1Q9LB

S25-2 fab unliganded 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) heavy chain
total genus 42
structure length 222
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB01
3MYJA 4PPTA 5TF1H 4C4KT 1VGKB 4MJ6B 1U42A 4XMPL 5DJ2B 2I26N 2VZTA 4LMQI 3MROB 3BWUC 3IDIA 4HGKC 3QXDB 3ZT7A 4ZUTA 5C0AD 4YC2C 4FTVA 1MCWM 5IWLC 3ULUF 5I8EB 1T2QH 1T22B 4JY4A 5A2JH 1HK6A 2WBWB 1SYVB 4OKVA 5D1XA 1AGDA 1DFBL 4L8SA 4E42A 3QAZC 5EUOB 4M6OH 4Y16C 5EBGA 3L3IB 3QUZA 4OD1L 5F7EL 4YHLL 4XWOD 2XWJA 5I75C 4L9LA 4P46A 1VFBA 5K9JH 4AT6B 2NY0C 3GGWA 1NFDF 2EEDA 3V6OE 3HRZA 1YEJL 3BPLC 4NKQB 3AUVA 2E5EA 3FJTA 4KZDL 2EDTA 3MJ8B 3VGHA 5MHSE 1I85C 3QDJA 3SO3B 3O3AA 5F8QC 3BRGC 3BSZL 1JZ4A 4ZO9A 1XZ0B 1PW3A 2ATPA 5MEOB 1IC7L 4DOHE 3MUGA 4BSWB 4G5ZL 2B0SL 4LQ1A 5FYKD 1IEAA 3DX6A 3OQ3B 5KTEL 1T83C 1XF4A 4PGCB 5HI3C 1UFUA 1P4IH 1XGQA 2LU4A 35C8H 2RIKA 4ZUUA 3B5GA 2BHYA 3E1F1 4U6XA 5DI8B 5J8OA 4K3DH 1NMBL 4JM4H 1KENL 4ZPTA 1MCNA 5C92A 3DMMC 4KK6D 4NJ9H 1CDJA 3UXFA 2H2SD 1DDHA 3LSOA 1GGYA 2EECA 4OZ4A 1YC7A 4PJBE 3TWCH 4OKVB 5D1XB 4N9GB 3U7WH 5DGQA 2Z93A 5E00A 5D7JC 4LVEA 4Y1AB 2WQ8A 1WVZA 2KQMA 3LN4B 1CU4L 3U4BH 1LQSR 1FO0A 4CU7A 5BV7L 3PWUB 4HGWA 1N6QL 5INCA 4XI5D 5C0AB 2A9MH 3V0VB 3FN9A 2WANA 1Q0YL 4V2CB 4LLVA 3VXUB 1BLNB 1FSKB 3NAAL 5HVHC 3OPZH 3Q6GH 3H3KA 5BRZE 4P3CL 3HCVA 5BXFA 5DMJB 3QPXH 3WKML 1I7RA 2EDJA 3LKPB 3O2VL 4AM0A 5EU5A 3ZYZA 3O2DH 3B2UC 1QOKA 1IEAB 1Q9OA 3JUZA 1BMGA 1NCCL 2P44B 4NO2A 9CGTA 5JZ7D 1J0HA 3VD4A 5F9JA 1YY9C 5AWNH 3HI6L 5TE6H 2ICWI 1SMOA 2VXQH 2AJZB 3H42H 4K7FB 1WF5A 1CD1B 3BP7B 1RUQH 2W9DL 3VD3A 2IH1B 5ALCH 1MAML 1Y18B 3GSWA 5GGTH 2FD6H 1GGBL 3VGFA 5DJ0B 5D7JB 1JE6A 5IVXA 4QHNB 2WUBH 2QQQA 1AD9B 4KJPD 3QO0B 1NMBH 3DV6B 4TSBH 4D0BA 1AGBA 1QSFD 1DEEB 3GSRA 3HPJA 3MA9L 4NQEE 4NQDD 1NGXB 1N0LA 4PRAA 4PV8B 1IGFH 3BJLA 3NAAH 5HHOD 1CZ8L 1KELH 3P9WB 3QUZB 2WIMA 4LLWA 4D94A 3O11A 5DJDA 5JIKA 4F8QA 4HAFA 2XWTA 3LRHA 4MDIB 2X1PA 1EFXD 5GZOC 4KXZI 5F1NA 2X05A 2DD8H 3EO1A 4CVZA 3U4EB 4UT7H 4PG2A 3V5HA 4YPJA 2X9YA 4NHCL 4AH2A 5D5MF 3RDTD 4X4MA 2FEDC 3V4UL 1RZFH 4PRDA 2Z8VC 4A6YA 5AAWA 3GSNB 1WUNT 1GCFA 5CSBA 1P7QD 4CNIB 2PTUA 5J89A 4UAOC 1F4YH 4F7CB 4G8GE 4JFED 1BZ7A 5I1AB 4BSWA 4FOMA 4GSDH 1L4IA 3KHQA 4U1KA 4FRWA 4ORGA 4YE4H 3OJ2C 4GG6F 4PRPA 2FSEA 4EN3D 1JFQH 4MS8D 4ZG1A 4AZ8A 1H15A 3B9KD 2B1AL 2R0ZH 3A6OA 1NPUA 1FL5A 3FN0L 3QRGH 4X4ME 1BF8A 5BVJB 1A7OL 1SY6A 5IBTL 4LLQA 3DV6A 1VGEL 1EDQA 2R1YA 3OGCB 1T66C 5KVMC 1D5XA 3Q5TA 4YDIH 2PYEE 1NBZA 3TT1H 5EZJB 2RAMA 4BUGA 2AK4A 3BIAX 2HLFC 5FCUH 5INDB 2NX5A 4DK6A 3UTPD 4RMSA 4QRTB 1A1NB 5FYKE 5E2WL 3ZTNH 1MIEL 3PWPE 4NWTH 3BDYH 3WIIH 1DQQA 4N8CL 3S97C 3KPOA 4HC1L 2DQUL 1BZ7B 5I1AA 4GRWE 1NCDL 4OZFG 3MNZB 1R3JB 1R5IA 2XN9B 43C9B 4ELMB 5F1KC 5GSRA 3QNXA 3N1QC 1EEQA 2I9LB 1B3JA 5D70L 3V4PH 3OBAA 3PWPA 3MV8E 4P2RE 1KGCD 4ELKB 4S11A 3MLWH 3V6OC 25C8H 3TBWB 5T3ZE 4XCEB 4OCMC 1S5IH 2H3NA 4PV8A 1XCQB 4M6AA 3G9AB 3BD4A 4NWTL 3FRPG 5GS0C 1EUUA 3QDGA 2Q20A 3KPSA 4APQA 4HXBL 3SN6N 5MI0B 1FYTD 1A6UL 4KV5F 2EDOA 1ZHNA 2E7HA 2O61A 1IAKB 3MRQA 4O2FA 4PLJD 1OGAB 4WUUE 4POZD 4WHTA 3CSGA 3BYTA 5GISH 2R0WL 1K8DB 5DD0H 4LAQH 5F7FA 4ZS7L 3GMMA 4JG1H 4OZFB 2VNCA 4F7CA 5L0QC 1L7IL 4ODTL 4OZHA 3BAEH 1HOCB 2VXSL 4X80L 2EDKA 5HI4C 1OQOA 4LQFH 4S10A 4LMQE 2AXHA 4Q9QL 1X5LA 4NRXA 2ZSVA 3GFUA 4MX7B 5CEYB 3E2HB 1AQKH 3TJEL 3IDXL 3FQUA 5J4MA 4G9FD 4GRWB 4HFWB 5F3HB 1GGIH 2X2YA 2P5EE 4XNYH 1OD9A 2EIBA 3HAEG 3R8QA 3CVHA 1KIRA 2HVJA 3LHPH 4MSWA 3RY6A 4FFYL 5JHLL 1B0GA 4NT6B 3EGSA 4NQEB 4X6EA 3BRDA 2NLJA 2XG4A 3W11C 3PXJA 4X5XA 2WBJB 3U4AA 2OMBA 4PD4J 5IROA 1M4KA 1B6UA 4LARH 1YMMD 3KLAB 4TNWK 4N9OB 1HZHL 1KN2L 3MRMB 1IM3A 3ILQC 2WZPD 1F90L 2CDGA 4U7MA 1K85A 3RWIA 1JHKH 4UINL 1DVFC 1EH9A 1T03L 3QEQD 4OFVA 3HMXH 4GBXC 1KG0B 4DZ8B 3WSQH 3RAJL 3LZFL 3T09A 1HOCA 4KKAC 3KPTA 3QNXB 7FABL 2B1AH 3PWJA 2H26A 1GGIL 2DWDA 4Q97A 5FUOH 3STZB 1MCKA 5K93A 1WTGT 4YBHA 4AT6A 1NCAH 4ALAH 3GK8H 1S9WB 3X11A 3IETA 3RBGA 3BUYB 3CDCA 4G6FB 4XXDB 1LE9B 2EO1A 2YN5A 2CUIA 2XQYK 3QZWG 1A7QL 4LRNL 1LNUA 5JO5A 1ZA3A 1QHOA 3UTSB 3WV0A 1NCWH 5FM5M 5HY9B 1A14H 3L5WA 4U1HB 4E41B 4MAUL 5CKAA 4NKDA 1M7IB 4GAYA 1IAOB 5I1LA 2JTDA 4IS6B 1YMHA 1P4BL 3LN9A 3MR9B 4PJAB 5KSUA 5FK9B 3QQ4A 3WKMH 1JK8B 5ESQB 1RZIB 3B9AA 3DRQA 1JL8A 4HIXL 3EO0B 4J3XA 4YBLC 1C8PA 3O8XA 2XTJD 2RJMA 2BVOB 3D69B 4M8VA 2NY4C 2GI7A 3T77A 2E3VA 2HA1A 4NM8H 5B8CA 2JJTA 4YXKL 2BFVL 4H88L 3MUGB 2Q6WA 2NY3D 1ZT4B 5GGVY 4OUOA 5J1AA 5DK0B 3PGCB 3VI3E 2F8OA 2VDQL 5D6CB 4NO5B 3QIBA 4KTDH 3LEYL 1V7MH 5KVDH 3DETD 1NC2D 3NH7H 4Y4KB 4WTWA 3BO8A 5A2LH 4ENEC 3HR6A 1QKZL 5DJXA 3LN4A 2F5AL 5FDWB 3S96A 5I1GL 3DROA 4NJ9L 3TBVB 4XVJH 1KFAH 4OV5A 1FN4B 4FNLH 3DRTB 4G3YL 2G5RA 3QUMH 2VABB 3MRKB 4KH2A 4H20H 5C0BA 4MA8L 4IRSC 4XPBL 2PNDA 3EJZD 4Y2DA 3RX8A 1DEDA 2MOVA 1Q9WA 3MR9A 3CZJA 1MH5B 3C5SA 5HHNA 2MJWA 3KPPA 3BHBB 3RPIB 4WI2A 4CRPA 1GZPB 3MRNA 4I77H 3TNNB 2QLVB 4WO4D 3MJ9A 2YN3A 2EO9A 1AFVL 1PY4A 4LCIL 1AO7D 2QSQA 1GSMA 3FQNA 4YK4B 2A0LD 5B38A 1EHXA 4HMEA 2G9HB 1YDPB 3TN0A 1N5AB 5JHDA 4CL7A 1IGML 2CKBA 5ERWA 3CJJA 2R39A 2E6PA 2FR4B 4XPAH 2KKQA 5I74C 2EXYD 3AROA 3MZGB 3UZEA 4APQC 4BKLA 5FEBA 1A9BA 2EH7H 3C6LB 5I19L 2VDNH 2ZOKA 4NCC1 4HKBA 2P24B 4KUZH 4R2GD 3QSKB 3RWIB 4X7FC 4JHAH 4ZUUB 1RJYA 3MO1A 5B3JE 1CT8A 2AJ3B 4PRBB 3LEXA 1IGYB 2OSLA 1YZZA 1KJ2L 1T1ZA 5DS8A 3FT3B 4YHIA 1KCRH 5F3BB 5C0GB 5T1DH 4Q58C 4HIHB 5L2JA 2YZ8A 4HUWB 4YDIL 2J6EA 4UT9H 1EAJA 1BWMA 2FWOA 4Y1AD 3G6DL 1LWRA 4UQ3A 2V2TB 3ARPA 1ZTXH 1LO4H 3TO4D 1IFHL 1NKRA 3L5WB 4E41A 1N5AA 3H9SA 3LKNA 2VDLH 4FQJL 1BQHB 4KPHL 1MCRA 3HAEH 3CFKB 2J8HA 1A0QL 5FHBH 1NMCC 4K3EH 4M43H 1TTFA 3WNPA 2PO6C 2D7OA 4W6XB 3OAYK 5BZWB 1FZKB 3QEUB 1MWAL 2FX9L 1S7XB 3BOVA 3FZUD 1JHKL 5E8EB 2D0HA 2XWBA 2NY6D 1FYTA 5CCKL 3DARA 5DK0A 4YHYC 2WQRA 2ADFL 5C0GA 5HGHB 1DN2A 5JORA 3QIBB 3KJ6H 5KW9L 3U6RA 1HIMH 1UZ6F 4GS7C 5HYQA 1ZGLB 1KB9J 3VFOB 2PR4L 3B4NA 4LLAA 4OD3H 5A2IH 1FFPB 5HHPB 1II4E 3BPOC 5FK9A 1G9MH 1GZQB 4YDJB 2J7LA 3P0YL 3SGEI 3MCLH 2QBWA 3LIZL 3S35X 1BM3L 4LGPB 5BVPL 1BM3H 3ARBC 3BKML 1QSEE 2Q8AH 3O3EA 2AJXH 1YEFL 1DQDH 3K0WA 2VZ3A 4QHKJ 1Y6NR 4YGVA 3G6DH 3G6JA 1D9KB 1NC4B 2EEBA 1F6AB 1WFUA 3IFNL 2J6EL 5DD3L 3WHE0 2XACC 1YPZA 3AY4C 3ROOA 2AKRA 1IEHA 5IHBA 4Y19D 1C7SA 4KZEH 3K7UA 1P7QB 5GSRB 2XN9A 4ELMA 2IAMC 2DQFB 4EOWH 1N3NB 35C8L 4JDTH 2WNGA 1KB5B 2PYEA 3ESVF 1FAKT 4HC1H 8FABB 1QRKA 3QR2A 3PWPB 3GSXA 3OKOA 4JRYD 3UYRL 2P5EB 1W72A 2VLKA 3DROB 1HWGB 4MA3A 2RHEA 1QBLH 4Z7QE 4I0PC 1ZE3C 1V7ML 5DEFB 4L3AA 3DHJA 3QBTB 1I1YA 1PEZA 4W70A 3CDGA 1ZKAA 3ZSTA 1EGJA 3R06B 1IGJB 2Q3AA 1MIMH 2XN9E 3L9RA 1A64A 4ELME 3RU8H 4P5TB 3GMPB 4RA0C 2JKXA 3LEVH 4MJ4A 1BFOB 3VXQB 2HLAA 5D2NA 4OF8A 2IG2H 1F42A 4LLWB 4F2MB 1S5IL 3CSPA 5FDYA 1KXVC 2DQCL 1V3LA 5FOBA 1CG9B 1A7PH 1V8HA 5DRNB 4U0QB 2IAMB 4DQOL 2D31A 2EE6A 1MCWW 4M1DL 5SV4A 3O6FB 2R9HC 2VDML 5C0IB 1CFTA 2QSCH 5CINH 4M4PA 5TF1L 2WINA 3VFWB 1Z3GL 1JPSH 1L9MA 4C59B 1D6VH 3B9VA 1VKXB 4HH9A 4KKLC 5ESVB 4JM2F 2A73A 4ISVA 2W07A 2ZJSH 4NQXB 4RRPG 1AI1H 1Z9SA 4N0YL 1I85A 4IOFC 1MCQA 3QXWA 1SYVA 2ADFH 1T21B 3PQYE 5TFSL 1NL0L 5E8OB 3F7QA 5F9AC 4JHAL 4NRXB 5AZEH 3LRSB 4LBEB 4EQ2A 2YA2A 4X6CA 4UB0H 5BMFL 2PXYD 1C5BH 1JI2A 5E8NB 3U36B 5J11B 2FJGA 3Q5OA 2EDNA 1CICA 4QY8B 1JHLL 5TE7H 5EN2B 3GNMH 3UO1H 3IXTA 4M8QA 5EBLB 4U1IB 2V9QA 1CL7L 2W0PA 2X5PA 2ORBH 4EVNB 3U9PH 2VRAA 1ORQA 1RIVL 4QXUH 2XPGB 1D6VL 3EO1B 4CVZB 4BELD 5FECB 5C0JA 1LO4L 1HHGA 1IM9A 4G7VH 3IB4A 1NEZB 4BQ6A 1MHCA 1DLFL 4I4WB 4OCRL 1ONQA 2BC4A 1KPUB 2HT4D 1CQKA 4WWID 4LSTH 2FB4H 3PHSA 4R2GB 4JQIL 1FC2D 1RY7B 2MCPH 5T3ZL 4WW2C 1WCQA 3P30L 1FQ9C 1H8SA 3D1MC 2A74A 2VDKL 1T1ZB 3IDYB 4ZFZB 3OAUH 4XXDA 3UMTA 3OL2A 4PJXA 4QY8A 1H3XA 1XCTA 2AXFA 2Z31C 4LLVB 3VXUA 3OF6D 1XR9B 3W5MA 2W91A 3VXOA 1N6QH 3IDMB 3AVEA 2DWDB 1RZKH 1YYLL 2P5WA 1RZKL 1YYLH 5EBWA 4Y19B 1N8ZA 1YA5A 4OZIE 4G9FE 1DSFL 3DYOA 5AG9A 3LQMA 1ZSDA 3IFLH 5I71B 4CAGA 1I8IA 5F1IA 2BX5A 1FGVL 1KEGL 3ARDD 1GAFL 1QR4A 2VDMH 3CZFA 3QEGH 5EU6D 1WISA 3MRBA 4JM2A 4FG6C 1A6UH 1G0DA 3QG7L 4LASH 4HK3J 4JQIH 2A6DB 3UJIH 1QFWM 4Y4FB 1EJ6A 2V5MA 4L4VA 4KMTL 5HGGS 2AJUL 3HZYB 4MQ7B 2CRZA 1YN6B 4TPRH 3SKUD 2W60B 3MSPA 3X13A 1CIDA 1OL0A 4LOUD 5BCAA 4J3TA 1EIBA 2JLLA 3MOBL 1T7VA 5ELIA 4L8CB 2NTSP 5DUPL 3EDKA 3BP6B 5C3TA 3SDCB 4N8VG 1WZ1L 2XT1B 5BV7C 1ZWIA 3I6LE 3KDMB 4XVSL 2V7HB 3UTPE 4FXGB 4KRPD 4UBDC 4PRIA 1DQLL 4I3GA 4BM7A 2X7LB 5D1XC 4ZSOB 2V2XA 1OM3H 2HFFB 2Y06L 4L4VE 3BN3B 2N1KA 4C56D 2DM3A 1MRCH 2E7MA 4U1NB 3H7BA 4RMQA 1KJVA 1T0NB 5CEYA 4ZAKA 3P77A 4A6YB 1M05B 1J8KA 5JDJA 4PGBB 3EOTL 2D4FA 5ILTL 3NZ8B 2FEEL 3OX8B 1HHHB 5F9DC 2Y1VA 2EE3A 4NUGL 3REVB 3AS3A 2NZIA 1BAFH 3EUUA 2UY6A 3MOBH 5GGUA 1UH4A 4AIXA 1A6WH 3QUYB 4XWOC 4MNGA 4EUPA 4OLXL 3TO2A 1CR9L 4LVHC 1DQML 1Y0LA 2VLRD 2FX8H 1GXEA 1ZA6B 4QOKB 2ARJA 3QEHA 1KB5A 3ZDZE 3HI5L 4JZNB 4ONHA 4HUUB 2HN7B 2V7HA 3DVFA 4K55A 4HUVA 3BP5A 1Q9KA 3EW3B 1PDKA 2DI8A 2EDDA 1GPOH 2IBGA 3NCMA 4P2OB 4YIQA 5F88A 5D9SA 1XGUB 3E6HA 3VFUB 4OM0L 4PJ5A 2Q8BL 3AXLA 5B4MD 4NZUH 3QJHB 5DYOB 5IEHA 2R2HA 3CH1A 3C6SA 2ADIB 2F53D 5EOQL 4HS8L 2HG5B 1RZJH 2F58H 1PZUB 2J4WL 2IQ9H 2HJFA 1S9XA 3UCRA 2FJHB 2IADA 3D0VB 2B4CC 2FLBT 4FZEL 4FZEH 1PLGL 1I1AA 4NKOB 3GSUA 3HCVB 5L88H 4AG4H 4PY7B 1CDUA 3L3KB 4WEBH 1QO3B 3MNZA 3ARGC 5IBLD 3QWRD 4L4TE 2B4CH 1YY9D 1EXUB 5SX4I 1CL7I 4LRIA 1BJMA 1KV3A 4EI6B 3H6JA 5E7BA 1FFOA 1XR8B 4NJAH 5E95B 2OTPA 5E8EA 4M03A 4TQEL 1E6JH 2GT9B 1E6JL 1UVQA 5ID0B 3QUMB 4DVBA 4JVUA 2I07B 1I8KB 4UDTA 5D7SH 1CTNA 1JYWA 5ICZA 1XGRB 1I1FA 4X7SH 1CXHA 5D7IB 4PRHB 4HPYH 1NUNB 3BGFC 1T5WA 1EZVY 4PD4K 1GGTA 2O26U 2P8PA 4HUNB 2F9BT 1EV2E 3WNMA 5GZOD 5C0DB 4XVUC 3MMEA 2VJXA 1V7NL 2ICEA 5EWIL 3L5XH 1RV6X 4KGLA 3VFOA 5K9JL 4ZFGL 4JO4H 5ESAB 4ODVH 3VGGA 1VCAA 2YA1A 4WHTB 3I3BA 3TO4B 1EBAA 2X9WA 3QNZB 3VFMA 3O6MH 1HQ4A 1U36A 1BVLA 3FL7A 4RSVA 4MJID 3RKDC 2DKUA 1AR2A 4CNIA 4H1LB 2HJLA 4UIKH 1UB6A 3KPQA 1QACA 1VACA 2PTVA 3OXSA 2G9HA 4LF3A 4Q6YA 4N90D 3TBSB 4MQXC 4RFOL 4LNRA 1DUYA 3DHMA 3QRGL 4I8DA 2VXTH 3IKCA 3WE6B 3FB6A 5CGYC 2NXZD 2FD6L 1NCTA 3SKOB 5MHSD 1VFBB 5H37H 2HJKB 4P59L 2EDFA 2AJYL 1WZKA 4ELKA 1T3FB 4OI8A 2R4SL 3ABZA 1T2XA 4P4KB 3IDGA 5CEZE 5HHXH 1RMFH 1U6AH 2Z0BA 3IFPB 2UY7A 1RD6A 4ZO7A 3O11B 5DJDB 3LKQB 1CE6B 2CO6B 1XF1A 5C07A 4LPYA 1FPTL 4HIEB 4P4RA 3UTQA 1FNGB 5E6IB 4D0BB 1JTTA 3EDEA 5DVNA 5DSCB 3WN5A 5FO9B 1F3RB 2IPTL 4UT9L 4NOFA 2EE9A 4K71B 1MRCL 2G5BA 2NNAA 2EXWD 3SDDC 2Z9TA 3PP3H 3IAPA 1QG3A 5I66A 5ILTH 4X5WB 1G6RB 3BP4A 4PJBA 4D0DA 1I3RB 3T0EA 3SQOH 5HD8C 2CO7B 2B20A 3V6ZB 4IIQC 1J1OH 1LVEA 4JO4L 5MERB 1KN2H 4OT1H 3JTSB 3TZVB 3T04D 2AS5M 1FVDB 1RK0A 5CGYD 1EJOH 3CUPB 3N1PC 5HYSA 1YEKH 1XF5A 1LO5B 5FV1L 4KMLB 2NZ9C 3VGEA 2E6JA 2CLZB 4WFHD 12E8H 4MYWB 4ONGH 5E6IC 5L2KE 4F80A 4QXGL 2DLFH 5TDOA 4QXGH 5INCB 1I1FB 1ZLUK 2YD7A 1A4KA 4MXWH 1TCRA 4KRMB 3BEVA 2NW2B 2W38A 4BZ2H 4XNMB 3M8OH 3W39A 4HIIA 5IFAL 3WDIA 5IEKB 2J8UF 1MJ8H 3RNKA 3G6AB 3FKUS 4OI9A 1GGCH 1A1OA 4GG8B 1BBJB 4EI6A 5BQ7A 5C09B 4NFCA 5BS0D 4KZDH 2A83A 4XNUL 4ACPA 1NGZB 1P2CA 2HFEB 3I6GA 2H32H 5HVFB 3U0TB 1JZ3A 2X1OA 3FB8A 2VZ1A 4N8PA 3MCG1 3QFJA 3VXRD 3DGGB 5FGBC 4NFBA 5FO8A 5LXGL 3JTSA 4V1DB 1A0QH 2BFVH 4H1LA 1ZT4A 4Y5YC 5IB3B 5A16B 5C8JB 4YC2B 5CD3B 2R69H 5FKPA 1UYWL 1QRNB 1YEEH 4M7KL 4JKPL 3VGAB 4M93B 4TYUA 4KKCC 2FNBA 4M6OL 1W0WB 4NKMB 3RDTB 4DGVL 4JM4L 2HT3C 1PVHA 5F8RC 4MNQA 4ZUVA 1UWXH 4JQVA 4LKCB 3RZCD 1A02N 1R3HB 3OKEA 1I4FB 4P2OC 4R4BB 5KG9A 2VZVA 4XZUA 5I1KL 4HHAA 3BXNA 4MJIB 3GEWB 3WFDH 2X4RB 2Y36L 4H20L 4YDLB 1S7RB 1LP9A 2DQJH 1C5CL 2DQJL 3B8YA 3IS0X 4I18A 3B9KB 3VJ6A 1DUZB 3FQNB 5CGTA 2XTJE 2FECI 5JPMB 2HRPL 3RWDA 5E5MB 2ED8A 3BGMA 2NY6B 3UC0L 4MNQE 3TYFA 4EIGB 3H0TB 2V2WA 3WKNA 1OGTB 2B2XH 3UDWA 5IMMB 1NCBL 1B88A 1WBYA 2EC9T 3L7FB 4DTGH 5IG7A 2FBOJ 2Y5TB 1MI5A 2AK4E 4IDJH 4UUJA 1F3DJ 1NGWB 5DS8B 4OQTH 3C2SA 3IT8D 1A3RH 4KY1H 1A6VL 3MXVL 3T1FB 4CVXB 4XP9L 3TWCL 3RKPA 3DO7B 1P5UA 4I3SL 5HHQA 1MFCH 5ETUA 4S1DC 3GZKA 1JYXA 4F58H 4JRYE 4BQBA 1MCIA 2HAZA 4GMTL 1VGEH 3D85D 1SBSL 3TV3L 5BZDB 4BH8B 2BSTA 3T4AB 3ALWA 5EIIA 2XXCB 3PQYB 4U33A 1NCWL 3I6KA 3BH9B 3OGCA 3GSOA 2D7PA 3AREA 3O2DA 4KK6C 1QEWA 3D25A 1QSFE 4GG6A 2VXVH 5KSBB 5TE7L 3C8HA 1JRHL 1GZPA 3DURB 2D03H 2YUZA 3AGVA 2W92A 2XRAH 5I1LB 4ZD3H 1CVRA 5AG8A 4P23C 5HGBB 2JCCF 5ANMA 3STLB 2GJZB 4PB9H 2DMCA 1W8NA 1LHZA 3RTQC 1OP5K 4WV1C 1WIUA 3C2AH 5E24E 4EI5C 3FT4B 2I9LA 4B7LA 1R3KA 5CSZB 3MLXL 5IF0A 3NA9L 4P2RD 1PFCA 2ZJSL 5HBBA 3ROLB 3BPOB 2W1NA 4O02H 3LV3A 1KJ3H 1OT2A 2BVPA 4XAWH 2YC1B 1JWUB 5DJYB 4ELMF 2XOTA 4XAKE 4M6NH 4H26B 1EMTL 4QHLA 2ESVB 1YPZF 3NN8B 2HFGH 3HB3D 1J8HD 1ZT7B 1JTPA 4ORZC 5ID1B 5DJ6B 2AEPH 4CMMB 1GH7A 1IC5H 5CUSL 4YX2L 5DF0A 5CILH 5E9DD 3K4DA 4YZFF 4NNYA 4LCCA 5FF6A 1HXYB 2H2SC 3O9WD 5DQDL 1ED3B 4BZ1H 1D9KA 3RUGA 4S0SD 1RU9H 3S3SA 1FZOA 2ZUVA 1MRDL 1F8TL 2PO6A 1D5IH 4K71C 1ZHKA 3VGAC 3SE8L 3L3GA 2YPVH 5JO5B 2N7BA 1EEZB 4KQ4H 2VSCA 1GOHA 4LHUD 4XBEH 4NN6C 4Z95H 1FJ1B 1W72H 1JNLH 4JFQB 1MF2L 3TCLB 4J6RH 2DRUA 1YEHH 3RHWK 5JQHC 5JW5B 1KLUB 1W2KT 5E4EC 4OQTL 2OL3A 2EC8A 2KZ1B 4KRLB 4QXTA 4TRPL 1UWGL 4ZTOH 1UWGH 4ZTOL 2JELH 3QT2A 4DUVA 1HHIA 3HMWH 1NJ9A 4XP5H 1FYTB 1BD2D 4WWKA 2IC2A 3INUH 5T1MA 3RWEB 1T5WB 4QLRA 3BQUA 2BXZA 2VITA 6FABH 2QR0A 1B0WA 1F4XL 4XNQB 4PRNB 4HD9A 1IRAY 1V5JA 2BVEA 2FIRT 1A7RH 2NYYD 4B7IA 1J9CT 3GB7B 3CXDL 2GCYB 4F15B 1KOAA 5F1NB 2VXVL 2PTTB 1IC5L 5TGBB 1DP0A 1T20A 3VFVA 2Y36H 1BZ9A 4P2QB 3KLDA 4GKNB 3SGKC 1TQBC 3V5KB 4EI5D 4J8RB 5AYUL 5K59E 4M1GH 4PJHF 5CIPH 1IKNA 3HUJE 1GC1H 4DCQB 4HSQA 3VW3L 3FO9B 1IZJA 1N7ML 2BHZA 1W0YT 3ZDYF 5KSAB 5L2KB 4NO2B 1XF4B 3QUZD 1M7DA 4KXZH 3WS3B 5DVLA 1YECL 3MCKA 3MNVB 5M94B 2OR9H 1A7BA 4JPVL 2ZG2A 4XMLL 1AXSA 3PDOB 3GIZL 5IV2B 2A9NH 1MHPL 1CYGA 5HYSG 4M5YL 1FVCB 4OD1H 3VCLB 1OAZH 5D2NC 3RWGA 4HKBB 3DXAB 4OZFH 5C09E 2K9UA 2CLVB 3LMJH 3HLAB 4LPXA 1U8MB 1RK1B 4PGDA 3VFUA 1RURL 4PB0H 3LQZA 4P3WA 3P9LB 4X7DC 3EHBC 4DGIH 2DQDL 1BIHA 4HG4J 1H5BC 2UVFA 3SDAB 2W0LA 3ARGD 5IBLC 4M9PA 1H3UA 4OAWA 3A0OA 1REIA 3WD5L 4PRIE 3BSZH 4G8GD 4JVWA 4MD4A 2PETA 4XPFH 1FZJA 4N5ED 5C08E 1QLFA 5DJCB 1S78D 3ARYA 1O7VA 1PX4A 4NPYB 1OARL 2HWZL 2GSGA 2NY1C 3LN5B 1MQ8A 3VRIB 5ISZD 4P9HL 1GC1C 4DN4L 4PG2C 4ERSH 2B4CL 3EFDL 4JJ5A 5C0RH 1NAMB 1WTLA 1HH6B 1EAPA 4KDTA 4QTIL 3LS5L 1CD8A 3FO0H 5C07E 5T3XH 2UZIH 3L6FA 4DAGL 5F9JB 1RJCA 4N0UA 3MFFA 3MRGB 4XP6H 5J1AB 1F4XH 2EEAA 3FOMA 2D7NA 3OKNA 2FO1A 2FO4B 5HI5D 3TBTA 1YUHB 2ZZUT 5AZEL 2CKBL 3TBYA 1SYSA 2X1QA 3MLZL 3ZE2F 4FQIL 4HPOH 2F19H 1YNLL 3MBXH 4X6BB 4G8EA 3VMOA 1MWAB 1QNZH 5JLZB 4N0RA 1JGEA 4MAYC 3EOAA 4TVPD 4X9IA 3S3PA 4OM1L 4LIQL 1QA9B 4C57C 4KPHH 4CDHA 3HPLB 4GRLC 4MD4B 3EYOA 3L5JA 5CINL 4R96B 1RHFA 1NCNA 5GGVH 2P5ED 3EFFB 3IDYC 3W0WE 4JHZA 4R9HA 4Y89A 3VWKA 1K6QH 3UTTD 3VXSA 4LEOA 4W4OC 3RTQB 1UXWA 3NCJH 3WSQL 4ZPTB 2D0GA 3SKNA 1I8LA 5IMKA 3OXSB 1WWAX 2CIKA 4UAOB 1F2QA 1JNHA 4YFEA 1G6RH 1ZT1B 1NFDE 2WK2A 4AENA 1AO7B 4LLUB 3SOBH 1EHLL 5D7JD 4IEFB 4L4TB 1KC5H 5D72H 4GKZB 5HHOB 3GMPA 1T1XB 4ZFFA 3G5VA 2X4SB 3GSNH 4KTEH 1XGYH 1G7PB 5EBMB 5D1ZA 2DQGH 3HZKA 1QRNE 1QLRA 4JM2C 5DEFA 4RWYL 5CP7B 5J13C 3QZWB 1B0GB 4YHPB 1KTKE 3SKJL 1XGTB 3MLRH 3MLRL 3H9HA 1Z5LA 1MELA 3P9MB 2DQIH 2GYSA 3MGTB 1OCWH 3EYSL 4JCMA 3NFNB 1IM9B 4HWBH 1MAKA 2XQBH 5CS7A 1T6VN 1KTLA 3QCTH 4UV4L 2ZUQB 4OV6F 1QP1A 1JZ8A 1BREA 4I5BA 4PJEB 4UDUA 1V3JA 4IOSD 5B3JF 3D2UB 3QG7H 1XH3A 3T1FA 5IVZB 4OCYL 4V1DD 5EG6C 4DN3L 4MS8C 4DZBB 1FZMB 2DLHA 3QO0A 1DQJA 4U6VL 1J7VR 3EJJX 4K3GA 4XP4H 1KLFA 3T2OA 4WWKB 5IIEB 1JMXA 3TIEA 4G8GB 3C60D 3HAEB 4LSUH 2BVQA 4JFFE 1JBJA 4LGSB 4PYGA 4M93C 5K59F 1TXKA 3CLEL 3NFPB 4BH7B 3L95A 4PGEA 3KS0H 2CR6A 3HC4H 1U58B 5HGDA 1AJ7H 3PF2A 2J8UA 2YD8A 4CJ0A 4PGZA 2LVCA 4LKXA 1RVFH 4XCYA 2IF7A 4QYOB 2R56H 2V7NB 1D5IL 3TVMB 3V0VA 3KYNB 5EPMA 3WXVL 3UZVB 3FO1A 3WJJC 1R24A 4K2UL 4FP8L 4X4ZA 5F89B 3ILPB 3T0VA 4BFIB 5B8CC 4LSPH 4ODSL 3GI8L 5KSUB 3IF1B 2SEBA 3FQWA 1TZHA 4NZRL 2JK5A 2M26A 1T6WA 1B90A 2BNUA 2XY1A 3M45A 3SE3A 2PYED 1R3IH 2IPKA 1TZIB 2ATKA 2I5YL 1AE6L 4M1DH 4WI4A 3FFCA 1WICA 1KPRA 4ZO8A 1YEGH 4QRQB 1NLBL 4E0RB 4M6MH 3DYMA 5IJVA 4TUJB 5I75B 3M17A 5GPRA 2GW5A 4MAYD 1BFVL 4YBLB 4GW5B 1U8LA 4PJ5D 3HZMB 3K1KC 1I9JH 2VLME 3PWNA 3S4SA 3ZL4H 2C26A 1CGUA 5DUBA 5DQJB 1P84J 3L5XL 1JHTB 4M1CC 1DN0B 4C83A 4U1SB 2R23A 3MV8B 3RGVD 4QOKE 4Y4HB 2C1PB 3PHQB 3ECBB 2ARJQ 5HDQH 4NN7C 3ARFC 1RFDL 2QQNL 1NCUA 4AK1A 1KPVB 1ZVHA 2Y7QB 4OTXL 2FHCA 2J88H 3I02A 1UA6H 3P9MA 2FBJH 1HEZA 1MCFA 2PXYA 4XMPH 3BQUD 4JO3H 2A77L 2J6EH 4QT5A 5DD3H 2Z8RA 4DN3H 4L8CA 1LO3L 4K7PX 4PBXA 3WIFA 1D6EB 4CW1B 1P1ZA 1VADB 3PXHA 4WIQA 4NJAL 4YHOH 1KUMA 1X6NA 3RY6C 2KDGA 3QFJE 1T1XA 4ZFFB 3IRPX 1X5KA 3ZDYE 1IAIL 5IMLA 4JFDB 5F7WC 2JJTC 3KWWA 5JW4M 1D5BB 1NGPH 5J06A 1AHWA 2CSPA 3HE7C 1JPGB 3A6CL 2J4WH 3FB5A 3MUJA 2R1WB 3KYOB 4HUKB 4N1CA 2BOCA 4F7PA 1T04A 3S37L 3FQXB 1MLCB 2LU7A 4DVRH 4GAGL 4BA8A 2B39A 5D2LE 5EO1A 1K5NB 5JW3L 1A8JH 4S1SL 1RIUL 2DD8L 2JB6A 3S3JA 3VMPA 2VISA 5E9DA 4XBGB 2HFTA 1AC0A 5DJAA 4HH8A 1NDGB 1FGNL 4H8WL 4ZS6C 5C3LD 1FNSH 1HQRA 4NQSB 3SCMC 2ESVE 4EEEA 3VFTA 1DBAH 4M7ZB 2BY2A 1EPFA 1U8HB 3RWHB 1G7HA 2F53B 2OTWA 3C60C 1G1CA 1JFQL 3G04A 1OD7A 1YYML 3RBSA 3ZKND 4X7EC 1XGUA 3E6HB 4P2RA 1A4JB 1XF3A 3HI1B 2GJ6D 5E4EB 3SBWA 4TSAH 4UOW1 5DLMH 2VXTL 1DBBH 1RJLB 2AV7B 3R1GL 1B4RA 3WNLA 4NQUA 1R5WB 4X6FA 4K8RC 1VFMA 2LAGB 1XT5A 4LCWD 1JYNA 4WHDA 5GS0H 3VXNA 5FIEA 4HLZH 3MRPB 4MZ3A 1CLOH 5CJBA 3ARBA 4QRRD 5CUSH 2W9EL 3CLEH 2A9ML 2YPKB 3MRDA 2ZG3A 3RA7L 4HQQH 3RA7H 3FQXA 3B6SA 4BFBD 5KVEL 5EOTB 4RRPA 2FIKA 3PP3K 1P4BH 4P57A 4RZCA 4MJ5B 2R0WH 3KYMB 4KI5D 3F58L 4RMVA 5C71A 2P7TB 1ZS8A 3SE4C 4MNHA 2GSGB 1NUFA 4XB8A 4GLRI 2Q3ZA 2CMRH 2R1XB 1PKQA 4H1LG 1BEYL 3QIBD 2NCMA 4WHCA 1F45A 1QQDA 1IM9D 4NHUA 2F8VA 1AGCA 1UM5L 1WSST 2GJ6E 1B0RA 1TJIH 3HR5A 1H3WM 4I5BB 1T4KB 4WUKL 4D2NA 2IANB 4AIZA 1MAMH 5TQ2H 1K8DA 5I19H 1OARH 3OAZH 5EOCL 1AIFA 5DQ9B 3U48A 1MFAL 1U8KA 2VAAA 2YWZA 4HWBA 1IAIH 4HIJB 5I1JH 2VKXA 2AW2A 2C7UB 1AKJD 3TBTB 1P5VA 1BD2A 4WWKD 4E5XA 5F72S 3RIFK 4NUJB 3WUZA 43CAB 3GO1L 2DDQH 1XIWB 3L7EA 2WUCL 3MFFB 3STBA 1RIHH 2XFXA 2EH8L 2EDHA 5EC2B 4LLDA 1SMAA 3WUWB 3FT2B 4U6HA 1G7MB 3OAZK 3SJVA 2YUWA 5EA0L 1UXSA 5ICYB 2MQ3A 4HKXA 1NQBA 4AG4L 4LCWA 4G9DB 4MHHG 2VKWA 4P9HC 5DTFA 4FNLL 4GW4B 2NY4D 3ZDXF 5EUKA 2XTLA 2OTUA 3DVGB 1S9VA 4RA3A 2P45B 4YR6B 5FA3B 1N2RA 4LAJH 3LCYA 3EO0A 1TITA 4XHJD 1BPVA 1PZ5B 4JFDD 1ACYL 1FZJB 4MD5B 1YNTA 3O4OC 1S8DB 1IKFL 1SEBA 1UXWB 3K8KA 3O9WA 4OD2A 4HWEL 3ZKXB 3I9GH 3ZTJH 3VFPB 1Q9KB 3RI5K 4C56B 3ZYJA 5FYKU 2IEPA 3BMVA 3O45B 3WNNA 4G9FB 5J9PB 3A6BL 4PV9A 2QQLL 3UBXI 5IFJA 2XZQH 5HVGB 1J18A 1LO3H 1VFAA 1FNEB 4UU9A 4PJ7E 2GITA 2WIIB 3BUYA 1IBGH 2G60L 5IGXL 3HPJB 4QKXB 5BO1H 3V52H 5CEXA 2COQA 4G42A 3QB7C 4RDQF 3N9GH 2WBJD 1RPQA 2R2BB 3BPCA 5HYFA 5HYJB 4MJ2A 5DJ0A 1PX3A 3IU3A 4RGOL 2R2EA 4NQCE 3TBYB 2VLKD 5JHDE 4PY8I 3DVGA 3TPKA 4HF5H 1YEJH 4M1CD 4WO4A 5IUSA 2BRRH 5TDPA 1JF6A 2VL5B 4HLZG 3CC5A 4K8RL 1ZMYA 3ZYIA 3TVMD 4RBPK 2IALA 2YMXL 3VRLF 4U1IA 4YXKH 3VWJB 1OT1A 2VE6B 1NFDA 2EYTB 4J3UA 4NRZB 2YZ1A 5DXWA 2VLJA 3VXMA 3CFJB 4R90H 3CPLA 1X44A 1TVDA 3ULUL 1RUKH 1BVKB 2H1PH 1X5AA 4BYHA 2FYYB 2W60A 2IANA 3NIDF 3M07A 2NTFB 1DANU 3K46A 5L7XL 4XVSH 1RQ5A 1B2WL 2V9TA 4BQ8A 4LK4A 5IP4A 2BY0A 4Z18A 5JW4N 2OXGA 2YK1H 2X4PB 1DBBL 5DLML 5CZVL 5EC1B 3GBML 4R97B 3QDGD 4K07A 3GIVA 3GMRA 4G6JH 4S1QL 2Q86A 1N4XH 4YLQT 2JE8A 5HTSA 1MEXH 4PRAB 2EDEA 3DPBA 1QD0A 5I30H 1BHGA 3DIFA 3GJEA 5HDOA 4CADB 4NUGH 1RZFL 3LKSB 3V0WH 4M62L 2VXUL 3IAQA 4J4PD 1EBPA 3CSYB 2VC2L 4XPHH 2XKSA 4X4XB 5JTWA 4P3DA 2X4UB 3U0PB 1WBZB 5DT1H 1F3JA 2R0LL 3BVNB 3IJSB 3D9AH 4PJIA 5B39B 4ZOCA 1R5VB 3I2CL 1HHJB 5MENB 1JV5A 5EU7E 3WS6A 1NGQH 3TPUA 4KWUA 2ICWJ 4F57L 1QFHA 4NUJA 5IBTH 3D5OF 3C5ZD 4Z7VA 2QKIB 2XZCH 4YQXL 3WLBA 2WUBL 1UZ8A 4KI5E 3DXAD 4HGMA 4ZAKD 1QZ1A 3WCYA 5I1JL 3MJ6A 1B6DA 4LSQH 4M5ZL 1HSAA 5J3HC 4BK5A 1AD0A 2DN7A 4XHQA 1Q94A 4KK5C 3RL1A 1FLRL 1UG9A 1YY8A 4LDEB 5FXCH 4D8PA 3QHTC 5LGJB 5FOJA 1MH5A 2NX5D 1FSKC 4WW2A 3ZKXC 4YHKH 1SJVA 4YX2H 3VXRA 3BKCH 1GHFH 3QI9B 4MMZC 1KIPB 4XBPB 2NXZB 1FG2B 5L0QB 4R4FL 5BS0A 2LTQB 1WBYB 2ZCLH 3ULVD 4Y5XC 3TH2T 5DZOA 1G7IB 5KVFL 1MWAH 2WSKA 4PJCA 4QRSB 4IHOA 1IGCH 5ISZB 5E2TL 3UPRB 1WAAF 1KNOB 1NDMB 1VADA 4CW1A 5MERA 3DX6B 1ZHLA 3HB3C 1LO0L 1VHPA 4JPWH 1LO0H 2IJ0C 4JPWL 2IAND 1QTYT 5SWZA 1IGIH 1Q0XH 3EDDA 1MCEA 3N1FC 4YHZL 2Y07H 1W0VA 5DGRA 1AQDA 5E6YA 3X3FH 5DD5L 5J1TC 1JP5A 4L3EA 5EZLB 1C5CH 4LU5H 1C12B 1OSZB 3V52L 2EIDA 5FM8A 3UJTH 3MRFB 5F6HI 2IFFL 5D1ZD 3CFBB 5E00B 3N9GL 3VI3F 4L3CB 4EN3B 5JUEH 2XWJB 3HUJF 4P23D 5SWZE 4KKBC 4JR9L 5GS1B 3CFDA 4XBGA 4XPFL 2ADGB 4P3CH 1Z0NA 1U0QA 2OZ4H 4NZRH 4NGHL 4XCNB 2NY2C 4FTVE 3S34H 5F7HA 3MREB 1LEIA 3MLYH 3L3OB 3S36X 1UH2A 5E70A 1PZ5A 3BKJH 1S7TA 3BPNB 5IHZA 4ZOBA 5LGKA 1TJIL 3C2AL 1JUFB 5B39A 3MXWL 3JV4A 3RKDD 5F97E 1WAAE 1OW0A 4LSVL 5DD6A 5IR1A 5SWSD 2FH6A 1YECH 3IGAB 1YN7B 3DX9B 4HJJL 3MV9A 3KLAA 3RL2B 1C12A 4I2XB 5ITFB 1AKJB 4JY5H 2FB4L 1X7QA 4JFOA 4DK3A 4FFZH 4G8FA 4JGMA 3VFNA 4X7SL 2CRYA 1A6ZA 1LEKB 4PJ9C 4PJFB 4NGHH 3EYVA 1A2YA 4V2BA 4XVTL 2VYRE 4FZ8L 4MB3A 1KXTB 4H5SB 5A2KH 2VDRL 1MEXL 2Z4QA 2ADJA 4ZXBC 1K8IA 5D7LB 3W82A 2NY4B 3EHBD 1SM3L 2J5LC 2W0FB 1Z0MA 2H2PC 4Y4HA 5H94B 1KYOK 4UT6L 4YO0B 4FP8H 3BD3A 5EU6B 1JNNL 1FVEA 1ZOXA 4C58B 4PR5B 1DL7L 1I1AC 1ZT1A 5AD0A 4PJGB 1U95A 5HYJE 3P0VL 1L7IH 3NFSL 1HI6B 3JWDL 1BOYA 1S7WA 1GPOL 4XP5L 4XGZA 4P49A 5F1SA 3MRCA 4CDGC 4KHTL 2GJ6B 1KN4L 1VEOA 1T7ZA 4RX4D 3I50H 3VD7A 3LQAL 3KVQA 1LEKA 3LY6A 3OG6B 3QDGB 4R97C 3B9DA 5LQBH 2R2HB 3CH1B 5KSVB 5DJ8B 4JFFD 1A3LL 5JW4Q 1PGRB 5I74B 2XA8H 4H25B 5I1CH 4IOIA 3E6FB 1CS6A 2A6KA 1PSKL 4GRLB 5EU7C 4DKEH 4CMHB 1PBYA 1G6RA 3BVNA 3CSBA 3QRFM 2E7CA 3QCUL 5E9DB 2C1OA 2VLRB 1OTUD 2GAZB 2NX5E 4OFIA 5IHZB 3Q0HA 1BP3B 4GUPA 4ZUWB 1IGCL 2Q1EA 4G80B 5E99H 1OLZA 4KI5C 4U3HA 4RQQB 3HE6C 4LOUC 3MLSL 3ARGB 4JCLA 3HUJB 3NCFB 2A1WH 4P23B 2ZCHL 4A6YL 3TA3B 3QIWA 5F96H 5ANME 4FN0A 1ULVA 4HZLB 1FORL 4P4KA 2O5XL 3MXVH 3GMQB 32C2B 4GH7B 4JDVA 3MYZA 1AHWB 3U7WL 5CD5D 4F7MB 2XKNA 2BOBA 3NIFF 5CJQL 2VIRA 4FABH 1NUGA 4PJ8A 5LKNA 4Y4KC 5JLZA 3WHXA 5D93B 4H1LH 2JCCA 3GJFA 4W68A 2RB8A 2ZKHH 4NT6A 4ZDHA 3MV11 2D4DA 1H3GA 3KXFA 3CVHB 3QQ9D 4YDKL 5F7NC 4JN1H 3VWJA 2QQKL 1LD9A 2SEBB 4F7EB 3TP4A 5I16A 2QHLA 4XH2A 4HUMB 4GKSB 2BSRB 3PUCA 1M71B 5MEND 3AAZB 1CGSL 3JZ7A 3QDGE 3NIGE 4UTAL 5H8DA 1IC7H 2ITCB 3UEZA 4GS7B 1NGWA 2BZDA 3JWOH 3WNKA 3UTZA 5C70A 3D48R 4MMXC 4KKNA 3HS0A 3QIWB 3RWCA 3WO4B 2ARWA 1RULL 1VESA 3NH7L 6FABL 1FFQA 1IC4H 5JXEC 2L7UA 2P5WB 2VR9A 4NNXA 5L8JB 1JPTH 2DS4A 4MB5A 1WT5A 2PN5A 5C07B 4ZOEA 1FPTH 3V5KA 2YUXA 1YJDC 1NAML 2C3VA 3KPMA 5HY9A 4FQXB 4OLVH 2VDPH 5GGRA 2VO5A 4ETQB 4XNZC 5C0FA 4ZPVA 2EDBA 5GS3A 2GCYA 2LQRA 4JM2D 1LDPL 1QRND 5EA0H 2BSSB 1CFSA 1T89C 3EZJB 3KPLA 5B3NA 3OKKB 4UQ2B 2DJSA 4W81A 1KJ2B 1QO3A 3PGDA 3SE9L 1FIEA 3VW3H 2ORBL 4QHKI 3SKMA 1OPGH 5DD1L 4OCLC 1UB5A 1NFIA 3PDOA 5IV2A 1A7NL 2G2RB 4S2SB 4UTBL 3LH2L 5I2IB 4NP4L 1BQUA 3UTZB 3VGDA 4NRZA 4Y88A 5IW1B 5IB2B 1I3GL 1F3JB 2F54E 4Z7WB 5MEQA 2RCSL 3T8XA 2Q7YB 3T0DA 3UTSE 2ED7A 4NBXB 1CF8H 4Y4HC 2DLIA 5E8PB 1MJJA 3WO3B 4ESKA 1TJHL 3GMNA 4JDZB 3BEWB 2V2XB 4JO1H 4IMLA 4Y5YA 2DMKA 5HHOA 3S5LG 1BBDL 5A40E 1F6LL 1I9IH 4OGXH 2HKFL 1DE4B 2H9GA 4P2OA 4YIQB 3ARXA 1QFWL 5JDSB 2ZNWA 3KAAA 3AY4A 1JGLH 4QRRB 4TOYL 5BJTA 1JGUL 2NXYD 3IFOA 1RIHL 3DX7B 4XBPA 4GAGH 4S0TD 4XCFH 4AEIL 4X6DA 1MCOH 4ZPVB 4YK4C 4XMKL 1L7TH 3W39B 4ZFOA 3RHWF 5HGAA 2QQKH 5CMAB 5J7CC 1UJ3A 3U9UB 4DUXA 3L3HB 2BHUA 4Z7QF 1DVFD 1IILE 1CFQB 3EYSH 3I75B 2XNAA 4JRWA 3ULUE 1CE1L 4AYFA 5KJRH 1IJ9A 1NMAH 3TA3A 3F5WA 1RAMA 3BKMH 4FQXD 3QCUH 1J88A 3MOAL 4U6YA 3G08A 3HE7A 1P7HL 1T7YA 4BUHA 3W9DB 5C0CE 2D31B 3D3VA 5CSZA 5BV7B 3VGBA 4UTBH 4KKAD 1MJJB 4LSSH 3S5LB 5IBUG 3L5HA 3F7VB 3ARFD 3BEWA 1CTOA 1T7XA 3FQRB 3KJ6L 4Y5VA 4XCCH 5BS0E 3PV7A 5C08D 1KIUA 1FFRA 4JN2A 5DRZB 3MJGX 4ZYKB 5IW3A 1WIPA 2VLLA 4JG0L 3QIWC 5DJ8A 3D3VE 4OF5A 3QQ4B 4MCYB 3JV5A 4DKFH 4TOYH 3MREA 4JFFB 3I9GL 5FHBL 2AJXL 2Q8AL 2XNAB 3V0WL 3KPLB 5DJAB 3S36L 4JFDE 5SWSA 4JKMA 4QHMB 5IJKC 2R0KH 3IFNH 1WWCA 2BSED 4RNRB 1KBGH 3S88L 5GXBB 3VI4F 3H42L 5F7DB 1CGVA 3E8UH 3LOWA 5ADOH 4WV1A 1JZ5A 4QRRE 2YD5A 4UNUA 3HZVA 2HWZH 1JWMA 2CIIB 3BT2H 3JWNC 1CE1H 2YC1A 1S7SB 4LSQL 4HJ0D 2FHFA 2NY3B 4L5FL 2VH5H 3TYGL 5DA4A 1FIGH 3GBNH 3V6FA 1WFTA 3VFSA 1KN4H 4G9DA 5L8KB 1T03H 5ICXB 4GW1B 3QXVA 2AI0H 4XP6L 1UM4H 1AHWC 4JY6B 4PJDB 2ERJC 3B2UD 3U9PL 3MLVH 4HS6B 4P2YA 5C0CB 4FFZL 3GSQA 1ACZA 1D9KC 5DRXB 4OLVL 3PDGA 3IDJA 4DW2H 1L6XA 5JOFB 3UTTE 5HDLA 2APFA 4ZFGH 2NYYC 4X9GA 3GMOB 5GRZA 4JHWH 5I8OL 1P7KA 4YXHL 1D5MB 2BNQA 2PTTA 5GS1C 4NPYA 3DTXA 4L9DA 5FECA 1I7TA 1QBML 1LK2A 5C0RL 2GTZB 1B0RB 4KAQH 5J12C 2J3SA 5FCSH 1KTDA 3G5XB 1A6TB 2CDEB 5EZIL 3RWFA 1QPPA 2KH2B 5I6XC 3C60A 3QUXB 3OB0K 5IQ7H 3H7LA 4QHLB 3ES6B 2FLRT 5KOVC 1AGEB 4PRNA 3FOLB 1DVFA 1G7QA 4XP9H 1MFBL 1FH5L 4MCZA 4MQTB 2Y4SA 5DD5H 2PW1B 3L5IA 1IGTB 3D85B 3CDFA 1MHHB 5DVOA 2D7MA 1DUZA 3DUUA 4RIRA 2E9WA 1OWRM 3O4LA 4M7LT 4Z78A 3GHEH 1Y6KR 2BNQD 3GHEL 4Q6IC 4JKLA 1EVUA 1FNFA 4KTEL 2DKSA 1Q38A 5I8CB 3O3AB 5CHNA 1I9JL 3VRJA 3TCXA 1OSPL 1L6ZA 3D0LA 1E4XL 3DV4A 1HILB 3W9DA 4TVSa 3DTXB 1IQWH 3BDXA 1FFNB 3ZDXE 1X5XA 1I1AD 5HYEA 3O2WH 1DLFH 1CGSH 1IKNC 4I3RL 3RNQA 4HUUA 1U8PB 5D2NE 4WHYH 2FEDD 4EJ1C 1AIFB 5DQ9A 3NCCB 2VH5L 1WGOA 2R0ZL 1T0MB 5I1KH 3MNWA 1UCTA 5C2UB 4F7MA 5J11C 3CCHB 4C54A 4G6MH 4PP1D 5SWQA 3R1GH 2Y9RT 3RZCB 1CL7H 1JHTA 4NC2B 5DC4B 1KB5H 4WNQA 4K23L 3CFCL 2HP4A 4NZTL 4J12A 4NO3B 3P73A 3RDTC 5DSCA 5FO9A 3V4VL 5KVGL 4FQQA 4XVTH 2B2XL 3O6KH 3ULUC 1S9VB 2Y06H 3QUKA 1X4XA 5C9JA 4Z95L 2RQ8A 3HC3L 4DVRL 5MEPA 3GMLA 3L3JB 4WW1A 1P53A 2VTFA 1GIGH 1D5MA 3WFHA 1M1SA 1FL3A 1KCKA 4MGXA 1X6LA 3I02B 4DJMA 5LBSL 1U8JB 1WWWX 4WCYH 4LSVH 2V9RA 4Z7WF 5T3XE 1CIUA 4CU8A 5DDHA 5IHUL 4YUEH 3BN9D 4DGVH 1YEDA 1MFDL 1MCCA 4ODUB 2MMXA 1EFXA 1PQZA 1BOGB 2AK1H 5GZND 5D2LB 5E1HB 1QSEA 3MA7A 1U8KB 2VAAB 2XZAL 2FZ3A 2WWKO 1LK3H 3VH8A 5EORH 4FQXA 3P73B 5DZNA 4HAGA 2XYCA 1U3YA 3W81A 3VXPA 1OB1B 4ZXBD 4U1GB 4KDVA 3BH8B 3X14A 4CADA 4IMKC 2UUDH 3KPNA 4RWYH 2EICA 3QXUA 2CRMA 2X6MA 4PJ9D 4UT7L 1BQLH 1A1OB 3NCYP 2F19L 1G6VK 3MBEA 4X9FA 4KDWA 3CFEB 4N8VA 4HV8A 2OCFD 1J1OL 4MXQD 5T5NF 1KTDB 3G5XA 3VFGL 1DLHB 2XWTB 4MDIA 4RNRA 4YXHH 3RVWD 1J8HA 4YFLI 3ULUH 3VD5A 5DMKB 1H5BA 1S5HA 5AZ2H 2OQJB 3UX9B 3TF7C 1XF3B 3K2UL 3CXHK 5GJSL 3QUZC 4D9QE 3TT3H 5EORL 4F9LC 2GTWB 2DJUA 1KPUA 2RFXB 4WFED 3D18A 5E9DE 5C1MB 2X41A 4NP4H 2G2RA 4S2SA 3MRFA 5I2IA 1E27B 3VE0B 2JJVA 3FFDA 1I8LC 4LCUB 3GBMH 4ODWB 3CK0H 3V2AR 2DQTH 5HYSB 3TV3H 2APWA 2GEEA 5GRJH 5EU6E 1TQCB 4Z78B 5D5MB 4ZS6D 2ICWA 4OUUA 4QCIB 5I1HH 5D1ZB 3MO1B 3FOMB 1OF2B 3UZQA 1KB9K 2L7JA 4HS6A 3IRZA 4Y16D 3C5ZB 3T2NL 1T1WB 4Z7UB 4V1DE 3WJJA 2NY7L 1KC5L 3MACL 4YHKL 4Z76A 4WUUA 1MPAL 2GHWB 3AS0A 4DWHA 2YPLA 3B8SA 4S1SH 5L88L 5J56B 3S36H 3AB0B 3LEVL 2EDWA 5ENWA 5ACLA 1LEIB 3HNTL 4PJ9A 3P40A 4EQ3A 1LILA 3EZ8A 2VN7A 4M43L 5CMAA 2M8XA 2ZCKL 4YWGL 1NCBH 1V05A 4CN4A 4ZXBA 1OHQA 2Y72A 2BMKB 5C86A 1KULA 1BQSA 3L3DA 3I85A 3IU4H 4Z77A 2EDQA 3EFDH 5I1DB 1UADC 4PJFA 2H32A 4WEUD 3QULB 3TH3T 4M61A 5D7SL 2V5TA 3VE0A 4G8FB 3CUPA 4Z6AT 3GO1H 5HD8D 2XZQL 4TUOA 1WK0A 2OZ4A 1SJEA 5JQ6L 4Y16A 3RQ3A 1K4CA 3O0RL 2EH8H 5J6HB 4FZ8H 1QR1A 5ISZE 4FG6D 4Z5RB 4ONFL 5E2UL 1U41A 3QIUC 3ELAT 3MGAA 4YHNA 3KG5A 3LD8B 4LPWA 5CP7A 4U1JB 1CDBA 1EERB 3S6CA 3GI9L 3DVNB 1TNNA 2VDPL 1CFBA 3HZKB 4OCWL 1YEFH 3EYFB 4HKXB 3EO9H 4X99A 3GRWH 3BN9C 5K9KB 1NBVL 1G9ML 4JFYA 4UV7L 4C83B 2X1XR 3LKSA 4OF3A 4YAQA 4XC1H 4MNQD 3NGBB 2WWMD 1MIEH 4L29A 3HFML 5GSVB 4X4XA 5AUMB 1BBJA 3LRGA 4WJ5A 4FQ2H 3VXUE 3DETC 1C08A 4PG9A 4IJ3B 1AGDB 4ZXBB 3G08B 2BVYA 1XGRA 3HZYA 3O45A 1N5YH 3D2UA 3PWLB 3F7RA 1VFUA 5E08L 2CK0L 3RL1B 2CXKA 1YJDH 1MFNA 3B83A 2CD0A 4TSBL 1Z9OA 1OAQH 4KRPB 3GRWL 3RZCC 5HHVL 3VDBA 3E6FA 5I1IL 5J6HA 1RZGB 5B38G 1KFAL 4R4ND 1EA9C 2B5IC 4FS0A 3EYUH 3F12A 5JDSA 2YK1L 2YPKA 2GK2A 4PYHA 3NZ8A 3B6SB 3T3PE 3DX7A 2CK2A 2MQ0A 1PJ9A 1A9EA 2W0KA 5K9KA 4X5XB 4Z9KB 4LKXB 5HDBE 3R0MA 3QNZA 3MNVA 2EDXA 1CDIA 4N5EC 5HYJD 1MI5B 2PXYC 4O2CB 1OTSD 4MXVF 3NPZB 4U05A 4U1LB 4GAFB 5DR5H 5TPWL 5IB4B 3OKLA 2DBJA 5FYLE 1SVCP 1KJ3L 1YN6A 4OIAA 4XAWL 5DEGB 2R29L 3BWAB 2Q7YA 4IDJL 4LP4A 4LVOB 3VU2A 4Y19E 3ES6A 2YKLL 4QGTA 4X7TA 1BJ1H 5JPNA 2E27H 4KVCL 4UNTA 1U8HA 1G7JB 1PG7L 2WP3O 3IFPA 3ARDB 3D87B 5L6YL 2H32B 5E94B 1U2HA 2IPTH 3JUYA 3RGVA 5EU4B 1T1WA 4NKIL 2HRLA 4WFHE 2O5ZL 4OAWB 4EN3A 3SE3C 4H26A 4JHBA 4C56E 3GSVA 1E4XI 4HKZA 3FQTB 3LB6D 5D2LF 5EWIH 1T7WA 5HHXL 1AQKL 3P4NA 1FH5H 4IRJA 5E8DL 2CRIA 5KAQF 1ES0A 4NRYB 3D0LB 3I6LD 5E8NA 1DBMH 3DUSA 1D5ZB 1EEUA 1G7LB 1MFEL 1U2CA 1U8IB 4KMQA 4HS3A 3EYFA 3WLWC 1A3QA 1SEQL 2CH8A 4AJ0A 2J88L 4CJ1A 5H35B 4Y8DC 4HFUH 4NQDB 4MZ2A 2AXGB 2I9TB 2YHGA 4L8BB 3PV6B 2JJWA 3ZE0E 3VH8G 4DGYH 4GKSA 3ARDC 4OLUH 1N5YL 3ARSA 3FRUB 4R8WL 4JQVC 2Z35B 3B43A 5T5FL 3MLXH 1ROWA 2UZYB 2YRPA 3HE6B 3BP5B 1R0AH 3S5LA 1JGUH 2K7PA 4GMSL 4XAKD 4YHLH 1I8MA 4L4JA 5CEXB 5D1QB 5IB5A 3VXRB 4UOW0 3FQTA 1IC1A 3RWJA 3SDAC 4HIIB 4LCCB 1M6OB 4JPIA 4KVCH 5FF6B 3PWVB 3TJHC 2CR3A 2O5YL 3SGEH 3SDYH 4DW2L 2OYPA 5BW7A 4ODBD 4Y2DB 2PYFA 1CFSB 2Q8BH 1A6PA 3IVKB 1RUAL 4M1GL 4P5TA 5D93C 4MQXD 4L29B 3TBVA 4PJDE 2B1HH 4OZGF 4MJIE 2B0SH 1MREH 2W65A 4PY7A 2C5DC 3SE8H 2KPNA 4AH2B 3NA9H 2YRZA 1RFDH 1AY1L 1NUDA 3V9FA 4YR6A 3EBAA 1ZLSH 5J13B 4WU5A 5JXEA 4ZS7H 3HFMH 1EAPB 1A47A 5E8PA 1Q0XL 5MEPB 2CLRA 2QHRH 4K3JL 5C0BD 4UMGA 3G5YB 1NCCH 1U8PA 2DIJA 4CN6A 1E4WH 4MD0A 4RISL 1QSEB 4U1GC 1UM5H 3HC0A 3LKRA 3MRGA 2ZOLA 4RBPH 3IYLW 1T2QL 4QHUB 3RFZC 2X7LA 3BPCB 2ZPKH 4DAGH 3WN5B 1SJEB 4P4RB 4LCYB 5IROC 3JVGC 5C0FB 1DQLH 3OKMA 1UT9A 5IM7A 2PYFB 1LNUB 5HHPA 2FL5B 1HHGB 2ZUXA 1FV1B 4HKJA 4UIMA 4Z7UF 1KELL 1K4DA 2IPUG 1UJ3B 3CFEA 1BFTA 4N8VB 3HPLA 3UROR 2P4AB 3P4MB 4ZSOE 1ODAA 1FYHB 2R1XA 2OQJA 1K2DB 3C9NA 5T1KD 1A6VH 1J0JA 5AWNL 3CVIH 4XWGL 3L3OA 1FBIL 3FFCE 1JMZA 4FMKA 3UTTA 4K7PL 4U7KA 3JV6A 1RHHB 1UYWH 4WI6A 3FQRA 5SX4H 3RWFB 3VMNA 4Y5VB 2ATKB 2VLRA 3GMNB 4JDZA 1MIML 1MRFH 5E2JA 3Q1SL 2R8SL 1MHPH 3TN0C 5D7LE 4HMCA 4NN5C 4TRPH 3EDJA 1DJSA 5H37G 2Z4QB 4KRNA 3V79C 1P9MA 4OF0A 3SO3C 3ZT5A 4XVUD 1WAAA 3DX8B 1NMCB 4I0PD 3TM6A 5CBAA 2E7LC 3N85L 3QH3A 3DBXA 4LRNH 3EKCA 4MXVE 4R7DA 2IH3B 4GT7A 3ZMRA 4YDKH 2HTLC 4FFWD 4PJ9B 3PHQA 1I3RA 2FX7L 3T0EB 1HH9B 1BECA 5A16A 3CFJA 2XRAL 3T3ME 1UWXK 4P3DB 5CJOL 5E56A 1NEZG 1F58L 4YUEL 2BVPB 1XF2A 3NTCH 5DEGA 3C6LA 3BZEB 5D1QA 5KSBE 3W2DL 2DI9A 1JWMB 4R3SB 4X6CE 3CVHL 3D6GA 3SOBL 5JNYA 1IBGL 1HZHH 5FGSA 2A6JA 3VI4E 3K3QA 3PL6D 3MUHL 1U8LB 1AXSB 1QFWH 5D72L 5IK3B 4GRWF 3OHXA 1LP9B 3V8CA 2F54D 4XCFL 4ODUA 4AEIH 1CLYH 1TETL 1FDLL 2MNUA 4NQCD 5HYJA 3QPQC 1TCRB 2X1WL 5JPMA 1Q1JL 1U3HD 1F4HA 1TIUA 5T1LD 2IH3A 5LG1A 1DEEA 4MCYA 3ZDZF 4Y16B 1HWHB 1HINL 3ZTNL 4ZD3L 4AEFA 5IM7B 5KAQG 4XI5C 5C0IA 2FCBA 4XWGH 2ICES 4LCIH 5DJZB 3G04B 1R24B 2IQAA 4NC0B 5GS2H 4QOKA 2VISB 2VMFA 2NY2D 5BW7C 5DRNA 5FB8B 4HV8B 4EZMA 2L0DA 1TTUA 2XXMB 4Y4FD 3T3PF 5HHQB 3VFRA 4R3SA 3GI8H 3QDMD 5DMGC 1CGXA 3DI2B 1DQMH 1E4JA 3NIGF 1RHHA 4UUJB 2Y6SD 3OHXB 2F5AH 5I1GH 2XWBB 3J8F7 4X8JA 1JTOA 1G9EA 4PRHD 2BOCB 3CX2A 1U8QB 3K4ZA 5KSAD 5L2KD 2Z31B 3LS5H 2V5YA 5ACZA 4OZIA 1UWEH 5EC2A 3GM0A 4N90E 1CI5A 3HC4L 3UTQB 1DVFB 1G7QB 2DQDH 1EHNA 1YEEL 4NKDB 4ZYKA 5GS1A 3JXAA 5CEZL 3R8BB 1GVIA 3VDCA 3STLA 4L3CA 3IVKA 1BWWA 3BH9A 2ADJB 2MPAH 4O00A 4PBVC 4Y2DC 3RU8L 1PKQE 1MWAA 5I16B 4LPUA 1VB9A 1YNKH 5D71H 1X5JA 1IAIM 5DZLA 4R7DB 3QIUB 3X3GL 1KTLB 4Q74A 2CXGA 2R0LH 5DUMH 3AFLA 4HWNA 1NC4A 4MLSA 4XPBH 1LK2B 1G0XA 1I1AB 4FFYH 5JHLH 3PABA 1HHJA 2I5YH 4U7SA 2X89A 4I77L 1WQVT 1HXMB 3F65A 1MHEA 3X12A 3TIDA 4KAQL 4G5ZH 3O3BB 3JV4B 5FKAB 3D69A 2GUOA 1AKJA 1KTRL 4HJGB 4HXAH 2ESVA 3QHFL 1JN6A 5ETUB 4GMSH 4S1RL 1I7ZB 4M5ZH 1QFPA 4XMLH 1ZVSB 2MPAL 4JREB 1IGIL 4FQQB 3BPLB 2DMBA 2O5XH 1MY7A 3CXDH 5FM4A 1MHHA 5LGJA 1F97A 4ZTPL 5T33H 2P8MA 1T1YB 4NRYA 3U1SL 2FATL 5EU4A 1X3DA 4OD3L 4ZFZA 5IB1A 5GRUL 1MLBA 5TGBA 4G6KL 4NQVA 4GAJL 3QIWD 3BEVB 2C3XA 2CUHA 3SDCC 2YXMA 4TULH 3DVNA 4LF3B 3HI5H 5DHYA 1ZLVH 2DBLL 5I0ZA 1KXQE 1KF9B 3OGOE 1MHEB 5EZIH 2IPKB 4J2XA 4LVHB 1BVKA 1NJ9B 1K6QL 3UP1A 4IRSB 3WIHL 3TVMA 4P99A 4OQ1A 4H0GA 1MNUL 2Y6SC 4Y5XB 5CLWA 4FQJH 3GHBH 4X6DE 3BIKB 3P0VH 1ITCA 3ZKMC 5JW5A 2XQBL 1NDMA 3RL2A 1MFDH 3ARVA 2GJ6A 2P46B 1Q9LA 2GIYA 2P24A 3H3PL 4NO0D 3D39A 4LVOC 1JZ6A 5CD3A 1U3HA 5D96C 2OSLB 1YJDL 3QUYC 4FQCH 1IGTA 4K94H 2DQGL 1XGYL 3S9DB 3NMEA 1OAQL 1X5IA 3TESA 5JW3H 1N26A 3AS1A 3O4LD 4WI3A 3EOTH 4AQ1B 4XCCL 1RZGA 1J11A 4KJYA 3TLRA 3VDAA 2N7AA 3TYFB 4PJEE 5EFIA 5HHOE 2W65B 4QWWD 2MCG1 5H94A 4Q2ZB 4O51B 4L4TD 1J8HB 2FJFA 4YEFA 3DSFH 2DQHH 3B9KA 2HVKA 2QADC 3RY5A 1KEMH 5GRVK 1QLFB 3LB6C 5DHYB 5DJCA 1O7SA 3WXWH 4HXBH 2PUQT 1DQTA 3KJ4C 1M71A 1ADQL 4UU9B 4PJHE 4ZODA 2AJSL 4OZHB 4JLRB 3JV0A 4P23A 2XTJB 4PG9B 1KPVA 1OAXH 3WDJA 4UT6H 2K1MA 4LEXL 4OLEA 1TVHB 3FFDB 1I3GH 5SX5H 1UM4L 5AYQA 5FUZH 3OB8A 4HJGA 3D18B 4HX1A 3P11L 5ITBH 1U8MA 5CIPA 4Y4KA 1G0YR 4I0PA 1GOGA 3G5YA 2ZNXA 3WDHA 2VN4A 3AB0C 5JUEL 3HNSH 1XIWA 2VLMD 3L7EB 2ZOLB 5C7XL 1C1EH 2DKMA 4LLDB 4GW5A 3D25B 1INQA 1ERNA 3AXLB 3ULVF 1NFKA 3NCYS 3MC0A 2QQNH 3NPSB 3S37H 3PNWA 4M02A 2R56L 3DMMB 5I9QC 1HXMA 4KQ3H 1ES0B 1NANI 2FL5A 3BZFB 3C09C 5F9OH 5EU3A 4X5LA 1OAUH 4GUPB 4PGJA 1IAOA 2BRQA 3VFPA 1NL0H 4I2XE 3RVUC 1PKQB 4JDTL 5DJYA 3C5ZC 5KJRL 5J9PA 4WUUD 1HI6A 4ORGB 1U8NB 3MJ7B 1U95B 4GRWH 5IOPB 4PREB 5C7XH 3IJYB 4X7TB 2Z8WC 4JO3L 1OLLA 1HKLL 3ME0A 3LRSA 4MD0B 2ITDA 1HCVA 3DXAA 3HE6A 3P3YA 1J1PH 4WU7A 1JGEB 1DE4A 2H9GB 5DRXA 3D39B 1ZV5A 4K7PY 1A7RL 3FMGL 5D8JL 4KJWD 3RWCB 2NX5B 1MUJB 5EOTA 3EYQC 3MLZH 4AMKH 4JY6A 3MV01 5J3HD 3H9ZA 4WENB 2L4OA 3LMJL 1CD9B 4FXKA 3IDNA 4YHNB 3ET9F 4FABL 2A6KB 5E2TH 1KIPA 4HS3B 4DTGL 4DKFL 1IKFH 1ED3A 3MV9E 3QPXL 3QEGL 4UZGA 1GAFH 1CG9A 4TULL 3BGFB 4Y8AA 3MRLB 2PO6B 2F74A 3VWJC 5E2VL 1EHAA 1WC7A 2Y23A 4X0KB 1JPST 1CK0H 1MJ7L 3IJYA 4OGYL 4OLYH 1CWVA 4TTGA 3BKYL 2GTWA 5IVZA 1U8NA 1AD0B 2C4FU 2D9QB 2DQTL 1U9KA 1TENA 5BO1L 5I17B 1AGCB 1SBBA 1S9YA 5E1AB 4LSRL 1RZ7H 4D8PB 1FO0L 2JJSA 4ENED 4XXCC 5IESL 5I1HL 5F9WC 1J12A 5J12B 1ND0A 1ETZB 4K8RD 1S3KL 2QADB 4GLRH 1AGEA 5KS9A 1MCPH 3KPRE 1TCMA 3KLSA 2AXJA 3RX7A 4XNYL 3ZKNC 3CU7A 1WEJL 4X6CB 5AEAA 1EFQA 3VH8B 3ARBB 2JIXB 1QLRB 1JF5A 5LQBL 4APQB 2DOCA 4GRLD 2R15A 2X4UA 4UDUB 4WUKH 4J3SA 4WO4B 3RX5A 5DUML 2C9AA 3LKOB 1ZHNB 2D0FA 4EN3C 2DTSA 4XPTL 1F90H 1M7DB 1HH9A 5E99L 3VWKB 1FRGH 4U49A 5I1EH 3F58H 1NEZA 1W0VB 4JFEE 3F5WB 2QSCL 5I9QB 3QEQA 3WIFB 3G6JE 3HE7B 3H9YA 1ONQB 2AVGA 2BC4B 2NY0B 1IGMH 5I1DA 3A67H 43C9A 4TSAL 3ALPA 5GQBA 4YHML 3FAWA 1EZVX 3DX9A 5CZVH 1NSNL 1CGWA 3OJMB 3H9SE 4TVPE 7CGTA 4GXUM 4WGWB 1CXFA 1QFWI 3MX0A 3OR7B 2ERJB 5L9DL 2VOTA 5BJTB 4BZ1L 4P59H 1JNJA 5BOZG 3ZSSA 1WFOA 3CFCH 3QPQD 3TZVC 3PQYD 3KYOA 1I7UA 1OTTD 3HZMA 5CILL 3G5ZB 3QEQE 3I3EA 5EUOF 2EYRB 3FTGA 2NPLX 3VXOB 5IW6A 5DRZA 4X99B 3MV7E 4LHQB 4P46B 1FJ1A 4I0CC 1QSED 4FXKB 2DYPA 2FHBA 5F7DA 4Z7UA 2C1OB 5DHVB 3Q2CA 2X9XA 2APXA 2YMXH 4JN1L 4Z0XA 1E0OB 3TIDB 5D71L 1KCLA 4I3SH 3WFCH 1F11B 1KNOA 1OAUL 2PXYB 2R69L 1IQWL 1JNLL 5EDXA 1CBVH 1CBVL 4NQXA 4QT5B 4L4VB 4RAVB 2AJYH 1D6EA 5F88B 5IFHL 4ERSL 4NC1C 5F7EH 4MA7L 5DWUH 5CFHA 3K4AA 4PRID 2XKNB 3FO0L 1SYSB 1ZANH 3FB7B 5GGQL 4LLQB 3L3DB 1DN0A 4I0KA 4PRBA 1C5DA 1A1MB 2FDBP 4G6ML 4M61B 4S1RH 3V95A 15C8H 4U1SA 1H3VA 1EX0A 4OM1H 4NQVB 5GRJL 2C1PA 3QYCA 5EBLA 5GRYA 3IFOB 4JRXB 1F13A 2HTKC 5DQJA 3MBXL 2GAZA 1Q8MA 4QXWA 4NQED 3DMMD 3P2TA 2V17H 5GSVA 1MFAH 2XZZA 4TQEH 5M7QA 4O02L 3O6ML 4Y1AE 3ARGA 1S7TB 3HRPA 3H0TA 5JOEA 3DSNA 2BDNL 5GJSH 5BVPH 3LZFH 3RWDB 4PS4L 1D3CA 5GS0D 1BQHA 3JBG7 3BDYL 3MRIB 5D5ME 4NBYB 3HNTH 1OAZL 3MYJB 2EKSB 3V7AE 4DGYL 3UPAA 3MXWH 4EUPG 4XP1L 2YA0A 1OF2A 3V0AC 5T3ZD 2W59A 1A4JA 3HI1A 5LGHH 4PJAE 3NVQA 4WRLA 3T4AA 3MZTA 5KSVA 4Q9RH 3RWJB 4FQLL 3MLTA 3VFNB 4GRMA 5BRZD 2CJUH 1RZJL 2F58L 2IPUK 1EUTA 2HMIC 5D7JA 5IVXB 2VXUH 4KFZC 4G6FD 4FHBD 4MHHI 5GJTH 4OZGE 4BH8A 4FQHA 3QZWA 5I8CA 2BOBB 5T1DL 5F7LB 5JOFA 3QIBC 3VFVB 5I66B 4XXCA 5IWLA 1AO7E 3LKOA 15C8L 2IWGA 2FJFB 3ECBA 1D5ZA 3DUSB 2FIKB 3QG6A 2AJVH 3LN5A 5IW6B 3U7YH 1KSRA 3KYMA 4TSCL 1JGVH 1HYRC 4YEEA 4YO0A 3Q3GA 3SO5A 4AY0A 4H88H 3V4UH 5FYKL 4BFGA 5LBSH 1IFHH 4FQ1H 4RQQA 1UGNA 3J7HA 5IKCA 3DLQR 1FG2A 2ZCKH 4BQCA 2CKBB 4OT1L 5ERWB 4XTRC 3U0WH 1N59B 4Z8FL 4LCWE 3DWTA 3DI3B 5AZ2L 1DQJB 2AV7A 2YPLD 3QUXA 3WUWG 4UOJA 3EAKA 1R5WA 4X6FB 2MQCA 3ARDA 4UIKL 3O2DL 5I8EA 3TYGH 1Q1JH 3IJHA 4NM4H 4HUXA 1IGFL 4LLYA 5KW9H 1YEDB 2HH0H 1FC1A 4KU1A 3GSVB 4MNQB 4ZUVB 5C08A 2CLVA 4K9EH 2AABH 4EBQH 3T0AA 5KG9B 2P5WD 5D7KE 3EOAB 4OM0H 5J57B 4O2EA 3U2SA 5JR1H 3CNKA 4M7LL 5DJXB 3SDAD 3W0WB 3C09B 1T5XA 1V7NH 4JFOB 1P84K 3H7BB 5BV7H 4XCYB 4OI7A 2XQYG 5DHVA 3CU1A 1UXSB 5ICYA 1W8OA 4PJHA 3LVEA 5CSGA 5C0JB 4BH7A 3FCTA 2FGWL 3WXVH 5I76B 3WS6C 3CC5B 1Q72H 4P5TC 5IB1B 4RMUA 3P0YH 3WFHB 4NQDA 1F00I 5DK2A 3DGGA 4N0FA 3BZEA 3MLYL 5JA9A 2YEZA 4OLWH 1FE8L 3VG0L 1XF2B 4G7YH 3RVTD 1WV7T 3JV6B 3UJIL 3BRFA 1MAJA 4P0DA 3MJ7A 3WFCL 2VZSA 2AABL 3PDDA 4EBQL 3GJFK 3MRRB 1ZXQA 2ARJB 5BZWA 4F57H 3BKYH 4QO1A 1JF1A 1RI8A 4BKLB 1T0MA 2GK0B 2NQCA 2ZUUA 5DR5L 1CLZL 3QFJD 5GS2D 5T1KB 4NQDE 3MV7D 5DMYA 1QPXA 4OCSH 3NA4A 2RR3A 2GITB 4DUWA 4PLKC 4B41A 3PP4H 4DOHB 2ZCHH 1FLTX 4A6YH 1GGUA 4X6DB 2XIDA 4P2OD 1MJ8L 3OR7A 4NN6B 1A2YB 5MI0C 2B7DT 4NO0A 2FZ3B 1VPOH 3WUWA 3TZVD 1E28B 1PQZB 4U1MA 4KJPC 4LPTA 5IB5B 3QH3B 2DI7A 5DJZA 4OF6A 2CKNA 2EDLA 1OCWL 5KBNC 5DFWH 5CHNB 5ABDE 3P4OB 4DKEL 1MCSA 3KXFB 3EYVB 4O4YL 4O2FB 5JOPD 3GMLB 4WW1B 3P0GB 4KK8C 3RVTC 5EUKB 1WBZA 3ULVL 3UPCA 3O3DB 5CZXC 5MEQB 2AK4D 4UINH 3O8XB 1RUKL 1S78C 1Z9MA 1JV5B 3UTTB 1RJYB 4RX4A 1H5BB 4NC1E 4Z7VF 3RVXD 1HN1A 3IU4L 1S7SA 4OTXH 4YE4L 3UTSD 3ZHLA 2FX8L 3BIKA 3QUXD 4AEHL 2AJSH 5ACZB 3MCKB 4FQ2L 1H9VA 4JLRA 4PR5A 4Q0XL 3EOBA 1J0ZA 3RZWA 4F9PA 4L9LB 3QULA 4JQXA 4CVWA 4YXLL 4E41E 1ETZA 1NCAL 5IOPA 4P9MH 3T0XA 1HSAB 3MNWB 3V6OA 1UM6L 3FQUB 1OB1A 5SWQB 1TTGA 1E4KA 1FV1A 4WW2B 3TJEH 3LQZB 2KL6A 1N8ZB 3FO1B 5FCUL 3GMOA 4BFIA 2VLLB 5FYJL 5CP3H 2BNQB 2K7QA 2OZ4L 3REVA 3BDBA 1ZLSL 4XBEL 4O51A 5C9KA 4GBXB 1FNAA 1LDPH 5IB3A 1NC4D 1RUAH 3LS4L 3FRUA 5HYIA 2Z35A 4GOSA 4ODTH 4UTAH 3KYNA 4R4FH 5EPMB 3QUYD 2IALB 4NNPL 1BQHG 2B1HL 3VWJD 1MFCL 3VXRE 1RUQL 2W9DH 2AXGA 2I9TA 2GUOB 4LU5L 4N0UB 5ESVA 5ADPH 5A2FA 2WBJA 4XT1C 3AU1B 4KTDL 1RULH 3C6LC 2UWEA 3WFEH 4PJDA 1CT8B 1JNHB 3BXNB 4MJIA 5HVHB 1FDLH 4ETYA 1YEKL 5DYOA 1OAKH 2BVQB 2HFGL 4N0UE 4NNYB 3KDMA 2RBLA 4DEPC 4PJ8B 2E7BA 2C3HA 2VXSH 3G5ZA 3ZHDA 2LVEA 1I9RL 4JKKA 1DSFH 1C1EL 3ARRA 4JPIB 3WNOA 4WFEE 4EVNA 3VXME 1ZA3B 3N85H 4M7JH 4M8QB 2P8MB 1F5WA 2YSSB 4CU6A 1BFOA 1AFVH 3KPRD 3KPMB 1Z3GH 4WV1B 1TJGH 3O6KL 3DBXB 1R3LA 3FN3A 5CD5C 2M1KA 5HI3D 4WJ5B 2WWKT 2AJUH 3T2QA 3HMXA 2D03L 4MJ5A 1C08B 1FYTE 3KPOB 2EYSB 3IJSA 2AQ2A 1CF8L 2VLKB 3MRQB 4KTYA 3VG0H 3FHAA 5AUMA 3LV3B 4LVNB 3SGJA 1DBKH 1R5VA 5MENA 4PJ7F 5FKAA 3QJFA 2F15A 3VXMD 3IS1X 4AENB 5TE6L 4OZFA 2WW8A 3VXSE 1J1XH 4E41D 1J0IA 2NXZC 1I7ZA 4H0HB 4PJCE 3QWRA 1U3ZA 3F7VA 5CJQH 3ZTJG 43CAA 2VDQH 1A1MA 1SBSH 3T8XB 1VA9A 1I1CA 4WU7B 2H1PL 5IEHB 1AD9A 1QR1B 1G7MA 3RIAK 4D9RD 4PJ5B 5DHVH 2CPCA 4QXUL 1EO5A 2OR7A 1B2WH 4O2EB 3U2SB 1BZ9B 4P2QA 1RIUH 3C6SB 4H0IA 1T3FA 2OS7A 5CEZD 5T3XD 3P4NB 1FZOB 4Z7OF 3W0WD 2IGFH 3WIHA 3GSOB 1I9RH 5C9JB 3TNNA 1SEQH 3LHPL 2OI9B 4OCXH 2F5BL 3AM8C 3RI5F 3UPRA 3QIUA 4Z7VE 2JB5H 1ACYH 1K5NA 4PB9L 5BXFB 5DVMA 4HWUA 1FL3B 3MCLL 3S7GA 4PRPB 2EZ0D 1A5FH 3WLWD 1NEUA 4P2QE 5FA3A 4Q9BA 1BIIA 2GSIB 5C2BL 5AD0B 1UACL 2BNUB 3EOBB 2D7TL 2R9HD 1F4YL 2Y5EA 4DZBA 4HCRA 2AEQL 5HI5C 4K3DL 1BX2A 1R3KB 3MRMA 5D70H 1MNUH 1I1RA 5E4IA 3ARQA 1T89A 4MA1C 7FABH 1CDCA 3AU1A 5IB4A 4NM4L 3ILQD 5TE4L 2UWEB 3HS0B 1D5BA 4Z7WA 1UCBL 3JWDH 3MJ9L 4W4OA 1YEIH 4K9EL 1KJ2H 4PRIB 2FATH 4FQHB 5CZKA 1CQYA 2P8PB 4ZNEA 4XZUB 1U92A 4Q9CA 4Z5RA 5GS0L 2X09A 4FQCL 2Q87A 2V2TA 4FQLH 4Z0BH 4GBXA 2ICEB 4CMHC 1OAYL 2F8XC 4O5LL 4WFGE 5C0DA 4J4PA 3U9UA 3B9EA 1AXIB 3B3IA 2HVJB 8CGTA 4NSKA 3QCVH 4QYOA 5DMKA 1JRHH 4PTUA 2H8PB 4NQCB 3S35H 5JOPE 2UV3A 3GHBL 1JUFA 1CLCA 1YN7A 2A9NL 1CXLA 3EOYG 5IG7B 5EH1A 3O8XD 5FYLH 4IRZH 1R5IB 2HFEA 2P5WE 2VITB 3FB8B 4HZLA 1OPGL 4KROD 4DFIA 1FIGL 4GMTH 4TUJA 4TUKL 4TUKH 5E08H 4DGIL 1IMHC 4HJJH 5JNYB 3IDGB 3FFCB 2YPLE 4LDLB 4LCWB 5D2LA 1OTTC 3ZE1F 1OGAD 2ADIA 2X4SA 2DTMH 1INQB 1NAMH 2F53E