D3VE 1MJJA 3CU1A 1JGVL 3BIAX 5D7SL 2O5XL 3ALXA 2EDOA 1UGNA 3NTCH 4YGVB 2VXQL 1A3RL 5HPMB 4MJ5B 3LEXB 4MDJB 4I0PD 1P4BL 2Y6SD 1EZVX 3S6CA 4LSDA 1UCBH 3L5WB 5A3IC 5DJ0B 3SKNB 3KLAA 3GMLB 4WI5A 3BKJL 4YFEA 1ADQH 5I75B 4PTTA 3LPFA 2VQ1A 3O6FA 1IGML 3KPQA 4AY0A 2Q7YA 2DIBA 4DTGL 4U7MA 3SGJC 4O5LL 2JF1A 4X4XA 2APBA 4X6DF 5L2KB 3EZJB 1EDQA 1OTSC 2V2WB 2RHEA 1CICA 2G5BB 4U1MA 1UM5H 5EBWB 4O2CA 4KHTL 4G6KL 1QFWL 3SE8L 5FGSA 1EZVY 4HLZH 3G5XB 4LOUD 4K71B 3QG6B 1A7OL 3RVWC 2VMFA 5JW4Q 5F71A 4Z7UA 4A6YA 4MSWA 1QFHA 1A47A 3TESA 3TVMA 1CICB 3DOSA 3NCYP 4MQ7B 4RGMB 1A3RH 3VGAB 1QLEL 3BDXA 3PQYA 3PUCA 1R5WA 1U93B 3V79C 3F7RA 4HKXB 5E8DH 3RWFA 1NC4A 3QI9C 4MD0B 1I1FA 1QFUL 1U2CA 1N0XH 4ZUTA 4LLWA 3ARFC 3ULUF 2C5DC 3RVUC 3ULVH 1WIUA 4Z8FL 2PTUA 4GRLA 3EYSL 5IT2H 3IDGB 4HS3B 4K3JL 5L2KA 1DBKL 3E2HC 5I17B 2JCCA 5JLZB 1FVDA 4JRYD 1B90A 3TA3C 3QCUH 3WD5L 3S9DB 5EC1A 4YHYB 3B5GA 1G84A 2F5AL 4O58H 2R23A 3E8UH 1RMFH 4GQPH 1GC1C 1RUPH 1YC7A 5FM4A 1AO7E 1JWUB 4TUOA 4Y2DB 1GOGA 2VKXA 2IEPA 3FB7B 2Q8AH 3OKDA 1OQOA 1J0HA 4KJQD 1LO0H 5C0BE 3B2UD 3GUTA 2HFGH 1JZ7A 5C9KA 1NBVH 4OGAD 4ZMAT 3X14A 2YZ1A 1ZEAL 5EULV 5KVEH 5KS9F 1PFCA 1AHWA 5KANI 3X12A 1KFAL 2H8PA 2NXZD 4L8BA 5TDOA 3OR7A 2IFGA 1X4XA 3TFKC 4MJ4A 5ADOL 5BXFA 2Z31B 5FO9B 3QUZA 2XWJA 3MV8B 3QEUB 4G5ZL 2AV7A 2HWZL 4MA3B 4PB9L 1XIWC 3I6KB 3QNYB 5C09D 2LQRA 4IOFD 3BGFC 3HR5A 1PX4A 4E41D 5CGYD 1G7JB 4ODHL 1ZA3B 2RFXA 4QOKD 3NPSB 5B3NA 3B2VH 2R9HD 4X6EB 1S9VB 1T0MA 3DV4A 3MGTA 3P4NB 4UB0H 5B39B 4OIIL 2APTA 1DVFA 1I8IB 4RFOL 1JYVA 1MCNA 3QNYA 2ADFL 2NQCA 4UINL 4JQVA 3L5XH 1PD6A 2CO6B 3TT3H 3HC3H 3OKEA 3KPNA 5FF6B 3BPNB 3TN0B 3EDEA 3HKFA 1VADA 4AL8L 3TNMB 5TDOB 1XGYL 2O5ZH 3CK0L 3MV11 4JO1L 4ZTPL 4JG1H 4Z0BH 1EEZA 1KEGL 3KPNB 1KCUL 5I1EH 4JQIH 4M62L 5ANMB 3OKNB 3NGBC 4WTWA 4LU5H 3QUXA 3PWJA 4FG6D 3DURA 2ATKA 3P77A 5K59F 2PXYD 5JHDD 1R3IH 3CD4A 3BP4B 3QUZC 4NQTA 4I77L 1CG9B 1ZVYA 3K2UL 2PCPB 3OJ2C 4PJXF 4GAYB 3TIDA 3P30H 1FV1A 3D0VA 2NXYB 3TBWA 1WFOA 3BD3A 1ZLUH 4YHLH 2JB6A 2QADB 4FQQA 3NACL 1JF6A 3HMXA 2RGSA 5DMIL 1YEGL 5GGQH 8FABA 4CVZB 3BD4A 1FQ9C 3IS1X 1JPSH 4ONFH 4P4RB 1OGAA 4EDWL 1ED3A 5AD0B 4KJYB 4UIKL 1J88A 3TO4B 4ZUUB 3FFCA 4OD2B 4P46B 4P2RA 1I8KA 1H8SA 3TF7C 2C4XA 5GGUA 4YXHL 3IJSA 3N85H 1QBML 2AK1H 3SY0B 1FAIH 4IBLT 5LWYL 2W9EH 3FQNA 4N0RA 4QXWA 1JF1B 1FIGL 5L2KE 3MLWH 5DVMA 1ZANH 4KK8C 3H0TA 4C56D 1SBSH 2EIZB 2YD6A 5LGHL 2KDGA 5IBTH 5AUMB 4KJQC 4ODHH 4V1DA 1E4XL 3AS0A 3GB7B 1J87A 4G5ZH 3ARYA 4HWBL 5HY9B 3JZ7A 1A7PL 5DQJB 4EN3D 2HLFD 5ACLA 4D2NA 4DVBA 3SDYL 4F3FA 3VD5A 4OGXL 3ULVF 3U9PH 1PVHA 5DJZA 5E2WL 1HDMA 3LZFL 4LQFL 1NMBL 5ACZA 1BFTA 5EU4B 4TQEL 3RNQB 3FONB 2BNUB 3T08A 1RZIA 3DX7B 5H35B 2FHBA 1BPVA 3MRLA 4PJDA 4DOHE 1A3QA 3LS4H 4PY8J 3WSQL 4U6YA 2SEBB 2IGFH 3H3BC 1YMME 2WAHA 1XF3B 2X05A 4HPOH 4BA8A 4G8IA 4XBPB 4CADA 4BH8A 4YHIB 1ZE3C 2QR0B 3IDNB 4TTGA 3B9KC 1IQDB 2DKSA 5IW6A 2B8OT 3O6ML 3NFNA 4M7JH 3MNVB 4IIQA 3ARSA 3DLQR 5BS0B 1EMTH 2H6PA 4NDMA 4HJJH 3QO0A 1R3KA 2AK4D 4X4ZA 4LSVH 1F8TH 2KQNA 1YQVL 4GQ9H 4LF3A 4PLJC 4YC2B 5I19H 1RIHL 2BSSB 5CINL 3V0WH 3I6GA 1VFBB 25C8L 1HH9B 2X4QB 1BVZA 3BPNC 4J6RH 3TN0C 3BH8A 3RWJA 3EFFA 3VI3E 4TN9A 4HFWA 1ZGLB 1YY8A 4HPOL 3PL6A 2WWKT 4OCSH 1N0XL 4LCWB 5EU3B 4JFEB 3VFOB 3ALWA 1YMMB 5F88A 3WFCH 1U91B 1D5MA 4FXGA 5F6HJ 4QF1A 3GHEH 4I3SL 1AD9A 3BQUA 4RGNC 5F7DA 5EOCJ 4KQ4H 2RAMA 3ZTJG 5D1ZD 4OLWH 5DJ6B 1UACL 3NOIA 3S35H 2ADIA 3QIWA 4H1LG 3TFKD 3LRSB 1YEIL 2EH7L 2F54A 1CS6A 3CAFA 5F9AC 1I3VA 4MJ5A 3SDYH 3V5DA 1Q0XL 5ALBL 1H3XA 4MQTB 4UI2A 1A4JB 5HD8C 1QBAA 3QA3B 1IGMH 4C83A 1HH9A 2OCFD 4U6HA 3U0WL 2WUCL 3VDCA 3I3EA 1MFAL 1AO7A 2BK8A 3BWUC 1FZOB 4ALAL 3F12B 5CJQH 3VWKD 2X1OA 5C3LD 4JPVL 1DDHB 2J8UE 1G9NL 1WF5A 5BRZB 4QF1B 3VFVA 2I5YH 3T0DA 3WUWA 1CE1H 1F4YH 3MA9L 3ARZA 1FAIL 5FYJL 3RL2B 4JY5H 4KHXL 1FZOA 4A6YH 1U8OB 4KAQL 2HH0H 1KTDA 1JNLL 2X4QA 2VN7A 4DKDC 3L3IA 4HGWA 5FYKU 1LD9A 4KJWC 4JM2B 3IU4L 4GRWF 1WUNT 4EQ3A 4ZS6D 1P6FA 1T0NB 3RDTC 3GM0A 1U8KB 2BCKA 2WSKA 3NACH 2LU7A 4LRIA 5FHBL 5CP3A 3OGCA 1OPGH 4FQLH 4GUPA 3C5ZC 2XZZA 1YN6B 4EI5D 3H7BA 3TO4A 2DICA 3WIHA 3LZFH 1NUNB 2EYTB 1G6RH 5TGBB 4Q9CA 4OCYH 4WI9A 2NY4B 3HE6A 2H9GB 2P42B 3HG1B 2VTFA 2O61B 2XQBH 4OTXL 5CEZD 4LU5L 2VLJA 4KK5D 3PNWB 5TJWK 4OCWH 4BJLA 3GM8A 2IADA 1KCUH 2DOCA 2V2XA 5CJOH 3NH7H 3G9AB 3PG2A 5EUKA 2VZ1A 3OAYH 4HS6A 5F7EL 2K7PA 4MX7B 3FRUA 2EIEA 3TJHC 3UZVB 5CJBA 4PRPA 3RQ3A 3VG0L 3TLRA 1HHKA 3MR9B 2PO6C 4CMMB 1T6VN 3Q5TA 4LSQH 1B2WL 1I8LC 4LHUG 2NYYD 4QY8A 4BFIA 2J5LB 1MHPL 2OTWB 3FL7A 1RULH 4M43L 4WU7A 2GK0A 4KTDH 5DJAB 1XMWA 2V2TB 2N7AA 4KI5C 4H5SA 2FGWH 5HTSA 1E27A 1I3GH 4LNRA 3RDTA 1F4WL 2C4FT 1SHMA 4NHCH 4NQXA 4N0CD 4QY8B 4BFIB 2UWEF 1X7QA 5MEQA 5E8PA 4QRUA 4KTEH 4NFDA 3DX7A 1IAOB 2DKMA 5H35A 1E4KA 1Q0YH 5DEGB 2I9TA 1U8IA 5KAQF 3H6JA 1FFOB 4JG0L 3O9WC 2HH0L 3O0RL 1CG9A 4M6NH 2E7CA 4WWKC 4LAQH 3H9HB 3VFUA 1M7IB 5I76B 4OGYL 3RZWA 2OL3B 2ATKB 5AD0A 1K3ZA 1CFTA 4ISVA 3MLRH 5C07B 4MHHI 3BE1L 5DD5H 4PGBA 1AE6L 3N1QC 3VG9B 4GSDH 3KJ4B 1QEWA 4GKSA 4WW2F 3E8UL 2EZ0D 3LKRA 2BCKB 4LAJH 1L0YA 5FKAA 5K9JL 1VEOA 1ZK9A 1OAQL 1OTUD 1MCBA 4I1NB 4PJIA 4OFPA 3MRPA 3NGBB 1F6FB 1HE7A 3MRDA 1RZFL 1ZMYA 1B0RB 4MMXC 1QBBA 1D9KC 2I24N 2PYFA 3G9VA 2D03L 4FNLL 3MRJA 1DP0A 3Q1SL 1MWAH 1L7TL 2XA8L 5FYJD 3IYLW 2H1PL 5BOPA 4NJAH 3IFNH 1EIBA 5EZIH 3VDAA 2FRGP 5AG8A 5IK3A 3FCTB 1QACA 1CZ8L 5EIQA 1PYWB 4QRPA 1IQWL 5C0NC 1FRGH 2Z8SA 3FT3B 4JY5L 1FO0A 2OJZL 4BFEA 4XC1L 4FQCH 2ESVB 1OB1A 3HCVB 1LP9F 5F7WC 3GI8L 1RUKH 1BBJB 5MEPB 1FH5H 4PP1C 3Q1SH 3IFPA 5FIEA 5CIPH 3QWRA 4HWZB 1KTRL 1N2RA 1U3YA 2JJSC 3CPLA 1CFVL 1G7LA 5EG6C 2FEEI 3BKCL 1HI6B 4G8FA 4S1SH 3KXFE 5GJTH 1LP9A 4MYWB 3SO5A 2VAAB 1CD9B 3EIFA 1AGBB 4LFHD 3MZTA 2NW2A 4ZAKC 1BQHG 2OLDA 4YBLB 4NQSB 1CXHA 1ZSDB 4LVNB 3LKPB 4EIZC 3B4NA 4P2QE 1OP5H 4EIGB 1MI5B 3MJ9A 4QRTA 4JN2A 3EYVB 5DJYA 4GO6B 3BP6A 3OKDB 1AR1D 1T7YA 1IEBB 1RUKL 5K9QI 4GRLC 3T3PE 1MRDH 4YAQA 2IBZX 5D72H 4WI7A 4QTHA 1PZUB 4OV5A 3T0BA 4L5FL 4ONGL 1P84J 3ILPA 3SE3A 2Y23A 5C0JB 3WO3B 4TYUA 3QDGE 4N9GB 5GS0L 3LD8C 1A6WH 2BNQD 3U46B 2VB5A 4L4TB 4MJ6A 3HE7C 4YPJA 3S37H 5GGSY 2WBJC 3BAEL 1X4ZA 1I3UA 4PV9A 1KPUB 1TVHA 4NHUB 5I66B 2NY6B 4HFWB 4FNLH 4Z7OE 3D2UD 3MODH 3SHSA 5IKCB 5JW4R 2XTJE 3QFDA 3LS5L 4UDUB 4YJZL 1I9IH 1XEDA 4NIKB 3P11H 4QXTA 5BOZG 5CWSB 2VLRE 3T8XB 4ZUVA 2AK1L 4MNGE 1B4JL 1C5DB 3QXDB 3L6FA 2CRZA 3MRNB 1I8MA 1FCCA 3IDUA 1VPOL 4HAFA 3VG0H 3MROA 3CFCL 1ES0B 2XPGB 4YPGB 3VD7A 3ALPA 4W4OC 5T1DH 4LSPH 3ZTNL 4MB4A 4GW5A 3G5XA 1NMCC 1CD1B 4ELMB 1LWRA 4MDJA 5AYQA 4GBXB 4JDZB 4KMTH 5DEZA 1GC1L 4BKLA 1MI5A 1DQDL 5SX4I 3MRKB 1BM3H 3WIHH 1YDPB 2OJZH 4DZBA 5L8JB 1MCIA 4LASL 1EHLH 4Q58C 2FIRT 4HH9B 3VDBA 3O0RH 3K2UH 4GW5B 1J8KA 3OTTA 5F72S 1ZA6A 5CCKL 1J8HD 4X6FB 4CNIB 3NZ8B 5C2UB 4ZUTB 3A6CH 1I1YA 2P5EE 4U31A 1DEEA 4ZS7L 4D9RD 5B38A 2Y06H 2EC9T 1GZPB 2QADD 3BH9B 3GJEB 1RUQL 3D9AL 4P2RE 3IS0X 3UROR 1I1AA 1R5VB 2EH8H 3FQXB 4PJIE 3JV6B 1FO0L 3L5JA 1RZ7H 1RIUL 1G7IB 5JXAH 4LSSL 1SYVB 2XTJD 3WNNA 4PRHE 5T1LB 3DVGB 1EHLL 3LAFA 5DR5L 2ADJA 4P23C 4CVUA 2VR4A 1EEYA 4NO0A 1LDSA 4NQEB 3D48R 3PWNA 1OD7A 1MVUA 4Q6IA 4YQXH 3T0EC 2W92A 3FAWA 4L4VA 5J06A 2X70A 4F7MB 5CJQL 2I26N 3FOMB 3JTSB 3VRJB 4LLVA 4OB5H 4ERSH 1HHHB 2RFXB 5TF1H 4YXKL 2P5WB 1INDL 4L9LC 4U4BA 5BQ7B 4HIXH 1NC2A 4KJYA 4L4VB 4PJHE 4OV6F 1MRFH 3GMRB 1DBBL 4TOYL 1WAAE 5FFLA 1MFNA 4NO5A 1TCRA 3QNZA 1B4JH 1UACH 4DVRH 2FB4H 1I9IL 3I84A 3ZTNH 2WM0A 1QFWH 3SE8H 2Z8RA 3MREB 5E2UL 3O3BA 3N50A 1YYLH 3PHOA 3GDBA 5D71H 5E2JA 2Z35B 1I1AC 2BVPA 3X14B 1I9EA 5IWLC 3L9RA 4Y89A 5CZVH 3WNKA 4MCYB 3CSPA 4PRID 3O6LL 2PUQT 4LHUB 4J3OC 4X6BB 1NCTA 2G2RA 1IBGH 4PGDA 1HYSD 3MNWA 2YUWA 4MNQD 3LEVL 4QTIH 1IGIL 2BVPB 4X83A 4F58H 5DQDH 4ODTH 4PJFA 5IW1B 1UQSB 4G8GE 4Z7WF 4F7EA 3V6OA 3U7YH 3VGGA 4GAJH 4QHLA 2DQEL 1ITCA 5JQ6L 1DR9A 5CJOL 4JY6B 5EZJA 1WT5A 4RMTA 3O41B 3BZ4B 4ODWA 1AQKH 4I18C 1N6VA 2HTLD 4LSUH 4PJBF 1NCUA 1T1ZA 5IB3A 4GW4B 1ZWIA 2FSEA 4HW6A 3PHSA 4C4KT 5FB8B 4KPHH 4IS6B 4NQVA 4F58L 5B39A 1IAMA 2OL3L 3TJEL 3MJ7A 4Q2ZB 2ARWA 3DSFL 3LH2H 3C5ZA 3IXTB 3RA7L 1HHHA 3FB6B 5BVPH 5J11C 5FECA 1SM3L 2DD8H 3WHE0 2FJGB 4IRJD 2AK4B 2Q6WB 4N0FB 3HI1A 1NEZA 4JY4B 4PRPD 4Y4HD 2X1XR 5DA4A 4PJEE 3L6FB 5JHDE 2N7BA 2YRPA 4HKXA 1E0OB 4Q9BA 4ODSL 1S7XB 1HHJB 3NPZB 1GCFA 1GIGL 3EKCA 4UDTA 4YE4H 3NZ8A 4G7VL 3U9PL 1T20A 4IIQC 2YKLL 5FDWA 2XFXB 3WXVL 4KWUA 4L4JA 3DO7B 1Y18B 4XAWH 4AEIL 2D0GA 2GK2A 3HPJB 3BJLA 2YD5A 1M05B 3E0GA 1AQDA 1NGZA 3BH9A 3UAJC 5DMKB 4NN7C 1VACB 4UIMA 1UVQA 1YN7A 1H8OA 1RJYB 1G9NC 1BZ7A 5C8JA 2BNQB 2VLME 3MV7D 1XCQB 4HT1L 3CJJA 4B7LA 1YN6A 1OTUC 4XTRC 4PV8A 2YWZA 3G6DL 1F8TL 4P5TC 1I7ZB 2NXZB 5E2TL 2R15A 5E8EB 5IJVA 5ISZB 4R0LB 3ARXA 5GXBB 1D5IL 1HSAA 4Z0XA 3ZT7A 4HBCL 4FQHB 4N0YH 1QHOA 1FNSH 2P5EA 4U3HA 3SGDI 5DC4B 2X4UB 3WNOA 3BDBA 4U1LB 5I1CH 3NCBB 3LPGA 1XR8B 4OZHA 3WXVH 1QR1B 3GJFB 3TBYA 5E1AB 3FFCD 4DW2L 2OYPA 3TZVD 2LAAA 1HH6B 4P49A 4K8RL 1JZ3A 1QTYT 4TVPE 2I9LA 4KQ4L 3MSPA 4LCCA 3ZLQC 2ITCA 2FH8A 3GSQB 1ZVSA 5IQ7H 3QFJE 2D7MA 1KIQA 3H9ZA 2K1MA 3QUKB 4LQFH 1HXYB 3SOBL 2LU3A 1BFOA 3QUYB 3QIUC 2BXYA 4Z7UE 2XZAH 3HI5H 4OKDA 5IM7A 1P4IL 2OL3H 3CZJA 3CH1A 1TJIL 2B2XL 1A7RH 1G0DA 2LV4A 1INEL 1CGWA 4Q9QL 2X2YA 3HUJA 4CGTA 3RX5A 3PIQB 4YQXL 4L4TA 4MJ6B 2V6HA 3KPRD 2Z31D 5CZXC 1QRKA 1VFUA 3STBA 3SBWC 1SVCP 5SWSA 1Q38A 4MCZA 1SJHA 4YDIH 2NY4C 1JV5B 5FEBA 5EO0B 2D7TL 2X1WL 2MPAH 4R7DB 1QBMH 2Z4QA 3HR6A 4S1QL 1AXTL 4XNZC 1QLFA 4PJCF 3S35X 1XFPA 3RIFK 3SDAD 2B1AL 1FZJB 2MKLC 1UB5A 2WINB 3WE6B 1OGTA 3RY4A 4E41A 5DRZB 1YEEH 1WCBB 4NO3B 4QOKA 4X98B 5DJ8B 1AGBA 4FMKA 3LKOA 1UJ3A 3PXJA 4Q9QH 5TE4L 1UXWB 1U92B 5I1AB 2P24A 3R0MA 5MHSD 3MRCB 4PIRF 3ZDZF 3GIZL 1EHXA 4LLMB 3QXWA 2Z93B 2X4TB 1ERNA 4ELKA 5CLWA 3LKOB 5I8CB 3C9NB 1F58L 3VXQA 2Y5TB 5DUMH 4PJGB 1RK0B 3V6ZB 3IRPX 3BT2H 5D1ZC 2H26B 5HHPA 1KLGB 3OGOE 4FQLL 3L7FA 5JPMA 1X3DA 1FPTL 3HTLX 1TZGL 5GIRA 5I16A 2CDFB 5CEYA 4PJIB 2F53B 3BYYA 1KEML 4ZYKB 4X7TB 4P5TB 1JWSB 2JCCF 3RI5F 1S9YB 2AJSH 4MAYC 3OPZL 4XPFL 3O4LD 5C0CE 3MRHA 4HZLB 5DFTA 4M7ZB 3D69B 3RP1A 4BQCA 1CGSL 1C7TA 1TPXC 1S7SB 2BZDA 4W81A 4XRCA 4YZFF 1NKOA 1CLYL 4U1LA 4KHXH 1WFTA 4IMKA 2DLFH 4P3WA 1VACA 4A6YL 4WCYH 2DQCH 5DYOA 1CGUA 3MLUH 5IB4A 4Y2DD 3EJZC 3ULSB 2IAMB 3ZHDA 2E27L 4LNVA 3QDMD 1NGYB 3MUZ1 2FR4A 2RCSL 1V3KA 1O5DT 1I7ZA 4JCMA 1TZGH 3GBNL 3DHJA 4G9FA 3K7UA 4BQ9A 5L2JA 1G7HB 3FRPA 3PDGA 4K9EL 2ZUYA 1CE6A 1KN4H 4LASH 3VXMD 1LO5A 1DLFL 1ZVSB 1OL0A 2QBWA 4KJWD 1U42A 1A6AB 1AKJB 1CYGA 5FGRA 4J3XA 3L5IA 4ZXBD 2A74B 1KBGH 5JZ7D 4P5MB 4RAUA 3LKQB 3JWOC 4L8SC 4PJFE 1J10A 5E1AA 1MH5A 4BK5A 3KPOA 2V2TA 1QRNA 4OLWL 4PRBA 3LSOA 1FL6A 1G7MA 4O5LH 3OV6A 4RWYL 4I3RL 3UTSD 3CU7A 3UBXA 4M7KH 5GRYA 5I1CL 2AKRB 2E9JA 1KCRH 1JN6B 4YDLB 1J0ZA 3DX6B 2OK0H 3D2UB 5GGRY 1ZOXA 5SWSE 4YFLI 2HVJA 4NCDA 4WY7L 2G2RB 3ZYJA 4OZHF 3G5ZA 4QLRA 4GXVL 4YBQD 2EDXA 3PGCA 1H3VA 1T89A 2VDPL 1OTSD 1MUJA 1JGUH 3LQZB 3BQUD 3E3QC 2W07A 4MX7A 3PHOB 4QHLB 4LDLB 4G6JH 4JQVC 1MRDL 5D93C 3KGRA 3LMJH 2ZSWB 1BLNB 4YO0A 3OKLA 5FO8B 4PJ5B 3V0VA 1C1EH 1AGFA 3BWAB 4MDIA 2DDQH 5J13B 4EBQH 3PNWA 5KVEL 4M6AA 5EO1B 2HFGL 2G75B 4NWUH 4GBXC 5D71L 4K7FA 4OLVL 2A6JB 1J12A 1ZS8B 3HUJF 2P46B 1P9MA 4OZFA 5DJCA 2R2CA 3BP5B 3KYMA 3PWNB 4L1HA 4ODUA 1II4E 3HS0B 4YFLF 3W2DH 3INUH 2AXGA 3Q2CA 5BRZA 1QYGH 2BVOA 4JM2C 1IGFH 1CFSA 2OR9H 5T3ZE 2F58L 1WBYB 3SDXE 3D39E 4DGVL 4D9LL 4PJFB 5IW1A 3H9SD 3MO1A 4D3CH 4B5EA 4OUUB 1KTDB 3M8OH 4RGND 3CLFL 4U1SB 5DR5H 3ULSA 2D7QA 5DYOB 4YDJB 2IH3B 3EO9H 1FIGH 5KSUB 4M48H 2ZCLH 1XGTA 3AS2A 2HMIC 2QKIA 5HYEA 1KCVL 3JSSA 3MXWH 3DYPA 5LGHH 2E6JA 5ESVB 5C1MB 2CDEB 3TBSA 4TUJB 4JFFE 3B43A 2R0WH 4KKCC 4P46D 2PTTB 3T0EB 4R96A 4YHIA 3QFJD 2C1OA 3QA3A 5CBAA 1GVIA 5DUBB 7FABL 3QUMB 1KB9J 4KUCD 2GW5A 3BZFB 4BSWA 3BPOC 1V5JA 2NY7L 5DMIH 5GSVB 4FQHA 4ELMA 3CH1B 1ZT7A 5GGVY 3QRFM 2NY0D 3VXRA 3THMH 2C3HA 5DMGC 3VRJA 5M95B 1B6DA 3LQAH 1Q9KB 3EYFA 4QGYA 5TF1L 4OGAC 3RVVD 3KPRE 3UJTH 1XGQA 2BDNL 1D6VH 4OF6A 4XX1E 4Y4KB 1UVQB 1YN7B 1OM3L 1MFDH 5MENA 1SBBA 2X4OB 2IBBA 1FJ1B 2XYCA 1T1XA 1U9KA 2EC8A 5HYJB 1IMHC 1UM6H 2KZ1B 4G8GA 3LB6C 5HYIA 5AUMA 2DQEH 2XN9A 4P4KD 5D1XB 3QQ9D 3KJ6L 2X4OA 3RHWK 1U58B 1UG9A 4DGIL 1HHJA 4PJ9C 4XMLH 4KTEL 1TIUA 2Z4QB 1TNNA 4X5WA 3HHRB 4ZNCD 4JQIL 1YEFH 2BX5A 4QEGA 1NMCB 4H1LB 2D4DA 3NCCB 4O00A 1YNKL 3QHTC 3WHE1 4CAGA 1L6ZA 1BZ7B 5KOVC 2DIJA 2V17L 2SEBA 4LSRL 3VI3F 5BV7C 4U6YB 3RL1A 2MSPA 5J3HD 4JM2F 5D5ME 4ODXA 3M8OL 3BW9B 4PJ8A 3VXPB 1UWGL 4JVPA 4M3KB 2VLKA 4D3CL 2VQ1B 4RISH 1T0PB 1KFAH 2CDGA 4LCIH 4ZFGH 3IDIB 2XTLA 3HRZB 2ZZUT 1A4KB 1QSFB 3GMQB 1RAMA 1FBIH 5C8JB 1JBJA 1VDGA 2ZUUA 5EZLB 1G7PA 4TVSa 4JRYA 1NANI 5CS7A 1ZHBA 2D7PA 5KW9L 1TQBC 1I8KB 3GB7A 4Z7UB 4OZ4B 5SWQB 1YEIH 2EH7H 2IQAA 4BZ1L 5KSBA 4IS6A 4NQVB 1A0QL 1A6VL 1S5IH 1FO0B 2R1XB 3KLHC 2YS4A 4MWFB 4PRDA 3ME0A 4EUPH 1RJLA 4HX1A 4OLVH 3BESR 3O3EB 5IB1A 2Z92A 1NKRA 1CGXA 3AGVA 3V6OC 5LXGH 2RBLA 1RMFL 2X42A 2OTUA 4WUUB 4XNXH 5CKAA 4POYA 3OG4B 4EI5A 1U3HD 4G43B 1KLUB 5FYJH 4XT1C 1MJUH 1MI5D 2BXZA 2FBJH 2YPLE 4HZAA 1IC7L 3HPLA 1BP3B 5DMKA 1BVLA 1KYOJ 1AQDB 1YMMD 2J8UF 3T4AA 4GBXD 5ITBH 3Q5YA 2NW2B 1LVEA 1CGYA 4TSCL 4PJ5D 5IVXE 4FFWD 4QCIB 3VGDA 1QSFE 2E7LC 3TBSB 1R0AL 2QHRL 3K8LA 3VGHA 5DQDL 2A1WL 2AVGA 2N56A 2F74A 4RDQG 4IOIB 1AHWB 2XWBA 1RJZB 2GSIA 4W6XB 3T4AB 2P7TA 4G6KH 3C2AL 4JHAL 5HHOE 4J3SA 4NKDB 5EZOL 1G0XA 4MCYA 1C5BH 1MJ7L 3MCG1 4BSVB 2GSIB 4PG2A 1QO3B 4XTRD 1DBJL 4G7VH 5BW7A 4LLUA 1GIGH 5I1DA 1I7RA 3B3IB 1YPZF 4P9ML 2CR3A 3RIAK 4P2OA 4TSAH 1V7ML 5BV7L 3B9KD 2P5ED 3K1DA 1Q72H 3ULUH 3RIFF 2GITA 5D7SH 1NLBH 3WS3A 2A73B 2R29L 4LHQB 3OKYA 1MLCB 5BJTA 4WI6A 3TZVA 2IFFL 1JZ4A 1KPRA 1RHFA 4KC3B 3H42L 4J6RL 3CDGA 3ARWA 3SE4C 4KTYA 1DQQB 1L7TH 2QSQA 2XA8H 3MLZH 4NKDA 1A6AA 4GW1B 4ZPVB 4ZXBA 5ICZB 2NTSP 5DRXB 2E8ZA 1F45A 5SWZB 3QZWG 5FYLH 4FMFA 2FO4A 5CJ8A 1QZ1A 2DQHH 1A9EA 3GRWL 4ENED 3VWKA 3QBTB 1F11A 5E8NB 4X6DE 1KOAA 3F7VB 4PTUB 3SGJA 2F53D 3BKCH 1T7VA 2XICA 4P2CG 2DMKA 3RTQB 4QHKJ 1KN2H 4H26A 4AT6B 2IQ9L 5FA3A 2FATH 4OF7A 3LV3B 2AJVH 4P2OC 1X5IA 3OKKB 3P4LA 3JTTA 3D2UA 4P4KB 5D1XD 1XGUA 4M61A 1T80A 3X3FH 3SKNA 2CUIA 4FP8L 1IM9B 4MAYB 3QP3A 1LE9B 1KJ3L 1G7QB 1DBBH 1I9JH 2YC1A 3TZVC 3C60B 1LEIA 4BKLB 3ARFA 4I48A 1L6XA 2Q3ZA 3BN9C 3GBNH 1T5WB 2G9HA 3VXQB 3TO4D 1JK8A 2H32A 3QR2A 5D1QC 2AJ3B 4FS0A 2H1PH 2Q7NA 1L0QA 4NN6B 1KN2L 3KNBA 3IDXL 4XPTL 1A6TB 2YD4A 3SJVE 5JIKA 3BEVA 3O6FB 1U93A 4JR9L 3T0VA 1CICC 3PQYB 5GS3A 4ZDHB 2XWTA 5AAWA 1R5IB 4APQC 4DGYH 2CIIB 4GRMB 5MP6H 3L3IB 2V5SA 2GY5A 1MEXL 3OJMB 4DKEL 2OQJA 4HH9A 4HXAH 1RURH 2YXFA 3NABL 5GS1B 2VXSL 1Q1JL 4NOFA 5ALCH 2F19H 2HFEA 1QSFD 1AE6H 5LVEA 1FNHA 5DVNA 3TCXA 3VGBA 3H42H 4GKNA 4NQDA 4N90D 4QWWD 2HWZH 3VFPA 3O11B 5FCUH 4Z5RB 3B9VA 5DSCA 3OL2A 1CDJA 5BV7B 2J3SA 1IEAA 3PL6D 4JJ5B 2GSGB 2DQGL 1MREL 5E4IA 5LG1A 1OLZA 1SMAA 3VFOA 1LQSR 4JFHD 4I5BB 4D0CB 4JM2A 4PJFF 5TE4H 3TA3D 2QL1A 5F7HA 3K2MC 2ZKHL 1BBJA 1QFOA 5IFAH 4AIZA 4HXAL 4BUHA 1PJ9A 2G60H 1I7UA 1F4HA 3GHEL 4QRRB 1T03L 4PV9B 2V7NB 5SWSB 1R24A 2OMNA 5D6CA 1LK3H 4X6CF 4ZTPH 5D1QB 1A6UH 4H1LA 2D4FA 4ZQKA 1N2RB 5D1XC 2R4RH 2PYED 4BK4A 1QNZH 2LTQC 4M1CD 1LE5A 3HMXL 4Y4HB 4KVNH 3EFDH 4OV5B 3RHWF 5E1HB 1CFBA 1M7IA 1VGEH 3EFFB 5I76A 1EBPA 4GG6E 3U1SH 3UBXG 1QRND 5FGBC 3GMPB 3U6RA 2BVYA 3QUYD 5F9JB 3DX8B 2DYPA 3EYVA 5A2JH 3E2HB 3QUKA 3WLWC 1BOGB 3P9LB 2XKNA 3F6LA 3QO0B 1FVEB 4HFUH 1IAOA 4M48L 4RQQA 3VXME 1H3PL 4D0DA 1HQ4A 3P9MA 2ZP0T 5T1KD 1Z9LA 5IP4A 2AJ3A 4Y5VB 2EIBA 1OAYL 1FNEB 3HC0A 1DQLL 2X40A 5D7IF 1WFNA 4AEIH 3BQUB 5F7DB 5ILTH 1E27B 1CLCA 1E6OH 3Q0HA 3WFEH 4O2EB 5ESQB 2XRAL 1UENA 2HT2D 4I2XE 5AZEL 2AI0L 2PYFB 4D94A 2ZG3A 4MJIB 3MV9B 3CFDA 4PJDE 4AEFA 3DRQB 3GSWA 3V52H 4K8RC 3KYKL 5ILTL 4O51A 4NCC2 3PE9A 4R96B 1T89C 5EU6B 3TO2B 1FFOA 4NKQB 4UDTB 4HUVA 3OR6B 5ESAA 3FQWA 4JKLA 3QHZL 3GSXB 5E6ID 2AI0H 3WEXB 2ENYA 4PP2A 3SY0A 4FTVE 1A1MA 2KBGA 3MLRL 4PGZA 3WFEL 4ODUB 2FJGA 2VDPH 1OTTD 5GGUB 5AAMA 2DQTH 4PJ8D 3DBXA 1D3CA 3E3QE 1HHIA 5K59E 3DO7A 3NCEB 1L9MA 2NY1C 1BIIA 2DM7A 1LGVA 4YDLC 3ULVL 3L3GA 4L3CA 1JGUL 1EO7A 1QP1A 3CFBB 3MMEB 5E8DL 3RX8A 1J0JA 4TSBL 1MY7A 3JVGC 1A6UL 1NGWA 4PJGF 1QFUH 15C8L 2J4WH 4ZSOA 3MV7A 1ZKAA 1NCCL 1OQXA 2DN7A 1MWAL 5CBEB 4OCRL 2APWA 4L8CB 1S78D 1NMBH 1XCQA 3DETD 1YA5A 3LDBC 3QULB 4BZ2L 5HYSB 1KC5L 2CKBA 4GRWE 3QJHA 1K8IB 4WW2A 1QFWM 43C9A 2ZG2A 1KTLB 4CN1A 3UAJD 1MAJA 2QV2A 1FL3A 4OFKA 4HS6B 5GS2H 3OZ9L 5E95B 1J8HB 1H3UA 4X6DA 5CSZB 2QADC 3PDOA 2FBOJ 4OZFH 1U8HA 1Y6MR 43C9B 5LCVH 2P43B 1X7QB 3FJTA 4ORZC 1A5FL 3G5ZB 5JXAL 5ESQA 1UYWH 4LLVB 1F4XH 1O7SA 4L8CA 3JVGA 1FO0H 1OPGL 2F74B 4HGKC 1IGIH 4LSSH 2GK0B 1CBVH 4ELKB 3PL6C 1IBGL 3CDCA 4UT7L 3WO4C 5FF6A 2AJYL 5CGTA 1UH2A 2JE8A 4X6CE 4KI5E 4HPYL 1D5MB 3U4BH 1KV3A 3KXFD 4HKBB 1F13A 1F00I 3MLVL 5GISH 4ZUSA 4HUVB 3BUYA 5E5MA 4LVHC 1ZGLA 4G7YH 1EBAA 1A6VH 1QO3A 2AXHA 4AIZB 2F8OA 3FN9A 3L7EB 4UV4H 3ROLA 1OP3H 2D2OA 2HT3D 1QVOA 4ZOEA 4YXLH 2CGRL 4K23L 3WIHL 4XP9H 2DM4A 1A5FH 1GC1H 1CDGA 1Q9OB 1G9NH 4ZD3H 5IHUL 1IM3B 4IDJH 3CSBA 4NGHL 1E28A 1K6QH 4G9DA 3SDAA 4QHMA 4UQ2A 1GGIL 4RBPK 3WNMA 3OR6A 2WUCH 1YEKH 4ZO6A 4KKCD 2ZUWA 2DTML 1N8ZA 5E24E 3QYCA 3QPXH 1NGXA 2X4NA 1IGTA 3UXFA 3PV6A 2EECA 4XP9L 1BVLB 4Z7VF 4YHKL 3MRKA 1FLRL 3T04D 5EFIB 1A3LH 4K3DH 4Z9KB 3SDDC 4R90H 1WQVT 4HIIA 4NKMB 3LPWA 4NUGH 2F54B 1W0WA 5L8KB 1A22B 1J0IA 4JO3L 4NUJA 2Z91B 1WJ3A 1N6QH 1RHHB 2CIIA 4GRMA 2M26A 2EDFA 1AJ7H 3UCRA 1A9BA 4ZTOL 5FHBH 4WVRA 3UO1L 1RIVH 5F1NB 4PJ8C 4JDTL 5D2LB 2NXYC 3BVNB 4MWFA 3ZKNC 2APFA 5IB5A 3IDGA 2D7TH 4LRIC 5I16B 1ACZA 1FZKB 2DQDL 1T1YB 4G6JL 3H9SA 4DAGL 3NCMA 1DCLA 3L1OH 4F7TA 2KPNA 2J8UA 3HB3D 2X4UA 1L7IH 4YPGA 5CJXA 1ROWA 3H0TB 5J6GA 1P7QA 5H2BA 5ID1B 4ODBD 5J11B 3TPKA 4UOW1 1Z5LB 2E9BA 5BCAA 1MFDL 1JWUA 4TUOB 4Y2DA 3G5VA 3TCLB 3ZDZE 3DV6B 5AYUL 2HT2C 4XCCH 5GGRA 4PGEA 4YIQA 3WV0A 3T65B 3QIBB 4S2SA 3AAZA 3QIUB 2RJMA 3LY6A 1I7UB 2LE9A 4U6XB 4QHUB 4G8GB 1ORSB 1H5BB 2DMBA 2GT9A 3T4YA 5DJYB 2PYEB 5EUOB 5HHXL 1JRHH 2P5EB 3DGGB 1IL1A 4QXUH 1C8PA 4LCWD 2CIKA 1NDMB 1OTTC 3LS5H 3D1MC 3V6OE 4MXVF 1IKFL 4K3JH 2VAAA 3ILPB 5D5MA 4XH2B 3GI8H 5EB9A 3VW3H 3CVHB 3MGOA 1N4XL 4X4MA 4LF3B 4YAQB 3B2VL 4KRNA 3FOLA 5A2IH 3QUMH 3H7LA 2VKWA 5E00B 1JZ2A 2E7LA 5GSVA 1CQKA 4ZUVB 2HFEB 1AFVH 1GAFL 3U7WL 1XH3A 4UBDC 3FTGB 1EHAA 2XNAB 4AQOA 5IJKA 1AGCA 1HEZA 1IQDA 3J8F7 4JB9L 5IVZA 3IXTA 5I1JL 5F96H 5CJ5A 4XNXL 2BNRB 3AROA 4XHJC 1JCKA 2E27H 1EXUA 2G5BA 4R4FH 2VDQH 1IKFH 5MENB 4LHJB 5I1GL 2NZIA 3VH8B 4MXVE 5BW7C 1DTUA 1E4WL 1Y6NR 2XTJB 5C0JA 1QFPA 4PRIE 4U1SA 3IJSB 3CC5A 3O4LA 5K9QG 5FECB 3OQ3B 4FG6C 3RY6C 3L5WA 3MO1B 5DT1H 2FECL 3T1FB 5DD0L 4P4RA 2VDRH 4KVCH 4XPAL 2ORBH 1P4BH 5I8EB 3O2DL 4OD1H