1Q9LB

S25-2 fab unliganded 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) heavy chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
total genus 42
structure length 222
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB01
3DBXB 3PQYA 3GNMH 1Q0XH 5ICXA 1KN4L 5F6IC 1QBMH 1JNLL 1HZHL 2PTVA 4HK0B 3BN9C 4AG4L 1UXWB 1Z9SA 5LCVH 2A9NL 2K3TA 5EH1A 1UB6A 2QL1A 3FQXB 2DJ4A 5FYKD 1HI6B 2DWDB 3UBXI 1LO3H 5MEOB 4S1RH 3RGVD 4F15B 2O5XL 1G7LB 3ZKMD 1Q9WA 4U6HB 4GBXD 4O51A 3K0WA 3TT1H 1XGTB 3TJHC 1HYSD 4UQ3A 2ADJA 2AJSL 2W9EL 1Z0NA 4MLIA 4NYLA 4XP9L 1AD9B 5LWYH 3GUTB 2CKNA 3VXSB 2UZIH 2J8HA 5DJ6A 5I1CH 3PQYB 2NY7H 5ICXB 2DJSA 1CXHA 3UYRL 2IGFL 1V7NL 1WICA 2ID5A 4EQ3A 5HVWA 1Y6NR 4D0DA 5ENWA 1UB6B 3IT8D 4NRYA 5L6YH 1F97A 3UTZA 5F1NA 4UT9L 1FRGL 3RVWC 4N8PA 2HMIC 1Q9WB 3P77A 1QFUL 4O51B 4X4ME 5E08L 3E1F1 4CW1A 2YKLH 2FR4A 3NGBB 4UQ3B 2VDPL 2ADJB 1YNTA 2PXYA 2QLVB 4YXLL 35C8L 3R06A 4NYLB 4TSCH 3CC5A 5I8OH 5HHME 5DJ6B 3WXVH 3TT3L 2AP2A 4N0YH 3QCVH 1FL6A 5HGAB 2B4CL 4RRPG 4D0DB 5JHLL 5ENWB 4OD3L 2XV6B 2Z8WC 4JREB 4NRYB 3HG1D 4CU7A 1TJIH 3UTZB 5F1NB 1GIGL 1FO0L 1GHFL 3OKLA 1FH5L 5JQ6L 3T0EA 4Y2DA 3BYYA 3OZ9H 3P77B 2N56A 3L3KA 5D9SA 4CW1B 3VU2A 2FR4B 1J0IA 4M5YH 4Y4HA 5CEZL 1YNTB 2PXYB 4KUZH 1WCBA 3R06B 4WW2C 2IMMA 3CC5B 4K8RC 3FQUA 3NA9H 5GGTH 5SWSD 4D9LH 1LP9F 1JNHA 2EDDA 5F71A 4YZFE 4KJWC 1IZJA 1FL6B 3OR7A 3U7WL 2E8YA 4JFYA 4YNYA 4MNGA 1CBVL 4HKXA 1YEHH 3OKLB 2E8ZA 4ELMA 2R0KL 3T0EB 4Y2DB 4U6YA 4MAUH 1A47A 1KTRL 3L3KB 5D70L 4KJYA 5D9SB 1YEEH 4Z7QE 1LD9A 4Y4HB 5C2BH 3MXWL 1IILE 1UM5H 3NCCB 1WCBB 4XPTH 1S7QA 4YQXL 1YN6A 4ZXBC 2PO6C 3AFLA 3EGSA 1FJ1A 3FQUB 4U33A 1JNHB 4TPRH 1FIEA 4D9QE 2ZUYA 5DVKA 4CN4A 2A6JA 4GAYA 3PE9A 1NAKL 3OR7B 1H15A 2EH8L 4Z7VA 4JFYB 3D18A 2ZCLL 4MNGB 4YNYB 1EGJA 4HKXB 1UWXK 5IFAL 2AJVL 4OLWL 1P84K 2GSIA 4ELMB 4G9FD 4ODBD 3DHMA 4HKZB 1PG7L 4U6YB 5KTEH 1VERA 3RRQA 3S36X 1VKXA 4KJYB 1LD9B 1LP9E 1DZBA 3VXUE 5TQ0H 1GH7A 3SCMA 4DAGH 4O5LL 4TUKL 1FC1A 1S7QB 4DQOL 4PPTA 1YN6B 4UUJA 2XTLA 3EGSB 1FJ1B 5DRWA 3ZTNH 2OLDA 4GAJL 3MJ9H 1EHNA 3O3EA 4NM4H 3T3MF 1A22B 2A6JB 4GAYB 4OCWH 1QBLL 3WNOA 4R3SA 1H15B 4D0BA 3LPGA 4RWHA 4Z7VB 3D18B 4HGWA 3G9AB 2A6IA 3N1FC 4AQ1B 1TZIA 4NO2A 4L4VD 4H0GA 2IQ9H 2GSIB 3OAZK 2PN5A 4ZAKA 3LHPH 4NFCA 4XVTL 2ADFH 5T3ZH 1VKXB 3MLZL 3VD5A 1A6TA 3W5NA 3WFBH 3GI9L 3SCMB 3IAGC 3H2WA 5T1DH 4LSUH 2UYLB 4UUJB 3IDXH 3LKSA 1VDGA 4XVSH 1JWUA 5DRWB 1YEIL 5KSBE 2MHAA 1DEEA 3O3EB 4HJGA 4FP8H 3VE0A 4JPVH 1KC5H 4LPCA 2BHYA 4K3DH 2DIAA 3RJDA 4R3SB 3X13A 2Z92A 1TFHA 2D9QB 3BD5A 1JFQH 2RBLA 3MRPA 4D0BB 2XWJA 4HGWB 3HZKA 4NKIL 4EI5A 1G6RH 2A6IB 4LPWA 5AZ2L 1TZIB 4NO2B 3L1OL 4PJ5E 2EKSA 1I1CA 4ZAKB 1PKQA 1FBIH 4N5EC 1IQDA 1A6TB 1CL7I 3ZDZE 5L2KD 5DHXB 3T3ME 1N4XL 3S37H 3MRIA 2R8SH 2W0LA 2VLMD 4PLOB 4M6OL 3CU1A 3LKSB 4YK4C 4LVEA 2MHAB 1DEEB 4XTRC 3WMSA 5GGVL 4HJGB 3VE0B 4Z76A 3MA9H 5FUCC 3HC0A 2DN7A 3DLQR 4AIZA 3KHOA 5I1EL 3X13B 1RVFL 3O2VL 2Z92B 3MGOA 5ID1A 3MRPB 3RGVA 3H9SD 2XWJB 4EI5B 3HZKB 2CIIA 4KROC 5GISL 3VFRA 2YS4A 2EKSB 1M6OA 4GBXA 3MV7E 1PKQB 5HHQB 1YEJL 1QFWI 1IQDB 4PGDA 2J5LC 2PF6A 2NY2C 1QSEA 3ZKND 3MRIB 4MLSA 4ONGH 4O58L 5DXWA 4AK1A 4Y4FC 2GHWB 2DKSA 1LDSA 5DZOA 3SKMA 4Z76B 3L5JA 4AIZB 1NGWA 1G7QA 4PGZA 3LEVH 4LCWD 4MD4A 4Q9QH 4G9DA 2IEPA 3MGOB 1P4IH 5ID1B 3RGVB 4OIIH 2R9HD 2VDQH 2OZ4L 2CIIB 4BSJA 2VKXA 3VFRB 43C9A 4GBXB 1M6OB 1A7PH 4H1LA 1CL7L 3B5HA 2UUDK 3PP3K 4ZOBA 1CT8A 2AV7A 1NSNH 4PGDB 5J6HA 2X89D 4WFHE 5J11B 1QSEB 4H1LG 4LLMB 4GS7C 4XVUC 1TJGH 2DQJH 4PRIE 5C92A 3CFCL 3SKMB 2IH1A 5JXED 4XI5D 3EFFA 2J8UF 3UTTE 3HG1A 4E42A 1NGWB 1G7QB 2PR4H 3KJ6L 4MD4B 4G9DB 1OW0C 2V17L 3V0VA 2ARWA 1BEYL 3JWOC 2EDTA 3RPKA 3P73A 4HS8H 3QUYD 5CILH 1G84A 43C9B 2OMBA 3GJEA 5IVXE 3SE9H 4H1LB 2BNUA 3FO1A 1B2WL 4IJ3C 1TITA 2DQTH 1CT8B 2AV7B 5J6HB 4OIAA 2ZSVA 3RBSA 1OAUH 3DMMC 2OJZH 4FFZH 5GS0D 5SWSA 3MLRH 4PS4L 2VR9A 1HOCA 5DURD 1DBJH 1OTTD 2B8OT 3PWPD 1RZ7L 3B5TA 4P46D 3SY0A 2IH1B 2H1PL 3EFFB 4M03A 5LBSL 5D7SL 3HG1B 4E42B 2DL9A 4XNMA 3LEYL 3V0VB 1TZGH 3DWTA 1NAMH 5SX5K 2CMRH 3P73B 1SQ2N 1KFAL 3BDBA 3GJEB 5I19H 2BNUB 3FO1B 1UKQA 3PHSA 4TTDD 1J7VR 1KPUA 3FL7A 2ZSVB 5TE7L 1N5YH 3UC0L 3RA7L 5JOPD 5SWSB 4DKAA 1HOCB 4OD2A 1EHLL 2DBJA 5L9DH 3SY0B 2IANE 4A6YL 1MRDL 2OYPA 4FFWD 4NNYA 2UVFA 5E9DD 1TETH 1FIGH 4XNMB 5L2JA 2CO7B 3BX7C 1EVTC 1T1WA 4JG0H 5ABDE 4G9FA 4HIJA 4YO0A 4JQXA 2FHBA 3WFCL 1KF9B 2GITA 2O93L 5DUML 4HXAH 1KPUB 4M1DL 3IKKA 3RP1A 3WIHA 4HUWA 1LO0L 5IESL 4KRLB 4KQ3L 4OD2B 1JF6A 2R0ZH 1HQRA 4XMLH 3RJQB 4W6WB 3L5XL 5C3LD 1NCAH 9CGTA 4LOUD 3CDGA 3JWOL 1O7SA 5D1QC 1EBPA 4NNYB 2Y06L 5L2JB 1P2CA 1T1WB 4L4VA 4G9FB 1ZLVH 2H3NA 1TVBB 5CINH 4HIJB 4YO0B 4Z95H 4KK6D 2JJUA 4TVPL 4FQLL 4GJTB 3WFDH 4JKMA 3KYKH 2GITB 5IG7A 1WSST 4M62H 2IG2L 3D5OF 5GJSH 1TJHL 1T20A 2J6EH 3QISA 2AS5M 2I07A 4Q2ZA 4HUWB 4OB5L 4ODSH 4OCNC 5GXBB 5D71L 3FMGH 1HQRB 4M5ZH 3RWHA 3CDGB 3BGFB 4BZ1L 4FTVE 1RD6A 4ZSOE 1P2CB 1YY8A 4L4VB 3MOBH 3H7BA 2H3NB 2QHLA 3QWRD 4MJ4A 4LEXH 4JG1L 5C0IA 3LB6D 1D3CA 4QYOA 5E8PA 4LHUG 1LO5A 5IG7B 5L2KA 4CNIA 4JZJA 4PB0H 1A1NA 4WCYH 1T20B 3S4SA 2I07B 4NUJA 1IEBA 5D2NE 4Q2ZB 2VXQH 3CSYA 2J88L 1N6UA 4WFFD 1SJHA 4NZRL 3RWHB 4ZO6A 3BKYH 1WIPA 4JHWH 1OCWH 3H9SA 2ZJSH 4G80A 5FM4A 5T1LD 4LCIL 5J3HC 3H7BB 4XMPH 2GIYA 1UACH 4Y5VC 2BNQD 5C0IB 2AKRA 3GBMH 2Z35A 5CD3A 2R69L 4EIGB 4V1DD 2X7LA 4QYOB 5E8PB 4YWGH 1JWMA 4P3CH 1LO5B 4F7CA 5L2KB 3SDDC 4JZJB 4CNIB 1A1NB 4HUUA 1SBBA 5HHOE 1VGKA 5CJOH 5EU7C 2OQJA 3S4SB 4OJFH 4NUJB 1IEBB 1NCCL 5IBLC 4IOFC 2PNDA 2NLJA 2P49B 4LNVA 3CSYB 5FCUL 1JTTA 5L7XL 1UCTA 2NQCA 4YFLI 1OM3H 1EERB 1TQBC 3BH9A 3EYUH 1QYGH 1X44A 2Z93A 1IRAY 2FJHA 5E6YA 1SJHB 4LCWA 1VPOH 3FB7A 2EDYA 3H9SB 4M3KB 1E4KA 1HCFX 3PIQA 4LRIA 1C5CH 4G80B 1KEMH 4PLNC 2D7TH 3S9DB 5IF0A 5I8KH 2AKRB 3FZUD 2Z35B 5CD3B 4ETQA 2X7LB 1JWMB 5D1XC 2FLBT 2X89A 4F7CB 4HUUB 1ZANL 1VGKB 4G6JH 5EU3A 2MTPA 3QIWD 1VCAA 2OQJB 4N90E 2AGJL 3WHE0 2NLJB 4JJ5A 3VXSE 5DMGC 5JXEA 1DQML 2EO1A 3BH9B 2Z93B 2FJHB 4C57C 1N3NA 4D3CH 5F7UA 3FB7B 4GQPH 1EEZA 5ANME 25C8L 3PIQB 5F7HA 3QUYA 4LVNB 3TZVD 4AYFA 5I1LA 4OZFH 3ULUC 1A6UL 2J4WH 5IF0B 4HJJH 4DEPC 3P30L 3BQUD 4W4OA 4ETQB 3BYTA 4L8SA 5GS1C 4ODVL 1NJ9A 4Y4KC 1I3VA 1H3VA 4JO3L 2FECI 4XX1G 1GOFA 3F7VA 5J57B 1YQ2A 5EU3B 1IC4L 1I8LA 3DGGA 1AC0A 3PWPA 2F5BH 4BUHA 4JJ5B 4FA8A 4P46A 3AGVA 1K9TA 4XCNA 2DQGH 1N3NB 3B9DA 1A7RL 2J12B 3OB0H 1EEZB 5H35A 5GGQL 3QUYB 1OTSC 5I1LB 2XACC 1CG9A 2CRMA 3QHTC 3V7AG 4HQQH 3V2AR 3QHFL 4L8SB 3HE6C 3UJIL 1NJ9B 4DN3L 3UO1H 1EAJA 1AXTL 1JHKH 4XC3H 3F7VB 4RFNC 5MP6H 5DURB 3DGGB 4HWBH 4W70A 4ELMF 3PWPB 3DOSA 4KZEH 4P46B 1U8IA 5ID0A 2B20A 2ICWA 4XCNB 5FECA 1UKSA 1RUKL 1RZFH 3A67H 1A5FL 5H35B 4P2CG 2J1KA 4HIHA 3WN5C 1KLUA 4FZ8L 1CG9B 3QPXH 4E41D 2CXKA 3EJYD 2G9HA 2FH6A 4G6KH 3G6DH 2FECL 1VGEL 4XXDA 1VFBA 4HWZA 2YN3A 2VZTA 1A3RL 1IQWH 5DUBA 4Z7VF 5T33H 2GJ6D 2NNAA 4HFUL 4LDEB 3ABZA 1HSAA 1PAMA 3BRDA 2NXYD 5L8KB 4ZFFA 1EO7A 1PLGL 4KK9C 1U8IB 1IM9D 2HRPL 1FSKC 5ID0B 1LO2H 2ICWB 4YDKL 5CD5C 5FECB 5SX4H 4GO6B 1MCLA 2E9JA 1DL7H 3LOWA 1JGLL 1GGIH 4KWUA 4HIHB 4WY7H 2DQIH 4OI7A 4IDJH 4WHYH 1KLUB 1P7HL 2G9HB 2XG5A 2EDQA 5GJTH 4ELME 4RIRA 4XXDB 1VFBB 1XGQA 1QNZL 4HWZB 5GRVK 4AL8H 5DUBB 2NNAB 4ONFL 2HKFH 1HSAB 4KKAC 1BM3H 4ZFGH 1GGTA 1XH3A 4ZFFB 5JMOC 4LARH 4OD1L 3MLSL 3QHZL 5AUMA 5A43C 4HJ0D 4DW2L 1HE7A 4HUNB 3U7YH 4OCYL 3DX9A 5IMMA 3CFIC 4X4YA 2G75A 2NY0D 4YXKH 1OAZL 3QWRA 4C59B 3DVGA 1YEGH 1K4DA 4OCLC 5E4EB 4Z7VE 1CTOA 4JRYE 1MCSA 4OT1H 3LAFA 4RIRB 3VXMD 3HMXA 1NL0L 4QHKJ 2BZDA 3VRJA 3STZA 3P4LA 1XH3B 1JRHH 1I9RL 4H26A 2HLFC 4NQDD 2PW1A 4M7JH 2MKLC 5C0CB 4HC1L 4LLAA 5AUMB 4HBQA 4HD9A 1FQ9C 4J3VA 5AYUH 3DX9B 5GQBA 5IMMB 4X4YB 3WNKA 5T1LA 3TN0C 2X1OA 4WEMB 2G75B 1X5HA 3DVGB 1MFEL 2XZCH 1K4DB 2BNQA 3RNKA 2UY7A 4V1DA 1GZPA 1S3KL 4KUCD 1XZ0A 1LHZA 1N5AA 4LGSB 1CDYA 4HWNA 3LKOA 4P59H 3EOYG 1CU4L 2FEDC 3VRJB 1U8KA 3STZB 4H88L 4H26B 2PW1B 5J9PA 2GQHA 1JI2A 1AJ7L 3GI8H 3NBNA 4ZPVA 1F5WA 3EIFA 5FYJL 3EHBC 4IIQC 3BKCH 3U6RA 5T1LB 3SKOA 4GUPA 1OQXA 2BNQB 3RNKB 1ZMYA 3D87B 1W72A 4V1DB 1GZPB 1E6OL 2CK0L 2UZYB 3MODL 3CAFA 1S9YA 2XA8L 1XZ0B 4IRJB 3RAJL 1N5AB 4PG2C 4NGHL 3LKOB 1MOEA 4NJ9H 3S34L 2L0DA 3QIWA 2Y9RT 4LPVA 2WMPA 3WIIH 4MA8H 1U8KB 4B50A 2BVQA 3LS5L 1OY3B 1GGCL 2APVA 4ZPTA 2R1WA 1TZHA 2OI9C 5F44A 5J9PB 4OM1H 5B3JF 4DGYL 2VYRE 1BOGA 2X4SA 4ZPVB 1ORQA 3IDGA 1NFDE 2NMSA 3TZVA 3U6RB 4MHHI 3C5ZD 4PFEA 3SKOB 4GUPB 5DQDL 3NFNA 3BQUA 1W72B 1Q0YL 4Z7NF 1S9YB 3MV8D 2VC2L 4Y5YC 4PTUA 2V2XA 2WANA 3QIWB 2YD7A 3B2UD 5TDNB 3CXHK 3GIZL 1T03H 2BVQB 4J6RH 1QSEE 4G7YL 4ZPTB 2R1WB 3WJLA 1TZHB 3QDAA 1FZOA 1BOGB 2X4SB 2ED7A 2IPUG 1GXEA 1ORQB 5I73C 1EGJH 3TZVB 5CJBA 5D7KD 5D7IE 1CLZL 3ZE1F 4LSVL 2WBJB 3JV6A 4XPAH 5LJYH 4JANA 3NFNB 4EOWL 1KGCE 3BQUB 3OKKA 3RVXC 3QCTH 1GOGA 2AEWA 4OCXL 5IK3A 4OQTL 4R7DA 4PTUB 4WI5A 2CGRH 3TA3C 3UJJL 5E6ZA 2V2XB 2ENSA 5JIPA 1A7QL 1EXUA 4DTGH 3WSQH 3EYFA 2IJ0C 1A2YA 3LCYA 3QUMA 3SQOH 4PY8J 1MCRA 1N2RA 1JNNH 3FOLA 1FZOB 5DVNA 4Z7NE 1BQLH 3CX2A 3RWGA 3QQNA 1MCFA 3WJJC 4YE4H 1NBZA 3HG1E 3JV6B 5MENE 3MLYL 4ZFOA 4JANB 3OKKB 5HI4C 4Z7UA 5HHVL 1V7MH 5IK3B 4R7DB 2I9TA 2AV1A 3NTCH 5DT1L 5EIVA 2GJ6A 4GAGH 5BQ7A 3VG9C 5KSAD 4OTXL 3UP1A 5JW3L 1EXUB 4GT7A 3M8OH 3QXUA 2CR3A 3EYFB 3IDYB 3LRSA 1WVZA 1A2YB 3ZE1E 2V7HA 3QUMB 5ISZD 1IM9A 4E0RA 1N2RB 4WGWB 5SWSE 5A16A 3FOLB 4NWTL 4BELD 4LASH 5IJKC 2JJTC 1D7FA 3RWGB 3V6OE 3SEPA 2DQDL 5C0ND 3KPQA 2VO5A 5KVEL 1IL1A 4LP4A 4HV8A 1NBZB 2A1WH 1A7NL 4ZFOB 2APBA 3P4NA 3QQ4A 4JR9L 1WJ3A 1IE5A 2E6QA 3QRGL 4Z7UB 1HHKA 2YPVH 4MQXC 2I9TB 3KXFD 4XC1H 2YUXA 2GJ6B 3WLWD 5BQ7B 1I1FA 2NXYB 1OAXH 3LRSB 3VFMA 2COQA 2V7HB 1A4JA 4OI9A 3FTGA 1IM9B 4E0RB 5FYKH 4RGND 5A16B 1A3LH 3K74B 5HBBA 3OTTA 1X5FA 1H3GA 2QQLL 3KPQB 1B4JH 1IL1B 4HV8B 1KBGL 3OKOA 3QPQC 3VI3F 3P4NB 3QQ4B 1OARH 2YN5A 2IAMC 2EXWD 3N1MC 1DE4A 1MREH 1RFDL 1HHKB 1U9KA 2I5YL 4GH7B 4UNVA 5AD0A 3VXMA 4P0DA 2NXZC 1FC2D 1T7ZA 4GRWE 4U1LA 4JM2D 1XGPA 4MQTB 4G8GD 1I1FB 4NN7C 4NQDA 2EH7L 4U6XA 4JPWH 1YC7A 5JW4M 2P42B 3VFMB 1MAKA 4LLDA 4M6AA 1A4JB 3FTGB 2PTTA 4KMTH 3E3QE 1WBZA 1JI1A 5TF1H 1U8PA 2NY0B 2N7BA 5I0DA 1ACYL 5ILTL 3OKOB 4FG6C 1PY9A 1J1OH 4XWGL 4WO4C 3KPOA 4H1LH 3LMJL 5EORH 1DE4B 3VJ6A 3LRGA 5F89B 4PY8I 4U49A 4KJQD 5AD0B 2CO6B 3VXMB 2HFGH 4TULL 1SVZA 3DSFH 1F58L 4U1LB 4MXWL 4Y8AA 4FQ1H 1XGPB 5BW7A 5EZIL 1CLYH 4P2OC 4NQDB 5HGDA 3IJYA 4HZAA 4LLDB 3TBYA 4UU9A 3QIBD 3VI3E 4UTAL 2NY5C 2PTTB 4G5ZH 5F1IA 4ZUWA 1WBZB 3FN0L 1CDBA 1U8PB 1VA9A 4G6FD 4LU5H 4UT6H 5I15H 5KJRL 2WUBH 1ZE3C 5D5MA 4MXQD 2Y07H 1FN4A 3M17A 5BZWA 2YK1L 3HKFA 3EYOA 3KPOB 1OSZA 1RHFA 3NCFB 3VJ6B 3BO8A 2JB6A 1J1PL 4U1JA 3ZDXF 4U1GB 1K8IA 5HYQA 2XWTA 1MFCL 1J8HD 1T4KA 4MCZA 3A6CH 5HGDB 3TFKD 2BFVL 5SWZD 3TBYB 4Q74A 4DK3A 4UU9B 1CD0A 4RBPH 4MWFA 5I18L 5F1IB 4ZUWB 5E2UH 2ICCA 3C5ZA 5E5MA 3S3SA 5IW3A 4FNLH 2CRYA 2V5RA 5D5MB 3O3BA 4OUUA 4KAQH 3H9SE 1FN4B 3M17B 5BZWB 4HPOH 3AAZA 3MV8A 3EYOB 5BO1L 1OSZB 3GMLA 1FLRH 4K9EH 4U1JB 2JB6B 3BE1H 3QDJD 1LEKA 3QQ9D 4KI1A 1K8IB 5HYQB 3R1GL 4NOBA 2XWTB 4ZD3L 4ZUVA 1T4KB 2UVEA 5EIIA 2I26N 4MCZB 4L5FH 3GBNL 5ERWA 3SBWA 3V79C 2XZQH 3PP4H 1IJ9A 4MWFB 1WWAX 4PRHE 3C5ZB 4PJIE 3NFSL 5E5MB 3CSPA 2WUCH 1KYOJ 1RUAH 5F7NC 3ZDXE 4CJ0A 3O3BB 4OUUB 3VGAC 4E5XA 1CGXA 1K6QH 4L9LA 1M05A 3ZO0A 2VXVL 5LGKA 3AAZB 3MV8B 5C6TH 3GMLB 4O02L 4KPHL 3ECBA 1LEKB 4UV4L 5FUOH 3WIHH 3QXAA 5F7KC 4ZUVB 1WZ1L 3MRNA 5EIIB 3KLSA 1IAOA 2ZWLT 2NY5L 3NH7L 4P9ML 5CP3H 5ERWB 1E4XI 1HKLL 4Q0XL 2ZZUT 4G6ML 4K23H 2BP3A 3REVA 3RU8H 4N1EA 1PG7X 5E8EA 3VI4F 4E5XB 4L9LB 1M05B 5E7BA 1CTNA 5GHWL 1TXKA 4NKDA 4G8FA 5C0JA 1C16A 5C07E 1VSCA 4M9PA 3T04D 1UCBH 4XX1E 1WWCA 3ECBB 5KSAA 4JQIH 3OAYK 3QXAB 1XCTA 3GHBH 3MRNB 1E6JH 1IAOB 3BN9D 3L3GA 5ISZA 2FX7H 4J4PD 5C0BE 3U0WL 2W65A 4BQ8A 1JF1A 1KIUA 2NZ9D 3B9KC 3PWPE 4LDOB 4QCIB 4DUWA 3REVB 4LSQH 1UADC 4MHHG 3W11C 1YNKH 5E8EB 3M1BA 2X4TA 1YJDC 2VLJD 3WV0A 3FHAA 3MFGB 3V7AE 3WXWH 4K8RH 4NKDB 1TENA 1YQVH 4G8FB 4Y5XA 5C0JB 1C16B 1CICD 4R4ND 5JDSA 3KXFA 5A2IH 5SV4A 1CGSH 1ZT7A 4CGTA 1BQUA 5KSAB 3C08L 1D9KD 3FQWA 5ALBL 3IU3A 3QAZB 1XCTB 2QQNH 1E4XL 1T0MA 5ISZB 5JOPE 3K7UA 5FUCE 4KHTL 2W65B 3VI4E 2BOCA 3EBAA 4LL9A 4WFEE 1JF1B 4PGCA 1RIVL 1PSKL 4OGXH 1WZLA 4TSAH 2ORBL 1ZLWK 2P46B 3M1BB 2CDFA 2X4TB 2FSEA 5D8JL 3DNKA 1PW3A 3V52L 5GZOD 4Y5XB 5JDSB 3KXFB 2AJYL 1HHHA 4JM2A 2BSSA 3RVTC 3WL9A 3FQWB 4G8GA 2APXA 3IU3B 1JUFA 2HKHH 3S3PA 1T0MB 3HI5H 4YH6A 2WZPD 4W6XB 4RGNB 2BOCB 2DQCH 3RPIA 1T2QH 5HI3D 3BMWA 5FKPA 4PGCB 1L0YA 2H26A 4TTGA 5H8DA 3Q1SL 1ZEAH 1OT1A 1T89A 4PLKC 4WWKC 3V4PH 4YHOH 2CDFB 1ZA6A 2FSEB 2FGWH 1EFQA 4RAUA 4NUGH 5FDYA 1JGUL 2P5WD 1HHHB 3D9AH 3HPJA 4ELKA 2X1XR 4JM2B 5IIEA 3ZDYF 2BSSB 4XCFH 1KCKA 3WL9B 3S88H 2C4XA 4G8GB 4IRZH 3O0RL 1JUFB 2VDRH 5BMFL 1WQVT 1BBDL 2W38A 3GO1L 3QIBA 5IROC 4HLJA 1K85A 5SWQA 32C2A 1R5VA 3JVGC 3RPIB 1UWEH 2H2SD 4ISVA 4YEEA 2OZ4H 3IU4L 5FKPB 5HXMA 5IHUH 4N0CC 4Y16C 5TPWL 5C0CE 1YJDL 1Z0MA 2H26B 5EUKA 1AE6L 1JZ4A 4I18A 4HWEL 1GAFL 1ZA6B 2HJLA 4LSPL 5FO9A 2CDEA 5KVDH 4RAUB 4TVPE 4FFVC 5E2JA 3HPJB 4ELKB 1U3HC 3QP3A 5IIEB 2WWMC 5GS0H 3KPRD 3QFDA 4LVOC 4OF6A 5F7YC 1PDKA 2NR6C 1J8HA 6FABH 1F4YH 2VXTL 2GTWA 1CF8H 5SWZA 3GM0A 3NIFF 2YD2A 3QIBB 1RZKH 5SWQB 32C2B 1RV6X 1R5VB 2DD8L 4HH8A 4ISVB 4OLZL 3KS0H 1KENH 1KJ2L 2ZUSA 4CN1A 3U36A 1OWRM 4G6FB 1NLDL 1QHOA 4M7KL 4O4YH 5EUKB 1RUMH 1UFUA 1QFHA 1F8TL 4I18B 2FH8A 2YXMA 3RI5F 2HJLB 2R29H 4U1MA 5FO9B 2CDEB 2VN4A 4KC3B 2VXUL 3TH3T 5D7LD 4DGIH 3QDJA 2QKIA 1R3KA 1KCRH 3KYNA 1IGML 4LMQI 4PJDE 3QFDB 1MJUH 1J8HB 4OAWA 3O2DL 1XF5A 3B9VA 2GTWB 2R4RH 5SWZB 5C09D 2NW2A 3N85L 1FNLA 3I02A 4PB9H 1UYWL 1CFVH 3RVVD 3U36B 1YYMH 5FYLD 4AEEA 4IMKC 4Y19D 3SDXA 5MHSD 2LAGB 4U1MB 5F7FA 3QDJB 2QKIB 3PL6D 1R3KB 4NBZB 2IFFH 1H3PH 4HIIA 3KYNB 2P44B 1LO4H 3JWDC 5IMOA 1EHAA 4OAWB 5K9JH 3P4MA 2R0WL 4CRPA 3G5ZA 1XF5B 4OZIB 5D1ZD 2XQBL 4PJHA 5F6HI 2NW2B 2CR6A 3WDIA 1F4WH 3I02B 1MRFL 3D48R 4WRLA 4X80L 3MV01 2DQHH 3VD3A 3QJHA 1YA5A 1CE6B 1A6WL 4N8CL 5EUOA 3SDXB 3MQIA 4N5ED 1I1AD 4FQXD 3U1SL 4YDLB 3KYOA 4KK5C 4X7EC 3V0WL 4HIIB 2LTQB 5IHLB 1MI5D 4U6VL 5IMOB 3W9EA 3P4MB 3G5ZB 1W8OA 1DBMH 1S78C 3KYAA 4J4PA 1FFRA 1XR9A 1U3JA 3IVKA 4Z7UF 1U8OA 4GSDH 4NO5A 4PJHB 5TQ2H 1IKNA 1NBYA 1AR1D 2BVTA 4RGOH 3MJ8A 3RKDC 3QQ3A 1H5BA 3MRCA 4KROD 2VLJA 3BZ4A 1IFHL 3KLHC 3QJHB 1ZT1A 1P4LA 3MJGX 2NX5E 3ARGD 5E94A 5EUOB 3UZEA 1CICA 3ARDD 1ORSA 1CE1L 3QEUA 2EDJA 3KYOB 3HMXH 2D2OA 1D9KA 4PRAA 3BRGC 4YHIB 4ODWA 5JPMA 1MCWM 4XB8A 3IGAA 3MRQA 4Y4FD 3W9EB 4EBQH 3HNVH 4YIQA 5M95B 4HEME 5FHAL 1KIPA 2Z31C 3IVKB 1XR9B 4QY8A 3X3FL 1U8OB 2WQRA 3KVQA 3Q48A 4NO5B 1NBYB 5CMAA 4RMUA 3MJ8B 3QQ3B 1H5BB 2AABL 1JZ5A 1SVCP 3MRBA 3MRCB 4RQQA 1FAIH 2VLJB 5EBMA 3BZ4B 1NANH 4IEFB 1ZT1B 1P4LB 3BSZL 5E94B 3BHBA 5I30H 3ALPA 1CICB 3PP3H 5IMLA 1ORSB 3QEUB 3JWDL 4L3ED 3UX9B 1CR9H 1S9VA 1D9KB 1SJXA 4PRAB 4MDIA 1NMBH 4ODWB 5JPMB 3X17A 3OX8A 3IGAB 3MRQB 2VUOA 1QG3A 2AQ2A 4KK8D 1TTUA 3MA7A 2V6HA 1AIFA 1ZAGA 4YIQB 1U6AL 2GJ6E 3EO9H 1KIPB 3SE4C 4QY8B 3T65A 3PV7A 5CMAB 2RIKA 2LU7A 4NM8L 3MRBB 5E00A 1AFVH 1V3LA 2ZUQC 4RQQB 5EBMB 4NBXB 1XGYH 1W72H 3LSOA 1MCQA 2ZG3A 2EYSA 1PZUB 3F58H 3BHBB 3I6LD 5DGRA 4KQ4L 5IMLB 2P5WA 4JHBA 1C1EL 2YRZA 3C2AH 1P7KA 1S9VB 2NTFA 1BWWA 4JDZA 4MDIB 4I3RH 3OX8B 3EDDA 1X5JA 3MA7B 1F4XH 1AIFB 2VZUA 5E0QA 4GQ9H 3AM8C 4KUCF 2DBLL 1WGOA 3EDFA 1J0JA 3T65B 4L4TE 3CMGA 3STBA 3K1KC 3O8XC 4MA1C 4Q9RH 3O6KL 4S1QL 3AMLA 3U30B 4RMWA 1JMZA 3ULUE 5E00B 3LSOB 5F96H 2EYSB 1QRKA 2P24A 2R1XA 5GPRA 4M7ZC 2D31A 1EFXD 2P5WB 4ZUTA 4P4KC 1ZWIA 1P7KB 3KPRA 2NTFB 2HJFA 1MAJA 3P11L 4JDZB 1X4XA 1JHLL 1IAKA 3IFNH 3LN5A 5D5MF 1FORL 3DV4A 1EX0A 1QLEL 1IT9L 3U9UA 3V4UL 2V2TA 1AY1H 4NQDE 1MY7A 3HFML 4NZUL 4ODHH 1FZKA 3ARSA 5GIRA 5A3IC 1IVLA 1QHPA 2HT4C 3FQRB 4EI6A 3RX7A 2DQUH 5D7LA 2P24B 2R1XB 2D31B 4DOHB 1RZ8A 3T08A 4ZUTB 4DGVL 1ZWIB 3KPRB 2HJFB 4QNPF 1FDLL 3RZCD 1DBBH 3L95A 2I25N 5EOCL 1IAKB 3LN5B 3TH4T 3QUMH 2AERT 2JELH 3QIUD 3W5MA 4N0UA 2YUVA 3DV4B 1QQDA 4Z0XA 3U9UB 3KJ4B 2VSCA 4M02A 2V2TB 1OP3H 1QP1A 5E8DH 5ESAA 5DJDA 3UXFA 3UEZA 4K3JH 5B4MD 1FLTX 1FZKB 2C7UA 5GIRB 5I71C 3O6ML 4JN1L 2VDML 4Y19A 5CUSH 5C0AE 1V05A 4EI6B 2BVYA 4UB0H 3ULVD 3D1MC 3UJIH 1JPFA 4KRPC 5D7LB 1MF2H 1K4CA 1MLCA 3PL6A 4LIQL 1RZ8B 5F3HA 1FZJA 3WD5L 5HVHC 1G0XA 3BISA 5B8CC 5I1KL 1U36A 3L95B 3FO2A 5D1ZA 2X4UA 1L7TL 4FQ2L 3D3VE 4ZUUA 1NGYA 4N0UB 3GNML 1Q0XL 1Q72H 5JPNB 3HZVA 3PHQA 4I3SH 1QBML 1QR1A 1R5WA 2QQQA 2AI0H 4NKMA 5ESAB 5AZEH 4F2MA 5DJDB 5D93B 5LCVL 3E6HA 4PRDA 5IEKA 2C7UB 5FYJE 4Y19B 2VR4A 4NHUB 1I1AA 1LO3L 4FQXA 4S1RL 3LVEA 1JPFB 1H3TA 4EDXA 1FYHB 5L0QB 1MLCB 1K4CB 2JJSA 3PL6B 1BIIA 5JIKA 1VFUA 3MV8E 1MI5A 5F3HB 1FZJB 4BZ2H 3DARA 3TT1L 1BF2A 4PJFF 1BREA 1HKFA 3I85A 5B38A 3FO2B 5D1ZB 2X4UB 1BHGA 4K7PH 5LWYL 4ZUUB 1FV1A 1NGYB 2UZIL 2GAZA 3SJVE 4YJZL 5I1CL 2NY7L 3HZVB 3PHQB 5B38G 3ULUH 4YHPA 1QR1B 1R5WB 1FFPA 4HSQA 1JGLH 4NKMB 4F2MB 5JHDE 3LZFH 3E6HB 3CXDH 3B8SA 5IEKB 1OWWA 2KPNA 3DVNA 1I85A 3DXAD 3IDNA 5L6YL 3ARGA 1CGVA 5D7KE 5FM5M 5F1SA 1I1AB 3ARDA 4FQXB 1MPAH 2ZNXA 4EDXB 2C1PA 3BESR 1BIIB 3UJTL 5FM8A 1MI5B 5I74B 4NP4H 2NZIA 4Y4FA 3RHWK 2E27H 2YKLL 5FA3A 2HN7B 3DURA 5B38B 4PJ7A 2Q3ZA 3P40A 3C6LD 4TSCL 1T1XA 5HYFA 1FV1B 2XQYK 5I8OL 2GAZB 5DA0B 3WXVL 5IKCA 4YHPB 1FFPB 4KTEH 1NPUA 3BAEH 4N0YL 3QCVL 4S1SH 4TUOA 1XR8A 3EYSH 3DVNB 1DN2A 3IDNB 3ARGB 1TJIL 1JTOA 3VXRA 5J7CC 5BV7B 4R4FH 3ARDB 4YPJA 5D1XD 4NCDA 4L3EA 2E7CA 3A0OA 1DANU 2C1PB 2ED9A 2DQEH 1K3ZA 3CH1A 3OZ9L 1YPZA 3T4YA 2XFXA 5FA3B 3DURB 4M5YL 4PJ7B 4KUZL 2B1AH 1T1XB 3GSXA 1QO3A 1NMCB 3NA9L 5IKCB 4KVNH 3N50A 3O6LH 4JE4B 1RJZA 5GGTL 4D9LL 3CFDA 4I4WA 4XGZA 1HXYA 4JM2F 2X9WA 1J8KA 4TUOB 1XR8B 2D0HA 3VXRB 1YEHL 3PWNA 4ZOEA 2XG4A 4LHJB 4L3EB 3SDAC 5L88H 2A6DA 4FQQA 1FYTD 2EXYD 4MAUL 3NCJH 3CH1B 5JR1H 2BHUA 1YPZB 1HIMH 3T4YB 2XFXB 1PY4A 1YEEL 3L3JA 3RDTC 1ONQA 4RAVA 4O2EA 5C2BL 1UM5L 4XPTL 4S0TD 2PYEE 3GSXB 3VXOA 4BUGA 1QO3B 4ZFZA 3INUH 5DFVC 1RJZB 1VEMA 4TPRL 5TJWK 1TQCC 3CFDB 4I4WB 3D0VA 4XGZB 4OV6F 1HXYB 3X12A 1YY9C 3ZT6A 3AS0A 2AK4D 1QTYT 4UIMA 4U4BA 2GYSA 5E6ID 1ZHKA 2KH2B 1EFXA 3PWNB 4DWHA 4CMHB 4NZTH 1I9JH 4K71B 5EZJA 2A6DB 5C0GA 4FQQB 4XNYH 5KTEL 3LS5H 4XHJD 1J1XH 4JPIA 3L3JB 7FABH 1ONQB 4ZTPH 4DAGL 5TQ0L 4RAVB 4O2EB 2QHRH 4PJCE 2EIDA 4WEUD 2Q8BH 3TVMD 3VXOB 1QFWM 1UJ3C 4ZFZB 4BSVA 4X9IA 1QSZA 4RA3A 4UV7H 3ZTNL 4MS8C 1XGUA 3MJ9L 1R3HA 3D0VB 3X12B 4NM4L 4GRLD 5HYIA 2F15A 4OCWL 3WFHA 3BPCA 2E3VA 2XN9D 1UA6H 5F93C 1ZHKB 1EFXB 1NUDA 2IQ9L 4X6CA 5EZJB 2F5AH 5C0GB 2DM7A 3LHPL 2LAAA 4MMXC 3L5IA 2ADFL 3GIZH 5T3ZL 3RZCA 4PJEE 4JPIB 3H42H 5DJYA 1FGNH 4XBEH 3BZDA 3PGFH 3WFBL 5FGSA 5DSCA 1MHPH 5E2WH 3QIUA 2YPKA 1DVFC 4WNQA 5T1DL 4LSUL 4J7RA 3RY6A 3B43A 3IDXL 1WF5A 4LCYA 4XVSL 4BSVB 5GRUH 1XGUB 4OFKA 1R3HB 1TPXB 5F7LB 4FP8L 2FO4A 3EDKA 2CSPA 4JPVL 1KC5L 2IBZX 1OP9A 2VRAA 4K3DL 3WFHB 2GFBA 4WFGD 1JFQL 3H9YA 4OGYH 3BPCB 1GRWA 1G6RL 4QTHA 3UJJH 1A8JH 2NYYD 3K4AA 1Q9OA 2Y1VA 1YEDA 2EEAA 2ITDA 4X6CB 1FBIL 2ZUUA 4X7DC 3RZCB 2BSED 5DJYB 3VFUB 1AQKH 2IWGA 5MI0B 2FHCA 2OJEA 4W68A 3RL2A 5DSCB 3QIUB 3S37L 1P9MC 2YPKB 4CJ1A 4M61A 4WNQB 5C08E 3SDXF 3KG5A 3OKEA 4LCYB 5DQJA 3G6JE 2IALA 4MAYD 4PRBA 2FO4B 3MA9L 2YD9A 1F2XK 1X6NA 1U8HA 2GFBB 4HG4J 3O2WH 3LQMA 4PJ9C 1JMXA 4QTHB 4PJHF 2VB5A 4LFHD 3ALXA 1Q9OB 4LBEA 1YEDB 2ITDB 4MQSB 4HAFA 1DANT 2AEQH 5J12B 1A6AA 1VACA 1U92A 2YD1A 4LLQA 3RL2B 1Y18A 5I9QC 2BC4A 3HI6H 4M61B 4ONGL 1NBVH 4HUVA 5EUOF 1QRND 2VE6A 5ACLA 4OZIE 4PJGE 5DQJB 5C3TA 2IALB 1AGBA 4PRBB 3DXAA 4OIBA 3LEVL 3H3BC 4Q9QL 4JFFE 1U8HB 1T6WA 1P4IL 4OIIL 3UPCA 4YFDB 2VDQL 5C7XH 2A6KA 1CIUA 1IC5H 3OGCA 3SO3B 1BAFH 4LBEB 1A7PL 1QPPA 1HWGB 2MPAH 1S8DA 2H6PA 3CZFA 1A6AB 1NSNL 1TMCB 1U42A 3C6LA 3W0WD 4IMLA 1VACB 4ONHA 1U92B 4LLQB 3PWVA 1HNFA 1Y18B 3GRWA 2BC4B 5IQ9A 3D39E 1ODAA 5T5NF 1TJGL 4BH7A 2VE6B 5EWIH 2DQJL 4OCRH 4P5TD 4R2GC 1AGBB 3DXAB 3IFLH 1N8ZA 1HK6A 2PR4L 5H2BA 1A0QH 5D1XA 3DETC 2A6KB 4HS8L 5CILL 4EXPX 3OGCB 2X40A 4PR5A 3VGGA 1KB9J 5IFHH 3SE9L 1WK0A 1S8DB 2DLFH 2DQTL 2H6PB 3CZFB 3C6LB 3MZTA 4IMLB 4ONHB 1OAUL 2VISA 3PWVB 2OJZL 4YPGA 4OF8A 2ZUVA 4ACPA 5IQ9B 4FFZL 5D4QA 2J3SA 4BH7B 3MLRL 3T1WA 1DBJL 5CSBA 1DFBH 4JQVA 2JCCB 4OF7A 5I17A 2EDOA 4OGAC 4U0RC 1H3WM 4AIXA 3LKQA 4JVUA 1N8ZB 4DVBA 2OTWA 1AHWC 1T5WA 2OTPA 5H2BB 1YMMD 3ZE2F 1TZGL 1NAML 2CMRL 2HAZA 5BZDA 4GLRH 1TDQA 1FYTA 2OP4L 3QDGD 4NQEA 1ZLUK 4PR5B 3MX0A 3LD8C 5I19L 4JFEB 2W07A 3RIAK 3VG0H 3B8YA 5K33A 1RZJH 2VISB 4YPGB 1N5YL 2AK1L 3LS4H 4PBVC 2WNGA 3MNWA 4GG6A 1BFTA 1MCIA 1QFOA 2AK4A 4PRPE 5I17B 1ZGLA 1X4YA 5L9DL 3BT2H 4YHYC 3LKQB 1TETL 4DVBB 1FIGL 2OTWB 3GSRB 1C08A 1T5WB 4P99A 1CGUA 5E6IA 4D9RD 3ZYJA 3HNSH 4JG0L 5E1HB 4X5XA 1UQSA 2VLRD 5BZDB 4JAMA 1FYTB 3VFWA 3KPTA 4NQEB 2HRLA 1UH4A 5EG6C 3E2HB 5J8OA 1BIHA 4HXAL 4CVZA 2VLLA 3G5YA 1FCGA 3GMOA 3TVMA 1KV3A 4P9HH 2EIBA 2CQVA 2DMCA 3MNWB 1A4KA 2X2YA 4U3CA 4CMMA 1PZ5A 4GG6B 1FNSH 1AGEA 1ZA3A 4GRLA 2R0ZL 2BNRE 4XMLL 4I0PC 2AK4B 1ZGLB 3N1QC 4BFBD 1NCAL 4KRNA 5DLMH 1HINH 4HXBH 4FZEH 2XN9A 1AGCA 1C08B 5E6IB 4X5XB 1UQSB 1UEMA 5EZOH 1T04A 5CINL 4JAMB 5T5FH 3WUWA 3VFWB 3U9PH 5IV2A 4Z95L 4NKOA 3WFDL 4R0LA 3KYKL 4HT1H 4UT7H 1O7VA 4M62L 1C5BH 3WUWG 4CVZB 2VLLB 3G5YB 5GJSL 1RSFA 2I9LA 2J6EL 2JIXD 1ZXQA 3GMOB 5AWNH 3TVMB 2E7LC 2IQAA 4WI7A 3EOAA 2DB8A 4ENED 2PETA 4ODSL 4CMMB 5K9QI 1A4KB 1PZ5B 1UM6H 1RULH 4K3GA 1ZA3B 1AGEB 3FMGL 4GRLB 4M5ZL 5DK2B 4Q58C 2IC2A 2XN9B 1AGCB 4P2QE 3JTSA 4LQ1A 2XRAH 5HPOA 1KCVH 3HUJE 3DRQA 4JM4H 3MOBL 1T04B 4LEXL 1EZVX 3WUWB 2BY2A 4NKOB 3KLAA 3VXNA 4NN5C 4R0LB 2FJFA 4PB0L 1IZKA 4WCYL 5A2LH 4K3HA 1GPOH 2I9LB 3O45A 2IQAB 1MQ8A 4F9LC 4FFYH 3EOAB 4I1NB 1I7UA 3VH8A 1DUZA 3H9HA 1CZ8H 2VXQL 4FRWA 3KPSD 4MAYA 1NGPH 4I2XA 3THMH 1OQOA 4RMRA 4XCCH 3VH8G 2QSVA 1ACZA 2YRPA 1KPRA 1UB5A 3BKYL 3EW3B 4EDWH 4JHWL 1OCWL 2ZJSL 2FGZA 2UY6A 3JTSB 3DRQB 2XICA 5D6DA 4XMPL 1UACL 2NXZD 2Y36H 3GBML 2EYTA 3KLAB 3VXNB 4YWGL 4P3CL 3T0VA 2BK8A 2FJFB 3EAKA 3EDEA 2D0FA 1QRNA 3O45B 2ED8A 5CJOL 4OJFL 3VH8B 1I7UB 1DUZB 3H9HB 3WNMA 4MAYB 1ZS8A 4N0UE 4I2XB 1OM3L 1CN4A 2XQYG 3EYUL 4JVPA 1JF5A 1QYGL 2RFXA 1FCCA 5FA4A 1KPRB 1UB5B 5M94B 1VPOL 5FKAA 1QVOA 1JYXA 3P3YA 5I1JH 1C5CL 3VA2C 1KEML 5FYLE 5GRYA 4Y19E 4DVRH 2D7TL 3C08H 2HH0H 2W1NA 5I8KL 2EYTB 3RWFA 3QDME 1ZGLM 3FRPA 2D7OA 3RTQD 1RPQA 3GSUA 3W0WA 4OZHA 4KHTH 3VFVA 1YDPA 3ZSSA 4G6JL 1QRNB 2VDKH 1VADA 3BKJH 2HWZH 4K7FA 4P5TA 2DF3A 1PGRB 1ZS8B 3EZ8A 4XPHL 4QWWD 5DRZA 2RFXB 5GZND 1MJ8H 4MXVF 3R0NA 5FA4B 4D3CL 5FKAB 5DZNA 1QVOB 2OR9H 4PJ7F 5KOVC 1F3DH 2YPLD 1BD2D 4KKLC 4NSKA 2F9BT 3B9AA 1C8PA 4JO4H 4F15C 1F00I 2J4WL 1EDQA 4HJJL 3RWFB 4PTTA 3QYCA 1MCHA 3GSUB 3W0WB 1T1ZA 1WFUA 2E7MA 4OZHB 2GY5A 3VFVB 1MI5E 1T22A 1VFAA 1YDPB 5C0FA 5D72H 1VADB 5TFSL 2BSTA 1ZVHA 4P5TB 4F37F 4QRPE 2F5BL 2J8OA 1YPZF 5EC2A 3WO3B 2W9LA 1UG9A 3MZGB 5DRZB 2DQGL 3BVNA 1YMMA 3VDAA 4U7KA 2F54E 3IXTA 5SX4I 3NZHH 3QDGA 4RMQA 4NSKB 5E56A 4AIOA 1B3JA 3VD7A 1CXIA 2B5IB 4WJ5A 1F3RB 1TNMA 4LMQE 4HQQL 1J05A 4N0FA 4PTTB 3LN9A 5IFJB 1CS6A 4OQ1A 1T1ZB 2VWEC 3UO1L 1T22B 1VFAB 1JHKL 1AGDA 2VH5H 3NGBC 4XC3L 3MFFA 5C0FB 1FPTH 1F45A 5MP6L 2BSTB 4HWBL 2VQ1A 1YJDH 2Q8AH 3RWCA 5L8JB 4X7SH 4YHMH 1FNAA 2Y7QA 4KZEL 5F8RC 2A38A 2P48B 2XKNA 3BVNB 1YMMB 1RZFL 3KPMA 3IXTB 2VLRA 3QEQD 4JREC 1L0XA 3N0PB 3QDGB 2WM0A 3QPXL 2CRZA 4WJ5B 3VXRE 4G6KL 1J05B 3G6DL 4N0FB 1K3IA 2C4FU 4MJID 2Q1EA 1IQWL 1IC7H 1INQA 2XTJD 1XF3A 2BERA 3MFFB 5T33L 2PXYC 1NLDH 2VQ1B 3RWCB 3PABA 3WNLA 2Y7QB 5C0EA 1JRHI 4G7VH 5FYLH 3IS0X 1LO2L 3BKMH 4UINH 2XKNB 4NNXA 2AJUH 2YA1A 3KPMB 4UBDD 4JFHE 1DL7L 5I66A 2VLRB 1IGIH 1GGIL 2DIJA 4WY7L 2DQIL 4IDJL 3SPVA 2XIDA 4N9OB 4RDQF 3NCYS 4NQUA 3T0EC 3BFOA 4Y2DC 3MCLH 3OAYH 5GJTL 2JIXA 4U7MA 5EO1A 4AL8L 4JZOA 4RZCA 4WI6A 2R39A 4Y4HC 1XF3B 4GW5A 1ZV5A 2W0KA 2HKFL 4LRNH 1HSBA 5CGTA 4X6EA 5BCAA 2BXZA 1BM3L 3RNQA 4ZFGL 5C6PB 4RGMB 3D2UB 4YXHH 4YDIH 3PABB 3LIZH 4LARL 4X6CF 4OSUH 5C0EB 2JB5H 3L3DA 2E7HA 3W11D 4LDLB 1X4ZA 3N1PC 4APQD 4F7TA 1AP2A 1M4KA 4NNXB 4MYWB 5J13B 4KKBC 5I66B 4YXKL 2E9BA 1YEGL 3SPVB 1P6FA 1R3LA 5BJTB 1IAIM 4I3GA 4NQXA 3ZHLA 4ZS6C 1QSVA 2LV4A 3WO4B 2JIXB 1BFSA 5EO1B 4XP5H 3HA0A 4JZOB 1CD9B 4X6FA 2DLGA 4RZCB 3ULVF 2X4OA 4G43A 4GW5B 4KHXH 5D96B 43CAA 1N0XH 1HSBB 4X6EB 3KPSA 3RNQB 2RHEA 1JRHL 1FZMA 4M7JL 1P53A 3L3DB 2DLTA 1CFBA 4KTDH 4F7TB 4U2YA 5AYUL 1AP2B 5BV7H 4GXVH 4Q9CA 2CRIA 1ERNA 2XZCL 1WWWX 1N0LA 1RHHA 2FCBA 4POUB 1R3LB 4UDUA 4QOKD 5BRZD 4NQXB 2O5YL 2NY3D 2Y6SD 4KI5F 4P59L 4X6FB 3TBSA 2X4OB 3SCMC 1V3JA 4G43B 3T77A 43CAB 4QXWA 4CKVX 3KPSB 3AB0B 1TNNA 1FZMB 2VAJA 2CUIA 3GI8L 3IS1X 1QA9A 4HAGA 4O2CA 3BKCL 3EFDH 4X4XA 5F9WB 3H6JA 4J12A 1DLFH 1RHHB 2J8UA 1G0YR 4L3AA 2LU4A 1PVHA 4UDUB 3RTQA 3STLA 1T2JA 4ZAKC 5IBUG 4JZNA 1QKZH 1BBJA 3NA4A 1H9VA 3BGAA 1AO7D 1NCDH 4NJ9L 4BFGA 1CCZA 5DJAA 3HAEA 5CSGA 3WIIL 3T77B 4UOW1 2AAVA 4P5KA 3O4LE 4WU7A 1MFBH 4M93B 4MDJA 3HAEG 4HIXH 4OZGE 3AY4A 5FHBH 4OM1L 4KGJA 3PG2A 5ACZA 2ZOLA 1IC1A 5FM5O 1DEDA 1T0PB 2A0LD 2YPLA 1BD2A 4PP1D 4X4XB 2DI9A 4KI5E 1PX3A 5IBUB 3HB3C 4EI5C 2W0PA 2J8UB 5JXAL 3CFKA 3QT2A 3RTQB 3ETBF 4HCRA 3STLB 5I76A 4JZNB 3FT2B 1BBJB 1CQKA 2KUTA 3FOMA 1LEIA 1JHTA 4NIKB 5DJAB 2WK2A 4R4BA 3HAEB 3V8OA 3Q0HA 1W8NA 4WHDA 4P5KB 1T03L 4J6RL 5EU6E 4WU7B 3JUZA 1LGVA 1IGFH 4FABH 3G5VA 1MAMH 2HTKC 4U0QB 5ACZB 2ZOLB 1JPTH 3VXPA 1A7OH 1EGJL 4MNQE 2YPLB 4LSSH 4MA7H 3RGVC 4J3OC 4XPAL 4X7TA 2RJMA 3ZKMC 3QCTL 3MOQA 3CFKB 4IRSA 2HT3D 3SN6N 4GBXC 5HI5C 5I76B 2CGRL 4NCC2 3RIFK 2NY1D 1HYSC 3FOMB 4ODXA 1LEIB 4I9WE 1JHTB 4R4BB 1VESA 3CSGA 1R3IH 5E7FA 2GEEA 4PYGA 5J11C 4DTGL 3WSQL 2XKUA 1JPSH 3LV3A 3RWDA 3SQOL 3N06B 4NT6A 3G5VB 1JNNL 3FJTA 3T2NH 4ODUA 1G9MC 4N0RA 4J3TA 2JCCE 1BQLL 3QEQA 3VXPB 4X98A 4M48H 1I3GH 2PYFA 4YE4L 4WENB 4UNUA 4X7TB 4IRSB 4MJIA 1V7ML 5JQHC 2FATH 1WFOA 3FFCD 2CLVA 5DF0A 3NTCL 3FT3A 1B0GA 4ODXB 4GAGL 1RIHH 5TH2A 4S11A 3EJZD 2QADB 5FGBA 1XEDA 3CU7A 4JFEE 4JKLA 3M8OL 1UZ6F 1PD6A 3BH8A 5ICYA 2R56H 3LKPA 3LV3B 3RWDB 2FYYA 4X0KA 4NT6B 2FJGA 1CXKA 2LVCA 3MJ6A 3I3DA 4ODUB 4C56D 4LASL 1YNLH 3ULVH 3MRJA 3QEQB 4X98B 4ZNCD 2PYFB 2A1WL 2GI7A 1XF4A 1OB1A 2FWOA 3PNWA 4TOYH 4MJIB 2YPVL 3B3IA 1FYTE 2CLVB 2FX8H 4WI8A 5IUSA 4NQEE 3WKMH 3FT3B 1B0GB 1GZQA 1SMAA 2XTJB 1D6EA 1S78D 4XC1L 5TH2B 4PJAA 2AJ3A 1L4IA 3CFJA 4W4NA 1DQLH 3AROA 1ZSDA 4PJBE 2ADIA 3GMRA 4R7NA 1OAXL 3BH8B 5ICYB 3LKPB 2CJUH 2FYYB 3I9GH 4X0KB 3C60D 2G60H 5FYKL 2FJGB 4APQA 1A3LL 2P8LA 3LQAC 5DK3A 4GG6E 4MB4A 4NWUH 3MRJB 2M26A 1KN2H 5DD1H 1PBYA 4XNXH 4MSWA 2FZ3A 2VLKD 3IAPA 1B4JL 4YUEH 3FFDA 3BRFA 2XY2A 1P7QD 3AS2A 4XWOD 2FWOB 1OB1B 1OARL 3GZKA 3PNWB 3MUHL 4HBCH 5DEFA 5HD8D 2V2WA 4JRXD 1MREL 4LVHB 3B3IB 1AKJD 1ITCA 1J18A 4O2FA 5F7EH 4R8WH 4OCSH 3KHQA 1GZQB 3BPOB 1D6EB 2EYRB 4PJXA 4PJAB 2AJ3B 3CFJB 4K9EC 1ZSDB 1DBAH 2ADIB 3GMRB 4R7NB 4M43H 1WITA 3WS6C 1G9ML 4B41A 3IDUA 4JPWL 4NQTA 3TIEA 1PJ9A 4APQB 1G9EA 4KMTL 2P8LB 1R0AH 1SYSA 5DR5H 5ACMA 5IJVA 5TF1L 5JLZA 4MSWB 2FZ3B 3FFDB 4YAQA 5HYJD 1I1YA 1J1OL 4QOKA 5BRZA 2HG5A 4JFQA 3K2MC 3O6FD 5DEFB 5EORL 4JQXC 2V2WB 5JORA 3G9VA 1S7TA 1T5XA 2HFGL 2LABA 2YD5A 4O2FB 4Z77A 3DSFL 3GRWH 2OL3A 4FQ1L 4PJXB 4QGYA 5J1SC 1EIBA 3F5WA 1CLYL 1WZMA 1DLHA 2GSGA 5KSVA 3TIEB 3KGRA 1E4WH 2EDNA 3E3QC 4S10A 3RHWF 4G5ZL 4NN6B 5HYEA 2UV3A 4EN3A 5J1AA 1SYSB 5I8CA 5IJVB 2D3VA 2VITA 5JLZB 4G6AD 4LU5L 3BGFC 4UT6L 5I15L 2WUBL 1MQKH 3UJTH 5IM7A 3ZHKA 4YAQB 1I1YB 1RUQH 2Y07L 1C7TA 1HEZA 3PWUA 4QOKB 4LSDA 5BRZB 2HG5B 4JFQB 5IHBA 2NY3B 1AO7A 5JORB 5T3ZE 1S7TB 1EH9A 1T5XB 5INCA 4Z77B 1Q8MA 2OL3B 5DQ9A 3F5WB 4KDTA 1D5ZA 3A6CL 3WBDA 1JIBA 1OD9A 4EEEA 1DLHB 4L8DA 2GSGB 5KSVB 3UMTA 1MNUH 3TYFA 4EN3B 4OZHF 5A40E 5J1AB 5E2UL 1SEQH 1YN7A 5I8CB 3SGKA 2VITB 4GW4A 2VQUA 4FNLL 5IM7B 1KEGH 4KAQL 1HEZB 3KNBA 3PWUB 4HPOL 4K3EH 1FLRL 1AO7B 1HCVA 3LDBB 3BE1L 4K9EL 4POZD 3MCG1 5INCB 3VFTA 4JZJC 3WFZA 4LSTH 5DQ9B 5FV2A 5HGGS 1UGNA 4L5FL 2UWEA 1D5ZB 1KXVC 1IKFH 4L8DB 2XZQL 3PP4L 3BDYH 3G08A 1MWAA 4KU1A 3TYFB 1OHQA 1YN7B 1U3ZA 4GW4B 1MIEH 2WUCL 5C9JA 1RUAL 2QQKH 3I50H 1K6QL 3CH8A 3KNBB 15C8H 1JPGA 3QDHA 1L7IH 5C6WH 1UH2A 5C6TL 4U3XA 3UTPD 4EUPA 4K94H 1WBXA 4JFXA 5HTSA 1DQDH 3VFTB 1OTUD 3TJEH 5FUOL 4EUPG 4QF1A 3WIHL 3ZKNC 2L4OA 4OCMC 3HC4H 5DTFA 5HDBF 4PBWD 2UWEB 4G8IA 3MLXH 1RIUH 3BP6A 5CJXA 3RKPA 3G08B 1MWAB 4K23L 3DO7A 2M8XA 3RU8L 4JB9H 5F8QC 5C71A 1Z3GH 2R9HC 1E4KC 3GSOA 5C9JB 4LRIC 4LVNC 4QEGA 1J0KA 1OGTA 1JPGB 3PF2A 1B0WA 4EUPB 1GYAA 2NY1B 1WBXB 4JFXB 1UCBL 3NIDF 4ESKA 1T3FA 3WNPA 4JQIL 3Q3GA 5SV3A 4QF1B 2WIIA 5AG9A 2MQ0A 3C2SA 3GHBL 5DTFB 5ETUA 5DRXA 1E6JL 2DM2A 4G8IB 5ELIA 2FX7L 4HPYH 5EPMA 3BP6B 3QCUH 5JUEH 4C56A 4Z18A 5JXEC 3TIDA 3AS3A 3OKNA 4XI5C 1EJ6A 3J8F7 3DO7B 3SDYH 4LSQL 3GMMA 4L4JA 5BVJA 4URTB 1YNKL 3GSOB 1WIUA 3QUYC 5CBEA 4OFDA 1W0YT 1OGTB 3WXWL 4K8RL 1YQVL 3CMOH 5I75B 2JF1A 4W4OC 1A02N 4L8SC 1CGSL 1T3FB 2A9MH 4LAQH 3Q3GB 2WIIB 5EB9A 1VEPA 4NQCE 5LXGH 5ETUB 3I3BA 2QQNL 5GS0C 5DRXB 1EAPA 1I8LC 3C60A 5EPMB 1OTTC 3C6SA 4C56B 2BCKA 2DI7A 4P46C 3TIDB 3OKNB 1JP5A 3HHRB 1FE8H 3ARBD 1RZKC 3T2QA 2VLKA 3ARTA 3GBLA 4OGXL 4TSAL 2ZCKH 3GMMB 5BVJB 3UPRA 1P7QA 3HMWH 4XVJH 5E4IA 4WV1A 5CBEB 1D5IH 4JRXA 2O26U 1B6UA 1AKJA 2W0FA 3HZMA 3GSNA 3S37X 5DVMA 4Y1AE 2G5BA 2WLZA 4TTDC 5F9AC 4J3XA 1JWUB 4XNZB 2ENYA 1MFAH 2HKHL 3GDBA 3BZFA 1EAPB 3O4OB 3C60B 3HI5L 3SO5A 4JN2A 1BZQK 3C6SB 3AUVA 3ARFD 3MGAA 1QD0A 2BCKB 2DQCL 1T2QL 2IADA 3H3KA 3CNKA 5AAWA 3GGWA 2VLKB 3T3PF 2OXHA 4LK4A 5HYJA 1ZEAL 4PY7A 3V4PL 3UPRB 1N7MH 1P7QB 4BQ9A 4YHOL 4WV1B 3ARPA 3O6FA 5KS9A 2FGWL 1ZOXA 4JRXB 3TC9A 1AKJB 2W0FB 3HZMB 2AEIT 3GSNB 4NUGL 2F8XC 2EE3A 3D9AL 2G5BB 4DK6A 4XCFL 3S88L 5IVOA 4IRZL 1YYLH 5DC0A 2P43B 4XP6H 3WHXA 2VDRL 4LLVA 1IAIH 3BZFB 3HC0B 4AT6A 1KJ3H 1FL5A 4JN2B 4CAGA 5F1OB 3L9RA 4QXTA 1UWEL 3PV6A 2IADB 4EQ2A 2ICWI 5IHUL 3GGWB 3MUJA 1MLBA 5HYJB 4JHZA 4CL7A 4PY7B 4HUXA 3F7QA 2YEZA 2OXGA 3O6FB 5KS9B 4FQIH 5E4EC 1G7PA 4KK6C 1CDJA 5TDOA 5KVDL 5AEAA 4O9HH 3B6SA 4TQEH 3MLPA 4LCUA 5KVMC 1KELH 5GS0L 5IW6A 4KV5F 4OBRA 1GC1H 1D5XA 1D6VH 3WHXB 6FABL 4UTBH 1F4YL 4LLVB 5DMIH 1CF8L 3VDBA 3W9DA 2EZ0D 1YY9D 4AT6B 2IBBA 5HDQH 1FL5B 1RZKL 3KPSE 3L9RB 3VRIA 1KCSL 4QXTB 3PV6B 4M4PA 1KENL 3VFNA 4XPFH 1MLBB 4O4YL 1T21A 2DAVA 1RUML 3CLFH 4HUXB 4LSRH 2YEZB 5CLTA 4X83A 2R29L 1G7PB 3TO4D 3LB6C 5TDOB 1MCCA 1OSPH 3IKCA 4DGIL 3B6SB 4YBHA 1KCRL 4PUBH 5A1AA 4LCUB 5HHPA 5IW6B 1MJUL 4JKPH 4D9QD 1D5XB 3TESA 2R4RL 2DIBA 3W9DB 3QA3A 2MKWA 3QWOA 2JJWA 4P3WA 3BIKA 3VRIB 4PB9L 1E0OB 2FB4H 1CGTA 1CFVL 3I3EA 3DVIA 3N9GH 3HPLA 3O3DA 5DYOA 3RIAF 4DN4H 2OP4H 1YYML 4Y7MA 2E7BA 3U82B 2H32A 1T21B 2V7NA 2A77H 1II4E 4H20H 2F8OA 3IYLW 1NCWH 1WT5A 4WGVB 3IKCB 1U8JA 4IRJC 4BFEA 2J8UE 2AK1H 4GXUN 3NCEB 5BXFA 2IFFL 1H3PL 1OGAD 5HHPB 4BYHA 1LO4L 4KY1H 2DTMH 5K9JL 4F9PA 4ZOAA 1GGBH 5I2IA 2F53E 3QA3B 3QUZD 1KB9K 3QWOB 5FEBA 2C3VA 1JZ7A 2NTSP 3BIKB 1NUFA 1F4WL 5FUZH 3NIGF 5F72S 2F58H 2DQHL 3HPLB 3O3DB 5DYOB 1S7RA 3H8NA 2X1QA 2H32B 2XZAH 3OXRA 5ICZA 2V7NB 2YPLE 5IB4A 1NANI 3FZUC 3L6FA 4AMKH 1AGFA 1U8JB 5BXFB 5HDOA 2EO9A 3MXVH 3QIWC 5I2IB 2FEEI 2GKIA 1MCNA 1WZKA 1DBML 2CLZA 5TQ2L 4GSDL 2C3VB 5CWSA 4RGOL 5DD0H 4C58B 4PJ5D 1S7RB 2QJDA 1KLGA 4QLRA 3TZVC 3C8KA 3OXRB 4QRRD 5ICZB 2WBJC 4Z5RA 1XGRA 3ARED 5IB4B 4B7IA 2EDEA 3BQUC 3L6FB 1AGFB 5LVEA 3HMXL 4HGKC 3UZQA 4H8WC 4UDTA 1XFPA 1CFQA 3NIGE 4EBQL 3HNVL 2CLZB 1AQDA 2VDNL 3ARBA 1A14H 1U8NA 4I0KA 3WJLC 5CWSB 4XBPA 2MCPH 3OB0K 4PJAF 1J0YA 2IPKA 3MV7D 1FAIL 1KLGB 4MD5A 3C8KB 5DC4B 5J6GA 5IWLA 4K2UH 4YGVA 3QEQE 5CZXD 4Z5RB 2OM5A 1XGRB 1E27A 5I30L 4WUKH 4AQOA 1CR9L 3V4VH 3ZYOA 2H45A 5I6XB 4UDTB 4XPBH 1NMBL 2P8MA 4JFDD 1CFQB 2FEEL 3ARVA 3IAQA 5E8NA 3TPUA 3KPNA 4H25A 3S4SG 2C3HA 3EO9L 4QRUA 1UM4H 1JJUA 3ARFA 3IDYC 1AQDB 4FXGA 5DJ8A 3K4DA 5CS7A 3ARBB 1U8NB 3DI2B 2VL4A 1YY8B 2O5ZH 4P3DA 4XBPB 3BW9A 4PJXF 4XP1H 2IPKB 4X4MA 3SKJH 1AFVL 1GGUA 1FNFA 4MD5B 1XGYL 1W72L 5J6GB 3ARUA 3O9WD 3F58L 3EJYC 2IMNA 1E27B 1TCRA 4WFHD 1VEOA 3CLEH 4WEBH 2I60H 3C2AL 4P23D 3CPLA 3UDWA 3U2SA 3HAEH 1QZ1A 4MNHA 4HLZG 2P8MB 1ULVA 4I3RL 5E8NB 3TPUB 4OBSA 2ZCHH 3KPNB 1F4XL 1NKOA 3HR5A 4H25B 4MVBD 2NXYC 4GQ9L 4DKFH 1BX2A 4QRUB 4OGAD 3ARFB 4FXGB 5DJ8B 2RCSH 3OV6A 5AG8A 3R0MA 4KXZH 3VMNA 4Q9RL 4P3DB 1PEZA 3CVIH 3BW9B 3PDDA 3D25A 3UPAA 5IMKA 5K59F 1LILA 4BFIA 5GRWA 5FYJU 1ZLUH 5F96L 1X5ZA 4HCRH 3M07A 3UYOD 5HGBA 1TCRB 3NCYP 1ZK9A 4H8WL 5F3BA 3HZYA 4ZO9A 2DMKA 1L6ZA 3CPLB 3U2SB 2QSTA 4S1DD 4MNHB 4M6NH 4XPHH 3PQYE 3IFNL 1MCEA 2YD8A 3HR5B 4U1SA 1BECA 2OSLA 4C55A 4Y88A 4PJXE 1BX2B 4GFTB 4LCWB 4X9GA 4F58H 1AY1L 3FN9A 3MV9D 4OLUH 3BN3B 4HJ0C 5H94A 4F33A 4ODHL 3ILQD 4XXCA 2ZPKH 2UZXB 3D25B 4F8QA 3IDIA 3ROOA 4OM0H 5IMKB 2NY0C 3BIBX 4BFIB 1NMAH 3TO4A 3V95A 2JJVA 2DQUL 5HGBB 3MRRA 4OLVH 1LK3H 5F3BB 2VWEE 3BP7A 3WIFA 3HZYB 1CDHA 3P4OA 1INDH 4IHOA 5TFSH 5JMRA 1RJLA 2VDLH 5T3XE 2FBOJ 1DBBL 5JW5A 3S96A 3NOIA 3QUML 2IAND 4U1SB 3RY4A 2JELL 2OSLB 4WHTA 3WDHA 2B0SH 1F6LL 1I4FA 4I77H 5K59E 1G0DA 1R6VA 4GAFB 3MACH 5E8DL 4L3CA 1MCKA 3MRMA 5H94B 2E9IA 4F33B 2AJXH 4K3JL 4MB5A 2Z8SA 1U2HA 4R26H 3IDIB 3ROOB 5CUSL 4ZFOL 4WI4A 2UWEF 4UB0L 3TO4B 1FNGA 2HTLC 1JZ8A 1MF2L 1RQ5A 3MRRB 1XIWD 1I9IH 3BP7B 3WIFB 4LGRB 1MCWW 3P4OB 1OGAA 1XF1A 4IHOB 1RJLB 4YBQD 2X1PA 4ZQKA 4U1GC 2W59A 1DJSA 3S96B 3WHE1 5BW7C 3QUZA 5E9DA 1ZLSH 3DIFA 4WHTB 4N8VA 3OPZH 2AW2A 1JGDA 1Q72L 1I4FB 3DPBA 1F4AA 4I3SL 4TRPH 3V8CA 2R0LH 2AI0L 5C8JA 4L3CB 5AZEL 2D7NA 1BJ1H 3MRMB 3HE7D 3BWAA 2Z9TA 1T7VA 3ISWA 5IGXH 3K81A 4M3JA 2D7MA 3T0EE 1FNGB 1L9MA 1QR4A 5DJCA 1J0HA 1KT2A 2DS4A 3MBXH 1OGAB 4PJ8D 4YHKH 4BZ2L 4MGXA 5KSBA 2QTEA 1JNJA 2KDGA 2AVGA 3NACH 4ZQKB 2BRRH 2BRQA 4NHCH 4K7PL 3QUZB 5E9DB 3DIFB 4J1UA 4X6DF 3QUKA 3ULUL 1CGYA 2UWEE 5C8JB 3SGJA 4PJ5A 5JZ7D 3LZFL 5M7QA 3BWAB 3CXDL 5EN2A 3B4NA 4MNGE 3TPKA 5ITFA 3QO0A 4QRRA 3C5ZC 5CGYD 2BHZA 3AREA 3G04A 4J8RA 2NY4D 1MPAL 1Y6KR 3RVUC 5DJCB 2N4IA 2Q86A 2NY6D 1KT2B 2Y5EA 5DUPH 1BZ7A 4NP4L 1KB5A 5KSBB 2E27L 3B2UC 4ERSH 1DDHA 1BOYA 4J1UB 3QUKB 1M7XA 2Q20A 4KTEL 4RNRA 4FMFA 3SBWC 2HVKA 3BAEL 2Q7NA 4PJ5B 1A9EA 4S1SL 3MV7A 3GK8H 5EN2B 5J89A 5ITFB 1JZ2A 3QO0B 1QBAA 3EYSL 4QRRB 2O61A 3AREB 3G04B 4J8RB 2X4QA 3S35H 5T3XH 4R4FL 1XGQB 5HHOD 4HFWA 4L9LC 4LKCA 2Q86B 2Y5TA 4EZMA 2DQEL 1INEH 2OL3H 2R2HA 4JFDA 1BZ7B 1KB5B 2X4RA 1M71A 1DDHB 5I16A 2B1AL 2E9WA 4KVNL 1QSFD 3O6LL 5DVOA 3UTQA 4RNRB 2H2PD 2HVKB 4Q6IA 1A9EB 3QI9D 2XPGA 2C26A 1NFIA 5TE6H 5IHZA 2O61B 2FDBP 4WTWA 3O9WA 2O5YH 1KTLA 2X4QB 5CAYB 1T83A 2WP3O 3VWKD 4DKEH 5DI8A 4HFWB 5L88L 4LKCB 4P23A 3ZKXB 2Y5TB 4NC0B 3NCJL 4N90D 3FHQA 5JR1L 2R2HB 3ARXA 1HIML 4JFDB 1ADQA 1X9QA 2X4RB 5KANG 1M71B 5KSAC 2DM4A 3SDCD 2G5RA 3E8UH 5I16B 5F1KC 3QAZC 1GL4B 5KS9F 4FS0A 3INUL 2XKSA 4DFHA 3RX8A 3UTQB 4L1DA 4Q6IB 2XPGB 1X3DA 5IVXA 4BK5A 1NFIB 5C0NC 5IHZB 5K9KA 3WUZA 3O9WB 3BPNB 1KTLB 2AEPH 2MCG1 3ARYA 4BKLA 3V6FA 3U83A 1PKQE 5DI8B 4NZTL 1I9JL 4P23B 4CVXA 4XNYL 4WI9A 4Y5XC 4JGMA 1J1XL 5F21B 5TF0A 7FABL 5GSVA 1ED3A 4ZTPL 3WLWC 2BSRA 5A2JH 2J2ZA 2B39A 2P47B 1HHGA 2QHRL 5KAQG 5CCKH 1UT9A 1HHJA 3EOBA 2Q8BL 2OX5A 1MRCH 5F9JA 3MV9A 5ESVA 1MWAH 4UV7L 4S2SA 4RGNC 3A6BH 4O00A 5GGSA 1D5BA 2EEBA 5FYKE 4Z0BH 2P4AB 4L1HA 5JXAH 3W82A 5IVXB 2E5EA 2Y23A 1UA6L 5I1GH 4EUPH 1LDPH 4AZ8A 4BKLB 2D4FA 3V6FB 2EXWC 4CVXB 2F5AL 4MA3A 2MQCA 4TYUA 1AD0A 1OLZA 3H42L 2YMXL 4JM2C 1FGNL 1ED3B 3FN3A 3PGFL 2BSRB 4XBEL 5GSVB 5E2VH 2IANA 1HHGB 1MHPL 5E2WL 2BY3A 3EYQD 4JO1H 1HHJB 4KMQA 3EOBB 3FKUS 4HZLA 2OR8A 5F9JB 12E8H 1P5UA 3MV9B 4BQBA 3IDGB 5GRUL 3MR9A 5ESVB 4S2SB 5GGSB 1D5BB 2ERJB 3RIFF 4LCCA 1DBKH 2W60A 4R90H 3TBVA 4WIQA 1U91A 2B7DT 3HTLX 4OGYL 1T89C 2MFNA 4KKCC 1XIWA 5CJQH 5B3JE 5GRVL 5FCSH 4KJQC 4MA3B 1FL3A 3F6LA 1ETZA 1KACB 1AD0B 2EDFA 1AQKL 1ZKAA 2CPCA 4U6TA 4WHCA 3KAAA 2IANB 2JTDA 5I1HH 4HX1A 4JFZH 1TTFA 2Q7YA 4HZLB 1A7BA 3MR9B 3QIBC 3HE7A 1BFOA 3EOTH 1FP5A 2C3WA 2ILLA 4GOSA 4E41A 4LCCB 1IEHA 4TUJA 1AI1H 2W60B 3TBVB 5MERA 1U91B 2FIRT 4OZFA 3O2WL 4MXQC 3TV3H 4I18C 1XIWB 1BFVH 4PJ8A 1FL3B 2AEQL 1ETZB 1IBGL 1U8MA 3I2CH 1CI5A 1HYRC 3QEGH 4HX1B 2R4SH 3HI6L 4YHLH 1NBVL 4WI2A 5IB5A 3TFKC 2Q7YB 4R9HA 1RZJC 4L8CA 4RBPK 3HE7B 1BFOB 3T0BA 2CKBA 5HHXH 4E41B 1NCBH 4XRCA 4JRYD 3K2UH 4FQPA 4TUJB 5MERB 3C9NA 4IS6A 4OZFB 4MJ2A 3GHEH 3DJ9A 1UZ8A 5C7XL 2AV1B 3GSNH 2HP4A 3VD4A 4XHQA 1IC5L 1BAFL 4PJ8B 2BVPA 5D2NA 1SEBA 4GLRI 4I5BA 3SCMD 5EO0A 2MPAL 4OKDA 3CFEA 4ALAH 3QQ9C 2DOCA 1U8MB 2WSKA 4R96A 5FIEA 1WIOA 4HWBA 5IB5B 1MEXH 5EWIL 4OCRL 3CVHA 5I1IH 4L8CB 4P9HC 2CKBB 4GMSH 3IFLL 4XRCB 3WE6A 2DKMA 2OCFD 3C9NB 1A0QL 4G9FE 4IS6B 2NY4B 5HHOA 1T66D 1UZ8B 2X1WL 2YZ1A 3L7EA 3MLVH 2Y25A 5EA0H 2NY6B 4NCC1 4YDLC 3TNNA 2BVPB 4OLYH 5D2NB 5IFHL 1SEBB 3QUXD 4I5BB 4J3UA 5EO0B 1G9MH 1OAKH 3CFEB 2DLFL 2VZVA 2LTQC 1F42A 3PJSA 4R96B 8FABA 4GKOA 1CLOH 4N9GA 1QSFA 1JZ3A 5D7JD 3CVHB 3RWIA 2KKQA 1DFBL 3LY6A 4D94A 3QI9A 3BUYA 3PWJA 2NPLX 3WE6B 4L4VE 1ZTXH 2V5MA 3VWKA 5LGHH 1NC4D 5HHOB 1LWRA 3L7EB 5I8EA 5C9KA 1I75A 3TNNB 1EEUA 1R24A 4U6XB 3SDCA 3PJSB 3VG0L 4L29A 1F3DJ 2ICEA 8FABB 4XCEA 1RZJL 2MNUA 4N9GB 3LS4L 1QSFB 3FAXA 2AQ1A 5ANMA 2HTKD 4J4PC 4YC2B 3RWIB 1IKNC 2NZ9C 4R97B 4MB3A 3QI9B 3ARRA 3VFSA 3BT2L 3U0TA 1H5BC 2VUYA 3BUYB 3PWJB 4LPYA 2MMXA 4RFEA 2EDKA 4KTYA 4AEHH 2OK0H 2HT2D 3VWKB 3HNSL 1DSFL 4NNPH 5IB1A 3VWJD 5HI5D 4GKNA 5I8EB 4AENA 1CICC 4R4NC 3W81A 5L2KE 4B0MM 1R24B 2VLME 3LQAH 1D9KC 1Q9LA 1QSED 3IJYB 3SDCB 1PX4A 2VN7A 4L29B 2ICEB 4ZO8A 4XCEB 4PREA 4P9HL 5FK9A 5ANMB 2EDRA 5HGAA 5ALCH 3B83A 1FNSL 3ZLQC 3VFSB 2H32H 3CX5J 1KGCD 4YZFF 3U0TB 3LH2H 3OJVC 4M1CD 5DLML 1HINL 4HXBL 4FZEL 4RFEB 2WWKO 1OAYH 3BO8B 5IB1B 3AS1A 5EZOL 4FQJH 3MLTA 4TSBH 4GKNB 5GZOC 5T5FL 2QSQA 2P8PA 3U9PL 4AENB 3QSKB 4HT1L 4UT7L 1Q9LB 1H8NA 1C5BL 2FL5A 4F80A 5ITBH 1MJ7H 4RRPA 4Z7QF 5AWNL 1DCLA 3NABH 3OJMB 1MCPH 4PREB 4FHBD 4NPYA 2BDNH 5FK9B 4JPKH 1YECH 1UM6L 5HI3C 1RULL 3DUUA 4Y2OA 4LCWE 4WUUD 3GMNA 5MEND 3MBED 3U30C 1R3JA 1F6FB 1RI8A 2XXMB 2J7LA 4LEOA 3GJFK 2XRAL 4LQFH 1KCVL 4JM4L 3SE3C 1CXLA 4JKWA 3MLTB 3ZZ1A 2P8PB 4ZS7H 2WLYA 4TNVK 3NAAH 3BGMA 2R23A 2FL5B 4QXUH 2E6JA 1GPOL 2EE9A 1KJMA 4FFYL 4NPYB 1CZ8L 4PJFA 1NGPL 2H2SC 3DUUB 4PD4J 3THML 5C2UB 4M1GH 2ZG1A 2C9AA 5I1DA 2Z8RA 4XCCL 1YEFH 3GMNB 1MCBA 1ZHNA 1BP3B 1ZVYA 1R3JB 4EDWL 4YX2H 3RFZC 4UQ2A 1I3RA 3VFPA 4QRQA 4LEOB 2ZOKA 3WFEH 4HKZA 2DYPD 2VERN 1TTGA 1OP5H 4F3FA 2Y36L 3DYMA 4PV8A 5CEZD 1NEZA 3TM6A 1P1ZA 4JY4A 5GGRA 3BGMB 2R23B 4XAWH 5FO7A 1NEZG 5INDA 1CDUA 1KJMB 1JL8A 4RA0C 1EMTH 4PJFB 1HXMA 4LF3A 3KJ4C 4IBLT 4JRYA 5I1DB 5KSBF 1ZHNB 2YWZA 2KQMA 3TJHD 4UQ2B 1F90H 1I3RB 3VFPB 4QRQB 5I1JL 3DX8A 2ZOKB 4GMTH 3S36H 2MQ3A 1CQYA 4DVRL 1UENA 4F3FB 2HH0L 3HI1A 4PV8B 1NEZB 1FNEA 1P1ZB 1N64H 2W9DH 4JY4B 2GK0A 5GGRB 3L3GB 2UYLA 5KG9A 5FO7B 1OGAE 5INDB 4JO2H 1NGQH 3WS3A 1ZHLA 3ZDZF 2VDKL 3MLUH 3BKJL 2HWZL 4YBLB 5BVPH 4NQSA 4UI2A 5E9DE 3NCMA 4LP5A 1HXMB 4LF3B 5B22A 3RVWD 4Y8DC 4JRYB 2HMID 3RVVC 5D93C 5GGUA 1MJ8L 2XXCB 3MRLA 2OR9L 4CVUA 5DD3H 3DRTA 3DX8B 4HLZH 1J10A 1ZT7B 4JO4L 3HI1B 1NCNA 3QUXA 2QEJA 5L0QC 4C83A 3PL6C 1FNEB 1FAKT 2XYCA 2GK0B 3OG6B 1SY6A 3CSBA 3MRHA 4UILH 1BWMA 5KG9B 3MREA 3Q6GH 1JE6A 1Q1JH 5FGRA 3WS3B 3OHXA 4U1KA 1ZHLB 1MELA 3OKDA 5D7JA 5D1ZC 5D72L 4X9BA 2D7QA 5GRXG 4NQSB 1IARB 5F6HJ 5GGUB 4Z7WA 3RL1A 3MRLB 4LHUD 2X05A 1NC4A 4HK3J 2OTUA 3DRTB 3PWLA 3K46A 3NZHL 3M45A 5HHQA 4QRRE 1I1AC 4FQXC 5HVGB 1S7WA 4K8RD 3QUXB 4C83B 2JJSC 1WC7A 3B5GA 4M6MH 1JWSA 2VR5A 3MRHB 3RBGA 5I74C 4KJWD 4QXGH 3MREB 3KDMA 2VH5L 4ZMAT 1A6PA 3OHXB 4U1KB 4KVCH 3OKDB 1FPTL 5D7JB 3TCLA 1NFDA 3P9WB 1UWGH 4HS3A 1IGCH 1MVFA 2Q8AL 4X7SL 4YHML 1AR1C 4U3HA 4UAOB 1MHEA 1HN1A 4Z7WB 3RL1B 3D69A 2W92A 1NC4B 2OTUB 2D4DA 3PWLB 1I85C 1ZHBA 1KCLA 3VWJA 5KBNC 3ARGC 3UAJC 1G1YA 2BJMH 5BV7C 4X4ZA 4ZXBD 2PO6D 3ARDC 1S7WB 1WC7B 4LLMA 1JWSB 4LLYA 5HSFA 5IVXF 3MRDA 5B39A 5DD6A 1IC7L 3KDMB 4JFDE 4OLXH 1KCSH 1KLFA 3TCLB 1NFDB 1C7SA 4WFFE 5D7IA 2ATKA 4CU6A 4HS3B 4PRHD 1UWXH 5B39G 1NMCC 3PDOA 5KAQF 3ESUF 1MHEB 3ZDYE 4G7VL 2VXSH 5FYLL 1A21A 3X3GH 3BKML 5JOFA 4UINL 2DWEA 4QRTA 2AJUL 3D69B 2BNQE 2GK2A 1IGIL 1ZHBB 1V5JA 4LLUA 4V1DE 3VWJB 4BZYA 3KR3H 3NPSB 4WW1A 3MCLL 1XAUA 4LLYB 3ESVF 3EO1A 3VGHA 3MRDB 4KK8C 5B39B 5DD6B 1RURH 2ITCA 1T7XA 3GEWB 1G1CA 4LRNL 3IFOA 3ZKSD 3O3UN 5D7IB 2ATKB 2P45B 4YDIL 3PDOB 4WUUA 4YXHL 3LIZL 4OSUL 5MENA 2JB5L 3BPLB 3MBEA 3OAZH 1Z5LA 5JOFB 2DWEB 1NQBA 4QRTB 1QFWL 3NIFE 5C07D 4LLUB 3NN8A 1MCJA 4CMHC 4WW1B 1EJOH 4YFEA 3OKYA 4K71C 1JGVH 4PV9A 3EO1B 4XP5L 1NKRA 5C0BD 1OOAA 3RI5K 5IQ7H 2ITCB 2DTSA 4KHXL 3UBXA 1N0XL 3IFOB 3C09B 3V6OA 3QXWA 2FBJH 4WUUB 3QNYA 2WQ8A 5MENB 1W0VA 1FO0A 3MBEB 3UBXG 5EOCJ 1NLBH 1Z5LB 3MV9E 5DDHA 1CFTA 4KTDL 5FO8A