1IBFA

X-ray 3d structure of p.leiognathi cu,zn sod mutant v29g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNKYGVGFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CU,ZN SUPEROXIDE DISMUTASE
publication title Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Photobacterium leiognathi
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ibfA00
2SODB 3HFFA 2ZKWA 2AF2A 2JLPA 2LU5A 3ECWA 2Z7ZA 1UXMA 2WWNA 2AQNA 4BD4A 3L9YA 1BA9A 4A7GA 4A7GF 5KBMA 1F18A 1ESOA 1E9PA 1FUNA 1E9OA 3KH3A 2VR7A 1OAJA 1PU0A 1SXAA 3QQDA 1N19A 1XTLA 1OZUA 1IBBA 1SXNA 3PU7A 1HL4A 1YAZA 1IBDA 1PTZA 1SXCA 2C9SA 3KBFA 2ZOWA 1IBHA 1CBJA 2AQRA 4N3UA 2R27A 1F1GA 3KH4A 1BZOA 1EQWA 2C9VA 3H2QA 4A7QA 4B3EA 1HL5A 3K91A 2K4WA 1CB4A 3GZOA 1OEZW 1F1AA 1Z9PA 2WZ0A 2E47A 4A7SA 1DSWA 1L3NA 3KBEA 3GZPA 4BCZA 1B4TA 1E9PB 1OZTG 3QQDB 1E9OB 1KMGA 1TO4A 3MKGA 2AEOA 2AQSA 2NNXA 2WYZA 1XTMA 5CU9A 2C9UA 2VR6A 1E9QA 2WKOA 2WKOF 1E9QB 3F7KA 4A7TA 2APSA 4MCNA 2GBVA 1RK7A 2GBTA 4OJAA 4U4IA 1QUPA 1DO5A 2XJLA 3ECUA 2ZKYA 1UXLA 1N18A 1EJ8A 1OALA 4BCYA 1XSOA 1B4LA 1U3NA 1Q0EA 2AQTA 2GBUA 2JCWA 3CE1A 5KBLA 1Z9NA 2ZKXA 3KM2A 4L05A 2WZ5A 2E46A 3HW7A 4MCMA 4A7UA 3L9EA 1SRDA 3CQQA 1JK9A 2WWOA 2WZ6A 1JCVA 3KM1A 3GQFA 3ECVA 2XJKA 3F7LA 5KBKA 2Z7UA 4OH2A 1YAIA 1SOSA 3T5WA 1SXSA 3S0PA 3MNDA 3HOGA 1SDAB 1IB5A 1PZSA 1TO5A 3SODB 2Q2LA 1SPDA 3LTVA 1SXBA 1SDYA 2Z7YA 3GZQA 1YSOA 2AQQA 1IBFA 1SXZA 2V0AA 2VR8A 3H2PA 3CQPA 4N3TA 1F1DA 1P1VA 1JK9B 3RE0A 1MFMA 2Z7WA 4FF9A 3GTVA 1S4IA 1COBA 3GTTA 4A7VA 1AZVA 2WYTA 2AQPA
chains in the Genus database with same CATH superfamily
4H0GA 1I8KB 3HFFA 3IS1X 5FFGA 4ODXB 4U6HA 5FGBC 4X6DA 4XMPL 3C8KB 2VZUA 4TKWA 4JO2L 1XF4B 4X5WA 5LBSA 2EDBA 2OMBA 2OP4L 2EH7L 5D7HA 4BHUA 2LFEA 3A4AA 2LLNA 1RK0B 3HLKA 4WFGE 2FRGP 4GO6B 3VFMB 3BVNA 2HWZL 4UM8A 1HEHC 3AY4A 3NFPB 4P2RE 4WO4D 3SJVE 4YHML 1R17A 4LSUH 1Z5HA 3PIQB 4HLZH 1MH5A 3AS0A 3RWDB 3W9DA 4ZX4A 4XNXH 1LYQA 4K2UH 4LO9A 5HHVH 3ZMNA 4FNTA 2WYHA 1D2PA 2YBGA 3JWNE 3UL4A 3S3CB 2DF3A 4HXBL 4PRDA 5C0FB 1WT5C 2JNZA 1A6ZB 4JANB 2FEJA 3Q2LA 2VDOB 4ACPA 1QI5A 3NEEA 3P11H 1NIDA 2PUQT 3ULSA 3ARSA 1WHOA 4JFXB 1ED3A 1KN4H 5F1KC 3GPSA 4FG6C 2JFCA 3CHPA 3HKZA 5B1KA 5F3HA 1BJ8A 5IOPA 1EEQA 2FO4B 4HT1H 1DVFA 1F42A 3LCYA 3SQOH 3U7WL 3L4WA 3FB8A 4Z7NB 4W9KC 4ZUWB 1J8HD 3Q6FB 1EXUB 3IMVA 1OWRM 4NQDB 4YSSA 1T7XA 1G5AA 2CIKB 3IGUA 1SMDA 4WW1A 2DIJA 4X6CE 5TGBB 4E9XA 1EBPA 1ACZA 1U3ZA 2Q6WB 2AAVA 3BKCL 1P4BH 3BI9X 5E2TH 4DT2A 3WAKA 2H6UA 1S3KH 3BESR 4LEEA 3F7RA 3EG9B 2DYSB 3QYCA 3QJHB 2QSVA 2F1BA 5DFTA 4NNPH 2O6PA 1JN6A 2CDGB 1FORL 4ZFOB 5EOQH 5MEND 2DZEA 4OF3A 1QZ1A 4KVCL 4KXDA 2YMOA 3SCMC 4YDJB 3BX7C 4XC1L 3V4LA 1G9NC 2B0SH 3P3UA 4RMTA 5EF3A 3RTLA 1S6NA 1T1WB 2QQQA 3IMSA 2YD5A 1FVEA 3C5ZB 3ZYJA 5DJ8A 1FAIH 4BFRA 5LUMA 1X6LA 4QF1B 4DETA 2RBLA 3TO2B 5GJSL 5KVDH 2VLJE 2BVPB 1YVLA 4JB9H 2Z7WA 3DHJA 1H19A 3PQYA 4KRPC 5CBEB 1Z9LA 3R06A 4GQQA 5CILL 2WGXA 4TUKL 2JLPA 1S8DA 4PR5B 3UTTA 4F37F 4QWWC 2WQSA 1XF2B 2EEFA 3NK4A 3L9YA 2WQWA 2F54D 4GOSA 1UH2A 4CBZA 2A0LC 3MBED 3H56A 3CUPB 3DLQR 1JL8A 4P23A 2NY6D 5LGHH 4Y1TA 3IEAA 2EDEA 1Q94A 1NPUA 1VLXA 4Y4FD 3WEBA 1M7DB 1MFEL 5G4OA 4B9ZA 4P4RA 3BSZH 4BRVA 5CLZA 3ARBA 5GGTL 5AD0A 3DXAE 3Q8FA 4JPWL 1P7QD 3L3HB 5IJKC 1MCPL 4N3UA 1A6UH 2HKFH 1INDL 4J3BA 3SDAA 4TNWF 3WXVL 3FMGL 3KWWA 3OBAA 4J3WA 3BDBA 4S0TD 4X98B 4QHLA 1SJEA 4MQ7A 1EEUA 5J8OA 2YD6A 4UQAA 4DCQB 5T1KD 1R5VB 1QFPA 4EN3A 1XF3A 3AJ7A 2WGNB 3MFGB 3VVWA 1GZQB 3U0WL 1MXGA 2WVSA 3V7MA 2G0KA 3H4HA 5LWYH 3K2UL 4I3GA 4TYUA 4GNKB 2YXWA 4W9DC 5CIPA 3TN0C 1W8EA 1IX2A 1GYCA 1MEXH 4JFOA 3J07A 3MBWA 3H55A 2GBUA 1A14L 1ILSA 4LXFA 2QKSA 2AEPL 3Q3GA 3RRQA 3HC2A 3KPQB 1KTRL 3GLAA 4NAQA 1RHFA 1H6UA 4ZYKA 4WI8A 3SO3B 5LCVH 1E4XL 5FKAA 3AS3A 3QH3A 3HVNA 4LSQL 4KJQC 4MMXA 4PS3A 3TIDB 1K9TA 3J27A 5HTSA 1T2QL 3DOHA 4JBSA 5L2JA 3MJ9A 5GS0D 3TNNA 5BV7B 5EPMA 4WFED 15C8H 1I7ZB 3ZTNL 2QELA 4MX7B 5EEZA 4DO4A 1IC4L 4N0UE 1U4EA 1N64H 2J4WL 3QEGH 2HKAA 3BVDB 4E42B 1BW8A 1EEYA 1MHPL 3DV6A 4RZCA 3FQTA 4XP6H 1AGBB 1E30A 3LJ3A 3V5DB 2QEJA 2DWEB 4L9DA 3SE8H 1G9NH 3L6FA 4XODA 5D1XE 1UJ3C 2I07B 2HJKB 1T1ZA 3P4MA 4ZUUB 3W57A 5AAMC 4N20A 4FFZL 2DYPB 3A3YB 4OGAC 4ENED 2J3SA 4O9HH 2VDLH 4K71B 1BA9A 4X6FB 1BAGA 5KBPA 3L5IA 1MJ8L 2YEZA 3T4AC 5H4ZA 4QRSB 3O2VH 4XAWL 4KHXL 1PAMA 2ED8A 5I6PA 2ODHA 1WIPA 5DMGC 4PPTA 4HUWB 4ZT1A 2A9BA 1KELL 4X99A 2EP6A 3L13A 3QUXC 4OLWL 1LE9A 4WEBL 4DP8X 1JF6A 5E9DD 1I9IH 4P4KC 1I3GH 2I9TB 4A2HA 3QWRD 4MDIA 4NZRH 3WY1A 1G87A 2RH0A 2ZXWB 4JFDD 1HEJC 2V37A 3C9NB 3K4AA 4JEGB 5J6GA 3F5WA 4HGKC 5DK2A 1P6WA 1PD0A 5CLTA 1V7MH 3GSUA 1MAKA 3O6ML 1A4KA 1H15A 1X4YA 4I7ZC 4AQOA 3IFPA 1MCBA 5BJTA 5KZCB 4QRTB 2BNQB 3DDFA 1LWHA 5EN3A 4E2OA 1ZE3H 3UGEA 3MCLH 4OM1H 4F7MB 3FH7A 5D7IA 3X13A 3LEXB 3CSYB 1RZIB 4R96A 3MOAL 4O2FB 4CW1B 1UXLA 1T1YA 2VXUH 4HIXH 3UERA 1UM5L 4M7LL 3L4VA 3V0FA 3WN5A 3QEQE 5EBLB 4I2XB 1T66D 2CXGA 1IQWH 1EHKB 3HS8A 5C0BA 5BW7A 2AJZA 4L9LB 3VA6A 1HTYA 1FO0L 5J12B 3ZLQC 1BX2A 1YJDC 4GG6A 5I0ZA 5I1EL 1JCVA 4NWUL 1CYGA 4YVNA 3GBMH 4G8GB 1V3JA 4OCMC 2Z0UA 5D2NA 2PYEE 3V0VB 4LSTH 4FE9A 4LPYA 4Q9QL 3I3EA 3ML9A 1QUNA 4PJ5B 2TSAA 3Q5TA 3E2HB 2HPOA 1MFAH 4Z0XA 4OQTA 4HS6B 1F4XL 1MLCA 4PIBA 4OV5B 4W9EC 1NA8A 1OHQA 1XH1A 2OSXA 4ONGL 2ZSWA 4Z76B 3VI4A 2JB6B 5DZJA 4PFEA 4L8CB 1QBLH 3HBPA 4JRYE 4UQ2A 1WFMA 1AKPA 4XCCL 1CG9B 5F6IC 5TPWH 3O0RH 1T89A 1YEFL 4I87A 4BE5A 1Z2KA 1NDGA 3FN0H 1U8KB 4PJEE 5JHBA 2ZP0T 4Q9RL 5KW9H 2AVGA 1YA5A 2XXCB 3AZUA 4JR9H 4MD5B 5KG9A 5CP7A 3O6FB 2D3JA 5IG7B 1XGQB 4IRJD 2Y7MA 3QDGB 3BSGA 4B3VA 3HN8A 1ZT7B 3MV8B 1MCIA 1T4WA 2ITEA 3NJLA 3ISRA 3LN4B 3PGFH 4KY2A 5IMKA 2I26N 1QP1A 2R23A 4HEPG 3NESA 3S7GA 5C0CA 1G9ML 1FHGA 1KIRA 1OIOA 4E5XA 3BD3A 1ZLUK 1CXEA 1RIUL 1OTTD 4QHKI 5CJ5A 3RDTC 2QDWA 3HMXA 1CD8A 4XMKH 5LG1A 3V0DA 3FTGA 2A4CA 3FAWA 1YPZE 1NEZG 4GT0A 5EHFA 1GJUA 3EYSH 1KB5A 5I1GH 1QATA 5DD3H 5C8JB 1SLUA 2Z92B 4MNGB 1IAKA 2O5NA 1HQRA 3H9HA 5IWLA 5T3XD 1JXGA 1KB9K 1KBPA 1K8IB 2BXYA 3QI9A 4MXWH 3UTQB 5MI0C 3D06A 3IDIB 1TO4A 2FWUA 3N1GC 4POUB 4XOEA 3V0GA 2X0VA 4IKIA 5A1AA 3CFIC 3I84A 3QO0A 1HDMB 3IJ9A 1W16A 1H5BC 3HAEH 1HCFX 4LCWB 3WFBL 1TMQA 3BN3B 4PJHE 4OVUA 1X7QB 4BZ1L 4HV8A 2R2EA 4DKFH 4PHZA 1G7JA 3UBGA 3FQYA 5DQJB 4DP7X 2BERA 4KZCA 3LQZA 5FUOH 4NT6B 2OYKA 5I1HL 4OLXL 3WE6A 3QORB 4YR6B 4N2BA 2AJVL 2ORBL 4ZAKB 3KM1A 3CZEA 2WXMA 3VD0A 4AW4A 4LKCA 3Q13A 4P3DB 3SZ6A 3PXHA 4E9YA 5JOPD 2XXMB 2GC4C 4IGBA 2Y06H 3SBWC 4YHZH 5GS1C 3ZQ9A 1IL1B 1TQBB 1BD2B 2NLJB 4B60A 4HQQH 5CWSA 3WE1A 1YJDH 1EVUA 5JOFA 1QLRA 1T21A 3SDXB 2WK2A 1D7CA 4LLYA 3ZTJH 3KEHA 2Y3AA 3CZGA 3E3QC 4ZFZA 1UGNA 4AENA 3ARPA 5JA8B 3DVIA 2H1XA 2QR0A 4J3SA 2OMVA 3QE5A 4U1IB 2DQFB 4UNTA 5CJQH 2W59A 2GSMB 3S96A 4JZJC 3STZB 1M7XA 2B15A 2Z31B 4HWUA 3TBTA 1KGUA 2K3TA 3JV6B 5F7FA 5KSBA 2RQ8A 4Z77A 1UZ6F 1TZIA 4JPIB 1P5UB 5DUPH 5IBUG 3SPHA 4DQOH 1CUOA 4KKBC 3ESVF 3P0VL 5HHMB 1C08B 3DJ9A 3CN2A 1NCDH 4M1GH 3IB4A 1SBBA 4H8PA 2C1OB 4XCFH 5EZOL 1WITA 2P47B 4X9HA 4E5XG 4W9HC 1VA9A 4AYGA 3HG1A 4ZDHB 5DHVH 3LNFA 1F6AB 1SJMA 3CN3A 3ARVA 5MHSD 1TEYA 1IAIM 4DTGH 2YOAA 2X05A 2VDNL 3BDXA 1AVAA 1OARH 3ECQA 4A7QA 3D25B 4I4WA 4PSPA 2Q7YA 3NCWA 3B2UD 3FT2B 4FQ1H 3OKKB 3FU0A 5F2FA 3KPOB 3FQWB 2F8IA 2CGZA 3BP6B 3NMEA 2I5YH 4LHQB 3H85A 5DVMA 2F08A 3T0AA 1R3JB 3D39A 2XA8H 4FTVE 1VERA 4YDIH 5ICUA 5CCGE 4HGMA 2FBJH 1A4BA 1W72H 3TZVC 1LO0L 3LS5L 4JO1H 2J1YA 4PJ9A 3LZQA 4OLVL 3O45A 4H20H 3O4LB 3PDGA 3X14A 2XTLA 5C3LD 3IRZA 1J0HA 2IH8A 2IQAA 3X1FA 1U8QB 1V3MA 1IGFL 1Q9KB 1EA9C 3E9UA 5D7IF 2HP4A 5C09B 4PUBL 4PSRA 1T0NA 3LKPA 2KI6A 4MMYA 3VTAA 4I0PA 4GXUM 2JKSA 1KEML 5F9WB 4L8SA 1J9QA 3ZYZA 4FTDA 4GFXA 2H9GB 1EMTH 3S9DB 5L2KA 2HAZA 4UQ3A 1IKNA 3FQNA 4FQXA 1KJVB 3WNIA 1PY0A 1S5IL 5FIEA 1CGWA 4G7YH 4O5LL 3WKYA 4PBWD 1LILA 2HTKD 2GY5A 4Z5RA 3DOIA 5FOJA 1I53A 1WD8A 4HAKA 4DOHB 4C58B 1S9KC 1IBGH 4G8IB 4L4VE 5GS0L 4EIZC 1ES0B 4Q9CA 4ZPVB 3AB0B 1IRAY 4HJ0C 2R0WH 3UBHA 4HIJA 3DBXA 3QUKB 4GSRA 5EU7C 3ZE1F 4GEJA 2HH0L 4PRIA 5GZOA 2N1TE 2EUWA 2WJ5A 3E0GA 4KTEH 1A3LL 4N85A 4FKHA 5DURB 3RP1A 3UJTH 3VI4F 4B9PA 3T2QA 1IE4A 1ULVA 2ZG2A 2FUQA 4LSUL 5EIIG 2VH5H 3CQPA 3QUZD 3GXTA 3CXHJ 3DVNB 1Y07A 4XOCA 5ANMA 4GYBA 4K2UL 1EFXD 5HHVL 3PL6D 3QJQB 4PGBA 2CIIB 2OTPA 5FECA 4G1EA 4WI2A 4FULA 3V0JA 4YBQC 1BVKA 3UBXG 3MLTA 4LOUC 5FV2A 3WFHA 5IMLA 1QTPA 1C5BH 2VTFA 1HS6A 4YSDA 4NJAL 4XR8C 4PLNC 3TS8A 4AJWA 4NXSA 1DE4A 5FGBA 2P5EA 3IRCA 1BM3H 1D3CA 4YFDB 1KN4L 4F9PC 4QYOA 5CD5D 1FFNA 2QADB 3SQOL 1JGVL 4PVBA 2OA9A 2A38A 2ZTBA 2YZ1A 4DZBA 1SXCA 3FT4A 2PCXA 5C3TA 1I85C 5ID0B 1R3IL 4LPVA 1HC1A 3M17A 3DSNA 4NENB 1F4WH 2BS9A 2A9CA 5AOMA 3JT2A 5D7LD 3TFBA 1MIMH 3T09A 1RIVL 1VPOH 2XN2A 4NLHA 3KH4A 4R2GD 2C9VA 1EUTA 5KUMA 4JFFB 1VZIA 5CEYA 1HOCB 2F2HA 5MEQA 2VABB 5E2TL 1GYWA 2F7RA 4QRRB 3L1OL 2FO8A 3GSXB 2UUDK 2HVKB 4P5MB 1S3KL 2DEYX 4O02A 4EKXA 1S7RB 2BNUB 1I3RB 2CH8A 2Q3XA 3MKGA 1YYMH 2MIZA 2AEOA 2F5BH 3RGVA 2QPFA 2IOIA 1OWWA 2DYRB 1O9WA 2GJJA 4MCZB 4F27A 2B0SL 2W9EH 3NIGF 3PWNB 4N0CD 4MJ4A 1NGWB 1FAIL 4GRLC 1SOKA 3G3LA 3HG4A 4AQAB 2QLVB 1XMEB 4FQJL 3ILQC 4KXZH 5LCVA 4JB9L 4Y4KB 4GKOA 2DQHH 4PD4J 2X4OA 3VSUA 4NQEA 5DC4B 3BXNB 3QA3B 5HVHB 4W9FC 2R1YA 4BQ8A 4NN6B 5D1ZD 2VDPL 4ISVB 4NP9A 2CHXA 2XLLA 5DFAA 3VXOB 2D2OA 3L3GA 4H44C 1H3VA 1SM3H 1NSNH 4OZ4B 1GTFA 4OJFH 32C2A 1J0JA 3GIVA 3VGEA 3B9DA 2WOYA 3GSVB 4LHUB 5D7SH 4MVBC 1NCUA 5LNDA 4WUUA 2WXJA 3L95A 3BSZL 3SCMA 3U0TA 1IBFA 2Y9RT 3LRSA 3EJYC 4U1GB 4WTZA 1A6UL 1FZJB 4J4PD 2HKFL 4QJ3B 3MRGA 2OCFD 1FPTH 1C7TA 1JNJA 2IDTA 4KZEH 2NY4D 3T0ED 2XPGA 1CDBA 3PYCA 5I74B 4B5EA 1NCHA 5KSBF 4BWTA 1R24A 4JM0A 3VXME 5IB3A 4OTXH 2ATPA 3TBWB 1TKWA 3QXTA 2BMKB 3FUIA 1P9MC 2KS0A 4KI1A 3GXFA 1FNEA 1OAJA 5CR1A 4PV9B 4QY8B 2BOCA 3MYZA 3GRBA 1IGML 4HMDA 3O2DH 1ZPUA 4NN7B 2V7NA 5AW8B 1BAFH 1MEXL 1YHPA 4E0RA 5CKAA 1O7DE 1DCEA 1P1ZB 5T3XL 2DEXX 4G6AD 1XGUA 5DJ6A 3DPBB 4LLWA 1XR9A 3JVFC 4WVRA 1DQDH 1ILUA 4KTYA 5G55A 3JYCA 4UT7H 1DN2A 1E4XI 1B2WH 2K6WA 4LU5H 1S9VB 1WUNT 4KMTH 5GS2D 3VM5A 5BS0D 3O81A 1UATA 4TPRH 4XNQB 1JZJA 4MWFA 2C3WA 1QWUA 2YD4A 3KXFD 1I8IA 2NMSA 1SYVA 3UG4A 1GIGH 3LIZH 1JV5B 1P7KA 3WY2A 5FO7B 4XPFH 3L5WB 3K5RA 15C8L 4OCYH 3STLA 3EHBC 5SWSB 5IHWA 2VZTA 3QEGL 4GAGH 4Y2DB 4M3KB 3ARTA 4I0CC 2A73A 3A67H 2AVFA 1OB1B 3MRRA 2BS8A 3KL0A 4OUUB 4L05A 5ESVB 5E51A 3ABKB 2QVFB 1QR1B 2YXFA 3SE8L 3QJVB 2VSMB 4XMUA 4GKSB 3T65B 3DTXB 1OP9A 3RVVD 1ND0B 3CDCA 5E1AA 5DA0B 1QFWL 2HN7B 2VDLL 5JHDA 5HDLA 2OMUA 1RSFA 1DVQA 3O6KL 3RB5A 2UXVA 4YIQB 5EZPA 1TO5A 4RSVA 1A4JB 3AC0A 5K9KA 3G5YA 1DVSA 4OIIH 1FIGL 1MQKH 3CC5A 4RA3A 2HVJA 3AT0A 4WJG3 2GJPA 2FJUB 5B39B 2G5BB 1YY8A 1N70A 3BFWA 3TH2T 3S8GB 4NC2B 5GZNC 3VQ1C 5KSAA 3N1FC 4YH6A 1I3GL 1J1PH 2PW1A 1PQZA 3ZHDA 5EU4B 1BM7A 3UJIH 4N0FB 1MVFA 1XH3B 3WEXB 2GIXA 1JCKA 3EDEA 3GD1C 2ZKWA 3O4OC 3EOTH 4HKJA 5GGRB 3SBPA 5J56B 2FX7H 2H3KA 1UJ3A 2CMRH 4KOCA 1DLHB 3WKML 1IEBB 2DAVA 1BQSA 3NZUA 5AAMA 4LEXH 3L2NA 4JVPA 5BUPA 3DGDA 4RMWA 4Z95H 3RWFA 2VERA 3EJQA 4QXUH 4D0DB 5KVFH 1JGUH 3MCLL 5A7EA 3QFDA 5AW9B 4P2QB 2OSWA 3T4AA 2OTWB 5I73C 5TK4A 3T0BA 3C6LC 4OLEA 4TTDD 3TVMD 1MRFL 2VXUL 3QW9A 4HIXL 2ZWZA 2ZAIA 3FFCE 1L9QA 3KVDD 1DZ0A 2YR3A 1ZWIB 2YS4A 3RWCB 3VXRD 2I7SA 1DUZB 1HOEA 3PQYE 5E6YA 1IQWL 4AJVA 4M61B 3H4FA 2DQCL 2HRPH 3QDJA 4P4KA 1R46A 2HT4C 2OMZA 4GAAA 1DBKH 1A1OA 3MLUH 4WI9A 5EDSA 4EQ3A 3L2MA 4U7MA 4E9VA 1XDTT 4K8RD 3AXIA 2IWFA 5BQDA 1PW3A 4LSTL 5T1LB 2WMPA 4NLAA 4WHDA 1XZ0B 2CKBL 2ADIB 3AM8C 2ZD0A 1MFAL 3S3SA 3M46A 2WINA 3U30C 3F7KA 1Q72H 3O11A 4O00A 5IBTH 5HJBA 4D8PB 2Y72A 2O5ZH 2FEDD 4R0LC 1QBLL 2LR4A 1CGYA 5TPWL 2R1WA 1OQOA 3O0RL 1I1YA 3L4CA 4UMSA 5F72S 3SKNA 4CN4A 1O5DT 5HGHB 1H6FA 1NGPH 1EGJL 1DJXA 3FN0L 4GBXD 2NT0A 3LXAA 4ZMQA 5KW9L 2W07B 4LIQE 5IB2A 2AXJA 4KO9A 1E50A 1O6SA 5AW3B 5H94A 2MCMA 2OR7A 4OFYD 5J89A 3PWVB 1YEJH 3K5SA 4OB5H 3FT3A 4HWBH 4EOWL 4PCTA 4IJ3C 4FC3E 1TCRA 2IAMD 4G6KL 3HMWH 2GAZB 3DUSA 4HPHA 2GC7C 3VDCA 2K1MA 1FNHA 1FRGL 5EF1A 1DSYA 4HFWB 3NVQA 4JW3A 1IC0A 1XVSA 2C7FA 1I1AC 1S7WA 2A6KB 2Z4TA 3AUWB 4OD2B 1IGIH 3T6VA 2YLKA 3AROA 3IDGB 1TPXB 1ZXQA 4XMKL 1BVLA 1QLEB 2H4EA 2X4UA 1F1DA 3AS2A 4ZMZA 3I3BA 3EYSL 2EEDA 1BZ8A 4TN9A 4WWKD 1CICB 2O72A 2YC1B 2PCFA 4MHHI 5DD3L 2G5UA 4H0IA 5FR3A 4HJEA 1XGTB 2R39A 4WWPA 2XTJD 3CLFL 5T1DH 4G9FD 2EIMB 4L0PB 1FVCB 3P9WB 1ZLVH 3WGUB 4S1RH 3P9MA 2XNAA 3OXSA 4MXWL 3NZSA 4Y5YB 4R8WH 4A38A 2C1PB 3CFBA 4LP4A 4HETA 5ES4B 5AKTA 1U8HB 1W2KT 2V9TA 5IEKA 1G6VK 1FE8L 1JZHA 3D3VB 4V33A 4LF3A 1T2JA 4ALAC 4XC3H 3D0VA 1OE1A 3FL7A 3L3KA 3EBAA 2H32H 3RZWA 1GVIA 3B83A 2QGBA 3CDZB 2H1PH 3G7TA 3QXAB 4DKFL 1SFHA 1FJ1A 3QZLA 2GVYA 1T5XB 1VFAA 4R83A 4OFIA 4XNDA 3RDTA 3D18A 4BSWA 2WQVA 1INQB 3O9WC 5KWYC 3TEUA 1JYWA 5E2WH 1RZQA 5JZ7C 1AD9A 3S8FB 3HHMA 5CZXC 2OK0H 2R0ZH 3CVIL 5JNYB 2VXSL 1KGIA 1OF2A 2AXGB 3FU6A 4FQQB 3D7PA 1E9OB 4B50A 4CSTA 3BISA 1L6PA 2JTYA 4G1MB 1LE5B 1Z7JA 3AABA 3B3BA 4Y19A 3F8UB 4HQQL 5D4HA 4DKTA 3RX5A 5DK0A 4KRLB 2D31B 4D9RD 4GUOA 5EBWB 5FYLH 1PZ2A 1QWHA 3N42B 2N1KA 2CLZB 4C83A 4ZUVB 1PLGH 1W6LA 4UU9A 1W0WB 5FM5O 2XQYG 4J6RH 2TRYA 1QSFD 3BD5A 4XCYA 4ZMPA 5DLMH 1RFDH 3H6JA 3WOVA 4Y88A 3C5JB 1E2WA 2F74A 4R4BA 4WAFA 3FUMA 2PETA 3II1A 4I1NB 1FO0B 3AG2B 4TUJA 4PRAA 2D0GA 1NPNA 3U25A 4CMHC 1OM3H 1EO7A 5D7JB 5DJZA 4HWNA 2MKWA 2BLFA 2FWLB 2ID5A 3UC0H 5B3JF 4AJ0A 1PSKL 4P3WA 1JPEA 2CJTA 4NBZB 3SBWA 3VXPA 5KBNC 4DEPB 1IB5A 2I60H 5GS1A 1S7XB 3NSYA 5I8EA 1NCDL 2GEEA 2XZQH 4XCFL 3ME0B 5D7IE 3WIHH 5MEOA 3C6SB 4ZMOA 1G6RA 4FA8A 4PG2C 4H8VA 3AXLB 2MQCA 4KJWC 2XU9A 4IIQA 2E59A 3W38A 1SN5A 1RZFL 4DTGL 1X9RA 3GI9H 2NNAB 4BYHA 1OARL 5BUAA 1DBJH 4PB9H 3FH5A 4FQ1L 2OX5B 3LXUX 5C0BE 2X41A 3F7YA 4GG6E 1Z66A 2I5YL 3N9GH 1KTBA 1KBWA 4KI5D 4NSKA 4I9XA 5D1QC 5F96H 4JZJA 3PS6A 4LGSB 5IB4A 4OVVA 5C1MB 5EO9A 1CD9B 1UZ8B 5D2NE 1KV3A 5ESAA 4YDIL 1DO6A 2FBJL 1W72L 3OAZH 3RUGF 3UAFA 4YHKH 3ZE1E 1OSZA 1BFSA 1OAQH 3HE6C 1U91A 2VDMH 1YY9C 2R83A 1JZ7A 3KLAB 4LNRA 3TPUB 1AGFA 3Q5OA 4A1RA 3VI4E 4PP2A 5IJVA 3BEWB 4MA3A 5FDWA 2DI8A 1OGAA 5F1IB 4XX1E 1D5BA 3BUPA 3E8VA 4NRYA 1T22B 5EO0B 5D72H 5FA3A 1QR4A 3EOAB 1EMTL 1LP9B 5DUBA 1GXEA 4FFYA 2I7OA 5DHYB 1N3NB 4R26H 3BVWA 4G7YL 4YC2C 5K9OB 5D4QA 2HMID 4H2CA 4HVBA 4GP8B 2V3DA 2WVTA 3LKQA 4NZDA 4NUJB 1IBGL 2YAEA 2WZPA 4YEEA 4GFTB 3D0AA 3NCJH 5ISZE 1J8HB 1KTLB 4LLUB 3UTTD 2R0WL 3C5SA 2JIXD 3FO2B 2WYZA 3TJHC 3AQDA 4ZUTA 3TZVA 2DL2A 1JUFB 2AK4D 3VGHA 3BKYH 3Q2CA 5C0CE 4MA1B 3W2DL 4ONOA 2X4TB 1TG8A 2X9ZA 2X4NB 1TF4A 3NCBB 3CXFA 3UJTL 4WU7A 3CK0L 4MS6A 4P23D 4XB3A 4PY8I 1TSRA 1NUDA 2NYKA 5SWQA 5L0QB 4TV3A 1A0QH 1DVUA 1B4LA 3GTNA 4LSVH 4OF6A 5ACZA 5E8OA 1OGPA 2WNKA 1TMCB 1XIWC 2E46A 1CTMA 3WEAA 3G5XB 4TUUA 3RU8H 1LWRA 1BBDH 2EVJA 5MENB 1LO4H 2VC2H 1C5BL 3EH3B 1YDPB 2DB8A 4TQPA 1UVQB 4Z7WB 4V2CB 3AMLA 2EDFA 3LZLA 1BM3L 3GO1H 1OB0A 4B95C 5AB0A 4EN3D 1VADB 1YNTB 1E5CA 3GWJA 1EAJA 1KIPA 2Y6SC 4FQCH 4FNRA 4D9QE 4YJZL 3R8BB 3NIGE 4NFCA 3VH8A 4D9LH 2XX1A 3E8UH 4AYFA 2JKJA 4TVPH 5AVTB 1NAMH 1F4WL 5IMMA 3MODL 1N68A 3DX4A 1EZSA 3VRJB 1MIML 1VPOL 3A23A 1VHPA 3P4LA 5A7BA 3A4FA 4PJBB 4XPBL 3OR7A 2F54B 5FO8A 3WFDL 4A66A 1I8LC 2CO7B 3KWXA 1PZ5A 4OZGA 4CADB 4EDXA 4K3JH 2NY6B 1IEHA 1E2ZA 4Y4FB 3LMJH 4PLJD 2ENQA 4NQCE 5I71C 1P7QB 3LEYH 1HL8A 1E28B 3TYFA 1UG9A 5IVXF 4Z1PA 1YYML 4XMXA 4CMMA 1N0LB 3NCCB 4F9PA 5JTWA 4NQTA 1KIUB 5DWPA 2B14A 4RESB 2VSKB 4MZIA 5HI4C 2W9EL 2WCPA 3FSZA 5BO0D 4IDLA 4PP1D 4AIOA 3VFTA 1L5GA 3WJJC 3HZVB 5F7EH 2VDNB 5T1KB 2V17H 1RHHB 4XH2A 1OK0A 3B3IA 1EHNA 2LTQC 2BP8A 2DQHL 1ZD6A 1L9RA 4K8RL 3J8F7 2W0FA 1DBBH 1NPJA 7TAAA 2KERA 2PR9A 3NZ8B 3DIDA 3VFPA 2E47A 5F7WC 3VGFA 5KSBE 1MCSA 2ED6A 2XKUA 5J11B 3MX0A 4S1SH 2X1WL 3PGCA 3JTSB 3K6NA 1SM3L 4P5TD 3U9UB 3ZE0F 5JXAL 3V5HB 4NNXB 4KROD 3AQYA 5IMOB 4G5AA 5D7SL 1HKLH 5CMAA 1KPVA 2XSKA 2XV2A 2BY3A 3LKRB 1FC1A 1OT4A 1OCWH 1YNLH 2Z8SA 2WO3B 2WNWA 3IJHB 1QVOA 3SO5A 3IMUA 3NFNA 4GRLA 1QHOA 3AS1A 3ESMA 3FB6B 2ZKXA 2XWTA 4KZEL 1BIHA 1G0YR 1PJ9A 3CH1B 3KPNA 3ELAT 3M1BB 4O2EA 4OW6A 1CLZL 2XOTA 2BIQA 3OWRA 4UV4H 5IEHB 1NM4A 1CF8H 2H6OA 3VXQA 3QJZA 3Q9PA 1NMCB 2EKSA 4OTXL 1IU1A 3WIFB 5IV2A 4W9JC 1JXFA 5H37A 1HEZB 5BOZG 1T4KB 1ZY9A 1U58B 2OXHB 4GIAA 3SYQA 1U95B 3VH8G 5DRXA 5J9PB 1BMGA 5KSUA 3KPSD 4LRIA 1EDQA 3O2DL 3W11D 3DARA 2UZIH 2OJ1A 2MPAH 2RA1A 3IJ8A 4KRNA 4GW4A 4LEOA 4P9MH 4X6EB 4PJFB 3BQUD 5TF1H 3DPDA 3MV01 5I1KH 4HBCH 3B7RL 3MO1A 3T8XB 3ZW3A 1QX1A 5L2KE 5IFJA 4CNIA 1CJYA 3GXUB 4OT1H 5EU5B 1UTDA 4R7NA 1YYLL 2NXZC 3U2SB 1DQDL 3WO4C 4B96A 4UT7L 1B2WL 4LU5L 1GSMA 3ECWA 4KMTL 4AGNA 4Y5XB 4NKQB 2MOGA 5AVZB 2D73A 2NZ9C 5I15L 4QTHB 5EBMB 1QSED 3IXTB 4XHJD 5B7EA 5I6LA 4H1LB 2XFXA 4AGPA 1A8ZA 1AZUA 5ESQA 3X1NA 1GIGL 3B8YA 3RVTC 3LIZL 1CFMA 1P9MA 3PHQA 4IS6A 4PRIE 5E9DB 5KVDE 2I85A 2IADA 3OAUL 4EVNA 3NIFB 3L48A 1RZ7L 5B38B 1PTZA 4PLKD 4Z7VB 4FADA 3K8LA 3QWOB 1TLKA 2EZ0D 2V7HA 4JFDB 5E8EB 3CX2A 4S2SB 3A67L 4OCWH 3TO4C 4AT6A 4U4BA 1KJ2A 3GJFA 3SQBB 5ANME 2Q76A 3US1A 1AXSA 2C9PA 4G9DA 4RNRA 3GJEA 2RR3A 1JNLH 4TL4A 2HSIA 1XF5A 2WBJC 3OJDA 2QV4A 3ZPDA 2HLFC 3K46A 2HTLD 5I1DA 1E6JL 4J23A 1QFWI 1AQHA 3HI5H 2BSTA 3CBKB 3RTQC 4GAYA 2P5EE 1HAWA 3RA7H 3IETB 3TIEA 4B0MM 4HD5A 4YDZA 1T0MB 4P06A 2VERN 3K6DA 4MFHA 2WOBA 2FR4A 5AENA 1N8OE 1NDMA 2X6MA 1NIBA 1I7RA 5TTRA 2NY2C 3E6FB 1NC2D 4X2UA 5BZDA 5JW5A 3KGTA 4PRPA 5IBLD 2FL5A 2X09A 4JJ5A 4N9OB 3KPMA 1IVTA 2YGNA 3MN8A 2PNDA 1U92A 4RCAA 2PP8A 1AFVH 1J1PL 3CLWA 4NO3B 4EKJA 1YMMA 3GMRB 4KV5E 4F2EA 3UJIL 3A22A 3CXDL 4F91B 2VDPB 4HWBA 4DPAX 3EOTL 3AAZB 4HLEA 4OZHA 4W93A 2FX7L 1MN4A 2CMRL 2WTPA 5H37G 3REVB 4CVZA 5E08H 1BZ9B 4KK6C 4NO0A 4PJXF 2ZF8A 1K4DA 5L8JB 1CWVA 1UWYA 4XVOA 3ILDA 1WAPA 1ZIAA 1GS7A 5DD6B 5F7YC 4CGTA 4Q52A 3TBVB 1BGXH 5FLVA 2VO5A 4AQ1C 4Z95L 3OVUB 3QI9D 5LBGA 2P46B 3BT2H 1BYPA 5EWIH 5KVFL 1JGUL 4GKLA 4IEFA 4L4TE 5JO5B 4BUHA 5ICYB 1I1FA 3SKOB 4D2NA 1CI3M 4M5ZH 5B1JC 4PJGB 3IGLA 3CFKB 2J88L 1UA6L 1AGCA 3QQ3A 2QKIB 4HIQA 2JKTM 3BIAX 1HWGB 1DN0A 5GZNA 1S7UB 2IFFL 3KYMA 4MD4A 3CFJA 4NQEE 5KSVB 2HRPL 3T0DA 2QMKA 4IRJB 4BSJA 2R69H 1HX0A 4OZGF 3MA7A 4L29B 2G3MA 1IAOB 2B77A 1ICTA 1P4IH 1AE6H 2J25A 3MLUL 4J1UB 5GRUH 4YPJA 4TOYH 1AP2A 1U8PB 3PV6A 4Z3IA 1T1XB 2GJZB 4TXVB 2BSEA 3OJMB 4O2CB 5IESL 2QVMA 3P73A 3X11A 1MZZA 1I7TB 4LLMB 1G7IB 1BZ7B 3NJVA 1AACA 1TJXA 4W70A 1XCQA 3Q5YA 4UYPA 5IQOA 4AMXA 4IMLA 4WUUE 4AIZA 1HL4A 5DC9B 1R5IA 5IBTL 2X4SB 3QZWA 4MCYA 3BPLC 2O5ZL 3BKMH 5DRZA 3Q1EA 3ML8A 2CM5A 3PWUA 3BZFB 3C6LA 2R4SH 5ALBH 1FGNL 4UTBA 4OKVB 4XB8A 3P4NA 4EUPH 1NGPL 3PGDB 3QG6A 3RI5F 5KVEL 3U9PH 5EZJB 3GSRA 2MRYA 5MP6L 1M1XA 3IMWA 4XZUA 1PLAA 2B1OA 1IM9D 4GG8A 1HHIB 3DHPA 3BHBB 1SLWA 1WCBA 3LKSA 3DYMA 2ZCKL 5DJAA 4H26B 3SDYL 3ESUF 1XAKA 3DGGA 3GMOA 1JZGA 4OB5L 5EU6A 3GSOA 3X17A 2Y1ZA 1EAQA 1FBIH 3HMWL 4MBOA 3AM8A 3LRHA 1A3RH 3AMKA 1MVUB 3KLDA 1LEIB 4JO5A 2A9DA 3UFIA 4S1QL 3EYOA 4WF7A 3QUMB 2Z91B 4HUUB 1UOLA 3I6KA 3HG1D 3OG6B 5B4MC 5IY5B 2Y22A 4R0LA 5I5JA 2FJSA 3QQ4A 1BVZA 1HNGA 4HALA 3U4EB 2WWOA 3G9AB 3LN5B 2VISA 3QFJD 3ZRCC 3MYJA 2ZXGA 3WIHA 2KQMA 4S1RL 2HRHA 4EZKA 4R8WL 4RFEB 3LHAA 1KBBA 3D39D 5CP3H 5IROC 1TVHA 3H7BA 4MQTB 3NPSC 5C0RH 1KOAA 4OZIB 2EACA 3H3PH 4XC3L 5FCUH 1C5CH 1DJGA 2VLLB 4HH9B 4PJ9D 5HYSB 2EVHA 4IRZL 3B8SA 3LZFH 4M5YL 3MQIA 3W3BA 3R0MA 1I1AA 2NNCA 3RIAK 3VDBA 4I18B 2RFXA 2WSKA 1S7TB 2M2DA 3QUYD 2X44D 2GKIA 5EO1B 2EUZA 2DLIA 2GW5A 5E2WL 4F7EB 2BHUA 2DQDH 1BF8A 2J6EH 5EUKA 2P8LA 1WBXB 4PTTA 3IWVA 4TQEH 3L3JB 1THCA 4HJSA 5JHDE 5IQ9B 6PCYA 3IDNA 1A5FL 4M8RA 4QRUB 4ZTOH 4ZJ9A 1NBQA 5TH2B 2D0FA 2VR7A 3PHAA 3QIWD 1AHMA 4QT5A 1QSZA 3GMLB 4TLUA 5FYLL 5FF6A 3MRLA 3WENA 2H47C 1PLGL 4B41A 4P2YA 3RFZC 4J6RL 4YDNA 1R1CA 3IYLW 1H9DA 5DLML 5D1ZI 4AQ8C 3V4UH 1QTSA 1OCCB 1C5DB 1M3JA 2UY7B 3HZYA 3VRLF 1IKFH 1XCTB 1GGTA 3V4PH 1TTUA 1MI5A 2C9RA 5IIEA 1KYFA 3O9WA 1OM3L 1N26A 4MJIA 1HHJA 1KV7A 1X5YA 3MV7D 1LQBC 2VDRH 4XRCB 4BCZA 4F9LA 4PJAB 1OZTG 2DQUH 3UC0L 4KKNA 2YLHA 4ATWA 3B5GA 2CKBB 2JI2A 3ZL2A 1ZVSA 5C0JA 1M2VB 3VO0A 4U1LB 2LVEA 5DGQA 2Z35B 1NFDB 3KGRA 3WTWA 2OL3L 3KWVA 2PWFA 1T0PB 3QJSB 4DQAA 1I8UA 3EJJX 5CSBA 3LSOA 5LG6A 3T1FB 3BH4A 4FYRA 1TVDA 3IFOA 2SEBB 1CT8A 1DBJL 1KWKA 2RMNA 4JCWA 3FTSA 2YMXH 3QDJE 4AY0A 1ZVHA 4OFDA 3PWLA 3U1SH 5ETUA 1AAJA 3MTRA 3N9GL 5FK9A 3UDWC 4NDMA 5T3ZE 3AWGA 1ASOA 5FGCB 1AG6A 3HC4H 2IH1A 3IMTA 2VZ3A 4MJ6A 3EJPA 4JNXA 2UZYB 2GI0A 4IKLA 4U3HA 5G2NA 3FOMB 5DD0H 3MOBL 1XXDC 1C8PA 1NAMA 4YHKL 4HG4K 3KYKH 3QUZB 5HI3D 5HGDB 1OAQL 5HI5C 2EDLA 3DRTB 2VDML 5FHBL 5DMKB 2WLJA 4R3SA 1WCQA 1SF5A 4GI8A 1H0DA 2EXTA 3PL6B 4H7VA 3RGVD 1D5ZA 4JFZH 3L81A 4H5SA 3N1QC 1F86A 4X0KA 3BWAB 1FYTA 3JV4B 3QDAA 4WNJA 4PG2A 1BOYA 4OLUH 5D72L 3DNKA 3RVXC 3QR0A 4FHJA 4N6RB 3TTSA 1L9TA 2P5PA 4R26L 4QRBA 3LYRA 4QOKA 2Q1EA 4YQXL 2YWYA 3VFUA 3DX6B 2CLVA 3DI2B 5D1QA 3K3QA 1AQDB 3WHE0 5CEZH 3NCJL 2EEAA 2ZSVA 1I1RA 3UO1L 2HT3C 2YD8A 2K6YA 4GLRH 4KQ4L 4F24A 2YUVA 5D7LB 5D5MA 2AK1L 4UQEA 4FI7A 4ZW5A 4R2GB 3BKYL 4OBRA 2GG1A 1EXHA 2E5EA 3G5VB 1DEEB 2ICEC 4XN7A 2WHVA 3LQAH 4WKZB 4YHPA 3EYQC 3UZQA 3HE6A 1TZAA 1XFPA 2IANA 3G6DL 5IVOA 5SX5K 1YPZB 1KYUA 3RJQB 3VJ6B 3SCMD 5TDOB 5GGUB 4LSVL 2CK0H 3BGMB 2ZWSA 3K72A 3RY5A 3I02A 1ZGLP 2N0MA 2PCPB 1ZS8B 4Q58C 3RX9A 1LEKB 4X8XA 2VSDA 4TSAL 3ZY7A 4F2ME 1A65A 2XWCA 1MW0A 3GLZA 4Z3FA 3RL2B 2CUAA 2VC2L 3D34A 4MDJA 3UYPA 3QQDB 1A9EB 1BQLH 1UXSA 3HG5A 3GO1L 5IVXE 2W91A 3ULUH 5GRZA 1T0OA 3WJMB 3GSQB 3GZKA 1WBYA 5HJDA 5F9OH 1F4YH 4FQCL 1ZGLA 1UXWA 1P7HL 2FIKB 5KYXB 4HISA 2VZ1A 3E8UL 4KITB 3UACA 3ZE2F 3VD3A 4L8BA 4YFEA 3TBSB 2XYCA 1W15A 4P57A 5D1ZB 1HH9A 4HAFA 2WM0A 3ELQA 2VLKE 4BDVB 5LXVA 2F53A 4FFWC 5BZXA 1Y6KR 4JRLA 4KMLB 1OOWA 3JTTA 5FYJH 1WQVT 1XIWA 2IALA 1IC1A 4K3JL 5IW6B 2VLME 2WXHA 1XGYH 4LCYA 5I66B 2P7TB 4M8QB 4AW7A 2C9XA 2CZNA 1X5JA 4YHYB 2HUEA 4Y19E 1UJTA 4XNUH 3EFFA 1XD0A 1K4CA 3NCFB 3ZE0E 1YEKL 1BFTA 2R15A 5C0AE 1TENA 3BGFB 4RDQF 1FLRH 3T3MF 3QIUD 4UDUB 1J88A 3U0PA 4JM2C 4DK6A 1NFKA 4JRXD 3RVUC 3B9VA 1MAJA 2BCKB 1BWWA 2NY4B 1VRSA 3T0EB 5IR1A 5F7EL 3KYNA 5L88L 2O5YH 2V17L 4MZRA 3I75A 1X9UA 1JMXA 1XV8A 4OCXH 3DMMC 4S10A 2IAAC 5EORL 3WMPA 4B9GA 3ZMEA 2WLIB 4JDVB 3HZ3A 4HUXA 4LLDB 3F01A 3GHEH 3SBQA 5HPMA 3PABA 1FL6B 2DJUA 4MKTA 3ROLB 5EUOA 3V4VA 2OR8A 1I8LA 3OAWA 1BQHA 4NKOB 1ZEAL 2PPEA 2H3NB 1S9WB 1W72B 1DFBL 3V0IA 2VLRA 2YPLD 2YQBA 1HHKA 5KS9A 1EEZB 2Y24A 2JLLA 1YN6B 2HZHA 2A6JB 1FUNA 1RUMH 3JWDH 1JWUA 2Y23A 4UUJB 7PCYA 2X2HA 1HKLL 3IGAB 4YNYA 5I9QB 5CF3A 3I6GA 2LOEA 4PREA 43C9A 1JPTL 4TVSa 4LPCA 5INCA 1YNLL 1OCWL 3FQRA 2G60L 3WJJA 3E3QE 1XZWA 1DJHA 1O9ZA 3KPTA 3RPBA 5BS0B 4NS0A 5ITFB 2J43A 4GS7B 2HJLB 5E6ZA 4Z8FH 3SDDC 1Q0XL 1IAII 3HA0A 4V11A 1BLNB 5KSAD 2ITCA 5C0AA 1ZK9A 4FTVB 2YSSB 1CF8L 3FSWA 3GGWA 4LEBA 4M62H 4KNTA 1MRCH 2X6BA 3NN8B 1P6AB 5E4IA 3BT0A 1JYVA 2K4AA 3S4SA 3MJ7B 1SMAA 3MJ8A 3NTCH 4LNVA 1KFAH 2NX5A 1U8NA 4K15A 1WVZA 4KO6A 4MMZB 1IARB 4MNQE 5IW1B 1LK2B 4FRWA 5D70L 3CSBA 3F7VA 1S2EA 4ODBD 2UZIL 4P9ML 2NUTA 1OGAE 1MHEA 3CSFA 4KVPA 3PNWA 3APFA 3WNNA 3JTBA 4HBCL 5I1KL 4YHNB 1EDYA 3CQFA 3HI1B 3GUTA 1D6EB 1HE8A 5DMGD 3TT1H 3ZQXA 4OT1L 3DX0A 4WW2C 1LNUB 4GY4A 1FNGB 2WZ6A 3L1EA 3N44F 3VDAA 4HLJA 1AHWC 4JFED 4I89A 4W9IC 3T71A 3ALPA 3OXRA 3RKPA 5T3ZD 4NZJA 1NCBH 2K8QA 1WTGT 5ERWB 3HE7C 3WLBA 5E2UH 4B27A 4N0YH 5DZLA 3S88H 2ZYIA 3C5ZC 1KFGA 4BGDA 3L4XA 4YBLB 4HOZA 1TZGH 2R69A 2F5AL 4DP6X 1K3ZA 2Q3AA 2WO4A 3ALXA 3TBYA 2DMGA 3MRDB 3W0WD 4CSZA 3P54A 1QFUL 2CBMA 2R56H 1JNLL 4UILH 1KXHA 1YQVL 2Y7SA 4DGYL 4GRMB 4PGEA 4X50A 2FQFA 1PFOA 2BC4B 4NOFA 5HYJD 2X1OA 3MRIB 4Z78B 2X40A 5K9JH 5KN5A 4R7DB 3HI5L 1WWWX 2CSPA 3IF1B 2X4QB 1C16B 3TWCL 5E6IA 1MJ7H 4J28A 3RA7L 1B3IA 1C12B 3BVVA 4L3EA 3TVMB 3WNPA 1BFOA 2Z0BA 4RBPH 2JXMA 3I74A 1LD9A 3VXRB 4MB1A 5EU7E 3EGDB 1JYXA 1HWWA 5HDBB 3T8VA 1GW6A 4P5KB 3ULUD 1E65A 3DIFB 1FH5H 2RIKA 4GKZB 2EYTA 3QHTC 4ZUSB 2EXWC 4EI5D 1LGVA 2YMTA 4FNUA 4W1TA 5K33A 5C07D 2CR0A 1YUHA 2HFTA 3M07A 4APXA 4JL2A 5DJDA 1AFVL 3IBEA 2XZAH 4ZMVA 1VFOA 1S7QB 3BMWA 2J5LB 4OZGE 1AS6A 1JWSA 1QO3A 2FH6A 4Q6IB 4DPRA 4DO5A 3VD2A 2YPVH 2XFGB 2DI9A 2CBOA 2Z4QB 2AGJH 2VJXA 5D2LA 2KPNA 1Y0LA 4F1SA 2EABA 2JWYA 3ZYOA 3RTQA 2R0LH 1BGXL 4JFUA 4LASH 3OMAB 1JYNA 3AXHA 2CCLA 4NRXB 1HESA 1XXFC 1EUUA 1C1EH 5EWIL 3VM7A 1S5HB 3EDFA 1DVYA 3LKNB 3QZBA 4H25B 2A6IA 2PN5A 2X2IA 4I9WE 2CDFB 3PPSA 4GUQA 3GF8A 3O3EB 1DO5A 4PGCA 1YEGH 3HBGA 4M5ZL 3IDJA 3GSNA 4GBXB 4M48L 5IHZA 2XWZA 2K6ZA 5C0GB 3FRPA 4HIHB 2ZOOA 5KUKA 1DEDA 3OHMB 4LB8A 4JHVA 2JJVA 4MASA 4ZQTA 4Z0BL 2NXYD 1L7TH 5CP3A 1P4IL 2P1YA 4FI6A 3GRWA 1V5JA 4TOYL 2BFVH 5F0JB 5GRUL 2IAMB 2GK0B 1LQSR 3VU2A 4L1DA 3T0XA 4JFPA 1RJYB 2Y7LA 4FERA 3GBLA 2GTWA 1YEHH 3FUFA 4DGWC 2VLMD 2C3GA 1TITA 3PJSB 1SXSA 4CVXA 5BV7C 2P4AB 4AH2B 2DWDA 3QULB 2DQTL 1PF3A 4WI6A 4AQ1A 4QXWA 1HILB 25C8H 1MUJA 2UY6A 1OD7A 1U36A 4WWKB 3D69A 5C3IA 1RP8A 1LO3H 4N5UA 5BRZD 2DQMA 3BYYA 4DF9A 3LN9A 4YSCA 2XTJB 4OM0H 5B1JA 1MSPA 5H2BA 4G9FB 2R4SL 2AZUA 5ALBL 3UTPE 1CI5A 1RH8A 4JO4H 4K23L 4F93B 3QHZH 5F44A 5IB1B 3TTYA 5EUOF 1N4XH 4B9FA 1T20A 4Y1AD 4PTUA 4K71C 2WXIA 4EF3A 5E24E 3INOA 1U2HA 1XBDA 2HFFB 4BD4A 2ZUQB 1AR2A 3KVPA 3GMQB 1FBIL 1Z5LB 4JM4H 2MQGA 4G43B 3CMGA 1MCNA 5DJCA 1OQXA 3OJVC 4G80A 3QEUA 3V4PA 4Z7IA 2VWEC 5DZNA 2OSLA 2WYIA 5HGAB 3DHMA 3TEYA 1QBBA 4L3AA 3TJEH 3K1DA 4B3EA 2H2PD 1ZXKA 4Y9CA 7PAZA 5F9JB 3MFFB 3TA3C 2QDVA 4X6DB 1RJZA 4RSYA 1JHKH 4DW2H 1QBAA 1F1AA 2WZ0A 4PGDB 5JW4M 2IXQA 3OKNB 1DSWA 4L37A 1E6OH 4WTQA 2Z1KA 5J13C 3EUDA 1BJ1J 3ECBA 4N2FA 3WV0A 2ICES 1WS7A 1QSFB 3EOYG 5C0RL 2ITDB 2EDWA 3BVNB 4TQ8A 3Q48A 4LSPH 4QRQA 4UM8B 3H3PL 1FVDA 4BZ2L 5FCUL 4LKXA 4KKBD 2UVEA 1MH5B 3ZHNA 3FRPG 1M4KA 2JSFA 3MMEA 5D9SA 3PRZA 4ONHA 3UAJC 4PVMA 3W9DB 1R5WA 3HCVA 2DMBA 4XCEB 4ADJA 4FZ8L 4L9LC 3N1MC 5FHAL 2H7WA 3IXAA 2VUOA 2VRKA 2EO9A 4P0DA 4PRDB 5CCHE 1GTNA 2BWDA 1CL7L 3GSWB 4OZFG 3VXUA 4LARH 1GZPA 3ABMB 3HB3D 1OT2A 2FO1A 2B1HH 2DQDL 4QLRA 2J6EL 4Y4HA 4JDZA 4IBVA 5IOPB 4TQEL 2DKSA 2LVCA 1OT1A 1GYUA 3FB8B 4N2AA 5KTEH 1S3RA 4W9ZA 1SZNA 4X6BA 3KHQA 1KCVH 2WVVA 5IUCA 4L1HA 4DVRL 2ENYA 2KT6A 1LO5B 1HHGA 2XWBA 3FQ1A 4LHJB 3SYPA 2JKWA 3TZVD 4PRPE 5A40E 4L3CA 1N2RB 1XCXA 4WW1B 3CHOA 3UOAB 2F7QA 3WDHA 4EI6A 2ATAA 3V9FA 2H26A 3V4UL 5BV7H 4PVNA 1AJ7H 2XN9A 3L9BA 4J7RA 2O6EA 1M6UA 4OLZH 4CN1A 3UZVA 5TE7H 4XTRD 2IDSA 1JBJA 2WLMA 1MFDH 1ZHLA 3N91A 4JDTL 1B9ZA 3D2UD 3O6FC 2BP0B 4OZHE 4PJIB 4XNBA 2ZUWA 5AALA 4HOXA 2BP3A 2E7MA 1YYCA 2J55A 2VDRL 1F8TH 1JN6B 2DQUL 2J57A 3CIQA 5EN2A 1JGLH 5EB9A 3L45A 4ZNEA 3TCXA 1FVEB 3EO0A 4ILDA 3VQMA 1X9QA 2B2XH 4Y0GA 4R9HA 2H8PA 4HJ0D 4TL5A 5FYKD 1OTUC 3S3DB 3U36B 5HBBA 4KK9C 1PL3A 4Q9BA 1T6VN 2NSMA 1X5XA 3WUWA 1PKQA 5L6YH 3RFZA 4U05A 4NZ8A 4RIRA 4ZMNA 3WY3A 3R06B 4AQ8A 3H2QA 2UWEB 1ONQA 2YMXL 1S8DB 1IFGA 3UTTB 4E9SA 3B34A 5AYUH 5E99L 3U1SL 2JIXB 4KQ3H 2HLEB 4X8CA 5FC9A 4ZQKB 4P48A 1KXTA 2AK4B 4KNQA 3ERXA 4YEFA 1HI6A 4TF4A 4N1HB 4IU2B 2KZBA 2A1WL 2MNJB 3B7SA 4N28A 2K45A 3QNYA 2NY5C 1M7UA 1VEMA 4P23B 3KPPB 1IJNA 5DD0L 5BZZA 5JORA 4P4RB 4BZYA 4LOUD 5AD0B 1CZ8H 1AHKA 1NBYB 3FU3A 5CS7A 2AI0H 2FJHA 5L8LB 3EO1B 3SPVA 1CLOL 3VACA 2AJXH 4HSAC 5JIKA 3IDMB 4JFZL 5C6TH 4CAGA 4KO5A 4UINH 3BZEA 5GISH 4QHNB 4QHLB 1CFQB 1SJEB 4MQ7B 2GFBB 3EF7A 1SJXA 2C9AA 3QORC 1NUGA 3PUCA 5E8PB 2ZX7A 4ZAKC 4YZWA 4EN3B 4QRPA 2W9LA 1E7VA 1S9XA 2YD1A 2YSTA 5I6OA 3AVEA 1UWXH 3DA0A 1OPOA 4BA8A 3UDWA 1TQBC 2OKMA 5CEZL 3F6LA 3NAAH 1QBMH 5I24A 5ADPH 5TQ0H 4TSBL 5CIPB 3BRFA 3RIFK 2YD9A 5ILTH 2K7QA 2ARJQ 1JPST 1KT2A 4UANA 4JFOB 4UOQA 5DD5L 3SD2A 5I5MA 3LQAL 1E90A 3MBWB 1E5YA 3QRFM 3ZE2E 1ZA3A 1EX0A 4M6ML 2C4FU 1YC8A 3IE4A 4Q14A 2P5WA 2WTRA 3ZVVA 2CK0L 2ZCLH 3C5XA 3FB7A 2JJSC 3W9EA 2D3NA 2Z31C 4K0OA 2F19H 1OAKH 4YXHH 4WHTA 1KCKA 2PO6D 4POZC 1F2QA 3PWPA 5E7BA 2FQDA 5FKAB 4MRBA 4NP4L 3X3FH 1P5UC 1CQYA 3TEWA 2N0KA 4K3HA 4YSRA 1XL6A 5DC0A 1ZHNB 1GGYA 4D3CH 1G1CA 3O3BA 1BQLL 2X6VA 2FATL 1MREH 4MSWA 2ESVD 3VWJD 2YGPA 3F65A 3WJLA 4HULB 3ULUL 4HC1H 4KZ0A 4UV7L 1N67A 5JHLH 3QCVH 1SXAA 5BVJA 1W8OA 1XTLA 2WIIB 3OQRA 4J2XA 3PU7A 3QXVA 4RZCB 3FQTB 3FBKA 3WUWG 2ICEA 1J8KA 1WICA 4P2CG 1M05A 3WL9B 1WIUA 2JTDA 2Y25A 1B0IA 2C3XA 3L6FB 1FFRA 2AV1B 3IU3B 3RWGA 4X4ZA 5CFAA 3LPFA 1SJHA 4G3YL 2XWRA 4NO2A 2V2TA 4P5TB 2AEWA 1SVCP 4Y7OC 1I82A 4KROB 1ZGLM 1YUKB 1JXKA 12E8H 1XGYL 3KBEA 3REWA 1AZBA 1U9KA 2R2BB 3E9TA 4WDIA 1YEIH 2W65A 7FABL 5FAAA 1JGEB 2E4TA 1OSPH 4XNMB 4APQC 2PWGA 1FN4A 4HWZA 4JO3L 2WVUA 1FLRL 2IGTA 1BQ5A 2OL3B 2ALWA 2VR6A 1FI8C 2ZOTA 4X99B 3V0WH 1E9QB 3MRMA 1J9SA 3DYOA 4ELDA 5F9WC 3BH8A 4LSSH 5I0XA 2O5YL 2DDQH 3P77A 4A04A 3BUYB 1NEZB 4OCXL 1U3NA 5FKPA 3O41B 2ARJA 2EUXA 5J6GB 3N04A 1KYOK 4FD0A 3B4NA 3GHEL 3HS9A 5EC1B 1NANI 5DK2B 5INDA 4NQVB 3NUKA 3QPXH 4Z6AT 4MJIE 5ANHA 3AB0C 2FX8H 3TWYA 1H15B 4FYQA 1Q9OA 1PAZA 2NQCA 5HDQH 3KPSB 1ZTXH 3THML 5DA4A 1QKZH 1SF3A 2ATKA 4F7CA 4UM9A 5BVPL 3KS0H 3BQUB 3X13B 2MWCA 2QGEA 1J05A 4JCLA 3CVCA 4L2YA 3JWDL 5DYOA 1JHTA 1T1YB 4FG0A 4LP8A 4JM2A 1M71B 1SY6H 4HD9A 4H8WC 2DL9A 2VM3A 4OJCA 1MLBA 2ZJSL 2NR6C 3K2IA 3OKMA 2HLAA 1OP3K 4F1ZA 4NHCH 1MWAL 2IG2H 3EHBD 4Z8FL 1HSBA 1YEEH 1QSEB 3DV4B 4GG6B 3DMMA 4OLYL 1W0VB 4NKDA 2P48B 3UBXI 3WXWH 1VSCA 2JJWA 1I8KA 1YMMD 2FGZA 3E38A 1FFPB 3S35L 5DJXB 2FT6A 1MRCL 3S5LG 2YZ8A 2QADC 3FQ4A 2IFGA 3EGSB 1XF4A 4FNQA 4TVPE 2XICA 2CALA 4IOIB 5LHDA 3VI4B 1RK0A 5B3SB 1NOAA 3S34L 4BKLB 3VFMA 4B9IA 3VD4A 3QZOA 1QMUA 4ORGB 3NFPA 1MELA 4Z3HA 3PIQA 4GIPD 4RGND 1E8WA 2BNRD 3F3HA 1KY7A 3RWDA 4N26A 2CHDA 4NC1C 4UIMA 2MJWA 2Y69B 3EO9H 4OF0A 4QOKE 4RGMB 4Y2NA 3ULVC 2QFPA 3SDDA 5CP7B 1FQ9C 1A6TA 4NKMB 4HHAB 3BVUA 1E8YA 5IBUB 3KWTA 5C0FA 1A6ZA 4JANA 5D1QE 3DVGB 1NC2B 3L2LA 4P99A 4Y9GA 5J06A 3WU1A 4JFXA 1NCBL 1PZUB 2YKKA 4JPQA 4ELMB 2R23B 2UXTA 4A55A 3WNOA 1GOFA 5D5ME 5KOVC 2CLRB 1KIRB 1VEPA 3EW3B 4N0YL 3NCXA 3C2SA 3ATEA 4GRWF 4E5XB 3S88L 1FNFA 1TZHB 4A7TA 2FD6H 1JXDA 1ZV5A 4LCVA 4U4IA 4ZUWA 2E9GA 1TZGL 3OF6A 3Q6FA 3TT3L 1EXUA 3DJTA 1FG2B 4HIIB 4A6YH 2GJ6D 1A9BB 4YHLL 1MFBL 5FXCH 4E41D 4NAMA 1KB5B 3BGAA 4Q0XH 1S78C 3WSQL 1KGCE 5HVHC 3TV3H 1HHHB 4UILL 1HQRB 4P2RA 5TGBA 4B9KC 1DQTA 1Z3GH 3LDBB 4NN6C 3QFGA 4GUPA 2Q6WA 2DIAA 4HBQA 3NCMA 3QI9B 2FH8A 4WW2A 5K9JL 2B08A 4ZX5A 1TCMA 2DTSA 3VXSA 3NRFA 3ZYIA 1MJ7L 1AHWA 3EG9A 2OW7A 2BRRH 2HT4D 4X5PA 3NFSH 4HPOH 4GJTB 4ZFOA 2ZYSA 4PBDA 2ZUYA 5LXGH 4YDJA 3HE7A 4HV8B 5EU6D 3P0GB 2NY7H 1URIA 4U1GC 1OL0A 1T1WA 5FOBA 1G7JB 4GQZA 3C5ZA 2WXGA 4XMTA 4GXVH 2QQLH 3IWUA 3RNKA 4N5EC 3MXWH 3TO2A 4CJ1A 4N87A 2BVPA 3WE6B 3FCSB 2CO3A 3VYPA 2NY0C 4JKLA 1G7QA 3SKJH 3QIBD 4KUCF 1TTGA 2AQPA 4JRFA 4KKAD 3UIZA 2YPVL 4PR5A 4H8WH 5C9JA 2AGJL 4X6CA 4YHIB 4MB3A 3FF7A 4N90D 4AE1A 2AP2A 1XF2A 1X5IA 4LAQH 1R3KB 3QC5X 2KH2B 2R0LL 4QLWA 5JOFB 4R90L 3CUPA 4JG0L 4FQHA 2VRQA 4UI2A 4NN7C 5DT1H 4ZFZB 4PS4H 2MCPH 2YHGA 5GGRY 1WA2X 3KR3H 1FDLH 2QR0B 4M1CC 4QJ4B 5EIIB 2OMVB 1HZKA 3CU1A 1KXVC 2EILB 2AQRA 3LRMA 1DQMH 1IM9B 3RNQA 2XXFA 1E7UA 1F1GA 4HUCA 4IDJH 2VM4A 2YKLH 4ATTA 4PMEA 2VN7A 5CJBA 3Q0HA 4DK5A 2WXFA 3TBTB 5AZEL 4GAJH 1I1AD 5FS5A 1L7TL 4UNIA 4Z77B 1USZA 3UBXB 5EUOE 3ZZSA 4X7SH 4DCQA 1U3YA 4QHMB 4HK0B 3W39B 1R34A 1WBZB 1W91A 1IKOP 3VFVB 1YEHL 1A3ZA 1PX3A 4YGAB 1GZQA 5CEXB 2M26A 3ULVH 4OD1L 5CU9A 3HG1B 3GBEA 3LXCA 2H45A 4Y2DC 3GS7A 3HHSB 1OSEA 3ZK0A 1AANA 2IWEA 4QDGA 2MHAB 3H9SD 4CKQA 4DGVH 3ZTDC 1MPAH 1ADQA 4NI6A 1LO3L 4ZFGH 2Q7YB 5E95B 1UKQA 2F8OA 3QFJB 2Q87A 2AQTA 2MNUA 1E3XA 3W1ZA 3TL5A 3ESOA 4JO4L 2DJ4A 4RAVA 1O5PA 2VZOA 3KPQA 1SDDB 1E4WL 1SMOA 1U3HC 3QHZL 2FBRA 3D39B 3MUUA 1TTAA 6TAAA 5JXED 3NIDE 5F7HA 5F7AA 4F7TB 3N06B 2C9QA 5E4EC 4DSYA 2CUIA 4J8RB 4BSVB 4ZG1A 1MI5D 5AG8A 4K5OA 2F7IA 3JWNG 4PJ9B 5FW6A 3O45B 1NCOA 3SSGA 3TIDA 1JZ6A 2XG4A 1HWHB 3VFSB 3X14B 4YDLB 3D50A 5FA4A 2I24N 3MNDA 1OE3A 2KQNA 2NX5E 4XCNB 1VACB 4HIEB 1ZTMA 1T0NB 3LKPB 4RVBA 4JM4L 1A1NB 4BFJA 4L8SB 4JM2F 4E42A 5KAQF 1EANA 3MLRH 4ZPTB 1A6VH 1QRNE 1TETH 2V0AA 1NBVL 3FQNB 4YO0A 3RWEB 1OW0C 3NJHA 3TJEL 1WP6A 1AGBA 2Y7QB 3F05A 5EULV 3TH4T 3CVHA 3OR6A 2P52A 1MG3C 5AW7B 4DW2L 2HJKA 2WLKA 2BX5A 2LQRA 3QIWB 5B7MA 5EEYA 1E6OL 3WD5L 2DYPA 1OV8A 1AOHA 3GKWH 4HIJB 5C0ND 4XNYL 1HH6A 2FNBA 4OGXH 1EFQA 1JNHA 1QA9B 2KDGA 3WG7B 3BLKA 4X6FA 4Y16C 1QI3A 1V27A 4YFLF 2OMTA 5A3ID 3L7FB 1CFNB 1E9PA 1T5KA 5G4MA 4LSPL 2QL1A 2EC9U 3T0VA 4JY4A 4MJJA 3UTSA 4HUWA 4XO8A 2RAMA 4DGIL 2JE8A 4YVUA 5ANMB 2ZUUA 3S36L 2XN1A 4I3RL 5GIRA 3L3DB 3SPIA 2VXQA 3MV7B 5E7FA 4XXDB 2O1AA 2W81C 5LB1A 1T04B 1FYTD 1UA7A 3MLTB 1CL7I 3KBPA 1ZPLA 4KJWD 3K74B 2HFEB 5IMLB 5I76A 4LARL 3TA3A 2B1HL 5GRWA 3NQIA 2HYMA 4I5BB 1QASA 4WWNA 2XT1B 1HSAB 4CSPA 1V05A 5BXFB 5CGTA 4FNSA 5KTEL 4L3EE 2EVFA 3D4YA 4HXBH 1T3FB 4XXCC 1XGRB 2CRYA 3L17A 1KCVL 1CK0H 2NY1D 1LMIA 2BNQA 2X87A 4KDTC 4ES9A 3FT4B 1KEGH 3DSNB 1E2VA 4Z7NF 5CJOH 2X4RA 1RZIA 2YUWA 3EJZC 4CW1A 3KLHD 3FPXA 5CEYB 1G7HB 2H0PA 4WGWB 3UAJA 2IAND 4XPTH 5AZ2H 3JUYA 1PCXA 3NG5A 2J8OA 5EBLA 2E6JA 4HJTA 2D0HA 3ZDZF 4OLZL 4WY7H 5TE7L 4L9LA 4LSRL 1DJSA 3LZPA 3S2CA 2Q86A 2Z8VC 3F62A 3FO9B 4OKDA 5D2LE 1F8TL 2IOOA 4CKVX 5C7XH 3MV9D 4AK1A 3V0VA 1RJLB 3RGVB 4PJ5A 2DIEA 1NBZA 2N7AA 2RQEA 5I16A 3QPQC 3T08A 5I0YA 2RB8A 1G84A 5M7QA 3SZKC 2B2XL 4EMZA 4ECNA 1TPXC 4MAYC 2OZ4A 1UURA 1MF2H 5CKGA 4L8CA 4QO1A 4XC1H 4YL9A 5L6YL 1CTOA 3NACL 1CG9A 3RURA 3FN3A 4LPXA 5JIPA 5DTFA 3EYFB 4XVSL 1V8HA 1U8KA 4CRPA 5GJSH 4FLHA 2VMCA 1ETZA 2F53D 3DUUA 3L3GB 3QEQA 5JHLA 2YRLA 4MD5A 2XG5B 5J1SC 3O6FA 5K69A 2CO4A 5IG7A 5B8CC 4TUKH 4EXPX 2QT6A 3L1GA 2QQKL 1ZT7A 2VN4A 3L95B 3MV8A 1B0RB 3SCMB 1GHFL 2H2SC 3LN4A 2AI0L 3LRSB 4IHOB 3MBXH 1ZK5A 3EXJA 4H8HA 1A7RH 2AJXL 5C6TL 5JLZB 4UINL 3QB7C 4IRSD 3O3UN 3VFGH 3P4OB 1J1XH 1MFEH 1QYGH 2CG9X 2X53A 4JKKA 4NIYE 2OI9C 5J3HD 2XPGB 4JPWH 3QS3A 5D93B 3A6CH 1U42A 2YAMA 2EDKA 4ZODA 2CKNA 2WLHA 1SHXA 3DROB 5DUMH 1R24B 5C8JA 2Z92A 3T6QC 4OZFH 4Z7OB 1TKWB 1HCVA 3FMGH 1OAUH 5AWNL 2GSIA 3C8DA 3PP3H 4M7ZC 5ACMA 1FNEB 3NAAL 4PJEA 3VGDA 2UX7A 4D0CA 3PXLA 4S1DC 3QQ9C 5KJ7E 2EH8H 2TAAA 5ILTL 1EZVX 2VLRD 5L4JA 4HKZB 1SEBB 2W80C 3CFDB 4NZUL 3T3PE 1DSFL 1LL1A 1XHHA 3U0WH 4E0RB 3CWGA 4K9EH 4XP5H 1E0OB 1XGUB 4ODVL 4XT1C 4UTBL 4LLWB 1NCWH 2ZCLL 1FG9C 5E94A 5HI4D 1M6OB 4GSXA 3I85A 2F19L 5CGYC 4YXHL 4LL4A 5D7JC 4JG1H 4GP5B 3HJEA 3D2TA 3QORA 2IWGA 1PEWA 3X3FL 5HJ3A 4MWFB 4ZAKA 4KKZA 4BK5C 1A14H 1AYOA 2D9CA 5E6UB 4K3EH 1I8IB 4P3DA 3MNZB 3OHXC 3QIUB 1SYVB 1NCAH 5DEGA 4C4KO 1HAUA 1P53A 4YSPA 1NDTA 4D3CL 3EDKA 4DEPC 1MREL 1X7SA 2GI7A 2OMWB 3VI3B 3ZSSA 1IL1A 3PV7A 1SY6A 2K0RA 1BD2A 1TJHH 2NLJA 4HC1L 5A2LH 3STLB 3WNKA 1JTPA 1E4XH 3QCVL 4G72B 2A6DA 2J72A 3Q1SH 4B0MB 4KKCD 3CBRA 1MJUH 4JQVC 4C4UA 1T2QH 2WN2A 4V2BA 1ZLWH 5H4YA 3OLEA 4J12A 4XVUD 5T1MA 1MCCA 2QVIA 4JVWA 1JF1A 5FYJU 4YXKH 3S2AA 5JQ6H 3OC5A 1QSVA 3IN0A 4PJHA 1Z1WA 2J4WH 2AMGA 2Z8RA 2YPLB 4QHKJ 4U1JB 5GGSB 1JSYA 2W95A 1U8OA 2JJSA 3BDYL 3STZA 2Z31A 3VXUE 1P6FA 4HEMA 5E1AB 4YGVB 4JUTA 2ADGB 3SY0B 1QLEH 2LU5A 3JV6A 12E8L 3MLZH 5E1GA 5BNXD 1A47A 4WO4C 4WHYH 3V7AE 2VXTH 3V9CA 4JREC 1YEIL 4FCAA 2A7BA 1DR9A 4JFQA 4JFYB 1VKXA 1OSPL 3QEHA 3FW6A 3UEZA 4AVIA 3CC5B 2PR4L 2HVJB 4FABL 5I8CA 1MHHB 2C1OA 3V0WL 1YY8B 1BBJA 3T9WA 1RK1B 3LB6D 1U8CB 1MJ8H 1SYSB 3FT1A 5KSAB 4ZDHA 2YN5A 4LSSL 2DDQL 4ZMLA 3A24A 1PQZB 2JV6A 4KHXH 2XN9E 1IQDB 1QABA 3FK3A 4HOWA 3D25A 3BP4B 1KELH 1OP4A 2XETA 3GMNA 2OPCA 3OKKA 4HKJB 3KPOA 3WIIL 3FQWA 4WEBH 4UZSA 1F4AA 4PI2A 3BP6A 3QR2A 5EU3B 1QQDA 4M1DH 1HZHL 2FX8L 3QDMD 5BZWA 4XVJH 4IIZA 3KNBA 3IFNL 3ZO0A 1ZTXL 1SLXA 5DJYA 3RWFB 2IIJA 2W0LA 3V95A 3BKJH 1AO7A 4J3OH 2UV3A 3RWIB 4ZW6A 2PXYD 3QFDB 3T4AB 4MA1C 4QJ5B 3OG4B 1MKFA 3LPPA 2F58L 2FK9A 2OCCB 3O4LA 5E6ID 5HYQB 3VRIB 4NM4L 3O6MH 1K2DB 1U8QA 2JCCB 4KU1A 4Z9KB 1RIHH 4G8FA 5C09A 5L0QC 1UA3A 5LVEA 4A2FA 4I1PA 5LQBH 3I2CH 5GRYA 2DBLH 1QTYT 3H7LA 4LVOC 4MJ5A 3DHUA 1PKQE 3QDJB 4MYWB 4ZX3A 2OCJA 2YAFA 4NHCL 2H9GA 3BIKA 4JFEB 5I1LA 2OMZB 3O6LH 3QARA 2GYSA 3ZRFC 3X12A 5BOJA 1JDAA 5E0QA 2HT2C 4IBUA 4G8IA 3U82B 2HA1A 4ZPVA 4FXGC 2Z34A 1NEUA 1MCWM 1RV6X 1JTOA 2WINB 3BH9B 1TR7A 3VG0L 5I1EH 3O11B 1SDAB 3W0WB 3MRNA 4ERSH 1VGEH 4S11A 4GRWE 2VE6B 3JWOL 1F6LL 3NA9L 4I1RA 4Q9QH 1T7WA 3QXDA 3OD3A 2ZX6A 3T8MA 2XXGA 1H8LA 2X89A 4QHUA 3AG3B 5FYJE 4H40A 2O26U 1F4XH 2G4EA 3G9VA 3SKNB 5HYJB 3UX9B 3FTUA 2H0EA 3VXTA 3CG8A 3DVNA 3LH2L 4I13B 5DRNB 3OM3B 3MBEC 4CBPA 1PY9A 1NQBA 3L5JA 1O6SB 2R29A 2GEQA 4JK0D 1S7VA 1AZVA 4QRPE 4Y4FC 2AABL 2ZXBA 2MNWA 2FUTA 3MJ6A 3CFEB 2CJSA 3BP7A 2NW3A 3NJKA 1YEFH 4HFUL 1VFBA 4Y9FA 2LU3A 1AMXA 2V6HA 3JVGC 4XP1L 2FHBA 3ARFD 4Q9RH 1TCRB 5K9QG 4PWFA 3PHSA 3US0A 4FEMA 4EI5B 1ACXA 4AYEC 4PAZA 5C07B 2BZ7A 4L4VA 4Z7QB 2O6FA 4MB5A 4U1KB 2FD6L 2OS7A 1SXNA 4NPYB 2ZWNA 1KB3A 4BH8A 2X4UB 5ID0A 4A6YL 2V5RA 1R3HA 2NOYA 3M7OA 4OJYA 4U1NB 4M02A 1TDQA 4Q0XL 3TV3L 2DKMA 4JFFA 1YEDA 3FUEA 4JHUA 5AL8A 4WI4A 5E8DH 3PWPE 1Z3GL 5IFAL 1QNIA 4C4KT 1UD2A 4WZ9A 5J11C 1KBKA 4R84A 3CFBB 3CMOH 1B6UA 2DMCA 2HVKA 3U6XA 4XP9L 4K3DL 4NI3A 1VAHA 1S7RA 2BNUA 2BRRL 2PWEA 1I3RA 2NDFA 1H8NA 3G5ZA 3NFSL 2GIMA 4HPOL 4XBPB 3GM8A 4HKBA 2D8KA 5DQ9B 5D55A 2WQRA 3I50H 3ARED 2NY7L 5FWRA 1FJ1B 3UROR 4ANVA 4D8OA 2NXYB 3G6JB 1NGWA 5HHOD 4AQAA 2QQLL 4DFIA 4LOFA 4BSWB 3MXWL 4V1DE 1UWEL 3RI5K 2VUKA 3WFBH 4X7EC 3KW7A 4X7CC 2FLRT 3GINA 4BZ1H 1BPLB 1AD9B 3SKJL 2BCMA 3RVWD 3SIKA 4OGZA 5GS0C 3JZYA 2VYRE 3MOQA 5I2IB 3CX5K 4DP4X 4G42B 3EIFA 5CZRA 3RQ3A 1LLAA 5KVGH 4OLXH 3UCRA 3FQUB 4HSCX 4LAQL 5DK0B 3T5WA 2AJVH 5GXBB 1M9SA 4JHZA 4OZ4A 3D5OF 5BRZB 5T33H 1R4XA 4CU8A 2BHZA 1V10A 4UU9B 3GSVA 3IS0X 4XCYB 3KWUA 3SDXF 3OZLA 2MCPL 3MHZA 1FDLL 4HKXB 2LAGB 3OKOA 5F3FA 3N0PB 3RWHB 1MWAB 3QYMA 1FZJA 4ENEC 4Y1AB 2YKLL 1W9XA 5JPMC 4XO3A 3L5XH 5DFVC 4Y5XC 2ZX8A 4X7SL 5B4MD 3LZNA 4PJ7B 7CGTA 1CO1A 1X4XA 2QPUA 1F0LA 2ZT9C 3SBRA 4GW1A 2BMKA 3VTMA 4A68A 4Y4HD 4FHKA 5TDPB 2YD3A 4ZD3H 3HN5A 4L48A 3KYAA 4PV9A 4B53A 4QY8A 2CBQA 3KPRE 4IIQB 4WSJA 1PZAA 1CGVA 3ARDD 3N5AA 4JMXA 3RIKA 3KLKA 1MPAL 2MKLC 4ZFGL 3H0TB 1JHLH 2X4PB 5FX3A 4HWEH 4QHPA 3IAQA 4X7TA 1NCGA 5C0DB 1KXVA 1AQMA 4XN9A 1KYDA 2CCWA 5IHBA 1G9EA 3WTYA 5DVKA 4NSKB 3DPBA 4JZJB 4AKPA 5IB4B 4KJYB 5EO9B 4KX9A 3TEXA 2VDNH 1WIOA 1S9VA 3B5HA 1NGYB 2A4ZA 3QJTB 4XNQA 1CTNA 4K5LA 3RY6C 4BFOA 1V55B 1ASPA 3D4CA 1U91B 4N8VG 1T66C 4K5MA 5DLLA 5FO7A 4NQUA 1IV8A 5AVWB 3CDGB 4MA3B 5FDWB 3LNEA 4NRYB 5SWSA 4L5FL 4WWOA 3MRFB 3OZ9H 5FA3B 3NRQA 4Y2DA 5DUBB 3BP5A 1TETL 4AYMC 3HB3B 4FP8H 4P04A 4KY1L 1IGFH 2GY7B 4PUBH 5ESVA 4XAKE 1R0AL 2XUWA 5IJBC 4A2MA 5AL0A 3VGAB 1FNSH 3EGXB 2QQNH 4NEHB 2NSXA 5LBVA 3BYTA 1U3HA 2ZOLA 1XT5A 4XO9A 4Z3EA 1RP9A 3C5SB 4BFKA 3DTXA 2BSBA 1IGCH 4TQHA 5DRWA 1S5IH 4OGXL 3MVSA 1Y7VA 4ZUTB 4O5LH 3FS9A 3TZVB 4HGWB 2B4CC 1ETJA 2WQ8A 4JFSA 5DVOA 1CXFA 4YIQA 4AGOA 5GS0H 4WU7B 3RAJL 1A4JA 2JH2A 4A39A 1CIDA 2YAOA 3AITA 3DJRA 5CUSH 4FEIA 4NOBA 1UOVA 5H35B 5CGBA 5E8OB 4NQDE 2HH0H 4HS3B 1AZRA 3D2UB 1A3LH 3ZDZE 4PRHA 2ISDA 3SYAA 3D33A 4ANXA 2W60B 1OW0A 5E9AA 4TNEA 5JDSB 1MFCL 5EU4A 1AYRA 4N0FA 4YPGA 3ZL4H 5K39B 2IMNA 1XH3A 3VD1A 1F3JA 5GGRA 4CILA 2YEQA 2P45B 3WCYA 1A66A 1UCBH 1DLHA 3MRPA 4M6AA 2FB4L 1IEBA 3MR9A 3VXSE 1QFOA 4K94L 1KIPB 2YUXA 3VH8B 3U4KA 3QYNA 1CK0L 4NJAH 4Y16A 1KEGL 4D0DA 1A02N 4CUCA 5GGTA 4GSQA 4P2QA 2J5WA 5CJOL 4FXKC 4H1LH 1FCCA 5A2FA 5CCKH 1ZLVK 5JYMA 1JGVH 2QLYA 5HI5D 4U1MB 2FLBT 3IJEB 2VT0A 3OR7B 4JQIL 3PAVA 3RWCA 1PZ5B 4XPTL 5AZ2L 3UYRL 1GAFH 4IBTA 4TTGA 2OZNA 1R3IH 4M61A 4WY7L 1TXKA 2P5WD 1MIEH 1IILE 1RIVH 4PV8B 3ULVF 4PWHA 3HC0A 4I77H 3TYFB 3PWPD 1BG9A 4LAJH 2VW7A 4LE8A 2AW2A 4P59L 3V52L 4ZMXA 2VQTA 5C7XL 4U3SA 2CRMA 2JKXA 3JWNH 5T1LA 1ECZA 3VMOA 1XZ0A 3MREB 3VWKC 4M4RA 3L1OH 2BFGA 4I8DA 5AW1B 2ZG3A 4Q4IA 4XXCA 1OP3H 3U6RA 5EFIB 5C97A 4CU6A 4KDTA 1KJMB 4R4ND 4NX0A 4D8PA 3B3IB 4W9LC 1MF2L 2K3HA 5GHWL 1N6VA 3HS0C 5GSVB 1J0KA 2G2RB 1A6PA 2YXMA 4F8NA 2W0FB 3ILPA 3L4TA 2EE6A 2W94A 1IEAB 1XEUA 2GHWB 3CFCH 4JHAL 5HGHA 1KIQA 5SV4A 3GDCA 3VFPB 4AYDC 3R1GL 2E9IA 4FQJH 3FFCA 3P3YA 3MX0B 2W07A 4NCDA 4LFHG 5JOEA 1IGJB 5E1QA 3OLDA 4L1TA 1RMFH 4DPCX 2WN3A 2QV2A 4NXKA 3ARUA 3GB7B 3PWVA 3H9ZA 2X0WA 4MB4A 2VDPH 2WCSA 4Y8DC 1CE6B 2ERJB 2X0UA 5CMAB 3NJJA 2WLZA 4F57H 4UYQA 1WSST 1OPGL 5EC2B 4DP5X 3MBXL 4E9LA 2V3EA 2E0PA 3LTVA 2VITB 2H5UA 5EOCH 3TBBA 1A7RL 1QVOB 4HFWA 2PO6B 4GRLB 3FDWA 3IRPX 2XWTB 3HHRB 3VFGL 2ICCA 4CVWA 1J1XL 3IDGA 1QYGL 2B4CH 1SHMA 3OKEB 4FQLL 4MAYA 4YZFF 5DO2D 2VMEA 5AUMA 4ZFFA 3KPNB 4FKKA 4O2EB 3A6CL 5FLUA 5LGYA 3TCLB 2ESVB 4FCHA 4M29A 4QXTB 5DUML 3VWJB 3VXQB 1TJIH 1XGTA 4FFZA 1O0VA 3HZMB 5FGSA 1OAUL 2DLHA 2X3AA 4PWGA 3SGEI 3ZR5A 1M7IA 1Y18A 1ZE3C 2C1PA 5DRXB 4IK7A 3ET9F 1RPKA 2IOMA 2XVGA 4NBYB 2LW3A 2EH8L 5B8CA 3Q06A 2JQZA 3D3VA 2ZX5A 1NLDH 4GW4B 4UM9D 3C12A 1X5HA 2G75B 5IKCB 1RLWA 3MO1B 4Q74A 3CDZA 2JB5H 4XMWA 3QXAA 4YDMA 3NSJA 5IFJB 4CNIB 4K9EL 3MLVL 4XP5L 1KYAA 2R27A 1IGMH 1NCWL 4DPBX 5DD1H 5G4NA 4LQ1A 3NBNA