4IKNA

Crystal structure of adaptor protein complex 3 (ap-3) mu3a subunit c-terminal domain, in complex with a sorting peptide from tgn38
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
255
structure length
249
Chain Sequence
b'FIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHNISFSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQKLPSLKGLVNLQSGPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-3 complex subunit mu-1
publication title Structural basis for the recognition of tyrosine-based sorting signals by the mu 3A subunit of the AP-3 adaptor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 52
structure length 249
sequence length 255
ec nomenclature
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iknA01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iknA02
1HESA 2VGLM 1I31A 2JKTM 3H85A 4EMZA 2PR9A 2JKRM 1BW8A 4IKNA 4EN2A 2BP5M 4UQIM 1BXXA 5FPIA 3L81A 1H6EA 4MDRA 5C7ZA
chains in the Genus database with same CATH superfamily
1URIA 4JAMA 3OX8B 3TO4B 4R4FL 4E68A 1HSBA 3S34H 1CXIA 3EADA 1T1XB 5HHOD 2JJWA 5B4MC 1IQDA 3MXVL 5EBMA 1DZBA 3LDBC 1GJUA 4M56A 3RLSA 2WNKA 1RZJH 1N0LA 2J2ZB 2X4SA 4MZ3A 4NM4H 1KUMA 4ZJ9A 3C8KA 3UYOD 4B9PA 1HHHB 3SQBB 3RZCA 4S1SH 5D2LB 5C08A 4YEEA 5F9JB 1JGEB 3UBXA 3CZNA 1SEBB 4YXHL 1FLRL 2R9HC 2Y2YA 4D7BA 2X38A 5HJBA 4F8NA 2ZAIA 3FUJA 2ZAGA 4BELD 3S5ZA 2LU3A 3RU8L 2Z34A 5DLMH 3KHOA 4UDUA 5CEZD 1A6VL 4QJ5B 3JUYA 1ZHLA 3F7YA 4K5NA 4PG2C 4FQ2L 2ESVD 1XMWA 3VRJA 5JXED 2EC9T 4TF4A 5J9PA 3T0DA 5F7UA 1WEJH 1Y6MR 4M8UA 5TFSH 4ZMNA 3DDFA 2VKXA 4UT7L 4UMGA 2OMXA 4TUKL 1MVUB 1EEUA 1JI2A 2QGCA 3L5XL 4TVPD 4WV1B 3WGVB 3V5KA 1CF8H 1HAUA 4U6XB 3BGAA 1BEXA 5DDHA 1DBAH 3UO1H 2BHUA 4PJ8D 2BHZA 1G9NC 1I85C 4ELKA 2XCMC 3VG9B 1Z3RA 3CFDB 4KMQA 2N01B 3FXIC 2WXJA 2CE6A 3X3FL 1RUML 2VMCA 1UD5A 1JYXA 2YD2A 1R75A 4LARH 1JZHA 1XH3B 3DI3B 3MLVL 4BK5C 2V5SA 3SB3A 1INDL 2B3IA 5KS9F 1ZA3B 4P2QA 3CX2A 4AKPA 4LLVB 1JZIA 3P3SA 2R1WA 2UX6A 2V2TA 1QBLL 3CE1A 2V5YA 3QUZB 3MGAA 2W07A 1JMZA 4QOKB 3WD5L 5FYLD 3QG7H 3ZMNA 5DUBA 4ZTEA 3Q0HA 5I0XA 1VZIA 1BGXH 1I1FA 3BD5A 4PHZA 4XHJD 4PJ9B 2TSBA 3D85B 4O2FA 4N90D 4AENB 4KROD 1N59B 3APDA 5IR1A 4NWUH 1DSFL 4LKXB 4WEBL 4W9EC 5IFJB 3BCFA 4HJIA 3EO9H 3BMVA 4PGZA 3TURA 3ULVF 1MW0A 3ZHKA 2WTPA 3FT3A 1CD1A 4LDLB 1CR9H 2PWHA 3RVWC 1V54B 2WNGA 4U3CA 4Y1AD 5ICUA 1CD8A 4H20H 2OMBA 2WZPD 1ZA6B 2WN3A 1E9PB 1EK3A 2UWEE 3F7KA 4YHML 2F8IA 3IMRA 4NQVA 2FJUB 1QI3A 2B4CL 5JIKA 2YEZA 5KBDA 1UQSB 4JZOA 3HVDA 3DJTA 4BFJA 1K8IA 5EO1A 4P3CL 4GSDH 4Y2OA 4KKCC 5I0DA 5CD5D 1LGVA 5TQ0H 1LQBC 4YDMA 4P23C 3M7OA 5CZVH 3U0PB 1M4KA 4OD3L 3L54A 5DS1A 3B4NA 1MFMA 1ZGLB 5D1QD 2HRHA 5E23A 5INDB 2XWBA 2CO3A 4D0DB 1Y0LB 4DUXA 1U0QA 1CXHA 3M7FB 5GSVA 2J71A 1X3DA 3LKOB 3UAEA 1BLNB 4E9VA 4IM8A 2YGQA 3DSFL 4L3AA 4O2CA 4DIXA 1CPUA 1QLFB 4GW1B 1Y7VA 1GTNA 1EEZB 1AQDA 1YEFH 4N3TA 3MRIB 3I02A 1KLFA 3IPEA 4WSGA 1LQSR 3DPDA 4U1SA 1EAPB 2E46A 3R7QA 3ARUA 5BJTB 1EXHA 1K6QH 3KPQA 3P3YA 1E42A 2OQJA 2H0PA 5EB9A 4PGDB 1VSCA 3S96B 3NAAH 1DLHA 3EJZC 1YYCA 1IIIA 4NP4L 3FQXB 4QY8B 4G7QB 4HUVB 3Q5YA 1T4KB 2J4WH 4GJTB 3TEXA 3IN2A 1U8LB 3QZLA 4QTFA 3TBTA 4J39A 3AREC 1Z9NA 1CG9A 4A04A 4LLUB 3PHSA 2HH0H 3ARWA 3BP4B 2APVA 4WWOA 4X0KA 4TVUA 1YEJH 3DLQR 4TQEH 1QLRA 5C9JA 4XBMA 1XF5A 3TCLB 4PI0A 1XR8A 1CGWA 2VITB 4GLRI 2OKMA 2AV7A 1IBYA 3HZYB 2IOIA 3QDJE 1P9MA 4ODBD 5AG8A 2GJZB 4WI8A 2IFFH 4HJJL 1CXEA 4AEFA 5J06A 4FEIA 4PUBL 3V6OE 5F0PB 1UCBH 1KFAL 2ZTBA 4KKAD 4LCWA 1ZXKA 3VRLF 4GRLD 1QWUA 1KF9B 1Z5LA 3OKYA 1QFOA 3WIIL 3ECWA 2B9AA 3P02A 4G6JL 4DERA 3QQXA 3LQAH 4XZUB 1PZ5A 2JJSC 2W0KA 5A7EA 1JS4A 4IOIB 2ZKXA 5C0BD 1FNSH 3JT0A 4XT1C 1R24A 4A7QA 1ITCA 4UZGA 3V5HB 2E9IA 4BFGA 4YGVB 4CBZA 4ZFOA 4LHUB 4C4KO 3D4YA 4R84A 1BFSA 1EX0A 3L6FB 4ETQA 2YQ3A 2DQDH 4GLRH 5AD0B 3QULB 4HP5A 4WCYH 4APQD 5E4OA 4V1DD 1HAWA 3PAZA 4YK4C 5ISZE 5IWLA 1S9WA 3O6LL 5EZJB 2BHYA 2N0MA 1PLBA 3AGWA 1OW0A 4CBPA 2MCPL 4D0CB 4YE4L 5HHMB 2JI2A 2LVCA 4LHJB 5DZPA 5I18L 1AZNA 3BXNB 5DHXB 3T4AC 2C34A 3ZYJA 1AGCA 3UMNA 3QGVA 3U7WL 5ABDE 4YWGL 2G30A 1VGEH 3GSUB 4JCMA 4GSUA 1RK0B 4IQHA 3RJDA 1IGJB 3BE1L 4J8RA 3D18B 2AXGB 5EN2B 2CBOA 1MCWW 2WLYA 4YXHH 3PU7A 1AHWA 3SYOA 1SLUA 5JYMA 4OI7A 3OKNB 2PWFA 2VLMD 4E9WA 3DVNB 5D96B 1A3LH 4OD2A 3SO5A 2F58L 2KH2B 4HV8A 4MA3A 3MRBA 4WI7A 2HPOA 4FXKA 1J0YA 2WXHA 4NO5A 2CQVA 4RMRA 2J5WA 3EYVA 5HGDB 5DJDA 4FQ2H 3K6SB 3FN9A 4H0LC 3FOLA 3D5OF 3DTXA 4JG9A 4Y16B 3NSJA 1QHQA 3U36A 3UPRB 4UT7H 4AMXA 4WWKA 3L5XH 4HKXB 5E56A 2XPGA 5EC2A 2X9XA 1A4KB 1XIWC 3FQWA 4UM8B 5GGSA 3GLZA 4XC1L 2IH1A 1BQSA 4PRID 4JY6A 5JQ6L 2FX7L 2H2SD 3X3FH 1KELH 1KPRB 1EXGA 3UBXG 1VKXA 4KGLA 4M1DH 4XWOD 3BLPX 1INDH 2XIBA 4UCFA 5JR1H 4D9QD 3F83A 3O3BB 5BPPA 2ZJSL 2G4GA 2F8OA 1QBLH 3MJ8B 1DVFB 3OWRA 3LH2L 5EH1A 3UADA 1SJHB 2ICWJ 4Z76A 1HCZA 1A4JB 2ENYA 2JCCB 5GZNA 1HNFA 2Y3AA 4KKRA 4UI2A 1OANA 1MSPA 3FQTB 1I7ZB 2P7TA 4PJXE 5T3ZD 1BFOA 3BWSA 2XT1B 4I18C 3BOVA 2WBJD 5CJQL 1PLAA 5ANME 1AZBA 5FX3A 4APXA 1U33A 4MXQC 5AFAA 1NIAA 4WEBH 3QIWC 4GUOA 4K2UL 5DJXA 3QXVA 5IUCA 1DSWA 4HCRA 4ODWB 3GUTA 2NSQA 4FC3E 1M6UA 1BYNA 1MW3A 1D9KB 3R1GL 3S36X 1CFSA 3PWPA 2VLRD 4RH4A 4GAGL 5F3BA 1JP5A 1EFQA 1U6AH 2X2UA 2GY7B 4N8CL 1B0GB 1QYGL 2BXYA 2LTQC 3SIKA 4F7CA 3DHJA 4W9HC 5B8CC 4YHMH 1UB5A 3NK4A 1JPST 3QFJA 2B4CH 3VH8B 5E8DH 2W59A 1JZ5A 3T77B 4BA8A 2P9RA 3OR6B 2HZHA 2ZSVB 4ZUWA 4P3CH 3RZWA 2WBKA 4QXVA 3TF4A 3RVVD 1SJEA 4PP2A 1FYTB 3F00A 2PYEE 1ZCRA 4OD3H 1QABA 2PO6A 1U8MB 5PCYA 1H3GA 3OSVA 1E3XA 3ILQC 1GRWA 5IM7B 1U8KA 1B4RA 5I73B 3TO2A 2HVJA 1H6UA 3MCYA 3PL6C 4MKMA 2NY3C 1IBDA 3JV4A 3O8XC 4Q7DA 4HCFA 3HN3A 2YA1A 5D7HA 2NY4C 2E8YA 4DKFL 2R69A 2PTTA 1QA9B 3D25B 5GGRA 3SCMB 3UTTD 5TGBA 5B1JA 4OZHA 4M61A 2X4NB 4XCYB 4TOYH 5HYJD 3QIUA 5IF0B 4BGLA 4ZFFB 4YHYC 1F4YH 2DMCA 3BIKA 3RWGB 3O2DA 2YRLA 5EU6D 4PTTA 3MLYL 3WKQA 3QJZA 4N2HA 4GP5B 3V2AR 4LCIL 2EABA 3R06B 1HL5A 3WNKA 5LGKA 4JUTA 4PP1D 5HHNA 1GMIA 3SDCB 4NP4H 5AB2A 1DFXA 1XCXA 1DN2A 5IB3A 3VFOA 3GSRB 4HG4K 4OB5L 2G9HB 3II3A 4Q14A 2LFEA 1AZCA 3QCUH 4D8PA 1IEAB 2UY6A 1GH7A 2JWYA 4DP4X 2DV6A 4JK0D 1NFDA 1Q4NX 2DYPA 4Z7VB 2IOMA 3PHOA 1OWRM 2H7WA 4TLTA 2G3ZA 4Z3FA 2J25A 4HJJH 1HQRB 5DJ2B 2O4EA 1KFAH 5F9AC 4ELMB 1UGKA 3H56A 1BQRA 5CS7A 4RGND 4LEOA 4AMKH 5A2FA 1XGYL 2GHWB 4GEIA 3KLLA 3WIIH 4HAGA 5A1AA 3WXWL 3U9UA 3K5RA 1P7QD 4G6JH 5HGHA 1OT2A 4KZEH 4LVOC 4X5RA 5T1DL 1NMCC 4JHVA 1X5HA 1TO5A 4JQXA 1BEYL 3B2PA 3FQ1A 1OP4A 4GG8B 4GKNB 1CDCA 5E9NA 4KBPA 5ENWB 4EZJA 5J12B 3MLPA 4X6DA 1UWGL 3ME0B 5DJAA 2H0FA 2I9LA 4D0BA 1TPXB 1M6OB 1D5XB 2C3VB 2V5TA 2A83A 3SYAA 3SKJL 4W9IC 4ZD3L 5DI8A 3QEGL 3KLKA 4OFQA 1JVKA 5JYLA 1BVLA 3HZKB 3V4VA 1H3PL 3O6LH 4LLMA 4L4VA 3EGXB 3QI9A 2MCPH 4NZJA 4R8WL 3ZDYE 1UH3A 1O7VA 3DX1A 1KBPA 3RWDA 4UQAA 1NC4A 2ZX5A 4YWGH 1ZHKB 3PHQA 32C2A 4M93B 2AQRA 3W5MA 5JXEC 4RZCA 4OCNC 5MHSD 3IBEA 1BD2A 4TN9A 3B9KA 3MROA 1HK6A 3MREB 3VXTA 3DMMB 4UTCA 1VACA 3FB6B 1AXSB 1AR1B 5EUOE 2BVPB 4X6FA 3C6LB 4L05A 4PJ8C 4R96A 4B9YA 1DQDH 2J57A 2CXKA 4L8DA 4N2OA 3SO3C 4PGCB 4IRJA 1TCRA 1OIOA 2R4RL 1DBKL 1BQKA 5I5IA 3ZR6A 2VLKD 1GVIA 4NXKA 5KS9B 4M7LL 5GGVY 2QR0B 1HWGB 4HIHB 2AK4A 2BFGA 3GSXB 1IKOP 4H1LH 5EO0A 4MMXA 3Q3GB 2WW8A 2DMKA 3WTXA 2DLFH 4HWEL 4HK0A 1ACCA 4IDJH 4Y4KA 2ATPB 3O4LE 4WJKB 4BHUA 2LQRA 3LS4L 1GCFA 2ZCLL 4PJIA 2HN7B 3GTVA 4MKTA 4WDIB 3MRPA 4MNQD 5AUMA 3C60D 7CGTA 1YZZA 3ATEA 1G87A 4XHJC 2H3NA 2O6CA 5JQ6H 5L88H 2FX7H 4KROC 3L3IA 3UGEA 1KWKA 4QNPF 3KPNA 1E8XA 1UD2A 3UTSE 3BGMA 1VEOA 3G6JF 4XOEA 3S3BB 1ED3B 43CAB 1JZ4A 4ANWA 1U92A 1F45A 4FEMA 3II2A 4RX4A 4QO1A 1XXDC 4E9QA 5DD5L 5M95B 4JPQA 1VESA 3ILPB 5DEFB 4EI5A 4UQ3B 2JB6B 3LX9A 4NO0A 4JY4A 1UH2A 4JUSA 1LO2H 1PZDA 4JFUA 2PABA 3M45A 3ZZSA 1B0IA 2O6PA 4QLRA 3U7AA 3BIAX 3FSAA 4OF7A 1FG2B 5C70A 1N2RB 2NY5C 1B90A 5CD5C 4XMLL 4K2UH 3L48A 5IMOA 3OLIA 1JXKA 2F9BT 1FNGA 4PJAA 4UT6H 1JHLL 4GAGH 4EUPB 5D1QC 4WK4B 5E1AB 3EUDA 4JHUA 3I75B 3B1UA 4N8CH 5EU5A 4I85A 4AGMA 5CHNA 4ZMXA 4JVWA 5DJ0A 3UEQA 5KN5B 4K7PL 1GGBL 1UOVA 2D9QB 1PKQE 5C3IA 3L17A 2AJUL 1TFHA 3IRZA 2H2PD 1LD9A 4NENB 3JWDC 2BMKA 1TITA 3GBLA 3LXUX 2AXFB 1I9RL 2Y7QB 4JFVA 3BZFA 2QEJA 5EUKB 2VTFA 1PDKB 1U8OB 3FBKA 3LRMA 4Z3IA 5E2TL 3VMPA 5FYLL 2QDWA 3DV4B 4YHZH 2YD0A 4K3DL 3S3DB 2VUKA 3PV6B 5C0IB 1DCLA 4RGMC 2FR4B 3MCKA 4PGEB 3EGDB 2HPTA 2GFBB 1VFBB 3IGAB 1LO0L 1F58H 4KC3B 4MXWL 3V0GA 1HNGA 3OC5A 4OZHF 1LO4L 3EJPA 1A7NL 3QDHA 4YZFE 4DKFH 5BUAA 4JM0A 3M1BB 2VDRL 3P9LA 1KEMH 2BFVL 4TXVB 3GRBA 3TN0B 1IM3B 2I25N 3QORD 4I1RA 3I2CL 4QRTB 1FIGH 2YPLA 4UQ9A 4O5LL 3IJ8A 1UJ3A 2ISDA 4PV9B 5L6YH 1ZK9A 5C8JA 1UT2A 1V27A 2CUHA 2P5PA 1GOHA 1XGRB 4YR6A 5I1EL 4KKAC 4GRLC 3RTQB 1H3TA 4FTVA 3AB0C 1BF5A 1TU2B 3LEXB 5BUPA 2KYIA 5D1XA 1WCBB 2XA3A 3AVEA 1BMZA 3GS7A 1A6ZA 1NFDF 1PG7H 4OB5H 5KEZA 3ML8A 4JPKL 2FQDA 1DBMH 4Z9KB 2X87A 4HEPA 4J3WA 1B3JA 4UM9B 2FECI 1EEQA 2V7NB 4NJ9H 1FGVL 1CYGA 5EU4A 2B9BA 1V8HA 1IC4L 1BJ1H 4PJ5D 4RNRB 2VDLL 5LHDA 1MELA 4A6YB 4HJ0D 3J2PA 4JS7A 3QJSB 3WTTA 3NCCB 1MY5A 5E8OB 3MRLB 4XN8A 3VXMA 1XGYH 3MRKA 1KGYE 1YAIA 2Q8BL 3V0DA 4ICXA 4L1LA 1HSBB 3K2MC 2G2PA 4W9FC 1P69B 3WXWH 3AZUA 4FFWD 5JIQA 1OWWA 1CLYH 4JHWH 5JO5A 3WIFA 1IQDB 2VMEA 2DWXA 1GHFH 4Y9GA 3TO4D 2EDKA 1JERA 3DGGA 3C8KB 1AC6A 3RZCB 3LIZL 4PWFA 5CJ8A 1UWGH 3ZMEA 5TF0A 2ZX8A 2W38A 4GRWH 4BRVA 2IAND 3SKJH 2BP5M 4HKZB 2BCKB 2C26A 3APCA 4ZD3H 5KW9L 4CKVX 4F3FA 5IVZA 5C92A 5I0WA 4EOWL 3UDWC 3ZXAC 2ZOTA 1L9NA 4HXAH 5D2NA 3TP4A 1XTMA 3GPEA 3H6JA 5ALBH 4YNYA 3V4UL 5AVVB 4HBCL 1VCBC 4H0HB 4R8WH 1JAEA 3F7YB 3PV7A 1UZ8B 2DN7A 4AYMC 4ZX4A 1BVOA 1N5AA 4I9WD 4WVRA 3VRJB 3VXUA 4ZMLA 5CEYA 3DHPA 3VWKA 1IIKA 3LPGA 4AV0A 2OMXB 3RWFB 2VWEE 1Y6NR 4PGJA 3LRKA 1U8HA 3G6DH 3LD8C 1P7HL 4U3HA 1ORQA 2OMYA 3L5IA 3V5KB 4KQ3H 5DJ6B 5C86A 4E2OA 12E8L 4HIIA 1SXBA 4ELKB 1E5YA 1MRFL 1DVXA 1XSKA 4HGMA 1QBML 5I71B 1K5NA 2ETWA 4P2RD 2ZXCA 3UAAA 1FV1A 2EDDA 4NT6B 2H2SC 1QBAA 2DBJA 1DQLL 4HGWA 4GFTB 3E9UA 2WWMD 3P2DA 2AJSH 4PWGA 2R4RH 1DBKH 4XWOC 1MZYA 1NINA 3BVDB 4M7LH 4XE0A 3AWFA 3E2HB 3PABA 4IKIA 4F1ZA 3RFRA 1HCFX 5DUBB 4PRDA 4GP4B 4OUUB 3K8KA 3QUYA 3GBEA 4PJIF 3MBEA 2VQ1A 3MAWA 4X99A 1Q9OB 1F3JA 1OGTA 4HWEH 5F8QC 1E3FA 3EH1A 1EDHA 3VI3A 5IR1B 4QOKD 1E5CA 3BD3A 4KY2A 4PRAA 5LAPA 3BH9B 3LZLA 5E6ZA 4DZBA 3RAJL 5IREA 1ZT4A 2W0FA 2GC7C 2Y23A 3IDYC 4CU8A 2WBJC 4NOBA 1NOAA 5IK3A 5I6OA 2FO1A 4C58B 3D85D 4Y5VA 3WO3B 4JJHA 3NIFF 1TJIL 4KXZI 4H26B 4HMCA 1B4LA 4NUJB 5EORL 3CZEA 1GZQB 5EZOL 5CLWA 1CXFA 4UQIM 3AWEA 1BZ7A 3PWLA 2F54D 2YEZB 5AVUB 2QTVA 4UILL 1NOFA 1UEMA 4B9FA 1YECL 1WTGT 2H32B 4CN4A 1K8IB 1D7BA 2P42B 3OXRA 4Y2OB 4AYFA 4HHGA 2JK5B 2TAAA 4U2ZA 1CFBA 1O7DC 3GFUA 4MJIE 3O3DB 5C0GA 1T5XB 3NCMA 3OPUA 2GT9A 3GJFA 4PV1C 2O6DA 2VMJA 3RVVC 4C56A 2XWBB 3IWUA 1D5MA 1UWFA 4AT6A 3VO0A 5J13B 1P5UA 1UM5L 3B6SA 1JHLH 1UZGA 4XNQA 4BKLA 5DFTA 3L4VA 4KXZH 4AVKA 1G9ML 1YQ2A 4O2CB 4LSDA 1E8YA 1CC3A 1RJYA 5DQ9A 2CIIA 4JZJC 1AQDB 1GGBH 2B1AL 1KIRA 4HC1L 2BNRE 4NQCA 5KBKA 4UIKL 1TZGL 1VDGA 2AJUH 4TULH 1ES0B 1KGXA 2QKIA 2X3CA 3BAKA 2EH7L 4U1IB 4RQQA 3JZYA 4ZOBA 5B21A 5E2TH 2R27A 4CU6A 4QYOB 1LP9A 5H4ZA 2XACC 4WUUE 1NIEA 5BS0B 4JFEB 1F00I 4GIAA 4K3DH 1DLHB 3FSVA 2WIIA 5T3ZL 2IXQA 2EADA 1YO4A 4C47A 2EACA 1KJVB 2FZ3A 2R7EA 3PPEA 1HZHL 1ET8A 4N0UA 4P5KB 1LO0H 4PP1C 4MXWH 3TBTB 3TZVA 2ZG3A 4QHPA 5DSCB 4B0MM 3WKNA 5IB2B 4LK4A 1G0YR 1LO4H 3QB7C 4JREB 1A7NH 3ZQ9A 4HG4J 4JFXB 1XEUA 2VDRH 3GMQA 1V10A 5K69A 1XF5B 3MRMA 2EVJA 3OL2A 2CHNA 2ED8A 1XR8B 3H7BA 3N06B 1N8OE 2AV7B 5GS2H 3FN0L 3I2CH 4WY7L 2ICWB 4O5LH 4LCWB 1EVTC 1N6UA 1Z5LB 4F8TA 1FZOB 3HPLA 3X13B 1I3RA 2NSMA 4HJGA 3CLWA 1O6TA 5AYUL 4RGNC 5BUGA 1I4FB 3D8MA 3AG3B 1PZ5B 3P4NA 4YFLF 2KERA 3QW9A 5DD0L 4FQJL 5BRZE 1IM9B 4JPKH 1E9OA 3ZDXE 2RACA 1FDLL 5H2BB 2C1OB 3DV6A 5AVZB 4F8LA 4P5TA 4ZFOB 2MQ3A 1FGVH 3SE9L 3FQ2A 1RLBA 4ETQB 5I82A 3MV8E 5L0QB 3H9SA 2IV9A 1FI8C 2EDEA 1BQUA 5AAMA 3VDCA 1BCIA 4AEIL 5FK9A 1S9VA 1A1NB 1R5WB 5DRNA 1S9WB 4LHUD 4ODSL 1HXYA 4JN1L 2Q8BH 5DC0A 4L3FA 1YJDC 5K9KA 3AU1A 2EIKB 5ESVA 2DYSB 2V37A 3H54A 5I6LA 3T6XA 2GC4C 1GS7A 2CO6A 5CBAB 3N44F 3BZ5A 1KTJA 1AGCB 2J8UA 1ZVNA 1QFWM 4FXTA 1WPCA 3ARPA 1CQYA 3LIZH 2CO7A 4I0CC 25C8L 3VGAB 1AQKH 4J8RB 1GW6A 3QNYB 4MHHG 3DX4A 3U0WL 5KW9H 1HYRC 2GW5A 4BRJA 3PXJA 4Y5YB 5EIVA 3U2JA 1N6VA 4XBPB 3IKKA 3NEXA 4HEPG 4EOWH 3N43F 2CKBL 2XBTA 4OD2B 1BLIA 4YX2H 4MA3B 5TDOA 3MRBB 4FXKB 2XHNA 3IT8D 3GMPA 4NO5B 3V4UH 2VDKB 3FT4A 3EYVB 4HBCH 2B5IB 5DJDB 1ECZA 1TOXA 2WVVA 3NPSB 3FOLB 1KCKA 1GA2A 3FUFA 4JRYB 1I9EA 3DVGA 1KGIA 3A6CL 2J8HA 1M42A 2ZF9A 4F91B 2AEIT 4HCIA 1P6FA 4L0YA 3WUZA 1TVDA 3PYCA 2VL4A 3J7HA 4U4IA 3KS0J 5GGSB 3TPKA 12E8H 4NQDB 4QHUA 2J1YA 2IH1B 3MLTA 4L1BA 4Y16D 5FW8A 5JMRA 4JY6B 5JZ7D 5F7BA 1MRFH 2Y6TE 3BEVA 4X6CA 2VJ0A 2VKWA 3D51A 1QBMH 4UTBH 1VKXB 1UM6L 4U7SA 1PYWA 3C60C 4OT1L 5FKPB 4DPBX 1JZGA 1KXTA 1UT1A 4PB0L 3IXAA 4HKBA 2EUXA 1RL1A 3G6JB 2X4UA 3VFSA 1DUZA 1T0MA 1K72A 3DRTB 5CR8A 1RUAH 2EH8L 4FI6A 3EAKA 3IBOA 1BFOB 2A74C 4ZS7H 3AG4B 4L8CA 1L7TL 4WKZA 3BIBX 1VRSA 3CFKB 1A2YA 4APXB 3O4OB 4UT9L 4ABQA 1UOKA 4ENED 4OGYL 5T8IA 3RAJH 1W6LA 5EDSA 4JKMA 4XX5A 2O5YH 3ETTA 3M07A 2EDYA 3LRHA 5C0CA 1S7QA 2XWJA 4XH2B 4B3VA 3L7FA 1CFSB 3PWPB 5F3BB 1E28A 1TJIH 3G6AB 2P46B 5EORH 1JPSL 1R47A 1MCCA 2FJFA 1JG9A 4XMVA 5LO7A 4MQSB 2D31B 3G5ZA 2FCBA 3QFJB 3LS5L 4AKQA 2MH4A 2AEWA 1P6WA 2CG9X 2BW5A 2QHLA 2NZ1A 1TKWA 2J5LB 3CHPA 1E5ZA 1TEFA 1QG3A 1HH6A 2KZWA 4PS4H 3BVNB 4CJ0A 3DSNA 4ZYKA 4HMDA 4C4KT 1Q94A 5F7AA 1SJEB 3SBWC 4PP2B 3N9GL 2Y3NA 1XR9A 2DQEL 2VXSL 2H2PC 1P1ZB 1UD3A 1LO5A 2CJUH 2K3HA 3VACA 4DKDC 3IETA 3TO2B 2HVJB 5IHLB 3JTTA 3RFZA 1FYTD 1UM5H 5CIPB 3JV4B 3FT1A 1G9MH 3OKOB 3QDGA 1KIUA 1PGRB 2XKUA 2Z31A 4DP0X 3ATDA 3DX3A 1J5HA 2AW2A 3RWJA 4GQQA 4P9MH 2PTTB 1UHVA 3T3PB 1CE1L 3FZUD 5FW6A 3I9IA 4HC1H 4EIGB 5TGBB 4OZHB 4M61B 1TZGH 1NIDA 1BAFH 5C0EB 4HS6A 4MWFA 3BIKB 3OBAA 3F01A 2XPYA 3CZGA 2EH7H 1OK8A 2DWEA 1DQVA 1LNUA 3OAYK 1KYOK 3QORC 4IYKA 3SCMD 3KMDA 1MVFA 1BHGA 1EO5A 3EFFA 2PP7A 5IOPB 5HHNB 3TBVA 1PLGL 2DWDA 5JPMA 4M4PA 1RUPL 2IH8A 5CZKA 5IB3B 3VFOB 3ARDC 1Z9SA 2ICEB 1HHJB 1U58A 1S7WA 5I8OL 3SDCD 4D8PB 5EEXA 5LNEA 1NFDB 2AQPA 1O5DT 3NEOA 3ZL4L 5HHQB 1BXXA 3BHBB 3HBPA 3PHOB 3FHAA 4CDHA 4HK3N 1EHXA 2DM2A 2XKSA 3T0EB 1KCSL 1MLBA 4KK5D 2GHZA 4ZUVB 4X6BA 3ZHDA 3B9VA 4I87A 2OMZB 5D55A 1NAMA 1HESA 2KDYA 3TESA 3QJQB 3OAZH 4HJ0C 5FV2A 3U9UB 2GK2A 5AYUH 1FWXA 4U6HA 2FSEA 3L2MA 4QRSA 3FUEA 2B0SL 5BVPL 4WNQB 3O3UN 3VFTA 5DD0H 4FFWC 3GBML 2VLJA 3PP4L 4P4KD 5BO1L 1W72L 3TOPA 1FDLH 1OV8A 2A9ML 4IKKA 3TO4C 1IB5A 2VJXA 2CHWA 2D3JA 2K1MA 4QRRE 4WEMB 5DJAB 3SE9H 2XVKA 2A83B 4OH2A 3CN3A 2XX1A 1HWHB 1BVLB 1TMCB 2OSLB 4G6ML 4GUPA 1ZEAH 3M8OL 4MB5A 5HDOA 4ODSH 3HC3L 1JZDC 4LLMB 1A4BA 1MHEA 2XWCA 3OAUL 3QHZL 4L4VB 1HHKA 4G8IA 4P4RB 3K46A 5EOTA 5F7KC 2GJ6A 2HTLD 2ZX9A 1NC2A 3O9WD 3LAFA 3RWDB 2KZBA 4N20A 1NC4B 3SE6A 3KGRA 3ARZA 4X5XA 1DJWA 1RLWA 3MTRA 25C8H 4HETA 4RZCB 1NBYB 1KXVA 4RDQG 4J4PA 4WFFE 3ORJA 4LOUD 5EU7E 1BD2B 3U0WH 3RURA 2DTSA 3VXTB 1DBBL 1VACB 3KVPA 3SDXF 2QADB 4CC4C 2CKBH 2IADB 2IBZY 3TA4D 3OKDB 1P1VA 1PVHA 3P3TA 4R96B 3L4TA 4YHLL 4AQ1A 5T1LB 3QH3A 4LAQL 1LWHA 3HMWL 1MAKA 4C57C 2KKQA 3DMMD 4TSBL 1TCRB 4ZS6D 4WV1C 1J05A 3MODL 3T3MF 1AR1D 4A2DA 4WU5A 2VIRB 4LEXH 2WWMC 1WO2A 5EO0B 4MMXB 3A6CH 2XTJB 4RFEA 2KPNA 4EVNB 1SMAA 2R2CA 4QCIA 1TQBB 2C9VA 4Y4KB 3AM8A 5DZLA 3S35X 5FEBA 2Y06L 1M7XA 2C4FU 4PJIB 2OX5A 5AUMB 3MRPB 3ZT7A 2GIYA 3UG3A 4I3GA 1QKZL 3DA0A 1JPEA 2H3NB 2BY2A 3F7LA 4U4BA 3P4OB 1RURH 4QAMB 3L3IB 3G5XA 4BFNA 4NC1C 4Y19E 3R8BB 4DKAA 2BSEA 3BGMB 1UM6H 3NH7L 1SDYA 3MNZA 1JN6A 3MUUA 4PB0H 4K5PA 4QO1B 4ZMPA 2Y7NA 5EG6C 3NIFB 1OCCB 1R3KA 9CGTA 3QRGH 5F7HA 3ULVD 4UINL 4NO0B 4JY4B 2EH8H 1AY1L 3GSQA 1FAIH 4R7XA 4DHLA 3S8GB 1L7TH 2DWYA 4WW1B 3THML 3HC4L 3ISYA 4UT9H 3SE4A 3VTMA 4OGYH 4OU3A 4ESKA 3IJ7A 3NQIA 1MNNA 1FBIL 3Q1EA 5IMOB 2EIDA 3CZSA 1DLFH 1FNGB 1NM9A 4P5SA 3GI9L 3QNXB 2YHGA 3NT0A 2E6JA 1X4YA 3QDMA 2LOEA 4HJUA 1JPSH 3MV7A 4PSPA 4K3HA 3ZE0F 1J0IA 4ZW7A 4JZNA 2HFGH 3LHPL 2X6UA 4PJCA 5DJ0B 4BH8A 4NQQA 3LS5H 1EBPA 3SPCA 3NIGF 4MJ6A 3OXSB 2DQCL 1YN7A 3SQOL 5KSAB 3RGBA 3KPSA 4M7KL 1SRDA 4NSKA 1I7RB 2BMKB 2E27H 2X5PA 2VE6A 3E0GA 3MFFA 3MJ9L 1MJJA 1T7ZA 3L3JA 3N9GH 2B59B 3GBNL 4HFWB 2BSDA 3V6FB 2DQEH 2VXSH 3UBHA 4KDTC 4OFKA 2VZTA 2FEJA 1YMME 3WNJA 3HTLX 3ET9F 3I3DA 5DR5L 5LB1A 4N6RA 4YFEA 4FGMA 4FQIL 3EGSA 2AERT 3RDTD 4LSQH 3V0AC 3VQ1C 4JRXE 4PG2A 2N4IA 1GGUA 2A7BA 4QGTA 2M83A 4JX0A 3Q6FA 4MVBD 2HAZA 3QUKA 2CPUA 3SHSA 2R56H 3E3QE 3GM0A 1OE2A 3P0GB 4IMLA 3DRQB 3OQ3B 3V9FA 3D39E 2OSWA 1U8NB 5FGCB 2ICCA 1IKNC 4LGSB 1TTFA 4CSPA 3RPKA 3PGCB 2VRKA 7TAAA 1JDDA 4XB8A 5IQLA 1M53A 3F64A 3BZEA 2FIKA 3MBWA 5C8JB 1ADQL 4PJEA 1MCOL 4YR6B 5IHWA 4BK5A 3U83A 5F7DA 3NCYS 3TN0D 1IM3D 1PY0A 3AW5A 2EE2A 4XB3A 4B53A 3H55A 3O11B 1UKTA 2IMNA 1PLGH 3DXAA 3P3RA 3QQDA 3TBSA 1W0WB 1A6ZB 1J5CA 1GYAA 5GS1C 4PRPE 4CU7A 5I8OH 1LO3L 1T66D 3B1TA 5DA0B 3RTQD 2P8LA 2WQAA 4MASA 2ZCZA 1RCYA 3ZL4H 3O6KL 1TT6A 2IWFA 1GL4B 3LNEA 4Y2NA 3RNQB 1KCSH 3TA3B 1NCOA 1NTDA 2OM5A 4G8GA 4HBQA 3LKPA 3BEWB 3MRQA 5F1NB 3D7PA 4XNZC 3ASNB 5I6NA 4RFNB 5CINL 1I7TA 1TZ8A 5L2KB 4LAJH 3IDMA 3WIFB 4KKZA 4Q6YA 2B0SH 3RVUD 5BVPH 2W65B 4FQCL 3GBMH 3DGGB 5K5YA 4S0SD 2ZCKL 1I8AA 2JSFA 4Z7WA 3N44B 5C9KA 5BO1H 4AJVA 2JQAA 3ARRA 5E5UB 1OXYA 2A9MH 3I50L 1I75A 3O2VL 3QZPA 3VD7A 1N3NA 1TFPA 4XNXH 3SBPA 1F11B 4NNYA 4UOW0 3K8MA 4NQSB 4JFYA 4XN2A 3WIHA 5EF3A 5IVZB 4HS3B 2NXYC 3RZCD 4G6MH 3M8OH 2QGBA 1GGTA 1NFIA 3JWNC 2J20A 2RJMA 3HC3H 3OAUH 1FL6B 3QHZH 5CLTA 3WN5B 3N43B 1J12A 3VXPB 3BWUC 3FU9A 4YNYB 3SJVE 1YPZA 2Q76A 2LU5A 1A8JH 1N5AB 3VXUB 1HCYA 3STZA 3U4EA 1A6AB 3UGXA 2EYSA 3VWKB 3ZSSA 4MZRA 3FB8A 3CH8A 2ZYIA 4B3EA 4MS8D 2E7BA 4QT5A 2X88A 5FO7B 1GGCL 4QAWA 3RX9A 4ODVL 2R1XA 4GAYB 4ZMTA 1IAII 2QPDB 1NDGA 4FQ1H 5D6DC 5AEAA 2HWZL 3N04A 2Z0BA 1DBBH 4QRAA 2IPKB 5K93A 4XVUD 2J55A 2VC2B 3U9PL 2K4AA 1XGZA 1U30A 1W80A 4ES9A 4Y16C 3C9NA 5KYYA 4YHLH 5JZ7C 3LV3A 5D7JA 3COOA 4LAQH 4CC1A 2OS7A 4NWTH 4PIBA 4F7KA 1N8ZB 3BESR 2AJVH 3AREA 3NN8A 4G6KL 3MODH 3MHZA 2K4WA 4KO6A 1XZ0A 2UVFA 4FULA 4H8VA 1JBJA 5ECGA 4HULB 4LU5L 5C71A 1T1YA 2FBJL 3QUYB 4PRNA 3QJHA 5C07E 3MRFB 5KBMA 2N7AA 2CUAA 4X99B 3ZO9A 1OGTB 8PAZA 1OAYL 5KYUA 3U82B 4E9LA 5JDJA 1RV6X 2GITA 2YFOA 5IB5B 5JHDA 2F1AA 3X14A 4PRAB 4DZBB 2NRDA 5MENE 4M02A 1QKZH 3ZJAA 3CFCL 1ZT4B 3BKML 2N7SA 2EVHA 5IK3B 4A7TA 4IOSD 1B2WL 4NQUA 3C09C 4ENEC 1H8NA 4Y5VB 4Y2DB 3F85A 2ZONA 1JDCA 3L1FA 4F15C 2JJSA 1F6FB 3X12A 4OTXH 2V5RA 5CWSA 3S48A 4UB0L 5D7LE 4J3OG 2NW3B 2GQHA 1ZD6A 4QHMA 2AJYL 5HGBA 4E41E 1AY1H 3N1GC 4AYFB 1IJNA 2GBUA 1JK9B 3V9CA 5CP3A 4MJJA 3THMH 3HC4H 2UY7A 1P84K 5DJZA 2GT9B 3GJFB 3MRCA 2RCSL 1F6LL 2ZP0T 3DOIA 1KJMB 3RILA 4F1SA 1D5MB 4WRLA 4AT6B 1KB9K 3GI9H 1OP3K 3B6SB 4F20A 4G9FE 1RVFH 1NSNH 3T4AA 4MD0B 3T6ZA 1U2CA 2PF6A 4BKSC 3GJEA 3STLA 5ETUA 3KDMA 2AEQL 1I8LC 1RJYB 3LHPH 2D8KA 2CIIB 3S9DB 5FKAB 3AGVA 3RB5A 3FO0L 4HUUB 1KIRB 3R4DA 2IG2L 4WI3A 2MCAA 2DQCH 1L0YA 3SQOH 3UYPA 3VE0A 3PQYA 3C75A 2Q3XA 1JV2A 3DYMA 3FZUC 4RQQB 5KSUA 3MJ9H 4HSCX 4S1QL 4UNVA 4LGRB 3GBNH 3MLUL 4FZEL 4ATTA 3CMGA 3VXSA 4TPRL 1SMOA 4TNEA 4FXGA 1KYOJ 4N2AA 2ITEA 5DR5H 5HYEA 3HEIB 4CADA 4DWHA 2IXQB 3H9ZA 4E9RA 3SCMC 2A4EA 2FZ3B 2R7EB 1AG6A 1X5XA 2Y9RT 3EH4B 1MKFA 2P26A 3BSGA 5BS0D 4JFED 4JG1L 4L3ED 2I27N 1W6WA 3JTSA 1DEEB 1I8MA 3MRMB 1OD7A 1F86A 3IJYA 2OJZH 4FQXB 4FMVA 1XIWA 1LEIA 3SDCC 5I1LB 4PJEF 4X5WB 3EH2A 1TYEB 3K0YA 3U4AA 1T7YA 1UASA 1ADQH 2DKSA 2H26A 3HPLB 3ZQWA 1MCOH 2X4PB 4AQ8C 4KK5C 1I3RB 4HJGB 1BFVL 3GS4A 3TEYA 1M71A 2WN2A 2A99A 1YSOA 4ZNEA 4G43A 4JQVC 2QSVA 3HIZA 3P4NB 2NX5A 3FRUA 3LZNA 5C7ZA 3HG1E 1AD0A 2QFPA 4NZUL 2EDOA 1YNTA 1OOWA 1PKOA 1LO3H 4X8XA 5C0AA 3NEEA 4M1GL 4Z7UF 4LLQB 4P5TB 2XPZA 3NJHA 3Q5TA 4I18A 4P4KC 1WHOA 3O6KH 4M8QB 2AMGA 3LZPA 3H9SB 1IM9D 1BOYA 5I1JL 1PF3A 4S1RL 3HFML 5FK9B 1S9VB 3B3BA 1V3KA 5DHVA 2SODB 2H6PA 3QCTL 5CINH 1MIMH 3AU1B 5DD1L 3S3PA 5HVGB 5ESVB 5J12C 4DP1X 4G72B 3HNTL 2OL3A 2CO6B 3BMWA 2OMNA 3CX5K 3EYUL 4JJOA 4R7LA 1UWEH 1MCNA 1CLOH 2FWSA 2G75A 2XIDA 4HFUL 5AWNH 4GB9A 5B8CA 5KVEH 3DETC 1YUHA 3JVGC 4FQCH 4UU9A 3ZZQA 2ZCKH 3H1ZA 3O9WC 3FO9B 2H45A 3I50H 4PWKA 3KLAA 5GS0D 1X44A 2WANA 1O6VA 4LT7A 3OJMB 3SEPA 2G5BA 3MU3A 3H3BC 5A43C 1KCUL 4JDZB 4FLHA 1NH6A 4LOUC 3V7AG 1YPZF 4IBVA 5AQ0A 4XMZA 1B4TA 3PL6A 1LHZA 4AYSA 3SDXB 4NM8L 4Y9BA 4IIQC 3O8XA 4G8FA 2BO0A 1HCVA 1Q9LA 2G2RA 2V33A 3HJ0A 2ZF8A 2XRAL 2J3SA 3DMMC 1YAZA 4ZS6C 4P9HC 3DVGB 3ZLQC 2YGOA 4K07A 3T1FB 3GLDA 3T3MB 1AR1C 5A2IH 4JFFB 5IY5B 4CNIA 3W37A 1C5BH 3OB0K 4ODVH 3S98A 2OMVB 4KZCA 4PJFA 1Y6KR 1CJYA 2HVKA 4GG6E 1JPGA 4MD4B 4K9EC 2LVEA 2PWEA 2HWZH 3CXFA 4JRYD 1XCTB 3C5SA 3BEVB 1PCXA 3CBJB 1KGCE 3U9PH 4DEWA 4BUHA 1PYWB 1S7XA 1KXTB 1WF5A 5IT2L 3LNIA 4NQDD 5JW4N 3IXAB 4UQDA 3V10A 4QHKI 3VFSB 1NAKL 3KWWA 2VN6A 3Q9PA 2K7PA 4IKNA 2NZIA 5GRYA 4NPKA 5A2AA 1BXVA 3UJIL 4LU5H 2FBJH 4LXFA 1QTPA 4XBEL 5CD3B 4XPTH 2A6DA 2NY1B 2Z93A 4L4TB 1OAYH 2YA2A 1QZ1A 3FFCA 4FS0A 4MNGE 4WKZB 4L8CB 1A2YB 3ULVC 3INUH 2A73A 3UJTL 5BZDB 2UVEA 2P28B 3E6HB 4HJSA 2XBZA 5KOVC 3CFCH 1WK0A 3BKMH 1H8OA 5IESL 3SE8L 3VD0A 2HSIA 3WMSA 1B2WH 5C0CB 5LCVL 1GSKA 5DQJA 2DQ6A 2YEQA 3TYFB 1E28B 1J11A 2C1PA 3BZDA 4OQ1A 3BH8B 2V3DA 4XNMA 1HXMA 2CCVA 4H4NA 4PJBA 1T0PB 2FJFB 3IDXL 5HHOA 1RULH 3L4YA 1AGDA 3PJSB 3FNKA 3G5ZB 3IJEB 4UB0H 4PBVC 4WHYH 3EW3B 1PZCA 5HJ3B 3QQNA 3ZE0B 3CDYA 3PWPD 2H0JA 5EF0A 4BSWB 3FT9A 4JEGB 2VAAA 1MCKA 1HH6B 3MRJA 4F7EA 1OF0A 4BQ6A 3DSNB 1Z1WA 1MI5E 3NIGB 2HG5A 2LU4A 1Q94B 4UMSA 1C12A 4P9HL 2DPKA 3IJ9A 3QFJD 1JWSB 5F88A 3QARA 1XR9B 3TWYA 2AAVA 3V0HA 1L5GA 1CK0L 2FJHB 2YSSB 3LSOB 2JKJA 4FHJA 3EJJX 4X50A 4A7SA 5JTWA 3CJJA 2PW2A 2FT6A 1TQCB 3C8DA 4K9EL 2HTKD 3TEWA 3JTTB 3RGHA 2UWEF 3P2TA 3SYCA 5HBBA 1CMOA 1KNOA 3QDGB 1C16A 2GIMA 5FYKH 1M7IA 4O58L 3RDTC 2AEQH 1T21A 4TUJB 2VXVL 5KSBA 4OF0A 2ESVA 4K7PX 3H2QA 1JGLL 3FO0H 4XXWA 5JXEA 2IG2H 4MVBC 2P5WE 3ARFD 4GEJA 5KUMA 2A0LD 3NFPA 3VI4A 4IK6A 2BVOA 3HBGA 4G11A 5AL8A 5JA9A 1O9ZA 4S1QH 2DWEB 1E5UI 2QDVA 1O75A 3MLUH 2AKRA 4PJ8A 2EAEA 2XWRA 4TPRH 5AL0A 1CFNB 1QEWA 3ULVL 3NRFA 4A7UA 2DWDB 5JPMB 5B1KA 3TN0C 4GP8B 2AVFA 2X9YA 1IEBB 4XMUA 5IB1A 2AAAA 2JKLA 4IBLT 4JG1H 2K6YA 1A64A 1X5ZA 2ODHA 4N1EA 4HT1L 1BIIB 5IJVB 5I8CA 3ZT6A 1I1YB 1ZGLM 4HIJA 1F4XH 1ZY9A 2EC8A 1V3MA 4I13B 4KVPA 3S0PA 5HVHB 1W8NA 1A1MB 3HCVA 1T66C 3RTQC 1MLBB 3M17A 5L7XL 3EXJA 2Y7MA 3LKQA 5EZPA 2RIKA 3RDJA 3ZQXA 1XZWA 3CQFA 1M3IA 1UYWL 5BQDA 1BFVH 2K6ZA 3QK0A 3T0ED 4LSSL 4U6HB 2FSEB 2IWKA 3CDZA 2PCFA 3VSVA 3ECUA 3WI9A 1NCUA 1GSMA 4OFIA 4Y1AA 3GSNA 3VFTB 3KM2A 5KBPA 1Q9KA 4NZUH 5KOMC 2WZPA 3SKOA 3V4PH 3DIDA 1HINL 4PVLA 3FCTA 4KI5D 3RVUC 1CS6A 1H3VA 4M1GH 4MSWA 1A3ZA 4PRIE 3DURA 3IDGA 5HP5A 4LNRA 4KZ0A 5FAAA 2EEAA 5FA4A 2WWOA 5IB4A 4UV7L 4Z77A 2F7QA 4S1RH 4BFBD 3HFMH 1FHGA 1OLLA 1HOCA 5L2JB 1QFUL 3A0OA 3QCTH 1MHEB 2A1WL 3WMQA 3RZCC 5DD1H 2CWRA 4G8IB 1UACL 4L37A 5D1QA 3HNTH 1OQOA 5D4QA 1IAOA 2P49B 4PMFA 3EYUH 3NSFA 5GRJH 1NC2B 1JYNA 4HFUH 5F3HA 2WK2A 3OZLA 3DOSB 1ZPLA 4NC2B 4YAQA 1JGDA 3B9DA 4L4VD 4X5XB 4OGAD 1GGIL 2Z4QA 2NMSA 1MFDH 3EHBB 2B1HL 4JGJA 1A6PA 1RK1A 4MS8C 2F53E 1UA3A 4F8PA 2N7BA 1NGXA 4XBGA 4XPAL 4OUOA 3NJKA 1NGWB 1KCUH 2BWDA 2KBGA 1Q1PA 3VX0A 1U8IB 3VFMA 4AQ1B 5MEPA 4AQAB 5K1NA 1OCZB 1TO4A 4M4RA 3VDBA 5AZ2L 4NM8H 4XVUC 1SHMA 4KVNL 4FERA 1J05B 2WVTA 4OCSL 1MH5A 4AUUA 4HJTA 5HHVH 3D3VD 2XRAH 1ADWA 2NUPA 5GRUL 5T1LD 4WJ5A 5CFHA 4Y88A 3PXLA 3CSYA 2CDFA 5I71C 1FSKB 4JJ5A 3SYQA 4QCIB 2JLPA 2FQGA 3QR2A 4A6YL 2OX5B 1MCIA 3UZEC 4JG5A 2XTJD 4X9YA 5HI3D 1MDAA 4G80A 3E2HC 3DJZA 4FE9A 4GRLA 5ERWA 3TFBA 3W0WA 3BRFA 2A9AA 3KDPB 4WNSA 2C7UB 4GMSL 4R0LB 3BVWA 1NUFA 3L5WA 2CLZA 3F5WA 1NAKH 4PGBB 1R3KB 1MCJA 1ERNA 3BP5A 4YEFA 1LJMA 1UWXH 5BZZA 3WTVA 3Q1SL 5I1HH 1U91B 5EU6E 3S4SB 5C0BA 3WFCL 4BQBA 2WB7A 4XBEH 1SJXA 4RX4D 4GPVA 1ZLSL 3UAJD 2A9CA 5IW6B 2NZ9D 5KTEL 4YPGB 4D9RD 2W92A 1E65A 4LMQE 4MAUL 4AIOA 4NO0D 5BQ7A 4KO5A 4M43L 2YMXL 1P84J 4K55A 3SE8H 2DQHL 1CDGA 4V1DA 4PJBF 3GQFA 1ML0A 3QDMB 2JV6A 3UTPD 1REIA 3KPRE 4OLWH 4BZ1L 3IJSA 4UQBA 1K9TA 3IDXH 4JZNB 1IAMA 3MV9B 4BSVB 4PJXF 4AG4L 4MYPA 2AQ2A 4NQEE 4B9GA 4D3CH 1YN7B 3OG4B 4OI9A 2R15A 4QRPD 3KPSB 3F04A 2V17H 1P2CA 3KXFB 3KYNA 4RGNE 1BQLL 3KR3L 4NSKB 4EO5A 1N64L 2X1QA 4R4BA 5J13C 5SX5H 4PQXA 2VE6B 3MFFB 2DH2A 2X41A 1PQZA 3L3JB 2XTLA 4P9HH 5E00A 3UDWA 4X8GA 1CK0H 3SPGA 1TZHA 4DCQB 5JHMA 1ZT7A 4IK7A 4UNUA 5KSAD 1UTDA 1RIVL 1EGJA 1FFOA 1JI1A 1KYDA 1E8ZA 5JHLA 5CO1A 5I16B 4KJWD 3RVXD 1NJ9A 1D7CA 1Q0XL 4AI7A 1O9WA 5KSBF 3ARGD 3KBPA 3LZRA 3ZE1E 3Q6FB 4ZQKA 5EA0L 4O58H 3B7RL 4F9LC 3C08L 4UIMA 4LF3A 5C0FA 2LV4A 4IMLB 4KOCA 4Q0XL 5CP7B 4AE0A 1BXAA 5J7CC 5KANG 1H5BC 1ND0A 2ADIA 3W81A 3ARVA 2BOCB 1YMHA 4A2GA 2EIZA 2OAAA 3OZ9L 4L1DA 5EZLA 2YD3A 3EYFA 2FIKB 2CGRL 4PJEB 4MXVE 4HHAA 5F7DB 5IVXE 4XMKL 3ULVH 3K74B 4ES8A 1KTKE 3DXAB 3QQDB 3ZE2E 4HC1A 3U6XS 3TBSB 3IMWA 3SD2A 2HLEB 3W39A 1XF4B 1S2EA 3QPQD 3VNYA 3CSPA 1IBBA 4B97A 2P8LB 2WMPA 1KJ2A 1AANA 5HPMA 5F7MC 3RWHB 1ZMYA 3TU6A 3CU1A 2X1OA 3KVQA 4U1JA 2ZOKA 3LRLA 4GMTL 4R3SA 5F21B 1NGZA 4NZ8A 2DI8A 3LXBA 4Z7UB 5F9OH 5CCHE 3FH8A 3QJTB 2PETA 5L7XH 1JZ2A 3LKPB 1U3NA 2BSBA 2WBJA 3QDAA 4HWNA 1HI6B 4KUCD 3FU8A 1AGEB 4MFHA 5ACZA 3P11L 1DE4A 3L16A 1UYWH 2C3XA 3OKEA 1INQB 3TA3D 4LSSH 2A3TA 1IGIH 5DZAA 4BZ2L 2VLRA 5L0QC 3CX5J 4X8CA 2Z35B 4AM0Q 1CTNA 5L2KD 2V9QA 4QJ3B 5AAWC 1XF3A 4XCEA 3UBGA 1EAQA 4RMBA 1MCBA 2ZNWA 1N3NB 4L9LC 5CBEA 1GYWA 4I2XE 4CA4A 2D3LA 3ZL1A 1FN4B 4UV7H 5GQBA 5A2JH 1SXAA 4LPCA 5GS0C 5DFVD 2APSA 3FHEA 4ZW5A 4O2EA 1OCRB 2VN3A 5JLZA 1TVBB 1CBVL 2P8PA 1SQ2N 4DKEH 1FFPA 1FL5A 1UACH 4UTAH 4HKJB 3LZQA 2ATAA 1U8CA 3IU3A 1CT8A 4HA1A 1YPZB 4LFHD 2EE3A 1HL8A 3FRPB 4JN2A 3U4EB 3BW9A 5PAZA 2OYLA 4Y5YC 3TL5A 1TIUA 3FB8B 4JO1L 1GGIH 2J6EH 1CBJA 2ZYRA 1X9RA 2J12B 2WSPA 3KJ4C 4Z1PA 2B1HH 3CVDA 4MJ5A 3L2LA 4FXKC 2Q0ZX 1G7PB 2WWKO 1NDGB 2FUQA 4QTIH 3UTTA 5J0BA 5HYJA 5E08H 1BX2A 2B5IC 2E76C 4XPAH 4WTWA 3NPSC 2F19L 3CN4A 1YN6B 4AZUA 2XU9A 3LV3B 5D7JB 5SV4A 3RWCB 1FL3A 2D3VA 1AOHA 2JXMA 4LDEB 4KVNH 3AREB 4YPJA 3MDJA 4JFPA 1RPKA 1A9EB 4OCSH 3UBXI 2EUVA 3MJGX 4ZFOL 4ORZC 5GRUH 3LPOA 1QUPA 5ICXA 1J8HE 3QJHB 3NG5A 5H37A 3V0WL 5GGUB 2H47C 2YD7A 4LIQL 3PWVA 4W9KC 5EIIA 3E1ZA 3PAYA 3VFVA 4PBWD 4UNIA 4KQ0A 2GITB 3T9WA 1JNLL 3X14B 5FHAH 4CVWA 4CMMA 1ASQA 3RL2A 1THCA 2VR6A 2ZYHA 4XRCA 1MAJA 3KYKL 3UABA 3WU1A 1OAQL 1M05B 1AGFA 4UYPA 3ESVF 4U6VL 4ANKA 5GS0L 5HGGS 5FWQA 1P7QA 3CTTA 3X12B 1BZ9B 3VJ6A 2ROXA 1KOAA 3O4OC 2Z7ZA 5DJCA 3CCHA 2L3BA 3GXDA 2MMXA 1WC7A 4Y2DD 3Q1SH 3Q01A 4QHMB 3WUWB 3N0AA 3WFCH 4BFIA 3K6IA 1X7QA 2I69A 4OCRL 3K7UA 1D3CA 5KTEH 2PYFA 2UY7B 2M2DA 4HWUA 5KYXA 5DJZB 3RVTD 2DWTA 2CA4A 2HX7A 4MAUH 1PY9A 5FO8A 3MRCB 4Z7NE 4M43H 2YMXH 4DN3L 3OF6D 1AVAA 2DQHH 5LXGL 1TYRA 3UL4A 4X9HA 2VDKL 2ZWZA 5CJBA 3WV0A 3T4AB 3BZ4B 3MZTA 3QR0A 1ZIBA 5F89B 3AG2B 3STLB 1ZSDB 2HTKC 3KDMB 4BV1A 5C2BL 2EKSA 2UWEB 1SUJA 4PYGA 4UT9A 5KJ7E 4ZZFA 5GJTH 4AG4H 3VFUA 1FF5A 4WIQA 4PJ5E 5C0ND 3D1MC 3ZTNL 4XOCA 8FABA 2LR4A 1PW3A 3VE0B 5JOFA 3L3DA 3KR3H 1XGQB 5FPIA 3VXRE 3ARFC 3CDGA 1E4WH 5DZVA 4PR5A 3QEQE 3NOIA 3PREA 3VXSB 1OB0A 1BREA 4FXGB 3JV6A 1MWAB 2GB2A 1RIVH 5AOLA 4A2EA 2ARWA 3IDNB 2H1PL 1Q0XH 3VSUA 1CE6A 2C9AA 4QHLA 4POYA 1EJOH 1FCCA 4TVSa 5EA0H 1ZJBA 3NESA 3Q8EA 3C08H 3F12B 2VLKA 4Q0XH 2ZWSA 3BC9A 2WAQA 1I8MB 1T0NA 3QQ4A 1U8PA 1IFHL 1XIWB 1YY8A 2A9DA 4PREB 5D2LE 1UZ6E 1QRKA 3QUMB 2FO8A 2VABA 1YEDB 3OZ9H 5GZOD 1CGUA 2ADJB 2YKKA 4ODHH 2AANA 4HCRL 1F42A 4DSYA 4AXWA 4XNAA 2ICEC 4MNQA 4FQXD 4OFYD 3C60A 2YC1B 3CUPA 2G0LA 1QUNA 2EE0A 3EYOA 4I9WE 4XMKH 1M71B 4Q2ZA 5I24A 3EDKA 1NLDL 4G43B 3IGKA 1E7UA 4N1HB 3FRUB 4U0QB 3R4RA 4YZFF 2A6JA 2CJSA 4OKVA 4LSRL 3T0EC 5D7SH 4TV3A 5HI4D 4GI9A 2VZ1A 4JFDE 3VSTA 4YDVA 1SZNA 2NXZB 4JBSA 5G55A 2QGEA 4PJ6A 3UH8A 2H32H 5D7IA 3K6DA 5C0AB 3DC0A 4Q9QL 3BP6A 2A74A 1YEKH 4KZDL 2AQ1A 3L9BA 3L9YA 4RISL 1GOFA 3QC5X 4DOHB 3LVTA 4GMTH 4KI5C 5HVFB 1WWCA 2HJFB 2XN0A 1AD9B 4QXTA 1G43A 4HK3J 5BOJA 2ZE0A 4AK2A 1WBYA 3TNNB 2VYRE 1W16A 2DM4A 2H6PB 1YEHL 3P11H 3QJVB 4RBPK 4LCVA 3GB7A 2PR9A 3LKSB 5F6IB 3CFTA 3GSVA 3RIFK 3N0PB 5LGJA 1Z6JT 2OL3B 4TTGA 4I0KA 3ZY7A 2G75B 4B0MB 2NNFA 4F57L 4N9OB 1AI1H 1J87A 2DMHA 4WGKA 1BZDA 1MUJA 4PS8A 4UU9B 1OM3L 1ZE3C 1H0DA 2C9UA 4AJYV 1M7DA 3B3IB 1BZEA 1FLTX 3WL9A 3O2DL 4WSKA 2Q6WA 3SBWA 4FADA 4KHXL 3BRGC 3UZVB 1QOKA 4XNDA 1E27B 1WZAA 2WKOA 2G5BB 3RG1C 4R26L 3T2LA 1KPUA 3CVIL 4Y4FA 4OQTA 4BWWA 5CR1A 5ISZB 3QO0A 4AKOA 4YSCA 3OZKA 1CBVH 2FYYA 2XFXB 4UDTA 3GHEL 5JPNC 3EO1A 3GHPA 1W72A 2W9DL 2P44B 1XD1A 2NY3B 4DGIH 3KZ8A 3LEYL 4Z5RA 5DT1H 1FNHA 2G2RB 3MRRB 5I1DB 1RD6A 4F7TB 4QXUL 2WQUA 1T6WA 5LUMA 2NY0B 5BOPA 1F3RB 2BSSB 5DVOA 4P46B 4PJFB 3MYJA 5IQMA 4FA8A 1WWAX 1S9YA 2VW6A 3HRPA 4P5MA 4EI6B 1DO5A 5IMLA 3QORA 3C5SB 5CMAA 3PHAA 2RHEA 4JFFD 2F19H 2VL5A 1S7XB 1S7RB 3C6SB 5DQDH 2WINA 2NY7L 2XTJC 5HI3C 3L2NA 2N1TE 4IRSD 5I5JA 4MRBA 4FFZL 1TQBC 3D4GA 4OZIA 3EJUA 4JM2D 2HLAA 3ARDA 1QSEA 4V11A 3KWWB 5H8DA 1L9RA 3KWUA 2O26U 2Y1VA 5F7LB 2A5UA 5KVEE 4OCYH 3TBYA 3DK0A 3CFIC 1EO7A 1NKRA 3V0WH 4LIQH 3CFUA 3L1EA 1ROCA 3FFCB 1A1OB 1JNLH 4QWWD 2AI0L 3F8UB 3UAJC 1XGTA 1NCBL 2NZ9C 5ADOL 1UT9A 3HMXA 4L4TD 2NY1D 2OR8A 2E7CA 1OAQH 2BOBA 4G3YL 1GJWA 2E4FA 5GS0H 5DU7A 4AWJC 2DEYX 2YD9A 4J3BA 4OLVH 4XNMB 1HXMB 4PJBB 4G5ZH 4NCC1 5HHOB 4NRYA 2W0PA 1CURA 1AGDB 3UAFA 5C0CD 1AKJD 4QGYA 5B22A 2QELA 3O6ML 3OX8A 2Y2TA 3TO4A 3MKGA 4X98A 1KBKA 3MRJB 4M62H 1MG3C 5F0JB 4PJXB 2H4EA 1SLXA 4XAWH 3K2UH 4OCRH 1T1XA 4XVSH 5AKVA 3MRDB 4ILDA 5GIRB 5F88B 2D0FA 3PGFH 4JNXA 2IANA 1KJ3L 3IEAA 1L5GB 4Z78B 1BJMA 2J2ZA 3GIZH 1L6PA 1QR4A 5FYJL 3WBDA 5C6WH 1DQIA 5E2WL 5H37G 1EVUA 4DN3H 2IFGA 2PW2B 1UB6B 1MW1A 1TEGA 5EIIG 4QHNB 3SQBA 3HLAA 5F9JA 1JGEA 5LXGH 3FAXA 3GZKA 3RNKA 1NGPL 1INEL 5KSAC 2GBVA 4XCCL 1SEBA 3KE0A 2TSAA 3WE1A 1C16B 4OZGF 4KJWC 5C2BH 3RVXC 1FH5H 1T21B 5DYOA 5KSBB 3ARGC 1HE7A 4WAFA 3KL0A 3ZTNH 4FMKA 1JZJA 4R4ND 1C5CH 4L2LA 5MERA 1GZHC 1RZ7L 4S0HA 4Y9EA 3ALPA 3X1BA 5FUOL 3VVWA 4K4KA 1ECYA 1AS8A 4CC4A 3BAIA 1E4HA 5JMOC 2AKRB 2R51A 4OCWH 1DFBL 3TBBA 1HJCA 2BRQA 1OAKL 4GSRA 4JKKA 4MA7L 2BSCA 4P2RA 4NAMA 4WV1A 1WAAE 5HHME 2OCFD 4XOBA 1OHZA 3MNVB 3ZKXC 3DJSA 3QP3A 5HDRA 1S6NA 4KQ4L 4A63A 1TJXA 2CSPA 4I1NB 3MFGB 5KJRL 2W5PA 4HIJB 1OTTD 1XH3A 4G6AD 3RPIB 1OTUD 3BYTA 4ZNCD 5SWSA 1IFHH 3QPQC 3WEBA 3SGJC 4YL9A 1ZA3A 1OGAE 2BCMA 1THAA 2GAZB 3N1MC 4LLDA 4AVJA 3U6RB 3DO7B 2ZG1A 3M17B 3EOAB 4CL7A 5I1GL 2BNQA 3LRSB 1TJMA 3LKQB 1T22B 2YUZA 4HCRH 4KROB 4QOKA 4LPVA 3IDIA 4OIAA 4YFDB 2OXHA 5GISL 5CCGE 1DQJB 2G9KA 1Y1UA 3GMRB 3WKYA 5G2NA 3CC5B 4UV4H 4H8QA 4K0OA 1NLDH 1N59A 3L81A 5EZIL 3WJMB 4MLSA 5C09E 4Y1AB 3GSNB 2BWQA 1JRHI 2Y22A 3EJCA 4LSRH 1Q9KB 1NDTA 3TA3C 1HZLA 4S10A 1Z0MA 3D9AL 1F02I 3FCTB 5IKCA 3RP1A 3D6GA 4Y8DC 3L4XA 5FYKE 4MSWB 4AITA 2FO4B 1ADQA 3NPZB 2F54A 3IDGB 4YLBA 3S36H 2F2HA 4LNRB 1SY6A 5AOKA 1RP8A 5FA4B 3VYPA 3CZFB 5IB4B 1ZA6A 5A7BA 3NFNA 1MFAH 1E9PA 3US0A 2Q7NA 5IGXH 4AM0B 4S2SA 3N1QC 1HOCB 1OVZA 1YEHH 1UQSA 4H2AA 4J3VA 1G0XA 2PCPB 3UZQB 1G7HB 5DFVC 5D1QB 5CCKL 4X4ZA 4TSCL 3VB9A 2WZ6A 1T1WB 1HL9A 3Q43A 2EDNA 3PDGA 2HRPL 4JFOB 5F3HB 4F57H 3UMTA 3U0PA 2DB8A 3NCYP 1ZGLA 1U36A 2Z4QB 2TRHA 1Y0LA 3O2DH 2WKOF 4OVVA 1NC2D 4P57A 1RK1B 4KHXH 3WN5C 4KJYA 1W15A 1D6EA 4XP6L 3IVKB 1NGXB 4G9DA 4KDTA 4UAOB 5IBUG 5T3XH 2YAMA 1QLFA 4R26H 3EHBD 5BV7C 5MEPB 1AXIB 4RGMB 4V33A 1PJWA 3GHEH 4D8OA 2W9DH 1EXUB 4DFIA 1BV8A 3LEYH 4DPAX 4A66A 1EAPA 3LXAA 2ZUQB 3AXIA 2XC8A 4RFOL 5SWZB 2NUPB 3AUWB 2GPZA 3MLZL 3KLHC 2CDFB 2XY1A 1IKNA 2A4CA 2AK1L 3ZYZA 1A65A 3LOWA 5BXFB 2IQAA 3NACL 5I66B 3TTYA 1EZVX 2VH5L 1T4KA 5I6KA 3WJJA 1RJZB 4HWBL 4OJFL 1JNJA 5FFGA 1J1XL 1X5YA 3BP4A 1M1XB 4U33A 5GGVL 1N10A 1AJ7H 3BYYA 1JTOA 4PFEA 2HVBA 3W0WB 4OZIF 3ROLB 3X17A 2VITA 5LDSA 3HZYA 5HI5D 3ABGA 2GI7A 3HRZB 2XDHA 3F5WB 2FRGP 2ZUUA 3NJLA 5GS1A 2KZKA 4B5EA 4OIBA 4ZUTA 1GJIA 3KNBB 2ZKHH 4PW9A 3HB3D 2BSED 4F5CA 4KXDA 3WHE1 2E56A 2X4RB 3FU5A 3VD1A 5C0BB 3BP7B 2MNJB 3IFLH 5GRWA 5H4YA 5DTFB 3NIDE 4Y5VC 4Y2DC 2QQLL 3O4LB 4Y0GA 1U8JB 4I48A 3HS0B 3CQPA 3V4VH 4IOIA 2AI0H 2W91A 5E6UB 3VFPB 1NCBH 5BQ7B 3ERXA 4V1DB 4K71C 3RVTC 3DI2B 2ITCA 3PFUA 4ZDHB 2XZCL 4KPHH 4EXPX 2VSKB 4G3YH 5D7KD 2FDBP 3IJSB 2GKIA 4J3UA 5E2UL 5AD0A 5I75C 3VYOA 3DDGA 2JELL 1CTMA 5A3ID 4FLOA 1I53A 4GIPD 4JFWA 3PF2A 4BHUI 3O6MH 1ZLUK 5EZJA 3A4DA 4P0DA 5F9WB 1CIDA 4R90L 2XYCA 5HPOA 3SKMA 5FOJA 1XFPA 4AGNA 2VLLB 4R4BB 4Z7VE 3WEOA 2VSDA 3BXNA 3MV9D 1ZHNA 5C0NC 1OE3A 2VC2L 3FTZA 3QJUB 3K71B 1NCCL 3CH1A 4M6OL 2ZD0A 3I9PA 5FYJH 1ZT7B 2Y07L 4EF3A 5E2WH 2CK0L 5T5FA 3KXFD 1FFOB 3GTNA 1IGJA 2R9HD 3SPJA 1NJ9B 3SDYL 1NGPH 1XGUB 1INEH 3HKFA 2YN5A 4XCCH 1P5VB 4ZQKB 3GRGA 2YXMA 1WCQA 2F7IA 3OKNA 5FCSH 3JWOC 2QHRL 4LF3B 4UIMB 5C0FB 3MUHL 5E5MB 3VWJD 5IMKA 3B7TA 2BP0B 1RZ7H 1OGSA 2HUHA 1PZBA 3GF8A 5D6DA 2EIZB 3T65A 4BXVA 3ULUD 1P0SE 5HGDA 3MOAL 5EZLB 3K6SA 4AYGA 2XQ0A 3T0BA 1DFBH 5KAQF 4Y16A 2XUWA 2AZUA 3CMOL 3X2QB 5GZOC 2EP6A 3DX2A 2M1KA 1OAKH 3ZKQD 4HKXA 1IT9L 2FGZA 2IWEA 4MA7H 4FQXC 2CH8A 1JXJA 1JD7A 4JFQB 2P80D 2YGNA 5KVFH 1A7OH 4X7SL 2EXTA 3ETBJ 4ZTPL 2XWXA 4KQ4H 3P30L 2X0VA 4NO2A 1Z32X 1OO2A 3MV11 1KPRA 3VFNB 5JOPE 2WMPB 3DXAD 1KJ2B 4O4YH 5I0ZA 5HPMB 5CGMA 3UERA 5HI4C 2X0WA 2I5YH 2ZOKB 4GXUN 4KX9A 2X09A 3DUSA 1NGZB 3GHBL 1NEUA 2P3YA 4MZ2A 2MQGA 2NDFA 3IDUA 3O3BA 5I1GH 3IDYB 4XHQA 3QEUA 3MJ8A 5FW7A 4U1KB 3HUJE 4NO3A 2CLVB 4RDBA 1A4JA 2D0HA 2H5UA 2JCCA 3RUGE 1K4DA 1DE4B 2XN9E 1XH0A 1TZIA 3VB8A 3FQTA 3CU7A 1I7ZA 3IMBA 3FCGA 4MNHA 2BLFA 3IMTA 3OPZL 1U3JA 2QPFA 5EZIH 2VLRB 5DJYB 4NX0A 1PIFA 5ICYB 5F1SA 5KS9E 5LLIC 1ODAA 4C54A 3O0RL 3FU7A 3MVSA 4XCEB 1VFUA 5KAQG 1BW8A 4X0NA 1IJ9A 1EZSA 5CBEB 2K9UA 4WUKL 2WUCL 5L8JB 5GSRA 3ZGIA 3VG0H 1B0GA 1QPXA 2ZUWA 5IFHL 5TPWL 4KTDH 3MSPA 5TTRA 3W2DL 1ASOA 1KCRL 3VH8A 2VAJA 4G59C 2GTWA 3J8F7 3OR6A 5A6IA 2ZSVA 1U8CB 2AV1A 2XY2A 5E6SB 4ZOCA 5CCKH 1QI4A 2WO4A 1JTPA 4TSCH 1KTLA 4W4NA 4PW3A 3RY4A 3TT3L 1FYTA 1I8LA 4JN2B 2ITDA 3BW9B 4ANXA 3BVXA 2WBWB 2IDCA 1AO7E 4AJWA 4YIQB 3VW3L 4XPFL 5IM7A 1FH2A 1TNMA 5F97E 1E7VA 3BPOB 4LQ1A 2R39A 4IOFD 2MTAA 5HYJB 5DC2A 1XX9C 1A6WL 3BJLA 4LOFA 4LDCA 4P06A 5BVJB 4W93A 2EDRA 1Y18B 5TE7L 4KKBD 2X3AA 4DGVL 2XQYA 2F8XC 3CFJA 1OARL 1YC7A 2X4NA 4XCYA 4A2LA 4H8WC 1AAJA 1QNZL 3I9AA 3RWGA 4JFPB 1MY7A 1QNIA 1N4XL 2GTQA 1IC5H 4R7DB 4RFOH 4IRSC 3RGVB 4J2QA 3GUFA 5D7JD 4JM2C 1UD4A 3MLZH 5EV7A 2H6UA 1DANT 1QMUA 3NMEA 4GW4B 3ETBF 3PWVB 4OIFA 3SDCA 3NACH 2QLVB 3K4ZA 2VH5H 4HEMA 4ATWA 4NGHL 3QXUA 4HUXB 4CMMB 1ACYL 1JVLA 3H0TA 4HAKA 1F56A 1G7QA 4OJFH 3WNIA 1J1XH 3B7UX 4AQ8A 1CFVH 3MRGB 4XPGL 3EBGA 1IEAA 5GGVH 4QWWC 2RFXA 4XN4A 2NY1C 3GGWB 4KAQL 4WO0A 2QQKH 3AQYA 3RL1B 1HQRA 5TH2A 1FP5A 1QPKA 3FPXA 5DJCB 3CCHB 4ELMA 2MTPA 3MJ6A 3QHTC 1WC7B 3RIFF 5IIEB 4L18A 2R4SL 2ZKMX 4P4KA 2OJEB 5CUSL 2Q86B 5I8EA 4BFIB 1G5AA 2DEXX 2QQLH 1MOEA 2FLRT 4G6FB 2PYFB 5CKGA 5E0FA 2V0AA 3KD4A 4I8DA 1LK2B 4YSDA 5LNGA 4DQOL 3ME0A 2J21A 2JI3A 1HE8A 2GJJA 1IAIM 2HJKA 1HL4A 1M6OA 2C3VA 2XFGB 2XZCH 2ZWLT 3Q9QA 4OM0L 3SGDI 1IGFL 4CMHC 5ID0B 3SY0B 3FK3A 5E2UH 1JE6A 3JVGA 1YEGL 4TNFA 2EKSB 4NIYE 4DGYL 3FULA 3O9WA 1QPPA 3HZKA 4H8WL 3CBKB 3VFUB 4XNBA 1TSRA 4OZGB 2CIKB 4N5UA 2BY3A 4R90H 1TQCC 3EGXA 3L3DB 3X11A 3LNDA 4WHTB 2BVQB 4H8PA 4FNSA 5K39A 5LCVA 1E6JL 1E4XL 2CUMA 4PJGA 4YOKA 3CDGB 4MJIB 2VC2H 4G5AA 1NOLA 4PR5B 1UXMA 4R4NC 4M6OH 3DX9B 4YDIL 1VEMA 3BWUF 1IKFH 2Y07H 3MQIA 4L1SA 4X42A 4BJLA 4KKQA 4ZW3A 1FYHB 2OPCA 4IIQA 1CQKA 2GJRA 4XO5A 3RPBA 3SDYH 3IK2A 3VXQA 4GW5A 4MCMA 2VXUH 1SGKA 1CE6B 3SGDH 2OYKA 3VXSD 2R0ZL 4HIEB 3DMMA 4YXKL 2DM7A 3M46A 3NRQA 4FMFA 5DUJA 3FB6A 4EDXB 1KPVA 1AXSA 1LEKA 2VLKB 4E9TA 1A66A 1UADC 3AMLA 3QQ4B 3O2WL 1DQQA 2BNRB 5C08E 2R2BB 4ZXBA 2WYHA 3LN9A 1OTTC 4G6AC 1YG9A 1OTUC 4OBRA 3MOAH 1F8TL 2WWKT 4OZFA 3BH4A 2VXTL 2QR0A 3GYRA 1CGXA 2OSXA 1NANH 2FEEL 4LP4A 3GSXA 4WUUB 2BNUB 5E99L 3CMOH 1L9MA 3EYOB 3SKUD 3Q3GA 5IEKB 3K5SA 4YL4A 1IT9H 3NQKA 4C83B 2CXGA 2CK2A 4KRLB 5HVHC 1TUPA 1BZQK 2WOYA 1QR1B 2DQFB 2HN7A 3JWNG 2A6JB 3OLGA 2VR4A 4X7SH 1MJUH 1Z0NA 4YDVB 1FO0A 1MXGA 3OWEA 3P30H 4LPYA 4NUQA 2XVGA 5IBUB 2IDTA 4R6UA 3G5WA 3BP6B 1QI5A 1OCWL 1BJ1J 1ED3A 5E51A 3K3QA 4JKNA 2JIXD 1ZAGA 4GQZA 3GHBH 3RY5A 3G5VB 4G7VL 3GJFH 3V0FA 2NXZD 3OAZK 4GO6B 1VF5C 1EPFA 3FW6A 1JWMB 5C0AD 2F0CA 2YRPA 1CXKA 1VENA 4C4BA 4OJDH 1BXUA 4YZWA 1VA9A 2WCGA 3CIAA 2EC9U 4XOAA 2NDGA 2O5XL 3QDJD 1NLBL 3QZNA 3MOBL 1XSJA 3RTLA 1R3HA 3OPZH 3KLQA 4XP5L 4P2QE 5CNHA 2X1XR 3GMOA 5BRZB 5I26A 4EPSA 4IBZA 4WWNA 1H0DB 2YAFA 3QRBA 4NN5B 1M7DB 1FFNA 4NPYB 1GZPA 3O0RH 3BLBA 2VM3A 2HG0A 4MBRA 1MJ7H 4OGQC 4EUPA 4M00A 2BRRL 2VXQL 3MV8B 4LPUA 3CHQA 3I75A 5J3HD 3K81A 5IFHH 2WQVA 4NS0A 4XO9A 3EBAA 4Y4FB 4AQEB 3IGUA 3W2DH 3MLRL 4I9XA 1KCRH 3KS0H 3ASWA 4HAFA 3ULAB 1MCSA 3EO1B 1W72B 1CFTA 2AP2A 3HI6L 4HLZG 3WNOA 5IG7A 4NENA 4Z5RB 3EHBC 4R7NA 5I1IL 4GXUM 2APBA 2Y7QA 3RDTA 1AZVA 4Y5XC 5ISZD 4EI0A 1I8IB 3TV3H 1MFEL 1SBSL 3DV4A 4ZUUB 3CXDL 1AQ8A 4EBQL 5F0LB 3VW3H 2Q2LA 4MDRA 4XPFH 2Q9OA 3PV6A 1W8EA 2Y36L 1IFGA 4FXLA 2N3JA 4N2KA 3F6IA 2X4QB 2GFBA 1S9YB 5F8RC 5IMLB 1A6WH 1DVZA 5CMAB 4HOXA 1IC0A 4XCFL 2ZUVA 3W5NA 2NY0D 2R0KL 3MXWL 3UP1A 3ZZLA 3M1BA 3NZUA 3ETSA 1M56B 2OYPA 4P46D 2WINB 3SODB 4IDLA 4DGVH 4J6RH 4UOQA 1OARH 3TN0A 1IM3A 1K4CB 2C9QA 2DWSA 3N1PC 1QNZH 2PPFA 4OZIB 2HLAB 3ARDB 1QSEB 3DVFA 3H4HA 4LBAA 3LCYA 3K1KC 2X40A 3D12B 2GBTA 4LVEA 3VH8G 5HI5C 3BFWA 5KZCB 3DIVA 4KRPB 3HB3C 1CGSL 3FN3A 2P52A 3HZMA 4N6QA 3A22A 5HY9B 1TU2A 3LEXA 4YMPA 1L9TA 1WCBA 1XHHA 2BSRA 3QFDA 2OCJA 4R0LC 4NGHH 1RXLA 1ACYH 4Z3HA 3H2PA 4X9IA 1T83C 2CMRL 1B6DA 1QASA 5DK3A 4P8QA 5JHBA 2D2OA 2HT3D 3S5LB 5AKTA 5H35A 3DX6B 4CW1A 5FF6A 1HJBC 2V7NA 2BOBB 1NZRA 2E4TA 5E1IA 3BFOA 4LPWA 5HDQH 3JZ7A 4KAQH 3BKYL 4RNRA 1BWMA 4A6YA 1JHKH 4X6EA 1NL0L 2EINB 2EDFA 4HSQA 5E8OA 3CVHA 2XQYG 3MRLA 2VR7A 4X98B 1G9HA 2R4SH 3BGFB 4GIOA 3RIKA 3PP3K 5A3IC 1JUFB 2VDOH 3LPPA 2X89A 5JIDA 5CILL 1UFGA 5AZEL 1HXKA 5TF1L 2IANB 4MA8H 2YLKA 4XCNA 1SF3A 4DH2A 4HUNB 1TZAA 4LCWE 4MMZB 1MHCB 1UUNA 1I9JH 3HLAB 1T20B 3RNKB 2ZWKA 3IN0A 4OM0H 1IGFH 4HKZA 4U6TA 2BCKA 1F1AA 3WY4A 1R9FA 3UIZA 2XKNA 3L95B 1M2OA 4FNLH 4Q74A 5DYOB 2DQTL 1GKOA 2GUOA 5C7XL 4J3XA 3VGHA 3V7MA 4JO4L 4H8WH 1L9QA 4PJGF 2OMTB 4JO5A 1BM7A 5FV1L 4DJMA 2APTA 5MERB 2OXGB 2O5ZL 2EECA 3EYSH 3VWJC 2F5BL 1E6JH 3DTUB 1WZ1L 1UZ8A 1LDPL 1ICTA 4YDIH 3WSQH 4KRMB 4BZ1A 3LMJH 4ZMQA 4M3JA 1RAMA 3ULUC 1JHTB 2QVFB 1E4KC 1L9OA 3RWFA 4ECNA 4YDLB 2I26N 4P2RB 3S35L 1AZZC 3I6LE 2HT4D 3I85A 5DJ6A 1KYFA 4I1PA 4KVCL 2PCXA 2R0ZH 3GT6A 3MUY1 4YXKH 3K4AA 2HT2D 3DUHA 1FA4A 1EDQA 4XODA 1KYUA 1JWUB 2BVEA 4PRHA 2RQ8A 3O2WH 1U4FA 1ZPUA 4NT6A 5SWSB 1GYVA 3QS3A 1IQWH 4LLDB 4H2CA 2O61A 2A9BA 1XO8A 2FX9L 3UZEA 2BNQB 3RJOA 3NP4A 2DLEA 4CSSA 1WGVA 5DGQA 5LBSL 4JPIA 3S2CA 3IDIB 2OXHB 4HJEA 2ZKWA 3NDZE 5F71A 3HHSA 4OUUA 1X5JA 3F7QA 1Q9OA 4IOSA 4X7CC 1R0AH 3IDJA 3U0TB 2CAKA 2APXA 3BH9A 2AXJA 3CSTA 4YLQT 1PD6A 5IKCB 3AS3A 1KN2L 3QT2A 5K9JH 3NTCH 1XB8A 1OCWH 1K3IA 2F54B 1FORL 2Q7YB 1JV5B 3FYIB 4NUJA 3B2MA 4AEHL 4H26A 4LQFH 4KJPD 1GZQA 1I82A 2DRUA 2GUYA 3G04B 4G7VH 3NFNB 4WLCA 4ETYA 3Q05A 4S2SB 4N0CD 4OSUL 3SN6N 4DVRL 4L8SC 2J88L 2H32A 1XTLA 2YPKA 2BPBA 1NLBH 3MOBH 3DX0A 2JK5A 4MDJB 4OZFG 3ZTCC 5C2UB 5E6ID 3LH9A 3O3DA 1T5XA 2DLGA 3A4AA 5FC9A 2YARA 15C8L 4X80L 5ALCH 4H5SA 5J6HA 1FZJB 3A24A 2AABL 3FT0A 1F18A 1G9NL 4P57B 4QRRB 3LPWA 1OP5H 2WXRA 3CHRA 4IBTA 4KJYB 2BRRH 4XAKE 1D6EB 1CD9B 1J10A 1SM3L 4G9DB 1PNDA 3WO4C 1M2VB 1ZS2A 4BZ2A 4KDVA 3KPMA 4IOFC 4JG0L 1S4IA 4MB3A 3MLRH 2P4AB 5I76A 1Z5YD 2O72A 3TC9A 2RALA 1TJHH 1WBXA 3CN1A 3NVQA 3HI6H 2YXFA 4YDZA 5IHZA 2X7LA 5DK0B 1JCKA 3PWPE 4KKBC 1ES0A 3WFBL 4U1IA 4R83A 3Q8AA 4F9LA 4PN6A 4N2FA 3B5GA 4QYOA 1YYLL 1MFEH 1AGBB 4GRMA 1SBSH 4IHOB 5BS0A 2L8AA 4JFEA 1H5BA 3GK8L 3QFJE 1J1PL 4L3EA 4DPRA 4EBQH 2IQAB 4HD5A 1X4XA 4RAVB 3NRPA 1KJVA 5D7JC 3UGUA 4P5KA 5SWZD 1T0OA 4FKHA 1NAMH 5DSCA 3SPHA 4F58L 5IB2A 1S5HB 3MXWH 1U4EA 4JFXA 4YHIA 1R19A 3FU3A 4KGJA 2BH0A 2R29L 2A6KB 4EUPG 5BO0D 5IFAH 3D4CA 1MFUA 1VERA 5GS1B 3VXNA 4ZUTB 3OVUB 2ICWA 4KU1A 1ZTXH 3WFDL 3WFEH 1SLVA 2QVKA 3W0WD 3FTXA 1KBVA 3TLRA 4HUWB 1FZOA 2Z7YA 5AOJA 1IAKA 4E9XA 3X13A 4POUB 4HIQA 3BKJL 1C1EL 4GG6F 3T3PE 2VCOA 1YEEH 1CGSH 3QVAA 1I4FA 4OZHE 3WIHL 3VD4A 4LGPB 4I48B 1ZHBA 4JDEB 3RYMA 1ZLWH 1EH9A 1IVLA 2F7RA 3Q06A 1VEPA 4XNZB 4NCDA 2CMRH 1IM9A 5GGQL 2EICA 3LY6A 4W9ZA 4Y19B 5H2BA 1F90L 2C1OA 2ITCB 3O4LD 1JGIA 2ENSA 5T3XE 2MRYA 4NLAA 1LMKA 3V8CA 1M9WA 3QYNA 1PBYA 1OSEA 3BKYH 5DZOA 4RWYL 3PCYA 4Q8BA 4YBHA 1QO3B 3A67L 3KPTA 4ALAC 1SFDA 1NL0H 1A1NA 1R5WA 2DYRB 4Q4EA 3UTSD 5AAWA 5GGTL 4R4FH 3HA0A 4TMPA 3T09A 4CGTA 3SKMB 5MP6L 4L9LA 1NFDE 1T6BX 3M88A 2VQUA 5CBAA 1ZHNB 3PNWA 5CILH 2NXYB 3MXVH 4BCZA 3CH1B 4MQXD 4XPBL 5AOIA 5D5MA 5BZWA 4J3OH 4AEEA 4OLEA 3TBCA 4A7GA 3RHWK 1HQ4A 1T5WB 4XP1L 3ZUCA 5I1KL 3QNYA 4ZI8A 3TIDA 1G1CA 1FLRH 3Q13A 2RR3A 2IPUK 5FA3B 3S37X 4Y5YA 4XBPA 3WS6C 1XVSA 2VM9A 5C7XH 2IV8A 4JO4H 5IMKB 1KLGB 1ZKAA 4FXGC 1VCAA 3RU8H 4X6DE 6FABL 2YPVA 3AAZA 1MG2C 3TH3T 2O5ZH 3T65B 1A6VH 3QWOA 3OMZA 3ZL2A 1WZ1H 4X7TB 3FT2B 3TM6A 1CI3M 4RCAA 4PIRF