1Q9LB

S25-2 fab unliganded 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 Fab (IgG1k) heavy chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 222
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB01
1BPVA 4P5KB 5CLTA 3WIFA 5D7SH 1I3VA 1AGFB 2VITA 3VWJB 1KENH 1RZGA 3L5JA 5MEOA 3QXDA 5F1SA 3ZKNC 1Z0NA 3I50L 4HUXA 1TCRB 4OFPA 5FA4B 1RY7B 5E9DD 4P4KD 5BV7B 3VD4A 3E0GA 4KHXH 5D7IE 3EJJX 5I0DA 3P4MB 4JLRB 1S9VB 1KCUH 2E9BA 1K9TA 3OPZH 4L8CA 3GMPA 5EBGA 1MCIA 4WFGD 5F3BB 5TF1H 4OZIA 3BD4A 5E00A 3ARBB 4CW1B 3RWEB 4G6MH 4AG4H 1MNUH 4JO1L 3SGEH 2YPKB 4W6XB 4JO3L 1CD0A 1KLFA 3L3KB 3O6LH 5MENB 1L7TL 1OL0A 3DNKA 4M5ZH 5I18L 2ED8A 3PHQA 3PWLA 2Y5EA 2NY1C 3BRFA 3CFDA 4FXKA 1BD2B 1L4IA 3VG0L 3OR6A 1N59B 5IB4A 1VDGA 1E28A 1F58L 1QNZH 1QSZA 4G8FB 3X3GL 3TJHD 3WEXB 1UCTA 4JQIL 1DBAL 1QBML 3FOMA 5INDB 5CD3A 1IFHH 3BQUD 5IHBA 3MUGB 3ZL4H 4NYLA 2QHRH 1A9EB 3D85B 3O6KH 5D4QA 3ABZA 2A6KB 1HXMB 3FQRB 3QIBD 4LQFL 5JQ6L 2EE6A 2JIXD 3C5JB 4U05A 1AD9B 3PDDA 2CKBL 2E3VA 4FS0A 5IVNA 3BE1H 4PY8I 5E4IA 2P8PA 4HHAB 4HDIA 1MFCL 3QQNA 1A1OA 2NXYD 4I0PC 5SWSA 4LVHC 2XWTA 4X7FC 3DWTA 2HRPH 3V4VL 4XWGL 3MPCA 3GGWA 1WFOA 4AIXA 4MDIB 2ITDB 1N6VA 1ZANL 3MRKA 2DQUL 4FP8H 2DQHH 2MOVA 2G5RA 1A64A 4LLUA 4U0RB 1GZPA 3WXVL 4YNYA 5L88L 1RJCA 4G80A 2BSSB 3KPMA 5C09E 3C6LC 2NY4D 3CU1A 4H0GA 3VGHA 4MB5A 5MHSD 5JHLH 4ODHH 3DX9B 5HGDB 3S5LB 5JDJA 1C5BL 4XB8A 4YUEL 2IADB 4EDXA 2QQKL 3REVA 3BPCB 4M7ZC 4ELMA 4WRLA 4XPFH 1OWRM 4YAQA 4L8BB 4WO4D 5B8CB 1P2CA 3G6AB 4XNYL 1WFUA 3NFNA 4ZUSA 5T1DH 4I9WE 5K9KA 1MUJB 4CVZB 1HK6A 1KTKE 1EEQA 3FQUB 3KPLA 2V2XA 2C3XA 5I6XC 3TWCL 4YHPA 5ID0A 1YPZE 1MCNA 3WSQH 5CKGA 3H9SD 2BHZA 4AL8H 4S2SB 3CFKA 2COQA 1FC2D 4Y1AA 3QWQB 4F8QA 1K8IB 1MWAL 3TT3L 4Z76B 1RUPH 1NDMB 3TNNB 4PJXF 2UVFA 5IMKA 3FB8A 4L29B 5EOCJ 4RWHA 4OI7A 1BFVL 3PWVA 3VFPB 3DBXB 4MDJB 1JN6B 2M1KA 4HJ0C 5FO8B 4OD3H 3QDJA 5KG9A 5T1KB 1S7RA 1LEKB 4NJAH 3FCTB 2GW5A 1IKNC 4JB9L 1MHCB 1E6OL 1XZ0A 4NO0A 3VCLA 1YJDC 4FFZH 2EDKA 5E8DL 2UWEA 4LHUG 4DKAA 3SCMB 4NPYB 2AP2A 5DHYB 4LSUH 4NRXA 5CLWA 1F11B 3MJ9H 3G6JB 3O11B 4WUUD 3WE6A 3OJVC 4ZPVA 5CGMA 5MEQB 3O2DL 2EH7L 4DN4L 1URLA 3GB7B 2J1KA 2FZ3B 1WEJL 1RUQL 4FQQA 3NFSL 3EZ8A 4H88H 4MWFA 2DBJA 1J11A 2R4RL 2CO6B 2C3VB 3CFIC 1OP5K 2PW1B 4JZJC 3WJJA 3HUJB 3ZZ1A 2O93L 3QNZA 4HGWB 1MLBA 5L8LB 1II4E 3TYFA 5HDQH 1HHIA 2X1XR 1TJIH 1NCCH 2BOBA 3I3EA 1LK2A 4NZTL 1S5IL 1T5XA 4LSDA 1B0RB 1CE6A 4P4RA 4JGUA 3PWPA 3DMMC 4EOWL 5IB2B 1YEEH 1CU4L 1RURL 2R2BB 3VMNA 4X5WA 1FNSL 4DGIH 1J05A 4XP6H 1DEDA 3HR5A 1I4FB 3MLXL 5C08E 1WBYB 5ICYB 4WV1C 1N0XL 5DYOA 5KVFH 4ZAKB 3BHBA 2ZCHH 5DRWA 2XKSA 3DO7B 3PWUB 3MR9A 3K4ZA 3MV9E 3WL9B 1JF1A 1CL7I 4EI5A 4QRQB 4XT1C 3C2AL 2B2XL 4ZUTB 4LLMA 4NQUA 4P3DA 5GISH 2FLRT 2Z31B 4XCYA 1ZGLA 2WZPD 3QUMB 4UAOC 2BVUA 1RFDL 3PHSA 5EUKA 2HTKD 4MA1C 2A6IA 3L3IB 1CN4A 3QDMD 1FG9C 5EPMA 1EZVX 2VRAA 5GS1B 4PY7B 3MRDB 4RDQG 3SE4C 4EBQH 1MJJA 1Q0XL 3ARZA 4DFIA 3QIWA 1OTTD 1TENA 2FBJL 4XRCA 4XCEA 4QXTB 5DTFB 3RL2A 5HHOB 5DO2D 3D0VB 5GHWL 2EEAA 3KPQA 5KSAB 4FQLL 2VZVA 3QRFM 1N0LA 1Y18A 4ZUWA 1FHGA 1AO7B 2XRAH 4PRHE 1WWWX 2AV7A 5SWZA 3X17A 4QTHA 5IIEB 1BIIB 3OAUH 1WUNT 4QHUB 2VN4A 4AMKL 2RIKA 3CFCH 1A9BB 2YWYA 1RIUH 3A6OA 5GGSY 4A6YA 4JRYB 2FECI 2DMCA 1FNEA 1XGTA 3V6OE 4G9FB 4YE4L 5LAXB 2CLVA 5LCVH 1F3DH 4IRSB 5HHXL 3OF6A 5E5MB 4L4TB 4X4MA 2XT1B 4P2RE 3W9EB 1DEEB 2VE6B 3LKPB 4X6DF 5C0NC 5F1NB 2OJZL 3HKFA 1MCCA 1NGQL 2A9ML 2FX8H 5F7YC 4OCXH 1KJ3L 3D39A 3FTGB 5CGTA 4G42A 3NBNA 4HIJA 1CFVL 4N0CC 1P53A 4NO2A 2J4WL 5JLZA 4M6ML 5K59F 2BDNH 5CILH 4PJAF 3RAJH 2VQTA 4OM1L 4JFOA 5H37G 2CO7B 3IXAB 4GRWF 1HZHL 2GSIA 1CLZH 2XNAB 3OB0K 2DB8A 1H3VA 3IDUA 1FE8L 5KVMC 3SY0A 4PB9L 2JB6A 2BNRB 2Z4QB 2ZUWA 2G9HB 3ULUF 1QSFD 5IROA 3HNVH 4Z7WF 5FYKD 4APQD 2DQDH 5B22A 3SPVA 3I9GH 4R4NC 4H26B 1R24B 5F70A 3W81A 4NKDB 1ES0B 5GZND 2JE8A 1C16A 1F00I 3ARBC 5F6HJ 3RWDA 2D3VA 4PJ5A 3V6OC 1VGEH 5E2UL 2O5YH 1FL6A 3PQYA 4GMTL 1AD0B 5I2IA 1FZMA 3B9KD 4ONGH 5CCKH 5FEBA 3V2AR 5F9DC 3AM8C 2FATH 3GSNB 2VB5A 4MXWH 4KVCH 4AIZA 5FYKL 5C0JB 4PRPE 4XPGH 4LLYB 1AI1L 4OTXH 4PGDA 5DD1H 3MRGB 4X0KB 1U8KB 1P4LB 4FFYL 4JFXB 4KROC 5E9DE 4NQDD 4O58H 3VH8G 5D93C 1MFBL 4RNRB 1FSKC 2I26N 1MI5D 4ZQKA 5D8JH 2EDOA 5DFWH 5ICZB 5I17A 3SKNA 2GJ6B 3IU3A 1FRGH 2FSEA 4HMDA 3UTZA 1IQDA 1DBKL 4HH9A 3CPLB 3MLZH 1ONQB 4WFGE 1GZQB 2H2PC 4NFBA 4DVRL 3VWKC 1AGDA 3L3DB 2GTWB 2ZJSH 4OUUB 1UXSB 5DA0B 1TVDA 3TA3B 1DL7L 3DPBA 3ILPB 4XHJC 5A16B 3IF1A 4HIHA 3U9UA 3VXSD 2CXKA 4OQTA 3NCMA 12E8H 3QCUL 4P9HL 1BF8A 3GO1H 3WIHA 1BX2A 2KDGA 2I5YH 5DA4A 5TPWH 1KSRA 3OAZK 1NLBL 1ZKAA 3V8OA 3HE7D 4Y4HD 4WI4A 3BO8B 5GS0D 4X98A 1KJVA 4OZHF 1FJ1B 4JHAL 1CD8A 2AJSL 1UENA 4W4OC 5IB3A 4Y2DC 3EYFB 2V17H 5IVXB 4KQ4L 3G04A 5T33L 5IKCB 1Q9WB 4Y5VA 3OKEA 3DETD 2J6EL 2ZG2A 3TBYB 3HRPA 3NVQA 3NIGE 5CD5D 1U95A 4U6VH 3WUWB 4XWOD 1BZQK 2JK5B 4RZCB 1SJVA 4QHKI 4YDVB 1CDIA 5GS0L 1H8OA 4P4KC 3GIVA 1VKXA 4M43H 2WLYA 4ZDHB 1TXKA 2KQMA 3MO1B 5E2JA 1UH2A 3L6FB 1K2DB 1S9WB 3BPLB 5GPRA 1QBLH 4O51A 5I1KH 5D7KD 5DMKA 3CUPB 4WU7B 1EHXA 4KVNH 2ZKHH 4M61B 1ZT1B 1JPTH 5L2JA 1J5OL 4ETQB 4JN1H 3KWWA 3QPQC 4XPBL 3UJIH 3ARDD 3U48A 3TBTB 1U3HA 4OCRH 5MHSE 3SDAA 3C6SB 3L9RA 5EN2A 5SX4I 5CEXA 4JY4B 1WIPA 1OB1A 1M7IB 4NFCA 3JVGA 4WCYH 5KVEL 1LK3L 3TJHC 4G6JL 4KKBD 4NZJA 2D03L 1HHHA 2YZ8A 5ESVB 5DR5L 5F7EH 1A3RH 1KB5A 5HDOA 3BQUC 2EIBA 1OLZA 4HWEH 2YOCA 2IQ9H 4ZYKB 3GSRA 4MAUH 3QIBC 4PJIF 5DZLA 5JHDD 2X4PB 3QHFL 4CRPA 1BQLL 3BPNC 3OKOB 4HX1A 1FL3B 3TLRA 1PAMA 1JPSH 1JI1A 2NXYC 1A0QH 2CGRL 3HTLX 2F15A 4O2EB 5IGXL 3EBAA 2A6JA 1MRFH 3R4DA 1R3LA 5DJZA 2FR4A 4NCC1 2DM4A 4KV5F 4DN3H 4U3CA 4YPJA 2ZPKH 3IJHB 4DKDC 1BQHA 1CI5A 3CH8A 3SGJC 4PJ8D 4CMHB 5TE7H 1RZJL 4OF7A 2GAZB 2WBKA 1CXFA 5C0CD 3D3VA 2NY4C 2ICWI 3GSVB 4KH2A 1YN6A 1B0GA 5TDNB 2Q7NA 3UJJH 1MAKA 1YEIL 1OGAE 2ENSA 1BM3L 4AEIH 1OF2A 1M05A 2QSVA 4Z7UF 2KZWA 1QA9A 1QSEA 2R29H 3TBVB 3V0WH 2W0FB 3RWCB 3IVKB 5JQHC 1IAIL 1YY9D 3STBA 5GXBB 5I1LB 4WUUE 4HUMB 4ZAKC 4L3EB 3ULSB 4XMPL 3VW3H 4PRIA 1W0VB 4KC3B 4O9HL 3PGCB 5IW1A 4NN5B 3LDBB 4KPHL 3ZE2F 1IEBA 4OD2B 3NH7L 3H3BC 4K23L 4P5TD 3BEVA 2OSLB 3ARGA 4HWBL 4H8WH 1D9KA 1IC4H 3ARDB 3V4PL 1UEYA 5FDWA 4OLXH 1QG3A 1R3JB 1Q9KA 3F7VB 2NY0B 4HG4J 4Q74A 9CGTA 1OVZA 1TJHH 1A3LL 4IRZH 3U4EB 2XZCH 4ZS6C 1X5JA 3ULVH 1DJSA 3W5MA 3TO4A 2C3GA 4JKKA 2JB5H 4P2QE 3WLWD 4HV8B 4FTVD 5D7SL 3IRZA 1CFBA 2M2DA 3BZDA 2OXGA 5DEGB 1KENL 5IBTH 1OD7A 3VFOA 1E4KA 1PY4A 5DVNA 4ZPTB 5C6TH 3QUZB 1D5MA 4G9DB 3DTXB 3H9YA 1FNGA 3GJEA 2WBJA 3RL1B 1I1AA 1T5WA 2VISB 3JWNC 1YMMD 4KHXL 4FQHB 1T7XA 1KCUL 4B7IA 4QF1A 4WENB 3RY5A 4X6BA 1J1XH 3OPZL 3QO1B 5ACZB 1JNNH 3QDME 1WWCA 4LGPB 4OLWH 5TF1L 4UT7H 1U91B 4G6ML 2CKNA 4AG4L 5ACLA 1MNUL 3L7EB 1W0WB 3O6LL 1NC4B 4LLVA 3RUGA 4M5ZL 4N8VA 1LP9F 1UYWH 4EUPH 1P7KA 2EICA 5GJSH 2VWEE 2ZCKH 4PJCE 1MCEA 1I1FA 1QNZL 4GKNB 5IEKA 2Y72A 4P5MA 2N1KA 5CIPH 1UC6A 2C26A 1IFHL 1A14H 3ZL4L 1LO2H 1P4BH 5IK3A 4B0MM 2XA8H 5M7QA 3O6KL 5GIRA 1A22B 2JJWA 3BE1L 4RGMB 2J7LA 4TYUA 3TBWB 1A3QA 1U9KA 2VYRE 3S96B 2C4XA 1ZT4B 3QUKA 2HRPL 1JBJA 5D1XB 1S9YB 2VL5A 4WNQB 4OF6A 1D6EB 1F42A 1NGPH 5C7XH 4FP8L 1NGXB 1KLGA 2DQHL 3KYOA 3U30C 3KPRB 1OTTC 3FT4B 1UACH 2ICEA 4PJEE 1L9NA 5E8OB 2X5PA 2IF7A 25C8H 5DO2C 1BVZA 2WSKA 1E4XI 1SVCP 2ATKB 2BHUA 5JHLL 4ODHL 3VH8A 1UJ3A 4XXDB 4CNIB 1K4DB 5DJ2A 2VWEC 4N0FA 1QSFE 4YGAB 1NCAH 3BT2H 5ITFB 4ZO7A 5FFLA 4I1NB 4ENED 1KCVH 3OKNA 2LTQC 1NGZB 3K80A 2X1WL 3AY4C 2VTFA 4XPFL 1KCRH 1OAZH 4TUOA 3VXMA 4JM2F 1E4WH 5CFHA 1S7UA 5I1HL 2HP4A 2V7HB 5T1DL 4KRMB 1PVHA 3SKJH 3MV8B 4YGVB 1JZ8A 2JCCA 4QRSA 4G7YH 5T5NG 4EVNA 3FZUD 3UDWA 1ZAGA 3B8YA 5BVJB 5HBBA 2FLBT 4JFEA 3SDCB 3WSQL 1JZ6A 4WHYH 4OUOA 1X4ZA 3DUUA 4NQDE 4Z0BH 1H8NA 4HH8A 4C58B 5HD8C 4AL8L 4OM0H 1MI5E 3T08A 3UTSD 3HE6B 3O3BA 4XXCC 4C56D 1RUPL 1RUMH 2NY3D 1LE9A 1TZHA 3PGDB 5C1MB 4J3SA 4V1DA 1DVFA 3DGGA 2HMID 2Q6WB 4UQ3A 2AJYH 5TDPB 4YLQT 1LO5B 3E8UH 3FAWA 4OD3L 4UOJA 4BSWA 4ZFOA 4PJDA 2PO6D 3VXSE 2Y6SD 4FQJL 1VEPA 1AGCB 3VI3F 4NJAL 4UMGA 2DLHA 2GUOA 4LPYA 1JPST 4X6DB 3BPLC 5KANG 5GZNC 4FFZL 1OQOA 4U1JB 3PL6B 4PJHA 1A02N 5DJCA 1VFBB 4WW2C 2I24N 1RJLB 3ARWA 4LSUL 3C5SA 1UB5A 1FZKA 3MJ9L 4GG6F 2FGZA 4CDHA 4QHMB 3B9KC 3HPLB 4UZGA 3O9WB 2EDDA 4PIRF 2IMNA 1XFPA 2BNQA 4CVUA 3F5WB 4PJAB 4JR9H 4H88L 3DLQR 4NRYA 4YIQA 4OT1H 4Y5XB 4XBGA 4HGMA 2YRLA 4GRWB 3P77B 2D2OA 2LU3A 4DZ8A 4H1LH 1X5XA 5C8JA 5HDQL 5SWQB 1TJIL 4B53A 4D0DB 1V05A 4Y19B 5EU6A 1NCCL 1HXYB 4P9HC 3GSXA 5IMOA 1RK1A 4J7RA 1HHKB 1ZTXH 1RZIB 4ZOCA 5A3ID 1FFNA 4ORZC 1YEEL 5GGRB 2NLJA 4BQCA 3E3QC 1VFAA 4KDVA 2MQ3A 4DGIL 1DDHA 5I73B 1C5CH 4XP6L 4OCSH 3V5KB 4D9RD 3MRIB 1FAKT 1F97A 4G6FB 5KVFL 3SKMA 2ZCHL 1G7PB 5DLMH 1F4YH 3LN5A 2CIKB 3PDOA 2YSSA 1KFAH 2FHBA 5FM8A 5GISL 2QKIB 3HE7C 4Y4HC 5GS0C 5D1ZB 2GYSA 4X9HA 5HHMD 1JRHI 4OIAA 5J06A 2X4RA 2F74A 2JTDA 4LU5H 4X6FB 1XF5A 3DYOA 5D6CB 3IDNA 1CIDA 1FV1B 4PGZA 4PUBH 5D7JB 4LKXA 3FAXA 5F9WB 3T3PF 3MRHB 3DETC 3W0WA 2BSTB 4LRIA 5JHDE 1D5BA 1LQSR 1A47A 2YEZB 5CD5C 3WBDA 1AJ7H 1NL0H 1I7RB 3TN0A 4PRDB 5DJ0B 5FGRA 2XRAL 5JR1H 1QLRA 1A6AB 4PFEA 4MX7B 4WU5A 3W82A 1G7HB 3U79A 2NY2D 3OAUL 4OZGA 4X7TA 3IS1X 2GJJA 2FEEL 3CFCL 3UROR 3I02B 1RIUL 4B5EA 3PP3H 5J12C 4N8PA 1HH6B 1UZ8B 5LCVL 1ITBB 4PLNC 1S7SB 4Z7VB 1DLHA 3BIBX 5L0QC 5E1HB 4JPKH 2K9UA 5GGTH 3ARDC 4KWUA 5C07A 3MRRA 5F89B 2Q20A 4L5FL 4UDTB 1CFTA 2FX8L 4WVRA 3CSBA 1XR9B 2YN3A 2XN9A 2H3NA 4OCXL 3IGAA 1NSNH 4I0PA 4JPWH 1XGUB 5EA0L 1X7QB 5D7IA 4X6EA 4D8PB 4CU8A 1F6AB 3EYOA 5F72S 5ICXB 2BDNL 2L4OA 3CDGA 4ERSL 3F58H 4U1SA 3RAJL 4NUJA 1KTLB 1PGRB 2DN7A 1RZJC 4F37F 1ADQH 3BP7B 2DQGH 1CLZL 3MJ7A 3KPSD 3QQ9D 1UH4A 4JN2A 4HJGB 5CEYA 5EUOE 3QEGH 4X9GA 1T83C 2Y23A 3C6LA 3CD4A 3JTTB 3S5LG 1G6RB 4KTEH 1CVRA 2BRQA 3VGAB 1BOGA 1T7WA 4LBEA 4QRRE 4LNRA 2NY6D 3HNVL 1M6OA 3V52H 1R0AH 1KCKA 2DQDL 3MRFA 3KYAA 3I9GL 2HVJA 1ZHNB 1X9QA 2Z93B 1X44A 3NCYS 2DQCH 2NY5C 2VDMH 5B3JE 2A9NH 4BQ6A 3NA4A 1FVDA 1VGEL 1AKJA 2O5YL 4I2XE 2F8OA 3VFMB 2DLGA 3IJYA 4ONGL 5CCKL 2QR0A 1SYVA 3DHJA 1VFMA 2PCPA 1NGYA 2FATL 5JNYA 5LBSH 4MXWL 4KVCL 3O6FD 2X4NA 4FTVE 4Q6IA 2FIKA 4GAFB 3WD5H 4XPGL 3BVNA 4OTXL 3WKMH 5DD1L 5DJDA 5J7CC 2AERT 3ILQC 1ZVYA 5I66A 3DROA 4O58L 3VFSB 4GT7A 1M7DB 2GQHA 1YMME 1U36A 4MNQB 5D8JL 2OXHA 2BC4A 3FFCE 1HEZB 1FRGL 3MLZL 4QRPD 1C08B 4X8JB 2NY2B 1T80A 2BSED 3FT3A 4OF8A 5DHVA 3MYJB 4ELMF 2V9QA 1T04B 3IDIB 32C2A 4OB5H 1K4CA 2ZJSL 4S1QH 3IXTA 5C09A 4L8SA 3Q3GA 4P5TC 4NWTH 4DUWA 4HKXB 3D6GA 5DUMH 4YDJB 4BKLA 4JFFE 4JRXB 3VGBA 4Y4KB 4HIIA 2H8PA 5IBUB 4XI5D 3GO1L 1JV5A 5GSVA 3SJVB 2ZUQB 5IV2A 2I5YL 5TPWL 5INCB 3T77A 1IAKB 2DTMH 3RX5A 2XWBB 4OZ4B 1HHJA 1JK8A 4WWKD 3T1WA 1MCOH 4NQCB 4X9BA 2NX5D 5F88B 1YN7B 2DAVA 3AAZB 2V17L 4EXPX 3ZDZE 1DSFH 2B5IB 2VAAB 1AGBB 5IJKC 3WLWC 1TDQA 4XAWH 1FO0A 4EKXA 3WFBH 4U6VL 4JZJA 1YQVH 2Q76B 1YPZA 4GFTB 4TVSa 1EHNA 4HZAA 1A1NA 1WZKA 1KCSH 4U6YA 2CIIA 4M43L 3PP4H 4AQOA 1PLGH 3MNWA 5I74B 1KB9J 1IMHC 1S7TA 2CRYA 3DMMA 3RVVD 3VXNA 1QBLL 2CDFB 2QL1A 2P47B 5I1KL 1ZV5A 3T0XA 3QFJD 4NQEB 1YNTA 2ZKHL 4PRNA 4QKXB 4E41E 5FO7A 1NFDF 1PQZB 4I3SH 1JPTL 2GY5A 4WV1A 4MJIB 2W59A 3S4SB 4JN1L 3SDCC 3GBNH 2EIZB 3G5YB 4PTTA 2VQ1A 3GSUA 4OCRL 1T7ZA 5C0AB 5A2LH 3HE6C 5EWIH 3WIIH 4JZNA 1QRNB 4WCYL 3OAYH 2QADD 3MODH 3IDYC 1MHEA 4LEOB 3QCVH 2YUZA 1KGCD 3I6KA 2F5BH 3GMOB 5F7EL 3GIZH 3KXFE 5ID1B 1A3RL 2IBZX 2FJGA 8FABB 3LSOA 5KSBE 3BGAA 2IQ9L 4MAUL 4H25A 1U8HA 4IDJH 4ZG1A 4M1CC 3T0DA 3PL6C 1JPSL 1A0QL 1LO4H 2ZP0T 1MRFL 2HJKA 2A6DA 3K2UH 3BZEB 4DN3L 4UDUB 3WFHB 2ZPKL 3QH3B 4GRLD 3SDXB 4NZUH 1LP9B 3MRBB 2FDBP 2VKXA 1GHFH 3UTSE 1T4KA 3LPGA 4UIMB 3ARXA 2R0WH 3TIEB 4XNZC 5ISZD 3H7LA 4C56E 5TE7L 5C08A 4NJ9H 2RGSA 1NCNA 5D2NB 4WWKB 5AUMA 1A7NH 2Y5TA 4KK6D 1YMHA 2ZCLH 1QR4A 1AP2A 4BFBD 1HE7A 3MV9A 3KHOA 3UJJL 1UFUA 3NFPA 4IOIA 1U3YA 3U36A 2GSGB 3SOBH 3GNMH 4ISVA 4AEIL 5KSVA 1MQKH 5F1IB 4OLUH 5IQ7H 5KTEH 4Q0XH 4MQXD 2R29L 4ENEC 1ROWA 1QR1A 3V0WL 4YHOH 4HAFA 4LDOB 4NWUH 2LFGA 4LVOB 4QRUA 1P5VA 5FDYA 2KBGA 3VW3L 2VXTH 5C0RH 5J8OA 4AT6B 1KB5H 4ZUUA 1EUTA 1U0QA 2BERA 3ULVD 1NMAH 3S7GA 1NFKA 5TE4H 4NO5A 4DKFH 3ARRA 3FZUC 4WEUD 5D1ZC 5HYJB 4H8WL 5JW5B 1G7MA 2OK0H 1PDKA 3Q0HA 4PRHA 1IC4L 2DBLH 2DWDA 4OLXL 2J2ZA 3FO2B 5D7JC 4BQ9A 4GH7B 5E4EB 3RZCA 1TJHL 3ZDXF 1KB9K 2NY3C 3V6OA 1SBSH 5I1GH 4Z7NF 4ZFGH 4IRZL 2XZCL 3ULVL 3V0VA 4HS6B 3OJMB 4NUGH 3FQXA 1ORSA 2HMIC 4UB0H 4P2RA 4XVTH 1U92B 3QISA 3QNXA 3UTPD 3AM8A 5J3HD 4RMUA 4JM2B 1O5DT 2PTTA 2PO6C 1J0HA 1H8SA 5EO0B 2Y6SC 5EBWB 5F93C 5IBTL 4CU6A 3PXJA 4FMFA 2GITB 4JZOB 3V6FB 5I71C 5C6TL 4HKZA 2FX7H 5EZJA 1CDUA 4N68A 2X4UA 3OJDA 2H6PA 1I8MB 1NEZA 1KC5H 3K81A 1LDSA 1RI8A 1U8MA 5DD3H 1GYAA 5HHME 1A6TA 3DSFH 3ARED 5EBLA 1J1XL 2C3HA 2X4TA 1JNNL 3VE0A 4OLWL 3VI4E 4UT7L 3EOAB 2B7DT 2VLJD 3VWKA 1RULH 2BY0A 5HYEA 2IH3A 1B4JH 3TBSB 1KJMB 5KSUA 5HGBA 5C0EA 2C1PA 1NCWH 2WWMD 4OCWH 2V7NB 1UYWL 1U41A 4IOFD 1I8KA 3CLFH 1LDPH 1JI2A 4QT5A 2DF3A 5GJSL 3MXWH 4PP1D 3BEWA 1RSFA 4XCFH 5A3IC 4L3CB 5B38B 1UT9A 3MJGX 4U1LA 1BFSA 1ORQA 1D5ZA 2VLRB 3MRPA 3ZTJH 3QXTA 4W4OA 4Y2DA 1A14L 3IFPB 1LO2L 1LD9B 1P4BL 4ZO9A 2L7JA 2XA8L 3HI1B 4GG6B 4PJ9B 2LQRA 4YZFE 3DV6A 4PRPA 2RQ8A 3ECBA 2C7UA 3TO2A 5F7UA 2JJTA 1IM3A 1OWWA 3C60B 3FB5B 4FQPA 2RCSH 1F3JA 4LLWB 5ILTH 2YD3A 2YPLB 3UYOD 3ETBF 5I1IH 4U1KB 5E9DA 4P4KA 1NKOA 1UWXK 4LCIH 3L7FB 2BNUB 2E9IA 4OFDA 2W38A 2EDEA 4Y8DC 2QQLH 5FECA 3DI3B 1KPVB 2X1PA 5C7XL 6CGTA 2R23A 3IB4A 3LKSA 3U9PL 4RWYH 3QQ3A 1UACL 2Q86A 1R5WA 1DE4A 3ZYIA 25C8L 1YEDB 3LMJH 3KPSE 5EFIA 4FMKA 3DRTB 1Q94A 3IT8D 4RIRA 5HPMA 4C83B 2NNAA 3CC5A 2CKBA 3N1GC 1NC2B 1QEWB 3E1F1 4LRNH 1FORH 1NCAL 3BT2L 7CGTA 15C8L 1KCVL 4R3SA 2X89A 2NY2C 5E7FA 1YYMH 1NJ9A 1UVQB 3CZFB 4LMQE 1KCRL 1OAZL 3R8QA 5MEPB 1BECA 4MD4A 4I4WA 1E4WL 5DS8B 4ZFFA 3BQUA 3EO0A 3RTQD 1WGOA 4KKCC 2ADJB 2WW8A 4IJ3B 3QIBA 2Z8WC 2JIXA 2N56A 1FYTD 1JGEB 4JPVH 3X12B 1PG7H 4UINH 2AV1A 4G7YL 2GKIA 1IL1A 5HHPB 3D69B 1YC7A 3DVGA 1I3UA 5F1KC 3G9VA 3DURB 1WT5C 3DV4B 4YDLB 4NN7B 1IGJB 5C0GB 1LVEA 1OPGH 1RMFH 3K0WA 3MRNB 4OZFB 4Z0BL 5MERA 4O4YH 4OM0L 3S3SA 5TQ0H 2B5IC 4PV8A 3SGJA 5JOEA 1QTYT 2OTWA 3WIFB 3V7AG 1E27A 1F6FB 5IM7A 1RUML 3AVEA 4LGSB 3KVQA 2VITB 4QRPE 1XCTB 5C0BD 3I6LD 2IPKA 3QXDB 1CGUA 4X5LA 4ODWA 5MEOB 5D2LE 3LIZH 5F7KC 4HUXB 3QQ9C 1NANI 1KG0A 3FB7A 1PX4A 3DYPA 4C54A 3PIQA 2AJYL 3VXUD 5JA9A 3E8UL 5F1OB 3VGDA 1I7TA 1JHTA 1N26A 4L8CB 3GMPB 1S8DA 5ANME 1CCZA 1GIGH 2YN5A 4OZIB 5E00B 2A0LD 3MLPA 2EEBA 3ROLA 4JFDD 4E42A 1J0KA 5CJ8A 3S34H 4R97C 5GQBA 4WO4A 2C5DC 2DJSA 2MCPH 2NX5E 4GXUM 5BO1H 5JXED 1MWAA 3PHQB 3PWLB 3CFDB 4FXKB 4JVPA 2HFEA 1YNLH 3EIFA 4JR9L 2DLFH 3OR6B 5IB4B 1JYWA 4OT1L 1E28B 4P49A 4XP9H 4AK1A 1TPXC 2PYEB 4ODSH 3CCHA 2XPGA 3K74B 5CD3B 1I9IH 4GOSA 4U6HA 3D87B 2BY1A 2G5BA 4K7FA 3H9SA 4NYLB 2IWGA 1J0IA 3VFWA 2SEBA 1ZTXL 4LVNB 3TYGH 4N0UE 4G43A 5FYLE 5E08H 2P8PB 1FNAA 4HDIB 3CDFA 4GW1A 1C5CL 1A1OB 1PEWA 5SWSB 3O2DA 2XWTB 1EFQA 4PJFE 1FG2A 5D96C 5CINH 3CVHA 5DLML 3G6JE 1F4YL 3R0MA 4GW4A 4RMTA 3ZHLA 5CUSL 1P9MC 1KFAL 1OT2A 4XI5C 1P69B 3MRKB 3RIAK 4XC3H 4NNYA 3HCVA 4X80H 3P30H 4QXWA 1JP5A 5EZLA 5IB1A 1SEQH 1UA6H 4LLUB 1GZPB 4PS4H 2PF6A 4LNVA 4YNYB 4WWKC 2JELH 4G80B 5C70A 1KGCE 3SDDD 4WUUA 1QD0A 4LU5L 1KIQA 2X4OA 2FL5B 4RDQF 4PUBL 3VD9A 1YEFH 5JIHA 3QXUA 3G08A 3PWPD 1ZHBA 4PJBF 1MFDH 4EDXB 1WITA 4PV9A 5DMYA 3REVB 1CGTA 2CDGA 4ELMB 1ACZA 1AJ7L 1NL0L 2F54D 1NBYA 4YAQB 4Z95H 4L4VD 3K1DA 1R5VA 4J4PD 4YHZH 1P2CB 5JR1L 1JYNA 2QQQA 3NCBB 3NFNB 3SO3B 2ADFH 4ZUSB 1MCKA 4M02A 5K9KB 2HLAA 1P84J 5K9JH 1BQSA 5ISZE 3V5HA 3KPLB 1U42A 2V2XB 4Y89A 3BOVA 1B6DA 5ID0B 1JZ5A 5FGBC 3QUYA 4JPKL 5GGTL 5C71A 1FDLH 3PWJA 3CFKB 4Y1AB 4U49A 1NSNL 4JPWL 4D9LH 4O2CA 1PKQE 2QADC 3LS5H 5IMKB 3FB8B 1NCUA 3PWVB 1Y0LA 2J88L 3RBSA 3CXHJ 3LRSA 4YK4B 4HUVA 3QDMA 3F58L 4UUJA 3QDJB 4Z0XA 1DTUA 5KG9B 1S7RB 3EJZD 1ADQL 1XZ0B 4NO0B 2DQGL 3VCLB 3V8CA 3ES6A 4WFFD 2OL3H 2UWEB 3QEGL 3VGEA 1RJYA 1LNUA 1R3KA 4KTEL 4TULH 4Z6AT 4NRXB 4JRYE 3X14A 5HTSA 4TTGA 4G9FE 2EKSA 3WE6B 1R0AL 1QFWM 3V52L 2XQYG 4ZPVB 3B3IA 4GRLC 4PJCA 2OTUA 4R6UA 1W2KT 2OCFD 4HIXH 2DQCL 4FQQB 2D0HA 1INQA 4MWFB 2VDML 2A9NL 5J0BA 4KU1A 3D39D 2XICA 3QNZB 1DQMH 4KK6C 1MLBB 3IFOA 4KK5D 5F3HA 3TYFB 2GEEA 1HHIB 1EO8H 3UTPE 1OP5H 2AJXH 2BOBB 5K9OA 1LK2B 2VO5A 1T5XB 3QI9D 1EO7A 2R39A 1CE6B 3B4NA 4P4RB 5LBSL 4CN4A 5FKPA 4FG6D 4NDMA 5SV4A 2Z35A 3WD5L 3VRLF 3VD5A 4M6AA 4MQXC 3WKML 5B3NA 4R0LA 4X5WB 4H8WC 1J05B 1JIBA 3B5GA 3HR5B 4MZ3A 4LP5A 3MA9H 1IC1A 1IAII 1ZE3C 4P99A 5DYOB 3BHBB 5DRWB 3W11D 4XXCA 3MR9B 1JF1B 4EI5B 1P7HL 4PJEA 3U46A 1EXUA 4LLMB 1FZOA 3ULVC 4P3DB 2HKHH 4MAYD 4S1QL 3RX7A 3P9WB 5E6ZA 4XCYB 3MC0A 1ZGLB 4NWTL 3O3DA 5DUML 3CJJA 5EUKB 3DGCR 1JTTA 1QSFA 2VDPH 4QTIH 2A6IB 3LQAH 2W0PA 1W72H 4APQA 2W91A 1Q1JH 2AJ3A 5EPMB 3RIFF 4IMLA 4MZ2A 1GOFA 1T1YA 1MJJB 3QIWB 4Q9RL 3EUUA 2DTML 4WW2A 4XRCB 4XCEB 3RL2B 4TQEH 3GM8A 1MCOL 1IEAA 3G5XA 3KPQB 3EFFB 5L2KB 5DJ8B 3IETA 1QZ1A 3B9KA 2XKUA 4AH2A 4OCYL 4RRPA 1DSFL 4KMTH 1Y18B 4ZUWB 1KPRA 2AV7B 5JO5B 5SWZB 4XAWL 5TE6H 5HGHA 3STZA 3T4YA 4HSQA 4IRJB 2E5EA 4QTHB 2GJ6E 3WFBL 1AHWC 3OHXA 1HOCA 1YQVL 4A6YB 1KCSL 1FNEB 1XGTB 5E8NA 3WO3B 3PP4L 4NQDA 1PLGL 2CLVB 2X42A 1MI5A 5F7LB 3AREC 1OAQH 2PTVA 2GK0A 3PGFH 4UTBH 2GI7A 3CXHK 4PJHF 1KT2A 1S78D 5EOCH 3TH3T 4NO3A 1S7VA 4I3SL 3OB8A 5IMLA 1MVUA 4HXAH 3D39B 4GAJH 5DHVH 4HIJB 5J13C 4PBWD 2WWMC 3GBNL 2C3WA 3C2SA 5HYSB 3VXSA 4M00A 4NO2B 1EIBA 4WTZA 2J6EA 1PYWA 1X5HA 5JLZB 3FQWA 5EIIA 3M8OH 2NY7H 3MBED 1DANT 5EWIL 5F9JA 3WIIL 3T3ME 2HA1A 4JFOB 3LVEA 3SGKA 3HE7A 4P48A 4Y4HA 4XTRC 3CU7A 4NKOA 3QCVL 3VJ6A 1XAUA 1YY8A 2F5BL 4G7VH 1HHGA 1I7ZA 2OMBA 3GIZL 5IJVA 3G5ZA 3SY0B 2I9TA 5JMRA 3EAKA 2RHEA 3OB0H 1DQQA 2HVKA 3TEUA 3SPVB 1FYTE 4IDJL 3I6GA 1C16B 3QAZC 2YWZA 3R06A 1FGVH 3RWDB 1NFIA 5HYFA 2I9LA 3MXVH 4PJ5B 1LO4L 5T5FH 1FL6B 1DBMH 3PQYB 5CZXD 3K2UL 5I2IB 2ZOLA 1ZLUH 1FBIH 4NZUL 4QYOA 1MRCH 4KKLC 1GHFL 4WI2A 3T2QA 4H0IA 2R0WL 4AIZB 3QSKB 4NJ9L 5C0BE 2HH0H 4PGDB 4FN0A 3P2TA 2ZCLL 4U31A 4LPTA 2DI8A 1JMXA 1NCDH 1WCQA 1EUUA 3VXUE 5J1SC 3PUCA 4ZQKB 3SOBL 3MV01 3O3EA 5I17B 3GNML 3SKNB 3IU3B 1MQKL 1S9XA 4NQVA 1YEGH 2FSEB 3QA3A 4OLUL 3UTZB 1IQDB 6FABH 5IQ7L 4HH9B 4UT9H 5KTEL 4Q0XL 3EDFA 3BH9A 4DKEH 4YHOL 1ZLVH 1AGDB 4M48H 1FVEA 3BWAA 4G6KH 3R1GH 4JFDE 5EU7C 1N8ZA 1T3FB 2BVEA 4TTDD 3IF1B 3RNQA 3RTQC 4HIHB 2Y36H 3U9UB 1JUFA 2FYYA 5C0RL 4OZGF 4P59H 1KB5L 4RAHA 4MNHA 5JHDA 1BX2B 4Y4FD 3RI5K 4HXBH 1NMAL 3V4UH 3LKRA 5E6IB 4GBXD 3AB0B 2V2TA 5TE4L 4DKFL 1T83A 1ZSDA 4X98B 1KJVB 1MJ7H 2EC8A 1SEBA 1UKQA 2E7MA 2OK0L 3MOAH 3OAZH 5IB3B 1KJ2H 5I1DA 2DBLL 3HAEA 4KDTC 1PBYA 5TQ2H 3G04B 3TNMA 2XTJB 1WK0A 4Y5VB 3OKEB 4JGJA 3AMKA 4PJ8A 4Y88A 2Y1VA 2K7QA 1SBSL 5I1GL 1U95B 5GGQH 4ZFGL 2OR7A 4LARH 2QV2A 4YDKH 4NUGL 5C0CA 4UB0L 4L9LC 4XVTL 3GIVB 1VKXB 3D0LA 1CD1A 4LL9A 1N4XH 1PX3A 4KZDH 4PRID 5GRVL 1OP3H 1OD9A 5IBLC 4O51B 1F6LL 5DMKB 4Z9KB 2FX7L 4HWBA 3BP6A 4XH2A 2A0LC 5GZOD 2AJZA 5L2JB 1D5IH 1KC5L 5DD3L 2WBWB 3DSFL 3ARGD 3BW9A 3KWWB 3LV3A 2DICA 1U3HB 5D71H 5JXEC 1UWEH 3SDAB 5J57B 5KN5A 4X7SH 3L9RB 5EN2B 5CEXB 4XC1H 1VFOA 1RULL 1OB1B 5E2WH 1B4JL 5EUOA 4N90D 1GXEA 1HI6A 3PNWA 1NCWL 5GRYA 4OCWL 2F54E 1HHHB 4H20H 4L4VE 3CLFL 5DJXA 1JMZA 5IBUG 1GL4B 1KB5B 1LDPL 4YK4C 3H7BA 1KEGH 5BW7C 1QFUH 3GSRB 3MXWL 2R9HC 3QEQD 3IS0X 3UTOA 4XCFL 4HX1B 2Y7QA 4I2XA 5FGSA 4HFWA 1ZHLA 3WHXA 2WBJD 3DSNA 4LVEA 2A6JB 1R3LB 4ZTOH 3PABA 5DJZB 2FR4B 3CGTA 4D0BA 3MNVA 3RKDD 4F2MA 1WSST 4FTVA 4N0RA 2BY2A 3UZVB 1IM9D 2H32H 3E2HC 1NAKH 2RCSL 5ILTL 3W2DH 2R1YA 3IU4H 3DXAD 5I1IL 4LCIL 1YMMA 2NPLX 5IG7A 4OKVA 2IFFH 3SDDC 3D3VB 4PJXE 1YN6B 1B0GB 2QQLL 5AZ2H 4ONHA 5M95B 1G9NH 1M05B 1OF2B 4RX4D 1XF4A 4PD4J 3GMRA 1QA9B 1QSEB 3F62A 3MUY1 5J6HA 3LMJL 4WFFE 4P57A 4MD5A 4MXVF 2RJMA 5BS0E 3DRQA 2DM3A 4J4PC 5JORA 4LRNL 1FORL 2BCKA 4UU9A 4PRIB 3ZYJA 5IW1B 3D2UD 4OGYH 1YPZF 4RBPK 4JDTH 4ZXBD 1IEBB 1FFOA 2AEIT 1H3TA 5EO1A 5GGSA 3AFLA 3CMGA 3BEVB 4WHDA 3ARGB 2DIAA 3B9DA 3ARFD 4JHZA 1D9KB 5IB5A 3KLHD 4JPVL 1PG7L 4UINL 5FDWB 4R7DA 1GOHA 1Q9KB 3HN3A 4U7SA 5T5NF 4Q9CA 3N0PB 2Q1EA 4QGTA 1KYOK 4B41A 2IAND 3RP1A 2QHLA 1BFTA 4X8XA 1HCVA 1OPGL 1RMFL 1JYVA 2XG5A 4TNVK 3TO4B 4O4YL 5TGBA 3HC0A 5TQ0L 4W6YB 2XKNA 2DYPD 2MWCA 4E41A 5C2UB 1RIVH 1PJ9A 3S35H 3VFOB 5KVDH 3MUJA 3X3GH 3LIZL 3MGTA 1JNJA 1D5MB 1FNGB 1VADA 3GJEB 3EGSA 1I1AB 1T5WB 1DFBH 1JCKA 4JANA 2ZUYA 4QF1B 4AYFA 4X6BB 4OAWA 1LO0H 5DURB 5FF6A 5HY9A 3L5HA 1GIGL 4OBRA 3RVWD 2VUYA 4MS8D 3C8DA 3KHQA 1JNLH 5J9PA 1OGTA 4BFIA 4RQQA 1DBJH 3ZKXC 3S34L 4LLVB 3RUGB 2MCPL 5KSBA 3RVTD 5BO1L 4KK5C 1Q38A 1MCQA 1QSVA 1L9MA 1P7KB 3U1SH 1YNLL 3QI9C 2ZWLT 3ZE1F 3FQNA 2DLFL 4NBXB 5JIKA 5I75B 1I1FB 2EO1A 1F4XH 2YS4A 3BAEH 4P5MB 4XP9L 4ODSL 3QG6A 4NQSA 2UYLA 1I9IL 3EHBD 2P5WD 4QLRA 3QPXL 5IK3B 2R0ZH 3UTSA 5DMGD 4OV6F 5IROC 1G9EA 5GIRB 3TYGL 3VMOA 4C56A 3O3UN 4X6CE 1OAKH 3DJ9A 5E08L 3T0ED 3MJ9A 4JFZH 3S6CA 4MAYC 1NUFA 3C5ZA 5J11C 2VLKD 5CGYC 4X5XA 4XP4H 4PD4K 3PWNA 3IYLW 3QUKB 1RZFH 4R2GD 5CINL 4E5XA 4RGOH 2WINA 2VL5B 2PO6A 4KRLB 2V5SA 3M1BA 1CDCA 3PP3K 1QBAA 2GHWB 2W0KA 4XC3L 1KLGB 3KYOB 3MRJA 5K59E 3D1MC 4X80L 3P30L 4PJAE 1SEQL 1UA6L 2ICEB 4PS4L 3TWCH 2JELL 3UBXG 4GRWE 1AH1A 1WVZA 5FIEA 3SE9H 3VH8B 3HRZA 3KPNA 1UJ3B 5DJ2B 1X5YA 1YEFL 5EC2A 4N0FB 2WAHA 1GOGA 4QY8A 4XBPA 3CX5J 3ZT5A 1MFDL 3MRMA 5DFVC 2EKJA 5FKAA 2AAVA 3B9EA 3OKNB 4QHNA 4Z7WE 2YBRA 4Z95L 1ERNA 4UTAH 4M7JH 3VXMB 1CDBA 4YHZL 1S7UB 1EERB 2ADFL 1Z3GH 5B38G 1N3NA 2YD4A 3SN6N 4QRTA 1U2HA 1ZVHA 5K9JL 3BPOB 2JCCB 4QRSB 3AB0C 1S78C 2HFFA 1CIUA 1KIRA 4UIKH 4PTUA 4JFEB 4YHYC 4XPHH 3T2PA 4YC2B 5F6IC 3GM0A 5BJTA 2EH7H 4R4FH 1A4JA 1FDLL 1JF5A 5DK3A 4Q97A 3O3BB 1Q9OA 3MBEC 2XTJC 2GT9A 3CVHH 4F7EA 4X7DC 4D9LL 1VEOA 5ALCH 1LE9B 1G6VK 2X6MA 3VG9C 1TZHB 5I30H 4Q9BA 3LS5L 5EZIH 4V1DB 3FHQA 3GI8H 1CXHA 1DVFB 3DGGB 4G8IA 1W8NA 3BD3A 4UQ3B 4OV5A 2VIRA 4ZFOB 4BSWB 4O02H 4PJDB 3S37X 3ALWA 4GAGH 5KS9E 3AXLB 2GUOB 4HPYH 4PJHB 5DJCB 2OL3L 1F90H 4Y2OA 2APBA 4RISH 4TULL 1M7XA 4H0HB 4YBLC 3C5SB 1UB5B 1FZKB 4V2CB 1S7QA 5CZXC 4OZHE 2IGFH 3DVNA 1CBVH 4P5KA 4YJZL 3SDAC 3L3JA 2BNQB 1OTUD 4HIXL 4HWZA 4MLSA 1OM3H 4NRYB 4YIQB 5IEHA 4HMEA 3VDAA 4GO6B 4XBGB 1BZ9A 1RPQA 4XX1E 5SV3A 3NZ8A 4DZ8B 4OLEA 1DQML 2CK0H 2IFGA 5C8JB 3C09B 2CR3A 2CRIA 1EO8L 2YD1A 1TFHA 5EU6B 2AJXL 5I8KH 4R96A 3GSXB 4LCCA 5IMOB 1RK1B 3P73A 5FM4A 4A2MA 1FFNB 3OQ3B 2FGWH 3UBXI 2NLJB 1ZLSH 1VFAB 1WT5A 1NCTA 4XP5H 1DDHB 2LAAA 2M26A 1A7QH 5D72H 2EZ0D 4FQLH 1MAML 4C59B 3MA9L 3HZYA 3SKMB 3AU1A 4F15C 3LN5B 3C8HA 2WV3A 3PDOB 2ZOKA 1AQDA 1T0MB 2YSSB 3DX6A 3F7PC 5KAQF 1QFOA 4Y4FC 3KPSA 2HKHL 4GBXC 4F3FA 5IHLB 1KN4H 1SYSA 4N90E 3QNYA 5FGCE 3QUXD 1WC7A 1AKJD 1YNKH 3WFEH 2X4RB 3JTSA 2F74B 2VDPL 1FVCA 4QTIL 2HG5A 3LQAL 1XF5B 1W72L 3EYSH 3NIGF 4TVPH 3IDNB 1Q1JL 1X6NA 1BVKA 1WZ1H 4WI7A 4LKXB 4KUCF 3W0WB 5C0DA 1D5BB 3KG5A 1A6ZA 4TQEL 2WQRA 4PJIE 1HQ4A 3PDGA 3QR2A 1U8OA 4KAQH 3TN0B 1IZJA 2OM5A 2NY1B 3EYUL 3UO1H 4KMTL 5L6YH 3MROA 5EIVA 1QLRB 5I1JH 2H9GA 4PJ7A 5DUPH 5TE6L 1BWMA 4WU5B 5DRZA 3O6FA 1J18A 4YDIH 2JJSC 4JO2H 4KV5E 4OZGB 1NDGB 4X7TB 5I8OH 2AJVH 2BRRH 5F7MC 5GZOC 5CSBA 3TH4T 4KZEH 3O0RH 4RFOH 4K7PX 3ARGC 1OAQL 1RJZA 1DLHB 4IIQC 3GSWA 3PGFL 4UTBL 4XVJH 4QRPA 4X9IA 5C07B 1BEYH 2E7CA 3F8UB 5EOCL 5D2LA 1CFTB 4UV4H 2XN9B 2H3NB 2GTZA 3IGAB 2B0SH 4I0PB 4LVHB 4HXAL 4GAJL 5FV1L 5D7IB 4Z7UE 4X6EB 3EYOB 4NQCE 4JKLA 5EULV 3M8OL 2NY7L 3CDGB 3VFRA 4U1SB 5ANMA 1G0XA 4NUJB 3BD5A 3OJ2C 1WWBX 5JPMA 4OLYH 3HG1D 1C12A 3MJ7B 4EEEA 1RZKH 4JN2B 4EQ3A 3KYMA 2X09A 1JHLH 4G7VL 4XPAH 1EVUA 3C6LB 2WBJC 2X10A 2NX5A 3ZE2E 4FFYH 4MJ6A 1V7NH 4MSWA 2UZYB 4PB0H 4LBEB 1CG9A 1JZ2A 4LNRB 1V7MH 1M6OB 1YA5A 2P5ED 1C5DA 3MRFB 3RKDC 3U0PA 1EAJA 3S36X 2HVJB 4JVUA 5HVGB 4GQ9H 4M7ZB 1FGVL 2AI0H 5IOPA 3MXVL 2IANE 2F58H 1FVDB 1T7VA 1UG9A 5T5FL 1MCWM 1G9MH 1AKJB 1DBML 5H37H 2EXYC 3IJYB 1FBIL 1L6XA 1LO3H 2QR0B 1SYVB 1MRCL 2PCPB 1NGYB 4N0UA 4ZSOE 5JNYB 1KEMH 3QFJA 3L3GA 3FOLA 2X4NB 4Q6IB 2FIKB 5A2KH 3MSPA 5I6XB 2HH0L 3BVNB 5DJDB 4PJFA 5I66B 1NCDL 1OW0C 3G6JA 4BSVA 4U0QB 5AAMA 5AZEH 5SX4H 5MEQA 2BC4B 4BSJA 1QLEH 3VU2A 2FJHA 1YEGL 6FABL 1EFXD 4UT9L 7FABH 3FT3B 5DHVB 4DKEL 1F4WH 3IKCA 4ZXBC 4KJPD 32C2B 1K4CB 2CLZA 4M48L 3IXTB 3PV7A 5C09B 5DK0A 4G6KL 4L8SB 3Q3GB 1U8LA 3R1GL 5GRVK 1TCMA 2Y36L 4BKLB 2IAMD 4HIIB 4WFED 1T1ZA 2H8PB 4P59L 3KLHC 1JV5B 5GSVB 4ZODA 3EDKA 4HXBL 5IV2B 2Q7YA 3EO9H 1R3IH 3V4UL 3BKYH 4BK4A 3T77B 4DTGH 3VA6A 1EO5A 1HHJB 1MJ7L 1JK8B 1B4RA 1M71A 4B7LA 3MOAL 2OYPA 2O61A 4LDLB 4XPBH 1KJ2L 2P5WE 1T22B 3IDXH 5TQ2L 3O41A 3TF7C 4MMZC 3ZKMD 2DI9A 1QUNA 4FQIH 5ISZA 1DQJA 1FO0B 5CHNA 5ERWA 4XZUA 1J1PL 5GS3A 4LARL 4JZJB 3G6DH 3T0EE 4YDKL 1YPZB 1FYHB 3RY4A 3GMQA 4KI5D 1A1NB 2E27H 5E8EA 2HRLA 4U6YB 2CIIB 4JDVA 1XF3A 4PLJD 4ZS7H 3WXWH 3MNWB 1N4XL 3L5WA 5GS1A 2VN7A 1S7TB 2KQNA 4KZDL 3DMMB 5FUCE 2AK4D 3VXNB 2EE3A 1JFQH 3RWJA 5I1CH 5DJAA 5D5ME 1PKQA 3RVWC 3S36H 1YNTB 2IBGA 4PRNB 2RBLA 4MS8C 3BPOC 5FO7B 3Q5TA 4WV1B 1D5IL 4BM7A 5H8DA 5D1QD 5IGXH 4PTTB 2VQ1B 3RVTC 3GSUB 2CUMA 2X9WA 5D71L 1UWEL 4X7SL 5JW4R 1N6UA 4XC1L 4UILH 4JZNB 5E2WL 2VH5H 2BJMH 3OGOE 4OCLC 3RZCD 1A8JH 4F7CA 1CDHA 4RSVA 1MHEB 4UAOB 4H20L 3I6KB 3UTTD 1N5YL 3JV6A 3EHBC 1DN2A 4MYWB 5T1LD 5A40E 1BFOA 1DEEA 1FN4A 3LSOB 1KEGL 5DMGC 1QFUL 4H25B 4NC2B 1BLNA 1HNFA 1VESA 1U8HB 1QFWH 1XGRA 1UWGH 5JW4Q 5J1TC 1QQDA 3T0BA 5EDXA 5EH1A 4PGEA 2L0DA 2HJKB 3CFJA 2A6DB 4ZTOL 5GRWA 2M8XA 3ARVA 5JMOC 5FUCC 1ZXQA 4PJEF 1AHWA 2Z92A 1T4KB 1NAKL 3W2DL 2VXSH 3IU4L 4ZTPH 1QFPA 5C08B 1UADC 5C3TA 4EUPA 5AUMB 4K3HA 5AG9A 2Y5TB 4Y8AA 1YMHB 2IFFL 1C8PA 3AREA 3GUTA 2YXFA 1AP2B 3CXDH 3MV9B 5AZ2L 5DMIH 4P2OD 1TQCC 4CBPA 3NFPB 4IOIB 4KUZH 3U36B 2VLJA 3QFDA 4RGND 4WW2F 4ISVB 5CIPA 1G9NL 5KSVB 3MLRL 1FLRH 5KZCB 5HYIA 1GGTA 1QR1B 2XACC 5FO9B 5ESAA 3ROOA 1S5HA 5A2JH 4ONOA 5DI8A 5EC1A 2VLRE 4QRUB 4UV7H 5DUBA 5IFJA 3F7RA 3UPRA 4OGYL 4GG6E 4ZUUB 3PJSA 4PRPD 4BELD 5F7HA 4JDTL 4OFIA 4NO5B 1S7WA 2YPLE 3BSZH 1XCQA 1CFSA 2ADIA 1G7MB 4PRHB 1FL5A 1B88A 4NN6C 2DWDB 2GJ6A 2VABA 5DZNA 2W9EH 1OHQA 1GZQA 1HINH 5K93A 3JV4A 4RMWA 4GG8A 4LRIC 3CSGA 3V0VB 5KOMC 3FQXB 3PF2A 1ORSB 3TN0C 1TJGH 4P2RB 3QNXB 4D94A 4DWHA 1G7LA 3CSYA 4NP4H 2PTTB 3U4AA 2A73A 1VEMA 4EN3D 1RIVL 4GUPA 2X89D 4POZD 3BGFC 5KVDL 3S35L 5KOVC 4HKZB 4U7MA 5EZJB 4DOHE 1YEHH 1GGBH 4KROB 4PJGE 2X4UB 1YEJH 2CK2A 3OJDB 5D93B 2H6PB 4M8QA 5EU4A 3TPKA 1NEZB 1FSKB 1DFBL 1U8MB 1BVLA 3FQTA 3OKKA 4MLIA 1A6TB 3I3DA 1KTDA 5EBLB 1FLTX 4LASH 2X41A 1LO0L 2X4TB 1IEHA 2R2EA 2V2WA 3GFUA 3FT2A 4G6AC 3VWKB 1OTUC 1JNLL 2IH3B 5DC4B 5HGBB 5KSUB 4FQCH 5C0EB 5JTWA 1WIUA 5DJYA 1DBJL 1QP1A 2C1PB 3REWA 3T3PE 1MCRA 3VFUA 3RTQA 1EMTH 1NMCC 1EJ6A 3DARA 5D9SA 1I8KB 3IDGA 2OZ4L 5F96H 1FYTA 4QT5B 3U1SL 3L6FA 3FHAA 2YZ1A 4XGZA 1P1ZA 3BEWB 1JWMA 5JUEH 1F4XL 3UCRA 1MFAH 3BAEL 1I7UA 4U1LB 2XA3A 3O2VH 1ORQB 4FFVD 1D5ZB 3MRPB 3Q6FA 2EZ0C 4Y2DB 4XMKH 1G7JA 3LQAC 1MJUH 4KDTA 2R0ZL 4MCZA 1JTPA 5D7LD 1AGEA 3ZE0F 1OAKL 3DV6B 4PRPB 5C0BA 3ECBB 2C7UB 3TO2B 5J89A 1EEZA 1IM3B 4JFZL 1F3JB 1UGNA 1Z9MA 2J5LC 1SJHA 3DIFA 4L9LA 4P4KB 3MRLA 5E9DB 4XP4L 3VXUA 5MI0C 1RZFL 5I1HH 4RGOL 2VZ1A 1A2YA 5FECB 1UWXH 5JOPD 1VFUA 2F9BT 3LKSB 4H1LA 3GI9H 3BXNA 3H0TA 4Q6IC 2Q86B 1R5WB 2Z91B 4JFDA 1F2QA 3HG1E 5EFIB 1Q94B 4KK9D 4MHHG 4RIRB 3V6BR 5HPMB 2PYEE 3QJFA 2NNAB 3SE9L 5JXEA 3CC5B 2CKBB 3T65B 4HS8H 4KKAD 2DQEH 2P5EE 2BVOA 2X1OA 5I8EA 1OLLA 4R3SB 2ED9A 1BWWA 1SY6H 1MQ8A 1JL8A 1NJ9B 4LLAA 2VKWA 4MXQD 3MMEB 2J8UE 4JG0H 3B5TA 4KQ3H 4UTAL 1YJDH 4M7JL 3MLWH 4MD4B 3WKNA 4L8SC 4I4WB 1AE6H 4ZFFB 5E5UB 5SWSE 3BQUB 4KJQD 1OGAD 5TDNA 3VFVA 5BW7A 3QIBB 4EI6A 4FQJH 1Z3GL 2JIXB 4HQQH 5BRZD 3MLVH 4JFPA 3WHE0 3BPNB 3O4LD 2AV1B 5E95B 2DRUA 1IL1B 3LEXA 3DVGB 2Y06H 2NXYB 2QSTA 3MBXH 5CJOH 3MTRA 4UIKL 1RVFH 1FGNH 4XPHL 1E6JH 2KZ1B 1ZEAH 4HLZG 5MERB 2K7PA 1CL7L 3ZLQC 2PW2B 4R4FL 1BQHG 1MJ8H 4QNPE 4PV8B 2UZXB 3CVHL 5EO9A 5EUOF 2OTWB 5IM7B 1AXIB 5ALCL 4MA7H 4QEGA 2YA2A 4AY0A 5I30L 5EZIL 2IPKB 4YHNB 4ODWB 3GI8L 1KG0B 2AEQH 35C8H 3FB7B 1DLFH 4S1DD 3SDDA 2NY4B 2BVPA 3PIQB 3P9LA 3QXAA 4PRAA 1I7TB 4O02L 2LVCA 1JHTB 1U3JA 2D7NA 3O45A 4GAGL 4WFEE 1WAAE 1S8DB 2R1XA 1U93A 4HPYL 3FRPA 1FNLA 1F90L 2F54A 3U82B 4I8DA 4JVWA 4LOUD 4RISL 3ROLB 3KPPA 4E42B 4L4VA 5GGTA 4JG1H 5TDOA 3HI5H 4LHUD 4IEFB 4J4PA 4WO4B 1XF1A 3QUYD 4IHOA 2IGFL 4K71C 4P2QD 2FHCA 1CBVL 1AIFA 1MWAB 4B50A 5JW4N 3W39A 4WIQA 2HFEB 3JUZA 3K3QA 3WS3A 4NM8H 5DEGA 1OM3L 3OX8A 4W4NA 1RZ7L 2YR3A 2XFXA 4G9DA 3K8MA 3NGBC 4QO1A 4HZLA 2CK0L 3CCHB 5DXWA 1WLHA 2XPGB 3WN5C 4KI5E 1P7QD 2KKQA 3UYRH 4U6HB 1TVBA 2XWJB 5I8KL 4S0SD 2G5BB 4K7FB 1IGCH 1ADQA 3H9SB 3BZ4A 3Q1SH 4M3JA 1A7BA 3VFWB 2RAMA 2SEBB 5I1AA 4BUHA 2AK4E 5JXAH 5FOJA 2FGWL 4G43B 1ZLSL 4TOYH 4MHHI 4GW1B 4XP5L 3W9DA 1D3CA 2J8OA 5E7BA 5AYUH 1A7QL 4KJPC 5D72L 1A6PA 2AXJA 2W9LA 4PJXA 4TVPD 1MCPH 1MCJA 1NFDE 4YXLH 3HMXH 1FG2B 3CVHB 5BCAA 5BZWA 2B1HH 4GW4B 2X4SA 2MFNA 3MNZA 3JWDH 3SQOL 1KN4L 4NNYB 3HCVB 4QWWD 5EZLB 5IB1B 3V6ZA 1YNKL 5BS0A 3LEYH 3DX8A 3WFEL 4PLOB 4WUUB 3UTTE 1XT5A 4JREB 4WI9A 4DUXA 1A4KA 1KIQB 3EYSL 4TVPL 2X4OB 2EDLA 1WZ1L 2BVQA 4YEFA 4D9QE 3G08B 1ZHBB 4L5FH 2FD6L 2JF1A 4PV9B 5FCUH 3MA7A 1INDH 3E6HA 2CDGB 3RVXC 4N8VG 4ELKA 1XMWA 1NBYB 5EA0H 4KAQL 5KJRH 4KI5C 1BREA 1R5VB 4FQXD 3UO1L 5L6YL 4LFHD 5CWSA 3VXRD 1FH5H 3GBMH 4PLJC 5BV7H 4ERSH 3QI9A 5I1JL 5DUPL 1RU9H 4RCAA 3T8XA 4YDIL 3S37L 4JO2L 2HLAB 4PR5A 3P3YA 5I8OL 2AJVL 2BRRL 1XIWD 3V5HB 1JZ4A 1IAOA 2X70A 4KZEL 3O0RL 4RFOL 5D1QC 4NNXA 4H5SA 4XVJL 5F9AC 1K6QH 3PWJB 1BEYL 2NTFA 3V9FA 4RGNE 1L0QA 4UV4L 1KTRL 2B0SL 4MAYA 3IFLH 3RZCC 4O2CB 4F37K 1ZLUK 3SO5A 4U4BA 2R15A 1Y0LB 2VDKH 5L2KE 3LRSB 4HFUH 4HUVB 3LKQB 3QDMB 4UUJB 3ZT6A 4E0RA 3LB6C 4YBQD 5DQJA 4Z0XB 3U30B 3CFBA 4M4RA 2EYTA 4OLYL 5SWZE 2IBBA 1RZKL 1RV6X 1ZWIA 3ES6B 1JHLL 4PRBA 4XPAL 4DAGL 3RWGA 2E7BA 1RJYB 1V7NL 3QDGD 1LNUB 1R3KB 1WF5A 3X14B 4PB0L 2EXWD 2EKSB 1V7ML 1C1EH 2ICES 1GGCH 1ZLVK 3B3IB 1G9NC 4PJCB 2OTUB 4MNGE 4ZO6A 4GQ9L 3OXRA 1QKZH 2LTQB 3LQZA 3RHWF 4JFYA 2AI0L 3BDXA 1INQB 3SDYH 1TNMA 3FRUA 5EU5A 2DLEA 4NBYB 2F58L 1G9ML 3JV0A 4AJ0A 3ZDXE 5T3XE 1UM6H 1DQDH 1VGKA 4IBLT 4ZUVB 5TDPA 1DR9A 2VDQH 5F3HB 4Z7NE 2VR5A 1LO3L 1AC6A 4ACPA 5K9OB 4X6CA 4P2OC 3UYPA 4JY6A 2HFGH 1KEML 4YXKH 4RGNC 5FKPB 2P48B 4NDMB 4DQOH 2Z35B 4D0CA 3AS3A 3MCG1 4NKMA 4ETYA 4R0LB 3NZHH 4Z7VF 2X7LA 4FHBD 1EV2E 4FQ1H 4Y16D 1HKLH 1WZMA 3MCKA 5AZEL 4J23A 2AVGA 4HCRH 4MQSB 1QLEL 3MBEA 4WUKH 7FABL 4PY8J 2I07A 4LGRB 4PJEB 3U46B 1EXUB 1F4WL 1FZOB 4Y5YC 2JJTC 4XP1H 1RZ8A 4NSKA 5EU3A 5L8KB 4JE4B 1OP9A 1SJEA 3O3DB 1OP3K 1U8IA 1CICA 4LPVA 3PQYE 4EQ2A 1QSFB 1CDJA 5AYQA 4APQB 2VR4A 4R8WH 3ZO0A 4NGHH 2AJ3B 4GXVH 4IMLB 2UZIH 3GKWH 5AWNH 2XI9A 3EO9L 1R3IL 4Z7WA 3BKYL 1T1YB 3O8XD 4DTGL 4WW2B 2AGJH 5HDBF 1FFQA 1K5NA 1F2XK 4OGZA 5SX5H 3CDCA 1IEAB 3G5XB 4F9PC 3IETB 4HUKB 4LCUA 4LCWD 3B9KB 4AH2B 3IDXL 2CIKA 3N1PC 2HT3D 1KPRB 4FQIL 3STZB 3GRWH 5D7LE 5HGHB 1FIEA 5IT2H 5HJ3A 4EN3C 3OHXB 3WHE1 5FHBH 1HOCB 4POZC 3G6DL 5FYLH 5EZOH 2V5RA 3MLTA 5FM5O 2E27L 4YHKH 5E8NB 2R56H 4NQDB 3EO1A 4Z5RA 3LPWA 4OJFH 5C2BH 4ZS7L 4WDIA 1MI5B 3WXWL 3NN8A 1FV1A 1C7SA 1JFQL 4KMQA 2GK0B 2FB4H 5I1CL 2QSCH 3RGVD 5JOPE 1DQLH 3RU8H 1CXIA 4LSPH 3F7YA 2WANA 4DW2H 5HI4D 3S36L 3QRGL 4NO3B 2HLFD 1S7VB 3SBWA 4F33A 3FONA 1MVUB 3T0AA 3TPUA 1I7RA 3JXAA 4P46D 4UT6L 5HGGS 5CAYB 4PLKD 5FHAH 3VXSB 1R5IA 1PYWB 3TCLA 5KS9A 3FQWB 5EIIB 1G0DA 2DKUA 5F97E 5F9JB 4UILL 4Y4FA 1J8HD 1S7XA 4GBXA 1E0OB 2BJML 1INEH 2VH5L 4DEPC 2ZNXA 3HE7B 4Y4HB 4KRPD 4NKOB 3VJ6B 1YY8B 1I7ZB 2DIJA 5IJVB 3G5ZB 4OZHA 2I9TB 2O26U 4YZFF 3VMPA 3V0AC 4J6RH 2OJEA 1BOYA 1BAFH 1DQQB 2HVKB 5DWUL 2F53D 5BRZE 1Z5LA 3H8NA 1QFWL 2QQNH 3I6GB 1NEUA 1UWGL 1QYGH 3O4LE 5I9QB 5DFTA 3R06B 1REIA 2VR9A 1NFIB 3L95A 1ETZA 1A7OL 2I9LB 4LLDA 3UXFA 2VERN 1BQUA 4CAGA 1MFEH 1S3KH 4HF5H 4WO4C 2ZOLB 2MMXA 3NTCH 4D3CL 4QYOB 5C9JA 3QUMH 2W92A 3OKDA 2JJSA 4F7TA 1XF2A 2VXSL 4ZTPL 4KI1A 1FCGA 4I18C 2HJFA 3FB6A 4I3RH 4RMSA 2XOTA 5J12B 1DQTA 5DSCA 3NPSC 1UM5H 5IUSA 3K4AA 4KK9C 4QRRD 5L0QB 4IIQA 1EZVY 3CXDL 4CL7A 1RQ5A 4PGJA 1EK3A 5DMIL 2P42B 3MOBH 4KUZL 3HPJA 4KKAC 3ELAT 3O3EB 1S9XB 3ZSSA 4NQVB 3QA3B 3TIDA 1FLRL 4TUJA 4KTDH 3LCYA 3BH9B 1I9RH 2VNCA 4N1CA 4MXQC 4DCQA 1FVEB 3MV7D 3I2CH 1N8ZB 4UV7L 3VXQA 1WQVT 4HUNB 3GK8H 4KJQC 3RNQB 4PJ7F 3B83A 2VJXA 2YPVH 3H3PH 1F4AA 1CZ8H 1JUFB 1J1OH 2FYYB 1CTOA 3QEQA 4GKSA 4V2BA 1BBDH 4M3KB 1LEIA 4RMVA 4MNHB 5JHDB 3JBG7 4YHMH 3QULA 5C0FA 4K55A 3LKRB 2V2TB 4PJIA 1J0ZA 2ZG3A 5BMFH 1ZSDB 2W65B 3BSZL 3QHZH 2V9TA 3C8KB 1SEBB 3ISWA 3FFCD 4JREC 3FN9A 4WFHD 3P4NA 2G2RA 5I1DB 3HAEB 3AMLA 3TNMB 2EC9U 5D2LF 2XQBL 1UZ6F 1IM9A 2W9EL 4PJ8B 1HINL 3DXAA 1LILA 3L1OH 5JPNA 5C92A 3DO3A 3SDXF 5C0CB 4JFFD 1V3LA 1PG7W 4OD1H 1TJGL 4TVPE 2P24A 4JDZA 4RFNB 4NP4L 3D0LB 1CD1B 5TJWK 5DQ9B 1H15A 3ZTNH 3IFNH 4RX4A 4LSVH 1T2XA 3BX7C 4Z7UA 3BP6B 4XH2B 2EDHA 1YEHL 1GGBL 1Y6NR 1OW0A 3I85A 5FUZH 2ESVD 1YEJL 3NCJH 2HN7A 4LOUC 5HGAA 2AJZB 4JQXC 2JJVA 2CJUH 3FO9A 3BW9B 1VACA 3LZFH 4LASL 1PZUB 3QUYC 3LV3B 4NCDA 2FO4A 5KN5B 3D2UA 5FA3A 5IMMA 5F8RC 4WHTA 4ZXBA 5EUOB 4FQCL 1KV3A 1EBAA 3GSNH 4P5TB 1HI6B 3PNWB 1V5JA 4PJBE 1EMTL 3HR6A 4XNMA 1IGIH 3ARFA 1NGWA 2HTKC 5F96L 1EHLH 3BH8A 3VXRE 3H7BB 4YFDB 3U9PH 5H94A 3SE3C 4E41D 5JUEL 2A83A 1MFAL 2IANA 4PJFF 2Y7QB 3O2VL 1T0NA 4I2XB 4HFWB 1ZHLB 3WHXB 3S4SA 4MCYA 4XMKL 3KPTA 3T09A 1MJUL 1RD6A 5LJYH 1XR8B 4JAMA 3IJSA 3PABB 4G8GD 4ZSOA 4D0BB 2MHAA 1WISA 3VDBA 2DYPA 3MNVB 5C3LD 4F2MB 1G7QA 3KDMA 3OKLA 3O81A 4FTVB 1BJ1J 4LKCA 2R69H 4F8TA 4IS6A 1Q9LA 4MB3A 15C8H 3TVMD 4GKOA 1F13A 3RNKA 4BQBA 2R1YB 4K8RH 1I8LA 4QWWC 2VZUA 4FNLH 3KXFD 4HG4K 1YMMB 3ZMRA 3U83A 1HKFA 1OOAA 4MD0A 4OKVB 1JGDA 2WIIB 1HNGA 4OI8A 3MRCA 3GI9L 5LGJA 4LPXA 4M7KH 3RDTA 5ITBH 1XF4B 3QYCA 3GMRB 4OLVH 5KVGH 3HNTH 5J6HB 4QHLB 4FZEH 4R0LC 4P57B 4WJ5A 3R0NA 4Z77A 1Q0YH 4MD5B 3QDGE 4X4ZA 3DRQB 4HS8L 4FQ2H 5EOTA 3QH3A 4FQXC 4QOKD 5JORB 4YFEA 2BCKB 3WLBA 2DQEL 4GRMA 2GIYA 3FFDA 1SY6L 2LU4A 4F58H 3IDYB 4JG0L 1FFOB 4HKJA 1UM4H 1XIWC 4KQ3L 5EO1B 5IF0A 1YJDL 5IFAH 3A6BH 3MLWL 5GGSB 3C5ZD 4GKZA 4X99A 1AE6L 1UH3A 2E7HA 2P5WA 4RBPH 1TIUA 1TITA 5B39A 4NT6A 3MZGB 3U0WH 4HQQL 3OG6B 4APQC 1EEYA 3MLVL 3SQBA 4XNQA 4R7DB 3P4LA 3JSSA 1RZKC 3PHOA 3T0EA 3MLUH 5HXMA 4J3OC 2Y06L 5I8CA 3QP3A 3OG4B 1JHKH 3MBXL 5CJOL 3TGXA 2VLKA 1RVFL 1FGNL 1G0YR 4U1HA 1E6JL 3VRLE 1B9ZA 1ZEAL 5HHVH 2HWZH 3LD8C 5TGBB 4POUB 3HC0B 4GMSH 1MJ8L 3ULVF 2XKNB 5D5MA 4YBQC 1CE1H 4XNZB 4NHUA 4E41B 2Q3ZA 4MA7L 2AXHA 2PXYD 1G9MC 3MGTB 4QHKJ 1N6QH 1VADB 2AEQL 35C8L 3EGSB 1DLFL 3NACH 4LCYA 3RPKA 4HKBA 3VXME 3K8LA 2EXWC 2I25N 3GMNB 4JANB 1EHAA 1ZA3A 2WIMA 4OAWB 5FF6B 5HY9B 5GGVH 5L8JB 1I1CA 1NBZA 5D70H 1Z9SA 3D9AH 5J9PB 1OGTB 5H35A 4DVBA 2A74A 4BFIB 4JG1L 4RQQB 3HI5L 1JJUA 4WI3A 5A43C 3I84A 5E99H 5KSBB 4LCWE 5DRXA 3NIDE 5CUSH 4P2YA 2DQJL 2JLLA 4NM8L 3FQNB 1DP0A 1LWRA 1WICA 2MPAH 3SGKC 1B2WH 3AC0A 5T3ZE 4CADA 3QG6B 4BZYA 5B21A 4F80A 2F5AH 4NQSB 3UYRL 2UYLB 1CT8A 3WFDH 3WDHA 4Y16C 3ZT7A 1I1RA 1IGCL 3Q1SL 3F6IA 3E6FA 3UTSB 2PNDA 4HLJA 2VLLA 2OL3A 5JXAL 4C56B 1KPUA 3OKYA 2NY3B 4TOYL 1IE5A 5AYUL 4F7MA 5I9QC 4XWOC 5DT1H 3QWOA 3DECA 3UC0H 1OQXA 4N0CD 3C5ZB 2GCYA 4X5XB 4U1GB 1MCPL 4YXLL 1LE5A 3HMXL 3PWNB 1JVKA 3VFNB 4AZ8A 4E5XB 2B1HL 2WINB 2PO6B 4LSRH 3M1BB 3N1QC 1KULA 2EDQA 5I71B 3JWDL 1J8HE 3MRJB 3VWJD 1XH3A 1A5FH 3BN3B 1TVHA 3QT2A 1XGQA 2DTSA 1CGVA 1NEZG 4M6NH 3LEYL 5GSRA 2ICWJ 4LAJH 3VFTA 2Z9TA 4KK8D 3KLSA 3HRZB 4GG6A 3KPNB 1BZ7A 4OZIF 1BGXH 1K3IA 4M93C 5EC2B 2EDFA 2XZAH 4LEXH 1J87A 4P3CH 1HQRA 2HT3C 4QY8B 4XBPB 2F53E 3MRMB 3QO0A 3SE8H 3ARBD 5FKAB 1U8QA 3IDMA 5FCUL 4QHNB 4XPTH 1INDL 2YBRB 2P7TA 4LP4A 4EDWH 2GFBA 1PW3A 2E9JA 5IR1A 5MEND 2J88H 4KKBC 3B6SA 4TSCH 3TJEH 5KJRL 5CP3H 4XAKE 3X13A 5L9DH 1H5BA 1FH5L 3UTQA 3GBML 5BV7L 1N5AA 4HC1H 1EEUA 4G5ZH 1RU9L 4TNWF 1BD2D 4C55A 2CUIA 1N3NB 2DQIH 3DUSA 3RGVC 5CP7A 2YKLL 4QRTB 1K8DA 3BP4A 2HLFC 5JZ7D 1YEDA 2HFFB 1KIRB 1W72A 5EOQH 4PTUB 2E8ZA 2OQJA 4K3DH 4PLKC 5BJTB 4RAUA 1A4JB 1K6QL 2VZOA 4RMQA 4F7EB 4KJYA 2GT9B 2H2PD 5DD6A 3TC9A 4MA3A 3IFLL 4PJ8C 3JV5A 4YXHH 4PJGA 3QUXA 4KRPC 2P43B 2BMKA 3Q48A 5HHMB 1JWUA 2VDKL 3MV7E 4ORGA 1FP5A 2MKLC 3V79C 1UJTA 4HFUL 4OV5B 2VIRB 4RFNC 3HC3H 5TH2A 3MQIA 2XZQL 3BDYH 5F6HI 4OZGE 4ALAH 2XZZA 3HS0A 1YY9C 1MEXH 1S7QB 1KIPA 2B8OT 4OZFA 1C1EL 3UAJD 1GGCL 3SGDH 3DVNB 4WFHE 5FCSH 1FNHA 2IPTL 2AEWA 3CFEA 1QKZL 1GGYA 5KAQG 3L3JB 4OF3A 3P0VH 3LN4A 3SDYL 1XCTA 4HWZB 5C07E 3VXOA 3RRQA 5IEHB 3UZEA 3T0WA 1BZ9B 1ZGLM 2XN9E 2B4CH 3NZ8B 4I0CC 1UM6L 1DQDL 3MUZ1 4TNVF 2VDQL 4HK3N 2APTA 4IMKC 4MQTB 4R96B 2LVEA 2HFGL 4LCCB 4YXKL 5DVMA 3P73B 4XBEH 4DQOL 4Q9RH 3M17A 1T03H 3NZHL 5I1EH 3NOIA 4FQ1L 2ESVE 1HKLL 5GGVY 3QPQD 2LE9A 4UNVA 3HZYB 4OCYH 1WBZA 4HCRL 3AU1B 2X4QA 4WUKL 4ZNEE 4L8DA 3RIFK 4NKIH 3TZVA 2ZOKB 1AQDB 3DX6B 3U0TA 2IMMA 3HG1A 1CF8H 3AS2A 4S1RH 1CGYA 4XP1L 3KPSB 3RWIA 4F3FB 4RFEA 1SYSB 3QNYB 2PYEA 3KLDA 1WC7B 1LEGA 3S88H 1FNFA 3JTSB 1SQ2N 5GRZA 3MACH 3UP1A 1FVCB 2NY6B 3QXWA 2HG5B 2P5EA 2VC2H 4R8WL 4NGHL 4GXVL 2ZUXA 1BVKB 2UZIL 3GKWL 5AWNL 5FYLD 3J7HA 4TN9A 4HK0A 5T1KD 1TTUA 2UWEF 2J8UA 2AGJL 2E9WA 1PSKH 1WBXA 5C0DB 1LHZA 1A6ZB 4KUCD 3SCMD 4U6XA 4R97B 3GJFK 1HQ4B 4HBCH 1U8OB 1MOEA 1QO3A 3P4OA 5E8PA 2FIRT 3MROB 4G8GE 4MJ5A 3B2VH 3LKOA 2H9GB 4PJ7B 4AM0A 1GAFH 3GRWL 1IC7H 4N9OB 3O6FB 5DRZB 5IT2L 3PV6A 2VLMD 5FHBL 5AEAA 5FYLL 4HS3A 5EZOL 1TPXB 2NW3A 3KS0J 2EDJA 1T89A 4YHKL 3WN5A 3OR7A 4QCIA 3MGOA 2R56L 4OJFL 5C2BL 1FZJA 5E2VH 1RJZB 5ALBH 2FL5A 5I16A 3GSWB 2FB4L 5LWYH 2QSCL 1DQLL 1EFXA 3RU8L 4LSPL 4QRPB 43C9A 4DW2L 3OMZA 1UCBH 4BH7A 5D2LB 5BOPA 3BIKA 2GTZB 4TPRH 1BBJA 3BI9X 4YR6A 1KJ2A 3MLSH 5D96B 5HYQA 2CRZA 4O2FA 4GRWH 4OFYD 5FHAL 4ZAKD 2IAMA 4UNTA 1WAAA 3VFRB 4QOKE 5ANMB 4MXVE 1H3PH 5HVWA 2OI9B 1INEL 2OLDA 4AEFA 1HH9A 1OCWH 4OLZH 5JPMB 3ULUH 1C12B 2NR6D 3KYMB 4JCMA 2Z31D 5IWLA 2NX5B 3JWOH 4MJ6B 4MSWB 4J6RL 3P9MA 4W68A 1CG9B 1BAFL 1C5DB 3U0PB 3WDJA 1UQSA 2QQNL 5KW9H 4O5LH 3DX7A 1QYGL 3TVMC 4P0DA 4LK4A 5HHOD 5IOPB 2PETA 4ZS6D 3TT1H 1ZVSA 3FMGH 1I3GH 1MHHA 3QJHA 4TRPH 3C9NA 5KSAD 3WNPA 1NLDH 1U58B 2EECA 1MFEL 1S3KL 2IG2H 4HF5L 3NTCL 2XY1A 3QUML 1AO7D 2AK4A 4N0UB 5GRUH 3QFJB 3L3GB 3FOLB 5CZVH 3HNSH 1OT1A 4I3RL 4HD9A 2P8MA 1UM5L 4JRYD 3KYNA 3GMMA 5HI3D 5HYSA 4PJFB 1NFDA 5D1QA 4G9FD 4BSVB 4IRSD 5LGKA 2MJWA 4L4TD 5C9KA 3P0YL 3MOBL 4PGBA 2FJHB 4KTDL 2OTPA 1I9RL 2QADB 3CIQA 3IKCB 2CLZB 5C0IA 3I2CL 1T1XA 3H2WA 5DK0B 3UTTA 1BHGA 1L0XA 1IGTA 1U8LB 3C5ZC 3GK8L 4U1GC 2BXZA 3I75A 2H32A 5T1LA 2YPVL 1JF6A 2HFTA 3H3PL 1CZ8L 1J1OL 1T1ZB 2G75A 1L7IH 4OF5A 5E2TH 1BBDL 1NPUA 3LAFA 1I85C 4YHML 2Q7YB 2QEJA 2FWOA 5BMFL 5D6DA 3ZE1E 1ZMYA 3QHZL 1M71B 4R4BA 3UBXB 2DMBA 2BNRD 4R7NA 3ZYZA 2O61B 4GRLB 1T21A 3O41B 2X2YA 1QLFA 1JZ7A 5ISZB 1DQJB 5CHNB 5ERWB 4XZUB 3L1OL 2H41A 2PXYC 2D7MA 2ZSVA 1ZGLP 1H3GA 2F8XC 3GMQB 2VOTA 4GSDH 5E8EB 4OD1L 3F65A 2AXGA 4JDVB 4Z8FH 1XF3B 4P2OA 5EG6C 2UY6A 3L5WB 1G6RH 2X40A 3ZTNL 3IFNL 3RWJB 2ERJB 4LSVL 5DJAB 5ADPH 2Z8SA 3F6LA 1PKQB 2Z8RA 4LHJB 2CLRA 4I77H 3RWFA 5FUZL 3BFOA 3NCJL 4NCC2 3OKMA 5DRNA 3EFFA 2CJUL 1DUYA 1RUKH 4LFHG 5DJ8A 5L2KA 3B43A 3KJ6H 3MRQA 3LZFL 3T2OA 4YX2H 1HCFX 1L0YA 3ARTA 5DQDH 4NQXA 5C6PB 2GJ6D 2FJFA 5JO5A 2V6HA 3QZWA 3QIUA 4IRJA 4DJMA 4Y5YA 1D5XA 4YFLI 2Q8BH 3GSNL 5HHNA 4F7CB 3EOYG 5LXGH 3INUH 2OS7A 5DD0H 5MENE 1F02I 1IGIL 3TA3D 4JQVC 3JV6B 4X6CF 1EHLL 4MNGA 3ZDYF 1BFOB 1MCHA 1FN4B 3JWDC 4Z78A 1I75A 4K8RD 2UUDK 4PG9A 1BD2E 1BLNB 1BIHA 4AEEA 4J8RB 1WTGT 2YA1A 1XGRB 4IOSD 2I27N 2PN5A 3WYRA 1QQDB 4OCMC 4F9PA 3BJ91 4PGEB 2ZUVA 4J1UA 4RRPG 3CFJB 1CDYA 1PY9A 5HD8D 4JFHD 3LY6A 4N9GA 2CH8A 2HJLA 3HZMA 2R69L 4EN3A 1AHWB 1RUAL 2Z92B 3JZ7A 3HB3D 1A6UH 4K8RL 3VWJC 4FNLL 4FOMA 1PZ5A 3MJ8A 2OZ4A 4EUPB 2F19H 3Q6GH 1G1CA 5BV7C 3STLA 1JWSA 3AREB 3GUTB 2LU7A 1S9KC 3IDJA 4HBQA 4QGYA 3H9HB 5DGRA 4KK8C 2VLJB 3QFDB 5GGRY 4LCCC 5CIPB 4M7KL 1E4JA 3NIFF 5CKAA 5ITBL 1U8JA 2VDRH 4OLVL 5KVGL 3HNTL 4S0TD 4HEPG 4FZEL 4GLRH 5J13B 1HDMA 5ESAB 3ROOB 1S5HB 3MREA 1Q0YL 5DI8B 4ZFZA 4WTZG 5EC1B 4JKPH 4RAVA 4KY1H 5IHZA 3U4BH 4DFHA 4FQ2L 5DUBB 4X4YA 4CMMA 5IFJB 5BXFA 2EYSA 3UPRB 3VRJA 3PJSB 3RPIA 4WTXA 3UEZA 1WWAX 1RZGB 4F58L 4PREA 1UM4L 4Q6YA 5IFAL 1S7WB 3A6BL 5JZ7C 4BYHA 3WMSA 4NBZB 2PKDA 1UXWA 4N8CH 1XCQB 1CFSB 5FUOH 2FO1A 2ADIB 3U0WL 1FL5B 2NY6C 3ME0A 4Z7OF 1TLKA 2HT4D 5D7LA 4EZMA 3MOQA 1MIEH 3MZTA 2VABB 2KPNA 2IEPA 5AG8A 3QAZB 3MLUL 5CJ5A 1T6WA 1HILA 43CAA 3X3FH 1JHKL 3JV4B 2P8LA 4GG8B 1R3HA 3L3OA 2V5MA 1T3FA 5HHVL 2HWZL 5KS9F 4KXZI 3EW3B 2VXUH 1C7TA 1IGYA 4GMSL 1U8NA 1G7LB 3CSYB 4KGLA 2YRPA 1CE1L 2YUVA 2A73B 4F7PA 4I18A