1Q9LB

S25-2 fab unliganded 2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 Fab (IgG1k) heavy chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 222
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lB01
3OAUH 2K1MA 3RIFF 4YK4C 5DSCA 5HHOE 4X7TA 1JWMA 4IRZL 3D39E 4I18A 4UTBL 3OHXB 3P11L 3SDAB 1FO0L 3I6KA 2Y25A 5ALCL 4KK9C 4Y5YB 3F8UB 1FG2B 3ZKQD 3MRNB 3MV9D 1TCRB 1BMGA 5C08B 1LQSR 1EEZB 1ZKAA 3HC4L 4OZHA 1RFDL 3WHXB 4IRJD 1I9RL 1VFMA 1CGSH 3VFMB 1ZGLM 3BPCA 1N7ML 5CMAA 2XKUA 4YHKL 3BO8B 1J8KA 3H9ZA 1RVFH 3BIAX 1CFSA 5IVXE 1GOGA 3KYOA 4FZEH 4WUUE 3DV6A 1O7VA 1IGYA 5IBTH 4PJBF 1JUFB 4QCIA 4H25B 3OKMB 1IEHA 3CK0L 1T0NA 4FZ8L 2FBOJ 3WFCH 3QDMD 1J1PL 2CMRH 5E70A 2OR9H 4ODHL 1QOKA 3HMXH 3OKOB 4ISVA 4P9HH 1RMFH 4NQDB 5BRZA 2A77L 35C8L 1MCNA 3QUXB 2XI9A 4LSSH 5L88H 1WBXB 4BM7A 1BFOB 3LEYH 3M45A 4NO5A 4UIMB 2J8UB 1KG0A 2OP4H 5FOJA 3S5LA 4HIHA 5DQ9A 3CXDH 3NPSB 5SWSB 1QPXA 5BJTB 3OAUL 2ZP0T 5CWSB 5J6HA 1J0YA 3PGCA 4QXUH 4XCYA 2FEEL 2Z8SA 3BXNB 4KHTH 1NGZB 5SWZB 4JY4A 1KPUA 3HR5B 3ARBC 1T4KA 1REIA 4XGZB 2Q86B 2PR4H 2P8MB 4N0UA 3CDYA 2Q3AA 4IRSD 4L4JA 3GJFA 3BP7A 1CK0H 2DLEA 4WU5A 1CGSL 1J1OH 4F7EA 4KRMB 3RL2A 1TNMA 3MXWH 2CDEA 5CLTA 2BVUA 4KXZH 1RVFL 2PO6B 4P2QE 3N85H 1MVUB 5EBLB 4HHAB 3ZL4H 1IM9B 4FZEL 4D0BA 3C08H 3QNZB 4Z7NF 3W0WE 2HFFA 1U93B 3DWTA 2WP3T 2YN5A 1SVCP 2RGSA 3O9WC 4JR9H 3S37X 2P8PB 4ZUSB 3WFCL 2KUTA 2CMRL 2IMNA 3I9GH 2OR9L 4WFGD 3HMXL 4RIRA 1XR9A 3FB5A 2BSRA 4P9HL 1RMFL 5DQJB 4JE4B 4CN6A 3MJGX 5F88B 1MHPH 1D5BB 4LSSL 5L88L 4XB8A 3U6RA 3LEYL 1J18A 5JPMA 2OP4L 3CFKB 5HGAA 2NLJB 5DXWA 5J1AA 4P5TD 3CXDL 1JMXA 1AR2A 4S1RH 4ODSH 4KVNH 1DDHB 4QXUL 3A6OA 4PJHE 1N0LA 4N8VG 4XP6H 4ZTPH 3ULVF 4ALAH 2C3WA 1YMMA 4KHTL 3H3KA 4JRYB 1V7MH 1HI6B 1KB9K 2GY5A 3L9RA 4DKFL 3CDGA 4KDTC 4MNHA 4GBXC 1HYSD 1T21B 2X7LB 1BOGA 2PR4L 4F8QA 2CIIB 4KUZL 4U33A 1CD1B 4HH9A 4KHXH 4ODWB 5DI8A 2ITCB 2Y23A 5JIPA 2HJLB 1DSFH 1IGMH 3MLYH 3E8UH 1CK0L 3LKNA 4NNXA 2VAAB 1I4FA 1J1OL 3BVNA 3MV7A 1R5VA 4OCSH 1MCCA 3MXWL 3V0VA 5BRZD 3H9SB 1KPRB 2R9HD 3WIFA 2CXGA 3DBXA 5TF0A 3N85L 1NFDB 2VJXA 3HMWL 4NC1E 4QRQB 1GL4B 3ZL4L 5C9JB 3C08L 1UXWB 4YQXH 2RJMA 3ILPA 2YPVH 3RI5F 3G6DH 4HWBL 4XB7A 1GGCH 1DTUA 4JR9L 5FYLE 3RY6A 4HD9A 3J8F7 5F3BA 2FYYB 5SWQA 3I9GL 1RIUH 3JTSA 1OPGH 5GJTH 3SCMD 1UEYA 1F6AB 1M7DA 3VGHA 5MENA 3E6HA 1MAKA 2H9GA 4U49A 3KXFB 1U8KB 5CJXC 1MHPL 5BZWA 1FFPB 2BZDA 5FKPA 4XTRD 5ID0A 2EC8A 3SJVD 3Q3GB 4V1DB 2WLYA 3HN3A 4JREB 3ILQC 4QRRD 2XWBB 1CFVH 4S1RL 5HPMB 4QT5B 2DM3A 4OCXH 2VLJE 4YBQD 4KVNL 2G2RB 3B9DA 3F6IA 3KPRB 4XP6L 4ZTPL 1A1OA 1VACA 2FNBA 4R3SB 1V7ML 4LAQH 1FNGB 3EOBA 3VXUE 1KLFA 1RZKH 3DUHA 4Y2DD 4R0LC 1R3IH 1ZT7B 4ELMB 4KHXL 1WITA 1DSFL 3MLYL 3E8UL 4POYA 3T08A 2NY2B 3O2DH 1L7TL 4OCSL 5IFAH 1JI1A 4PJ9D 3OKNB 5C0DA 4RFNC 3MUJA 8CGTA 3RTQB 2PCPA 1JPFA 4PJ7F 5DD5H 4BYHA 2QADD 4YQXL 4MHHG 2XKNA 2OTUB 1ND0A 1TZIB 3TESA 3G6DL 5JO5A 3I6LD 1K6QH 1GGCL 3VFVB 1YY8A 1HH6B 1YMMD 1RIUL 4HGWB 4UILH 1OHQA 1OPGL 5GS2H 5GJTL 3REWB 5FV1L 1A7PL 1NGWB 4MZ2A 1F3RB 1J0KA 3O3EB 5D9SB 2W65A 3TO2A 1O5DT 5I18H 4LCWE 4CDHA 4PJDB 3OHXA 3SDAA 3OAZK 4PRBA 4ODTH 4X6FB 4I4WA 4X6EA 2CRMA 5F6IB 5J06A 1CFVL 4OCXL 3U4BH 2W1NA 1W0WB 3DYOA 1EMTH 4KZDH 2P46B 1GXEA 3BHBA 1GZQA 5DJAB 4LPCA 3V2AR 4LAQL 3VFMA 3WJLA 3O2DA 3RUGE 2M8XA 5LAXB 3UBXG 4F2MA 1RZKL 4MWFB 3VFNA 5I16A 1R3IL 2CRZA 1IGCH 1FJ1A 3UTSB 4PJCA 1UWXK 4LVHB 2DOCA 5B8CB 3D6GA 1ED3A 4GRLA 2VLME 5ILTL 2HA1A 5EU3A 3C8KA 4H25A 5CKGA 1L6XA 4MYWB 5CHNA 1F42A 3BFOA 2CSPA 5DD5L 5AZEH 3SKOB 2DJSA 3QUZC 3TNNB 1X5GA 5F3HA 1Q9KA 5HHQB 1YQVH 3REVB 3LD8C 3S4SA 1J8HE 2X5PA 5J57B 4RRPA 3ARRA 4XVSL 4DFIA 1K6QL 4ZO9A 1KLGB 3FFCA 4UIMA 2J8UA 5ITBH 4UILL 3IS0X 3UPRB 5CEZE 3RVUD 4JN2B 3T3ME 1JTOA 3PWPD 5J3HD 1P5VA 2ICES 1SM3L 1KTKE 1I85C 4P4KD 3MBEC 1NBZB 1A47A 4M8VA 2B7DT 5SWZA 5I18L 4R4NC 3HR5A 1FVEB 4ZPTB 4ODTL 2JF1A 1RJCA 3GIZH 4WV1C 3PJSB 2Q86A 4JRXE 4LBEA 4U1IA 3L6FB 4JDZB 5K33A 3U4BL 4W81A 1FYHB 4GAJH 1EMTL 4KZDL 3G9VA 4I77H 4NKIH 4OD2A 1U8OA 2X4TA 3TCLA 2PO6A 1T1WB 3PL6C 3VH8G 1MVUA 1K2DB 1ZANH 4MJIE 1LWRA 1CGYA 1IGCL 2IANE 1VEOA 5KSBB 3PQYE 1RUPL 1MHHB 1UWEH 1EK3A 3DX6B 1S7QB 4K3EH 1AGCA 2VO5A 4OCRH 3ULSA 5AZEL 4MMXC 1Z9LA 3RZWA 4LP4A 1H8NA 5GS1A 3SDAD 5DQJA 1YQVL 2Y6SC 5HGBA 5DMJB 4RAUA 1T5WB 1KCVH 4RMUA 4OCYH 1FNEB 2NY1B 5F88A 3V6OA 4X80H 1RU9H 2MHAB 2XQBH 5E9DB 5C08D 4MXQD 5ITBL 1BIIA 3CFKA 3W11C 3MNWA 3O41B 2DLHA 3TH4T 2CIKA 1HDMA 2YBRB 4YO0B 1CFQB 1IZKA 4MZ3A 1G7HB 3PV6B 3AB0C 4JRYA 3BEWA 1KN2H 4KI1A 3BPOC 3GIZL 1T21A 2X7LA 1A22B 4YLQT 1CD1A 5HVWA 2BOCB 3UROR 2ITCA 3QH3A 4QTHA 2VAAA 1RJLB 4I77L 4NQDD 1HEZB 1G9NC 1DQQA 3QUXD 1T3FA 4N8VA 5CJQH 1NFDA 43C9B 1ZANL 3EHBD 3HC0B 4QRQA 1WCBA 2A6KB 4U2ZA 1QHOA 3QDAA 5SWSD 5IBLC 5LKNA 1UWEL 4OI8A 1RJZB 4RGMC 2NXZC 4GMSH 4K3EL 3PG2A 5AD0A 3UYPA 5K59E 4OCRL 5D8JH 1P69B 5SWZD 2H2SC 3TZVC 2HLFC 4JFHD 4AMKH 1KCVL 1VGEH 3O4OC 3NN8A 3R8BB 4OCYL 1U8KA 2FZ3B 5DJXB 4X80L 3HG1A 1F02I 1KFAL 1U3YA 5D1ZB 5HHPA 2XQBL 5GZOC 4KDVA 1BQUA 1AO7E 2XWBA 4L4TE 3PDGA 4CU8A 4NQVA 2UWEF 3DECA 4NN7B 2G2RA 2PO6D 4PRHE 5KZCB 2XWJA 2ZUYA 3EYQC 5EU4B 2EDYA 1IM9D 5JMRA 3C5ZA 5FM8A 2AK1H 1KN2L 1Z2KA 2D0HA 3DX7B 4GT7A 2CUIA 4FMFA 4OZGB 2P7TA 4BZYA 3SDCC 1NAMB 3FB7A 3BDYH 3DPBA 4HS8H 1VA9A 1N6UA 4J7RA 3KR3H 1JPST 3NMEA 3C8DA 4UNVA 2H6PB 3OKNA 2V5TA 4NQEE 3FL7A 3DVGA 1SY6A 4NQCA 4GG8B 3QXTA 5CJQL 4I3GA 5C0AB 2BY3A 4KKBD 4PJGE 2ORBH 1M6OA 4AJ0A 2BRRH 3V6ZA 5C0FB 1GVIA 5DFWH 3OTTA 1F4YH 4K55A 1UA6H 1FN4A 5GRYA 1AD0A 2L7UA 2VZUA 1TZIA 1K4CB 4MNGB 4D9RD 3M07A 3EDEA 1NQBA 2J6EL 4GMSL 4ZOEA 3TA3C 1NCDH 5D8JL 3IDGB 4XVTH 5F96H 3HRZB 4JRYD 4BSVA 1AHWC 5DFTA 1FP5A 4G8FA 3VI3E 4FTVB 4AMKL 4CGTA 1VGEL 3BGFB 3O3EA 1A6TB 1S7VB 3ARPA 2ESVE 4KI5E 2P5EA 4A2MA 1WFNA 2HTLD 2O26U 1XGRA 5GGVY 3GKWH 1MCPH 2P43B 2A6DB 3LMJH 4TUOB 1OP9A 4WFED 5I1HH 3LIZH 2BVOB 1V5JA 1KENH 5I1AA 3ARUA 4M3JA 3H9SD 3T3PE 4FRWA 1MCOH 4NPYA 1KB9J 4EUPH 4F58H 5DJAA 2AK1L 3BAEL 4I18C 5DR5L 1KN4H 5LAXA 2D7OA 1OTUD 3EYVB 2Z93B 4HC1H 4OGZA 4JGMA 5DHXB 3BDYL 4HS8L 5DDHA 4MJ6B 3VRLE 1NL0H 2VLKA 3KR3L 1MEXL 1OSZB 5B8CA 2NXYB 5DJ2A 1MI5E 4U3CA 1QSEB 3KPMB 3KXFD 4AEFA 1UH4A 4YC2B 5AAMA 2ORBL 2Q76A 3SKOA 3G5YB 2BRRL 3TNNA 5GXBB 1F4YL 4V1DD 1T2JA 3IXTA 4RWYH 3UBXA 4YUEH 2K9UA 5EIQA 5J9PB 2VN4A 3LEXB 5HYJB 5I75B 2D0GA 3KPRD 4U2YA 4OLYH 1NCDL 4Y88A 4XVTL 2Q7YA 5F96L 2BCKA 4LGRB 4JN2A 2J4WH 5EZIH 5FUZH 1NKRA 2CLVA 4LCYA 1IGTB 4MD4B 3L3OB 4NFDA 3KWWB 3GKWL 1MCPL 3QQ4A 1RV6X 4J4PD 5FGCB 3Q48A 4ZPTA 3LMJL 5I1HL 3LIZL 2NY2D 3NOIA 3SKNB 1KENL 4X7SH 4PTTA 2F53B 4IIQB 1HXYB 1QQDB 3RTQD 4U31A 4NT6A 1MCOL 1DANU 5IEKA 1FGVH 2OLDA 4F58L 5F7HA 3MLUH 1KN4L 3QIUA 3D0VA 4HC1L 1YEKH 3LH2H 1T1WA 1NC2B 5DRNB 2BERA 1VFUA 3KPNB 4JB9H 5DMIH 4Z7VB 1OWWA 1TNNA 1NL0L 4KC3B 5DFVD 5GISH 1X5YA 3DV4B 1GZPA 3BT2H 4Z7VF 4LOUC 3X13B 4C58B 3BZEA 1T0PB 4L9LC 4U0RC 1XGYH 1ZT4B 4RWYL 3I3BA 4Z7WF 4KJQD 4P9HC 4YUEL 4PGEB 3R1GH 3VH8A 2FH8A 3NVQA 5FAAA 4OLYL 1MCQA 4Y1AA 4CRPA 3FT4B 3QNYB 1RIVH 1U8MA 5EU7C 5EZIL 5FUZL 4Z5RB 1AR1D 2MSPA 1XGPB 1NGPH 1KJVB 3B43A 2CLZB 5HVHC 2PYEB 3LKQB 4LVNB 1A6UH 4YO0A 1CFQA 1OLZA 3UTSD 1G7HA 3LKOA 3CSBA 3O11B 1S3KH 3LDBB 5I8EA 1A7QH 3KHOA 1U36A 2Q87A 4X7SL 1N26A 3T8XA 2W59A 1CLZH 3M1BA 4RGNE 4PR5B 1MJJA 2BOCA 2BXYA 3MBXH 1AGEB 4OZIF 1FGVL 2R1YB 4HKJA 3MLUL 5GSVA 3ZKMC 4MXVF 4X0KB 2YN3A 2OX5A 43CAB 1I3UA 1YEKL 3LH2L 4EXKA 4NJAH 2XZZA 5I8CA 1X4YA 3HC0A 2VDPH 2WIIB 4JB9L 5DMIL 1N6QH 2CLRB 2A6KA 4WWKB 5GISL 2V2WB 1PW3A 3BT2L 3IKCB 2C3XA 4K94H 1RJZA 3QIWB 1RZIB 2BVEA 4PRAA 1FV1B 4QGYA 4WGVB 4DZBA 5MERA 1BECA 1VEMA 4JO2H 1NANH 1XGYL 2E7MA 2FX9H 2R1WA 5C0CE 2FZ3A 5DJXA 4QHNB 1G6RB 5IKCB 1BLNA 3G6JB 3RY6C 3QUYA 5D1ZA 1UB6B 5H2BA 4L3CB 1XF2A 5DJCA 3LQAH 2R15A 3CVIH 1RIVL 4MJ5A 3U4AA 2YZ1A 5JUEH 5FA4B 1NGPL 1UXSA 2XIDA 4K8RL 4HF5H 2FLRT 1TPXB 3MA7A 4PV9B 5DQDH 5F72S 1A6UL 3LKPA 5EU6B 5C0EB 1S3KL 1Y6MR 5K9QG 3DIFA 2DM7A 3EGSB 4JKPH 3DX7A 4FQ2H 1KIPA 5D96B 4HXBH 3PP4H 1CLZL 3HNVH 3MBXL 2FBJH 4F57H 1JGVL 4TVPH 2EYSA 3D85A 1FNSH 3GMOB 4LEOA 2Y7QB 4WU7A 3MRCB 2NY1D 1Q1JH 1TENA 3KS0J 4NJAL 5DS8B 5E9DD 5IHBA 2Q7NA 5C0FA 2VDPL 1N6QL 5JOPD 1ZSDA 3OSKA 4JPIB 4GKNA 5GJSH 3U36B 3CDCA 2MTPA 3F7VB 3MRRB 3VXTB 2F54A 4K94L 5KSUB 1QTYT 5D7IF 4HUXB 3RZCB 1B4RA 3GSWA 1C16B 5KSAA 3TPUB 1I1YB 8FABA 4U6YB 1CTOA 2Q3ZA 3ULUD 2PTTA 3MFGB 1HWHB 3V7MA 5LWYH 4FXKB 4JQVA 2FX9L 1M7IA 1S7SB 3AREA 3UC0L 1CXFA 3PWVB 3QUMB 1X44A 3KDMA 3LQAL 3MOAH 4TUOA 3CVIL 5JUEL 1MFDH 1G7LB 4HF5L 3ARGB 4CDGC 5DQDL 2NX5E 4K23H 3X3FL 5IB4A 4NN5C 2IC2A 3MREB 4XPHH 3HS0B 1V05A 3QQ9D 5I73C 3TJHD 4JKPL 4LHUB 2W0FB 3WFEH 1I8IA 1A9BB 3PP4L 4U7SA 3ARVA 3L3HB 3HNVL 4MJ6A 4ZYKA 3B83A 4WI6A 5E6IB 2FBJL 3CPLB 1OCWH 5E2WH 1Z9OA 2HT4D 4TVPL 1MAMH 4FN0A 1FNSL 2FEEI 2LV4A 4MCZB 2EDXA 4AT6A 3KPMA 3WNMA 4N68A 1Q1JL 2AGJH 3VFPA 3FT2B 5D1ZD 4XI5D 4X6DA 3QUKB 4GLRI 3INUH 5GJSL 4N90E 3FMGH 4GRLC 1K4DB 3LEXA 5HYJA 5KZCD 5AZ2H 4Y19E 4L8DA 3DSFH 4Z78A 5I6XB 4AY0A 2QQKH 1D9KB 3I50H 4QXTA 1H0DB 1WQVT 5D2NE 1YA5A 2HFTA 1A6ZB 1Q9WA 1NGYB 4AIZA 3OKEA 3TYFA 4Y4KB 1N64H 3MOAL 4ZSOB 4HUNB 1ERNA 1MFBH 5EPMB 1MFDL 4JGUA 1RUAH 2VWEC 4KQ4H 4J3VA 2F53A 3PHSA 1HXYA 4NO2B 5C0AD 1A6PA 4K23L 3FFDA 4L1HA 1KYOK 3RVWC 3WLBB 1A14H 3ZSTA 1T1ZA 4XPHL 1S78D 1HQ4B 1S7XB 3RGVA 5CZVH 2I24N 3HLAB 4JO3H 1S7WB 1IKNA 1K8DB 5MEQB 3WFEL 5EOTB 5T3ZD 1NC2A 4ONHB 3EOAB 2AJSH 3OXSA 1VENA 4K07A 5I1LB 1OCWL 5E2WL 5IVZA 3DV4A 1YDPB 1MAML 4FTVD 3VXRB 4IM8A 3IFOB 4U1JB 2AGJL 4IOIB 5JW3H 1CDJA 4WCYH 5CCKL 3RVVC 1J7VR 5C92A 3S36X 3INUL 3OL2A 4Z77A 3VXOB 4HUKB 2FSEB 3FJTA 3FMGL 4KK6C 3RKDC 3V6BR 4JN1H 5AZ2L 2ENYA 3IJYB 4N0CD 2NY4C 3DSFL 1IEBB 5TH2B 3FT4A 4B5EA 2QQKL 3F65A 3JZ7A 3I50L 3AMLA 3SDYH 4Z5RA 5GS1C 1C12B 1KJVA 2CLZA 3NIFF 5D5MA 1G9MH 4S1SH 2R1XB 3TBVA 1E4KC 4ZNEA 3QWOB 4ETYA 3KPLB 1OARH 2NXYD 3MRDB 1MFBL 3BH9A 1RZGB 1UVQB 1RUAL 4MA8H 1QSED 2HFEA 4KQ4L 1AQDB 1JNJA 1T7ZA 5C86A 2YRLA 2FDBP 4UU9A 1WZ1H 4P3WA 1A14L 5LCVL 1A5FH 4Q74A 5CZVL 1WC7B 2F8VA 4JO3L 4Z76B 1SJEA 43CAA 3QB7C 1AC0A 1KCSH 4KZEH 2Y06H 4XNZC 5HYJD 2NNAB 3NGBC 2EIDA 5JDJA 1OWRM 1CWVA 2WIIA 4F37K 2PW2A 4LLVA 5DVNA 3GBNH 1WV7T 1F45A 2CDFB 4U3HA 2XTJC 3QXDB 5DHYA 5JW3L 1FZMB 3BIKA 3IAQA 3OB8A 4WCYL 2FB4H 4QRPA 1FV1A 5DJ8B 2DBJA 3D3VA 3BRGC 4Z18A 5E99H 3EFFA 1XGUB 2JB6B 1HZHH 2NZ9C 4PRPA 4XX1E 4Y4HA 3RQ3A 1OGAA 1JGLH 2F53D 4JN1L 3G6JA 4TUJB 2ICCA 3DURB 5BS0E 4PJFA 3C9NA 2B39A 5JLZB 4HCRH 3SDYL 3WO3B 4X9BA 5J12B 2AXFB 1A21A 3L3GA 4F15B 4M93B 1YEJH 1G9ML 1R3KA 1NC2D 3CMGA 4S1SL 3DETD 2UZYB 2X1WL 5T3XD 1VFOA 5ESVA 3IDMA 2ZCHH 1RUQH 3MRBA 3EGSA 4OD1H 1UT9A 5CP7B 1X7QB 4MA8L 5DA0B 2A74A 5INCB 1QSFB 5A2JH 3H2WA 1KJ2B 5KS9F 1WZ1L 3SDXE 1CDBA 1G1YA 3C5ZC 4LSQH 4MJ2A 4NZTH 5EO1A 1A5FL 2Y7QA 1JWSB 5EDXA 5FCSH 1Q94B 2CO7B 3R06A 3MRCA 1KCSL 4JQIL 2Y06L 3EYFB 4W70A 4Y8AA 3UTTB 4KZEL 4C56A 3TNMB 3U30B 1QFWH 3MV9E 2BXZA 3GBNL 4CVZB 4F7PA 4H0GA 3FQXB 1U8QA 4YHMH 4P2YA 4TPRH 3RZCA 1I8MB 2BSTA 2PYED 3JV4A 4U6YA 2FIRT 3NACL 2FB4L 2A2QT 2HTKD 2Z35B 1DN0B 4MX7B 5E99L 3H0TB 1NDMA 4GS7B 4KROC 1HZHL 1S7SA 1CLYH 1WLHA 2ICEA 4CKVX 2ZOKA 4A6YH 1JL8A 4L8SB 5IFJB 1EPFA 1CE1H 3QDME 5J0BA 1K5NB 2FHCA 3EJJX 5IVXF 1NSNH 4HCRL 4JZOA 2LVCA 4XVJH 4ETQA 3T2PA 1A0QL 6FABH 2G75B 2H32H 2RFXA 1DQJB 1YEJL 5E2TH 1X6LA 5ENWB 2FGZA 2VXTH 3MZGB 4M9OA 5C71A 3P0YH 4WWKD 3MREA 3KPOB 3RU8H 2ZCHL 1RUQL 2HT2D 4IJ3B 4OD1L 5FKAB 5FGRA 5CEYA 1IFHH 4GW1A 3GRWH 5FK9A 3QIWD 5T1MB 1V3MA 3T77B 4LSQL 2K7PA 4FHBD 4NZTL 5KOVC 3RBSA 4U6HB 2AV1A 4P2RA 4AL8H 4CMHB 4AIOA 2GY7B 3OX8B 3VFUA 2C5DC 3W39A 4Y5VB 4AENB 4ZPVB 1X6NA 2D03H 3LEVH 4PREB 3U4EB 2FECI 4DK3A 4YHML 4TPRL 4K7PL 3D0LB 5AWNH 5J8OA 4X7FC 5EU6D 4I2XA 1D9KA 5FGSA 2AQ2A 3FZUD 3VFTB 1YN7B 5GRJH 1MHEA 1CLYL 3RY4A 4NZDA 3WBDA 1T1XA 1OTTD 4A6YL 1A6ZA 2H32A 1YEEH 3VXPA 1NGYA 3F5WB 3D2UA 4HUVB 1CE1L 2QSCH 1CIDA 1JPSH 3BUTA 3U79A 1NSNL 4WFGE 4QWWC 5EPMA 4DEPC 1UACH 5DVMA 4WO4C 4XVJL 6FABL 2ZG1A 3BRDA 5D4QA 3MNVA 1PY9A 1BFSA 2VXTL 3ZSSA 4M48H 3P0YL 4P46C 2ATKA 1X5ZA 4JQXA 1LD9A 3RU8L 3VXNA 3C09B 5I1DA 3GZKA 1U92B 2AJVH 1IFHL 3ALWA 2VDRH 5EOTA 3RZCD 3GRWL 4M3KB 4PP1C 3HZVA 1EA9C 3QJFA 5LGHH 2EDKA 3MV8A 3VRIA 5EZOH 3MRKB 3U2SB 3GJFK 4MB4A 3FRUB 3CZJA 3VXRA 5BW7A 4AL8L 3QIUC 3IFOA 4U1JA 5CGYC 2RHEA 5ACZB 1KB5H 4K3DH 4NSKB 4PJHF 2OMNA 5HGHB 3VXOA 5B22A 2FSEA 2D03L 3LEVL 3X14A 2DF3A 1OTSD 3ARGD 3WNNA 1IVLA 2OQJA 4H1LG 4EKXA 5AWNL 5BRZE 3TN0B 5TH2A 1IEBA 1MCKA 2WMPA 2X9XA 1M71B 3GHBH 4M00A 4Q6IA 1AFVH 5GRJL 5E4EB 3PHQA 4LHUD 3OKYA 1XEDA 1BZQK 4MAYB 1YEEL 2AQ3A 3GEWB 3LCYA 3L3IB 1C5DA 1WWBX 4NN6C 3C6LA 1S7TB 1QSZA 5IMOB 1U58A 2QSCL 5E6ID 1JPSL 1DQLH 3DRQB 4NDMB 4PBXA 4RMRA 3ORJA 1UVQA 1IKFH 4H1LB 4PYHA 5CUSH 2X4UB 1B88A 5D1XA 4ZMAT 5DVOA 4M48L 2VL5A 2ZUXA 1K3ZA 3SJVE 4GXUM 1WC7A 1KXTB 4M5YL 1PD6A 4QRRE 5EIIB 2AJVL 5FUCE 2VDRL 1OLLA 2CH8A 4LF3A 3GSOA 1KB5A 1X5XA 1HILA 1V3JA 5LGHL 1D9KD 2UYLA 1UWGH 3DO7B 3HC3H 5EZOL 1H8SA 3JV5A 4YHYB 1NH6A 3BMVA 1XF5B 2XKSA 4NQUA 3N0PB 2CDFA 1XR8B 3GK8H 5INDA 2BNUB 4GUPB 5HHMB 1KB5L 4BFIA 3STZB 1N5YH 4K3DL 5EZLB 3LKSB 3FO0L 2ZCLL 3P9MB 4Y4KD 3GIVA 3MJ8A 5JXAH 5B3JE 2CK2A 3A6BL 4PJBA 3RWDB 4LQFH 3KYMA 2FLBT 2W60B 1IARB 2VDQH 5MI0C 5FYJU 2WINB 4MS8C 5I1GH 1KT2A 1NLDH 2DLIA 5HI5D 3GHBL 1PX4A 1U8NB 4LRNH 2UV3A 3VGGA 1AFVL 3P9LB 1EHXA 3BOVA 3CDFA 3HE6C 5F9WC 5CIPB 4M7ZB 1R6VA 3I6LE 1UC6A 1YPZE 2X89A 3QUYC 3UYOD 3QJHA 1DQLL 4P2OA 4EIGB 5A3IC 1YMME 2P24B 2OR8A 3IDYB 5FA3B 1LE5B 5J89A 1QO3B 4APQA 1BJ1J 4PS4H 3VXRD 1JK8B 1IKFL 5EOCH 2P42B 4DK6A 3BN9D 5INCA 5CUSL 3S96B 4E42B 1JYVA 2YXMA 5F8RC 1KYOJ 4L29B 5TQ2H 2EYRA 2ZKHH 3FOLB 3OKLB 2X09A 1UFUA 4OLEA 3L5XL 2FX7H 3AUVA 1CXKA 3DUSB 4K9EL 4KPHH 4P57B 2J5LB 3UTTA 1B6UA 4DQOH 4WEMB 4R7NB 3D9AH 3ULVH 5I71C 4I3SH 1I3GH 1D6EA 2VXSL 3U7WH 4HLZH 5DWUH 1ZHNB 5E7BA 3I84A 4CVZA 3HC3L 2OL3B 1DQMH 3AAZA 4ONGL 3RDTB 1JMZA 3C6SB 3GK8L 2V5RA 4P23B 3RWJA 1HHGB 2OCFD 2XNAB 4WNQA 3OR6B 3RFZC 1B3JA 3AU1B 4YHPA 1DN0A 4RDQG 3O2WH 2Z9TA 4K71B 1PYWB 5JXAL 5IJKA 2DQCH 2W92A 4LQFL 1MFNA 4LL9A 3RUGF 4L8SA 3I02A 1DBJH 1G7JA 4KKCC 5KSAC 1ZMYA 5I1GL 1CGTA 1NLDL 2E9WA 1J87A 4HK0B 2C26A 4LRNL 1LO0H 5I17A 3C87A 2GITA 2VKWA 4I0PC 4JQVC 3AREC 4WEBH 4PFEA 5D1QA 3DUUA 1HINH 1D5IH 5F6HJ 3L3JB 4LNRB 3KPOA 1MCDA 1VHPA 1TLKA 5F7UA 5FKAA 3PWPE 5EOCL 2Y5TB 3F7YB 4Y5XB 4OZFB 4YH6A 3DVNB 5TQ2L 4OIAA 2KBGA 1CS6A 3VWJA 3VG9B 2ZKHL 2FX7L 5IF0B 1ZLSH 4KPHL 3LRGA 5EBMB 3DLQR 4WTXA 4YFDB 5FDWB 3QI9C 1BAFH 4CU6A 5F89A 1X5LA 1QLFB 2OXHA 3D9AL 4I3SL 4ONOA 1I3GL 5EULV 3U7WL 3ULVL 1YY9D 1ZVYA 3RHWK 4BA8A 1XCQA 5ICZA 3TLRA 3O81A 4ZPVA 1DQML 1YC7A 4N9GB 1A1MB 1IEAB 4YC2C 2BVPB 2X89D 3W5NA 4TNVK 5E95B 4J3TA 3VFTA 2P47B 3DROB 4LDLB 1BGXH 2XTLA 2DQCL 2A73B 4LPWA 2WV3A 4K7FA 4OKVA 4X98B 3GBMH 4LVEA 1QSFD 5IQ9A 2ICWJ 3F5WA 1ZK9A 1DN2A 1DBJL 4K2UH 3G5ZB 1CQKA 3TBSA 2VXUH 3WV0A 3GNMH 4GXUN 4Y4FB 1F13A 1GGIL 1AIFA 3ARDB 1LO0L 3UTTD 4WEBL 4XMLH 4YFEA 1H3TA 3GMQB 5EU5B 1HINL 1D5IL 5C08E 1WBYA 3T0EA 3O3DA 3GSNH 1T83A 2YC1A 4XHJC 1T6WA 3HB3D 1SMOA 4X99B 1FZJB 5FB8B 3U2SA 1JZ2A 3IXAB 1EFQA 1ZLVH 3RGVC 3MV01 3UTQA 3BD4A 1ZLSL 5D2LB 1MCLA 4NQXA 3O6LH 3OR7B 4MA7H 3CZFB 5F7EH 5ACZA 5CFHA 4H26B 1IGJB 2GCYA 3HAEG 2IAMB 2V5MA 3I75B 4XNMB 5GS3A 4YXKH 4NQDE 4HS3B 4DFHA 5DMGD 3TN0A 4PJ7A 1MCHA 4HIIB 2VH5H 4WRLA 5E1AB 4P59H 1PQZA 5GZNC 5HI3D 1U41A 1BGXL 3QCUH 2DQJH 1M7XA 4PJEB 4UT7L 4OLXH 5SWSE 2E6QA 3MSPA 4YEFA 4MAYA 1LK2B 1NMAH 3BZFA 4HIJB 4K2UL 3NH7H 5JIKA 2VXUL 3L3KA 4NDMA 3S7GA 1QR1B 5IROA 5SWZE 5MEPA 3GNML 4WHTB 5T5FH 3T1FA 4C55A 5GRWA 4JFHE 4LIQH 4H1LA 3BEVA 4YDJB 1HHIA 4PRIB 5E00B 5EUOB 4XMLL 5CBEB 3VDBA 2O5ZH 2Y1VA 3P4OA 3RY5A 5K59F 2KPNA 1XGQA 3GSNL 5DC4B 4M1CC 1P4LA 2AXGB 2EYTA 1G7QA 1Y18A 1A7BA 2EDNA 4M7LT 2ZOLA 4L8BB 3SKMB 2BMKA 1MUJB 3O6LL 2F19H 4MA7L 4UINH 5F7EL 1QKZH 5F9DC 1W2KT 2VITA 4Z7UB 3LSOB 2DI9A 2UY6A 4NCDA 3QEUB 1BVKB 4XBGB 4C83A 1KCUH 4EDWH 1D7FA 4YXKL 4OQTL 3RWDA 1AKJB 4AM0A 2CKBH 2QQLL 2L7JA 2VDMH 3V6OE 4KH2A 2VH5L 1HXMB 3DMMB 3WDJA 4I5BA 4P59L 4HBCH 5GGSB 3QCUL 1JF6A 4Y4HC 4OLXL 4D9RE 1NMAL 3UPAA 4L4VA 1G9MC 5KN5A 5IP4A 3NH7L 4PJGF 1U8HA 4JRYE 3UDWA 4MA3A 4XPAL 1JK8A 1X4ZA 5F1KC 3LN5A 4LIQL 5GRZA 5H8DA 5I15H 4LLWA 4O00A 3SE4C 1A4JA 1NANI 3K4ZA 2O5ZL 1JYNA 1NGQH 1W72B 3OKLA 4N9OB 2QEJA 3MUGB 4JO4L 3PDDA 4YHZH 1MLBA 4GG6B 1PLGH 4WFEE 4ODVH 1I75A 1SEBA 2GK2A 3LQMA 2V17H 1AGFB 2GJZA 3H9SE 5KOMC 4O2EB 3TN0D 1BD2B 1A1NA 1MIEH 1NFDE 1ZHNA 2KDGA 4N5EC 4KI5F 3SBWC 2RB8A 2OL3A 2ED7A 1GH7A 4FFWD 4YIQB 1YUHB 1C7TA 3MO1B 5D72H 4P23A 1HHGA 2CKBA 2F19L 4MAYD 4UINL 1MRFH 4H5SA 3BPLB 1QKZL 2X41A 3T3PF 1QRKA 1S5IH 2X10A 1PYWA 2O61B 2EIZA 5EC2A 4WW2B 1KCUL 2Z92B 4EDWL 4TNWF 1CICA 2CKBL 1FNLA 4MDIA 1FL5A 3F12B 2FL5B 3KXFE 2VDML 2YEZB 3DHJA 3V8CA 4MQXD 1EEUA 3FQUA 3ZT5A 4JM2B 1KSRA 4LCUA 5F7NC 4H0HB 1NFKA 4HK0A 1E6OH 4HBCL 4V1DE 1WICA 2ZZUT 3VRLF 1FFRA 4KV5E 1JGUH 5DUBA 3OG6B 3O4LB 4QHKI 3KPRE 1B2WL 4PG9A 1YNTB 4PGZA 1QEWA 1J11A 3L1OH 4OIIH 2C4FU 4YK4B 5I15L 5HHMD 4Y5XA 2N1KA 5IQ7L 4X6BB 3TIDB 1IGFH 4H8WH 5DK2B 5F9OH 4HGKC 4ELME 3STLB 1IQDA 4OCLC 4YHZL 2YPKA 2V9QA 1PLGL 4E41A 4ODVL 3SGEH 5CILH 5FDWA 2V17L 3WJJA 1WVZA 1IRAY 5DD1H 4LGPB 1MIEL 3D25B 4FQLH 3KLHD 2QR0B 5J6GA 1UH2A 4HKXB 4KDWA 3X11B 5D72L 2GTZB 4UNUA 4FQCL 3VRJA 1INDH 1SMAA 1S5IL 1DLHB 2P8LB 5C2BH 5BVPH 4XXCA 5KANI 3IF1B 1S7RB 3CH8A 3S34H 1N3NB 3SY0A 4Z7OE 4OI7A 4O5LH 5DRZA 3EZ8A 3T1WA 3G5ZA 3QR2A 3W81A 2APFA 4MCYA 1XT5A 2OMBA 3BJ91 2A38A 4PJDE 2H26A 4JHBA 3ME0A 3HRPA 1H5BA 3LQZA 4UAOC 3IT8D 5GHWL 5BOPA 3NCYP 5T3ZH 4LLUB 3CXHK 3RDTD 4KVCL 5FO9A 1X5IA 3L1OL 4OIIL 4P23D 4LLDA 4ZXBA 1RQ5A 4DTGH 5GGVH 2YSSB 1IGFL 4H8WL 5F9OL 2DLFH 1FZJA 5FB8A 1KELH 1PEZA 3ARBB 3HE7A 3UTSE 4U1SB 1T5XB 1J10A 2DIBA 4XP4H 3PHOB 5K9KA 4GO6B 5CILL 1NFIB 5DD1L 2ADIB 3E1F1 1IGJA 2C3VB 3UYRH 4FQLL 1MHCB 4XCEA 4XNMA 4ZFGH 2DIAA 3LV3B 5JXEA 1AQKH 3QDGB 5JTWA 1YNLH 4YDVA 1INDL 1QLRA 4HIIA 1NDGA 5DJDB 2I9TB 5BVPL 4PJ5B 5A2FA 3S34L 3O9WB 5B4MD 5C2UB 4O5LL 4HWUA 3QCTL 4G8IB 2GAZB 2QHRH 3HAEA 1IQWH 4A2LA 5DJ0B 1JHTA 4XZUB 3KJ4C 1RK1B 3T0DA 4Q6IC 1VFBB 5T1LB 2HG5A 5KG9B 1YEHH 3ARQA 1T22B 4D9QD 3C6LC 3KPTA 3NA9H 2HP4A 5T3ZL 1A2YB 5MHSD 3VXMB 4U1HB 4L3AA 2IPTH 3IDIB 4NHUA 1ES0A 1D6VH 5HHNA 1MCWM 1P7QB 4DTGL 3HHRB 5D1XC 3LB6C 5GGVL 2DLFL 3KPQB 4L8BA 1CXIA 5KSBE 4GXVH 4GBXB 2OTWB 4XP4L 1EZVX 5C07B 1OAKH 5D7LB 2H3NB 5T1DH 3DRTB 2FIKB 3BI9X 5DJYA 2WK2A 2VKXA 2ARWA 3UYRL 4AYFA 3MV11 4Y4FD 1BVKA 4XBGA 4L3EA 3ARDD 4ZFGL 1AKJA 3QXVA 4FP8L 5KVEH 2X2YA 2V6HA 1AQKL 2DL2A 2EH8H 1WEJH 1YNLL 2J7LA 2DDQH 4X6CB 1DANT 1B0GA 3O6FA 5E9DE 2GSIB 2WBWB 5JOPE 4G80A 1D5MB 5GGSA 5I76A 4X5WA 5FGBC 1VESA 1DE4A 1UB5A 3G5XA 3QO1B 3PGDA 3RVXC 3WDIA 3B9AA 4XP5H 3WIHA 1IQWL 3S35X 2N7AA 3ULUE 4OJFH 5FO8B 2I60H 2VZSA 1YEHL 4XT1C 3PUCA 1JGDB 1OAQL 5GS0H 3NA9L 2IAMD 2IH3B 4P2OC 2D7NA 3EJYD 1FVCA 2OJEB 2IPTL 3WKNA 4APQC 4QNPE 5IB5B 2NY3C 1ZHLA 1D6VL 1I7ZB 2HH0H 1A3RH 2J2ZA 3BDXA 2V2XB 3MRPB 5ICXA 2H2PD 4GXVL 4G8GB 4CVXB 1FL6A 1KJMA 5M7QA 4RQQB 5T1DL 4E0RA 4NQSB 4NUGH 4R0LB 1FZKB 5L2KA 1KNOB 4M61B 4XCNB 4TSAL 4UQ3B 4UZGA 3T4AB 1T1YB 2O61A 2Z92A 1Y6KR 4RFNB 3TV3H 1CTNA 5KVEL 1CT8A 3RNQB 2FL5A 1BHGA 1T66C 2EH8L 4PRID 5K93A 4X4XA 3MNZA 2DDQL 4M6MH 2AEQH 3JWDC 1K3IA 3WEXA 2UWEE 3KLAA 4MVBC 1BPVA 4XMPH 3N50A 4Z7WA 4X9IA 1U95B 4Y16A 4C59B 2ARJQ 2E6PA 3M8OH 4XP5L 2VLRA 4LKCA 1K8IB 4G9FB 4D0CA 4P9MH 1I8LA 2QTEA 4OJFL 5KAQF 4KJYB 2I60L 3IU3B 3C8HA 2NY0C 4KK8C 1F00I 1ZHBA 3BP6B 3P77A 4OZGE 4QRTB 4QF1A 5D1QC 3FO9B 5GS0L 2VXQH 2X70B 1G6RH 3IFPB 1U91B 3QEQA 4Z95H 3W9DB 1G84A 4HIXH 4HUWB 2BSED 1QFHA 1NJ9B 1AKJD 3K4DA 5TGBB 3G08B 5C0JB 1LNUB 3TBWB 2HH0L 1A3RL 4OZIA 1WZKA 3ULVC 1LVEA 5C0AE 3DMMD 2NYYC 1BZ7A 4Q97A 3VWJC 5CD3B 2R2HA 2QBWA 5TDPA 3B2UC 5GGUB 2APBA 5BV7H 1U8JA 4CU7A 2GTZA 4LLQB 1YN6B 3UPCA 1ZEAL 4MQ7B 4MNGE 4NUGL 1LE9B 5ITFA 5T3ZE 4X83A 4RA0C 4RAVA 1LO3H 2XYCA 5JORA 4OBSA 1PKQA 1A7RH 1AGDA 1DR9A 1XFPA 5J4MA 1S7RA 4XNXH 5ID1B 4FTVE 3TV3L 4CJ1A 3LVEA 4HJ0D 3FB8B 4LLYA 3QUZB 5FYKD 4M6ML 5ANMA 1HSBB 3RIAF 4LFHG 1EEYB 1R24B 3LD8B 3FKUS 1S5HB 3QISA 2RCSH 4XMPL 4MLSA 4NC0B 1CXEA 5H37H 4XC3H 3FT3A 2EDTA 2A6IB 1BD2D 1OP3H 5DJZB 4LLUA 3LPFA 4P9ML 5FFLA 3MBEB 4HLJA 1M05B 4XBPA 4KJPC 1I1AA 5IHUH 3MJ6A 1XF3B 2YSSA 5TDOA 1EJ6A 1BQHB 1IL1B 5E2UH 5HYEA 2VXQL 5JW5A 1G6RL 1T89A 3ARBA 4X5XB 4U1SA 4Z95L 5DMKB 4HIXL 3QUMH 4WV1B 1YYLH 3LHPH 3T0EC 2EXWC 4HKBB 4PJIB 1QSEE 2C3VA 4JM2D 2OR7A 5HI4D 1D5XB 1FLRH 1ZHKB 1KGCD 1YQ2A 2H8PB 4ZFFB 1FZOB 4LPTA 4WJ5B 5BV7L 2YD7A 5IMMB 3PL6B 4ZQKA 3O4LD 5HJ3B 5HYJE 4PRDA 4JHWL 1LO3L 4OGYL 4RFEA 3B8SA 5DJDA 3X12A 1A7RL 2NW2A 5CBAA 1H15B 3MLVH 1TZHB 3ZHKA 1RUMH 2GI7A 4XNXL 3QNXA 4N1EA 5D7IA 5HHVH 4CW1B 3G04B 3DOSA 2GAZA 1HHHA 4YHLH 3RWEA 5ESAB 3WS3B 3ZDYE 3OG4B 1M4KA 5A16A 3QQNA 2EEDA 5FGCE 3QFJB 1PDKA 4NKMA 3H9HB 2RCSL 4F9PA 4KK9D 3HA0A 4MD5A 4OLUH 3EUUA 4XC3L 3V7AE 3OF6D 4LKXA 1A3LH 1FFQA 3B6SA 1E28A 3ARFA 1GGUA 1LP9B 1ROWA 3V4UH 3DXAA 1GGBL 5IROC 1BVZA 1OM3H 1UQSB 4HX1B 4U1HA 2D4FA 4B41A 1S7UA 3WN5C 4UBDC 4NRYA 5J11C 2IQAB 4ACPA 3FQRA 1D3CA 3HCVB 3JTTA 3N1GC 3QWRD 4KMTH 3AB0B 1BM3H 4M62L 4PJXB 1ZLUH 3KPQA 3O3UN 3K2UL 3BPOB 1OQOA 4Z7VE 4RNRA 5T3XE 4GBXA 4KGJA 2XFXB 3QUML 5C07A 5D7LA 1YYLL 1WISA 2Z91B 4EQ3A 3DRTA 3LHPL 1QACA 1FLRL 2JJTA 1NC4B 3CSPA 5I1EH 1OB1A 4XPFH 3F7QA 5CSZB 2VYRE 1MQKL 5ICYB 4R8WH 3DNKA 4NO3A 4PP2B 3QG7H 1MCBA 4X6CA 4Q9RH 3IB4A 1XCTA 3NCJH 3I3DA 1JN6B 1KTRL 3SDXF 1WAAE 1EAPA 3MLVL 4CN1A 5ERWB 1RUML 1RZ8B 2WBJC 4RGMB 2NXZB 1U42A 4M4PA 1KIQB 3QO1A 5HHVL 3ZTJG 3GGWA 2PYEE 5MEOB 3WUWA 4DVRH 4YHLL 1HSAB 3TZVB 2GKIA 3WHE0 1BVLB 4GRWB 3ARBD 1YYMH 5A2KH 5DJ6B 5CLWA 1LEIA 2VRAA 2DS4A 3O4OB 4NBYB 4HKZB 5C0BB 4OLUL 2GIYA 3S8WA 3QDJB 2ICWB 4HV8B 1JF1B 1R0AH 1A3LL 1MJ7H 3CXHJ 2VDKH 1OM3L 3DX9B 3V6FA 1DVFA 3UDWC 3RA7H 1JGEB 3SKJH 3QDGD 3LN4B 4QHLB 1I7ZA 4M7KH 2YWYA 3PWUB 1VFAB 1A6AA 2HYMA 2IPUK 4J1UA 4KMTL 3TIEA 4JFDA 1MJ8H 4G8GA 1MCRA 4BQ6A 4PJ5D 2NR6C 1CQYA 1P2CB 4RQQA 3O9WD 4TTDC 5ACLA 1FZKA 5DVKA 4YWGH 3SDCB 5E24E 5C6WH 1T20A 1NBYA 4D8PB 3CVHB 1T1YA 4R96A 1LDSA 2BY0A 1E27B 5I1EL 1GIGL 5T1LD 4IHOB 4UB0H 4XPFL 4QTIH 2FO1A 4R8WL 3RVTC 1PSKH 3QG7L 2XZQL 3G6JE 4DOHB 3NCJL 2HAZA 5E8OB 2AABH 4PJAF 1X3DA 3T0VA 4Q9QH 3VXMD 4DGVH 2YR3A 3D69B 1U95A 4WUKH 3VG0H 3E2HC 1CICC 3TA3B 4HG4K 32C2B 1P7QD 5GIRB 4DVRL 4Y0GA 5EU6E 3CFDB 4HZLA 3G6AB 4M7LH 3RPKA 1K8IA 1OQXA 1YYML 4TULH 1HQRA 3R0NA 4GBXD 2V2TA 4CNIA 5C07D 5D7LD 2BNRA 3Q6GH 4JJ5B 1RZ7H 5D6CA 5IJVA 1R0AL 3ROLA 2R4SH 1MJ7L 4LCCC 2VDKL 5IEHB 2R23A 2X4PA 5ISZA 3QRFM 5TGBA 4AH2A 3RA7L 3ZYOA 1C08A 2AEPH 4NGHH 3SKJL 2FJHA 4P3DA 2IH1A 4M7KL 3TBWA 4X7TB 1JWMB 4I18B 4N5UA 3MLXH 2A1WH 1MJ8L 5GGUA 3G5VA 3I6KB 2ZPKH 3KPPB 4MQ7A 2FJGA 4YWGL 1T0MA 3QPQC 3WJJC 4KTDH 3FAWA 3L5WB 4OZHB 1OW0A 5DGRA 3FHQA 4U3XA 1ORQA 3EKCA 5AUMA 5CGTA 4R7DA 1WUNT 3BPCB 5CMAB 4UB0L 1AGBB 2BVYA 1S9VA 1ITCA 3MJ9H 2UVFA 1CFSB 3FB8A 1PSKL 3QUZA 4ZO7A 5CJBA 1HSBA 2VLJB 3KYOB 3CUPA 1BQSA 3BZ4A 4YZFE 1SJVA 3ILQD 2AABL 4Q9QL 3H7LA 1WIUA 3DV6B 4XXCC 4JAMA 4DGVL 2G9HA 1IGYB 4JCLA 1J0IA 4WUKL 1QRNA 4WFFD 1UGNA 4I13B 4UMGA 5DJZA 2AJXH 1NAKH 4M7LL 1FHGA 1JPGA 4TULL 4JG1H 4PRNA 4G8GD 4ISVB 3SE8H 3PXJA 5E5UB 3THMH 4FQXA 4EI5C 3Q6GL 1RZ7L 2DN7A 2Y5EA 5CP3A 1H5BC 2R4SL 1DBAH 3KYAA 4P48A 4ZTOH 4H8WC 4JDTH 1A6WL 2IADB 4WTZG 4WV1A 1NMCC 4FG6C 3TH3T 4PLKC 2GTWA 3B3IA 4KFZC 2AEPL 1DUYA 5J6HB 4PJIA 4OKDA 4OFIA 5L2JB 4XCYB 4ZXBC 5KS9A 1ZHKA 3MLXL 1FZOA 3NFNA 3HE7C 2A1WL 1E6JH 1MRDH 1T4KB 1ZTXH 1HIMH 4KUCD 3QIBA 5IMMA 2ZPKL 4N0UB 1R3LB 4QY8A 3BP7B 4HUMB 4BQ8A 5HHOA 3MGAA 4G9FD 4WU5B 3NIDF 3ZZ1A 3D39A 5HPOA 3DTXA 1TZHA 3RL2B 1KJ2L 4F7EB 2CDEB 5C9KA 3MJ9L 3QULA 5JXEC 1ONQA 1KF9B 5SX5H 3BWAA 4L9LB 4D0BB 4EI6A 1G6VK 4U0RB 3QFJA 2X1XR 4ZSOE 2HFFB 2HRPL 4S0TD 1LMKA 4IOFC 2VERN 2OI9C 1OAUH 2VQUA 2NTFB 2AJXL 2NZIA 5IVXA 1NAKL 3CNKA 5T1KB 2Z8VC 4RIRB 5D6DA 3FB5B 4HH8A 1UQSA 2BSRB 4HX1A 4WUUA 3SE8L 5BOZG 3THML 2DM4A 4J8RB 3GUTB 5FYJD 5HVHB 2IQAA 5B3JF 1EHLH 3U6RB 3HCVA 3MMEA 3RIFK 4PJXA 2QLVB 5IT2H 4WHYH 1F6FB 1DBAL 5JPMB 4ZTOL 1S9XA 2MOVA 5HGAB 1JVKA 4JDTL 5J1AB 3GMLA 2KQNA 2Z91A 3KJ6H 3VXRE 2CJUH 3QUZD 4POZC 3QFDA 5CINH 2VDOH 2IQ9H 4RX4D 1YPZF 4NRZA 1E6JL 1MRDL 1ZTXL 3GMRB 3O6KH 4MNHB 1HIML 1ZT1A 2Z31A 3EW3B 5CSZA 3MRHA 5ICYA 3V0WL 2VAJA 3UJTH 5B21A 5DI8B 3MXVH 1S9WB 3IU4H 5FHBH 3LKNB 4NNXB 5IB3B 3BVNB 3MV7B 1R5VB 3WS6C 1NCAH 1NMBH 3MBED 3V0VB 1NCNA 3WIFB 4G43B 1MFAH 4R4ND 4OIBA 1ITBB 1HSAA 1BVLA 4PB0H 3O6FC 3MRLA 3ILPB 2XWTA 4HKZA 4ZOCA 5C0BA 4V2BA 5F70A 3UAJC 5F3BB 1F5WA 1OAUL 4XRCA 1WWWX 4P2QA 4G6ML 3SOBH 1DFBH 5MENB 3MRGA 1EGJH 5M95B 3E6HB 3O0RH 3W0WA 2H9GB 3PL6D 1CZ8H 4CADB 5E2JA 3I85A 5BZWB 1EHLL 3PWUA 2MKLC 5FKPB 3Q5YA 5ID0B 2AVGA 5IT2L 4Q9CA 4QEGA 2E3VA 5B39G 3P73A 5IVOA 2CJUL 5FYLH 4O2CA 4D8PA 1A1OB 4U1GC 5CINL 2VDOL 1VACB 2IQ9L 1KLUA 3QFJD 2EKJA 2Y6SD 3MGTA 1E27A 4XP9H 2Z0BA 3O6KL 2VE6A 4YHKH 3EOBB 2FO4A 4IHOA 4ODUA 4AG4H 2YUXA 2ZCKH 4R26H 2EE6A 2ZNXA 3UJTL 4QOKB 4PJHA 3MXVL 3LPGA 3IVKA 3R8QA 1WZLA 5FHBL 3W11D 5FOBB 1G7PA 1BFTA 3EDFA 3NCEB 3MA9H 5B39B 1YEFH 1NCAL 1NMBL 2PW1A 2JCCB 1ZS8A 4W6XB 4KWUA 2E7BA 2PCPB 4Z9KB 1JPFB 2AK4B 1MFAL 4OV6F 1MAJA 4MA1C 2IEPA 3CFDA 4PB0L 3FN0H 4ZG1A 3QEGH 2XKNB 2WSKA 3WLWC 1ZGLA 1ND0B 4EIZC 2Y72A 1U3HA 3KVQA 1EGJA 1DQTA 5JO5B 5E8PA 4EN3A 4Y16C 1GCFA 3OB0K 1QSFE 4IDJL 4G7VH 1RZFH 3O8XB 1JPTH 5GS0C 4Z0XB 1NC4D 5EWIH 3TT1H 2FJFA 1FO0A 3SOBL 1DFBL 2EDHA 1I8LC 4EXPX 3HNSH 1EGJL 1YEIH 3O0RL 3KPSB 1CZ8L 1SYSB 3UTTE 3IFNH 2W65B 3TO2B 4NN5B 1S8DA 1TTFA 5CD5C 2XQYK 5IW3A 5I73B 5AYUH 4PRBB 5IBLD 4I4WB 4X6EB 4TN9A 4AQ1B 3VD5A 4Y2OA 1WGOA 3KPPA 3P2TA 4GLRH 2NXZD 5AEAA 4OCNC 5IG7B 4OSUH 1JE6A 4N0FA 4DKDC 5FYLL 3L5WA 2H2SD 1GRWA 3TZVD 3BHBB 1GZQB 2HLFD 4XP9L 3SHSA 4YBLC 4O51A 4PGCA 3RBGA 3S4SG 5C0BD 1AGBA 4AG4L 5IM7A 4RRPG 4F2MB 2ZCKL 4R26L 1U2HA 2BC4B 1AXSA 1G7MA 3QDJD 1OAYH 3VFNB 4L5FL 5GZOD 5I16B 1BZ9B 2VLJA 2W0LA 1FJ1B 4OFDA 4PJCB 3SGEI 3AROA 4OT1H 3ZKXC 4HEPG 1ED3B 2P48B 5I30H 2XOTA 4GRLB 4IMKA 3MA9L 4S0SD 1YEFL 5EU3B 3C8KB 5CHNB 3EYQD 3VXUA 4UV7H 3RI5K 1FL3A 1TCMA 4NNYB 4LMQE 2YD6A 1JRHI 3FN0L 2C7UA 5F3HB 3QEGL 1Q9KB 3IGAA 3BJLA 4TNVF 4R9HA 2JK5A 3S4SB 3C2SA 3VA2C 3WE6A 3SDCD 3F58H 4RFOH 2HT3C 4OTXH 1OD9A 3FFCB 1UEMA 4FQHB 4G7VL 1RZFL 1JPTL 3CC5A 4MNQB 4G42A 1T04B 2IADA 5EWIL 2R0WH 3TT1L 1U8LB 2R0LH 2J8UF 4TVSa 3HNSL 3BKYH 1YEIL 3TGXA 1F3DJ 1T7VA 3OXRB 3IFNL 5L2JA 1CR9H 3TP4A 1I1AC 3OJVC 3SN6N 3RL1B 4DKFH 1T89C 5AYUL 1CCZA 3T0BA 4ZUTA 1R3LA 4KUZH 4LBEB 4U1IB 4OSUL 5BV7C 4LP5A 3TA3D 2EKSB 3E6FA 1P7HL 3EZJB 2KQMA 2HVJA 1J1XH 4WTZA 4OZFH 4LCWA 1GC1H 4OD2B 1U8OB 2X4TB 3OAZH 5CEZH 3TCLB 2ATPA 3LKRA 1BBJA 4ORZC 1OAYL 3HMWH 1TJHH 3RKPA 3FQWB 4L9LA 1QYGH 4OT1L 3HMXA 4ZDHA 4YHIA 5I30L 5KJRH 3T0WA 4HG4J 4HWBH 1CGVA 2NY4B 4UV7L 1AGCB 3SGJC 5EBWA 3ULSB 2NTFA 4JGJA 2HLAA 4JLRB 2PXYC 5T1KA 4FXLA 5GS1B 5F9JA 5C1MB 1CDHA 5ESQA 5HGBB 4J8RA 3GUTA 4RAUB 4F9PC 4NZUH 3F58L 4RFOL 4HJGA 4OTXL 4S1DC 4AZ8A 5BQ7B 1PZ5A 1BIIB 3ARFC 4X7EC 4YAQA 3B9VA 1V3LA 3I2CH 2R0WL 5GRVK 4F33B 2XXMB 3MNWB 3QAZC 2DQGH 2R0LL 3BKYL 4PV8B 2CIKB 1HDMB 1J8HA 4ZAKC 3CFEA 1CR9L 1A4KA 4YDLC 2EXYC 2VLJD 4HDIA 3BEWB 3GMRA 4Z7QE 2V7NA 4G6FB 3R4DA 1LEKA 4XNZB 2AKRA 3NGBB 3OGCA 2D31A 2P4AB 3QH3B 3FO2A 4QTHB 4O2FB 1S9WA 1J1XL 3OPZH 3HZKB 2ZG2A 5IB3A 1X5JA 3IJHA 2JJTC 1L7TH 4NOFA 1GC1L 2CKNA 5CEZL 1DBBH 3LAFA 4DUXA 2XTJB 1DQQB 4HWBA 4PGJA 1CI5A 1N8ZA 2I07B 1T3FB 4N8VB 4G43A 1TJHL 4JRXA 3N1PC 1WCBB 1QYGL 3UTZA 4X5LA 1VCAA 1NFDF 3GJEA 3P40A 4FQ1H 2FHFA 5JA8B 2ZUUA 5B38G 5KJRL 1CFTA 2HJKA 3FO1B 4L8CB 4KKLC 1TITA 5AD0B 4YPGA 2ED8A 4OM0H 1H3XA 3VWKA 2DLGA 3TO4A 4MJIA 2AAVA 2IANA 1A7PH 3MLTB 3NN8B 4CADA 2YZ8A 4NZUL 3HG1B 2M1KA 3S3JA 5HHPB 2M2DA 2AS5M 4FQIH 2LAGB 3I2CL 1WSST 4ENEC 2DQGL 4NQVB 1DVFC 3V5DA 4LOUD 5FM5M 2BVQA 1LO4H 2XWJB 5HHME 1NGXA 5IB1A 4KV5F 3C5ZB 3QRGH 3GM8A 4CAGA 1MSPA 3TBTA 4MJ4A 3VFGH 2J3SA 1NBQA 2P7TB 1VEPA 3VD7A 3FB7B 2R8SH 4QOKA 1JNLH 5HYFA 1WFTA 5T1KD 3OPZL 5FOBA 4RWHA 1MIMH 4ZUVA 4ELMF 5C0GB 5B39A 2R2EB 1QP1A 3K0WA 1DBBL 5ILTH 2JCCA 3BW9B 3DVGB 5H35A 5KVMC 4NQCB 4U1MA 3OKKA 2WUBH 4UV4H 2AK4A 1M6OB 3V6ZB 3VJ6B 1MWAH 1IE5A 2OXGA 1FN4B 4KROB 4FQ1L 1AD0B 1I3RA 4NFCA 4H0IA 1EO7A 4XVSH 4G6AC 1DLFH 4HK3J 3VW3H 4JEGB 2CR6A 4KJWC 1FNHA 4NRXA 3O8XA 4HPOH 4OM0L 4Z0XA 2CD0A 2ITDB 3NFPA 3ZKMD 4BSVB 1U8IA 4F7CA 1YMHA 4G8FB 1SM3H 3VGAC 2ADJA 3KPSA 1I7TA 1UZ8A 1SYSA 4I48A 4R6UA 4Z7OF 2P5EB 4W68A 3PABA 1XGRB 3RWHA 2AJ3A 3EOTH 3V79C 4FQIL 5L0QC 3MV7D 2Q20A 4ESKA 5I1AB 4M7JH 1II4E 1UM4H 2GJJA 1EO5A 3OKDA 4PJDF 5IG7A 1LO4L 2IBGA 3BSZL 3QDHA 4ZO8A 3EDJA 4NPYB 3V8OA 4G9DA 3U83A 5FIEA 3QRGL 4U1LB 1GGTA 1UENA 5H94A 3BP5A 4ZFZA 2B8OT 3VE0A 1JZ4A 1AO7A 3VFGL 2BC4A 4L4TA 4BZ1H 1T7YA 1BZ9A 4XBEL 1R5IA 4BKLA 2R8SL 5DDHB 1JNLL 4PRHA 2VLKB 3OJ2C 4LASH 4LSRH 1OW0C 1MIML 1RUPH 5MEND 2WWMC 5DJ2B 1JF5A 5EH1A 5EG6C 2WUBL 4UV4L 3BH8A 4NNYA 2Q76B 3MJ7A 2MCPH 3RPIB 1FIEA 1EO8H 4EUPG 1MWAL 1HYRC 4LSVH 3AM8A 4B7LA 3IXTB 4FNLH 2ERJC 5DEGA 3UBXB 3K2MC 3OJMB 1DLFL 2HWZH 4PGBA 3VW3L 5TQ0H 1MCEA 3CD4A 4FQHA 3FTGB 4HPOL 2DYPB 4MNQA 2BCKB 4PJGA 2Q7YB 1T04A 4DEPB 1FH5H 1VERA 4WO4B 3TEUA 1U8LA 2CLVB 4FQXC 4LCYB 3OXRA 1ETZA 4P46B 4QOKD 4EUPB 3QQ4B 5K9QI 4D9QE 4WFHD 3RL1A 3EOTL 3MZTA 1CLCA 3C60C 1XIWC 2ILLA 5MHSE 4M7JL 1UM4L 3WFDL 3TFKC 4PTTB 2EKSA 4NT6B 2AK4D 2CXKA 5IEKB 2FECL 3PIQA 2GK0B 3IDNA 2SEBA 1JZ6A 2E9BA 3IDJA 1W72L 3QIUB 4OFYA 3D0VB 5AAWA 3QIBC 4DZ8A 2C4FT 4BZ1L 1PG7H 4W4OA 4JO1H 3WD5H 1N2RA 3FQWA 4Q9BA 1EIBA 2NX5B 4LASL 2BJMH 4LSRL 1GZPB 4Y89A 4D0DA 5KSBF 3AVEA 3KPSD 4M6OH 1FVDA 4DWHA 2MCPL 3EJZC 3JSSA 4JLRA 3BZEB 1EO8L 2XY2A 4LSVL 3EAKA 4NC2B 3QEHA 4FNLL 4GKOA 3NZHL 4NN6B 3VH8B 1KFAH 2X42A 1MI5A 4HT1H 2VSDA 1E4KA 2HWZL 4X4YA 5TQ0L 4JFXA 5KVFH 4XC1H 5BQ7A 4Y1AB 1TQBC 5F7DA 2HJFA 1B0RB 1H8OA 1U8MB 1FH5L 2BVTA 3K81A 4F33A 5D6DC 2DKUA 2PF6A 4PV8A 3CAFA 4JFQB 1Y0LA 5D2LE 5TF1H 3C5SB 2BNQE 1ZV5A 3LKOB 4Y19B 4MDJA 5I8EB 1EERB 2HVKB 4GRLD 3BQUA 3MYZA 3ULUF 1I3VA 5JR1H 3OWEA 3T8XB 4AEIH 2D9CA 4PGDA 3M1BB 1MJJB 2CRIA 2PN5A 4O2FA 4HKJB 3HZKA 4NNPH 5GS2D 2R0KL 2VISA 2BHYA 3PDOA 5GSVB 4PTUB 1OGTB 4HBQA 4R4BB 5E2VH 5HYIA 4QYOA 4PJEE 4YR6A 2I07A 2Z31C 5K9OA 1PG7L 2DQHH 3B8YA 3FFCD 5I8CB 4JO1L 4QNPF 3WD5L 1QLEH 4S2SB 4MNQD 4U1NB 4NZRH 4M1GH 4F9LA 2BJML 2D4DA 1ZA3A 1RHHA 4NO0A 3FO1A 4L8CA 5MI0B 2J6EH 4M6OL 5ELIA 4PRIE 5F97E 3RVWD 2R4RH 4PIRF 5EUOE 4PRAB 5MERB 4DZBB 3MRQA 1B6DA 3MLTA 2R1WB 3HE6B 2UUDK 4LRIA 1C1EH 1U6AH 5F9WB 4PPTA 4F3FA 3HPLA 2NY6C 2QSTA 1BLNB 3QUYB 4HT1L 4LHJB 1IZJA 1EHNA 5H2BB 5KVFL 4XC1L 1XF2B 5DJCB 4XXDB 2N56A 4D3CL 1JWUB 4MJ5B 4YHNA 4QHUA 5B38A 3RX7A 1UXSB 4OFYD 3MA7B 5E5MA 1MREH 5TF1L 4POUB 3LKPB 3T2QA 3RVVD 5CZXC 4YEEA 3UZEA 3BAEH 4Z7UE 5DR5H 3DIFB 4KK6D 3RKDD 1UJ3C 1KIPB 5JR1L 3UXFA 5I71B 1G7IA 4AEIL 2GHWB 2NY4D 5JOEA 2ARJB 4OZGF 4ZUWA 1MEXH 3BRFA 4NNPL 2EYSB 3D85B 4LEOB 5C0GA 2R2EA 4WU7B 3O6MH 1IC7H 5E2VL 5HY9A 3BW9A 1Q38A 3VD4A 1TQCC 4NBXB 2J6EA 4XNYH 2DQHL 4DN4H 5C6PB 4R97C 2DWEA 1V8HA 1QLEL 2VLLA 3VJ6A 1ZSDB 4NZRL 4M1GL 2YUVA 4GKNB 2MMXA 4M6AA 2F54B 2YPLB 3VU2A 3GSWB 5KSAB 8FABB 2R4RL 1CE6A 5FYKE 2BFVH 1N4XH 3S37H 1JHLH 2ITDA 4F7TA 3ARTA 2PTTB 2NY5H 1MVFA 5FEBA 1HKLH 4GG6E 4G6FD 4I0PB 1M7IB 1C1EL 1U6AL 5E8NB 3AREB 1U3HC 3DGCR 5SX4I 5DD3H 2VDLH 4PY8J 4EN3C 5DHVH 3JV0A 3KDMB 1BD2E 5J1SC 4GAGH 4NC1C 3I6GA 3VFWA 2O93L 2XTJD 3CH1A 4QGTA 4OLWH 1MREL 3TPKA 1R5WA 4DAGH 5C0CA 5IB4B 4U1LA 4MSWA 2NZ9D 4GAYB 3K4AA 3QI9B 4B7IA 4PJ8A 1OAZH 1I8IB 3BESR 4ZYKB 4ORGA 4RMVA 1SYVA 3B9EA 3DVFA 2V9TA 2E6JA 2X1OA 1KGCE 1N5AB 2V5SA 3O6ML 1IC7L 4AT6B 4KAQH 3MLRH 2YD3A 1N6VA 1TTUA 1HH9A 4XNYL 3HG1D 2D2OA 4MGXA 4UI2A 3VFPB 4DN4L 3RPIA 3O4LE 2IGFH 5E8EA 4X6DB 3CFCL 3BE1H 3FN3A 4IMKC 4UUJB 2EH7H 3DO3A 4L8DB 1RI8A 4Z78B 3FTGA 1GOFA 3HPJA 4HS6A 2DYPA 3C5ZD 5DHVA 4DUWA 2BFVL 1N4XL 4QXTB 1JHLL 3S37L 3IDUA 2NY5L 4WO4A 2EO1A 1FRGH 1HKLL 1OP5K 2PKDA 4HWZA 4JZJA 1YC8A 5DD3L 2GJ6B 3OQ3B 2DB8A 2VDLL 5EO0A 5HYSG 1Q9WB 4ZOBA 5E1HB 4AIZB 1J88A 3OKEB 3TYFB 3MGOB 4P46A 4EUPA 4NZJA 4GAGL 1ZVSA 3ZDYF 3MRMA 4U6XB 1INQA 4M1DH 5GGTH 2PETA 4X7DC 4HC1A 1AD9B 4NQCD 2IG2H 2LU3A 4OLWL 1OF2A 4DAGL 2L0DA 1E4WH 3FFDB 1CYGA 3MCLH 2GK0A 1T1ZB 2AV7A 4KROD 1WK0A 3RGVB 1DP0A 4AQOA 1OY3B 1JI2A 2NW3B 5HYSB 1OAZL 3FQTA 4IS6A 3WHE1 4F7MA 4HEME 1WFOA 4XNQA 3TVMC 2NX5A 3OXSB 5IVZB 3WXWL 1LEGB 4PYGA 4KAQL 5JZ7C 3MLRL 1VGKA 3MCKB 2QSQA 1F4AA 1HOCB 5ADOH 3H7BB 2P5ED 1ZWIB 3U0TA 3MOQA 2IGFL 3QO0A 3EYOA 1CD9B 4Z77B 1OP3K 4GH7B 3BE1L 3HI1A 3MOBH 3U1SH 5EFIB 5IUSA 3TCXA 2EH7L 3QXAA 1F3JA 4R90H 5K9JH 1B0RA 4GRMA 4EOWL 1FRGL 4K8RH 1CDIA 2BP3A 3MLWH 1WAAF 3PWNB 4JFQA 5D5MB 4J3UA 2J88L 1UCBH 3C5SA 3TBVB 4OBRA 3EIFA 2FEDC 2VLKD 2FR4A 4Y19A 3BPNC 2R2BB 1I1FA 2HVKA 4M1DL 5GGTL 3BH9B 2HFEB 2IG2L 5D2NA 3QDGE 1E4WL 2XY1A 4UU9B 5SV3A 3MCLL 1JGVH 3HZYA 3NCCB 4PTUA 1OGTA 4R4BA 1SJEB 2APXA 1GC1C 4PJ5E 1X5FA 4JJHA 1K9TA 1BJ1H 4X9FA 2PW2B 3S6CA 5D7JC 4S2SA 2DYPD 4U1NA 4LLVB 3S88H 5JQ6H 4QWWD 1Z3GH 4WHDA 3SQOH 4WO4D 3NTCH 4UTAH 2EZ0C 5DHYB 5ADOL 4P5TB 5CSBA 3BIKB 4P46D 4QRPB 3D3VB 3WFHA 3EFFB 3PWJB 2C3HA 4E5XB 4Y4HB 3HE6A 4PRPB 3ZKNC 3VXME 2IBBA 3MOBL 1OGAB 3O3BA 3U1SL 3TF7C 2IPUG 4PP1D 3UC0H 4PJFB 3C9NB 4R90L 1JYXA 4XXDA 5K9JL 3G6JF 1JWUA 3VWKC 3TO4C 2A83B 3QIUD 5CGYD 2Y36H 2DJUA 5C07E 3L3GB 5D7LE 3MLWL 1R3KB 1L6ZA 4HUUB 4UT9L 2VUYA 5DD0H 1UCBL 3X3FH 3NA4A 1H3WM 3MUHL 3PNWB 3RWFA 5JOFA 2NX5D 4JFFB 1FFNB 5ESVB 2VC2H 3IDMB 3MRBB 3Q5OA 1J5OH 3QHTC 1L7IH 2A74B 1KIRB 1NCTA 1QPPA 1TJGH 3U7AA 3L95A 2QQNH 1H3VA 3C5JA 2ARJA 4X6CE 1D5ZA 3GSXA 5EO1B 4PG2A 1UM5H 4ZO6A 2YHGA 3R06B 4D9LH 5TFSH 5D93C 1T2QH 4C56B 4OD3H 2VIRA 1O7SA 4WI4A 4Y1AD 5T5NG 3S88L 5JQ6L 1Z3GL 3SQOL 4ERSH 4F7PB 1U8QB 2DRUA 3FQNA 3NTCL 2YPLA 4UTAL 2BSTB 3AC0A 4MXWH 1G9NH 3JV4B 3BN3B 4Y19D 3FONB 1NDMB 4I0PA 5GGRA 1DL7H 5E8NA 2ICEB 3ZTNH 2ZOKB 5IR1A 2WP3O 1A6VL 3H6JA 4WFFE 2V9RA 3O8XC 3SGKA 4LARH 1I7UB 2CO6B 4GJTB 2Q8BH 4JZOB 2FRGP 4YZFF 4G8GE 2Y36L 4ETQB 1W0VA 2RFXB 1BJMA 1C8PA 5DO2C 5DD0L 2IBZX 4MD0B 5JHDB 1B90A 3ZE1E 2XN9B 5TDNB 1DJSA 2BSSA 5BS0A 3ARYA 2VC2L 4GAYA 1J5OL 1L7IL 3QI9A 5CEYB 4GW1B 1RZKC 2BHUA 5FK9B 1TJGL 4MS8D 2QQNL 5FHAH 1OT1A 3N06B 3NPZB 4UDUB 4TUKH 1FSKC 1UM5L 2XICA 1N5AA 1ZAGA 2QQQA 3HE6D 1A02N 2AV1B 1I7RA 4P2RB 4D9LL 4NJ9H 5TFSL 4HWNA 3GSRB 1T2QL 3VFUB 1WZMA 3QUYD 1FPTH 1DBKH 4OD3L 3W39B 3EDKA 5E94B 5CCKH 5A43C 1ORSB 1JBJA 2JJWA 3GB7A 3BUYA 5F93C 5A3ID 1QBMH 5GGQH 3SDXA 4ERSL 1ADQH 4G9FE 3B9KC 3WFBH 1EEQA 3MQIA 3VGDA 4HWEH 4A6YB 3N1FC 4XNUH 4UUJA 4MXWL 1G9NL 2AEWA 1TVBA 4G6KH 1Q9LA 4I2XB 3K8MA 2JB5H 2Z8RA 1VPOH 3VMOA 2GUOB 4WEUD 3AM8C 2H41A 3E3QE 1MHEB 2VN7A 1VKXA 3Q6FA 1DL7L 4IRJA 1T1XB 3ZTNL 2GJ6A 1AC6A 2H32B 4DGYH 3VXPB 4GKSA 3VI4F 4UAOB 3MGOA 4PBWD 4ZS6C 3D2UB 1CF8L 4LARL 2Q8BL 4U6XA 3D85D 4ZFOL 3QPXL 1AD9A 3BP4A 2AJUH 4OGAC 5FYJE 5IB2B 4HIEB 3MNVB 4FMKA 1IM3A 2YD1A 2EC9U 5IHZA 2ATKB 3KHQA 5LCVH 1LD9B 3VXNB 5CEXA 4MQTB 5I1DB 2F54D 3NCMA 4JFZH 2NW3A 2YPLD 5HYSA 2I27N 3ES6A 1FCCA 4RZCA 4KKCD 1G0DA 2UZXB 4DUVA 5KSAD 3HZVB 3QJFB 5FHAL 2PUQT 3MV8B 3VRIB 4KI5C 2QKIA 4TUKL 5FYKU 1ADQA 1LEGA 1NCBH 4YNYB 4I0PD 3ARED 3MCKA 4NJ9L 1BOYA 4YFLI 1HOCA 1PG7X 3H7BA 1FPTL 1DBKL 1ZWIA 4W4OC 1VADA 1JHKH 1QBML 2J8HA 2HMIC 5GGQL 1ADQL 4Z8FH 5JNYB 1AI1L 3X14B 3WFBL 5EFIA 4HWEL 2GQHA 2OQJB 3QA3B 4XNUL 3PWLA 4G6KL 4X4ME 4XWOC 2JB5L 3OZ9H 2C1PB 1VPOL 3HUJB 4JVWA 3KJ4B 2VL4A 4IRSA 4TVPD 4Q6IB 1H3GA 1RPQA 3S97C 3PHQB 3R0MA 3QI9D 2MQ3A 3PWNA 2E7CA 4DGYL 1PAMA 1C5DB 3C6LB 1JV5A 3CU1A 4PJIE 3DARA 3NFSH 3VGFA 1U58B 2B0SH 2JTDA 4JM4H 3QZWG 5C8JB 2DTMH 3RAJL 2R2BA 4OF7A 5I74C 4BFEA 2GSGA 5E8DH 2AJUL 3MLPA 5D1XB 2VL5B 1ZE3C 2GT9A 4JY6B 2YK1H 4JQIH 3BQUC 4JFZL 3SGDH 4ELKA 3MTRA 4LF3B 5CKAA 3GSOB 1IAMA 1KB5B 1HILB 4NKOB 3QZWB 1XF1A 4FXGA 2UYLB 1CVRA 1OT2A 4WW1A 5BZDA 5SX5K 3DI2B 1NCBL 3QFJE 5DA4A 3U9UA 4WVRA 3OAYK 5INDB 4CMMB 2GJ6D 2DQFA 4W4NA 4P5TA 4BFIB 1FYTB 3NACH 1V7NH 5ADPH 3H42H 5IMKA 4ZUUB 3GIVB 2JKXA 1AY1H 3CLFH 1JHKL 1JZ5A 5IW1B 1LP9E 3MJ8B 3PWJA 4E5XA 4MB3A 3UJJH 4F9LC 4Z8FL 3GJFH 2IMMA 4PJBB 3KYMB 3CFBA 2LE9A 4XHJD 2X1PA 1KC5H 1OVZA 1FE8H 1JP5A 5A40E 5DLMH 1KT2B 1QD0A 3OZ9L 4KRPC 4PJXE 4NYLA 3RGVD 2A83A 1A0QH 1RSFA 3SE4A 4LRIC 3AXLA 4HUUA 2EIBA 3NFSL 3PNWA 5EUKA 2EE2A 2B0SL 3QG6A 5HXMA 4JFFA 1FFNA 3QJHB 4JM4L 4P2OB 2DTML 1IAOB 4FFVC 4APQB 2NY3B 3K3QA 1KIRA 5E8DL 1RD6A 4HSQA 3SBWA 1EZVY 2EYRB 4U7MA 2N4IA 4X8JA 5GZND 2Y4SA 1XH3A 2YK1L 2ZSWA 3ECBB 3FOMA 3SCMA 5C3TA 4U6VH 2MWCA 1XF4B 5FO7A 3MRIA 1D6EB 1R3HB 5F1IB 4WI8A 4GRWE 3AAZB 4BH7A 4OLVH 3SJVA 3ABZA 3PP3K 2YA2A 4K7PH 2DI8A 3RWJB 2EDWA 5C0BE 3T04D 4WNQB 4QRRA 3RX8A 3QDJE 4TRPH 2C4XA 3W82A 1V7NL 4LPVA 3H42L 5FDYA 4YHPB 5ADPL 5IK3A 3CLFL 1AY1L 4LQ1A 4RGNC 3FONA 4HCRA 5F1NA 3FB6A 3UJJL 5FV2A 2X4NA 3EYSH 2HKFH 4M1CD 5EN2A 1KC5L 1I8KA 3I02B 4Q58C 2RAMA 1FE8L 2XQYG 1G7JB 5IBTL 5DLML 4HLZG 4Y2DA 1I7UA 5MP6H 4JFPA 2JLLA 3MRFA 2FH6A 5I17B 2O5YH 2GITB 2NY0B 4HXAH 5JHDA 4MD0A 5D1QB 2F58H 2XN9A 3DUUB 4PJ9A 1QFPA 5TDNA 2LFGA 2VR5A 4JFOA 1CG9B 4WDIA 4HMCA 2DKMA 5DYOA 2XPGA 4H88H 1JCKA 3L5JA 1S9YA 2YRPA 2W38A 2AJZA 4PJAE 2X05A 4QRPD 3VWJB 2DTSA 4ODXA 3V5KB 1ZA6A 3D3VD 1YPZA 4DOHE 2DL9A 4UDUA 4ODBD 1G9EA 4XPBH 1EBAA 3HR6A 2JJUA 4Y4HD 1U8PA 4PRPD 4OAWB 5C0IA 4RISH 1OGAD 1XZ0A 2V7HA 3GSRA 3IS1X 5FM4A 4PJ8C 4U6VL 5F89B 3K7UA 5E94A 1ORSA 5ETUA 1XCQB 5BXFB 5ICZB 5C0NC 3HI6H 2F8OA 1T6VN 2ADGB 4OLVL 1RK0B 5KSVA 4A6YA 2EDLA 2D3VA 2A0LC 1XMWA 1BX2B 3I3EA 5DTFB 4TRPL 4KMQA 1QZ1A 4JFFD 2GUOA 4PY7A 2NY5C 2DQUH 3D87B 2P1YA 4K7FB 3EYSL 4OKVB 2AERT 2HKFL 5IQ9B 1R3JA 4N5ED 2A9NH 3TBSB 2GEEA 3WKMH 1NCWH 2A9MH 1SBSH 5MP6L 4O58H 5IW6B 4UDTA 1AIFB 1ACYH 4OUOA 2O5YL 3RJDA 1P1ZA 4HXAL 4JZJC 3WNLA 2EDEA 5IB2A 4HIEA 4C56D 4XVUD 2XA8H 3GRWA 5IWLA 2F58L 4N0YH 1TETH 5HGDA 4OZHE 1WBYB 1JIBA 3DJ9A 3EO0A 4M5YH 3T0EB 2MNUA 4H88L 3LS4H 3O3DB 2YC1B 4R2GC 1G0XA 4WI7A 1Q9OB 5JW4R 4ODSL 3WCYA 3RNKB 3IKKA 1B4JH 4XPBL 5DEFA 5DD6A 4ALAL 1X4XA 4YNYA 3UTQB 4NQXB 1FC1A 4RISL 3VFRA 3PWPA 3FO0H 2ZCLH 4P4KA 2GCYB 1NCCH 3T2NH 2OYPA 4QRSA 1P4BH 3HI6L 5FECB 5JNYA 3A6BH 1IGML 2APTA 2YKLH 4JHAH 5EZJA 4Z7QF 3QA3A 2JIXB 3QT2A 4GKZA 2I9LB 1KACB 4PJ7B 4OUUB 5JHDD 2XN9D 3T4YA 5JIHA 3P9WB 2C1PA 3HUJA 4ONFH 1PQZB 1YEDA 5C3LD 3SPVB 2DQUL 4LVOC 3BZFB 5E08H 2YPVL 5LGJB 4S1QH 2A9NL 4KK5C 3D18A 3L3KB 3WKML 1A9EB 1NCWL 3VXSB 2A9ML 4WENB 5C8JA 5MEPB 1SBSL 4O58L 3T1FB 5E4IA 3SO3C 3WN5B 1ACYL 1RURH 4P2RD 5J11B 4OF0A 3BEVB 3GSNB 4PD4K 4TYUA 1HHIB 4J6RH 4N0UE 2XA8L 3NIDE 4X9HA 4N0YL 1TETL 3P4OB 2LVEA 2WAHA 3TM6A 3L5XH 4JY6A 1NUDA 4K9EH 1XGQB 5HD8C 2KL6A 2R69H 3GM0A 3LS4L 1PVHA 3E3QC 2VXSH 4NKOA 1P4LB 2EYTB 2JE8A 1G7QB 1Y18B 2VXVH 5L6YH 5D2NC 3QZWA 4Y5YA 4V2CB 1FG2A 1HHJB 2ZOLB 1B4JL 3MRNA 4X4ZA 4NIKB 4ONGH 1TCRA 2BMKB 5C08A 4KKAC 3DX8B 1EEZA 2B2XH 3WHXA 4OFKA 4CMMA 3FRPA 2VITB 1FYTA 1LDPH 4IDLA 3D2UD 4ZUUA 4NM4H 1NCCL 3BO8A 3NCYS 4M43H 5D7SH 3T2NL 5IW1A 1P4BL 2P5WB 5EU7E 4C83B 5FGBA 2WBJB 2YKLL 4JHAL 4AM0B 2XACC 5HVFB 3UMTA 3O2DL 2EDRA 4NCC1 5IFAL 1JUFA 4PLJC 4I5BB 3OKMA 3N1MC 4ONFL 2MQ0A 3V95A 4K8RC 2AQ1A 3OKOA 3MACH 5I9QC 3KLDA 4NQDA 4L4VB 5J7CC 1CFBA 5E08L 1A7OH 4S1QL 5KN5B 3QUXA 3SE3A 3MV8D 1WBXA 1IAOA 1U8HB 1BFOA 2B20A 4TSBH 4MA3B 1RURL 3LN5B 2L4OA 3KAAA 2DBLH 3AFLA 4LLWB 1SJXA 5SWSA 1A4JB 4J6RL 5BJTA 5GPRA 2Q8AH 4YHOH 2GYSA 2E7HA 5CWSA 1IC1A 1PG7W 1MLBB 1RHFA 3ECBA 4YDIH 1L9NA 3BXNA 4ZS7H 2UZIH 1NGZA 1SEBB 3MV7E 2R69L 1FG9C 2GJZB 1XF4A 5I19H 1U3ZA 1R3HA 1FAIH 1L0QA 1MFCH 1A1NB 4XGZA 1TIUA 2VXVL 2I26N 4M4RA 5F1IA 5L6YL 2P8MA 4GFTB 5HTSA 4PG2C 2B2XL 2CKBB 4K94C 4EZMA 4H5SB 5EC1B 2QJDA 4OI9A 3C6LD 1LDPL 3NAAH 2ZUQC 4NM4L 3WO4C 4M43L 5D7SL 3WL9B 2EIZB 5EC2B 2VSCA 3ROOB 5EBLA 4HHAA 1IM9A 3QNZA 3E2HB 2OS7A 1CICB 5MENE 3O3AB 3S36H 4MDIB 1FL5B 2B5IC 5D1XD 3LB6D 1U93A 1KCRH 2B1AH 1EBPA 3FQUB 3GBLA 4LCUB 4Q0XH 3LQAC 3TT3H 2P8PA 2DQDH 4ZUSA 1GGIH 3MACL 1MELA 3QYCA 5DUBB 2YUZA 3MPCA 4LCCB 1A7OL 2PYFB 1D5BA 2VZ1A 4YFLF 1CG9A 3SGKC 3ZDXF 4TSBL 4PG9B 4RDQF 4UT6H 1QEWB 3F62A 5L8JB 3LS5H 2NLJA 3ZHDA 2DBLL 4BZ2H 4NCC2 1FYTD 2Q8AL 3BGAA 4YHOL 3V5KA 1DDHA 4QOKE 1IQDB 2YPKB 4WFHE 1FC2D 4YDIL 4ZS7L 4E41B 4OAWA 2UZIL 2B4CH 1QNZH 1HI6A 3WNPA 3RVXD 2JCCE 1EVUA 4DW2H 2K7QA 5I19L 5E6YA 1FAIL 1MFCL 5BXFA 2AK4E 2CIIA 1B0WA 4NBZB 4ODWA 5J6GB 4GAJL 1JZ3A 5I1KH 2ADGA 2HJLA 1RK0A 1JZ8A 3VRJB 3MROB 4NKIL 1BX2A 1VDGA 5DTFA 3NAAL 5DRWB 3P4MB 1UKQA 3H9SA 1KPRA 12E8H 4P2OD 3D1MC 2IFGA 1GPOH 4J12A 3H9YA 4UIKH 4JKMA 1EFXB 4KY1H 4APQD 5C9JA 4UT7H 2NY3D 3SY0B