4IKNA

Crystal structure of adaptor protein complex 3 (ap-3) mu3a subunit c-terminal domain, in complex with a sorting peptide from tgn38
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
255
structure length
249
Chain Sequence
FIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHNISFSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQKLPSLKGLVNLQSGPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords AP-3 complex subunit mu-1
publication title Structural basis for the recognition of tyrosine-based sorting signals by the mu 3A subunit of the AP-3 adaptor complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 52
structure length 249
sequence length 255
ec nomenclature
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iknA01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iknA02
1BW8A 1BXXA 4EMZA 2VGLM 2JKRM 5FPIA 2BP5M 3H85A 2PR9A 1H6EA 4EN2A 4UQIM 4IKNA 2JKTM 5C7ZA 1I31A 1HESA 4MDRA 3L81A
chains in the Genus database with same CATH superfamily
2F8VA 3BUPA 4XBMA 1FJ1A 3ALWA 4UU9A 4ZMNA 2OZ4H 4QJ3B 2JCCF 1QRNA 3EO9L 3GRGA 2RBLA 3PDOA 1F1AA 4WI2A 2R4RL 1HT6A 3DKHA 5DLLA 3TH3T 3VGAB 3IMBA 1PDKB 3QC5X 2B39A 2F74A 2IV9A 4B60A 3QJXA 1PAZA 1KN2L 3OAYK 5GRYA 5I6MA 1H6UA 1HXYA 1OCWH 4DZBA 3P2DA 5CAYB 1YHPA 1MJUL 4MXVE 4UNTA 1BM3H 4QHKI 3GLEA 4Z9KB 4LXFA 7TAAA 4Y2DB 2KZ1B 4AUJA 2CKBB 3CG8A 3QCTL 4K5NA 1P2CA 2XCMC 1P4UA 1HCVA 2DQUL 2VDQB 3M07A 3WAJA 3QCVH 2A74C 2OS7A 5AZ2L 1UD2A 2WLNA 2EAEA 4HMEA 4KO7A 3INOA 3KH3A 5EG6C 1FZMB 5JO5B 2NTSP 2QQLL 4GW1B 1UH3A 3CSPA 4NO3A 4XC1L 1XZ0A 5D96B 4XXWC 4XCYB 3P4NB 4MAYC 1BQKA 3HC4H 5E0QA 3VXMB 1QNIA 1OALA 5DEFA 3E38A 3WLWD 3GRBA 2F61A 4JREC 5DWUH 4K8RL 2NT1A 1OD9A 5JDSB 1YNKH 2OR9H 3Q05A 1D6VH 3ZRCC 3LIZL 4K71B 2JELL 4D3CL 3V52L 5C2BH 3U1PA 2NY5H 3P73A 3ZZQA 4NC1C 2Q8AH 4RGNE 4KJQC 3QUMA 1Q0YH 2FWLB 4J1UB 1NBCA 4G7VL 2ZX8A 3VACA 1WT5C 2RTTA 1C12B 2XPGA 1SLVA 3O6FC 1R4XA 1MI5A 3WEBA 1ZV2A 2DIBA 2EEBA 4X6FB 3W0WB 2ZWSA 3F8UB 1IC4H 5H35B 4ACTA 4LQFL 5TF1H 3Q8EA 5J1SC 3A24A 5JXAH 2AJZA 5D5MB 3RZCC 4BZ1L 4X7TB 2XFXA 4RMTA 1CFSA 1L9NA 4OAWB 5A2BA 1ACZA 1G7JB 1U6AH 4OZIA 2LE9A 4IRSD 3GMQB 2IEPA 4CBPA 1IGCL 4PBDA 1ZTXH 4F33B 3S35X 1TKWA 4M3HA 3RY6C 4B9CA 3DGGB 4XCCL 5IBLD 3I2CH 4RFNB 2LU7A 1SJHA 4L8SC 3RWJB 3GHPA 3BRDA 3DX9A 3Q5YA 2MTAA 1XTMA 2CJ3A 5AB0A 5DC9B 4HA1A 4Y1AA 5IJCC 2WIMA 4YXKL 3HZKA 1F02I 5D1QE 3G7TA 1SEBA 5I17B 5CD5C 2OMTB 1WZLA 3OXRA 4RAUB 1P5UB 5AYUH 1ZANH 3D0VA 1IT9H 5KSBA 1AZZC 2DM4A 3JWNG 4L3CA 5D7IB 3QZPA 4BFGA 3AQDA 2EC9U 1V3LA 2EDFA 4MHHG 4OLVL 3JWOL 1KTCA 3JZYA 1PG7L 1V10A 2XA3A 3D3VD 5DUPH 4DPCX 2DWDA 4KTEL 1I7UA 4E0RB 3OLGA 1SDAB 3M17B 3FU7A 1OAUL 4KKRA 1LJMA 4JDVB 1UEMA 5JOPE 4KMTH 3QQNA 3CZEA 4WK0B 5T1LA 3GTVA 3B37A 4NQVA 3MLSL 2YIHA 3ILQC 4HMCA 3LSOA 3HS0B 4Q6YA 1R17A 3W11D 2AQTA 4NFCA 1UWGL 1IARB 3NCWA 4UT7L 3IJHB 4R3SB 4A1RA 3EOBA 4HIIB 1OSPH 3HMXH 3EUDA 1KTDA 1T0NA 5E6IA 1VEOA 1VKXA 1MFUA 4Y4FA 4A2FA 5D93C 3U7WH 4FL4C 2EDWA 5ICXA 4JHZA 1O7VA 3RWGB 1ZLUK 4OZIF 5EU3B 5K9KB 5F71A 3DVIA 3KR3H 5AW5B 2WPGA 5FWRA 4Q6IC 1EHLL 5EZLA 5KBPA 1VACA 3RUGA 1TZAA 5I8EA 4YZFF 3SGKC 3ZDZB 1ZS8A 5BNXD 3LH9A 1SM3L 3FMGH 3GMMA 4FLSA 3QNFA 5FV2A 4LARL 4ZUTA 4K4KA 1OT1A 2WZ6A 4PRPD 4FERA 1T5WA 4XMKH 3FU5A 3SKJL 1AOZA 4YK4B 5ABZA 1XL6A 1GY1A 4PLNC 5KSBF 3BP6B 3CVIH 3DNKA 1CL7L 2WAHA 1YEHL 4PWHA 1OE1A 2F1BA 3D3VE 5CZRA 5F44A 5LUMA 2MFNA 1EXUB 1NEZG 2I32A 3ZYIA 4HK0A 5DU7A 5EH1A 1CD1B 1WFIA 2L0DA 1WD8A 2QFPA 4IEFA 4U1KA 1LP9B 5MEPB 4WLCA 3O3AA 1V3KA 1ASQA 1FVEA 4OIFA 3CCHA 4LL9A 4YGVA 2ESVB 3VGFA 4MB4A 4M1DL 5L7XL 4H13C 4QRBA 4KOCA 5BOZG 1F8TL 4HVBA 3VFTA 2WB7A 3H85A 4IJTA 4A6YH 4ZQKB 1LO5A 5HYEA 1MCRA 4LCIL 1CQKA 1NBVL 3ULSA 2WLHA 4LF3B 1U8CB 4JHWH 2CUIA 3QORA 1YUKB 1UXSB 3B9KB 4GOSA 3HBPA 4JM0A 4JL2A 4IBQA 4J3WA 4RRPM 4X80H 5AVWB 5DYFA 3UTTB 5I15H 5FHAH 4DH2A 1P84K 2XA8L 5F97E 4PCYA 3CDYA 3CLFH 1NZRA 3RNQB 2VLKD 3NJIA 4KKAD 3P0VL 3UMTA 5M7QA 3F05A 3RUGF 4K8RC 1O7SA 3BW9B 4KI5F 5GIRA 4M43L 3RKDD 3KYKH 1QACA 3NN8A 2OTWA 4NPYB 3SD5A 1R5WA 4ZXBB 4PRPE 1HNFA 2BNQD 4R7DA 3VD9A 3UPRB 1UD6A 5E8PA 2EIBA 1PZBA 3L95B 4BQ6A 3BZ4A 4JGNA 3V4VB 5J13C 1MOEA 2I5YL 1BIIB 4PJ7E 4MZ2A 1AZBA 3OKOA 4ELMF 3C08L 3OJVC 4JQIH 5B1CA 3IFLH 2V8LA 3WO4B 3GHEH 4Z7VE 3D4YA 5CEZD 1D5RA 5I1EH 3QEGL 3ZZLA 3BMWA 5B1JA 3GB7B 1WDAA 2WKOF 5KG9B 2LU5A 4TULH 4WVRA 3C5ZC 4DQOL 5IEHB 1VADA 1S9YB 2WXMA 3QPQD 5CBAA 2N56A 4P2OB 4M6MH 3U36A 1OTUD 2DY2A 2YOCA 1A6UL 1BFTA 1GZHC 1NEUA 4WHCA 1X5KA 3NUKA 4ZS6C 5DRWA 4JS7A 1KENL 3IGFA 4JVWA 4NIYE 2I7SA 3QIBB 1IC0A 2PCFA 1R5IA 4KWUA 1X5JA 4UQ3A 4C4BA 3AAZB 1VZHA 3GSRA 3DARA 5ID1B 2IVFC 5BUAA 3PJSB 5HPOA 3DK2A 3GRWA 4Y4HD 3SBPA 2AJ3A 4WWKB 3F65A 1XSOA 1MH5B 1XD1A 4D7PA 3HPJB 4BH7A 3RDTA 5EDSA 3CZJA 4JN1L 2VLKE 1JGEB 5E4IA 5F93C 1DQVA 1JMZA 1N7MH 1NAKH 2ZIDA 3J8F7 3ZE0F 3TBWB 1CDUA 1HYSD 2YPVA 5CXPA 4JPVL 3G5YB 3JWOC 4W6XB 1P7KB 3QEHA 1AQDB 1RIHL 2QADC 5D2LA 1IGYA 1NJ9B 4HJJL 3II2A 4H1LB 1GGTA 5D55A 4ZI8A 3TZVB 2JLPA 3N85L 2EDYA 2G3NA 3O8XD 5B21A 1BXVA 3QWOB 2A83A 1G94A 1TO5A 3D0LA 4MXWH 5JXED 3HN8A 1EZVY 3T2LA 2FEDD 4IKJA 4GUPB 2I60H 4L4VB 2EP6A 4TMPA 2RACA 4U1HA 2X6BA 3F7YA 3GLAA 5CEZE 1TXKA 2XRAL 4J3OH 1N6QL 4JQVA 3WUWG 1NLBL 4I18B 4P05A 1HXMA 4N0YH 1LVEA 3ZN6A 3CAFA 4TQ8A 1CU4H 3MYJA 4KX9A 2PPCA 5IMOA 5A3IC 2FJUB 5I5IA 1K85A 4M9PA 3L7FA 4HJSA 4MCZA 4PYHA 1X5ZA 1SVBA 1IAOB 3H55A 1K9TA 1R46A 3HVDA 4YVUA 1WS7A 2A9CA 2X88A 5DYOA 1W72L 1HN1A 3FCGA 4JE4B 1J1OL 1OAXL 4WSKA 4X7SL 4FP8H 4GUOA 1WAAF 2W65A 2FQDA 3P77A 1TZIA 4P5TA 5JIDA 1SJMA 3OAWA 3EW3B 1A1OA 3BDBA 4C57C 2DQHL 3ARBB 3X12A 4WUUD 1D6EB 3VRJA 3RAJH 4CN1A 2WLZA 5AD0A 5M95B 3ARFC 2COVD 3LEXA 4PGEB 4G43A 1U8QB 1DDHB 4JY5H 2WINB 5JMRA 2AK4E 4P9HC 4YZWA 4FQJH 3RJDA 4PP1D 4AMKL 1GHFL 1QFUH 3B9DA 4PVMA 5DK2A 4G83A 2NW2B 1HHIA 4PREA 1GY2A 4U1GC 5FKAA 2WP3T 1DDTA 2B59B 4LLVA 4X0KB 2HG0A 3HRZC 3MOBL 1CO1A 4Z0BL 5IQ9B 5D2LF 2AZAA 3NAAH 4HX1A 1JRHH 4PIBA 4XBGB 3SOTA 3VFMA 4HKBB 4KTYA 4DP7X 2W59A 1OTTD 1FSKB 5FECA 4GMSL 1AGCA 3ARYA 4NI3A 4AM0B 5HHME 1R3HA 1KGIA 2K7QA 3QUYD 3ZVVA 2J57A 4YX2H 1G43A 3HI5H 1I1FA 3FSZA 4WI6A 5DVLA 4D0DB 1J1XL 4C83B 2G5UA 1ROWA 4TTDC 5TDOB 4EI5D 1KMGA 1GSMA 2ICEB 1FGVL 1R34A 2AXFB 4D0CA 1EDQA 3US1A 4QT5A 3RA7L 5ICYB 3CBJB 4TLTA 3A67H 4PVBA 4P4KD 5ANME 4AENB 4K55A 1F56A 3HG1B 1ZK9A 3MRFB 4MXVF 4PEEA 1S7WA 3IDIA 4GG6E 2DWYA 4X9GA 2YPLB 1FLTX 3U46B 4JRFA 6FABH 3HC2A 1VHPA 2BSRA 2C34A 2ENSA 3EYFA 5E8OB 3SYOA 3BGFC 4EEEA 4JX0A 1MY7A 1MF2L 1YJDH 1ZK5A 4ZO8A 3BD5A 3KBPA 3QDGB 2DKUA 2QMJA 3U2IA 3KPSD 4CUCA 4L8BA 5D1QA 3S3BB 4FQIL 3KPQB 4PLOB 4POZD 4KITB 2E7LC 2BC4A 1NCIA 8CGTA 1JP5A 3GXTA 3CTTA 1H3TA 2AITA 1T4WA 3ECUA 4O02H 3NCXA 4GNKB 4GRWB 2MIZA 5EWIL 5LGJA 4I1PA 2AJUH 3V0DA 3STZB 1SZNA 2ZX5A 5AW2B 1DSFH 4NNYB 2CHWA 2X87A 4HBQA 5C9KA 1DBML 4AGOA 4DESA 3RE0A 3FO9A 1S8DB 5K33A 3U2SB 4U1JA 1UZ8A 4YDVB 1V3MA 3OAYH 3FN9A 1CXHA 4DGVH 2Z65C 1F42A 2ARJQ 5ESQA 1DUYA 2DIEA 3KBEA 4JANA 3VU1A 4TVPL 3GC3A 4AC2A 1O9WA 1G9EA 5IK3B 2FB4H 5DHVH 3V6ZB 2R2EA 3PGCB 2DEYX 5GZOD 4U1SB 1UJ3C 3HZVA 3EJCA 4AGMA 2R69L 3IB4A 4YSTA 2G0LA 2X7LA 2N0KA 3RWDB 3W39A 2H5UA 4FFYH 4GUQA 2UZYA 1KPRB 1IKNA 1RUML 4I0PC 3RTQC 1J1PL 3MOAL 1IB5A 1NCCL 2X4UB 1UA6L 1CDCA 2WVUA 3TCLA 4ANKA 3MRLA 1INDH 4L0PB 3KS0H 7CGTA 3LKPA 4X6DE 2EUZA 3LNDA 2BNUB 4GFTB 3MBED 3SYPA 3TNMB 1XB8A 1NGZA 3BLPX 4EVNA 5E1GA 4QHLB 3K2UH 3WFDL 3I9GH 2MKLC 4UTAH 4MMXB 1ID5I 3LV3B 3KPSE 3IF1A 4PJ8D 1X5YA 2YSSA 1JZ6A 2A6IB 2JQZA 4MA3A 3FHQA 3UGUA 2VDRB 4H40A 1BZ8A 1O7DE 5EC1B 2ZXQA 2NXZD 5TDPA 1CDBA 4K9EL 43C9A 1EXGA 5EO9B 1N9PA 3KPPA 1QFOA 5J11B 4OFIA 1ZSDB 2DDQH 1WICA 3L13A 4JQXC 5HYJB 2B5IC 2OJZH 3D3VA 1ZA6A 3NJXA 1IJ9A 1VRSA 3FO0H 3TV8A 5FUCC 2QKIA 5I82A 3MRKB 4PJFB 5IR1B 1HH9B 4LRNH 3EHBC 1I82A 5FO7A 2PWFA 3LD8C 4YHNA 4U1IA 1AE6L 2JK5B 2WVVA 3NRFA 3TPUB 2CK0H 3U2JA 2XKNB 3PY9A 3NJNA 5CIPA 5FM8A 4OUUB 4IOFC 1Y6NR 4JDTL 4Y5XA 2ZKYA 4RWHA 1UGKA 2FECL 3ULVC 2OZ4L 3KPLB 3I3BA 1AZUA 4GQZA 4NWUH 5D7JB 5PAZA 3SDYH 1RKRA 3DV4A 4JO5A 1T2QH 4MAUH 3EADA 3V6FB 2ZONA 2FWOB 1MJJB 3ZX1A 5HD8C 2BS8A 5HPMA 1UD8A 1S7SA 1OCWL 2B1HL 2MHAB 2F53B 4MQSB 3L4YA 4CMMB 1BM3L 1T22B 3MA7B 3TBSB 5E1HB 1FG2B 4EBQH 2UY7B 4W9CC 5F7DB 3V5KA 1EJ6A 4IYKA 4OQ1A 1HOEA 4PRAA 3FH8A 2Y7QB 4PRPA 3F7VA 1DLHA 1U3YA 3BGMB 4JHBA 4BHUI 1TLKA 1M56B 2QR0B 3DRQA 3FO2B 3F04A 3QCVL 3UMNA 3MMEB 4PJ7A 4EMZA 1S7VA 5B8CB 2R27A 1U8KA 2HA1A 1FFOB 2EYTA 4GAJH 4XCFH 5J56B 2Z4QA 5I1LB 3LKSA 2K4WA 4Z7VA 2OJEA 3HC4L 3R4RA 1IAKA 2PYFB 5A16A 2R4SL 5IJBC 1L9OA 5E5MB 1HQ4A 2R59A 2Y2YA 3WGUB 1T03H 5DWUL 1Q72H 5HHOE 1YNKL 2OR9L 4Z7OE 1D6VL 1RVFH 3NJGA 5C2BL 2NY5L 3VD3A 3CFMA 5EU4A 1DQJB 1ZLUH 2F9BT 3H7BB 2Q8AL 4UDUB 5A6LA 3EJTA 4B95C 3FT3B 2G60H 2IDCA 3GWJA 2W60A 2EDMA 4APXA 1MIMH 4Q97A 1Z1WA 1MFEH 5GS3A 3ZIYA 1AXSB 1O6SB 3SQBB 2Y23A 3T1FA 1BFOA 1IC4L 3BSZA 5TF1L 5C0GA 3WFEH 5JIPA 1ED3A 2D0HA 1J8HB 5JOFA 5JXAL 1EZVX 3MREA 1TETH 2FUQA 4IIQB 3VFNB 1U6AL 2VLKA 5JA9A 2WCPA 3HAEG 3PV6B 5I16B 5CJQH 1QEXA 2NY6C 1ZTXL 1F00I 3L16A 3QXTA 4L23A 1JPFA 2YGQA 1NFKA 3OGOE 2R2BA 1Z5LA 4YSDA 4U6YB 4PS7A 4WTQA 2A38A 3F7PC 1BGXH 1MCQA 4AYFA 3FCTA 3FW6A 3I2CL 3BUYB 4UIKH 1EUUA 4YSPA 1Z0NA 1I8MA 4OJAA 1Y0LA 1Q4NX 4XH2A 1PNDA 4IJ3B 1RCYA 4BK5A 3LRSA 4OZFG 2EVIA 2Y5QA 3MRJB 5AYUL 4BUHA 1ZANL 3NJMA 3O3EA 1IT9L 3BQUC 1OB1A 5CR1A 2BIMA 4Z7VF 1FAIH 3DX2A 1AKJB 3VWKD 2X09A 1YN7B 4PRDA 3WTXA 3P9MA 3BI9X 2ITDB 2X4QA 5DUPL 1QTYT 2VR7A 4YDLC 6PCYA 2X1OA 4RMRA 2V9QA 5I74B 3WJJA 4KMTL 4YFDB 5GRWA 1T7VA 3OKMB 4ZNCD 1BREA 1ASOA 1N5AA 1OZUA 3CFEA 3DLQR 4HUVA 2D4DA 2FWUA 5GZND 1AACA 4LRIA 1JSYA 4U1LB 4UILH 4JE0A 1NCNA 3C09B 1JI2A 4TQPA 5SWQA 4Y4HA 3VWJD 4QYOA 3APNA 4MVBD 1AQ8A 1OSPL 3HMXL 4MX7A 3FOMA 4GIAA 4AYGA 4K3HA 3L5XH 4K9EC 2J6EH 3U7WL 1IM9B 1V55B 3B7SA 2AK4A 4J27A 4L37A 5F89B 4EXKA 2PO6A 2LHAA 4NLAA 1YC8A 2NYYD 3KR3L 4ZMTA 5H4YA 2LR4A 5J6HA 1YYMH 3HE7D 4P46C 5CFHA 3O8XA 3MRCB 1SVCP 2CRYA 1WRFA 1ZEAH 4IOIB 5FUZH 3FMGL 1KY6A 5JXEA 5DJCA 3EOYG 1CF8H 4BINA 1KYOK 3WY3A 2VITB 3QNXB 4OH2A 1NKRA 1CI5A 1PFOA 1Q9OB 3GO1L 1BD2B 1X7QA 2WC7A 3A6OA 4U7MA 4ZO7A 4HF5H 3QG6B 4WO4B 4XMKL 5E8EA 2H3NA 1U36A 4FG4A 3NRQA 2FECI 4XNZC 5KVDE 4FQXC 1NL0H 2OPCA 3L5HA 3CVIL 2A99A 1E9PB 1WA2X 2YD9A 4R26H 4XOAA 1HCZA 3AREC 2BCKB 2EINB 2NY3C 2YGVA 1N59A 3X1EA 4ZMOA 5I0XA 3SPJA 5JIIA 3FOLA 2W9EH 5HHXH 3ULUE 1L0PA 3VYOA 2NCMA 5ANMA 4HZ1A 1K6QH 5GSVA 3U25A 3ZR6A 4GG6A 1JGDB 3LEYL 3HUJE 4NXKA 5ACZA 4UNIA 2A74B 2Y0SA 2Y6SC 1V7MH 1WCBB 5I6NA 1UB5B 3CSFA 2JTYA 3W9DA 1XH0A 4MAYB 2KBGA 3UTQA 4A6YL 1F45A 4P57B 4GP8B 4TUJA 3WBDA 4ZQTA 2QGEA 3BWUC 1L9RA 1TQCC 1ZT7A 2GK0A 4JHWL 1UATA 3KLKA 3V10A 3ARGC 5C0EA 3KWVA 2E9BA 1JZJA 1EMTH 4X80L 3U9WA 3VFOA 2A6DA 5I15L 1OANA 1WFJA 1H3WM 2A9AA 2QTVA 3CLFL 4A2MA 2J8UB 4GO9A 4FKHA 2LLLA 3W0WD 3NJFA 5LO7A 1DZBA 4ZO9A 2DQCH 3O6FB 4UT9A 1PJWA 3CSYA 2X9ZA 4F8TA 2NY5C 3QUYA 1HJCA 3X3GL 3LNIA 3FHAA 3T6VA 1UVQA 1ZGLP 2H1XA 1OSEA 4QLWA 3GZQA 4LNRA 5J8OA 2WLKA 2X40A 1I4FA 4U1NB 3S4SA 1N0XH 4JQIL 1FNLA 1P5VB 4D7BA 4L29B 3GHEL 1VSCA 5AZEH 3T8MA 2CCVA 5HGHB 2C7FA 3GSUA 3QAZB 3CPLB 4KTGA 2ZAHA 3PWVA 1N68A 1D5ZA 2YN5A 4P4KA 4PJAB 3GBEA 4ERSH 2BVPB 4AV4A 4X6DA 5AB1A 4TULL 4L8SB 4YDJA 1UA7A 2AJVH 4UQ2A 1A6TB 3MNDA 3BUBA 3PL6A 4GG6F 2P26A 4M6ML 3IPFA 5C07B 4GT0A 1JPEA 4FYTA 5KVEH 3KPSA 4BK8A 1G7PB 1MCOH 2C4FT 2CIKB 2FK9A 4RDQG 1O9ZA 3DJSA 5F9WC 2GTQA 1N4XH 4FNRA 1JTOA 5KANI 5A6MA 4QYAA 3V0AC 4M7ZC 4KH9A 1Z2KA 3DTXA 2HX7A 3PDDA 3IJSB 4R9HA 3D51A 2B3IA 1B0RB 3I6GB 2DQDH 4ORZC 4JHAH 5DVKA 4D9QD 1JYNA 4JMXA 4OJYA 3LVTA 1X5IA 3KVQA 1N7ML 1NAKL 2EC9T 1NIAA 4WGWB 5KYNA 2VM3A 4PBWD 5ETUB 2WD0A 1U8OB 3HKZA 4MJ6B 4GRLC 4OGYH 5AOZA 5IVZA 4AYSA 5GZOA 3UXFA 1OCZB 4JKNA 2FO4B 1MAJA 1SHWA 1H5BC 3BPCA 2I60L 4FL4B 2J1ZA 3CSBA 2XZCH 2NUTB 3TFKD 4OZHF 3QZNA 1NMAH 3ES6A 1I7RA 3FYEB 1TYRA 3RPIB 1PKQB 2O6DA 2V5TA 3K6OA 4N0YL 2XX0A 2ZUXA 3SKMB 4IBTA 4U1MB 1HAUA 5CJOH 1DJZA 4O00A 2VM9A 1I7ZA 2ZT9C 2OMUA 3MBEA 4HJEA 2GITB 3UP1A 12E8H 4MS8C 5D7IE 3LZLA 1JZDC 5FW7A 1MVUA 3DXAD 3VGGA 2HFTA 4PJ8A 3C8KA 4JFDB 1B4LA 2NLJA 4E9YA 3W3BA 3CXDH 4MS6A 4K0OA 1MY5A 2B9AA 2CO6A 1RV6X 2CHNA 4PV9B 2ZF9A 5DZLA 4FP8L 4APQA 1HWHB 2K6YA 5IJKA 4Y16C 5E94B 3U0TA 2BOBA 1I1YB 4MTMA 1KB9J 2WYTA 4ZSOE 3S48A 1A8ZA 3TCTA 4D9QE 3IDJB 5JQHC 1ND0A 4XN4A 4NQEB 1DVFC 2DMGA 3RAJL 4EPSA 1IIIA 2P8LB 3IDNA 3PNWB 3T2PA 2W8CA 4JY5L 2ESVD 3B34A 1D2OA 4FQJL 3LQZA 4P04A 4IRJD 2ADGA 3KJ4B 4PRNB 1QFUL 5HHOA 1S7QA 2V33A 1JPTH 3QNYA 4FQ1H 1QQDA 2PR4H 4WDIB 4F7KA 5J12B 3GJFB 4PCSA 5D1ZD 3BUQA 2XG4B 3NAAL 1JRHL 1EIBA 3VFVB 4I88A 3I84A 4UCFA 3Q2CA 1VDGA 3L54A 3EJZD 3H1ZA 3ECBB 1F0LA 4IGBC 2WWNA 4PJ9D 1IKFH 2P5WD 4JRYE 4YX2L 3WE6A 3IFOA 3VQMA 4JFQB 4BD4A 5GS1C 3HI5L 3LS4H 3VD0A 5L9DH 2HTLC 3NSFA 5C0BB 3SY0A 4N2NA 4QNPE 3ASWA 3SY6A 1U8PB 3C12A 5T3ZD 5I6XC 1HJBC 4WI4A 3MX0B 5CD3A 3BWAB 2V7HA 5JPMB 2BVTA 2VAAB 2VDPH 3N40P 2X89D 3GMNB 4MZ3A 5A2AA 1E8XA 3DXAE 3UZEA 2E4FA 3A67L 3T3PB 4XNQA 3C6LC 5DD5H 4H4NA 3HMWL 3Q44A 3F7KA 2RJMA 1AYOA 3ZTJH 5GGUB 4TLUA 4A66A 6FABL 1YEGH 5J13B 3FUEA 1KEGH 4MJIB 2WZAA 4Z7AA 5H4ZA 2ATAA 5C1MB 1RUQH 2F7QA 1YJDL 4BJLA 4XWOD 2CBQA 1K8DB 4PWIA 1U3ZA 1TIUA 4LCCB 4DERA 1JG9A 5HY9A 4Y2LA 1VZIA 1YNLH 4O02L 2ESVE 1H9VA 3A21A 4P0DA 2AJUL 5I1AB 3RZWA 1HZHH 4ISVA 4RIRB 1DSFL 2V5SA 3F00A 2E46A 3QIBD 2NNAA 1B0GA 1ASPA 1WZKA 3MRRB 4Z7OF 4DPBX 4AQ1C 4RA0C 1HXKA 2XC8A 1JHLH 4Q6KA 5TDNA 3WIFA 2ENPA 3P0YH 5AVZB 4DGVL 3L5WA 4DKFH 4NDMA 1HZLA 3PIQB 3WXWH 2VISB 2P5WE 2CZNA 2X6VA 3FDWA 3L1EA 2NX5E 1MJ8H 2HAZA 5ERWB 3EGDB 3A4DA 2FB4L 2Y4SA 4PJHB 5EU5A 5IFJB 4J2XA 4J6IA 3NT0A 2ADJA 2IDSA 4YN3A 5T3ZE 3CFDA 4Z78A 4FFYL 2Z4TA 4RZCA 4AGNA 2GBVA 4LSSH 3TZVD 3CDCA 1RFDH 3LRGA 4DP1X 2C8NA 5IF0A 4L0ZA 4ZNEE 5E51A 4I48A 5I73B 2Q0ZX 2N7SA 2NY2B 4LPWA 1INDL 1R19A 1IQWH 5JW5B 5LCVA 2WXQA 4KROD 1KJ2H 2QFRA 4GI8A 4L4VD 4U7KA 3DROB 1IZKA 2YMXH 3FTZA 4QTFA 3KPNB 4XP4H 4XN2A 1OT2A 3K2UL 5TFSH 5I71B 5I8CA 1TPXB 4JFZH 1CK0H 3MNZB 4UTAL 4CADB 1NDGB 1UOLA 1EGJA 1U3HB 1SXSA 4Z7NB 4LGSB 1L5GB 5IOKA 2WQSA 3OKEB 4DGUA 2BXYA 3S7GA 1N6VA 2XWBB 4PRID 1U30A 5I66B 5K9OB 3W5MA 3VWKA 4N8CH 5CWSA 4E9XA 1AD0B 4WI3A 1F5WA 1N2RB 2DDQL 3B3IA 3Q2NA 4M8VA 5DD3H 4ZFGH 5DMGD 3EZJB 2OJZL 4PS8A 4DK6A 3FO0L 1RHFA 1IGJB 4J3OC 2ARJB 3FUIA 5IKCB 2A2QT 2D3JA 5BOJA 3WN5C 4I1NB 1KGUA 4KPHH 1OSZB 4TUKH 3IJ8A 4Y4KC 1ZIBA 3SYCA 2VQUA 3D08A 2F2HA 4G6AC 2DLFH 3HUJA 4TYUA 4TUOB 2YEVB 2B77A 3CU7A 3UH8A 1ETB1 1MW1A 5GZNA 3CQQA 2DN7A 3S5LA 2CLZA 2CK0L 4MD4B 3T77B 4ZAKC 3T4AB 3UPCA 2HLAB 1CT8A 4HW6A 3VI3B 3SPHA 2E9GA 3VWJA 1UASA 2R51A 3ARFB 4PP2B 4OD1H 4JHVA 4NQXB 5EZIH 3TBVA 2C7UA 3CZUB 3IRPX 3NEOA 3CE1A 2NDFA 1NGWA 4NXSA 4UIMA 5JORA 1NGXA 5CR8A 4Z3GA 5J6SA 3D39D 4WJKB 2PWGA 5B1KA 1E40A 1DFXA 5GGVY 4NWUL 1JHTB 4NRYB 2QPFA 3FN3A 3IFNL 4MAUL 3WIHL 1C5BH 5FF6A 4XNMB 2PXYD 5CEYB 2C9AA 2FAUA 2VKXA 3HE7A 4YIQB 1TJIH 2XVKA 4HLZG 3ZYZA 4I3RH 2FGWH 1DBAH 3QG7H 4EBQL 5JHLH 3QUZA 3LKOA 2FZ3B 4G7RB 1CCZA 3R8BB 3PUUA 5DVMA 1JRHI 1OQXA 3ARDC 3V7AG 1CBVH 3CUPA 4G8GB 4M5TA 5FO9A 4WEUD 1C5DA 3FT4B 4PRIE 4BYHA 2B8OT 4YDIH 5KJRL 4NWTH 1JD9A 1HQRB 2AEIT 4GAJL 4XCFL 1DJWA 1F13A 2PUQT 4L9LB 5DEGA 3AITA 3ETSA 5MERB 3WIIL 4NAJA 2IFFL 2VMFA 4HXBH 4N2IA 3W9EB 1T03L 1Q72L 3KPTA 5B7MA 5JO5A 3ULUF 5E23A 1RJZB 1VERA 5MEQB 3BGFB 3CXFA 1BVNT 5JHMA 4W4OA 2NQDA 3BIBX 1JF1B 4KKCD 1WEJH 2GJ6B 4N6RA 4DKAA 3MLRH 3TV3H 1EDHA 4N1EA 2D7TH 3WTSA 1DP0A 1J9TA 2AERT 2ADFH 2G60L 5JDSA 2A0LC 1MIML 2FEEL 4G8EB 1HC1A 1MFEL 3FUNA 1KYAA 4S2SB 1QW9A 4GI9A 3D39E 3F7RA 1YJDC 2QPEB 3POHA 1R3IH 3WFEL 1P6WA 3KW8A 1A2YB 3JZ7A 5C0DB 4B3EA 1ZKAA 2KQNA 4YHIB 4ANUA 1BZOA 5CO1A 1KNOA 1KGWA 1TETL 1KIUB 3EYSL 3K8MA 2Y22A 5E1QA 1XCWA 4NZDA 3WS6C 3BEVB 2Q7YA 4ZUUA 2BVYA 4AL8C 1PZUB 1ZT1A 5GGSY 5CJQL 7PAZA 2EDRA 3BOVA 2VJXA 5DMKA 2JI2A 3QDHA 2YOAA 3CFBA 1BGXL 1E3FA 2BOLA 4UIKL 3GMQA 1UJ3B 5FDYA 2C4XA 1YY9D 4NUGH 1G7IB 2NRDA 2X3BA 3B43A 5FFGA 2NY0C 5IG7B 3SGJC 3DGGA 1PZ5B 2RIKA 2YAOA 2ZUVA 3RTQB 1G0YR 2IH8A 5FFOA 1IL1B 3SJVB 3ZDXB 2VR8A 4OCSH 1S9VA 2DI9A 4OLXH 2ZOOA 1XQ4A 4W9KC 5EF3A 1OOAA 4KZCA 4N6QA 2RCSH 3BN3B 3Q5TA 2KYIA 2WUCH 1NIFA 1Y1UA 3EFFB 5AYTA 3I9AA 4AITA 4L8CA 5D8JL 1NOFA 2XI9A 4RAUA 3U9PH 3EYQD 4HIEA 1ZV9A 5D7IA 3QRFM 3BKYH 1K72A 3E3QE 1N18A 2Z93B 3ELAT 3L9RB 4M5YH 3RFZB 3CVHH 4XXCA 5D6DC 4BSWB 3Q43A 5ABAA 5DD6A 2P4AB 5HYJD 2PWDA 5J3HC 4F9LA 4JG9A 3BAEH 2XN2A 5EO0A 4M9OA 4MZRA 2VJ0A 1HL4A 2R83A 3HLAB 4UILL 2NQ3A 3MSPA 3WLBA 4ZSOA 4ADGA 3DX6A 5ADPH 1JDDA 1JZ2A 3B2UD 3RWFB 4LOVA 3PXJA 3VD5A 3OR6B 2WXFA 3VI4E 5IB3A 5EZJB 2J6EL 2B4CH 1U95B 4MKMA 2X28A 5DUMH 1E0OB 3AY2A 4Y8DC 1BLIA 1RJLA 3CC5A 3LD8B 4ANWA 2X4PB 2A3TA 4JHUA 4AVIA 4KV5E 1YYML 4B9IA 3CFUA 4WRLA 3ZBMA 3EJSA 2DMCA 4UOJA 1W72B 4QO1B 5D7JD 2XIIA 5EU3A 3TO4B 2WBXA 4WWPA 5K9KA 1CF8L 3TC9A 1ROCA 4NFDA 4B7LA 3C2SA 4N9GB 4JRYA 4M8UA 5HGDB 5D71H 4MAZA 2ZE0A 2XKSA 1ZLSH 3PJLA 3BPNC 4WW1A 3KYNA 2P43B 1NL0L 3E7JA 2FJGB 3AXHA 3FSWA 1AGDB 1MCPH 2XWTA 4U3CA 3QARA 1OAQH 4R26L 3NSXA 1DJIA 2EECA 4XAKD 2W9EL 5HHXL 5D6CA 3EYOB 3DXAA 5ECJE 5I1JL 1G1KA 2OCCB 1MFAH 4DNLA 1GR7A 3BP6A 3LB6C 4U3HA 5D7IF 5FM5M 4AJ0A 4L3ED 1QSVA 2WJ5A 1U93B 1KIPB 1EHKB 2MKWA 2WTRB 1GPOH 2X4TB 5J9PA 1V7ML 3VXPB 4NS0A 5IBUB 1CG9A 2A6JB 3J7HA 5BOPA 2GBUA 4WHYG 3TVMB 3L3KA 1IBZA 4MJ4A 1AIFA 4Y8AA 1OPOA 2Y07H 5EULV 4D8OA 5I75B 2ESVA 4HULB 1M4KA 5INCA 2BRQA 2A9MH 1W15A 1EMTL 2UY6A 4IRJA 3IRZA 1BQHG 1NAMA 2XT1B 2ADIB 2WZ0A 5MENB 3NZ8B 2XN9D 3UADA 5LDUA 2EICA 1JWMB 3QQ9D 1MLCA 2VE6B 4WEEA 1VPOH 3V79C 3GIVB 4LSDA 2XQYA 2ROXA 5D1ZA 4XRCA 2ETWA 3IXAA 3FFDA 2DQCL 3LCYA 1XEUA 3U30C 2FO1A 2VMEA 3EG9B 3WY1A 3ILEA 3TNNA 4PJ9A 2P3YA 2P5WA 3VXSB 5L8JB 2DLGA 2BOCB 2KZBA 2NX5A 2FEEI 2NZ1A 2X4NA 3B7RL 3NCFB 2UYLB 2OSLA 5G2NA 3ZDZF 3R06B 3EJRA 2AF2A 2BVQA 2P8PA 4QAWA 3LXBA 5ID0A 3LNGA 4QNPF 4XAKE 4HS3B 1BOGA 5AZEL 4N5EC 2X89A 2ZXWB 3QO1B 4ZNEA 4NCC1 3MJ8B 2HJFA 3HI1A 2VDKH 4L3EE 4JY6A 2CCWA 4GKZB 4NKDB 4NO2A 4ERSL 4HOZA 3WAKA 5T5FH 2V9TA 2AJVL 1HCFX 4Z5RA 3VW3H 4XGZA 2RB8A 2J56A 5F1IB 5GGQH 1PW3A 1A6VH 4ZFOA 1OP3H 4YBLB 5E03A 1AKJD 5KVEL 3GB7A 1KN4H 4IW4C 3NDYE 1I3VA 1MCOL 1M7IB 3HIZA 4HU8A 2J8HA 2BO0A 3SE6A 2Q20A 4LBAA 3WV0A 1N4XL 1EFQA 2IF7A 5B39G 4ZUVB 2VN4A 2YAMA 5AOIA 1NBYB 3RIFF 2DQDL 4JHAL 4N0CD 5J5EA 5C97A 3NFPA 1ET8A 2XN9E 1KT2A 2YQGA 1WBXA 3DPBA 4HJTA 4RISH 2P8MB 4PRBA 3P4OB 2EDHA 3ISYA 1I8IA 3KDPB 1SNRA 2E86A 5KSUA 2YLHA 3HPJA 1I53A 3VSQA 4ZMYA 2IQAB 2ZYSA 4ODXB 5AOKA 1IM9D 4OGYL 4TRPH 2E8ZA 4DJMA 1HESA 3E6FA 32C2A 4U2ZA 4FHBD 4BBWA 1TDQA 4LIQE 1CICC 1YMHA 2AMGA 2D2CC 3AU1A 3IKCA 4JM2C 2VLRE 2XZCL 1VA9A 3GMLA 3TZVA 1S9KC 2FIRT 3F12B 1NMAL 5C0FA 1SLUA 3JV4A 2M26A 3FQNB 1TG8A 4OV5A 4FQQA 1KB5A 5C3IA 5AAMC 4EE2A 4O51B 2OMYA 2VQ1B 5CJOL 1NGYB 1WZMA 5ES4B 4RFEB 2V2WB 12E8L 3KL5A 2OAAA 2AQNA 2Y36H 3KNBB 2ZWZA 2CO7A 4I18A 5DDHB 3CXDL 1GGCH 4CVZB 1JGLH 3D7PA 4HWZA 5CJXC 5IW1A 2AHIA 3MRMA 2NYKA 4X5WA 2EYRB 4PRIA 3UG3A 4HKJA 3GSNA 3GSWA 3AREB 4QY8B 3ZT5A 4E9LA 5B7FA 4CBZA 3T0XA 3KLHD 3X1BA 1KXHA 3FPYA 1AZCA 2BZDA 1WWWX 5HTSA 1XGPB 1UEYA 3K74B 4MAYD 1C8PA 2F5AH 5C2UB 4DZ8A 4FQ1L 2OI9C 3SQRA 4W9DC 2PR4L 4QHMA 4TXVB 5J1AA 5EOCH 4QHUA 2WXIA 5FYLD 3BVNA 2CO3A 1Y18A 2CRZA 4LP8A 1IKFL 1Z0MA 5CILL 4PSPA 1F18A 2YO3A 1QVOB 4AZ8B 1EAOA 1MAMH 3D39A 4KJQD 3LS4L 1QFWH 3UOAB 3WE1A 5L9DL 3VDAA 1R47A 4JKMA 3O6FD 1X7TA 2G30A 1UFUA 4S0HA 1BZ9A 5KYWB 1A4KA 2PXYA 2I9TB 4V1DB 1Z9LA 4EI6B 1DSYA 4IBZA 2VDPL 1HHJB 3WNKA 5ENWA 1I8LC 2FO8A 5JPNA 3PXLA 3RZCD 1D9KC 4PW4A 5DD5L 4MWFA 4KXCA 2VMCA 5T1KB 1EZLA 2GJZA 2J21A 1YEGL 5ICYA 4YE4H 4F2MB 1UH2A 3P9LA 1XD0A 1KEGL 4IMKA 2JJWA 2YN3A 1RUQL 2CXKA 1RAMA 2V2XA 3V5DA 2BIIA 4O2EB 4ZTEA 4HBCH 1YNLL 4QRSA 5I76B 4R8WL 4YS4A 5CBEA 4KNQA 1L6XA 5LGYA 1FL5B 5ANHA 1HZHL 2JKJA 3HRPA 5HHNA 3MTXA 3SE8H 2ATPA 2AW2A 2O1AA 3NP3A 4JUTA 5LBGA 2DAVA 4PSRA 4U6XB 4L1DA 1T89A 2XACC 4AYEC 2HT4C 5IB4B 3ARUA 1AGBA 4HGMA 3K3QA 3ABKB 1JHLL 4XX1E 3P0YL 1M2VB 3VFRB 5EF0A 2EADA 4DKFL 4NC1E 3WXWL 3BVWA 4L5FH 4M7ZB 3DX7A 4ODHH 3WTTA 1MJ8L 1S8DA 2MCPH 4N8PA 1PIGA 1AGEB 1BHGA 3ILQD 4QRPE 5HJGA 3BKMH 4AK1A 5GS0H 3U1SH 2AGJH 2V37A 2DQMA 2VGLM 4YLQT 4F58H 5KBMA 4AG4H 3O6MH 4P5KA 4LLYA 3VI4A 2XG5A 1RFDL 4ZO6A 1JNHB 4U1SA 5JUEL 3J2PA 4UOQA 1IQWL 3VVVA 3IVKA 1S7TB 3QJHB 1WBZB 4MXQC 1KJ2L 4GRLB 1SY6A 5F6IB 2YMXL 4XP4L 2DIAA 3OB8A 5DJXB 5TFSL 1DVQA 1KG0B 5E8NB 4KKLC 4JFZL 1DBJH 2P42B 4NQSA 5I6LA 5EBWB 5IMKA 3US0A 5SWZB 5H37H 1XGZA 3VM7A 1EDYA 4HWEH 1HX0A 4JDEA 1PX8A 3UBXA 4X4XB 3UO8B 3VDCA 5CCGE 3AUVA 1KJVB 2ED9A 4QHLA 5D4IA 3IFPA 1KBWA 4YSOA 1DQKA 4N8CL 4JFDD 4FG0A 3NA9H 2QQNH 4DHLA 2HG5B 3FRPB 4ZFGL 4Z76B 2HRLA 3I6SA 4BH8B 4X5XA 4ICWA 4N26A 4ALAC 4KPHL 4TUKL 3VD2A 4GRWF 2NYZA 4WY7H 3TTSA 2P24B 3PQYB 2DLFL 3U0PB 3VXQA 4BRVA 2OMXB 5A6IA 4LKCA 4Y16B 2G2NA 1BFVH 2F7IA 1AS7A 2FQEA 1IBGH 4HIJA 4L9DA 2IAMC 3MRKA 2DH3A 2OXHB 5IR1A 1HH9A 4NYLA 1DVFB 3MUGA 3DRTB 4IIZA 5K39A 4OD1L 4OKVB 5EZIL 3QDMB 3CBRA 2FWSA 4JFYA 4QXTB 1ZDQA 1QLFA 5D2NB 2MOQA 3VI4F 2NY4C 3DSNB 4PR5B 3A4AA 1HILB 1WUNT 1C5BL 3G04B 3QK0A 1FZOB 4UYQA 1U8MA 3VFPA 3ZMRA 1G9HA 3GGWA 1BMWA 1TJIL 3KLLA 3KLQA 4ETQB 3FQUA 4I3RL 3BFOA 2FGWL 1DBAL 3QG7L 5D7JA 4C54A 1A7RH 5JHLL 1BYPA 5E6SB 5F3BB 3MV9B 5F3FA 5ICZB 2DTMH 3DI2B 5KS9E 5I0WA 3PU7A 4XMPH 3WTVA 4QRRE 1CBVL 5TE7H 4Y9EA 2PW2A 2VIRA 1SOSA 4K8RD 2J72A 4YVNA 4A6YB 3MA7A 4TNGA 3SQOH 1XCQA 2J44A 3VG9B 4JO2H 4YDIL 5DJ0A 1CFNA 1UOVA 4NWTL 3UJTH 5EBGA 5E56A 3C5SB 2Y7QA 1P7QB 1OXYA 2PTTB 3BGMA 3OHXA 4NKMA 5DURD 4DOHE 1F3JB 1L9SA 4KDTC 4EIZC 1KYUA 3ZLQC 3D05A 3DIVA 1ETZA 5B8CA 4L3EA 3SBRA 1FFOA 3O45B 5L2JB 2R7EB 2K6WA 3Q3GA 4M1GH 1T4KB 4IKLA 3SSGA 4OF5A 3K6SA 2VXVH 4Q9BA 1OM9A 2EEDA 1WEJL 4ZTOL 3MLRL 3TV3L 1PL3A 4FJ6A 5EU7C 3WKNA 3DIFA 2D7TL 1F4HA 2ADFL 2J5LB 3C5ZD 3RVWC 2NUPA 4NZUH 2VXSH 1QFHA 3QFJD 1AP2B 2AXGA 2E3VA 1TR7A 2H26A 1GIGH 3UO1L 5KYUB 1R3IL 4ZS6D 4L18A 3K6DA 2RD0A 5DF0A 3HR6A 4BDVB 1KDJA 3WLWC 1DVUA 2E27H 3AVEA 3CFTA 4CSTA 4RAHA 3L7EB 2CRMA 2DL2A 2XN9A 2ZOUA 3L08A 1WIUA 2X1WL 3HFFA 4GSQA 4Y19E 4AQ1B 4BKLA 3Q2LA 3QUKA 4KI1A 4PN6A 4ACPA 4ANXA 1D7FA 3P30L 3NPSC 1UZGA 3QQ4B 2DKSA 2ICWA 4H2CA 5IIEA 2YAHA 1DE4A 4G72B 1FO0H 2GABA 3NJJA 5CS7A 3FRUA 1JUFB 3T08A 5IROD 3GMOA 1VFBA 3AY4C 3Q8CA 1SRDA 2GFBB 5HDRA 1PYWA 4NUGL 4OVUA 1JV5A 3DV6B 2QADD 5CEXB 4BFNA 1AG6A 4G11A 4TV3A 4U6YA 4QPEA 3JT0A 1O6VA 4HOWA 5FW6A 4OCSL 2VLRA 4OLXL 4DT2A 1CIUA 1NFIB 4M48H 3U79A 1URZA 4GKNB 2F54D 1MRDL 3F6IA 4IRSC 4JZJC 2RCSL 4BV1A 2WUCL 5JQIB 3ROLA 4DP5X 1FL3A 3BT2H 2DL9A 2K6ZA 1BA9A 1F58L 3CZFA 4DIXA 4NP4H 4GSDH 4E42B 1XWVA 1DJXA 3OKDA 3U9PL 3BKYL 1WC7A 2CM6A 1TFHA 4M5YL 1USZA 3D6GA 3CVHL 2E74C 3QB7C 1CXIA 2R0ZL 3O3UN 1E4KC 5A3ID 3BH4A 3QFJE 1MQKH 3LRKA 4F5CE 5BVJB 3BAEL 1LEGB 4DVBB 2Z92A 1EEQA 1FFNB 4BFRA 5IB2B 4N2CA 3FU9A 4NQDB 2ZKWA 5DMJB 4CRPA 4FAAB 2QGBA 3KWXA 5FWQA 5ADPL 1X5XA 4ZJ9A 2GI0A 4YHYB 3DYMA 4TVUA 4UM9B 1ORSA 2CLVB 1LEKB 1EJFA 1SPDA 4FLHA 4ONFH 2B4CL 3WN5B 2R23A 5IWLC 3VRLE 5DUML 2GSIA 1G5GA 2MRYA 2GTZA 2OYMA 3FQTA 1P4BH 3ARFD 3DYPA 2OMZB 1C1EH 2NT0A 3Q6FB 4FXGA 5E6YA 3GMRA 4TQEH 1L3WA 3MPCA 2IDTA 4ZAKB 5G5DA 3W11C 5F89A 4AQAB 4Y2OA 1F1DA 3QIWB 1XSIA 2VDMH 5D7SH 1S7UA 2AKRB 3LZNA 4YMPA 4Y5VB 1F3DJ 3IE9A 5TK4A 4OM0H 1DUZA 1JZEA 3QEQB 3ARTA 3QUMH 2F54E 5D7KD 2GEQA 1ZLSL 1W9XA 1A3RH 4IOIA 4ETYA 3UJJH 3I74A 1MCPL 1BAFH 1PCSA 5D7HA 3SPGA 1AC0A 1OAQL 1PVHA 4KKQA 5AG9A 3HBQA 3HCVB 2VO5A 1G7QA 1R5VA 2H32A 4TTDD 1MFAL 4WFFD 3S2CA 3QEUA 4GP5B 5L0QB 3ARDB 1E4HA 4QUOA 2XETA 1I3GL 4QDGA 3P4MA 5EBMA 4P3DB 2FSEB 2K70A 3MLTA 4F3FA 5FIEA 3LS5H 4E41E 2C1PB 1GPOL 4JZNB 3GMPB 2OR8A 5LNEA 2EIMB 4MMZB 4YPGA 3G6DH 1JGDA 4ODWA 3J27A 1XF1A 2A74A 2MNUA 4LCUB 4MJ2A 1QABA 4AX3A 2Y07L 2AFNA 2G2RA 4FI7A 1SGKA 2PN5A 1NOAA 4ZBJA 2AJYH 3AS1A 2A9ML 1N8OE 2DS4A 4NZFA 3ZHKA 4JAMB 1PKOA 4XPTH 3QZMA 4MAYA 1LM8V 3LZQA 3MR9A 3O2WH 4G59C 3PFQA 3FTXA 3WKYA 5F7AA 3RIAF 3VTMA 1KCBA 1VPOL 3MRHA 2NXYB 1M1XB 3IGAA 1E4WH 1YDPA 2Q76A 4FTVD 3FB5B 1TTAA 3LKQA 5DFAA 4Y1SA 2TRHA 3JVGC 4KZEH 1TZ8A 1TJHH 4AMWA 5D7KE 1U8JB 4QMEA 3KLSA 3FO1A 1WT5A 3QAQA 1ODAA 2DJSA 1RZ8B 4MB1A 4QRPA 3RY5A 1FNFA 3BZFB 5DMYA 4O02B 1N26A 4JN2B 4RX4D 1HH6B 4XN7A 1THCA 1XEDA 3F2LA 4UWQB 1A1MB 5I9QC 3IGUA 1JDCA 1E7UA 1WIPA 3PS6A 5CJBA 3I6KA 2FGZA 4OD2B 2IBBA 3FT1A 1BF8A 3MLXH 4NN5C 3RZCA 1RERA 1SFDA 5SWSB 4RMWA 3RTQD 4MDJA 4TNFA 3SJVD 3KEDA 1T1ZB 5T5FL 4BSVA 3MRPA 1YMMB 1AMXA 2EO7A 3TA3C 2EO1A 1CGWA 3CPLA 3F7QA 3VW3L 5GGQL 1A6VL 4PG9B 4BGLA 1OP9A 5K9OA 5FGCB 2G9HB 1KN4L 1UFGA 3ATEA 3WUWA 4ZW6A 4HSQA 2IXQB 2P7TB 5DHVB 2DYPA 3NSJA 2V3FA 1QBAA 1V8HA 2H6PB 1CC3A 1YYLH 1KB9K 4YLBA 1FORH 3C6EA 3WUZA 4PBXA 1JERA 1GW6A 4MSWB 4RISL 4DVRH 1AZRA 3DVNA 3KYMB 4PGDA 3PAVA 3JWDH 4LKXA 4NENA 2G5RA 3B5HA 4NBZB 1MSPA 2IC2A 2N7AA 4FTVE 4XHJD 1B0RA 3MV7B 5AAWC 4AV5A 4WFED 2OX5A 1A9BA 5AUMA 4W9ZA 3FTGB 2JKSA 4I1RA 4OZGB 1BQLH 4TRPL 3KBFA 4W6YB 5HSFA 3GXNA 3EAKA 3EHBD 3EJPA 3GXIA 3QUXB 4D0BA 1RH8A 4FOMA 1OHZA 4U6TA 4QR7A 3Q1SH 2P9RA 1T6WA 4MJ6A 2Y24A 2XWDA 3BZDA 4NSKB 3D52A 5A2JH 4QRQA 2XXFA 5FO8B 3FUDA 4IOFD 1M6UA 1I8KB 2BVOB 2O72A 3GHBH 3QDJB 1HSBB 5K93A 1RZFH 1N19A 4XBPA 4WWNA 5E95B 3EO1A 2Z7ZA 5DJYB 5E1IA 5C08B 1HTYA 1QZ1A 4W93A 2NUTA 5J0BA 1T20A 3GDBA 4FJZA 3TBBA 4DN3H 1XF2A 2H2PC 2Y36L 4OBSA 5HD8D 4Q6IA 4YC2C 2FJSA 1VENA 4HHWA 4WFGD 4ZUWA 5T1DH 1D5IH 4AVKA 3IMRA 4NUQA 5DVPA 1GGCL 5KS9A 5ESVB 3SGKA 1JGLL 2IALB 4N9OB 4NKIH 4PJ5D 3BPNB 4QRRA 3OD3A 5I1IH 2CU9A 1S9XB 1M6OB 4A68A 1G0XA 2EDXA 3FF8A 4XB7A 3CH1B 1FI8C 3H4HA 5EUOB 4YBHA 2X4RA 1QMUA 1RZJH 1I1CA 4Z77B 1I8AA 1I1YA 2Z8SA 4NLHA 2CJSA 3ARWA 4B9JA 1MQ8A 1U8LA 3EFDH 2ICWJ 1LTXA 1XGYH 1Z66A 2F5AL 2QDWA 3FUHA 1NOLA 3MU3A 4MNQD 5JHAA 3RL1A 3ET9F 1FDLH 3ZSSA 2ID5A 4X6CE 2WBJB 1HZKA 4GINA 4AKQA 5EOCL 1D5XB 4HWUA 1H8SA 2BVEA 2FIKA 4JFXB 3RVUC 4FQ2H 3NTCH 3UIYA 3IJYA 3N1PC 1QWNA 4R4BB 4KK8C 3QUHA 4U05A 3QNZA 2IPUG 3HNVH 4ODTH 3POCA 1MAML 1QFWL 1Z9PA 3RX9A 4L0YA 3FT2B 3MRNA 4ZDHB 3DHPA 1JK8A 5CUSL 5IB1A 3ULVE 4GO6B 2BP3A 1U2CA 3FU0A 3VXSD 4Y19A 5GGTA 4H44C 4POUB 1RK1A 3OKNA 4WTWA 4AIZB 1G6VK 3GRWH 1IEAA 1RZGA 3WIAA 2YQ2A 2JCWA 4G9FE 3WI9A 2Y7LA 4WFGE 5IOPB 1KBBA 1AXTH 1OTTC 3F62A 3MX0A 3ZZ1A 1BX2B 1MHEA 4PJ5E 2NY6D 2OKMA 4YE4L 2VAAA 2YPVH 5DZPA 4U0RB 3K6FA 5KS9F 4L3FA 4L4JA 3LIZA 4TS6A 4DCQA 4J39A 1WWBX 4AZUA 3LN4A 1GGIH 3H56A 4BQCA 3MBWB 2Z31B 3C6SA 4HBCL 1U21A 1X5HA 5EEXA 3KG5A 5JYLA 4LVHC 1T3FA 1HL8A 1JWSB 4KRPB 4XCEA 2IBZY 3CLWA 4DWHA 4E9SA 3AQYA 4HHGA 2D31B 4PJCE 3SE8L 3BQUD 3BGAA 1TLMA 3C8HA 5LXGH 1ZGLB 4MNQE 1UCBH 4PTTB 2F7RA 4OBRA 4U6VH 1IMHC 1F6AB 5A2CA 4BZ1A 1AKPA 2YJLA 1E5AA 3K0YA 4I85A 3VMNA 2FLRT 3C5ZA 3ABMB 4ZFFB 5C09E 3A0OA 3N44F 4AH2A 2OW7A 2IH1B 3QFJA 2BMKB 3II3A 5E2UH 1M57B 4ODHL 4F5CA 1GZHA 1XTLA 4ZW7A 2ZICA 1G5AA 1IGFH 2ZQKA 3QH3A 1INEH 1XH2A 4F7CB 3BKML 5GS0L 1PEZA 3U1SL 2AGJL 4F58L 3ARPA 4X6BA 4XCNB 3S3SA 2AJXH 5TE4H 1EFXD 2VISA 2Z8VC 1XSJA 3BO8B 3O6ML 4OFPA 4AG4L 2YKKA 4BQ8A 3JV6A 4ECNA 1TCMA 2NNCA 3TLRA 1SEQH 2YEZB 1PQZA 3HG3A 2YQ3A 2J3SA 1IC5H 4Z23A 1AD9A 2J25A 1AO7B 3GJFK 2EDJA 4FNPA 4QRUA 3DX4A 4NRZB 4RAVB 4XVOA 2KH2B 4UBDC 3CHOA 4RQQB 2K3TA 4KQ3H 2DM7A 3BWZA 4HJUA 1Z9MA 5AOLA 4AE0A 3RWEB 1E3XA 3NOIA 4HWEL 2YR3A 2QVKA 3PWUA 4WJ5A 5FYKH 3QRLA 4P46D 1XMEB 3LKNB 4IS6B 4P2RE 1P4IH 1NCWL 2F54A 3GXPA 3MFFB 5BCAA 5DUBA 5ECGA 4FXTA 5EF2A 2G75B 4ZS7L 4CADA 1J10A 1C08B 1E5ZA 2BWDA 3NA9L 5DUJA 5C6PB 1L5GA 4S1QH 4W9FC 4XNXH 3WO3B 2KHAA 4QJ5B 4FQXD 3O3BB 2BNRB 1HWWA 2V2TB 1Q9WA 1T2JA 4WKXA 2JB5H 3ARED 1LO2L 5F88A 4Q9CA 3MODH 1XR9A 2WTOA 4PV8A 4WY7L 1ZVHA 2K1MA 4JR9H 3BP7B 3VH8B 1KC5H 2AK1H 1CIDA 4WW2A 2VMDA 4LVNC 4PLKD 4E41A 2WANA 2ARJA 1BFVL 1IBGL 1T1WA 2CH8A 3R4DA 5ESAA 2AABH 4WEMB 2H6OA 1MKFA 2PABA 5EPMB 1AFVH 4NX0A 5E5LA 2Y6SD 4MQ7B 2QL1A 3B7TA 2WKLA 4H20H 2AQQA 4OIBA 5GPRA 1PZ2A 3AQZA 1H0DB 3C60C 2EKJA 1UKTA 4NQXA 3VRLF 4CN4A 4Y5YC 1Z5YD 3D50A 4GPVA 4S1RH 3ARGD 3T0AA 5C9JA 5IJVB 1CYXA 1OF2B 5IW6B 4XPHH 2VZ1A 4G8IB 4QOKB 2JNZA 1A7RL 4LMQI 4JVUA 1LK2B 1MCBA 1QP1A 3HRZA 2G3MA 4LHUB 3AXIA 2DTML 5CEYA 4XMPL 4O58H 3D2UD 2Y5TA 5TE7L 3MCKA 4YIQA 3HAEA 3KM1A 3SQOL 1HKLH 1S5HB 4OUOA 4JO2L 5B1BB 3UJTL 1CS6A 4IBWA 2Q7NA 3L3OC 5DQJA 4U49A 3PHOB 3MJ7A 1Y1DA 1SJEB 3IDYC 2CE6A 4MNGB 3QWQB 2K9UA 4G7QB 3WJLA 1RUPH 1RXLA 1UB6A 4YFLI 4Q9QH 1R1CA 3PUCA 3TEUA 4B3VA 5IHBA 4MB5A 2D4FA 1I3RA 4G6FB 4M1GL 4J8RB 4OZFA 1NCJA 3GLZA 2B20A 2VXVL 2WCSA 4BKSC 5CMAA 3PWPB 5GRUH 2GJJA 1KSRA 2OL3B 4ZW3A 4WW2F 3VA6A 3W9EA 5L8LB 2WQVA 1JE6A 4NZUL 2VXSL 4HISA 5MEQA 2DLEA 4IOSA 1U42A 3FFCB 3KAAA 2VDOH 3VXRD 2OP4H 4Z1PA 1GIGL 2BSSB 3IWVA 1IM3A 2BSTB 2O5YH 3MNMA 3QZOA 1U2YA 1CE6A 3OMAB 2E27L 3S3PA 5DT1H 1LNUB 1KPVB 3DDFA 1W0VA 1Z3RA 2EXWD 2I07B 2W88A 4IBUA 4LEOB 1AZNA 4PGZA 4FTVA 4CDGC 2CIIA 3NCBB 3UIZA 4M8QB 2E6PA 2MNWA 1FO0L 1KTBA 5DGQA 2I9LB 3BEVA 5CSZB 2EZ0D 3WOVA 4V11A 3MNVA 5KBNC 2XJLA 4LU5H 4KK5C 3RG1C 3K46A 5F7YC 2WVSA 2OTUA 1DN0A 5FA3B 4A7UA 5HDOA 4GRLD 1MUJB 3N43F 5GJSH 1TTFA 2X4OA 1UJ3A 4M48L 5CIPH 4B9KC 1G7MB 5I5MA 2A77H 5EOQH 3T8XB 3MRQB 3ISWA 5GS0C 1LE9A 2HT3C 5LAXA 1BSIA 3BT2L 4G2AA 5SWZD 4I0PA 1UKSA 1NSNH 1DEEA 1HHHA 4NP4L 3RTQA 4GSDL 1NCHA 5DJDA 4XNAA 5DHYA 3TN0C 3GBMH 3EFOB 4FQHB 4CVXB 5HYQA 5AVTB 3FFOA 3S4SG 3GUTB 2DWSA 3QA3A 4WENB 2WNWA 3PP4H 4N2GA 1IAMA 4MS8D 4UNVA 3EOAA 1MQKL 3VXRE 1NUFA 3D85D 1ES0A 5I6PA 5DRXA 3MRBA 4OLZH 3AC0A 5IFHH 2H45A 4LQ1A 3SYAA 1EAQA 4HFWA 3E9UA 4Y16D 2BCMA 4ONFL 4FFZA 5HDWA 5LGHL 4GEIA 4QHPA 3IAQA 1DVFD 4JQXA 3IBOA 4F7EA 1P4BL 4AT6B 4EDXA 4OLYH 1C1EL 1XH3B 3A47A 3QDMD 5CHNA 2VSDA 4TQEL 4Q8BA 1NGQH 5HVFB 5AKTA 2WLMA 4UOW1 4X6CA 1SF3A 3KGTA 5LB1A 1KJMB 2G0KA 4XZUB 3SDDB 3NZSA 3TCXA 5K9QG 2VDML 5D7SL 1KGCE 3T4YA 3BXNB 3NZHL 3QXVA 3MV8D 1XL4A 4OM0L 2NY4B 3QUML 5FYJD 2VKWA 1A3RL 2N59A 4IGBD 3EO0B 3UJJL 1S4IA 2VZVA 1BAFL 3G5VB 3STLB 4HD9A 4NRXB 2VOTA 5IVXE 4PJGB 4X50A 1JZ3A 4IU3B 3ESPA 4UUJB 2YKLH 3EKCA 2IBZX 2DM3A 1HL5A 3ILPA 1G7LA 4G9FA 1G9NH 2W80C 1NUNB 1AGDA 3VGAC 1CB4A 3X11B 3C9NA 1JPGA 1P7QD 4JJ5A 1HHGB 1R3JB 3A4EA 5HJ3A 1G9MH 1ECYA 3C6LD 3EH4B 3LS5L 2HFEB 4PJ5A 1E5BA 1SDYA 2J20A 3KW7A 4W9EC 1YN6A 4HKXA 2WIIB 1AR2A 1CZ8H 3G6DL 4Y2DC 1I7TA 1ZVSA 2B0SH 2R1XA 5HHQA 4PJEB 2XJKA 3IDXH 3RDJA 1PMYA 3ZO0A 1P1ZA 2DWXA 4QRTA 3DMMB 3VXPA 5I19H 2GYSA 4PGCB 1X9UA 2AJYL 3D8MA 2W0LA 4AUYA 3WTWA 4UZGA 4IU2B 4XPTL 4PJCA 4AXWA 3N3EA 2VDPB 3ME0B 3QDME 3O2WL 4AJWA 5CEZH 3MJ9A 4PRHB 5AVYB 4MNQA 3T3ME 4BCXA 1EWHA 4GSRA 1HSAB 2GAZA 1E4WL 3WKMH 5BRZB 1ONQB 5LN4A 1SMAA 2PCPA 3MGTA 4UT6A 4YR6B 2J7LA 5KSVA 2CNYA 3A22A 5C09A 5J89A 4X6CF 4LGPB 1TF4A 2DQFB 4K71C 3MV8E 1ZE3C 4KZEL 1WGOA 2Y3AA 3NH7H 2HVKB 2Y2WA 3CVDA 1TJHL 5FYJE 1V05A 4JBSA 3FS9A 2R29A 4I77H 4O2FA 3HJ0A 4OD3H 3ZKNC 2DQIL 2J2ZB 4MD0A 5IHUH 1HL9A 4BFIA 4G9DB 3G6JE 2EVGA 1UZ6E 3QT2A 1D5BB 3T65A 3ULVF 2EH7H 3FB6B 3U6RB 4XOBA 1OZTG 3ZQWA 2F8OA 1KTKE 3MLXL 4GQ9H 4UI2A 4N90E 1XBRA 1KYFA 4I2XB 4BZ2A 1JNJA 3GS4A 1F1GA 3DJRA 1UACH 4S0SD 2HFFA 1XT5A 4JGJA 3ZYOA 3W38A 4G8FA 1FWXA 4ELKB 2X6CA 4ODUA 3S37H 4NKDA 3NESA 2OCFD 1IRAY 4N28A 1BLNA 5ISZB 4BQ9A 3E8VA 5JIMA 4P2RA 3AB0B 1QTSA 4RFNC 2FX8H 5F1IA 2VRKA 4KO6A 1N3NB 4P2QB 2PPAA 4BEIA 1J05B 1YYLL 1FORL 2Y25A 3BAJA 5C6WH 4MDIA 3BQUA 4N2FA 3I9IA 3IDUA 3BYTA 4DVRL 1T21A 4PJCF 3JWDL 1P5UC 4GG8B 5EF1A 4NQDD 4DFIA 3FTUA 3U4KA 4H26B 1UCTA 2HWZH 4GJTB 2SEBB 1EHNA 2H47C 4FD0A 4J6RH 5F1NA 4J3OD 3RBSA 4UM9D 4FKEA 1P69B 4R0LA 4UYPA 1F4YL 1BQLL 1TFPA 4LBEB 3LPWA 1EPFA 1U0QA 4PCKA 4DP0X 3TS8A 4AYID 2XV3A 4ZMZA 4HHAB 3CFCH 2AV1B 1EFXA 3E8UH 3Q1SL 4OQTA 1P6FA 4KHXH 2H8PA 4ZAKD 3EBHA 3KPRB 2UVFA 3L1OL 2PYEB 3AT9A 4OZ4A 1XGTB 1QR4A 5HJBA 3S37X 5IMLB 3GHBL 4O5LH 1A7BA 3ZHDA 1RZFL 3S0PA 1CE1H 2VR5A 3S3CB 4W70A 5E5UB 3L4TA 1TTCA 2EEAA 3JUZA 4V2BA 5DC4B 2TRYA 3EZ8A 3US9A 3NIDE 1U8HA 5ABDE 4DN3L 2X12A 4HKZA 1RIUH 5T1DL 2VM4A 4H7VA 1D5IL 4O51A 2R56L 5GSRA 3GSQA 2D73A 5IVOA 5BS0D 1PD6A 2AV7A 4P46A 1MLBB 3DIDA 3IMUA 4RFEA 4NKIL 1EEYB 4P06A 1KTLB 1W0WB 1HEJC 5G4OA 3GD1C 3ARDD 3VFGH 3ZHFA 5DDHA 5CN2A 2JV6A 5FB8B 1CDJA 4WU5A 1RZJL 4FQXA 1MW3A 1E27B 2DF3A 3PHQB 3PLYA 4O9HH 4NQDE 1ILUA 3NRPA 4Z7QB 2XLLA 2ZOTA 3EFDL 1TCRB 1VEPA 3TA4D 2OZ4A 4AOFA 1XGYL 2A1WH 3O11A 5C0CB 4M7LH 4L1BA 4MGXA 3GM8A 5JHDD 1FDLL 5F7EH 5KTEH 1ZWIB 4QHNB 2RFXA 2WYHA 3VXOB 1FZJB 1AGFA 3NTCL 4FQ2L 4L2YA 4NZTH 1LD9B 2FJFB 3PWJB 4K3DH 1U58B 2Q2EB 4ODTL 2NXYD 2AQ2A 3KL0A 1X5MA 3APMA 3WS3A 4RGMC 4WO0A 5SV4A 2DWEA 2A0LD 4CA4A 5I2IA 1EBPA 2DM2A 5EBLA 2W1NA 2H1LM 3MRIB 1GYVA 2PP8A 2Z1KA 3DOIA 3IJ7A 4QRFA 4CJ0A 4AKOA 1XGQA 5EN2A 1GAFH 1VEMA 3ARGA 3O81A 4JFVA 5IBTH 4BFKA 2WN3A 4MA7H 1W91A 3GRWL 2JJUA 3QQ3A 2VR3A 3B9KC 1YEDA 1KCLA 3N6YA 4UF7C 1U91A 1AXTL 5I0ZA 5L2KE 5BS0E 2I9TA 1MXDA 5AB2A 1MCWW 2D8KA 3D2UA 2YPKA 3K8LA 3TBTB 2YPVL 2IDFA 5K1JA 4HGWA 4LO9A 4P3CH 4P2CG 1KBGH 3HHMA 1GGIL 2FJHB 3BVDB 3K72A 3LRLA 4MCYB 5F70A 5SWSD 2R9HC 1F11A 3KYOB 1INQB 4HUWB 2DJ4A 1U3JA 4H8VA 1MVYA 4IMLA 4MD5B 4PJDB 3FQ4A 3TYFB 2EDQA 1AHWB 4ZXBC 1F90H 1YMMD 1I9IH 3V5HA 1JV2A 1U92B 1JF5A 3D87B 2X9YA 1R75A 1UH4A 4ZUSA 3ASOB 4HIXH 3ZE1E 3VTTA 5LXGL 2BP0B 1EEZB 5KZCB 4JO4H 3PHSA 1UCBL 3G5ZA 5HDBE 3X14B 1IGIL 3TIDB 4NO5B 5JHDE 2XQYK 4LLQA 2A6KA 3NCCB 4ZFZB 1XR8A 3BUDA 4XWOC 2ZYIA 3D18B 3WY2A 5E2UL 3VXRA 3SCMB 1IGFL 4P2OC 1INEL 5J3HD 3MV7D 3TU6A 4LNVA 3CQFA 4R5TA 1G87A 4RSVA 3VFRA 1HS6A 2AJXL 5D7EA 5TE4L 4L8DB 3PAUA 1MFCH 4N3TA 4HJGA 4K23H 2WQXA 5FDWA 3BWUF 5MEOA 2YA0A 4NN6C 5KJ7E 1SN5A 2YLKA 1NICA 3IETA 5DD1H 1BFSA 3IE4A 1SEQL 2NTFA 1XIWC 1IC5L 3T5WA 1UOKA 4M7JH 2Z7UA 3O4LD 3BZEB 4NT6A 4WWKC 3M1BB 1ID2A 3JWDC 3CVHB 2FL5A 4WGVB 4KGLA 4KQ3L 3RL2B 2V9RA 5FXCH 3QDJD 1OB0A 4HUNB 2QPSA 3QWNA 4LP4A 5B4MC 1FGNH 3CGTA 1QSFB 2GTWB 5EB9A 5FYKL 1BM7A 1MJ7H 5TGBB 3RNKB 4X0NA 1P4IL 5GRJH 3WY4A 1E90A 3CDZB 2HX8A 1MFDH 4J3UA 4Y7MA 5FGCE 1H5BA 1MDAA 2QSCH 3JV5A 3WSQH 2GI7A 5IUSA 3REWB 2ZOKB 4S1QL 4XNXL 3CZNA 1BBDH 4UM8B 5IVXA 4H25B 3OQ3B 1QHPA 3GSOA 3LEVH 4XC3H 5LBSA 3HMXA 4NQCE 4ZPTA 1NUGA 3VXTB 1MPAH 3RWHB 2JB5L 5KYYB 3MODL 2P5EB 1KC5L 9CGTA 4AQEA 4Z76A 3S88H 2AK1L 3NIGB 3EDKA 1WIOA 1FVDB 1VGKB 4PBVC 4DP6X 3LB6D 3OKLB 3D85A 1H3GA 1PG7X 2AABL 4X9IA 2L04A 5E1AA 2E8YA 1U8NA 4OT1H 3SDAB 1AFVL 4LFHD 1X6LA 4G3YH 1M42A 4G80B 4H20L 4AVHA 4LAJH 2WBJD 2EE2A 1ZHBA 2XWCA 3OPUA 2ZAGA 5JNYA 1B4RA 5BO0D 1IVLA 3T6QC 2XZZA 1SDDB 4Z3JA 1BYOA 1OTSC 3O4LE 1RZJC 3ARBC 3LH8A 3QDMA 3K6NA 4S1RL 3P3SA 4XPHL 2M2DA 1EH9A 3CMOH 4OCXH 3T2NH 1BQSA 2ITCA 2BPBA 4JY4A 2VSKB 4G6JH 4UDTB 1G7HA 1E4XH 4PY7A 3MV8A 4O58L 5FKPB 1CGSH 5SX4H 5MHSD 3WENA 2WP3O 4HUKB 5BJTB 4KOBA 1COBA 3MVSA 1HKLL 4WV1A 4IGBA 5IHLB 4LCWD 5I5JA 4LZKA 3H2WA 2WGXA 4LCYB 2YBRB 3QI9A 1FSKC 4YEEA 5GS1A 4M5SA 3G6JA 2ENQA 1L3NA 1DFBH 3T0EA 4G1MA 2WOYA 4WKZB 3KPOA 1OGPA 1WK0A 1T0MB 5D1XC 5IVXF 3BAYA 1RUPL 3QGVA 4Q9QL 4M4RB 1DQDH 3NG5A 3PXHA 2YZ8A 2W95A 4N5ED 2VZUA 4JFEE 3ZRFC 2ICEC 3C6LA 1U8IA 4K3GA 2FATH 3HE6A 5GRUL 4FQPA 5EFIB 3ECWA 1UADC 3KH4A 3FSOA 3CHPA 2QVMA 3SDXE 1T4KA 2OXGB 4K2UH 1NM4A 4M6OH 4GW4A 2OP4L 1CTOA 2O5YL 4QTHA 1EGJH 3V4PA 3HG2A 3ML9A 5FO2A 2C3VB 1IGTA 2ZUTA 1OGTA 2E7BA 5DT1L 5LKNA 1AY1H 1HE7A 1QUNA 3NABH 4PJXB 4DTGH 2W07A 2XVBA 5KVDH 1Y7VA 2VDKB 5F0PB 5F9JA 3DJ9A 3T3MF 1AMYA 1UXWB 3PF2A 4UTCA 1SF5A 3DUUA 4L1LA 4G42A 2FQGA 3LRMA 4FQLH 3FQRB 3NBNA 3HPLB 4JQVC 3ULUH 3D06A 3V7MA 1NDMB 5MHSE 1XF5B 4HS8H 4XNBA 3I50H 4LU5L 4FMVA 4LCWE 2VUKA 1QD0A 2IANB 1AH1A 1HHKB 1RZ7L 1AO7D 4KVNH 3TH4T 1BPVA 5DRZA 2CGYA 1J5HA 1URIA 4HYTB 1JUFA 3FN0H 5GJSL 1I75A 4EJ1C 2C9SA 3G6JF 2A77L 3GJEA 5DK0A 5EOQL 5G55A 1UZ6F 3RI5K 3U7AA 1CICD 2VL5A 5CZKA 2QQKH 2WQRA 3JV0A 1NSNL 2WNKA 3IJEA 4G7YH 1Q94B 4X98B 1ZIAA 5EC2B 4D9RD 1DBBH 2OQJB 4MMYA 3VD7A 5CLWA 1VB9A 2FDBP 1MCCA 3G5XA 3GBML 5D4JA 1UT9A 2V4LA 3OC8A 5F7BA 1OHQA 1IQDB 2C1OA 1M3JA 1KBKA 4YZFE 1KXVA 3PP4L 1D7CA 3E0GA 3LYRA 1ZLDA 3KLAB 5DK3A 5C71A 1FH2A 2APFA 4YNYA 4MQXC 2WN2A 4PWGA 1RSFA 1SYSB 1Q0EA 4OLZL 3KXFB 2FR4B 5IFHL 4KHTH 4FG6C 4MMXC 4P48A 3WNOA 3MLPA 4FKKA 4Q58C 1GW0A 1EO7A 3WEXA 4ZZKA 3P2TA 1LEGA 1JAEA 2CDGA 2XTJE 3TA3B 3EYQC 3RVVC 4AM0Q 4NQDA 4LSRH 5BXFB 3BDYL 4BWWA 4OLYL 4YBQC 5EO1B 4PW9A 5FGBC 3WL9A 3ZT7A 5FCSH 4BFBD 5J11C 3HR5B 3EYVB 4HZLB 1NGQL 2XPZA 2IFGA 3IMTA 2VR4A 4Y4KA 3DURB 1X4XA 1BQHA 3C5JB 4M61B 4W1TA 1OWWA 4OCLC 3WNIA 1WCQA 2CUHA 4KRLB 4K7FB 1ZJBA 2FYYB 4R96B 3GFUA 5FA4B 2Z7YA 3C60B 1B3JA 3CH8A 43CAA 3PAYA 2WY3B 3ARZA 3E6HA 5FM5O 3L3IB 4D9RE 1N0LB 5HGBA 4TNWF 1ZV5A 3LQMA 2IV8A 4JJHA 3L45A 5D1QC 4X9BA 3FXIC 2YKLL 3NQIA 2GHZA 4FMKA 2E9JA 3QXDB 4ENEC 1G9NL 4MASA 5JOEA 4H1LG 1NC2B 5L2KA 5BS0A 1XF3B 5KN5B 1KLUB 4P4RB 1G9ML 3BISA 1JYVA 5F7LB 2WHVA 3BHBB 4Z0XB 4YHZH 4B9PA 4YFEA 3ARDA 8FABB 3CFKA 5DZ9A 1CZ8L 3HHSB 4DGYH 3VQLA 3ARXA 3DJZA 3IDYB 4JFOB 1H3XA 3DBXA 4ELME 2Y6TE 4LCVA 5F7UA 1MRCH 3IDXL 4P99A 2JJVA 1UTDA 5I19L 3PPEA 4JZNA 4NNXA 4YO0A 1KFAH 4FNSA 3MQIA 1UWYA 4KU1A 3F85A 2VRQA 5CEZL 3FFCD 3LN5B 1THAA 1FYHB 3BP4A 3ERXA 3JTSB 5JHDA 1JHKH 5B39A 3IAPA 4J3OF 5LLIC 2PR9A 5HGAB 4JRXB 4X9HA 3VCLA 3BWSA 3QJTB 2G5BA 3T0BA 1JK9B 2GPZA 5C0AB 2HT4D 2CHDA 3RKPA 2APWA 4TPRL 2DWTA 4FNLH 4S10A 3NH7L 3UCRA 4K5PA 3VYPA 3WFCH 4LGRB 4XNDA 3KHQA 3JYCA 1NIBA 4I77L 4OD3L 3DO4A 3GSXB 1IO4C 3FSAA 5CN1A 2GC7C 3DHUA 3ZT6A 2YQBA 1NH6A 2D7QA 2PTUA 2JE8A 2EH7L 5I24A 1ZAGA 4OV6F 1QBBA 3VSUA 2JKXA 1YLBB 3OKKB 3ZUCA 1VZGA 5IVNA 4GQ9L 4O02A 5D70H 4JN2A 3WS6A 3OQRA 1T1XB 2O93L 1QOKA 1SBSH 1JZGA 4XP5H 1JYWA 4HWBA 1UACL 4IIQC 4OD2A 5C92A 1E28B 1LK3H 4GP4B 4HCRA 3OJ2C 4DUXA 3N9GH 4MB3A 1HOCB 3G5WA 3KPMB 3S37L 2Y3NA 2X6MA 3NDZE 4AQ8A 1E65A 4ODSH 4WNQA 1SQ2N 2A73A 4EN3C 2BXZA 5IEKA 1QYGH 4R5VA 4KKLD 1YSOA 3B8YA 4GKSB 2FX8L 3CVBA 3SGJA 5KUKA 5D7LB 4BRJA 4N24A 1QW8A 1R24B 3L2LA 2W0FB 1QRKA 1QO3B 3ZL1A 4JDZB 4MYPA 3ZE1F 4R7LA 3MO1B 4HUUB 4Q2ZA 5EU6E 5CKAA 2JH2A 3ESMA 4NQCA 5T1JA 3BMVA 5HDBF 3SPVA 5HI3C 2HWZL 4J6RL 2M8XA 4KJYA 4Q4IA 3BH9A 1FNGA 3QJFA 1YC7A 3MRGB 5D6DA 5EIIB 2K7PA 2KUTA 3GXUB 3H53A 4FXKA 3MXWH 4A7GA 2HUEA 2YAQA 1WAAE 4P23B 3UERA 4K5MA 4ZW8A 3CFCL 4YHPB 1I1AB 3E8UL 3RHWK 3FTGA 4KHXL 2HN7A 3NYKA 4I5BA 2IAMD 2D03H 2J88H 3KBHE 4LLWA 4X7EC 1A25A 5BQDA 4FF9A 2WLIA 3HZMB 5LG1A 4O5LL 2ZWNA 3SDDD 1CE1L 3C09C 3SDCB 3O4LA 3OWRA 1N6UA 3D69B 3KCPA 1VFAA 3O3DA 1M71A 2NY4D 4O2CA 1BZ7B 2HB0A 4CC0A 1NAMH 3CZGA 3HZ3A 3ZKQD 4ANVA 4EZMA 1RIUL 1WHPA 5FHBH 3SGEH 3S5YA 3DYOA 3TOPA 5DQ9B 5I1DB 3S34H 1HYRC 1MCDA 1VLXA 4MYWB 1V3JA 5CCJA 1PJ9A 5KSAB 5HBBA 1NC4A 2DMKA 5F7FA 1IGMH 3VFGL 1OP4A 4XOEA 4XPFH 4ZW5A 3VJ6A 1SYVB 1KACB 3COOA 2XWEA 1A3ZA 3I6LD 3P11H 4O9HL 4GAYB 4NHUA 4WO4C 1J18A 1S9XA 5T3ZH 4Z7IA 1MREH 4AC4A 4U33A 4WCYH 3UBXG 2G2PA 1SN2A 1EAPA 4M93C 1XGUA 2A1WL 4M7LL 2GCYA 2IJ0C 4JFEA 3PGFH 5D9SA 5F96H 1K8IA 3WIHA 1TVBB 5F7EL 5KTEL 5F0LB 4U6HA 1HWGB 2BP8B 3KDMA 2YD6A 5INDA 3LDBB 1EBAA 2X70B 2O5XH 5LGKA 4EO5A 1XVSA 3LZRA 3SDXA 2FBJL 4NZTL 4PG2A 4PRHD 3EXJA 4A7GF 4CGUB 1EX0A 4HDIA 4K3DL 4KXBA 2QGDA 3KCWA 3TXAA 3BRGC 3RVWD 3KLHC 2YD3A 5BRZD 1JN6B 4PV1C 5AQ0A 5DXWA 1OK0A 1DQQA 3P02A 1WTLA 3PABA 3RX8A 1GAFL 1QZNA 2HJLA 2JCCB 5C0IA 5IBTL 3PGDB 3RP1A 4NO0B 2Y1AA 1EJ8A 1TQTA 1AG0A 3P3RA 4JFPB 4MA7L 1YPZB 1FVCA 3L8QA 4R7XA 5HHVH 2BW4A 3KJ6L 2OMWA 1G6RA 3QO0B 1MCJA 3ESVF 4I7ZC 2CAKA 1JNLH 4DO5A 4AIZA 2GSGA 3K2MC 4HV8B 4NUJA 5IHWA 1P4LA 1KBGL 2HVJB 2ROYA 3OSKA 1PX3A 4LCWA 1TTUA 1EQWA 1FYTB 4X8GA 3T2OA 4MJ5B 4IRZA 2CHXA 3WJJC 1IVTA 1I9IL 3I6LE 1IBHA 4NPJA 2WWKT 2VLJB 4GH7B 1SXCA 3QFDB 3L48A 4HIXL 3VFSA 5CZVH 3UP6A 4CSZA 3KWWB 4LRIC 3CV5A 5A2KH 5A40E 1TVHA 4OF3A 2RA1A 4F7PB 5ISZD 3DETC 2RH0A 3BH8B 3H9HA 2I24N 4IHOA 4JO4L 5ICUA 5IV2A 2AVFA 1KB5H 5CGMA 4P2QD 3QAZC 2MOVA 1FO0B 1AIZA 1J12A 2QSQA 4LVOB 5E9DD 2C4FU 4Z7WE 4PRHE 1ZGLA 3L3HA 5JW3H 1ZA3B 1U33A 4PTTA 2HTKC 3NFNB 5EU7E 3UEQA 4ABQA 2PO6C 3SDXF 4TOYH 3OHMB 3H9YA 2XXCB 1BP3B 4TF4A 3CZKA 5BZWA 3DBSA 2XQBH 4NJAH 1D5MB 3OF6D 4LVEA 2GG1A 4K23L 1FL6B 4E5XB 4NEHB 3GSNH 1NLDH 3VU2A 1FJ1B 4UU9B 5DD1L 1CFMA 2FCBA 1QRNB 3ZTEA 3UTZA 4XCNA 3A6BL 3UG5A 2R1YA 4A7VA 4M7JL 3BO8A 2L7EA 4DAGH 2F74B 2DYRB 3ZKXB 1X5GA 2C9RA 2P47B 1HXYB 2H0FA 2PYED 3AT8A 3ESUF 4JFFD 4DZBB 5H2BA 2EXSA 4I2XE 1T6VN 1WE5A 1FGNL 2LV4A 3ML8A 1II4E 3MYZA 5DSCA 1MJ7L 3HB3C 2WKGA 3AM8A 4RQQA 5DS2A 1P2CB 3DO7A 1CFBA 1OLLA 3FQXA 3FAXA 5GRJL 5TH2A 3RGHA 2I25N 2IADB 1MFDL 2UXGA 4K94H 4EUPA 1CICA 2QSCL 3SE3C 1H15B 4CDHA 1PY4A 3BD3A 4JM2A 2YD2A 1HEHC 3L3GA 4YHMH 1RU9H 1XHHA 2WTPA 3ZUNC 1BBDL 4TNEA 3L9YA 4BWUA 1XZ0B 3MKGA 3LEVL 4P2QE 4XC3L 5AAMA 4M5ZH 5FPIA 4NZRH 1MW2A 5DEFB 5FS5A 1C08A 2Q9OA 5E9DE 2J6EA 3SB3A 4Q7DA 3S88L 5B3NA 3CSTA 2E9WA 3O3BA 1VFOA 2PNDA 3P73B 3GXDA 2VDMB 4MNHA 3FQWB 3KM2A 4Z18A 3VFWB 2V7NA 2F8IA 2YRPA 3DUHA 4OT1L 1CLYL 3RTLA 1QI5A 3LQAH 3QUMB 3VH8A 2Q5BA 5C0CD 2YGOA 5CJXA 4M1CC 2D2OA 4ELMA 3ZDYE 2XPGB 3H4FA 3IBEA 4H8WH 4CSPA 1MI5B 5HP5A 2HJKA 3O2VH 5DJ2A 3Q9PA 4KUCF 3R0MA 2CSPA 3PHAA 1F3DH 3FQ2A 5CP7A 5D4HA 4NZ8A 1LDPH 4LHQB 2AJZB 3MRDA 2KERA 3I02A 1JFQL 5B3JF 2XFXB 2WKOA 2XFGB 3K4DA 1CFSB 3VXUB 4JFFE 1O9VA 4QGTA 5CNHA 4OZIB 4JJOA 2BSBA 2ZCLH 4ZG1A 3FB7B 1CFTA 4GW5B 3CMOL 1JZ7A 3SOBH 4OCXL 3T2NL 4B5ZA 4HH9A 3QYNA 3KJ4C 2XZQH 1TKWB 2BFVH 4R7NA 1ETA1 3W57A 4G6JL 2K3HA </