1Q9LB

S25-2 fab unliganded 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) heavy chain
total genus 42
structure length 222
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB01
3VG0L 1YEKH 3QNXB 3TA3C 5I18H 1D9KC 5EORH 4X6EB 5FYJU 4YXHH 4ZO8A 4U6VH 4N8CH 1NCCL 4N8VA 4M8QA 4OZIA 4G9FA 5DJYB 1INDH 5JHDE 5J3HD 1LE5B 1OF2A 1AD0A 4JPWH 5KANG 3OKDB 3UEZA 3V6OC 3BRDA 2YUVA 5C0BA 1KCUH 1AFVL 1TVBA 2Z8VC 3LRSA 3OR7B 3R06A 4OF6A 2YUZA 1S5IL 2W92A 4IEFB 4UT9H 1OARL 1MFEH 3C5JA 5EO9B 2B5IB 4HIIA 3K8MA 2Y6SC 4D0BB 4Y5YC 4OZFA 5BRZD 1L9MA 1XF3A 3PP4H 3RRQA 3W0WA 2OI9B 3KLSA 4MVBD 5J3HC 1T3FA 5B39G 4QOKD 2WLYA 3QUKA 1KEMH 2P47B 4ZPVB 4R97C 2J6EA 3Q1SH 2W91A 3BISA 5ALBH 1A4JA 4GG8B 4WI8A 2GJ6D 5FM5M 1C5DA 3SE8H 3BSZL 4HMDA 4P2QD 2VMFA 3S3SA 1T1XB 3S37X 3T8XA 5KANI 5K9KB 1N7MH 4O51A 1N5AB 5IOPB 1DDHB 3MBXH 1UCBL 4NCC2 4ONGH 1Q0XL 2JLLA 1CG9A 3TA3B 8FABB 3QUML 4XGZA 4HK3J 4PRPE 5F71A 1P2CA 4HIHB 1LD9B 3T3PE 3QG6B 2WBJD 2A83A 3MJ9L 4MCZB 3T08A 2HKFL 5C08B 4WDIB 1UB6B 5T3XL 1YQVL 3JV0A 4O4YL 1H0DA 2Q76B 2A83B 4QRRE 2GEEA 3SJVA 3D85D 1J0KA 3IRPX 4L4TB 3LKRB 1QHOA 3S36L 1FH5H 2VLRB 3IXTA 5JW5B 2UY6A 4EI5B 1YEFH 3WE6B 1K5NA 1KJ3H 1NMBH 2CIIA 1A9EB 3F7YB 1JVKA 3B2VH 4GKSB 3MYJA 5IBTL 2G5BB 3U4BL 3SKNA 2QQKH 4OZ4A 4ODSL 3IXAA 5JW4Q 4L8SC 4U6XA 5LGHH 4E5XA 3RNKA 4HUUA 5C0RL 3DRQB 3O2VH 1J0JA 1KCRH 2Y23A 5ISZB 1TCRA 5IQ7H 1NAKH 1CTNA 4NQVB 3F58L 5ID0B 4RMRA 4NN5C 3WHXB 1MAMH 4TULL 3VG9B 4KKNA 1IAIM 1E4JA 1DLHB 1R3LB 3HNVH 3TIDA 4G8FA 1QSFB 4L9LB 5SX5K 3RZWA 4P0DA 4ZUWB 2HLFD 1FYTA 2QR0A 5SV4A 5FO7A 3CC5A 4M7JH 3RUGE 3TJHC 1HQ4B 3UTTB 5EU6B 1PDKA 2F54E 3BD5A 4HKZB 5CEZH 4EEEA 3UYPA 2WP3T 1QPXA 2CDEA 1VA9A 3F7VA 1IAKB 3ZDXF 3WFDH 2IPKA 5GS1A 1U0QA 4PJDF 5B22A 1QO3B 2FO4A 1I9RH 4G7YL 1EZVX 3GKWH 3D25B 3D69B 4QRRD 2CXKA 3MXWL 4U1LA 1NBVL 2FGWL 3RAJL 1YY8A 2AJUL 2ED7A 1IM3B 4K8RL 5L7XL 3VA6A 1QP1A 3QCUL 3C9NB 3BYYA 4G6FD 1TJIH 5MP6H 3GJEA 2BNRE 4H8WC 1NCDL 1NLDH 4O2EA 3T04D 5HYJB 3RVVD 1OSZA 1UM6L 2N4IA 2VZOA 4NQCD 5IBUB 5IFJA 3MV11 3SPVB 2RCSL 1IGYB 5FDWB 4LEXH 3C60A 4M7LT 5JZ7C 3TWCL 2GJZB 2APXA 4LSDA 4QTHA 5F9WC 2F53D 3CVHB 4NZRH 2DQHL 3FZUD 4LSSH 4XPTH 3PXHA 2GFBB 1HSAB 1HKLL 3MQIA 43C9B 2W07A 1KNOB 4FNLH 1OAUH 4PJHE 1YY9C 1FZOB 1HSAA 4XPAL 4HPOL 1OD9A 3TPKA 3D85A 3OSKA 4Y4FB 5CBEA 3O41B 4H25B 2BCKB 3BKYL 3PWVA 2YMXL 5DJ2B 1BVLA 4LASL 2FSEA 2R2BB 3BIAX 3OZ9H 5CBEB 4ZS7L 5BO1L 4DTGH 2DMKA 4PRIB 4EVNB 1AR1C 3HE6D 4G8IB 3BGFB 1Y6MR 5E2VH 3U7YH 1BD2B 4G9DB 5E4IA 3HC3L 3MZGB 4W6WB 2XT1B 2ZOKB 2A0LD 2HFGL 4I3SL 4MMXC 3OKNA 3BGAA 4L3CB 5DC0A 2VDQH 1I1AA 5EU7E 4P5TB 2BHYA 1LO0H 4Q9QL 3HZYA 3RVTC 1MI5D 3RWJB 4RA0C 1VADA 1J0HA 4EJ1C 4H20H 1OHQA 1CGSL 1BFTA 3B9DA 1MUJB 1NUGA 3LOWA 4CJ0A 3W11C 4EIGB 5CEXB 5C0JA 4FZEL 2QKIB 5CJOH 3KXFA 4H1LG 3B4NA 4Z7WF 4Y4FD 4ZDHB 5C0AD 3LZFH 1E4WH 3RU8L 1T1ZA 1WQVT 3MRMA 2NPLX 3CDGB 4PJ7F 3W11D 1AH1A 4R4FL 3S5LA 3QI9A 3QXUA 5J1SC 1KEML 1T1XA 3BH8A 4C4KT 4PGCB 4KKAD 1IAOB 4MJIA 3C09B 3PV6A 4RMVA 3MRGA 5DDHA 2MNUA 5LGJB 3MLRH 2A0LC 4C56D 2GT9B 5T5FH 3HE6B 3BQUA 2MCG1 4XCCH 3MRGB 3HLAA 1WIPA 2ADJB 1KPRB 1A7PL 3MODH 3QB7C 3H6JA 3TEUA 4P99A 5I8EA 1HDMA 1XR9B 1FZKB 3UDWA 1N59B 1OLLA 4NWUH 3MJ9H 2F74B 4XC3H 1L0QA 3CFDA 5F96L 1YQVH 3SBWA 4K8RD 2YPVH 1M7IA 3VFMA 2AK4D 5HHXH 2BNRA 5F9OL 3S36H 4RAHA 5A1AA 3HI5H 3BP6B 3ARPA 3UYRL 4RIRA 4OKDA 3TZVB 1G7MA 2YD3A 4PGEA 2K3TA 1OTUC 1V5JA 2NYYD 1KJ3L 4LNVA 3OR6A 3B2VL 3OAZH 2Z31C 1T1WB 4CDGC 1JBJA 1CDBA 5IBTH 4ODSH 2YPKB 1YNTB 5EUOF 4UIMB 1T03L 4RAUA 2FX8H 1RMFH 4U3CA 5DK3A 4Z7NE 1A7OL 5D72H 4XP5H 1NGWA 3T0DA 2NTFA 4RX4D 4ZNEA 2FR4A 3ARGC 1A7NL 2I5YL 3DHMA 4OCLC 5INDB 3NFSL 4QHKJ 3SE4A 5BQ7B 3WIHA 4EDWL 5GS0H 1BVZA 2H2PC 1YEDA 3F7PC 5D7JD 1IGCH 4H1LA 5JQ6L 3D6GA 5GIRA 3KPSE 3QH3B 1M7DA 1EEYB 2MOVA 4Z7UA 3DO7A 1LEGA 3O6LL 5EO0A 4QHLA 1S7SA 3AB0C 3EJYC 5D1ZC 3RVXC 3V6OA 1F58L 5E8OB 1U8NB 2NY2C 4KDTC 4Y89A 1GIGL 1T04B 1J1PH 1X5JA 5JXAH 4X4MA 4NO0D 3ARQA 1UWXK 2JJWA 1D9KA 4NUGH 4KTEL 1CGWA 4PY7B 2D4DA 3ARZA 3BGMA 2BC4A 3MUJA 1G7JB 3W9EB 5CGMA 1G0DA 1E28B 2NX5B 3VWKA 3FCTA 1T0MB 3OHXA 1A2YB 4F9LC 3HPLA 4G7YH 1F42A 5TF0A 4M7ZB 1H8NA 3PGCA 1VKXB 4OIIH 4HKJA 5SWSA 4EQ3A 3OKMB 1ZT4A 3WIFB 1DE4A 3U36A 4F7EA 1DBML 5F9DC 4QXGH 1J88A 2FZ3A 1T0NB 4JPVL 5DUBB 3L3HB 5ISZD 3QXDB 3ET9F 5IM7A 2R2HB 1BD2D 4LMQE 5MP6L 2UWEE 1MFAH 4I3RH 2V2WA 3GMMB 1J11A 2X9XA 1ZGLM 5TH2A 4PB9H 2PXYC 4UQ3B 3QJFA 1UM6H 2R2HA 1UM5H 3KJ6L 5I1DB 1ZLWH 3QZWA 2E7HA 3RWEA 1U95A 3PWNA 4PJ5A 1OAYL 1V3JA 1XGQB 4JM2C 4QRQA 5HYSG 5JA9A 4EI5D 2XQBH 5CILL 1VERA 3KLAA 4HUXB 1ACZA 3RY5A 5T1DH 43C9A 2R0ZH 2V5YA 2YZ8A 4QOKA 3BPLC 4QF1A 3VE0A 4XPTL 3QNYA 3IDJB 2AEQH 4Z95L 1AHWB 3TNMB 5C9JB 5HHVH 3U30B 2P5WD 4LVEA 2MQ3A 4MLIA 1XF5B 3HI1B 3RTQB 3VFWB 4JFHD 4WI2A 1EERB 2BJMH 1TZGL 3MA7A 1KIPB 1BJ1J 1CLYH 3H9SD 5D2NB 1Q9OB 3Q5TA 2XIDA 1HWGB 5GRUH 4FTVA 2FATL 1C8PA 3ZYIA 4GRLC 3NGBC 2WIIA 4M43H 3VG9C 2MJWA 3GSNA 1A21A 4OD2B 5I15L 3X13B 3EOAA 5GZOC 1XCQA 4WFGE 5CINH 2V2XA 4F8QA 2H9GA 1TQBC 3U7WL 4RGOL 3HG1A 4ZFGH 1NEZA 2AP2A 5HPOA 2DQCH 3ARDD 5DGQA 3HB3C 3I84A 3RNQB 4JEGB 4G5ZL 3VXOB 3X3FH 3C8KB 3ULSA 5JHDA 1TXKA 4IRZH 1JI2A 4R96A 4UZGA 1T89A 3ZKXB 1U8OB 3NTCH 4M3KB 4EDXB 4I5BB 2HH0H 4QCIB 3Q6FA 1EXUB 5GSVB 1LD9A 2ENSA 1JWUA 5D7KD 3SEPA 2FWOA 2D0FA 5D2LF 2QHRL 3TO2B 2Y6SD 5L2KB 3ZE0E 5T3ZD 3VMPA 3QWQB 4JFOA 1LP9F 3TBWA 2QV2A 2WUBL 5D7LA 1KCVL 3RGVB 5KVGL 2QLVB 5ACZB 4ESKA 3HZMB 2JTDA 1P84K 4Y4HC 5DA4A 1UB5B 2PO6D 2GCYB 1XEDA 1L7IL 1V3KA 4P23B 3S96A 2ZUVA 4NUJB 3ZDZE 1MLCB 4NM4L 2BOBA 3SDDC 1OB1A 1EEZA 3OAYK 4BSJA 4F7CA 2BHUA 1KIQB 2DOCA 3P77B 2Y5EA 1VHPA 4IRSA 1A7PH 1H3WM 1T5WA 4OIAA 5E8PB 3FT2B 5F6HJ 1NANI 1X5AA 2KZWA 2HJLA 5FYKU 3WHXA 3G9VA 1T7WA 3KS0H 4XPFH 5ESQB 3BUTA 1MFDL 1FYTE 1S7XA 4WFGD 5AZ2L 5F7WC 2ICWB 1UJ3C 5EIIB 2IGFH 4LPTA 3VJ6B 4Z7UB 1FRGH 5TE7H 5I19H 4L9LC 1AI1H 5AUMA 4WU7A 3WMSA 5JR1H 5T1KD 3PHQA 1JPST 4P2QB 4NP4L 3ZKSD 3QI9D 3VWJC 5ILTH 5HYFA 2VNCA 1MCWW 1KJ2H 5LWYL 4QHMB 4DVBA 2NY4B 3HCVB 2XN9B 4BFGA 4PJ5E 4OBRA 4A2MA 4XXCA 3QHZH 5SX5H 1Q9LA 1IM3A 5DHVA 3KS0J 3SDDB 1T03H 5DVLA 3K1DA 2ORBH 2ZWLT 3WFCH 4V2BA 3D69A 4RFNC 3VXME 4DKFH 1OPGL 4OSUL 4ZFFA 5KSBF 1XF4A 2BY0A 3VRLF 1FG2A 1B4JH 4KKBD 2ICEB 3K4DA 1LE9A 5EH1A 3RL2B 2RJMA 1LO3L 5DJAB 2E7LA 1XGTB 2FECL 2H6PA 1QEWA 2P8PA 2ESVA 1UM4L 5EOTA 2AQ2A 4FFVC 4P4KC 5JA8B 1LDPH 4U0RB 5D1ZA 2XQYK 4G6ML 4PGBB 4KMTL 2GFBA 3SDXF 2DLIA 2VXUH 1JYVA 1JPFA 3SDDD 1YN6B 5BV7L 3CSYA 1KIRB 5K9JH 1YPZB 2AJXL 4M7KH 4R4ND 2IFFL 3AMLA 3MRCB 4Y1AB 1V3LA 3VE0B 1IKNC 1I3RB 3SDCD 4O2FB 2MQCA 5H2BA 5IMLB 3BESR 3BZ4A 2DJUA 2P45B 1RJLB 1VGKA 3RGHA 4HIIB 1T4KB 4V1DD 4XNYL 3MA9H 4O2FA 4X0KA 1BGXH 5I2IB 5EOQH 4ODUB 4OIIL 1ZVSB 1KIPA 5DFWH 2C3GA 4BFEA 2FECI 3T0BA 5GSRA 3EFDL 1VFOA 5GZNC 2Y25A 4HX1B 4HGWB 2DQDL 4JPVH 1UWEH 1P9MC 2ZOKA 5H35B 3GHBL 1X4XA 3OQ3B 4ZXBC 5TQ0H 4ZD3H 2Y7QB 4HGWA 4X8XA 4PIRF 4QRPB 1HQRB 1MFAL 4I3RL 2ZG2A 3MRMB 1IKFL 4IIQC 1AXSA 1OTTC 4BSVB 1DN0A 2XTLA 3K0WA 4OM0H 3GSQA 1TITA 4UNUA 3RX5A 3U6RA 1DANT 2H2SD 2EDQA 2UYLA 1CU4L 3PV7A 4DKAA 5DRZB 1F3RB 3DETD 4BSVA 4XP4H 2Y5TA 3DXAB 4JG0H 5CILH 1F4YL 5EN2A 3O3EA 2QTEA 4MCZA 4NQCA 2Z8WC 3IDMA 3WLWD 5EPMB 1ADQA 2UZYB 3CFKB 4UU9B 3CX2A 2B1AL 4PBVC 5JPMB 3MV8B 2BDNL 1QLFB 1R5IA 4JHAL 1CFNB 3MR9B 4MQ7B 5JPNA 1CGYA 4BQ6A 1TZGH 1WAAF 3EYQD 1FVEB 3ALXA 2NY5H 1EGJL 2CDFA 4MQ7A 4CMHB 3MACL 5HGBA 3O81A 4MJ6A 4NFCA 4LLQA 2P8MA 1EBAA 4RNRB 1R24A 4IMLB 2EYTA 1WLHA 1CE1L 4NZUH 3AREB 1PQZB 2F54B 2DL9A 1KPRA 1JWSB 4PY8I 4PLNC 1IQDB 4I77L 2DI9A 4RGOH 4BH8A 2OXHA 3PGDA 4WEBH 3TPUA 3FFCA 4WW2A 1N26A 1FP5A 3TBSA 3DX6A 1WAAE 3VD3A 1EGJA 1RULH 4OB5L 3MRBB 3VRIB 3ZDZF 3HPJB 5C86A 2C3HA 3OJMB 4IRSB 4IRZL 2EIZB 3P9MB 5E2WL 1A3LH 1T21B 1Z2KA 2UV3A 1MLBB 3AU1A 4CVZB 5FHBL 3N9GL 2RB8A 5FYKH 4FFYH 4BUHA 1ZWIA 3A67H 2DQJH 2O5XH 1YYML 5CGYC 4LLVB 4HF5H 4HW6A 4Q6IC 4RX4A 4U05A 1BF8A 3V7MA 1K5NB 4LCIH 5DD3H 2C3VA 1QSEE 1CDUA 1R3HA 2VLKA 1I9IL 5CEYB 5KVGH 5D7JA 4M6NH 2YA2A 4UIMA 2XA8H 3N85L 4FXKA 4TOYL 1A6PA 5CIPH 4U1NA 1HHHB 5KN5B 2Y06L 3GB7B 5TE6H 5I6XC 4JKWA 5LBSH 1ND0B 3UTSE 4EN3D 3CH1B 4XP6H 4RQQA 4R8WH 4O2CA 1B6UA 5I30L 3GB7A 5AAWA 3CZFA 4YHPA 1NLBH 3BN9C 3IJSA 1E4XH 4QWWC 3O9WD 3TN0B 3OAUL 4I9WE 2NNAA 5HYQB 2W60A 2DLFH 4MD5B 4LGPB 3MLTB 4KK5C 1IM9B 1MNUH 5F7KC 5C7XL 3MREB 1KEGL 2ILLA 3MV8E 4GXUN 4N9GB 3A6CL 3WO4C 1V7MH 1XGYL 3KPNA 2A77L 3RVWD 3ZYOA 3QQ9C 4AL8H 2R2EB 3IVKB 2IGFL 1DQMH 2GKIA 1FRGL 4FQPA 4OLWH 4PPTA 3LRGA 4XNQA 1CD1B 4PRID 3OJDA 2M2DA 3QIUC 2Q3AA 3P0GB 3OG6B 4R4BA 4XVTH 1U2CA 2R29H 2NLJB 3NGBB 3LN4A 1TETL 5DF0A 4RRPG 1FE8L 3SGEH 4Y1AE 1X5HA 2J5LB 2YN3A 4HKJB 2NY3D 1OTUD 2ZCLL 4U1KA 4ONHA 1OF2B 2MFNA 3OKDA 3SGKC 5FO8B 1Q1JL 4DKFL 2PW2B 4PJCA 2BSTB 5HPMB 2HT4D 5DK2B 4OLUH 4OI7A 1CIUA 4PJCB 1VDGA 2A6IB 3FQTA 3MRIA 1JRHL 2FLRT 6FABH 5MEQB 3ORJA 5DI8B 4KK5D 2GITB 2R1YA 3SCMC 1JYXA 3SGJA 4H8WH 2GSGA 2VQUA 2FEEI 2VLLB 5D93C 5DMJB 5FCSH 4XB8A 2IJ0C 3QEQE 3MRCA 1AGDA 1M6OA 3H9HB 5CSGA 4D9RE 1Q8MA 3HZYB 2VXSL 3IFNH 4AH2B 3RTQA 4EN3C 2GSIB 2M26A 5DMGD 1KJVA 1R3JB 3LS5H 1DN2A 1XCTA 4B7IA 2O93L 3GEWB 3RKDC 1U91A 4F8TA 4JM4L 4TVPL 4HMCA 1D3CA 1U8JB 3U0TA 4NCC1 2VZUA 4K7PH 4P5MA 2EDDA 5JPMA 2VERN 5JORA 4NCDA 5TDOB 3QEUB 4XNYH 3V6ZA 4PRIA 5EWIL 5EOQL 3MRFA 5GGRY 3SDAB 1GH7A 4NQED 4XCYA 1GC1C 1VGEH 4HUWB 3KPSB 5IT2H 1GC1H 2VDLL 2CDGA 4NC2B 4GSDL 1MFCL 2J12B 4ZPVA 2XPGB 3ULVH 1KG0A 3N1MC 3NIFE 3ARDC 3GSNB 4GUPB 4HJ0D 4WVRA 4JFPB 5F21B 5HI4D 2LAAA 4LHJB 5F7EL 5BRZA 4X4YB 4K71B 3TM6A 1YPZE 3GIZL 3G6AB 3ULUL 3DO3A 1K8IB 4DAGH 3LKSA 4L1HA 4PJDE 5CLWA 1HSBA 2V2TB 4B41A 4MNGE 1RFDL 5AZEL 2Y1VA 1Y6KR 2IH1B 2B7DT 2O61B 3DX7A 4E41D 3PWJB 1DTUA 3DMMD 3D39A 2VDNL 1FBIL 3KPOB 4GAGL 4JDTH 1LEKA 2JCCF 3V79C 5KSBB 1BIIB 1JJUA 3LHPH 3VH8G 1GPOL 4URTB 4HPYL 3HAEB 5KVDL 4KKCC 5H94A 3G04B 1OGAA 3DV4B 2B2XH 4HS3B 4DOHE 2ZPKL 2OQJB 4C56E 3TBWB 2EYRA 1K6QL 3NH7L 5HVHC 3REVB 1H5BB 2GK2A 4X5WB 3MACH 2IPTL 4EI5C 3DVIA 3SJVD 4RBPK 2EDBA 2W9DL 3MYJB 5E6IB 2XICA 3WLWC 1JZ4A 4WEUD 4N1EA 4W4NA 2PXYD 4JGMA 5L0QB 3EO1B 4PV9A 2V7HB 4R7DA 5JZ7D 4AEIL 4XNXH 4C4KO 2YWZA 3VMNA 2VTFA 1IM9D 3T3ME 2EIDA 1RULL 4CDHA 3IRZA 4P2RB 1HHIB 5KAQG 2VDPL 4X6CA 4Y19E 5D1QC 3GMPB 1R6VA 4YPGA 4B53A 4P2QA 2R56H 4ZFFB 5I71C 2YD7A 4OKVB 2HJLB 2GK0A 4Y4KD 2X4RB 4Z77B 2EC9U 2QBWA 4M7LH 4HEPG 1SYVA 5F6IC 4V1DB 2FJHA 3A0OA 4D0CA 1FNLA 1QEWB 4LCIL 5DD3L 3T2PA 2IBZY 5DJDB 3RKPA 4PJ8B 2R23B 4HKZA 4NQSB 4OF0A 4LDEB 2CKBH 2WIMA 2H32B 4MB5A 4MLSA 4JJHA 4K3GA 4DVBB 4YHNB 3N85H 3HCVA 1JUFB 5AG8A 5DJDA 4KXZH 1S8DA 2R23A 4WV1C 1FNAA 1FO0A 2E7MA 3MRRB 3WNMA 2W65A 3U30C 2JIXB 4POZC 5TE6L 4OLXL 3NCYP 1QO3A 1J0YA 2BXZA 2FO4B 3V0WL 5CWSB 3BZFA 3GBNH 5ERWB 5LGKA 2GUOA 4NQDE 3WV0A 4XCEB 4PBXA 5I30H 3QG7L 4G6AD 2IALA 3TJHD 3GSXB 3PABB 1E4XL 5JXEC 2GUOB 4X98A 1W72L 3U4EB 1IGFH 4LIQE 4PRIE 3CCHA 2I60L 3TNNB 3IS0X 1WEJH 1QOKA 2R2EA 5J1AA 1KEGH 2GJ6B 3Q5YA 3ZHKA 3B3IA 1YN6A 1R5VA 4RFOL 3P2TA 4YBQC 3MO1B 3H9SB 4YXKL 4AL8L 1BX2B 1HI6A 3VXSE 1PKQB 1LEIB 4YZFE 3B5TA 2I9TA 4JFYA 3D18A 2YS4A 1RV6X 4IIQA 5DFVC 2V5RA 5KSVB 1J8KA 3UTOA 4JFYB 3KYNB 1CT8B 1X5IA 1KSRA 4PS4H 4UILH 5B21A 4WV1B 5IHUL 4PD4J 3DRTB 1HH9A 35C8L 4PRPB 4RGMB 1FYTD 3ARXA 2ZCLH 5DT1L 3G6JB 2VZ3A 5T1KB 3E6FA 3P4NB 1FZOA 1DUYB 5DK0A 2A6JB 3RIAK 2E6JA 2J1KA 4GT7A 5B8CA 1CGUA 4YX2L 4JQIH 3ILPB 3PHOA 5MENA 1Q1JH 4X0KB 3MRPA 1MI5E 3KXFB 2R4RL 2CRZA 5B8CB 5ICZB 3OGCA 3RWDB 1R5IB 5EOCL 4N9OB 1J8HD 1UKTA 5ADPL 2A9NH 2ID5A 4PJIA 4K3HA 1NAMH 4NRXA 3SDXB 1F6AB 2AI0L 4WI3A 3PWPD 3W0WB 4DEPC 6FABL 1U36A 2VITA 4PJIB 1KACB 1CFSA 2WV3A 3QNZB 1BJMA 3I9GL 1AD0B 2ED8A 5I0DA 5EU3B 5L8KB 3HR6A 4JANA 5JNYB 5AYUL 5AD0A 5C0IB 2P5ED 3R06B 3MLUL 4HWZB 4APQA 2Z35A 2VXSH 3PJSA 3RA7H 4JFDE 4P4RB 4L8DB 5EDXA 4AT6B 4PJGF 3G6JF 4WTXA 4WW1A 1CCZA 5D2NA 4XHQA 5CCKL 5IR1B 3LN9A 3AY4A 1CR9H 1URLA 4G80A 3T2NH 2A74B 4QXWA 3SKOB 4F15B 4BJLA 3I75A 5HXMA 4YUEL 4FQLL 5CD5D 4OD2A 3LCYA 4P2OA 4LP4A 4I18C 4JRXD 1IEBA 4XMPL 5IT2L 1QBMH 5ESVA 4HWNA 4GAJH 3VXQB 3SE8L 5BRZB 2AKRB 4ZNCD 4NZTL 32C2B 5E6IA 3NFPB 3VCLA 1ZA3A 4ONGL 3TFKD 4MXQD 3VGAB 5J1TC 1J10A 3L3JB 1ZHBB 5FA3B 3V4VL 5FEBA 4KXZI 4XXDA 5GPRA 4Z0XA 3CMOL 4RMWA 4R90L 1ZMYA 1JHKL 1ZSDB 2X1OA 4OFIA 2NW2A 2AV7B 3IJSB 3EZJB 5DMIL 4CUCA 5F9JA 1MLBA 3LS4H 4WJ5A 5KVDH 1ZOXA 1AGFA 1FL5A 2DI8A 3W5MA 2YPLB 5DHYA 1CL7I 1SM3L 3DX8A 1HEZA 3NIDF 4NKDB 2VXTL 1JNJA 2ZPKH 1ZLWK 3WXVH 1HHHA 4D0CB 1NMBL 5HHMD 3F6IA 3FB6B 3ARYA 4HBQA 1ZHKB 4F9PA 2IPTH 4JY5H 4ONOA 3QO0A 1R0AL 5LGHL 2HVKA 4PRBA 3B9EA 1MRFL 4KQ3H 1T7YA 3O2VL 1CD1A 3NBNA 3BP7A 2OTUB 3MRRA 4Z76B 1BM3L 4NRYA 4ALAH 4YBLC 1BQHA 3FOMA 5GS2H 1RSFA 3FL7A 1NAMB 5CWSA 4MA7H 4WWKA 2OYPA 2JCCA 5D93B 5HY9A 1CQKA 1TVDA 3S7GA 2IALB 1MJ7L 4KGLA 4WO4C 3O3AA 2VABB 1P7QB 1JMZA 1PD6A 1VFBA 1PX3A 2BK8A 2NZIA 5FYJL 3MRNB 2FEDD 3RTQC 3TBTB 2R56L 3JTSB 3O4OB 1OT2A 2EEDA 2YA1A 4PJIE 4ELME 4QXUH 3O3DA 4QRUA 3AMKA 1W0WA 1FZMB 2FNBA 4LCUA 1CF8L 1K85A 3BO8A 1S7TB 2JB5L 1Z9LA 4M5YL 5E7FA 1IGMH 1JGVL 4Z0BL 4OZGE 4M1GH 4QTIH 4GO6B 1PG7X 1UXSB 4O02L 1ZLVH 1JGDB 1ETZB 1GGUA 4NPYA 1GRWA 1JGLL 3Q5OA 1WIUA 3KYKH 3GMRA 4JZNB 2FH8A 5JHDD 1NGXB 3MXWH 1TJGH 1FVDB 3MV9E 2YHGA 4PJEE 3TN0C 2OI9C 5GJTL 3ARGA 1P69B 2YN5A 1CGTA 4KRMB 4WO4B 1J9CT 3WJLA 3RTQD 3NA9H 1QLEL 1HWHB 3HMXA 3V4PH 2QSTA 2AGJL 1NCDH 5I8CB 5C8JA 2NY2B 1L4IA 1WFTA 2P5WE 4KJWC 4LCCA 2PYFB 4HFUH 1RK1B 4JFHE 4OGXL 2WIIB 3ARSA 4MCYA 5FUOL 1MCQA 1CFSB 1N4XL 1N6VA 4IOFD 4LQ1A 4QKXB 3WEXB 5L2JB 4I9WD 4FQCH 5B4MD 4GKZA 1MF2L 4G9FB 1JHTB 1FVCB 2DWDB 1CK0H 4M61B 4Q2ZA 4WFEE 5DJYA 3HG1B 3WFZA 3ROLB 3O3EB 4IHOA 4XRCA 4LIQL 3L7FA 5D70H 2HG5B 3OKNB 1DL7H 5KG9B 1EJ6A 5E8EA 2DIBA 4CVXB 1YYLH 3QG6A 4MA8H 1T20A 2NYYC 4HWBH 15C8L 3HG1D 1YEJH 1WV7T 5JPNB 1WIOA 4YR6A 4OTXH 2P44B 1I85A 3S34H 4FQ2H 3WJJA 5DSCB 4OAWA 5CMAB 2X9WA 4J6RL 2E6PA 4OUUB 3OAZK 4JFOB 2X4TB 3QDJE 1Q72H 2I07B 3F65A 4GRLB 1CFQA 4GG8A 4UBDC 2DYPD 3UTPE 1A6WH 3X13A 2JB6B 2EYRB 5I6XB 1KG0B 4GG6F 3WIIH 3MYZA 2VDMH 4I3SH 2FD6H 3O8XB 2Y07L 3IJHB 4PREA 1F11B 1JCKA 3BEWA 1RU9L 2YOCA 2CK0L 2VDQL 3D39B 4OCSL 4G9FE 4APQB 5TJWK 2DM4A 4IRJC 2B4CL 3NN8A 1JZ3A 2AQ3A 5LKNA 1I1FB 1I8MA 4XXDB 3MLUH 3MLPA 4WCYH 5J4MA 4TTGA 2R4SH 4WDIA 4Z18A 3DYPA 1J7VR 1RY7B 4PJFF 1KPUA 4K9EL 5EU7C 5CD3A 4MB4A 2NW2B 1FL3A 5DTFA 1CR9L 1AO7D 5SWQB 1Y0LA 3DGGA 1BLNA 1FNEB 1DLFL 4U0QB 5DQ9A 3ARBA 5ESQA 5DTFB 4YUEH 3K4AA 2IQ9L 4UOW0 5E2TL 3FMGL 3NIGF 1RHHB 3IB4A 4MHHG 5IFAH 2P24A 3WFBL 2DL2A 1GCFA 2Q7NA 5TF1L 3DSFH 4QRPE 4YHYC 5EB9A 5KS9B 3QULB 2YPKA 1T2QH 3IXAB 2YD8A 1PFCA 5GRVK 4M93C 5D1XD 1IAIL 1JZ2A 3SE9L 5I66A 4NJAH 4NYLB 3S37H 4RFNB 1EFXD 3QAZB 2F5AL 4APQD 1FGNH 3VGGA 1J1XL 4JY6B 4NYLA 1QFOA 2BP3A 4NBYB 4X6CE 1CDCA 4K3JL 4L8SA 2N56A 4ODTH 4R90H 1JHKH 5JMOC 5TFSH 5F96H 4H0GA 1QSFA 5DEFA 3SBWC 3QXAA 1I1AC 1AR1D 4JRYE 1IGTA 3OBAA 2DD8H 4DFHA 5T1LA 3PABA 3WKNA 3JTSA 1OP5K 1ORSA 1P4BL 1G7MB 5CLTA 4KJYB 3W0WE 5FUCC 1IC4H 3JSSA 3UYRH 1SM3H 4J3WA 5EOTB 3WXVL 5MEPA 5C09D 1P7HL 1XR8B 1KLGA 5EFIB 4PJGE 1IAII 3CSPA 4L3AA 3ZSTA 3CH1A 1UXSA 2H32A 1BQHB 1A7OH 3CZFB 5HTSA 1EV2E 4ZOCA 3BPCB 4NRZA 3G5YB 4FQQA 4JZJB 3RVUD 2FGZA 3UAJD 3SDDA 3RIAF 2C26A 3FB7A 4KI1A 3TVMD 1NDGA 2SEBA 2OJEA 5H2BB 3S36X 5GS0L 3S4SB 4XNUL 4Z78B 4LPCA 4S1RL 1MREL 2BSSB 4TQEH 5B3JE 1MJ7H 4X7FC 2DI7A 5E8OA 1NDGB 4RMSA 5IB5B 2XWJA 1PKQA 1LEIA 3O6LH 3GO1H 2HA1A 2R1XA 2A38A 4C56B 2QSQA 5GRXG 1BFVL 1BWWA 5ALCH 3QZWB 4KHXL 2NY4C 4FQIH 5GGRA 1CD0A 1NKOA 3HR5B 4KTEH 4J3OC 3IFLL 5I1EL 1IT9H 3QWOB 5I76A 4TUJB 4QF1B 5IVNA 4CU8A 3IAPA 3DPBA 4JKPL 4M1GL 1FAKT 4KAQH 3RP1A 5KSAA 1EEUA 3EYUH 3LAFA 1QFWH 2HWZL 1XGRA 3OKMA 4QO1A 4RZCA 1G7IB 1CLCA 5GGSY 1YEIL 3BE1H 4OZHF 2X2YA 1C5CH 1PW3A 2B1HH 4H88L 1XF3B 3QUXA 1K8DB 2X5PA 1MHHA 3N1GC 4NN7C 4X80L 3MFFA 4XPGL 1FGVL 2YBRA 1INQA 2NY7H 3IF1B 5E8DH 5GGUA 5JDSB 2BVOA 4P4KB 4Q9RL 2AGJH 1NL0L 3CFEA 1GVIA 3V52H 1SHMA 3I50L 1XGQA 4Y0GA 2ZZUT 2DDQL 5BMFL 3EAKA 2R1WB 3VRLE 3PL6A 5DD0L 2ZOLA 2IAMB 3ULVD 2YRLA 3BZEB 5HI5D 1FNFA 3ROLA 3KYAA 1EAJA 2V2XB 5C6PB 2AJ3A 2CGRL 3IU3A 5DVMA 2F5BL 3NFPA 3HE6A 3J8F7 5DRWA 5DEGA 3NN8B 2IAMC 4I5BA 4JANB 4NQEE 2I9LA 5D1QB 1LEKB 1S7UB 4P5KA 1MCWM 4NT6B 5IHLB 3FRPA 2X70B 3LKRA 3QCVH 4MA8L 4EQ2A 1XR9A 1PGRB 1UENA 15C8H 4R96B 2JJSA 4R3SA 5T1LD 1JL8A 4HFWA 4N0FB 2CDGB 4OTXL 5GRUL 2A74A 1PJ9A 5DD6A 3RPIA 3GFUA 4NZJA 1YNLH 4J6RH 2EH7L 4NBZB 4P23A 4O5LL 2WWKO 4U6XB 1Q0YH 1MAKA 2GQHA 3WO4B 5C0AA 4GQ9H 4XVUD 3KPTA 5F3HA 1EVUA 3U7WH 1MHPH 4NO0A 5SV3A 4P49A 2AK4E 3IDGB 2WBJC 5C07B 4XBEL 4RMUA 4JR9L 1UEMA 2FD6L 1LNUA 3C08L 2HLAA 4N0CC 3VI4E 5J12C 3QJHB 5ADOH 5K9OA 5IK3A 5A16A 1CLOH 3BP7B 4JHBA 4L3EA 2VZTA 5HDOA 1QR1B 4JLRB 1INDL 3RX7A 4I48B 3L7EB 3QQNA 3P9MA 1JTTA 1ADQL 4WCYL 3T0XA 3FQWA 3CZJA 1NCAL 3HAEH 2NNAB 4MS8D 2NR6D 5IJKC 2GJ6E 4GMTH 2ZJSH 4UT9L 3FAWA 3VFMB 1PKQE 5T1LB 5HDQH 4YH6A 2GCYA 4OGZA 4ZSOA 1DLFH 2NZ9C 5EG6C 3VGDA 3L5JA 3GGWB 3FB8A 1E4KA 1JPGA 3INUL 3VA2C 4RMQA 2DYPA 1QYGL 3U1SL 4Z76A 1QQDA 5D6DC 3UZQA 1U3HA 1XH3A 3O4LA 4L1DA 4WU7B 3WFBH 2XV6B 4XNMA 5ALBL 4HJGB 3L9RA 3FRUA 3U46B 2P5EB 1Q9LB 2HFFB 1U92A 5DJZA 1JNLH 4UTAL 5ITBL 3IDUA 4TRPH 4V2CB 1N7ML 1T66D 4P2RD 4XAKD 5IKCA 4X4XA 4NJAL 3VXPA 5E8PA 1ZTXH 4OD3H 2VJXA 3S37L 1OGTA 1U9KA 2GY5A 4KHTL 5D2LA 2XFXB 1A2YA 4PR5B 2X44D 2Z31A 2EIEA 3PGCB 2AJSH 4FP8H 1WJ3A 4J7RA 1RIVH 1OOAA 3V6OE 3MROA 2ZUUA 3D0VA 5J1AB 1BEYH 3MREA 5TFSL 5IFJB 4BA8A 2FJHB 2WW8A 3MXVH 5BJTB 2G9HB 5JR1L 3H9SA 2DD8L 3GSRA 4KZEL 1T89C 1OL0A 4G8GA 5CKAA 2VDRH 3LPWA 4XP1H 4IRSC 3CVHA 1SBSL 5J6HB 1F6FB 3OB0K 1ZHNA 5E4EC 5BZDB 4FQ1L 2J8UB 4FQJL 1J1OH 2GSGB 3Q6GH 5GGTH 1V05A 2NR6C 4PJDB 2EO1A 3ARGB 4OLYH 2AJZA 1YMME 2YD1A 4MNGB 5IESL 1J87A 4NKMB 3C6SA 1KLUA 1MHEB 3D85B 4Y4FA 3NVQA 4XTRD 5FYKD 3WFCL 5C0DA 1MCEA 3GSOA 4JFXB 4UMGA 1KLUB 4S11A 1IQWL 4XHJD 1K8DA 3VFOB 1MCFA 3L6FB 3EDFA 3ARFA 2UWEA 3V0VB 1RUAL 4C59B 4MAYD 4S1RH 4UI2A 5D9SB 4M4PA 4TQEL 1RZIB 4GAYB 1ZANL 1UKQA 1XF2A 3VFSB 2F15A 2W0LA 2AJVL 4P57B 4ZFOB 4F37F 3BN9D 4GKZB 2CRMA 5E6ZA 1G9MC 2X1QA 4LLDB 4L9DA 3X11A 1EAPB 4JPKL 1ZT7A 4OFPA 2AV1B 1BD2A 1BOYA 3TZVD 2IFFH 3BKMH 5C0IA 1M6OB 3TP4A 3IFLH 4GLRH 4P59H 2HN7B 2PXYA 3W39A 1A1OB 4JKPH 2VXQH 1TVBB 1NDMA 4AJ0A 3WFDL 2VAAA 1HHKA 3EYUL 3HHRB 4XX1G 3QDGD 4L3EE 4LPVA 5D5MB 4U7MA 3HI1A 5DRZA 1BECA 1KENH 3LEVL 1SJEA 2H3NB 3FN0L 4OJFH 3MOQA 3GKWL 3WUWA 1KTDA 2ZG1A 3U9UA 4JB9H 5IEHA 5BS0A 2WLZA 3EFDH 3QUXC 5D4QA 5CEXA 5A3IC 4U1IB 2E8YA 1WT5C 2AJUH 4UOW1 4ZAKB 4K23H 4K8RH 5JDSA 2DQDH 4QRPA 5DLMH 1IEBB 5BS0B 2E27H 4PGCA 3TVMB 4R97B 5FF6A 1FL3B 2H2SC 3RGVA 1FGVH 4IMLA 1SY6L 1D6EB 4ZD3L 4YPJA 2VOTA 4ZAKC 3FKUS 2UZIH 4KY1H 1NL0H 1BWMA 1QD0A 1EBPA 5CZXC 1UH2A 5IVXF 2H9GB 1CS6A 3IDXH 4Y5VA 2X40A 2ZOLB 3LQAH 4FTVD 5BZWB 4OM0L 4K07A 4YHIB 3QXVA 4PTTA 3VXTA 1CU4H 3P73B 3L95A 3SY0A 2EZ0C 2ATPB 1CXEA 4RSVA 3UJJL 3TWCH 4PJ8C 4UV4H 5CZXD 2DKMA 3BEWB 3DURB 3WN5C 2A73A 1WAAA 2YRZA 3L95B 5IWLA 4AM0B 3LV3A 4PUBH 3PWUA 3Q0HA 4EDXA 2EXYD 4JRYA 4NQVA 3TPUB 1H0DB 2IC2A 2H41A 1F2XK 3I3EA 4JRYB 2X1WL 4FQXC 4DZBA 5I8EB 1J05B 2YSSA 1IEAB 4MAUL 4U49A 3EYQC 1T21A 4RNRA 2X4QA 3TZVA 1MFNA 2IBGA 4K7PX 4J12A 5C2BH 1RURL 4PJXF 1RAMA 4DGVL 1C5BL 3OPZH 3OZ9L 1MIML 3WIHL 3MRLA 4PP1C 2EH7H 4NNPH 1QQDB 5H8DA 5D7LD 5J13B 4LSRL 1Q0YL 4U4BA 4E5XB 3U9PH 5F7LB 4GQ9L 4C83A 5E2VL 1MHPL 3P11L 3O6KL 4H0IA 1P84J 2RFXB 2EC9T 3EO0A 4UTBH 4X9FA 4NWTL 1FLRH 4Y16B 4AENB 3GM0A 5AWNH 5IVOA 3VXRB 4FA8A 4ODXA 4WI4A 1W8NA 3TVMC 3QRFM 5ADOL 4MNHB 3DBXB 2VQ1A 3ARDB 3AC0A 3JV6B 3QAZC 5JHLL 5KSUB 2AEWA 3FQRB 1CLOL 3FOLA 4HC1A 2VR4A 3MLWL 3W5NA 4JO1L 4ZOAA 5KSUA 3V5HB 2O5XL 5ID1A 1S7WA 1NCAH 1NCTA 1OT1A 2BNQB 1WBZB 1CFTB 4K3EH 3RWIA 2JF1A 4BSWA 1IRAY 2ZJSL 2VH5H 4EXPX 1IE5A 4JCMA 1E4WL 2JKXA 3RU8H 3WFEH 1TTUA 1NMAH 1NUNB 4D0DA 1QYGH 3D39D 1T04A 3JTTB 3DTXB 1HXYB 1PZ5A 2AXJA 3KDMB 4JN1H 4FN0A 4NPYB 3O2WL 1TCMA 1M71B 4XP6L 5J7CC 4R8WL 1GHFH 4UTAH 3S97C 2FHBA 3E2HC 3HAEG 3QUZD 4OF7A 1G7HB 1A6VH 2BRRH 3K74B 3MNZA 3MNVA 1MNUL 4MZ3A 1N6UA 1A3QA 1U8LB 4H25A 1F3DJ 2X89D 5J13C 4FP8L 3G5XA 2LABA 3ARED 1QVOA 2AXGA 4LAQL 2HTLD 2EH8H 1DFBL 5FA4B 1K9TA 1CICC 3TBYB 2DQTL 3PP3K 2BSTA 2YPVL 4P5TC 1U95B 5HYIA 4TUJA 2G5RA 4GKOA 5F9OH 2VL4A 3U0PB 1MRCL 3O2DA 4Y88A 2OR9H 5E6ID 3BD4A 2YK1H 4JZNA 3MUHL 2B8OT 5I1LA 1B0WA 1P4LB 1GZQA 3F5WA 4FQ1H 4PRNB 1CFVL 4J4PA 5DJ6B 1PEZA 1UQSA 1YMHB 4JRYD 4XBGB 1PG7H 4OLYL 4LARL 3WSQL 5IB3A 3RGVC 3QT2A 5DJ6A 3MBED 5CKGA 5D72L 1X5XA 4XP5L 2HMID 1KTDB 4M62L 3L3IB 5IW1A 4XZUA 1I7RB 5DJ2A 1IQWH 3WNPA 4RGNB 4UV7L 3VFWA 3H2WA 3NFSH 3ARFC 4TYUA 4G80B 5C0AE 1QFUL 2XKSA 1RUAH 5GS1C 3EOAB 3QIBD 2Q8BL 3O45A 4P9HL 2R1WA 5FF6B 4JN2A 3DIFA 4LKCB 4WNQA 5D1XB 4AIZB 2WANA 1DVFC 1IILE 2APFA 4RGND 4FTVB 4M00A 2PTVA 4TSAL 1NGZA 4L5FL 4OM1L 4AH2A 3GJFH 1A4KA 2FO1A 1Z9SA 1JHTA 4M61A 5HHOE 4CGTA 4OQTA 1U8KB 3PGFH 4YHIA 3AM8A 4S1DC 3V5DB 3NCEB 3QUZB 2AK1H 1UB6A 3MLZL 2WBKA 4N1HB 2R0WL 4P59L 3PG2A 3TBSB 4JFEA 3S6CA 3QIBA 1PX4A 4RISH 1JFQL 1B90A 4NKIH 5ISZA 1UXWB 1PY9A 3FN0H 1AE6H 4QCIA 4YZFF 5EWIH 4PJAA 1AQKL 5T3ZH 4G43B 2ZUTA 5B8CC 4ZMAT 4MAYA 3EHBC 4X6BB 2EYSB 2R9HD 5E2UL 4ENED 3I75B 2VDLH 2YWYA 4GKNB 4QXGL 5HGBB 2ZSVA 5EZIH 2DM2A 3VFVA 1T1YA 2AVGA 3C2SA 1QSED 4KJWD 2IMMA 5D6DA 5F7EH 3QR2A 4EI5A 2UZIL 4QXTA 1JE6A 4O58L 3GIZH 4C83B 5F3HB 3IDXL 5I74C 4HBCH 3KJ6H 1ZT1B 4LKXA 5JW3L 4Z7NF 3SDYL 5KSBA 5AZEH 3TYGL 4ZXBB 1TZHA 1ZHBA 3O4LD 5FA3A 4UV4L 3JV4B 5J12B 3MX0A 1D5IL 3OXRB 4OLEA 2W1NA 2CLZA 4QRRB 1SVZA 4L3EB 2DLHA 1QR1A 2OQJA 4DGYH 4U0RC 1XAUA 5DEFB 4P2QE 2D7TL 3LSOA 4WHYG 4FXGB 5IBLD 3DOSA 4P46C 3HA0A 1K3IA 2RGSA 2YXFA 4MAUH 3SGDH 3SHSA 3BXNB 4YDLB 2WM0A 5E7BA 1RZGA 3F6LA 2P5EA 4OLZH 4XP9H 3GJEB 4ZOBA 3ULUE 3FJTA 4QHUA 2FATH 4AQOA 5BW7A 4OZFG 1C5BH 3OPZL 1RZFH 3EO9L 1FO0B 3D25A 2NY2D 5GISH 3WL9A 3D5OF 4LCUB 5I9QC 1OAZH 1IJ9A 3O6ML 1MQ8A 4AEIH 4NQSA 4NNYB 1CTOA 3GMQA 4KUZL 4F7MB 1JMXA 7FABH 2M1KA 4ZFGL 1E6OL 4HMEA 1FLRL 4OZHA 5FHAH 3FOLB 2SEBB 1SEBB 4G5ZH 2VDPH 2ZP0T 3H3BC 5J6GB 2HT2D 3DVFA 5CJQL 1MCRA 1F13A 1JPTL 5JHLH 1FJ1A 1LHZA 3RZCC 1JF5A 3O3AB 3NTCL 3ZL4L 4HDIA 4XB7A 4Y2DC 4KJQD 2IG2L 1PY4A 2P8LB 3R0MA 1FJ1B 5ECJE 3RUGA 3NACH 1HOCA 5BCAA 1A1NB 5C71A 1OLZA 1FQ9C 1HKFA 1OW0C 3GSVA 4W81A 3VXUA 1DEDA 3HR5A 4JZOA 4KKLD 2CKBL 3F7RA 3D0LA 1N0LA 1A8JH 1FNSH 3MNWA 4HS6A 1I3RA 2KBGA 1ITBB 2C1PA 4FQQB 1K2DB 1EH9A 1AR2A 4OLXH 3GI8H 4LDLB 5E9DB 3HPLB 1H3UA 2CQVA 3VFOA 4HCRL 4UOJA 4I18A 4E41A 1A22B 2OJZH 1NC4D 4IDJH 4PJEB 1X5GA 4JHWL 2YKLH 2X7LB 5C0BD 1F4AA 1I3GL 2J88L 1VFMA 4S10A 3DGCR 3ESVF 4K94L 5T1KA 1WCQA 4X99B 4ELKA 4Y2DB 3U9UB 3ULUF 1P5VA 5D7IF 4L29A 4F58H 5E8NA 4XPFL 2X09A 3DYOA 5DWUH 1YDPA 1FC2D 1NFDF 4AY0A 2GITA 3D2UD 5DJ0A 5TE7L 1KTKE 3N06B 1CDIA 3P4OB 1D6EA 1CDYA 4YIQA 3TH4T 4OZIB 4XMKH 1I3VA 4Z7WB 2R69H 2J5LC 2V9TA 4KTDH 5ACLA 5D6CA 5LWYH 2YPLD 4FRWA 1AXSB 3PV6B 3IJHA 2YK1L 3U6RB 3VXTB 1WWBX 3MCLH 4TSCL 3C5JB 3VXRE 2BNRD 3C60C 5KG9A 3PWJA 4UQ2A 4UAOC 3WCYA 3GBLA 4Y4HA 3UPAA 1XT5A 2OBGA 5D7KE 4FQXA 3QI9B 4BQ9A 1ZV5A 3LKOA 2G75B 2R4RH 1FIGH 2DQUL 4MJ6B 2GTZB 4HS3A 5ESVB 3DGGB 5ACZA 1CQYA 3MRDA 4DZ8A 4ZUVA 4IRJD 3N1FC 3ZE2F 1IQDA 3O2DL 1WCBB 2E9IA 1DBJL 1NMCB 2XKNB 5BOPA 4OF8A 2QEJA 2FJGA 1JK8A 1MWAB 1VEMA 1U41A 4NQUA 5HGAB 5I73B 5I1IL 4M1CD 5DD5L 3LEXB 5HVFB 2UZXB 4PJBE 4H1LH 2AJXH 5C08A 3MLZH 2E9JA 3HLAB 4RDQF 4AENA 4X7DC 3EYOA 3HKFA 3UCRA 2NTSP 1XIWB 1G6VK 3QDMB 3MA9L 4CVZA 4QY8B 1BGXL 3VFTB 1CL7H 3FZUC 1A3RL 3HTLX 2XZQL 5ID1B 3BWAB 1A6UH 3ZYZA 2ZUQB 5DFTA 2FL5B 2ZCHL 1UA6H 5A43C 2WINB 4ORZC 4R7NB 5KS9E 4FMFA 1DBBL 1RI8A 5TQ0L 3GMLA 3WDIA 1ZT1A 2QSVA 3R1GL 5IQ9A 3BVNA 3KPQB 4NKOB 5JXED 3U79A 4U1NB 2K1MA 5JW3H 2VSCA 1KJMB 4FFWC 2CKBA 2QADD 3BMVA 2J8UE 2CLZB 4QRRA 1FFQA 2JCCE 1WITA 5T3XE 3JV5A 1S7WB 2BNQA 4DVRH 1T0MA 5J6GA 4HWUA 1R3IL 5FOBB 3ARRA 1MCPL 1BZQK 3QHFH 2GAZB 2ICWJ 2BRQA 1BZ9A 5C3LD 3S4SA 4L4VA 3U0WL 2X41A 1IM9A 4GG6E 4PTUB 1DCLA 2Z4QA 2XZAH 1UJ3A 2VXTH 1YEHL 2CSPA 3N1PC 2P46B 3G5XB 4LPWA 1U3HB 4PJHF 4MHHI 4YJZL 4C56A 1S9YA 4MWFA 4YHYB 4TVPD 3VFUB 1WBYB 4M4RA 2GJZA 5SWZD 1G7PA 1LP9E 1VB9A 5CEZD 1R0AH 1W0YT 4NM8H 4XPBH 3REWA 1YPZA 3O6FB 1S9YB 3CGTA 5EFIA 5IKCB 5GGVY 4HAFA 1W72A 5I0ZA 1CE1H 1OTSC 4N8PA 4ALAL 3GJFB 5DRXB 4QRQB 3GKZA 3BZFB 2IANE 4U1SB 4XH2B 5IMOB 4KUZH 4NZDA 5C0DB 3QUMB 7FABL 2ARJB 5I1LB 3EGSA 4RBPH 4PJEA 3RDTD 5KBNC 3T0EE 1LE9B 3MOBL 5DS8A 4NIKB 3RVVC 2HT2C 4NO5B 1OQXA 5CJQH 5GSRB 3RWHB 3RVUC 3UAJC 3BP5B 1MSPA 5MEQA 5I8KL 2ZNWA 3ESUF 1LO5B 5J57B 4OZFH 4U1MB 4Z7UE 2IG2H 3B5HA 5LAXB 1J0IA 4IRJA 1NCWL 1YYMH 1CXIA 4QXUL 1QTYT 4WENB 2BVOB 4P4KA 5D8JL 3H9HA 1QSVA 3R0NA 4KI5C 5EU4A 1VPOL 4M5ZL 4AIZA 2JB5H 4M5YH 3K1KC 1G9NC 1BOGB 2J4WL 5CAYB 4BZ1H 4GRWH 4BZ2H 1AGBB 4MDJA 3WN5B 3THMH 3KR3H 4MZ2A 4WFHE 1FNSL 3RFZC 3KYKL 3VFRB 4MX7A 1QRND 4KZDL 2A6KA 1J18A 1TJGL 1I1AD 4BFBD 5ENWB 2A9MH 4Q0XL 5DK0B 3L3KA 1G6RA 2CLRB 4JPIB 3BPNB 4JN2B 3QIBB 2DB8A 2YKLL 4K7FB 1GGCL 1RZJC 2BVTA 4CVXA 3MA7B 3MOAH 2FHCA 2J88H 2LVCA 1HE7A 4HGKC 2DLFL 3STZA 3BGFC 2K7PA 3O3BB 2I26N 4GRLA 4F9LA 4K94H 3MFGB 2Q6WA 4OCXH 5CZVL 5DMKB 4M02A 1S5HA 4HFUL 4TVSa 3D87B 1JF1A 2ZSWB 1MJUL 5HDBE 4NRXB 4YHKL 3KGRA 2A77H 2AXFA 4NBXB 1QHPA 3R4DA 1K8IA 1UJTA 3QUZA 2XA3A 1DVFB 5I1GL 1OAQL 3B6SA 2ADFL 5IW6A 4WHYH 4AEHH 5DRNA 4MXQC 3V6BR 1TJHL 3HFML 4GFTB 3SY0B 2AXFB 3N50A 3GSUB 3B9KC 4GUPA 1DDHA 1VADB 3AS1A 5E8EB 1WGOA 2JB6A 2HJFB 3HRPA 3DURA 3BQUD 1MY5A 1MUJA 3V5DA 4X8JB 2R9HC 4PRAA 5EPMA 2Q87A 1YYLL 2EKSA 3MCLL 4TSCH 5L6YL 4ZYKB 5IB1A 2FYYA 3OTTA 4NN7B 1AP2B 1D5XB 1PLGH 3VFNB 4OZGF 3HRZA 3GHEH 4IMKA 4GMSL 4P2OB 5IB2A 1OAKL 1IFHL 1U3JA 3VFNA 1D5BA 2VKWA 4BM7A 1HEZB 1IAOA 3BWAA 4MJIB 3VWJA 5K93A 5SWQA 3S9DB 4EI6A 1JGEB 1KN2L 4Z8FH 2WWMC 1ONQA 3PHQB 2D03L 4YEEA 1DBJH 4OCSH 5FB8B 3QIWB 2UUDH 1U93A 2A1WL 2FCBA 3F7VB 5I74B 2OL3A 3PWUB 4YHLL 1A6ZB 4XCFH 3IFNL 1PBYA 1OSPH 1CVRA 1KCUL 3CFDB 4M48L 4X83A 3LS5L 1KIQA 2DBLH 2X4RA 5H37H 4R2GD 2YSSB 1S5IH 4CBPA 1FV1B 2YA0A 3EJZC 3MBEC 2HMIC 3MPCA 5GGQH 3FT2A 4KK9D 4P2RE 4S1SL 3DO7B 1VEOA 1MI5A 2FIKB 3MBEB 2IH3B 2VLRE 2APWA 4I0PC 1T2XA 3C6LD 2G9HA 4GBXC 4JJ5A 4RWYH 1U6AH 4EUPB 1VGEL 5TF1H 2RHEA 2FIKA 2XZQH 3ZDYE 1AO7B 5E2JA 5CP7A 4Y16D 1MH5A 4LF3A 3KDMA 4JJ5B 4EUPA 1UA6L 3ULVL 1IAIH 2OTWA 3E0GA 1LO4L 1DBBH 1T22B 1Q0XH 3MV9B 5GGTA 3R1GH 5EBGA 1D9KD 5CIPA 3BRGC 3OJ2C 3FO1B 2NY1D 2VL5B 3RJQB 4F33A 3AREC 3EFFB 4Y19B 1GGYA 3PQYE 4LCWA 1A9BB 5JLZA 4EBQL 1NQBA 1HOCB 1H3TA 5ITFA 1VFBB 4O4YH 1R3IH 5KVFH 4JDTL 5HPMA 3G5ZB 3C9NA 1GPOH 4KUCF 1U8NA 1IGJB 1NC4A 1D5MB 5DJAA 5ICXB 4KVCL 2X42A 2H1PH 4YC2B 1BFOB 1TPXB 5JW4R 5HYJA 3I6GA 2DQGL 3ES6B 4HIEA 4EN3B 2C5DC 3VFSA 5DI8A 5IB5A 1I9JH 1R5VB 1NJ9B 1K2DA 4PG9B 3BGMB 1P53A 1K6QH 1XGUA 5IVZB 1ZLSL 5SX4H 2WSKA 1FSKB 3LN4B 5GGSA 3G9AB 5I75B 3QUYA 4AMKH 5CGYD 5IMLA 3QDGB 3RWGA 3GUTA 5SWZB 5C0RH 1JV5A 1AKJD 3G6JA 5BVJB 1ZS8A 2OP4H 3JWOL 3BFOA 3KPRE 3KWWB 3KYMB 4Z7WA 1A1MB 4N90D 2E6QA 1WZLA 4CVUA 1KXVC 4PJ7A 1JWMA 1GJIA 5IQ7L 2PW2A 1BBDL 4YEFA 4MD4A 4NQCB 1WK0A 5GHWL 2Z91A 4HAGA 2AEPH 4RFEB 1I1CA 2XWBA 3NAAL 1FAIH 5GS2D 5DUPH 5I8KH 4E42B 5ALCL 1ORQB 1RK1A 3MFFB 3SCMB 4KHXH 2EICA 4P57A 2FX9H 3K2MC 2PYEE 5CEZL 1LE5A 4LBEA 1FFOB 5I1EH 1F6AA 2BX5A 4HIJB 3MJ7A 1S9VB 1CXKA 4F57L 4HD9A 4L8DA 4AT6A 3WXWL 4G9FD 4EUPH 4FG6C 2VLJE 4HJJL 3VXNB 2XI9A 1M05A 1YECH 3Q6FB 5GSVA 2HFTA 3BE1L 1NFKA 4KZDH 4G42A 5HYJD 1PZUB 4H88H 1UXWA 2AABL 5L9DL 3FRPG 3RAJH 1HHJB 3GSNL 2KKQA 1L0XA 5EU5B 2G60L 2QADB 2VLKE 4XCYB 1NSNH 5IR1A 5CMAA 1G7LB 3LKQB 3AU1B 4EIZC 4UIKL 2NY7L 3DI2B 3R8QA 2AKRA 2YD2A 1IAMA 3CDGA 2XKNA 3OXSB 3NZHL 1D5BB 1NBYB 5L88H 3DUUA 1H5BA 2CDFB 4AEFA 1WEJL 4GH7B 4JFPA 4LLWB 3ZKMD 1U8KA 4WW2B 1I85C 4QOKE 4U3XA 2AJ3B 1EO5A 4Y16C 3T2QA 5F9AC 4QRPD 3ZMRA 1EMTL 2EDJA 5GZND 1GXEA 3C8KA 5JHDB 4AEHL 1MVUB 1FDLH 2DQHH 3B9KA 2CGRH 3EHBD 4LSSL 4I0PD 2J8HA 1YMMB 1CXFA 43CAB 3RNKB 1OAUL 4U2YA 4J3XA 5IHUH 1JPSH 4XPAH 1LK3L 4JM2F 5L6YH 1UC6A 1A64A 3FT3A 3OX8A 4I8DA 3IXTB 3LSOB 4F7PA 2LTQC 2CXGA 4R4NC 2W0PA 3QRGH 1S9KC 3GHEL 1A7QH 4WUKL 5FV2A 3REVA 3O6FD 1ORSB 2EDXA 4DTGL 5BO1H 4RMTA 3IETB 5I1CH 5HD8D 4P23C 1AY1L 4KMLB 4Y1AD 3BVNB 3U7YL 5KS9A 3IVKA 3DV6A 5ADPH 4Z7OE 2HLAB 4JFDD 1SJXA 3L5XH 5B39B 3HC3H 2IANA 3F12A 2AI0H 1DQJA 4OV5A 4TUOB 3CU1A 5DHVB 5D7SL 3HN3A 1MCKA 5JUEL 5M95B 3FO0L 4MD5A 1LO0L 4Q9QH 2VABA 3G5YA 4YHLH 3PUCA 5AYUH 3RWCB 5EBWB 3RGVD 4H20L 1S3KL 1FYTB 2VLRD 1OM3L 3ARTA 5FCUH 2ICEA 1OSPL 3C5ZD 4M48H 3ECBB 3FN3A 4FZEH 2DS4A 3UDWC 5CJOL 5JO5B 1KTLA 3H0TA 1PSKL 2LTQB 3LZFL 4MA3A 3AXLB 2D31B 1T0NA 4MNQE 3T2NL 5HGGS 3GNMH 5HHQB 3INUH 3D0VB 1G6RH 1J8HA 4JO2H 1EA9C 4FQLH 1Y6NR 4RWYL 1U3HC 4U3HA 1GYAA 2MKWA 4PV8A 1H15A 3BW9B 1JNLL 1OGTB 3IDYB 5FDWA 2HTLC 3MLRL 1UZ8B 4NZTH 1H9VA 1LO4H 5I16B 5T5FL 1ZA6A 3HG1E 5C07D 4JO3H 5J11B 1A9BA 3E6FB 3P4NA 5C09A 3VI3F 1DBKH 3V4VH 3QUZC 4K55A 1XGTA 4GXUM 5EO9A 4HKXA 1RIVL 5J11C 4G6AC 3CMOH 3ZZ1A 4LHUD 4XC3L 4DEPB 3RUGB 2V5TA 4N5EC 2J7LA 5TDNB 2NY0D 2R1YB 4Z9KB 5E5UB 4AG4L 4JHZA 1DP0A 3GRWA 4LSTL 2VDRL 4XP1L 3FQTB 5DJ0B 1S9XA 1H3VA 3KPRD 5IWLC 2V9RA 3O3BA 1KCSH 2JE8A 3P0VL 3SGJC 1ZT7B 4KK8C 4OZIE 4Y4KB 1I9JL 5C0BE 1ZLSH 2HG5A 4UUJA 5K59F 2Z8SA 3BZEA 3D48R 2F53A 4JY5L 3S35X 1JNNL 4ZFZA 3NZ8A 3LDBB 3CLEH 4KQ3L 2APVA 4K7FA 5E03A 1FVCA 2DWDA 1HSBB 1INEH 1KC5H 3FQXB 3F62A 4Y4HB 1CD8A 4LVOB 3STZB 1VSCA 4D9QE 3K8LA 4X8JA 3NCBB 5FYJD 5L8JB 4MA7L 3I6LE 2VYRE 5BS0E 4EVNA 4KUCD 4KGJA 4K94C 1QSFE 3L3GA 1IGCL 4OCYL 1HYRC 2AEPL 1MAJA 3QPXL 4U6HA 5F70A 1L7TH 3OXSA 2GW5A 3ZKQD 1G7QB 1FAIL 1OTSD 1Z0MA 1G9ML 3FO2A 1C08A 1X7QA 2A2QT 3OL2A 4NO2B 5LQBL 2JK5B 3IAQA 4OZ4B 2NX5E 4MQXD 2BY3A 3BKML 2ESVD 2ZNXA 4GBXB 1KIUA 1B3JA 4F57H 1F4WH 3E1F1 5DEZA 3RHWF 1D5XA 3HPJA 4FABL 5FB8A 4O02H 1WC7A 3BUYA 4W4OC 5HHNA 2ATKB 1I4FA 1OB1B 3CPLA 1EIBA 1E4XI 2XWTB 4JB9L 4P46D 2Q76A 1MFBH 4P48A 3QFDB 4UDUB 5HHNB 2E8ZA 3TV3L 4PJ8D 3TIDB 5GJTH 5CFHA 4K23L 3G04A 2K9UA 2D3VA 4UT7L 1NSNL 5EUKB 5D7IB 3FN9A 3NA9L 4J3SA 3V4PL 5DQ9B 1RIUL 3KNBA 4OGYL 4V1DA 3DETC 4PB9L 2ATPA 3ZTNL 4S0SD 4LSPL 5F93C 4DQOL 4H5SA 1BVKB 5C6TH 4LPXA 5JIKA 3QULA 2V6HA 3UJJH 1EMTH 2IPKB 3QJHA 1BZ7B 4NRYB 5T1DL 5BV7B 1II4E 2VLJB 4GRWE 4JFDB 2HFEA 2DM3A 4PUBL 4PJEF 5CBAA 2XNAA 5KW9H 1MRDH 4LIQH 3KPPA 2FJFB 5GRWA 3V5HA 5ERWA 1JI1A 1DLHA 1R3LA 4D2NA 4M9PA 4ENEC 1BZ9B 3D3VD 1JPSL 3HE7A 2L7UA 4HWBL 1X44A 2BVYA 4G3YH 1H8SA 5KZCB 3S8WA 3TZVC 1QBLL 4OFYA 5EBMB 1X3DA 4X98B 2P8LA 1IGIH 4WFFD 2NXYD 4MWFB 1MIMH 3WIHH 1KT2A 1YJDC 4XCNB 1QLRB 3BDYH 1YUHA 5IQ9B 4HUVA 5J6HA 5HHOB 3L9RB 4M1DL 4JZOB 2H26A 3UO1H 3TJEH 4NWTH 4WHTB 5J06A 4LMQI 2ERJB 2DQCL 4D0DB 2VDML 5KAQF 1JN6A 1TTFA 4U1GB 5D7SH 1RU9H 1NFDB 3KYNA 3MNVB 3FO0H 4LPUA 1NBQA 2XTJD 1MJJB 5FYLD 1W2KT 4OFVA 1C1EH 3MV9D 3DUHA 5IVXE 1PYWA 1JZ7A 1AXTH 4N9GA 4TVPE 1RJYA 3QXDA 1S3KH 5E5MB 1OM3H 3I6GB 5F1NA 4PTUA 2C7UB 5CP3A 3SJVE 3WFHB 4ZG1A 1BX2A 1HI6B 2EECA 5C1MB 5SWSB 2CR3A 1RJYB 5I1DA 2GJ6A 4X7TA 4BUGA 1BFOA 1Q9KB 5E56A 3GNML 1YDPB 3ZDXE 1G6RL 2VUOA 3MUZ1 4JO2L 4NHCH 1A1MA 3T0ED 1T83C 3DMMB 3HMXL 3WEXA 3WNNA 2CR6A 3DSFL 3RL1A 4JN1L 4OD1H 4JKLA 2LVEA 1HNFA 1RZ7H 1T2QL 2F53B 4XBPA 4YHMH 4HH9B 4G8GD 1JNHA 5BVJA 3EYVA 4G6KL 1A6VL 2BRRL 3BZ4B 4FQHB 4BK4A 1FGNL 3DROB 3ME0A 3PXJA 4D8PA 1A6TA 1T66C 3O11B 1CGXA 1XF1A 1MFDH 5DMKA 3QCTL 4PJ9B 1QSEB 4OZFB 2V17H 5I19L 2DQTH 1FVEA 5E8NB 3PWNB 4HLZH 3CUPB 2FHFA 3UTPD 5ILTL 1ZGLP 1EFXB 5DRNB 1KJ2L 3PE9A 3MLXL 3GRWH 4I1NB 3P0VH 4KU1A 1OWWA 3EUUA 4Y5VB 1D5ZB 4ZODA 3RPKA 5HYSA 4PREB 2OR9L 2I9LB 4D9QD 1U2HA 4GW4B 4OI9A 3ZKNC 3STLA 2HT3D 4CW1A 4PRAB 4N1CA 3Q2CA 2L7JA 4LARH 3SO3C 4P5MB 4FMKA 1I7RA 3ARBC 2NXZB 3T4YB 1P6FA 3T77B 3WS3B 3GI9L 1INEL 3IU4H 1DBAL 1FG9C 3H3PH 3MLSL 4MNQB 5FM4A 1NBYA 2P49B 2F54D 1Y0LB 3LKOB 5F88A 4NN6B 1MREH 1T1YB 4MJIE 1UM4H 3QUYD 4JKMA 1YEEL 9CGTA 4OFDA 4HXAL 1LDPL 1L7TL 3S35L 1SBBA 2HRPL 4N90E 5EBLA 5FGBC 3V5KB 5K9QI 1E0OB 2PYEA 3WE6A 3FFDA 4XAKE 4JDZA 1KB5L 5K9JL 1U93B 4UBDD 5ICYB 1TCRB 1QSZA 1CDJA 4PLKD 1ZSDA 3V4UL 1CZ8H 1AJ7L 3E8UL 4LHQB 5E00B 3P77A 3FFDB 4I48A 5KSBE 5T33L 4JFDA 3O6FC 1NC2A 2VIRB 5MEND 3ZSSA 3TO2A 3P9LB 4RISL 5BXFB 4KAQL 4FABH 1NAMA 1QFWL 2HWZH 4M6AA 3QFDA 4UDUA 1YEIH 5T3ZL 4DUWA 3DSNA 3K4ZA 4LSUL 1KF9B 4NN6C 5KJRL 2AQ1A 5T3XD 2CDEB 5B4MC 3CVIL 3MRLB 1KT2B 2W0FB 2IADA 2XG5A 4IOFC 1KYOK 1U92B 5DJZB 3QHTC 4N0RA 3FB8B 4FXLA 4QRUB 3VFUA 5EZLB 1UWGL 4J3UA 4HV8B 1WF5A 4HHAB 1B88A 3RWCA 4WHTA 1G7JA 2EXWC 4NN5B 1JF6A 4PJCF 3ROOA 2DQIH 4JY6A 5F7DB 1U8MB 5TDPA 4WGVB 2AEIT 5I1JL 3GJFA 1UVQA 3BH9B 5DRXA 5HGDB 5SWZE 1EEQA 2VKXA 1A6AB 5IMMA 4DGYL 2CJUL 5HDLA 5KW9L 4JRXA 2OCFD 5EUOA 3TNNA 2Z31B 5F1NB 1JIBA 4HG4K 1XIWC 4JHAH 4PG2A 3QUXD 4E9LA 5DS8B 4DOHB 3ARVA 1XF4B 2CLVB 1IGYA 5KOMC 12E8L 3VRJB 4K9EC 3BIKA 3JVGC 3RBGA 2NY5L 5C0CE 5HDBF 2V2WB 1DZBA 4PLJD 2F8XC 1OD7A 1YUHB 2ESVB 2DQFA 1RZFL 5I16A 2PYFA 3EYFB 3GMRB 3BDYL 2P43B 4F7MA 2VZVA 1EHXA 3QDGA 3RWGB 3C6SB 1QFHA 2ZCKH 3C60B 4J4PC 4M1DH 4HZLA 3UO1L 3TJEL 1WFOA 1UZ8A 3QQ3A 4JR9H 1G7IA 4JE4B 1KUMA 4HZLB 3ARFB 4OB5H 2DJSA 2LQRA 5TDNA 1A14L 1ED3B 2C1OA 2BERA 3ZHDA 3PWPB 1KCLA 1T5XA 4BKLB 5FYKL 1IZJA 4KJPC 1K3ZA 4LEOB 1A5FL 1HQRA 3SDAA 4LLDA 4TTDD 3DIFB 4WNQB 1C12B 1N6QH 1I9IH 3LQMA 1HHGA 1QBAA 1I1AB 4X6EA 2IBBA 2XA8L 2XXMB 4I0KA 1KFAH 4P2CG 3TA3A 2I27N 4NHCL 1EPFA 1YEGH 1NPUA 3GI8L 4OD1L 1SJEB 2H3NA 5CJXC 3FTGB 3BP4B 2OMNA 5C0JB 2CRYA 3DJ9A 2AJYL 2CIKA 3TYFB 3N1QC 1IC1A 3MJ8A 5IEHB 2A6KB 5IGXL 4TRPL 4IDJL 4MD4B 4JFEB 2PXYB 3HMWH 3UZVB 1ZLVK 1UG9A 5IHZB 2JJVA 3GBML 1W0VA 5JORB 3SGKA 3RUGF 5ICZA 4LPYA 5EZJA 4PJXA 4OI8A 3UX9B 2HKHL 5C7XH 1QRNA 3T4AB 3BT2H 2XWTA 4V1DE 1P5UA 3MRDB 3CXDH 4NFDA 1V7ML 1XGYH 1GAFL 5D1XC 1CFNA 2R15A 1PKOA 1DN0B 3QCTH 4U1IA 5JW5A 3AS0A 1DQML 4CRPA 1EFXA 4HC1H 3MCG1 5D6CB 5F3BA 2GTZA 3B5GA 3PL6B 4OLWL 2MHAB 1RZ8B 2X4PB 3MJ7B 4KZEH 1T7ZA 4XMKL 1JGEA 4ZPTA 2VDOL 1SBSH 5F3BB 4JKKA 1SY6A 5JDJA 1EFQA 1HXMB 2GTWB 1LNUB 3MRBA 3C6LC 1JHLH 3SGEI 2PETA 3AVEA 4HK0A 4DW2L 2G2RA 2FJGB 1GOFA 4WEMB 5FECB 4OFKA 3MRHA 2X70A 4GOSA 1FFNB 1HN1A 2ICCA 3I85A 5CS7A 5IESH 3LEXA 5SWSE 5D7IA 1G7LA 4ACPA 5EUOE 3F7QA 1DBAH 3IU4L 1S7QB 1FIGL 1QA9B 4YPGB 4MD0B 3DX8B 5HYEA 3TA3D 1SQ2N 4LGSB 5TGBB 3QDJA 1BVKA 2ADGA 1A9EA 4DKDC 5B3NA 1JRHH 3KPLA 4POUB 4WY7H 1ZANH 3EDEA 1KCKA 3S88L 2Y9RT 2YC1B 3CFCL 1WISA 4H8WL 4NO3A 2XACC 1UACL 4Z7VB 2WWMD 1FN4B 3CXHJ 4GLRI 5I1IH 5FYJE 4ZUTB 1ZLUK 5E9DE 1KB5H 4HH8A 3FAXA 4PJBB 4U1JB 3LH2L 4YAQB 5DJXA 4WWKB 1PEWA 1CZ8L 3L5HA 4W70A 3DLQR 5T33H 4OZHB 1MQKH 2AV7A 1CE6B 3QDJD 2NXYC 4YDVA 2VXQL 1WBZA 3V2AR 2VE6A 3O9WA 2NCMA 4JFEE 1NCBH 2OL3H 2FH6A 4PJAE 2EKJA 4YHZL 5AG9A 1KENL 3LEVH 1MCHA 1RUML 5CEYA 4LCCC 1DQQB 2RQ8A 1QZ1A 1HYSD 1FFPA 3IKCB 1CDGA 1L6ZA 2GAZA 1A3RH 4JAMB 1K4CB 5CHNA 4KV5E 1LO2L 2O5ZH 2UVFA 4H0HB 3U7AA 1Z5LB 4JM2D 3OMZA 1F4XL 4QHMA 2EZ0D 4I0PB 4JAMA 1RK0A 1G1YA 5GS3A 3CVIH 4KFZC 3RHWK 2HVJA 5DFVD 2LFGA 4ZS6C 3BW9A 4P46A 4Y5YA 5DA0B 1I7TA 4YHNA 3FOMB 5JW4M 3ULUH 3SKJH 3VXPB 3LQAL 2DWEB 3DTXA 1VKXA 4JFFD 3TBVB 3GUTB 2OZ4A 2NY3B 3WFHA 4NSKB 2VWEE 3ECBA 4DVRL 3UJIH 5A3ID 1B2WH 3JZ7A 2VDNH 4XXCC 4U1HA 1MCPH 3LHPL 4PJHA 1MEXH 1JZ6A 5F44A 3T09A 1AKJA 5F1IB 3VI4F 3QA3B 4LHUG 2VO5A 2BOCB 3EJJX 3U0WH 3CCHB 4O2EB 2FB4L 4DFIA 5D7LE 2XOTA 2ZG3A 4G8IA 1EHAA 3EDDA 3X12A 3KLHD 3AAZA 2XWBB 1P7KB 2VZ1A 4ZFOA 2DQFB 4PJGB 1SEQH 4KVNH 4G9DA 5DK2A 3NFNB 3UMTA 4DGVH 3WYRA 3CXHK 1RZKL 1RUPL 4XMLH 3KG5A 4LSVH 3C5SA 3QUMA 25C8L 3M07A 4LBEB 4LSRH 5IB3B 2NXZC 1EVTC 3QUXB 3P11H 3O6KH 4XPHH 1QNZL 4BZYA 4GQPH 4KWUA 3U0TB 4D0BA 2XG4A 3L3IA 3Q48A 4UTBL 3RWFA 4HWZA 3CK0L 2YRPA 1P4LA 5M94B 4C54A 5DQDH 5C0GA 1B0RA 4OCWL 4RZCB 1T4KA 5AWNL 3RX8A 1UADC 1NUDA 2A6JA 1V7NH 1NANH 4MYWB 3KPSA 3VXMA 5C2UB 4HLJA 3KYOA 2L4OA 3RDTC 5J9PB 1NGQH 3DX9B 3P4MA 4M7LL 5TDOA 3VFPB 4JVWA 1UWXH 5DJ8A 2HT3C 4K3EL 3SCMA 3T0VA 3K3QA 4YHOH 2VH5L 5L2JA 2MHAA 1G0YR 2YUWA 4JFFE 3LKSB 1N6QL 2UVEA 3MRKB 5I75C 4BZ1L 4J3VA 3FT4B 1AHWC 3LVEA 2ICES 4IRSD 4NOBA 1ZA3B 5JNYA 2JJTC 1YEGL 4OBSA 5ETUB 3DRQA 3QDAA 3QEQD 2J6EL 3TO4A 2ATKA 4ODHH 4DN3L 1U8QB 5DC4B 4OZHE 1X9QA 2X05A 1FPTL 1N3NB 2EDFA 4YDIL 5IGXH 2Q86A 2PR4H 4XAWH 3OKOB 4A6YH 3B9VA 5EU5A 2NY0C 1W72H 5DUMH 2G5BA 4F7PB 4PY8J 4KC3B 5EIVA 3OKOA 1DSFL 2ESVE 3HAEA 4IS6A 3VFTA 1QKZL 3CXDL 5D7LB 4YHKH 3VDAA 5F72S 3AROA 3DHJA 3CC5B 3GMNA 1GAFH 4R6UA 4YXKH 3ELAT 1GZPB 5I1GH 2B0SH 4FZ8H 4I4WB 4UNTA 3UTZB 5IROA 4YXHL 4HC1L 4U6VL 4GKSA 2F9BT 5C9KA 2W0FA 3BQUB 1FN4A 4PG2C 8CGTA 2AERT 3CDYA 7CGTA 1YA5A 2HVKB 4PRBB 2VDKH 2D7PA 4LVNB 1T5WB 1AFVH 1JZ5A 1IAKA 5FECA 1C16A 1JHLL 3DXAE 1L0YA 4Z0XB 1FZKA 5CD3B 3SKMB 2OSLA 3I6KB 2MMXA 3T0WA 3QSKB 1OP9A 4ZNEE 1CD9B 5BXFA 1S7RA 1F97A 4NQCE 1MI5B 2E7BA 3WSQH 1QA9A 4JQXC 3VH8B 4IMKC 2VR5A 5HI3C 5FKAA 4YGVB 3UBXI 3K7UA 4QY8A 4XNZC 5DC9B 3X14A 2GI7A 4BSWB 1OAKH 3MRQA 1ZVYA 2HP4A 1P1ZB 5FO9A 5EOCH 1S7XB 2DMBA 4E0RA 3FRUB 1YNKL 4P3DA 4N0CD 5D7JB 3B2UD 2A9NL 2AK4B 4ONFH 3VD9A 2Q8BH 3BIKB 4YFEA 4S2SB 2WINA 4R7NA 4WY7L 1S8DB 2D03H 2DYPB 4YK4C 2APBA 3P40A 5EOCJ 2HYMA 1BZ7A 4Q6IA 3LIZL 2PO6A 3QEQB 4U1LB 4B7LA 1CFBA 1EO7A 2A1WH 3VWKB 3H3KA 3B83A 3WL9B 5KVMC 1U8IB 1ZHNB 3UTSB 1LVEA 3PGFL 2BHZA 1MJJA 3ZLQC 2CO6B 4H26B 5DHXB 1F3JA 3BN3B 5FM5O 5D5MF 5IMOA 5BQ7A 4NSKA 5D96B 2KQNA 2IAND 5FAAA 5HYQA 2DBLL 5EBWA 2GYSA 1NGXA 1OP3K 5C08E 3LD8B 3GSRB 3K80A 1F00I 5CCKH 1CWVA 5GGQL 3MBEA 1AQDA 2DM7A 4OF3A 4XCEA 1JFQH 4S1SH 3LN5A 4JCLA 4L8CB 2BOCA 1NCBL 3BQUC 5IIEB 1LO5A 5E1AB 1AQKH 5C0EA 5D9SA 1BD2E 3ZHLA 4P3CL 4I0PA 2BNQD 1U6AL 4K3DH 5E2UH 4LEOA 1NC2D 1AD9A 1LO2H 2XTJE 5GJSH 3NFNA 4NGHL 3ULVC 2R39A 1KNOA 5D2NC 5DHVH 5B38A 4X4ZA 2GJJA 1WT5A 3G08B 1KCRL 4IIQB 2WMPA 1KGCE 2C1OB 1QUNA 2KQMA 4D9RD 2GSIA 4HIXL 5MERB 1ZA6B 4LNRB 3TNMA 3F58H 1MAML 4HT1L 3ABZA 2FSEB 2R2BA 3NZ8B 1QRNE 3IAGC 3SDYH 4O9HH 3HNVL 4EBQH 1BQSA 1RUKL 2VAAB 4NO5A 2Z93B 1D5IH 3MGOA 3CAFA 2O26U 4M7JL 4POZD 5DMIH 4E42A 5I2IA 4Y5XB 2A6IA 2H1PL 1UH4A 2Z93A 3D18B 1IBGL 3X17A 4PJXB 5TH2B 2IF7A 3UTTE 1DQDL 5FGRA 3TCLA 5FGSA 2VITB 4JFZH 2OR7A 3MV7A 2X4TA 1BAFL 3RWEB 5H35A 2PTTB 1KYOJ 5EU3A 1UYWL 4PJFB 5JOEA 4JGJA 2EEAA 3MRJA 2CIKB 2QSCL 1CDHA 3CLFH 1A0QL 2UWEF 3BMWA 1I9RL 4UT6H 4PJFA 1MRFH 3QNYB 3EO9H 1LP9A 3JWOH 4BH7A 4LSVL 5LGJA 3RWFB 3T65B 4YO0B 3FTGA 5ENWA 1BBDH 1K4DA 1F4HA 4WI6A 3BPNC 1EUUA 5DQDL 5FHAL 1LWRA 3NIDE 5TE4H 3WO3B 3MV8A 2XRAH 4HUWA 1WBXB 3D1MC 1VENA 5FUZL 4NQTA 3TVMA 4LEXL 3VU2A 2W0KA 3NOIA 3MC0A 2QQLL 4G6FB 4XGZB 4NNXA 2BNUA 5ANME 1LQSR 3K46A 4NO2A 1EO8L 4HK0B 1N8ZA 3OV6A 5A2LH 3KPLB 4YHOL 1JZ8A 4AM0A 3GSUA 4BQBA 1VACA 5HHMB 1JGVH 4Z0BH 5BZWA 4U2ZA 4LFHG 1I8IB 2CUIA 1BIHA 5IHBA 3SDAC 2F74A 3WXWH 1TZHB 1WFNA 1VACB 4KKCD 1JGLH 5HGAA 4P2YA 3KLHC 1XGPB 2OX5A 4A2LA 2X1XR 2MPAL 2NW3B 4ZTPH 2ARWA 3AY4C 4N5ED 3GSNH 1AP2A 2PW1A 5F1KC 1FPTH 4LASH 2PNDA 4KROD 4PJCE 4LCWD 4PJXE 5FKAB 4A6YL 4X6DF 2PW1B 1R5WB 3WJJC 4TPRL 1KBGL 3SKNB 3IFOA 3IT8D 1DSFH 4KJYA 1QKZH 4F58L 4HUUB 3NABL 2Z8RA 3B9KB 3DXAD 3UBXB 3LY6A 2EDEA 1TZIB 2NY1C 5FUOH 3RY6C 1BPVA 2B20A 4GRMA 2B0SL 2D2OA 5JTWA 3VXRD 2YC1A 2QQNH 4LVHC 1XR8A 4W6XB 1FDLL 3FB6A 4ZS6D 1U3HD 4Z7VA 5JMRA 2XN9D 1CGSH 4RAUB 3QYCA 5ELIA 4PRHD 3W2DL 5D70L 1X6NA 1J12A 1P7QA 3H9ZA 3QH3A 4P2RA 1MCSA 4L8SB 4YC2C 2YZ1A 1YEJL 4KRPD 4W6YB 2Z4QB 1BMGA 1I75A 5EIIA 3GMOA 4MMZC 3LN5B 4L8CA 3WIFA 4FQ2L 3HZKB 4JQVC 1BQLH 4R4FH 5IB4B 4M1CC 3VFGH 2KUTA 1OGAE 3BKJH 3JTTA 4OV6F 1B4RA 5FYLE 5I1CL 4R2GC 2AK4A 1Q72L 2DQUH 1AY1H 1NKRA 3REWB 4HWEH 2VSDA 1MPAH 2VXVH 2XN9A 3ES6A 3SDXE 1A6WL 2D31A 3FCTB 5BW7C 2L0DA 2Z9TA 5GGRB 3L5XL 5BVPL 2B39A 3NPSB 4J8RA 2OTWB 2IFGA 3UPRB 1J8HB 1I1YA 2Y07H 2HT4C 2AJZB 3B8SA 1EZVY 4I2XE 4PR5A 4RGNC 5E9DA 1FVDA 3MODL 1QRKA 5E70A 4P23D 3NCCB 3T1FB 5FFLA 3JBG7 5C0CD 4HH9A 4NWUL 3DUSB 5JO5A 1RJLA 1VGKB 3UC0L 5FCUL 1DUYA 2Y4SA 3AXLA 2D7NA 3G6DH 4LLUB 5HHXL 4RAVB 4RGNE 4LSQL 4JRWA 1PSKH 4KRPB 4Y2DA 2AW2A 4JG1H 4LVHB 4PLOB 4OQTH 4PYHA 4WWKC 5FA4A 2NQCA 4UINH 4KRPC 3QIUD 2IQ9H 1JPFB 1ORQA 4ODBD 3FMGH 4GW5B 3VXSB 3X12B 4QOKB 4P3CH 5IFAL 5C8JB 3MNWB 4HS6B 1A6UL 4Y8DC 3RI5K 4XBGA 3E6HA 3G08A 2FX8L 1RMFL 2IBZX 2ERJC 3DMMA 4LGRB 2ZUXA 4PJ5B 5IOPA 3B9KD 3ZKMC 3FO9A 1F45A 4HS8H 2AAVA 1WTLA 5C0ND 5D5MA 1KN4L 3C09C 4WIQA 1J1XH 4HIXH 1DBKL 4OCRH 4QYOB 4WTWA 5GS0D 3LKNA 4WUUE 1T5XB 5IW3A 1U91B 4EXKA 3RY4A 4NQDA 4O9HL 4X99A 5E0QA 4Z5RA 1JWUB 3EDJA 1S9XB 4IM8A 3W9DA 4MCYB 2YBRB 1GIGH 4U1GC 4LSTH 3S5LB 3FO2B 1P4BH 5HYJE 5EU6E 1DUZA 3CVHL 5JXAL 1NEZB 5DD6B 4MJ5B 3G6AA 3IS1X 1X4ZA 3U4AA 2XZAL 4Q2ZB 3PDGA 1XCQB 1BAFH 1JF1B 2ZSWA 1N8ZB 1JK8B