4IKNA

Crystal structure of adaptor protein complex 3 (ap-3) mu3a subunit c-terminal domain, in complex with a sorting peptide from tgn38
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
255
structure length
249
Chain Sequence
FIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHNISFSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQKLPSLKGLVNLQSGPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-3 complex subunit mu-1
publication title Structural basis for the recognition of tyrosine-based sorting signals by the mu 3A subunit of the AP-3 adaptor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 52
structure length 249
sequence length 255
ec nomenclature
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iknA01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iknA02
4IKNA 4EN2A 3H85A 5FPIA 2BP5M 2JKRM 4EMZA 2PR9A 2VGLM 1H6EA 1BW8A 1BXXA 2JKTM 1HESA 4UQIM 4MDRA 1I31A 5C7ZA 3L81A
chains in the Genus database with same CATH superfamily
4F33B 3V4PA 4P23C 4HWEH 4ZQTA 4YO0B 1RJYA 4PBWD 5HGBA 2Y9RT 3GJEB 2P26A 4DN4H 2B5IC 1DQLL 1OF2A 5I17A 1SNRA 3VFSA 4RGND 3FHQA 4YHYC 3PHOB 1KWGA 1E5UI 3FCTB 1DBJH 1F8TH 1PF3A 4D0DA 5CD5D 2AXHA 3LKPA 4MXWL 1DZBA 5E9NA 2BY2A 3SE4C 2DQDH 5BZXA 1T20B 4PJHB 3SOTA 4P04A 3APDA 1L0XA 1HWWA 1QFUL 2HG5A 3O3EB 5L2KE 1FG2B 3MRRA 3CHXA 1J1OL 2OZ4L 3ULSA 2XBTA 4UM8A 5GGUB 3HCVB 4L9DA 2EICA 5CWSA 1OV8A 4PIRF 4IKKA 4LRNH 4OFKA 4JG1L 4HEMA 2IPUK 2YXWA 1N8ZB 2XACC 4QAWA 1MFVA 5FO7A 1J0IA 1KLGB 1O5PA 5EUOB 2WQUA 1JK9B 2O6FA 2NY7H 3BPLC 1E2WA 5HYQA 4F7EB 3O8XA 4Q8BA 3UZEA 3ASOB 1PAZA 3WJMA 4K7PL 5CD3B 1T3FB 3GSNL 1SXSA 3MOBL 1NGQL 1HILB 5AWNL 5D2NE 2FX9L 1U8CB 2J44A 1YJDL 4CILA 5AVRB 4XNQB 1RUAL 2P5WA 1JZ4A 5KANI 2VDMH 5F6HJ 5JDJA 1FC2D 3OF6A 2CJSA 1MFDL 1JPSH 4NZTH 1NGYA 4ONGL 3OLGA 1J11A 4CSPA 1BVZA 1TPXC 3ZKMD 1BZEA 3OHMB 2BSBA 1O9VA 4DVRH 5AZEL 1I7ZB 2Q3ZA 4Y4KB 1SQMA 3ZX1A 3GFUA 2C1OA 1XIWB 4ZSOB 4XC3H 1I31A 3VXRD 2AJUH 5D7KD 3PNWB 2NSQA 3B9KA 3LH8A 4UM9D 3VXOB 3QBTB 1MUJA 3ELAT 2E0PA 4XE5B 1M2OA 3QIWD 3RWIA 3LQAL 4P3CL 1FIEA 4JDEA 2EH7L 4XOEA 1MCLA 2JK5A 1AQKH 2XU9A 4TPRL 5F0MB 3SKUD 2VSKB 5FECA 5DJXA 1VSCA 3CN1A 5CEXB 1LO2H 1U3ZA 1SJVA 1UM6L 4PB0L 1S7QA 3GIVB 2F7PA 3QJUB 1ZHBB 4XE0A 5D1XE 1ML0A 2WTRA 1TMQA 4RAVA 5JZ7C 3MX0A 5C86A 3NA9H 4F15B 32C2B 3ATFA 1E6JH 3RTQD 3U6XS 3MRNA 3QORC 3G5WA 2BOBA 2V2WA 2MTAA 2V3EA 3EG9B 5FYJU 2OCJA 2JKRM 3WUWG 2PR9A 2DJSA 3ALXA 1R5WB 4MB5A 3ZRFC 4M5TA 2EEDA 4JG9A 1FFPA 4JRWA 1G9NL 5LCVH 3W82A 4D0CA 2APBA 3X2QB 3MYJB 2WQAA 3IETA 3WKML 1IRAY 1MPAL 4S11A 5TTRA 4GO9A 3BVUA 5CJOL 1RP9A 1ERNA 1ZLVH 3TM6A 3HHRB 5A2LH 1ADWA 3NP3A 1ZV9A 2O5XL 4IBLT 4S2SA 3NH7H 2B4CH 1TQSA 3DRTB 1BF5A 1N5AB 1OAYL 1NDGB 2QFRA 3QR2A 1IGIL 1KXTB 3RL2B 1MREL 1UXMA 4C58B 1BXUA 1MVUA 4HK0A 4Y1AE 4ZPVB 3VGAB 2BERA 4WLCA 1LD9B 4D9RE 1BEYH 2YUVA 3D69A 4NKDB 2ODIA 4JREC 5E6ZA 4ENZA 2Y3AA 5HP5A 2JI3A 2NZ9C 3ZXAC 1ROCA 2O5ZL 3PAYA 1VADA 1BVLB 2XZAH 4KY1L 4ZXBB 1EVTC 1S9XB 1PD6A 2APTA 3QDHA 4HMCA 3RIAK 4ZMQA 2A9BA 5EDXA 1MLCB 2ADJA 4BH8B 5IEKA 2J12B 1PEWA 4PJ7E 4Y5VB 2Q6WA 1TJIH 3WFBH 4Q0XH 2WLZA 4JKPH 3MSPA 2Z9TA 3R18A 2C9RA 2IH1B 4PLJD 2H26B 5DURD 1UD5A 4PJDA 1K5NA 1FO0L 2RAMA 5E94B 2HJLA 3ZE2E 3IMBA 1KN2H 2FO1A 5JIDA 3CCHA 5KTEH 1ES0B 1U93B 3AFLA 3BAXA 4KXCA 3WJLA 1OXYA 5EZJA 4FHBD 4KMTH 4F8PA 1SHWA 2IBGA 4JUSA 4TM9A 2X6MA 2JCCA 1Y6KR 2JKTM 3FRPA 4Z18A 1YY9D 1HNGA 2Q76B 3V4VB 5BUGA 1ZV5A 2BCKA 4FULA 4X9GA 5AG9A 4HPOL 3L1OH 3ULUL 4IJ3C 1LO0H 2H3NA 2VYRE 2Z1KA 1UD3A 1X4YA 3ARVA 3NIGE 2XRAH 3EYSH 2YBRA 1XGTB 4HKXA 2O72A 3BZ4A 4RA0C 1R19A 1SHXA 3EYUL 4Y5XC 4FXGA 1MHHB 1UWEH 2WCSA 5B38B 2GPZA 3ZYJA 2BIHA 3FUDA 2V7NB 4PGBB 2B08A 3UTSE 1TXKA 1D9KD 4AEEA 3D4YA 5IHHA 1BPLB 2DM2A 5FB8A 1SJMA 4MCYA 1YG9A 2O5NA 1BAFH 1G7IB 2A4ZA 3BSGA 3GSOA 3S5LG 4B3VA 1FNHA 1QTSA 1NGZA 2FYYB 3OGCB 4OLZL 4QHLA 4WDIA 5D5MB 2X05A 4IU3B 3WG7B 1E9OA 1NKOA 2ZWNA 1W0WA 4HIXH 1NDMA 3CFIC 3EJUA 5SV3A 4NBZB 3ZDZF 1DBAH 1E42A 4GT0A 2V5TA 2UZYB 3FU0A 4HGWB 1AGCA 1WWWX 4J3OF 5B8CC 2XXGA 5FK9B 4MDJA 3LHPH 8FABA 3N1GC 5HJGA 4JR9L 4M5SA 1IE4A 4ADIA 1KCUH 2QSCH 2KPWA 3MV8E 1XH1A 4ONHA 1QLEL 3GD1C 2ZE0A 1BZ8A 1KELL 4R2GD 3RPKA 4FL4C 4ZOEA 4D8PA 4P23B 1IVTA 3KPQA 3CSGA 1U8OB 4Y16A 3ULUD 1QLFA 1BIHA 1YNTA 2JI1A 3CVHB 2W60B 5DC2A 5BZDB 3DUUB 4R4FH 3LNEA 2AQ2A 3SCMD 2B5IB 2QEJA 1BQHG 3HNSH 4JDTH 4YHYB 5IHWA 3BQUC 1HSAB 5JPNC 3QIBD 1UA6H 3VNYA 4MLIA 4PJEB 3HN3A 5GPRA 3S3BB 1G9ML 1WFIA 4G59C 2K7PA 3W11D 1KJ3L 2VDNH 4HJJH 3SYOA 2CLZB 2R7EA 3WLWD 4YGVA 3P1VA 5D7LA 4OW6A 2F08A 4J3SA 4LEEA 4DP7X 1OAQL 4DETA 3I3EA 1CIUA 1U8QB 5BO0D 4NQQA 1NM4A 4TSCL 3RGBA 2EIKB 4D94A 3HZ3A 4P46D 2VN6A 1PGRB 5B1KA 2PCFB 3TNNB 5IW1B 4ZODA 1AZRA 3RAJH 2I7SA 5E1AB 4Q52A 4V2CB 1MHPL 5AENA 3BPLB 2HTKC 2Y6SD 3MV7E 4N2AA 3CFKA 5FGRA 4EE2A 4XVJL 4YSDA 3O9WA 4BK4A 5C6WH 5KVEL 4ODSH 1YEWA 4PJAB 1P69B 3THMH 4CMMA 3IU3B 3RLSA 1EIBA 4LASH 4HWZB 1R4XA 2AEPH 2B4CC 3GGWB 4ZZFA 1QZ1A 3BP6A 4LPCA 3K5RA 3LZPA 1OGTB 1R3LB 3LNGA 3MV01 4GO6B 3GMLB 5EU6D 2CGYA 1S4IA 4JKNA 3ZHDA 5B3SB 3MCYA 1TPXB 1CD9B 4HMDA 1B6DA 1WZKA 5BMFL 3HUJB 4QO1A 3CE1A 1OCZB 4R7DB 5D1XC 5DLMH 3IPFA 4X5PA 5E1IA 4PY7B 4L3EA 4IBZA 4N2DA 4DIXA 2OA9A 3LPWA 1RU9H 4ZG1A 1XGRB 3MBWB 3V0AC 5CHNA 3GUTB 3H8NA 1UA7A 2XFXA 4K3EL 2DLGA 4BZ2H 1MJ8L 4XGZA 4ZQKA 1LTXA 2FT8A 5T3XL 1X5XA 3ZO9A 1PZ2A 3I9AA 4BKLB 4IQHA 1JGUL 1NCGA 5FWRA 3QRLA 1OE3A 5E99L 1FC1A 1QRNA 5FHAH 3E8VA 5FO8B 3Q8BA 4LLVB 4PJXA 1RULH 3DVNA 4W4NA 4X7DC 4XHQA 5EBGA 1OSZB 5EO9B 4FA7B 3D6GA 4ZOAA 2J71A 4JGNA 3BCFA 5I76A 2R56L 2KLTA 3QISA 3F64A 1FVCB 3GK8H 4E9YA 1LQBC 1NUDA 4UBDD 1DR9A 2FATL 1FFNA 1M1XA 5AOLA 5F6HI 1F3RB 3UAEA 1QO3A 4WY7H 3GJFK 3H54A 1D7BA 4HWUA 3RGVA 3JXAA 1D7FA 4AEFA 2HVBA 2H1LM 4OZIA 3RX8A 1AKJA 3QORB 1FORL 2HVJA 3KBFA 4FNRA 3T2LA 3WV0A 5BV7C 5DJ2B 3RVWD 2YXVA 4MNQA 1L9RA 5EBMB 4Z7VF 1HXMB 1Q8MA 4PJ5D 3V0DA 3F05A 3QCTH 3VFOA 1D6EA 2Y7QB 1HHIA 4A66A 1LM8V 1MXDA 4V2BA 4HULB 4YX2H 5JNYB 4XI5D 4L18A 4YNYB 2V0AA 4P9HL 2CCVA 4URKA 5LG1A 1N59A 1A0QH 4PGDB 3ZDYB 3O6KH 1KCSL 1TKWB 3FO1B 4KTDH 3ARED 2LU3A 5LVEA 4ONFH 1A7BA 4OCSL 1KEML 5DS2A 5SWSB 3KYKL 3SPHA 4MMXA 3TVMA 2ITDB 5T3XD 5J6HB 3IDIB 2ZWKA 1DFBL 2WWNA 3T6XA 4DP1X 1NWPA 4GSDH 5I1HL 3MJ8A 1U58B 5IBLD 1YUKB 1GOFA 4RMQA 4JREB 4LSPH 1OAUH 3HG1E 1RUPH 1JGEA 5E6YA 3P2BA 1O9WA 4PS4L 3PJSA 2R4RH 4GMSH 2UWEA 2D7PA 4N8UA 5FYKE 4YL9A 1ZVNA 3HC2A 5F9AC 4AKQA 2R0WL 3LKNB 1JWSB 4YSPA 1H6UA 2HFFB 5HHOE 4X4YB 4W9KC 1XSKA 1QI5A 5D96B 43C9A 1WT5A 1HZKA 4PRPA 2D7OA 2GITB 1G7JA 3AXLB 1S8DA 4XCYA 1MJ7H 3UMNA 4U1JB 2F53D 4F2MB 5L0QC 5D1QD 4YJZL 3H3BC 2CDFB 3UDWC 1NFDA 4QRUB 3S36X 1EZVY 1CBJA 4KMLB 1GGCL 1N70A 2CG9X 2BNQD 1CFQB 3Q13A 1TZHB 4L4VD 2MCPH 3FN0H 4IJ3B 2XZQH 4TV3A 5EU7C 3ZYZA 3FO9A 4JZNA 5J9PB 4ECNA 3NZSA 1AGFA 1FIGH 1KBPA 4XPBL 1WK0A 2R1WB 2P5EB 4Y5XB 4NQCD 4XMZA 4Z7QB 2VXVL 2BNRD 4G6AC 3LKRB 2FVNA 4A2MA 3GLDA 3H7BB 4AEIL 1TTUA 2C8NA 3BUYA 4GBXC 1KIRB 2JLLA 2YA0A 4ABUA 5I0ZA 5A16B 2I26N 3B2UD 3K6FA 1W6LA 3C5SB 4G72B 3Q05A 3RYMA 3SO5A 5F7KC 4F33A 2MQGA 3DTDA 3D48R 4H8PA 4YO0A 1DCLA 1X7TA 3KPLB 3QFJD 1U4EA 4JPIA 4G7SB 1NTDA 4ZT1A 3U7YL 2WINB 4KX9A 3BWSA 1XGPB 2LV4A 5B8CB 3MJWA 4OF3A 5I75C 4PCYA 4JRXE 2GJ6D 3PHOA 4FQXB 4PJFE 4PRIB 3TJEH 4RZCA 1NEZB 1KBWA 6PCYA 1Y1UA 3CUPB 3VXUA 3P4MA 4TSAH 5BXFA 5L2KB 5TK2A 1YEJH 1HCVA 1T20A 4PJHA 3X12B 3OZ9L 3O3EA 2QGCA 2ZUSA 1FG2A 4ZUWB 3RE0A 3W0WD 4FL4B 1QHQA 2KLRA 1FWXA 3KPMB 4YXHL 3HCVA 1CD1B 5KSBF 3WTYA 5HHVL 1CYGA 3L08A 5CJQH 3ARSA 3ZIMA 2GIYA 1N8ZA 1MH5A 3CBKB 1VGEH 3NK3A 1KLGA 1EEYB 3ME0B 4J12A 5EUOA 5CEZL 3BQUB 4MTMA 5JW5B 4QYOB 5D6CB 5JPNB 5CKGA 4L1SA 3NSCA 4NI6A 3QK0A 4FQQB 2O6CA 3Q48A 4W9FC 1P6AB 3FT4A 1T2QL 2MH4A 5CD3A 1T3FA 2Z7WA 3R06B 1ZTXE 5LBSH 3CZEA 1HILA 2PYFB 4GQRA 3C5JB 3N42B 1U8CA 1OPOA 1H6FA 1KTLB 4KX8A 4P5TD 4N8CH 2IDFA 5D7IA 1I4FB 4JQIH 5ESAB 2A6IA 4HWNA 4XWOC 4Z9KB 4DQOH 4QRPB 3QWRA 3HFMH 1SDAB 1GR7A 4M6OL 4HISA 5JW4M 5F7FA 2ZWYA 4ZX3A 2X40A 1I7ZA 3TFKD 1YEKL 4F1ZA 4IRJD 4Y4KA 3ZHNA 1XXFC 3ZT6A 2BXYA 2W0FB 1QG3A 2VXTL 3N41B 4ZSOA 2WLLA 1KJ2H 2MOVA 2RIKA 5F9JA 4XZUA 2ERJB 2FJGB 1A25A 3Q5YA 4HJ0D 1KB9K 3VXOA 1T2XA 4JFEE 4LOEA 2IJ0C 4TUKH 4M8VA 1OCWH 5KS9A 4NZUH 1TEYA 2HH0H 1OKEA 1QEWA 4YC2C 4GRWF 4G70B 3DYOA 2DQEL 3G6JF 4ZOBA 4G82A 1LK2B 4H0LC 1OT2A 5I1CH 4BK5C 3IGKA 5CEZD 1HS6A 3D52A 2AQNA 3BIKA 1PG7X 4ODHL 4RVBA 5DJDB 5CEXA 1LE5A 5K39B 1ZT7A 5D1XB 4M5ZH 2CA3A 4NUQA 3GIVA 4GI6A 1NH6A 1F4WL 4WUKH 3MLUH 3QYMA 1ZHBA 2RQ8A 3MLWL 3RWGB 4FKEA 4KO6A 4KV5E 4Z95L 1XH0A 1YHPA 2RHEA 1KGCE 4XN4A 1MQKL 3HNVH 1J9TA 4APQA 4WNJA 4ZFFB 2YARA 1NIDA 3BRDA 4OIIL 2ZJSH 4UCFA 1KYOK 1TF4A 3HMXH 4GKSA 4N8VG 4XXWC 3SDDB 1R5WA 2WO4A 4XCNA 1K4DB 2R27A 5I19L 3UPCA 2NW3B 2XV3A 4M3JA 5AW6B 3QUZD 3VFTA 2VW7A 3QE5A 4AK2A 2D2OA 2VCOA 2Z7UA 4MX7B 3EKCA 4AYID 3WY1A 4HZLB 3QDJE 3TA4D 4CBPA 4QRSB 5EF2A 1HXKA 1R17A 3DRTA 3LB6C 5CGBA 5BV7B 2YLHA 3D0LB 2KUTA 1ASOA 5AB0A 4NPYB 4W9JC 3RL2A 3P4NB 1QEXA 1F4YL 5L8LB 1JK8B 5KBDA 2DMKA 1JGVL 1LD9A 3Q8AA 4NKDA 3WN5C 2Q8BH 2E74C 3N1PC 4ZUUB 1J8HD 1FBIL 3EO9H 1J0ZA 4PJ7B 1BVLA 3ARYA 1S9XA 3GO1L 2EIJB 4BH8A 4BWWA 4KVPA 2FHBA 5FDWB 4WTZG 2PKDA 3VGGA 4X0NA 5EUOF 1G7QB 3ZE2B 2IH1A 2P3YA 2WXFA 3KH4A 2ARJQ 1N3NA 1REIA 4J2QA 3VDBA 5IB4B 4MXQC 2EILB 1OTSD 3SE3C 2LE9A 1EBPA 3EH5B 4KXZI 1OCCB 4TF4A 1T7VA 3OHXC 5AZ2H 3LRKA 1ES0A 5BRZE 1AHWC 5KVDH 4N2EA 5F0LB 3KLKA 3TWYA 1JNNL 5C92A 1H0DB 1EPFA 4FC3E 5CSGA 1SF3A 2UYLA 2DDQL 5EOQL 1DQLH 1P7KA 2RGSA 3GF8A 1XGTA 1V27A 3RNQA 3TBSA 1TZOA 2CA4A 2EKJA 4MXWH 5DO2C 4NQDE 4X5QA 5I8EA 3OKNB 1MHHA 2VLJD 4DP2X 4PGBA 4JO2L 5DO8A 5L0QB 2NCEA 4BINA 1QFUH 2VDNB 5DHVH 3ABZA 3SDCD 4NUJA 2WXNA 1J1OH 3OZLA 2OZ4H 2ED9A 2VGLM 1NGPL 1NCDL 1PCXA 3TWCL 3QEQA 1SBBA 1G7IA 3QZNA 2BP8B 3P0VL 5AKRA 3FULA 3HEIB 3DI2B 1KZYA 2PCXA 5D5MA 3F83A 4J3XA 4JG1H 2H6PA 3UGXA 5I2IB 2AP2A 3NABL 2H4EA 4B9GA 2X6CA 1KG0B 3LZOA 2KDGA 3DYPA 1RIVL 1A1OB 3RIKA 3MPCA 4TNVK 1EV2E 3PPEA 2UZYA 4HGWA 3BH9B 4OZGA 2NXZD 2VR8A 2KKQA 1DVTA 3MV8B 4K7PH 3N40P 1AH1A 4GUOA 3GSNH 3TO4D 3MOBH 1NGQH 5AWNH 2FX9H 1YJDH 2VMJA 2C26A 4FNQA 1QQDB 2DQJL 3D34A 4N90D 2J1YA 5EIQA 4DERA 3MRDB 4DEUA 4P23A 1U8OA 1MFDH 2FEDD 4ONGH 3S35L 4GP8B 1ZHLB 1WCBB 4MASA 5BZDA 3DUUA 5DZNA 2K70A 5E9DD 4GFXA 5AZEH 5I75B 1HE7A 2MJWA 1SEBB 3O2DA 4GUCA 3FQXB 4HD5A 4XTRD 3CSFA 2V2XB 5ICYB 1DO5A 2EEFA 4PJEA 3G5XB 3SE4A 1CD8A 2EUZA 2AW2A 5B7FA 4U3CA 3ZTJH 2BP0B 2DLEA 3CNKA 3MJ6A 2DQ6A 2Y2WA 3MUHL 4UQ9A 1BP3B 1I7UA 3P9LB 3RDTA 4P3CH 4U1MB 3RVUD 4AKPA 4WUUE 1U8QA 2X3CA 4KOBA 4NPKA 2EH7H 3T4AC 1I8KB 4TPRH 5AVZB 2EVGA 4XMXA 2W0LA 3MV7B 2I24N 4ESKA 2BW5A 1UM6H 2P80A 4PB0H 3TNNA 3QT2A 2Q7YB 5CFAA 1YN6B 3T3PF 4L3FA 5E1AA 5KJ4A 3QW9A 3WEMA 4HWBL 1PZ5B 5AAMC 5C3LD 3P11L 5HHQB 1QFPA 4PJAA 3RG1C 5ANME 1J0HA 1IAIL 3AROA 4RGNC 1JHLL 1Q0XL 4HWZA 4HJUA 3IMUA 2X87A 3DUHA 4NQUA 5HVHC 3GGWA 4NAQA 3LEXA 1OGTA 2E7CA 2G3NA 4OFYA 2ZICA 3CFUA 3GMLA 3G5ZB 1GOGA 2ZOTA 1G9NH 2ISDA 4LZKA 4ZMPA 3MOAL 2A83B 4UIMB 4JM0A 1MPAH 1I9JL 5CJOH 1I1YA 4IKIA 1F4AA 3HUJA 4R7DA 4N0CD 3MJ9A 3RWFB 1I8LC 2O5XH 4PY7A 4HCIA 1IKNC 4Y2DD 4GXVL 1CL7I 3Q1SL 4OLWL 2YA2A 5F7EL 1OAYH 4EI5A 3GUTA 2Y7SA 3ARQA 1FNGA 1CWVA 1M7DB 4FKKA 3I84A 1Q9KB 3VGEA 4QWWC 1IGIH 1DEEB 1QASA 1MREH 2P8PB 1BHGA 3ESUF 1AHMA 4YC2B 4BKLA 2XV0A 1AACA 2XN1A 1OO2A 2C9XA 3N43B 2O5ZH 5E51A 5EO9A 4KY1H 2DMGA 1N26A 3D2UD 3QXAA 3LCYA 4PBVC 4ERSL 4L29B 2V7HB 4FJYA 1FVCA 4YHIB 1CLYL 1QSFB 2PWGA 3V8CA 2G3XA 3VJ6B 2BFVL 3U4AA 2B20A 1B0GB 4MS8D 5TDOB 2CBOA 3ZKMC 1MY7A 2N4IA 3ZO0A 4JRLA 5I73C 4LKXB 2RB8A 3QORA 3PY9A 4NQTA 2BDNL 5EBWB 3QRGL 1RIHL 5K1JA 4EXPX 1SXZA 3LS5L 2XV6B 3SYPA 3D09A 3GM8A 3OBAA 5DJ2A 5IFHL 5IHBA 4XBPB 1V5JA 3EOBB 1HXMA 1Z3GL 2PF6A 3WHE1 1Q72L 5CINL 5F1NA 2Y7QA 1ZHNA 5F44A 5JNYA 3OKYA 1G6VK 3VI3E 4HPOH 3U7WL 4LMQI 2OMWB 4QHMB 4RRPG 3ULUH 2F68X 5CZVL 1IM9B 1EZVX 2OCFD 4PGDA 5E4EC 1FGVL 1U42A 1U8NB 3ZU8A 2E6JA 2ZOWA 1TKWA 3AW5A 3FO1A 4LCYB 3U83A 4ZX5A 4ZW5A 5JPMA 3BXNB 3EYUH 1CFMA 3F85A 4BSWB 4QRRA 3DHJA 1UTDA 5SWSA 3VWJC 2ITDA 3WUWB 1BAWA 2AV7B 1XSIA 2ZP9A 3QDGE 2IAAC 3ASWA 3IDIA 1D7DA 4IW4C 3DRQA 1I1RA 1E40A 3HG1B 2WQRA 2NZIA 5DZJA 4P2RD 5C9KA 1YJDC 2DEXX 3QAZB 4OLZH 3WN5B 1BF2A 3KS0H 3WKNA 3U0TA 3CN4A 5HHOB 3QGVA 4FQ2L 5BQ7A 2XCMC 4HQQH 2YS4A 4Z0XB 1E3XA 5E8OB 3LKNA 1PKQA 1LO5A 3KD4A 3AXHA 2HFFA 3DHUA 1S46A 4GXUM 2D0HA 4JR9H 4PJBE 2OTWB 1YMMB 3AAZB 4UNIA 4OV5B 1F00I 3AXLA 5HTSA 1GZPB 3OHXB 3P30L 1OLZA 4U1JA 1NDTA 1QLEH 5IQNA 4F2MA 5KVEE 2CDFA 4GMTL 1KELH 3QHFL 1UT2A 4PD4J 1GY2A 1XAKA 4JPSA 4J27A 1CFQA 4M1GL 4NNXA 3LQAC 1EBAA 1EGJL 1TZHA 3CLFL 1TO4A 1Z6JT 3QI9D 3LIZL 4OGYL 1AD0A 3C5ZB 3AG2B 4KROD 3H42L 2R1WA 4Y5XA 2P5EA 1DVQA 4YUEL 1G9MH 1KJ3H 4TVPD 1EAJA 1GMIA 4IRSB 4KFMA 4LP4A 1MFNA 3CFCL 5FS5A 1P5UC 3UO1L 2QGEA 3FN3A 4U6HB 4N1HB 3ZL2A 3A5VA 2X4TB 2BY0A 1NAMB 2LVEA 1BXAA 4LLWB 5GGSB 1OAQH 4ZDHB 3G9VA 3MRGB 5A16A 3JWOC 3C5SA 4TSCH 3PGCA 4GQ9L 2IV9A 1KB5B 5EO0A 1A21A 2AZAA 5DA4A 4FFZL 4HX1B 4IGBD 3VWKB 1OTUD 5ID0B 1KFGA 3KPLA 1SY6L 3L9EA 4OJYA 2E7BA 1G9NC 4PJFB 4KI5E 1MHPH 4K94C 4RFEB 3UBGA 1YY9C 1XGPA 1FHGA 3J27A 2WV3A 4LNVA 5B8CA 4XVJH 5IMMA 5DJZA 4PRIA 4MD5A 5D4HA 2Y0SA 2FRGP 2FLBT 1NEZA 4XR8C 3WGUB 2ZPKL 3CUPA 4U49A 2X1XR 3MRCB 7PAZA 1EFQA 5LKNA 2GY5A 3S5LB 5L2KA 2VLRE 4YDJB 3I9GL 3X12A 1TQWA 1LMKA 3S8GB 5CCJA 4KTGA 3CLWA 5TK4A 4YSEA 4NFBA 5F88B 2V5RA 1D9KC 1TJHL 1EZLA 3KPMA 4B7IA 1CD1A 5CUSL 4OI8A 4OFDA 3I74A 1WS7A 1LYQA 4JE4B 2B2XL 5BMFH 4OF7A 3IXTB 3KLQA 3UJJL 3RI5F 1EEYA 1FLTX 3N9GL 2IPTL 4QAMB 4MQXD 5D6CA 5JPNA 3CFNA 3N06B 2CHWA 4FQQA 2AXFB 3ZDYF 2LR4A 3VUAA 2Y7MA 4K3EH 1MJ8H 4ZFQA 1EJFA 4PRHE 3ZTNL 4QOKD 5T3XH 4B50A 3FFCA 3HG2A 3PL6C 5I6OA 4P57A 4WI9A 4QTHA 1DSYA 1KXHA 3VX1A 4MMYB 1JGUH 1KTLA 4JK0D 4Y19B 3T4AB 1WA2X 5I71C 1F86A 5FW6A 1BQHB 3BH8B 4HFUL 3UTPD 1MEXL 5MERB 2PO6C 2P7TB 3CFJB 4QRPA 2R51A 4UUJB 2R56H 1ZLWK 5C71A 3CSTA 2OYPA 2QZQA 4G9FE 3VXMA 2FATH 2Z3FA 5IVXA 2BW4A 3B7RL 3BWUF 2WBJD 1CBVL 5J0BA 4AGLA 3LDBC 4YSOA 4F8NA 5CCKL 1DBBL 4PJ6A 4X4MA 3SCMC 2GEEA 2QQLL 5KYYB 4ZMWA 5MENE 3KPSE 1FORH 1ORSB 2HWZL 2W0FA 4RGNB 4FEIA 4HOMA 3QIBC 5HGDB 1X4XA 4HCRL 5HVHB 2RH0A 2WQSA 3W11C 1RZJL 4LT7A 3WLWC 4NFCA 1G5AA 5T8IA 5D1ZD 2VLLA 3ZR5A 1P1ZB 2L3BA 1LNUB 4KZDL 1F3DJ 1S3KL 5DJDA 1IBHA 1SN5A 5IBUG 2IH9A 5HBBA 1WAAE 5D1XA 1KCSH 1L9SA 1Q9OB 4P46C 3FU5A 3RWGA 4OCSH 1E2ZA 1KEMH 4JDZB 3KYKH 4PI0A 2Y6SC 4JM2D 5FM8A 4EVNB 1DFBH 4N24A 4NO2B 2Z64C 5EA0L 4RIRA 5I1HH 4O2CB 3UYPB 2LTQC 2VM9A 4ZFFA 4ADGA 1BM3L 2LT9A 2NYKA 3KL3A 5D93B 5AD0B 3SY0A 3LKSB 4PS4H 3B3BA 1K4DA 5I23A 1BREA 4G3YL 3TCLA 2WB1A 3EGSB 1VA9A 3UERA 2NW3A 2VLKD 5T5FL 2R0WH 3V0EA 3QDJB 1A8ZA 2J3SA 5I82A 5C0EB 1MNUL 5GSVB 1M7XA 4NKOA 4N1EA 2NSXA 1P5VB 2C9VA 1TETL 1S7RA 2BIPA 1IIIA 4NKQB 5I73B 2F8XC 2AJYL 2R15A 4QRSA 3ZTDC 2EUWA 1AYRA 1BWMA 1KYFA 1G9MC 1G94A 2X88A 2HXAA 5J4MA 1CFNB 2C9UA 2WQWA 5HYJD 1GGCH 3OJDB 3P4NA 1KXQE 3CX5J 4WJ5B 2FO8A 1JK8A 4Z8FL 4XVTL 4YE0A 1HU8A 3VDAA 3PQYD 2I9LB 1CF1A 4CADB 1CFBA 1XTMA 3QJZA 2DIBA 1OAXL 2BOLA 3ZIYA 3IDNB 1BQKA 4CDGC 2HRGA 1LP9F 5E4EB 4GW1B 1A6UL 1UA3A 3MRPA 3MRQA 4Q6YA 3QUML 1M3JA 2E9GA 4XPBH 1AXSB 1XR9B 3G04A 2HTLD 2W88A 1KPUB 2VXVH 3HZKB 1G7QA 4M8RA 4M02A 2KBGA 3VWJB 5C1MB 1CG9A 5FYLE 5BVJA 2YAPA 1I9IL 4U1NA 1WEJL 3ARFD 5DQ9B 5IB4A 5BRZB 4AEIH 2XY1A 4LRIA 2VIRA 2Y5QA 4HUXB 4N0YL 1Q4NX 3GSNB 2A6JB 1RJZB 2W59A 3CFEA 5CN2A 4HK3N 3DX6B 4JFUA 4B53A 1IEBA 2J1WA 1R34A 1GCFA 3D12B 4LLMB 5DTFB 4FABL 5FO2A 2DQHL 2D31B 4HUUA 1PYWB 2WQVA 3KWXA 3RVWC 4UTAL 1U33A 2IBZX 5IUCA 2K6YA 2WLYA 2UXVA 3CN3A 2G5RA 3K2MC 2AF2A 1LEIB 5FAAA 2FB4L 3BUIA 4L23A 4K9JA 4BQ6A 3IS0X 1UWFA 4NQDB 5I18L 5DFVD 4FMVA 4CU8A 1MFEL 4OUUA 2GT9A 2X41A 3L4YA 4JPKH 1DJSA 4DGUA 2IAMD 3ULAB 5ISZE 3OZ9H 2DB8A 2ZNWA 4OGXL 4ZRGA 2P47B 2XG4B 3UDWA 1VFOA 3NEEA 3EF4A 3TO2A 3DBXB 4YXHH 2BP8A 4HUNB 4BK8A 4HJSA 1AOZA 5HHVH 2AQSA 2PYED 4B9PA 2WM0A 4KI5C 5I2IA 3FK3A 5JHDE 3WFHA 1KG0A 1F90L 5CEZH 1A1OA 3F01A 4Z3FA 4RMWA 5IMOB 1JGDB 1OM3L 3A67L 3GKZA 3BH9A 3Q1EA 3IKKA 2J56A 2GTZB 1T2QH 5I0DA 3MV8A 2I25N 3GXMA 2EYSB 4Y4HD 1JIBA 2DOCA 3O2VL 4GBXA 3HB3D 5B4MC 4I2XB 1QQDA 4XO4A 2XWJA 1H3VA 4JB9L 4BCZA 3NJLA 4QXVA 5DJCB 5DS1A 3MRDA 5D1QC 4G7QB 3ERXA 3A6OA 4BJLA 2FBJL 1WCBA 4YXLL 4M6OH 1DVSA 2DYPD 4P9HC 2OKMA 1RUKL 4D0BA 2BZCA 4F7CB 1TQBC 1YEKH 1SEBA 2G9HA 1TNMA 3LZFL 3FQXA 3M7OA 3JUZA 3NCCB 3FSAA 4XP9L 2V2XA 1JV5B 5ICYA 2VXTH 2CU9A 3G5XA 3ESVF 2DF3A 4UTBL 4GRLB 3FU3A 1L7TL 3TJPA 4BZ2A 2G75B 4OZHB 1D9KB 3F84A 1R33A 1M6OB 4U1MA 1QYGL 3DX9B 4XMLL 2DQEH 5KVGL 1NUFA 2Y06L 2CLVA 2PXYD 2EXWD 1X5LA 1I8KA 5LBVA 3VD2A 4ODHH 1HFUA 5ADOL 1S7XA 3GTTA 2J6EL 3WEAA 3ZYOA 2Q7YA 5C0GA 1YDPB 1YN6A 4YZFE 1F4WH 2OAAA 2WVVB 3IBEA 4P2OD 4PJ7F 4DKDC 3MLWH 5ANMB 1A3RL 5E8EB 3DWTA 3X11B 1HOCA 1XGUA 4Z95H 2E3VA 4HKJA 3KDMA 3QNYB 5GSRB 5GZOD 2GYSA 2W95A 1MCNA 1MQKH 3PL6B 3ZE2F 1FO0B 4DK5A 1KBGL 5C09E 1TDQA 4XH2B 4YHKL 4OIIH 5I71B 1O6VA 2QADD 2I69A 2YRBA 1A6WL 1HI6A 3AVEA 2PO6B 5I26A 5I19H 4OCRL 4TNGA 5GRUL 4LGSB 2BVEA 5ICUA 2A83A 1G7PB 4U1LB 4UIMA 4NUMA 5I1KL 4A37A 3NIGF 3LDBB 3FN9A 2B1HL 3IFPB 3QJXA 4AJVA 3RWFA 5IROD 3SCMB 4D9QE 4J4PC 4D7PA 4OCLC 1F3DH 2M26A 2Q8AL 1CMOA 2VISB 1OALA 4S10A 2ZXDA 4JY6A 2NTFA 2EACA 2I85A 2P8PA 2A9NL 5ENWA 3DETD 3ES6B 4X8JB 1F4YH 3TH3T 5BZZA 1CYWA 1C8PA 4XN8A 1JGVH 1CVRA 2HAZA 3LSOA 2I60L 4N25A 3NFNB 3OB0K 3US0A 4M93B 2ZCLH 2Z31D 3E9UA 4WI3A 3TA3C 3AMLA 4BK5A 1FBIH 4PG2C 2GHZA 3QP3A 3IDXL 4O58L 2Y7OA 3UP1A 3V6FB 4P5TC 3GO1H 2F7QA 1NFIB 4L29A 1U2YA 3OG6B 4GAYB 1QSFA 3QO0A 1T83C 2F5BL 4P46B 5DWUL 3RUGE 4G8GD 2IEPA 4IMLB 2Z0BA 3IGLA 2NZ1A 4KOCA 1WWAX 2EXTA 2XQ0A 4LKXA 3UCQA 5DJ6B 3TFKC 1ET5A 2KT6A 3QH3B 4IRJC 4YSCA 3E2HC 2LTQB 2ATPB 5F3FA 1W72B 3GB7B 1JMZA 2XVGA 1QLEB 3HRZC 4MB3A 3EOBA 1E8YA 4O2FA 3VI3B 4QRFA 5AVVB 1JNNH 4JLRA 1UGKA 1BWWA 4HC1L 4JFZL 1KV3A 5DCCA 4MWFB 1NIEA 4LHQB 2OMWA 2AK4E 1L0YA 2DDQH 4QHMA 5DMJB 2B14A 5EOQH 5T1MB 4Z3GA 2G2RA 2PPAA 4ABWA 2OL3B 1FPTH 3QEUA 4LCYA 3ZGHA 3MRMB 4K7FA 3QDGB 1IAKB 1Q94A 4BSWA 3LS4L 4HEPA 1U95A 3V6BR 4ICWA 2KPNA 4JO2H 2VN4A 3WUWA 1S9VB 5K9JL 5T1LD 3PG2A 4FTDA 5H2BB 1AI1L 4AYMC 1NGPH 1NCDH 2QPUA 3HG1A 3TWCH 3H85A 1LJMA 2A9ML 3IFOB 3P0VH 2C4FU 3WNJA 2QQNL 4NRXB 3WDJA 3WN5A 4DP8X 2VN5A 4U7SA 3NABH 1Z0NA 1QACA 3CVCA 4CGUB 5AVXB 1RIVH 2J8OA 2EIBA 5DVKA 4XB8A 2F0CA 4Z0XA 4PN6A 3K4DA 3ZDWA 2C1PA 3RZCD 1TEFA 2C7UB 1AC6A 1A2YA 1AE6L 1WVZA 3QUZC 2VJXA 3P9MB 4HIPA 3GHPA 2OTWA 1YMMA 3ZQ9A 3SE3A 2QKSA 4OV5A 4PM1A 3OHXA 2DWEB 3PDOB 2CH8A 2DQJH 1F1GA 2ZKHL 1F18A 1PBYA 1AHWA 4L0ZA 1XH3B 5AOZA 3RDJA 3BEVB 3S37H 2BSSB 3EBIA 3P0GB 1CTMA 4Z3EA 2A9CA 3QZWA 3S35H 2Q2LA 4O9HL 1AO7E 3KLDA 3MCG1 3D1MC 2GSGB 3K0WA 4WIQA 5ALBL 1TYJA 4N2BA 1MAML 1F6AB 2ID5A 2C3HA 1X5YA 1E30A 4M7KL 1N68A 5IOPB 5DS8B 3OXSA 5KJ7E 4BH7B 2EEBA 4IBYA 3F7VB 1I8MB 4YH6A 3PV6A 1QRKA 2K78A 3K6DA 2FLRT 2B15A 4U6HA 5SWQA 5C0BE 3INUL 2X4TA 3LRSA 3BZFB 1D7CA 1JDCA 4KRNA 4LLWA 1YNLL 5GGSA 4ZDHA 1YEFL 4XCCL 1O6TA 5LBSA 5LXVA 3JYBA 4RGMB 3FKUS 2VDPH 5LWYL 2XDHA 3MA7B 5DD1H 3S5ZA 2WWOA 3IWVA 4HX1A 3S0PA 2PWFA 2WYIA 4JQXC 3EGDB 5KZCD 5ID0A 1IZKA 3NCYS 3MLPA 3L9RB 2MEJB 4XRCB 3N43F 5E1GA 1HXYB 3QUYD 1OT1A 2YAEA 2EDKA 4CC4C 1CXKA 2ZOLB 4HWBH 2NYYD 3CQPA 3WHE0 4L1HA 4UANA 1WSST 3MRCA 1JHLH 1Q0XH 2YO3A 3TASA 3S5LA 2E5EA 4PVBA 2YQBA 4LLUB 2JF1A 4KPHL 1KJ2A 3WOVA 4LSQL 5F88A 5LQBL 5D1QB 1GS8A 5C07E 3SDCC 5M95B 3W57A 4LHUA 4ZYKB 4U3SA 1I9JH 5C9JB 3L3OC 3IXTA 4ZS6C 5KG9A 5F3BB 1TU2B 4L4VB 3MGOA 1G0DA 2CM6A 1AP2B 3EUDA 1BZOA 4GXVH 3Q1SH 3ATBA 3GBML 4LCWA 4OLWH 4OIFA 5F7EH 4YBQC 2VDOL 3MBED 3KHQA 2D03L 3HBGA 3IRZA 3K8KA 4YE4L 4PI2A 3DARA 3S88L 3VFMB 2NXZC 2DAVA 4MMYA 2KMWA 4Y19A 3T4AA 3WN6A 2VDKB 1Z9LA 4OCNC 3B34A 4G9FB 4XAWL 2J57A 4NWUL 5MERA 5K59E 4NQED 3HMXA 3T6QC 4ERSH 2P7TA 1LEGB 1LQSR 4UUJA 1INQA 2JMRA 1T5KA 3N2JA 3QZMA 1J1PH 1CLYH 3FZUD 2FEDC 2BFVH 4DZBB 5SWZE 4NRYB 4XNXL 1DDHA 2H32H 1KGWA 1HSBB 1SDYA 5AAMA 4RX4D 3P69A 4HU8A 4LEOB 1IAII 1ORSA 2BDNH 1RIHH 2GJ6B 3DXAD 3QRGH 3LS5H 3AC0A 4HCFA 3AG4B 4HT1L 4MKMA 5HGDA 1C12A 2HUEA 3IJEA 5K33A 2HN7B 5IFHH 4X5RA 1GZQB 1Z3GH 4M7JL 4XNUL 4W9LC 3HBPA 3ARGC 1Q72H 1JXDA 3MNZB 5CINH 1CDGA 4HKBB 1FAIL 1L3WA 3O4LD 5HVGB 2WKGA 5FCSH 1J7VR 3RVXC 3U7WH 4XPGL 1PG7W 4GFTB 3RVUC 5CZVH 2G5BB 1NC4D 1SXNA 3L13A 4QD2E 3K46A 4QXWA 5H37G 1FGVH 3T0EE 1E4KC 3DO7B 4Q6KA 4PTUA 2NX5E 3MUGA 3ZZLA 2FIRT 1Q9OA 3RB5A 3CU7A 1JMXA 2ADYA 4DCQB 1J8SA 1IKNA 3LRLA 4M8UA 3CPLB 1DEDA 4H0GA 4KKNA 4TVPH 4EVNA 4GSQA 3MV9D 3PP3K 4RSVA 4ODXB 3GXUB 1OSPL 5CBAB 4NO2A 4OZ4B 2YC1B 2GC4C 4O2CA 3UYPA 3Q8FA 4U2ZA 4F5CA 3VSQA 4WHYG 5AD0A 3TA3B 3QCUH 1NCCL 3VTTA 4P5TB 4FQ2H 3F8UB 4FG6C 5EC2A 3CVBA 5CEYB 4BSJA 5ESVB 1A1MB 4A7GF 1ILUA 3UOAB 5GSVA 1JPST 1R47A 1CDUA 4Q97A 4PJFF 3IRCA 2HX8A 2WANA 4LFHD 4B9JA 2ZF8A 4N0CC 2Q87A 2Y7NA 3VG9C 3SY6A 3P30H 1RPUA 2VDLL 1OVZA 2OXHA 3E2HB 2ENQA 4BGDA 3I2CL 4GMTH 3QHFH 3ZL4H 2ICWJ 3HRZB 2WWKT 1FJ1A 4R26L 2V3DA 3QZPA 5DHVA 3VFWB 4B0MB 3KPPB 4WJ5A 2P5WD 2Q0ZX 1F1AA 3EYQD 2AQ3A 4ELME 5I6PA 4M1GH 2DWXA 3BAYA 3II3A 3QXTA 4PRBB 4ZNCD 4DSYA 1EGJH 2MMXA 2I9LA 3ARWA 4MQSB 4CADA 5IQ7L 4MCZB 3IYLW 3CLFH 3GSRA 3QIWA 4NXKA 2ZNXA 3IDNA 3LIZH 2FHFA 1FNFA 2K8QA 1E4XI 2VR3A 3H42H 2P5PA 2GJJA 2UXFA 1AXSA 1QTYT 1XR9A 1AY1L 2HJFB 4YUEH 4IBUA 1XQ4A 2XA3A 1XF4B 2YRZA 5D8JL 3VWJA 2JQZA 2WBKA 2X1WL 1WS8A 1D2PA 3CFCH 3UO1H 3QG6B 2OQJB 1N18A 5DQ9A 2P24B 3NSYA 2W07B 3A23A 4K71C 4HUXA 3C8KB 5FM5M 3GSNA 4UAOB 4C4KT 1SJHB 2ZAGA 1RJZA 2BSTB 1SYVB 3DX6A 3TL5A 3WTVA 4GQ9H 1HEJC 4LLMA 5DK3A 3S2CA 3H2QA 1AIFB 4FFZH 1JL8A 5CP7B 5DFAA 4HPYL 1VCBC 1OGAB 4Q74A 1SY6H 3ILDA 3SPVB 4JPQA 4FQ1L 1MVFA 4DGWC 4J3OD 2YEQA 2B9AA 35C8L 4YDIL 1HX0A 5AW5B 1GKOA 4BZ1L 4B9FA 1OIOA 4LAJH 4WSJA 3TN0D 2R2HB 3QUZB 4MDIB 3FT3A 4KXDA 4WENB 2ZPKH 3HTLX 5ISZB 3EYOA 1CN4A 2VABB 1A6ZB 3CTTA 3I9GH 3VFRB 3EXJA 3UJTL 4N5UA 2XG4A 3DK0A 3ILQD 4C47A 1BD2E 3TPUA 1U91B 3JV6B 1TJHH 1A4KB 4PREB 3FL7A 3MCKB 4I89A 3GTNA 3DBXA 2QQQA 5JHDB 4JKMA 1MFUA 4KVCL 5CUSH 3OMIB 5FUOL 2B2XH 1ND0A 4TUJB 3UJJH 2ZUUA 3QXVA 3N9GH 3B2MA 3E1F1 3PF2A 2IPTH 4DEPC 1F3JB 1F6LL 1FI8C 1G4MA 5IMOA 5DHYA 3EF7A 4EI6B 5I9QC 4KK5C 4P2QD 3H1ZA 3R0NA 4WI8A 4NZRL 1KLUB 2VR7A 3NFSL 1P5UA 3ZTNH 2EYSA 3GMRB 4GAFB 1J12A 5ITFB 1U3HD 2XXFA 1WD8A 3GMMA 3VTMA 3GJFH 3BP7A 3P2TA 4I2XA 1OQOA 1IU1A 5HI3D 1ZVSB 3RI5K 2VXQL 4JFDD 2YKKA 3MQIA 4A2FA 3MDJA 1Y0LB 3JWDL 4HFUH 1MEXH 1T1WB 1SFHA 4PV8A 4AM0B 4PV1C 2XKNA 1J0YA 3BD5A 1CD0A 5HHMD 4CBZA 5KOVC 5IEHB 1CBVH 4HS8L 5EU5A 3DMMD 1SMDA 1DBBH 3QDME 5AW7B 4DW2H 5CCKH 2QQLH 3AWGA 1EK3A 1JWMB 2H5UA 2HWZH 1UVQB 4KHTL 5F93C 5A2CA 3NP4A 4RDQG 4AUUA 4HCRH 3V7AG 3T0AA 2X1OA 3H0TB 1AQMA 1RURL 1QOKA 3CX2A 3GRGA 5F9OL 5I30L 1KWKA 2VLJB 1BGXH 1RZJH 1HH9B 3BPOC 1T1XA 3D3VE 1D9KA 4OZHA 1OOAA 5JW4N 3HR5B 2JNZA 1HHJB 3SDCB 4EDWL 1ITBB 4KZDH 5GHWH 1JYWA 1S3KH 3HC3L 1X9UA 1QSED 1LL1A 1KCLA 1QSVA 3NCYP 1YDPA 5GQBA 2C3WA 2WVVA 4JFPB 4PCKA 4KKCC 3H53A 4JHUA 4PTTB 4TS6A 3CZFB 3KXFE 5GSRA 3QNYA 2YAOA 3K2IA 4YDMA 5C09B 3OLDA 2ZP8A 3LXAA 5EA0H 3PL6A 5CJBA 3UL4A 1FO0A 2NXZB 4G11A 3H9SE 3EFOB 3MFFA 4ZZKA 4Z5RB 2WOBA 1BM3H 3UZQB 4JDVA 2AABL 2K3HA 1JAEA 1FN4B 1YCSA 4G3YH 1DQQB 3T0EC 4U1HA 5T5FH 1NQBA 1PX8A 1G7PA 4HH9B 1MNUH 3UBXG 1K2DB 4KKZA 2WXKA 1TETH 2IMNA 3IFPA 4N0RA 2WBWB 5DQDL 3SCMA 1XDTT 1YN7A 1BZ9B 2AJYH 2WMPB 5E9DB 2ATAA 2EIZB 2VISA 4MQXC 2HMIC 3QIBA 4WKZA 1CGVA 4WF7A 4JHWL 1A6VL 1F41A 5T33H 3NSJA 1JZ7A 3ES6A 4P2CG 4X8JA 3ARGB 1W8OA 2N7AA 3CVIL 2PR4L 4Z8FH 4XVTH 3F7PC 4DO6A 3TCXA 5LNDA 3HA0A 4YHNA 1F02I 1OAXH 5IOKA 2OS7A 3VQ2C 5AW3B 1A6UH 1NFIA 3QUMH 2H7WA 4GAYA 1HNYA 4P46A 1P4IL 2YPLD 2CK0H 2JQMA 1KACB 4IMLA 5IR1B 1PVHA 3T6VA 1K8DA 2YFOA 4N0UE 1I9IH 3SD5A 1WEJH 1IMHC 4Z3JA 2G3ZA 5DJ6A 4N0YH 4QGTA 3QH3A 1YRKA 4GEIA 3RWJB 2EIEA 2ATPA 1U3JA 2DIJA 3L4WA 1W72A 4PJ8D 4G2AA 4FABH 4HIJB 3JTSB 4RNRB 2DQHH 1K3ZA 2BNUA 2ZG1A 2AK4B 5IBUB 3FU8A 2DQUL 5ACMA 4UTAH 2YGNA 4J2XA 2NNAA 4P4KD 4MWFA 1AZZC 1DDTA 3C6EA 3K6SB 5EU6A 2YUXA 2D9CA 2FB4H 2HT2D 4HA1A 5D1ZC 5T1MA 2OL3A 5I18H 3GXPA 3ROOA 1AHKA 2XQYG 4ZUSB 1MFEH 3MRMA 3HS8A 3QDGA 5DZPA 3O9WD 3EHBB 3VG9B 3OR7A 4G8AC 1YY8B 4H40A 4OGXH 2A6KB 1Q1PA 4HHAA 4JN1L 5IWLC 1G43A 5AALA 4OM1L 3RJOA 4MXVF 2BIIA 1D5IL 2CDGB 3IFOA 5FO9A 2MPAL 2J25A 5E00B 4X4ZA 4YL4A 1IC7L 1Q9WB 4FI6A 3GSVB 4X6CE 4LIQL 3Q2LA 5HI5D 4NOFA 1F90H 4XNYL 4AH2B 4YSTA 1QBAA 3TTSA 1OM3H 3VB9A 3A67H 3WL9B 1MJJB 1RZIB 2IDSA 2YAFA 4WSKA 4L3ED 1HL5A 1ZJBA 4MSWB 2C5DC 1X5IA 1JF1A 3NCMA 5KN5A 5T1JA 5MEQB 2BZDA 5DMGD 1A9BB 3NBNA 3O2VH 4K71B 4POZD 4FLOA 2X6AA 4NQXB 2DWEA 3PDOA 4HIEA 1OTTC 1AJ7L 4JB9H 1AO7B 5FUCC 4GQQA 1XH3A 3IFLL 4L3CB 5AB2A 3BEVA 2BSSA 2C4FT 1GGTA 2E75C 3VXTB 3B3IB 1RZJC 2GUOB 1VERA 3RX5A 3HLKA 2FBJH 3IJHB 2GSGA 1KXVA 2NR6D 2AGJL 1II4E 4Y9FA 2OJEB 1RUKH 1F6AA 2ICWI 4NO5A 5IFJA 1DVZA 4M03A 1FNEB 3FOLA 2DQGL 1NJ9B 1EXUB 5DJ8B 5DRXB 1NBQA 5IOPA 3FQTB 3D50A 3LZFH 5DS8A 2AJSL 4XP9H 3OKDA 4JAMA 1WO2A 2V17L 3FO2B 4WQOA 4BH7A 1KFAL 4XN9A 3F7VA 3RGVD 3TZVD 5BS0E 5C0BB 3BOVA 4K4KA 4AUJA 4WEMB 4FN0A 3GDBA 2Z4QB 4K23L 4UTBH 1G9HA 1G7HA 3WNMA 4XVOA 1L7TH 5I0WA 4N3UA 4M5YL 3N50A 3T5WA 2NMSA 5KBLA 4XO5A 5KVGH 4XMLH 1QYGH 3ABKB 4MAUL 4HJTA 1KJVB 2Y06H 4HU2A 3JWNH 2E47A 4EEEA 3W2DL 5FEBA 3MA7A 3B5TA 2RTTA 5H94B 2J6EH 3EGDA 2E4TA 3PPSA 2WN2A 2VN7A 3L9RA 4DEPB 4XRCA 1HXYA 4F2FA 1A3RH 2ICEA 3OM3B 5DYOA 1EX0A 2ZOLA 3G5VB 1ZE3H 2BRQA 2C9SA 3FPYA 5DDHB 1UENA 4H8VA 4KJPC 5D2LE 3QO1A 2YAHA 1KBGH 2NY1D 1BMZA 4P3DB 3S3SA 4YHKH 4LLUA 3F7QA 3CH8A 3SPCA 2WLMA 5C07B 5KAQG 2YA1A 4QGYA 1CXHA 1EHKB 2XIBA 3RHWK 5ICZB 4ZO6A 2F53A 2IAMC 1A6WH 1IGML 2YD7A 5D1QA 4BHUI 1T6VN 1OP3K 3P77B 4P5SA 4OCRH 3UH8A 5GRUH 3VI3F 2ZWLT 3UTTD 1T5XB 2MSPA 2BNQA 5F7NC 3VM5A 4ZYKA 5I1KH 3QJVB 1EZUA 2X6UA 2P28B 2B1HH 4PGCB 1QTPA 4HG4K 4L4VA 4ABQA 2A74C 4TQEL 1KTRL 1E9QB 5E5UB 3IEAA 1ACYL 1FH2A 1AANA 1U21A 2Q8AH 1UCBL 1D5BB 4MNGB 4L4TE 5DA0B 3IGAB 2A9NH 5CGTA 1B4RA 3OLEA 4HV8B 2BNRA 3BPOB 4UF7C 4NKMB 2I60H 4Y4HC 2OYLA 1S3RA 1GGBL 4S1DC 3DTXB 4WZ9A 3OAYH 2GW5A 3IDXH 4O58H 2BOCB 2BVOB 4DO4A 1I8AA 5DWUH 2F5BH 1S9KC 3NSFA 3SD2A 4DZBA 5F6IC 2C9AA 4NRYA 5GGRB 3QFJA 3ZTCC 3QRBA 3DVIA 3BWZA 2B9BA 1BLNA 2YD1A 4FE9A 4L9LC 4C56E 3APMA 1MHEA 1JRHL 4AC2A 4PJBF 3V7AE 3UTZA 5E4AA 5E8PB 2GJ6A 5KUKA 5KYUB 3VW3L 1HT6A 1RMFL 3IMSA 3OKLB 1VFUA 1W15A 1U0QA 2F9BT 2YQ2A 4HKBA 1TZGL 4HC1H 4JFZH 4ZMOA 4UQ2B 5I1EL 1GL4B 1WAAA 2HT3D 3T0EB 3W0WA 2OR7A 4J3VA 2NX5B 5ABDE 1UD8A 2WYZA 5ID1A 2G5BA 1F2XK 2PXYC 1NZRA 2EXWC 2Z34A 3DO7A 4PJCE 1I1CA 4KDWA 2ED6A 2G60L 4J4PA 3LS4H 3ZZ1A 2H47C 3CPLA 2MHAB 1GKEA 2QV2A 5K9JH 3AGVA 2ZYHA 4BA8A 2PWHA 4P0DA 5AW1B 2VQTA 4ODXA 5L88H 1S9WA 4XCEB 3RKDD 1P6WA 5D72L 4OZ4A 2AJVH 1ZT4B 2YC1A 1PQZB 4X4XB 5GZOC 4Y0GA 2QQNH 4XOAA 3TA3A 3FH7A 4TQ8A 1OSEA 4PG2A 2CO3A 4H26B 3VXQB 3HZYB 2ETWA 4P5TA 1Z3RA 1EJOL 2Y1ZA 2XKSA 1MCFA 4KI5F 2QADC 1PU0A 2VZVA 4FXTA 3LEYH 1A1MA 1T83A 3T3MB 2RALA 4R83A 5F3HB 1AE6H 1PG7L 2XX0A 3PWJB 3A4FA 1TFHA 1UASA 4IBWA 3ZMRA 1I7TB 2PETA 1XR8B 5IROC 3EAKA 4FFVC 1KXQA 4IRJA 5AW2B 2ZKHH 1DVXA 3CN2A 4KJWD 4ELMB 3IAGC 4R90L 4JFOB 5JOFB 3VE0B 4AL8L 3VFWA 3KPPA 3WCYA 1NCJA 3R4RA 1INEL 4O9HH 4KUCD 4H44C 4PRBA 3REWB 2BVYA 5ALBH 5EZIL 2NUTB 1UCTA 1MAMH 4LEXL 4XXDA 3QWRD 3QC5X 1KTCA 2FX7L 4Y5YA 4QJ3B 4G80B 2W9LA 4M7KH 4CUCA 1XCWA 4X8GA 3FUKA 2WSKA 5F9WC 4ZMAT 3L3KA 4JEGB 4R4BB 2HJFA 4WEUD 4YPGA 1N0XL 5I1AB 3AT9A 4YAQA 1EAPB 3FS9A 4H25A 1XIWD 3VD5A 2OQJA 4PLKC 3VMNA 2P24A 3B9VA 1YNLH 1YEFH 4XCCH 2FYVA 1H8OA 3SYQA 2P1YA 4RRPA 1MI5D 2OJZL 3W39B 2F2HA 4CNIB 5LWYH 4OFVA 3MRJA 4GT7A 1OD9A 3JV4B 4MYWB 2WN3A 1AIFA 2AJXL 5CP7A 1K3IA 4ZFOB 1OGAA 2PP9A 5F7YC 4XO9A 3RU8L 1T1ZA 3EYVB 1HH6A 3FB5B 1Z9SA 4N2MA 4QNPE 2VLKB 3FTUA 3K72A 2R2HA 3QUZA 3HS0C 3MO1B 3O6ML 3EFDL 1W0VB 2ITFA 4ORGB 2YEZB 2E76C 2Z8WC 2OR8A 2VABA 1Z5LB 2A2QT 2KI6A 1ANUA 4KPHH 4WU5B 2BWIA 1RH8A 3FT0A 3VFRA 4RQQA 1JWUB 4LSQH 5TDPA 2F1AA 2I7OA 5LQBH 3JV6A 1A4KA 4JG0L 4PREA 2Q10A 3MCKA 4PJIA 2AV1B 2EP6A 4LPUA 4XPHL 5FW8A 3V4PH 3MZTA 3Q2NA 4JFVA 4TUJA 3V4VL 1QHPA 4IBTA 2QGBA 1WAAF 4PJGB 2HJKB 5CU9A 1J8HA 3NRQA 2B1AL 3GBMH 3H3PL 2BCMA 2E9JA 3UCRA 4Z7OE 2D03H 1KLUA 2J1XA 4HLZH 4I3RL 4YE4H 2CIIB 4KWUA 1TYEB 3GMRA 3RZCC 2W8CA 5ITFA 4M9PA 3QHTC 1CDIA 2VOTA 1BEXA 1V7NL 2PWEA 3AG1B 4NGHL 5E6IC 1SEQL 2N1TE 3HBZA 5D55A 3UBXI 2DQCL 3S2AA 1Y0LA 2WAHA 4X6FB 4WGVB 4XAWH 1T1WA 2MRYA 2VZ1A 4M62L 4NWUH 1LWRA 1MWAL 3IN0A 3WIIL 4AM0A 2ARWA 3K4ZA 5IJVA 5CP3H 3QDMB 1KCKA 4JJHA 1H9VA 4ZXBD 1BW8A 1YAIA 4LHJB 3VO0A 2EJ1A 4XNXH 1MFCL 1OP4A 2FGWL 5IEHA 4WFFD 2KZBA 3D8MA 4CC4A 5TE4L 4CL7A 5KYNA 2ZCKL 4NIYE 4G42B 3TJHD 4P8QA 3ZRSA 1N2RB 1UVQA 1GGYA 1EEZB 1KIUA 2B3IA 3WIHL 5C08E 4NC2B 5JHAA 3OJVC 3BQVA 4X7TB 5TQ0L 4E0RB 2Y6TE 3FB8A 4M7JH 4HW6A 4XNUH 4G8FA 2VLJA 2WPGA 1HH9A 2IAMB 3P02A 1FAIH 2ED8A 3BZEB 4I1RA 4HHWA 5C0AE 3SDCA 1URIA 4XPGH 1PZ3A 4JFFE 1F56A 3ZYIA 3WEOA 3L3OA 1PNCA 2CJUL 2Y5TA 5CZRA 5EEXA 3ZDXE 2PYEB 3CVHL 4K9EL 4C8XA 2A74B 2D2CC 4KQ3L 2NY4B 2WVSA 4JE0A 2E6PA 2NY0B 3QUMB 1U9KA 4PTTA 4PG9B 1J8KA 1IAOB 4M6NL 1IIKA 1A65A 3QUYC 1H8NA 5G55A 2H8PA 3IF1A 4OUOA 4LCIL 1OSPH 3TNMA 3PABB 5TF1L 4AYDC 3NESA 2DQFB 2NYYC 3N44B 3EFOA 2RBLA 3ECBA 3Q3GB 5CKAA 3TO4A 4Y4HB 2CHXA 4UINL 5CZXD 1NCCH 3QEHB 5EULV 4BKTC 3CIQA 4FXKB 1DQQA 1GZHC 5KSVB 1OAZL 1CO1A 4V1DE 2YZ1A 4HH9A 5J6GA 5F6IB 3CQFA 2DWYA 2ICWB 3DIVA 4J3OH 1RK7A 4RMTA 1YUHB 2B0SL 4W6YB 5E9DA 2WMPA 1C1EL 1RI8A 2HKHL 3DYMA 1I1AD 2FECL 1JUFB 2EIZA 2VDLH 4J1UA 4L5FL 4HIHB 4OGAC 2NLJB 2XPZA 3I2CH 3MNVA 1ET8A 4AYGA 3NJVA 3ZUCA 1LK3H 3GS4A 4R26H 4BUQA 3MBEC 1PY4A 1VIWA 4BBWA 3UZVB 4JFWA 3B7SA 4Z7UA 4IMKC 4I5BB 1XEUA 4AIZA 4K5PA 4P23D 1BJMA 1M7UA 1VF5C 3B5HA 4ZBJA 1URZA 3T09A 2JB6A 2EZ0D 1E4KA 4A7TA 1SFDA 2MQ0A 1AY1H 3LXCA 1WE5A 5DRWB 5IR1A 5D8JH 1DN0B 1WIPA 4MZ2A 4YOKA 3MJ9L 4DPAX 2OZNA 3PDGA 3VA6A 4U7MA 1J0KA 2WQXA 1U8PB 3ISYA 3U2IA 1FUNA 4GAGL 3RWJA 2WIIB 3IWUA 3TESA 2QQKL 5J1AB 5IHUL 3F7YB 4HS6A 4HIJA 4LBAA 2RFXB 3MFGB 4H88L 4OKVA 4RNRA 3ZHFA 2J5LB 3W9EA 1UB6B 5HDLA 4HPYH 5J5EA 25C8L 3BDBA 3V79C 2DQTL 3CMGA 3K3QA 4FQ1H 4BWTA 3K6SA 4JFSA 35C8H 1F58L 4BZ1H 3RY4A 2CCLA 4U7KA 4N68A 3I6KB 4QDGA 2WVTA 1PL3A 1VGKB 2ZKMX 2NDGA 1W8NA 1J5HA 2K4AA 1ZT1B 2VR6A 3VRLE 4Y1SA 2UZXB 1YY8A 3UJTH 2A6KA 5JO5B 2X4OB 3L9BA 4X99A 3SQOL 2QFPA 4X6CB 2CDGA 5LN8A 1JDDA 2AAAA 4KVCH 1G0XA 4Y2LA 5FUOH 4TVSa 2ZG3A 1Q9WA 4WCYL 4FI7A 4CU6A 3RURA 1X4ZA 3HPJB 4H2CA 1U92B 3FQNB 2C34A 2XIDA 4MA7L 2DWDB 5F9WB 4YZFF 3BUTA 1XGZA 3L7EB 3VXPB 4AVJA 3WL9A 2D7QA 2MWCA 2R69L 2VDQB 1RZIA 3L5IA 4NZRH 3PWPE 1ZLWH 1MLBB 4KRPC 1ECYA 3NFSH 2HFTA 4MSWA 4TYUA 4HWBA 5MEQA 1A9BA 1IC5L 3GMQB 3PWUB 2Q86B 4NQXA 5BZWB 2XN9E 4N9OB 4XO8A 1AO7A 2DW5A 4DPBX 3JWDH 3AQDA 1QR4A 3V5DB 3GLEA 4TLSA 5F0PB 2GUOA 5T3ZL 1A14L 2TAAA 4NT6A 3LPGA 4YDNA 1GYUA 2OJEA 4LVNC 5K9OB 3AM8C 2FO4A 4HS8H 4R9HA 1FNEA 5C0FB 5DJ8A 1E0OB 5DRXA 4MJ4A 3O3AB 2F54E 3HS0B 1QBBA 3U1SL 5MI0C 3WFZA 4KHTH 5JZ7D 1BXXA 3M17B 2X4QB 2DTSA 3OMZA 2Z4QA 1RZKL 1T6WA 3QORD 3X1EA 3CMOL 4K7PY 1RURH 5FHBL 3UGUA 5F9OH 5ADPL 1WQVT 2E7DA 1A47A 1DVFC 2H3XC 3MVSA 3UTQB 2YD2A 3OX8B 3L3IB 4W1TA 1KJVA 1SLWA 2VRKA 4N4YB 4EDWH 3F00A 4NBXB 5FOJA 2DMHA 2VWEC 2NOYA 1MF2L 3HC3H 8PAZA 4UOJA 1AGEA 1V05A 3RUGF 2AQRA 3CVDA 5JIQA 1EHNA 1ACXA 5CNHA 1UM5L 2H32A 2X4RB 2EIMB 1AR2A 5SWSD 1Z9MA 4KBPA 4YHLL 3TN0C 2IANE 3WSQL 5CSZB 2AABH 3U46A 5E6IB 3CN0A 3G08B 5ICZA 4KKBD 5T3ZD 3O11A 2X28A 1E3ZA 1I3RA 3V0JA 4JL2A 4PCTA 3P77A 3UJIL 4M4RA 3QFDB 1T5XA 1VRSA 4GI8A 2Z8SA 3QUXD 2WYHA 4GPVA 3BD4A 3C9NA 4PGCA 3CFMA 5DQDH 1E9QA 3MUZ1 2R2BA 5DUBA 3PWNB 2R9HC 1D5BA 4MNGA 4WTXA 3SKMA 4JHWH 5GISL 4M7LL 1A6VH 3IGAA 1UG9A 3IDMA 4GKOA 4WFEE 5JOPE 4HV8A 2V9UA 2GJRA 3RWHB 4WWKB 2WXPA 2Q20A 2ZXAA 2PR4H 3CVIH 3V0WL 4NKMA 4CSTA 1PDKA 4LP5A 4W6XB 3WIFB 1U3HC 2YPKB 1A7NL 1KENL 1ZS8B 2CZNA 4EIUA 3DTXA 1AZCA 5DGQA 5HI3C 3SQBA 2WUCL 3HRPA 1F1DA 3VFPB 3KH3A 2CJTA 5C0RH 2X12A 2ZWZA 4FI8A 2A3TA 1KYAA 3DV4B 1P4IH 3B4NA 1WRFA 2ARJB 1ASPA 4S0TD 4JKLA 3QUYB 3FCSB 1T4WA 2P5ED 1B3IA 5AOJA 4OY9A 1ID5I 4B97A 3DMMC 3QWQB 5LO7A 1NBZB 2FQGA 1NBCA 2GUYA 4OU3A 3OKLA 2ESVE 4DP5X 2R29L 3S3DB 2DQUH 2Y36L 1CFVL 3SJVE 1KIQB 4OIBA 3T0EA 3GSWB 1WWBX 2NQDA 1U6AL 4PJCB 3RKPA 1EGJA 3QJHA 1GPOL 4EF3A 4PS3A 2CUMA 4AMKL 3ABGA 3CZGA 2VLME 2W91A 3LIZA 4HK3J 4TXVB 3LV3B 3TYFA 4FQXD 4LLYB 4PP2B 5FM5O 1RQ5A 3U25A 5J1TC 1PD1A 4QUOA 5L2KD 3I3BA 2EDDA 4JN1H 5EV7A 2VERN 4OM1H 1MW3A 1A7OL 1D5IH 1ZT4A 2MPAH 4X4XA 5F1IB 3ZT5A 4ZO9A 4QOKA 3Q2VA 3KCPA 3MUY1 1IC7H 4ZPTA 1N6QL 4LIQH 3UBXB 3BGMA 2IBBA 4PMFA 4H26A 4XNYH 2G3MA 3HZYA 3F3HA 3JWDC 3PUUA 4XWGL 4RAUB 3VTAA 1KTDB 3BDYL 3L95A 5C8JB 1ZDSA 4R0LA 3SODB 4BRVA 2DBLL 1T03L 3DROB 1A4JB 2O1AA 3BQUD 3LRMA 43CAA 1R24B 2X7LB 5D7JD 4KKLC 2GTWB 1I7TA 2F5AL 3LPFA 1XR8A 5L4FA 2J8UA 1PNDA 1VEOA 5TFSL 5B1JC 3SGKC 1AJ7H 2VH5L 4ELMA 5CIPH 4I88A 4C59B 5JOFA 3P40A 3IFLH 3CHQA 3BEWB 4J7RA 5EIIG 5FCUL 3BIBX 1LDPL 1SMOA 5IREA 3REWA 5I0VA 2E7LC 2DJUA 2AGJH 2HFGL 3B83A 3KJ6H 3VA2C 1FVDB 4QRPD 5DRZB 5D1ZA 4R7NB 2DQGH 2VMEA 5FWQA 2AJSH 2CHNA 4NERA 5DEFA 5I0YA 2XWCA 1KFAH 3DSNA 4GLRH 4R4BA 1CDBA 2BJML 3QQXA 4P07A 4RFOL 3E6FB 4G1EB 1EAPA 2VDOB 1QUNB 3QEGL 3IDYC 2VMFA 1E7UA 2N3JA 4M5YH 5IWLA 1CLOL 1K9TA 3GLAA 2YRPA 4MAUH 4A7QA 4JM2A 4QHKJ 1DSWA 3TBTB 4GRWH 5BV7L 5J3HD 4XPAL 3W2DH 4AY0A 4CNIA 3VSUA 4EI0A 4QJ4B 3JV4A 1D5XB 1G1KA 4PJ8C 5K59F 4ZFOA 3SGEH 3FUHA 5DUPL 2CGZA 1UOWA 3BUBA 3ZMEA 5D1XD 3EJYD 3DV6A 3OPUA 3OAWA 3ZKNC 3L4UA 5KBPA 2DM4A 2VLKA 2WKOA 3QA3B 4KRPB 2ZOUA 4V11A 5DHMC 1B2WL 3H9HA 3MO1A 5GGQH 3TEYA 4ORGA 1W0VA 1RERA 2K6WA 4MAYD 5CGMA 3I6LD 3RB7A 1CZ8L 3D87B 1Z5LA 3CFQA 1COBA 2Z8RA 1JOIA 3NPSC 2HLAB 5AW0B 4NUPA 1WBYB 2GQHA 3COOA 2CK2A 1PX4A 5B39B 1KLFA 5KSUB 5MEOB 1IGMH 2DQMA 1U2CA 4P49A 1AZUA 2AV1A 4WI0A 3SDDD 2IFFL 1MCWM 4FG2A 5DUJA 2C7FA 4FD0A 5INDB 3DX0A 4F7TB 5DI8A 5EFIA 1U8MB 1H3WM 1HHHA 4LVNB 2FHCA 2J5WA 2VNCA 3PQYA 4PJGA 2HJKA 3OB0H 4H1LG 4TQEH 4Z7OB 3U30B 1KNOB 1ACYH 2GFBB 5CLXA 5MI0B 4HYTB 3TU6A 1UCBH 4GLRI 5EEWA 5LBGA 4B9YA 1R5IB 1HHGB 5FA3B 4Y1AD 1Z9PA 2GAZB 1DVFB 4D9RD 4UT6L 1LEKB 1MRFL 3ARFA 5HYSG 5DMGC 4ODWA 1GGBH 1KGJA 1TEGA 1BYPA 4POZC 2FJHA 2GC7C 1NLDL 4X6FA 5CLZA 3F5WB 2FEJA 5GS2D 3MLRL 3WD5L 3TIDB 3SGEI 4GNKB 4A39A 4AQZA 5LNGA 1EDYA 5HDBE 2GBVA 3TBYB 5T5FA 4RCAA 3GBNH 3ZDZB 4B5EA 2NR6C 3D0AA 3S34L 4G42A 5C08B 1BJ1J 3T1FB 5L2JB 1JRHH 1MIEH 2V9QA 1N2RA 4J3UA 1E5AA 3C60C 4UMSA 5E6UB 3B1UA 1WBZB 5D6DC 1ZK9A 4X7TA 5AOKA 1RMFH 2VDLB 1ICTA 1CJYA 1RK0B 2V33A 5FOBB 2YRLA 3VW3H 3Q8CA 1FZMA 2PW1B 1ETB1 4JFFB 5GGTA 2IAMA 1TZGH 4FNLL 5I1EH 4ELMF 5DEGB 3EADA 4FNSA 1DQTA 4I0CC 3ZDXB 1CYXA 2FWSA 1I75A 5DUML 3VNZA 5AKSA 4Q2ZA 2PYEA 1MG2C 4DEWA 1AQDB 2JELL 1YYML 4ODBD 2BVPB 4ANUA 4F58H 1T0NA 2AITA 5B7MA 2IOOA 3QUMA 4PR5A 4EN3C 4GUPB 3PAVA 4PG9A 4TVPE 1V3JA 4WW2B 1XV8A 5HDRA 3UTSD 3V9FA 4GQPH 1MWOA 4E41E 3E8UL 5CJXC 2OSLB 3RL1B 4P2QB 5ACZA 5IHZA 4I4WB 1C9SA 3PABA 3VAEA 5D72H 3KBEA 2DQFA 2EXYC 3ECVA 4GRMB 1TTCA 2IG2L 2ALAA 2XZZA 3Q3GA 4J3WA 1IGCL 4Y4HA 3N0AA 3GBEA 4PRAB 2NY1C 1M7IB 2PTVA 4V1DB 5KSAC 3CSYB 4JFDB 1EJOH 2CIKA 3L9YA 4UTAA 3WXWL 5HGAB 5KSVA 5B3JF 3O4OC 2F58L 1NCHA 4HZ1A 2QHLA 3KPNA 2ICWA 3ARZA 3Q6FB 1RY7B 2DYPA 4P2AA 4L9LA 5JDSA 2XFGB 2QVKA 5ABAA 1JYVA 1I7RB 3S8WA 3DMMB 1JUFA 1OANA 3MV8D 3UROR 1URLA 2NLJA 4R90H 4WNQB 1XZWA 4JG5A 2H1PL 3UZVA 2GBTA 3F7RA 1DN2A 3NJNA 1INEH 1CI5A 2WGNB 4G71B 1N4XL 4I5BA 4U1IB 1LO4L 5EZIH 2UUDK 4LEXH 2X9ZA 1N7ML 2FX7H 4B27A 3OSKA 4GEJA 2CRIA 4W9GC 3RFZC 2PXYA 5I1LB 1TENA 3B43A 3QUKA 2D7TL 1IM3D 1QSEB 1XF3B 2XWTB 1N0XH 4LF3A 3HHSB 2XPYA 5DRWA 4YVUA 1DN0A 1IBZA 1LDSA 3K81A 5ABZA 5LGJA 1HQ4B 2YEVB 1TJMA 4N5ED 3SIKA 5I6MA 4NCDA 1U8PA 3LEVH 3EGXA 5EBLB 4FQJL 2OJZH 2VUKA 5J1AA 5GZOA 4HDIB 1ZCRA 2RFXA 2YJLA 2AJXH 4OAWB 3SKOA 1YQVL 4A38A 1YEEL 1ETZB 3LY6A 3AS2A 4MHHG 4BHUA 4A6YB 3MV7D 4E9WA 3RU8H 4IKNA 2HT3C 5FUZL 3MKKA 1ZT1A 4OGQC 5IROA 4OTXH 1RLWA 1O7DE 3NACL 2UZXA 3FTGB 2HKAA 3L5HA 3LVEA 4UTBA 4LSVL 5IMKB 5JO5A 3UO8B 4JG0H 2FQEA 4X6CA 3T0DA 4Z7VB 4PH8A 2DI7A 3EFFB 2OXGB 3RKDC 4FTVE 3G6DL 4XPHH 5LG6A 5EHFA 1T7WA 4J5VA 1JHTB 3S96B 1ZD6A 2YBGA 3UEZA 3V4VH 3HPJA 3T8XB 2M8XA 2Z91B 2GBUA 3ESNA 3FQNA 3NSDA 2J6EA 3PWPB 3VXPA 5IKCA 2W0PA 5F7WC 3VFNB 2B1AH 2CDEB 2CO7A 3H3PH 3RVVC 1HKLL 2ATKA 1MLBA 3S97C 5KEZA 4I3RH 1B90A 2BIOA 5IB2A 1OPGL 1PZAA 3IDYB 3EJSA 3U2SB 3BISA 1QP1A 3CXDL 3GMQA 1SZNA 3I9PA 3PWUA 4JJ5B 1ACZA 2R8SL 1V7NH 2EDFA 3V0IA 4NGHH 1SEQH 1ZSDA 3LIUA 3HZVB 4PIBA 1NCBL 3N44F 4M62H 4KJWC 1MWAH 1A7RL 2KZ1B 1JNLL 2R59A 3NVQA 1QAWA 1IE5A 2F54B 5FYKL 1MFCH 2FGWH 4LGRB 5JUEL 5TE4H 2ZCKH 4AYFB 4CN6A 3O3DA 4U4IA 3U0PB 3O3AA 3HS0A 5EDSA 2BX5A 4X98B 3V4UL 3WIHH 2TSBA 1M6UA 2X4QA 3GXTA 2LAAA 2DKUA 3K8MA 1JZFA 3NPSB 4I0PC 5TQ0H 2XTJE 3QPQC 3BVXA 2NCMA 3QULB 1XIWC 3MOQA 5T1LA 3L3IA 5E6RB 1H3PL 4NRZB 4EDXB 4OLEA 1VB9A 4R4NC 1DLHB 5TPWL 3DDGA 3LMJL 1SHSA 4K9EH 1DZ0A 1NL0L 3CVHH 3B56A 1ITCA 4KQ3H 4QHKI 4IBVA 1IM9D 1A6TB 4JO3L 3LOWA 4M6NH 3O2DH 4GKLA 4R3SB 3N1QC 2IANB 2X4RA 1FP5A 4LCIH 5TF1H 3RZCA 1ZGLB 3E3QE 2YD4A 1A9EA 3DDFA 3CD4A 5CSZA 1BJ1H 1FQ9C 4BV1A 1CGSL 5E6IA 4UINH 3HG1D 3EH4B 2CUHA 1CI3M 1R3JA 2XNAB 1NAML 2X53A 2Z4TA 4AL8C 3L4TA 2XSKA 2VDRB 5HSFA 1HCFX 5IV2B 5FYKD 1H3XA 1WA0X 1OAZH 4HC1A 3R19A 3QFDA 4RMBA 5SX4H 1KB5L 5HHOD 4UZUA 1J9SA 1FFRA 3BN9D 2Y24A 4JKWA 3WKPA 4YFEA 2WP3T 4XP1L 3L3DB 3H9YA 2B0SH 3HIZA 4AJWA 3W9DB 1C1EH 1XSJA 4GAJL 2HKHH 4K3JL 3PWNA 3C60B 4L5FH 5C0CE 3D05A 3D2TA 1PD0A 4FFYL 4MXQD 4NNPL 3SDAC 3V6OA 1Z9OA 4X5WB 3ZPDA 4JPVL 1IBDA 4ZUVB 1KUMA 3RWHA 2XT1B 4Q56A 4Y2NA 2EDQA 4Y2OB 3WIFA 4TMPA 1DLFL 1ZS8A 4XMKL 4G8IB 5I66A 4P2YA 1N5YL 2VZSA 2IF7A 3ET9F 3VGAC 1UACL 1HK6A 1S7WB 3HMWL 2FZ3B 3DV4A 3C5ZD 4EN3B 4JZOA 4EUPG 2OULB 3MJ9H 4X7CC 4PLNC 3QUYA 3WEXA 3RIFF 3FCSA 4Z3IA 2WZ5A 5EPMB 4IRSD 4XCFL 4BYHA 2WXHA 4Y5VC 3TV8A 1ZTXL 4GAGH 2LFGA 4AW4A 3Q5TA 1NBZA 2QQKH 3M8OL 5IHUH 1YLBB 5AW8B 5JXED 3GZPA 2EO7A 2X6VA 3CJJA 4H88H 1OARL 5A2KH 3HLAA 25C8H 5KSAB 3WHXB 2FT6A 3OC5A 2DQTH 2JJUA 2P8MB 1KIQA 1GZHA 2OMTB 3GSWA 3D4GA 3VWKD 3CV5A 1F58H 1FL5B 5SX4I 1HWGB 3D39E 3LQZA 3LZNA 4JRXD 4DNLA 1UEYA 1WFUA 2Y1YA 4HBCL 4ISVA 3LV3A 1FA4A 1JV2A 1VFAA 3T77B 3C09B 4MQTB 1UWGL 3AS0A 3QJQB 1N10A 3TBWA 1S7SA 1ZV2A 2CR6A 2WOYA 3MBEA 4QCIB 1L3NA 3SQOH 3DX8B 4B60A 4IMKA 5F1IA 2XWBA 3UYRL 4S1QL 1QPKA 3QYCA 2P46B 4WCYH 4ZNEE 4Z3HA 3IVKA 4YPJA 2F74B 5C8JA 3RFZB 1KGYE 3FHAA 4MA7H 4U6XB 4N2OA 4YHOH 1A4JA 3QHZL 4NQEA 2R69H 2AI0L 2ICES 4XVUD 4LOVA 1IQDA 4MZ3A 1R24A 4QT5B 1O7DC 2X7LA 4IOFC 1IGYB 4MQ7A 2GTWA 3ZZQA 4AQAB 1OM9A 4CW1B 3LKOB 5D2LF 3MTXA 4IS6A 4RX4A 4PWFA 2Y2YA 1BX2B 3ZHKA 1I1AC 3DXAA 4MA8H 1WV7T 5AW9B 3D9AL 4HUVB 4TUOB 4RGOL 3OQ3B 3BEWA 2HX7A 5C0JB 1B2YA 1BG1A 2JIXB 5T3ZH 1A14H 1AAJA 1FVDA 3MXWL 3O4LA 2OMYA 5DRZA 4G1MB 2J43A 4YHPA 1DTUA 4EAEA 1L9PA 2CKBB 1IGJB 2BS8A 3MRIB 4HG4J 4H8HA 1EFXD 5LAPA 3FQRB 2HA1A 2WQ8A 4K9EC 3U1SH 1NC4A 2EZ0C 4HSQA 1EZSA 4LSTL 1ZANL 3E6FA 3A47A 1JZJA 1RZKH 1L6XA 4JFED 4G6KL 2VQUA 3CMOH 1QUNA 2CNYA 3BAIA 5FHBH 5ADPH 3BRFA 1FYTE 4P48A 2BPBA 2IDQA 2OI9C 2Z92B 2JE8A 4WFHE 1OAJA 2VL4A 4X6BB 3MV9A 4JANB 3RTLA 1E3FA 1MF2H 4E36A 2E86A 1INDH 1XH2A 4NSKA 3FB7B 3V5KB 3CX5K 3GI8L 2UXGA 1NAKL 2NYZA 1M2VB 4EBQL 1S7UB 4XN7A 5I8KL 5CP3A 4CJ0A 2OMXB 4OZFG 3LN5B 4LL9A 1OB1B 3WXVL 1CS6A 1KGCD 1LP9E 1R3KB 4RDQF 1L7IL 3WGVB 2VQ1B 2XTJC 4YHLH 1SBSL 5KBKA 2EVHA 3N6YA 1QPPA 2KL6A 3ZE1E 4QWWD 1FFOA 4L1LA 1UOLA 3N85L 2Y7LA 1WBYA 5B39A 5KSUA 3IJYB 2WLJA 3OL2A 4AQ1B 3QUHA 3ULUF 3RX9A 3HAEG 5C70A 5HVFB 5GIRA 4L2YA 1T04A 3GHBL 4ZUTA 3UJIH 1T4KB 3SPJA 4XBEL 1T89C 3ZL1A 1S9YB 4JFYB 4F7TA 4KRMB 4Q4EA 1XHHA 3AM8A 5IM7B 1S6NA 2YOCA 3QDJD 3PRZA 4PJCF 1CICD 3GSXB 3KLLA 2FWOA 1KNOA 2GFBA 3ILEA 4N85A 3RWCB 3E3QC 5TDNB 3EJZD 5GISH 4M7LH 1OHQA 3V7MA 4NO3A 4I0PB 3S4SA 5INCB 3FU6A 3A4DA 3GPEA 1M57B 4KKAC 4MCMA 5FA3A 3VD0A 3L3HB 1E4JA 1CIDA 3V9EA 1CL7L 1DVFA 1ORQB 2GAZA 5AZUA 3STZB 3V0WH 3OMNB 2QPDB 1LEKA 3AT0A 1T80A 1KGUA 1A7NH 1KENH 4UV4L 2OSXA 1JZ3A 2WUCH 4EZLA 1WZMA 1MZZA 4ELKA 3F5WA 5HYFA 4QHUB 1MI5B 1YPZE 4JRYE 3V52L 3L4ZA 1MCDA 3CK0L 5IGXL 1UQSB 3TIDA 4KK9C 4C4UA 4L1DA 1BFOA 1EXGA 1YC8A 1HAUA 3CHSA 1I53A 3SDXE 2B77A 5C08A 3EO1B 5L2JA 3TT1L 5DJYB 4LSUL 4UT9L 3BWAA 3VWJD 4NP4L 2XYBA 4BFJA 3TN0A 1N6VA 4JN2B 2FCBA 5HJDA 3WS6C 3T4YA 5DQJB 5BRZD 1AQ8A 5ALCL 3NSXA 1RK0A 4MZIA 1HCZA 2PW1A 1BIIB 2R29H 4JFFA 5AKVA 3V0FA 4M00A 1SRDA 2Y36H 2ZXEB 1CFVH 3JWOL 5DEGA 3UXFA 4FYSA 5CR8A 3NRFA 5ICXA 3TXAA 1ETJA 1MW0A 1U6AH 1TJGL 2QZ5A 1F42A 1GPOH 1O6SB 4AMKH 1FGNL 4EZMA 2CD0A 2X2IA 3P4LA 3SZKC 2FK9A 1HQRA 5CM1A 4E41B 4K94L 4NQDD 4GUPA 3FDWA 2WCGA 5M7QA 2JJVA 4ZFZA 4KAQL 3H55A 4W9HC 4UOQA 5TD4A 3SDAB 2OSLA 4P2QA 4ZOCA 4I4WA 3K6IA 4XNDA 4UDUB 1A7OH 4LU5L 3F6IA 3KJ4C 2YSTA 4GRMA 2XY2A 2YKLL 1U3HA 1CGWA 1GAFL 1M7IA 1FZKB 4U3HA 4V1DA 3FRPG 4XWGH 5TJWK 2WNKA 3BDYH 3CSYA 4JFDA 2DBLH 3TYGL 1T03H 4KKBC 4QRQB 4JY4B 4UQ3B 2Z0UA 4TQHA 4LPVA 2F6AA 4ZTPH 3T3PB 3F2LA 4QNPF 4BZ1A 2Y3NA 4GW5B 1GH7A 3BE1L 3BWUC 3L6FB 3NEOA 3CZKA 3QUXC 2EDJA 2F5AH 4LO9A 1I7RA 4AI7A 3DMMA 5F71A 5TFSH 3RWEB 1A6PA 2VH5H 5IBTL 4CVXB 4OF0A 4ORZC 3IDGB