4ICWA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
DQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Centrosomal protein of 120 kDa
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icwA00
5JHBA 4XE0A 3L54A 4FHKA 1DJIA 1E90A 2WXNA 3DPDA 1E7VA 3R7RA 3NZSA 1A25A 3QAQA 4WWOA 4F91B 2UZPA 2A4ZA 2EP6A 4PS8A 1UGKA 3GPEA 3W57A 3ML8A 1UOWA 3HHMA 4MJJA 3LJ3A 3F05A 4TS6A 2ZKMX 3FDWA 2WXJA 1BCIA 4URKA 3NSJA 2WXMA 3MJWA 3PYCA 4WWNA 2LHAA 1QATA 5H4YA 3ENEA 4FULA 4QAMB 1CJYA 2CJTA 2K45A 4LDCA 5JHAA 3T8MA 3ZIMA 2K4AA 3KWTA 5CCGE 2Q0ZX 1BYNA 5CCJA 4A55A 4V11A 4FJYA 3CSTA 4NP9A 4G11A 3RPBA 2CHZA 2BWQA 5KJ7E 4NPKA 1W16A 3QR0A 2NSQA 4GB9A 2WXOA 4GNKB 1E8ZA 3L13A 3IM1A 4PS7A 3PRZA 1E7UA 2WXPA 1WFJA 4F93B 3SD5A 4LT7A 1E8WA 2QZQA 2CHDA 2WXFA 4OVVA 2WXIA 4HVBA 1TJMA 3P2BA 2A5UA 2ENQA 1DSYA 5CCHE 4DK5A 4NS0A 3S2AA 2V4LA 1DJWA 2RD0A 3APDA 2JQZA 3FBKA 2WXLA 4JPSA 1UOVA 3APFA 3APCA 4BFRA 3DBSA 4FLHA 1DJGA 2WXKA 4PS3A 1YRKA 3F00A 3QR1A 4TUUA 3TWYA 4WWPA 4ANVA 4FADA 3F01A 4HLEA 2Q3XA 2FK9A 2D8KA 3OHMB 4AJWA 4BGDA 3B7YA 1GMIA 1TJXA 5G55A 2CJSA 2CHXA 1K5WA 2ENPA 3L9BA 3JZYA 3PS6A 4L23A 4WEEA 1QASA 2WXGA 2X38A 2WXHA 4NPJA 1DQVA 3TJPA 4EZLA 4OVUA 2DMHA 3RDJA 4EZKA 4KITB 2ISDA 5EDSA 3PREA 2CM5A 4Y1TA 2NQ3A 4IQHA 3KWUA 5G2NA 4ICWA 1RLWA 2DMGA 1RH8A 2B3RA 2ENJA 4ANWA 2WXQA 4LCVA 1E8XA 2YOAA 3QJZA 2QZ5A 4QJ5B 4FA6A 4XX5A 2FJUB 4FHJA 4Y1SA 3R7QA 4F1SA 3M7FB 4L1BA 4IHBA 3ZVVA 3L4CA 3QARA 1E8YA 3L16A 3IBEA 3ML9A 3OAWA 1DJYA 4FJZA 5H4ZA 2CHWA 2KI6A 3L08A 3W56A 3F04A 3N5AA 3ZW3A 3QK0A 4EZJA 4KZ0A 1WFMA 1DJHA 2YRBA 4ANUA 4AOFA 4TV3A 3HN8A 5T8IA 1W15A 2Y3AA 3TL5A 4DNLA 1DJXA 2K8MA 4QJ4B 4ICXA 4QJ3B 2CM6A 3PFQA 1BDYA 2N1TE 4L2YA 4ANXA 1V27A 4J6IA 1RSYA 4XZ4A 3CSFA 2NCEA 2K3HA 4WAFA 1HE8A 4L1LA 4KZCA 2Z0UA 3HIZA 3NZUA 4F92B 2R83A 1DJZA 2WXRA 3L17A
chains in the Genus database with same CATH superfamily
3FB5B 3PUCA 2FL5B 3FUFA 1USQA 4PLNC 2E7BA 1IGMH 4NUMA 4GRLB 4H2AA 2DB8A 5HVHB 2FE0A 3RZWA 1EHLL 5CJ8A 4K4KA 5C3IA 3BXNA 3U82B 2EYRA 3K6NA 4JO2L 2D9QB 4GRWH 4BH7A 3A6BH 3VXTA 3GINA 1BCIA 3QCUH 4DK3A 1WD9A 3MNVA 2C8NA 4OV5A 5E94A 4Z5RB 3JWOC 5LGYA 2OMVA 4LLYB 4XTRC 3QXDB 4P3WA 1R46A 2EDNA 4KX8A 3DC0A 2R4RL 3P40A 3O45B 1M9SA 4FQCL 1AKPA 1H6EA 4CGTA 3ILEA 4XXCC 3BGAA 4WTQA 3W1ZA 5C0BB 3L13A 2G4GA 4PS7A 4EAEA 3QEGH 2GITA 2D73A 2E9IA 4OH2A 2EH7L 3T08A 3QRGH 2A9MH 4P9HL 4BRVA 3SGKC 5L7XH 3VH8G 1R3KA 4GRWB 5I71C 1QQDA 4OZIB 2AEPL 2CLRA 3BD3A 4J6RL 4XN5A 3L2LA 4G8IA 4U33A 1FL6A 5AZEL 4FA8A 1GHFH 3KDMA 3AMLA 4P5KA 5D7HA 4OZGF 2R27A 4BZ1H 3ETTA 4BZ2H 3CV5A 5BXFB 3S36L 3TPUA 1RZIB 3U1SL 5K9KA 1OK0A 1TNNA 1X44A 1E65A 5FYJL 3LEVH 7PAZA 1DVTA 2HH0H 4A1RA 5DO8A 1F0LA 3FK3A 5C0AA 3WHE1 1MG3C 3CCHA 1XGTA 2ZOTA 3QZNA 4MNQB 3NCYP 1M7IB 1BYPA 4UF7C 1NUDA 4E2OA 1HDMB 1BZ7A 2Z6FA 2PXYD 4PJXF 2VXUL 5FA4B 5IHUL 1IX2A 2MWCA 3D39D 1U8IB 5FC9A 3KLAA 5L2JB 2AAVA 1IC1A 5CZKA 2KMWA 5HJBA 4IRJA 4F58L 4G7VH 5K69A 3LEYH 4JL1A 1NPUA 2J20A 5JXEA 5DRNA 4NO2B 4NN5C 5I17A 5IHHA 2FGWL 3VU2A 3T4YB 4CVXB 1TFHA 1LDPH 4UDTB 1DJYA 1I53A 2HZHA 3DI2B 3PGCB 1WA2X 2EYSB 2BNUA 4X98B 8FABA 4HC1H 5ANHA 1CLVA 3BSHA 3MA9L 4ZOBA 3UBGA 4QNPE 3KM2A 4S1QL 5T8IA 4WV1B 4LLVB 3TNMB 2DTML 2V3DA 1A3RL 1U2CA 3CSYB 5IROC 2GJ6B 3BT2L 4ODUB 2ITCA 2W07B 1T5WA 5GRVK 5DQDL 1HN1A 5HHVH 1IEBA 2IBBA 1A6WL 4LHUA 3KPOB 4WUKH 3BZFA 4HJJH 2YK1L 1YPZB 4XC3L 4K71B 4ESKA 2XXGA 1CDIA 3NACH 1KXQA 3S3BB 1L9PA 1A6AB 1Z6JT 5HD8D 3OKNA 4WJKB 5KUKA 1I9EA 1L3WA 1SFDA 3KJ6H 5AW8B 3MX0A 2FLRT 1YNTF 5FPIA 3EHBB 4TOYL 4X42A 4GAYB 1U8NB 5DWPA 2BNRD 5DD6A 4Z9KB 2IADA 2XPYA 2Z31A 2Y7LA 3I02A 2FX9H 4QRRE 4K3DH 3HS0C 5K39A 3A3YB 3H9SB 4NRYA 4JFFA 2WWOA 3LH2H 2ZOKB 4F9LC 4JFZL 4AW4A 4PV9B 2QPUA 4GBXB 4LT7A 5T1DL 2GTZA 5I15H 5HDBB 3I50L 5E1HB 2AABL 3RYMA 5H35B 2RA1A 1U8CB 5GISH 3LAFA 3T0AA 3Q0HA 1MCDA 4ZFOL 3FRPA 3WDHA 3AG1B 4GT0A 2JI1A 3ECVA 3N91A 1T7YA 3ARDC 3WJJC 5D2NA 2QGBA 3GMPB 1SXBA 3BI9X 2NY6B 1IM3A 2IWEA 2UZYA 4UM9D 2Y1AA 5CM1A 4M6OH 3SDXF 5EBLA 1FYHB 1WAAF 3MLXH 1I3GH 1E4XI 5F7AA 4JFQA 4KDWA 1MOEA 2F53D 4CSTA 4CVWA 5C70A 1I8IB 1RZFL 4I0PD 2ZG2A 4OQTA 3IRPX 3RVTC 4PB0L 1S5HA 3WG7B 1OD9A 1FFNA 1A7PL 1VLXA 2O5XH 3BCDA 3FTWA 2YQBA 4NKMA 3NH7L 4O5LH 1JWSA 4L1DA 1AO7A 4PB9H 5CIPH 3CFBB 1FZOA 4NQDD 1EANA 3QJSB 1YECL 2EIZB 1JZGA 3P4NA 4FQQA 4KI5F 3T77A 1OO2A 1MJJB 1N70A 2AF2A 5DC2A 2C1OB 4GKLA 4G72B 3TEYA 4PSRA 5HGDA 4YXLL 3DUUB 1RZJH 3WHE0 5I19H 4LSRL 5KBKA 3L3OB 1J5OL 4PRAB 5D6CA 3AU1B 1TYJA 4ONGL 2PCXA 3MGAA 1QHOA 2GTWA 1LWHA 3I9AA 4M61A 1QHQA 1W8EA 5CIPB 1P2CA 4B7IA 1MY7A 3COOA 3DHJA 4XC1L 2BC4A 1U3JA 5I71B 3TS8A 2JJUA 2WCGA 4M1DH 1HSAA 4DFIA 5HHOE 4DIXA 5DQ9A 4JG0H 1ETZA 1PLGH 2AV7B 5EHFA 2YMOA 5A3IC 2YBRB 5J1AB 1ZHBA 4F8OA 3AACA 2FATH 4U1IB 2CJUL 1G7HA 1G7JA 1NFDE 4KTDL 1H3PH 3UTQB 2CD0A 1JDAA 3KS0J 4LRIC 2EACA 4H26A 4XNXL 2VLRB 4ETQA 3E0GA 1KIPB 3G6JE 2DN7A 2OMUB 1SJEB 3GYRA 3O3EA 5MHSE 2WJ7A 5D9SA 3T4AC 3PGDA 1XF4A 1M6OB 4MX7A 4PJ9A 4Y7OC 2Z4QB 3L1GA 5A2KH 1F56A 2F5BL 1H5BA 3LIZA 5GS0L 3AFLA 4XXDA 5I8KL 5EPMB 4NN5B 3U4BL 4MTMA 4X6BA 2XSKA 1GGYA 2JELH 1VACA 2NSMA 3WE6A 5IW6A 4Z3JA 1KC5L 2WD0A 1N5AA 3MGOB 4HF5L 4PP2A 4WO0A 2DL2A 3PU7A 1F6AA 2AANA 4P2CG 5E2VL 2OJEB 2Q8BH 3QUYB 4YSCA 1A14L 4ZSOE 4LEOA 1SJMA 5T3XH 4FG4A 2NY2D 1QSEE 3IU3B 1V8HA 4BHUA 4UUJA 2NNCA 2OCCB 3HMXA 5L88H 4X7TB 1NCUA 3D33A 5J0BA 3OAZK 2R59A 4JHZA 3T2NH 2GI0A 1FL5B 4ZMOA 5E4IA 4Y1TA 1MFAH 2NTFB 4GKSB 5JORB 2AQNA 3GMMB 3A23A 2E56A 1EAJA 1ANUA 1P1ZA 4WTWA 1IAOA 4XMZA 1VCBC 1RJYA 1INDH 5FUZL 4KDTC 4S0HA 4KPHL 3OM3B 1BA9A 1WBXB 3ZTCC 1K2DB 2ITDA 2YD4A 4XHJD 2YWYA 4W1TA 1Q1PA 1N68A 4WDIB 1PDKA 1D6EB 1MVUB 1LO0L 4LP4A 5BZDB 2FJGA 1E27B 3QEQE 3E7JA 1ZDQA 2VM9A 3GBLA 1QX1A 1TXKA 4ANUA 5H94A 5BPPA 1A7QL 4XCEB 4Y4FA 2BSRB 2PYED 2V2XB 3K8MA 4U6YB 4XBPA 4YO0A 5DD1H 4K5LA 4RZCB 1KTDA 3IDGA 1L5GB 1U8QA 4WK0B 3W9EB 2R9HD 1HE8A 3DETC 2X7LB 5E4EB 5BS0D 5AW0B 4JHUA 3DGCR 3VGGA 1XIWA 35C8H 1QO3A 1FL3A 1TU2B 4OZGB 3UIYA 2O4EA 1DJIA 4RBPH 1NAMA 3NJLA 4PUBH 1YNLH 3VH8B 4N2EA 1KSRA 4EBQH 3T9WA 3ARFD 4QXTB 2VH5L 3ARDB 4ZFGH 3FAXA 4LLAA 3WFHB 3FOMB 2E27H 1UUSA 5C07B 2H32H 4PJXB 4R6UA 4NRZB 3T8MA 1JHLL 3DDGA 3H3KA 3BIKA 4JFED 2ZG1A 3O8XB 4G9DB 4OSUL 4Y9GA 4O58L 4EIGB 1HI6A 3KE0A 4PCKA 4EI5C 3B2VL 1TQCC 2Z8VC 3PGFH 4KGJA 3PLYA 5HHMD 3A6CH 1MHCA 4LVOC 3L4WA 4WFED 5I82A 1F97A 2WBWB 4PRIB 2XG5A 1T1ZB 1JHTA 3F5WA 1PQZA 3O3AB 1I8KA 2IFGA 4R3SA 1WBZA 4PV8B 5IBTH 1JBJA 2NSXA 4F8LA 2H32B 3ILPA 2Q76B 2WN2A 3T2OA 3FCUB 4YE0A 1V54B 4LNRB 1U8OB 4J2XA 1ODAA 2A9DA 2JSFA 3C75A 4WFGE 3DRTA 3ECWA 3QIUD 1GAFH 4RMBA 3IJEA 4EEEA 4UMGA 5JMOC 5FLUA 5E08L 1VB9A 3RKDD 3UZQB 4DZBB 1A02N 2P26A 3V52H 4MNGE 4N9OB 2YD5A 4AMKL 3QFJB 1KY6A 5DZNA 1P5VA 1N64H 3N42F 2LTQC 4V2CB 4F2MA 5I0ZA 3KM1A 1DUZB 3ESPA 3PJLA 4WNSA 5ACLA 5KW9H 1YNTB 4NCC2 1GZQB 1RZPA 3RL1B 4ORGB 3T8XB 2BOBA 4Z8FH 2HT3C 4NERA 4PJGF 2CRYA 4W70A 3L4CA 2BIHA 1KEGH 2WBJD 5AW9B 5JO5A 3T0DA 1CLCA 4PRPD 4U1GC 3K2IA 2WO4A 5F3FA 3QQXA 2OQJA 1E9OA 4P99A 1NGXB 1A47A 4ZUUB 3S34L 2D7MA 3BE1L 3UZEC 4G71B 1KBGH 3MAWA 3W37A 2QTEA 3EOBA 4HKJB 4M7KH 4G5ZL 3L81A 3Q5YA 4KH9A 1NGPL 3KPSD 4EN3D 5CLWA 1R3LA 1CFVL 2ZYSA 1WP6A 2FX8H 3ZOAA 5EO1B 2VE6B 1GGTA 1ZHLA 4HWBA 5AWNH 4JK0D 1YEWA 3ROOA 5DDHA 4I77L 3HZKA 4JO4H 4LLWA 3I6KB 5F7LB 3VXSD 1MHPH 1IL1B 3DX7A 3B2PA 4NZTH 1UM5L 2PYFA 3O2DH 1W6WA 2N0KA 1RUKL 3QRLA 2ZX6A 1JWUB 4ZG1A 2CIIB 3WFCH 1JZJA 2HTKC 5C2BL 3R4DA 3JBG7 2GI7A 4PVLA 3NAAH 2OPCA 3MJ7A 3BVUA 3CDZB 4Q0XL 4Y2DB 1FSKC 1G7LB 1YJDL 3QG6B 5AYQA 2EVHA 4XNMB 1AFVH 1OAQH 2ZNXA 5DMIL 2I24N 2IPTL 3FQYA 5HHXH 3VGFA 3HS9A 4PJHF 2MNUA 2B0SL 5K9JH 5I73B 3NFPB 5ADPH 1VEOA 5DJ2A 1CK0L 1JXDA 3C6SB 4R97B 3LX9A 3U4KA 2GSGB 3RGBA 4UT6H 1GKOA 5J6HB 5E5MA 2BNRA 2YMXH 1IAIL 2WYTA 5I2IA 3LQAH 4Z0XA 3PE9A 4BFBD 1HAUA 2FNBA 3NPSC 3GZKA 1FDLL 4IEFA 1XF5A 5ALBL 2I60L 4XCNB 4GO6B 5I6OA 3NP3A 1P4BL 1FBIH 4DUVA 5HDQL 1IRAY 1L3NA 1RPQA 3S35H 3TT3H 2X9ZA 1TT6A 2WSKA 3MLWH 4HAKA 4F7TB 1SHMA 3L45A 5EULV 2ARJB 3SBQA 5MERA 4PJCF 3SBPA 2EKSB 1KNOA 2BW5A 3NJVA 3GXFA 4J4PC 1YY9D 5I16B 4JQVA 2FBJL 5CLTA 5CSBA 5E8OA 1ID2A 3VUAA 3PV6B 4MGXA 1L7TH 2P45B 1XGYH 1EMTL 4OCNC 4PG9A 3FMGH 3EADA 4DN4H 4JREC 1RIUL 4HZAA 2O5YH 1KIUB 1J87A 4WFHE 4JZOA 2Z91A 4LIQE 4F15B 4F1SA 4RMWA 1LD9A 1NEZA 3H8NA 4RWYH 5AYUH 1FC2D 1PG7X 3ZO9A 4EIZC 3FO9A 3R8QA 4WWKC 3KCPB 2XQYG 1GYCA 3SBWA 5AAWA 4FG6D 3QPXL 4ONHB 3ULUF 5SWZB 1M05B 1R3HA 3QIWC 2BVEA 2O6CA 2WGXA 4JQXC 4NQDA 3DI3B 4GUQA 4UQDA 3IRCA 3X11A 4UV7L 5I9QC 4I7ZC 2ICCA 1KTKE 4Q56A 1T22A 2OA9A 3FB6B 3ZDZE 1FG2A 1GZPA 1NCAL 3Q1SH 3IVKA 2CGRL 1G4RA 2IWKA 4MA8H 1P7HL 4H5SB 2A0LC 3VNZA 3D69B 1YQVH 4D9LH 1D5IL 1A4AA 4LVOB 1A2YB 3DTUB 3A0OA 2YD9A 4FI6A 4XRCA 2X28A 1EZVX 2NYKA 1JXKA 2QSCH 1GCFA 3I84A 3I85A 3K6FA 2H9GB 2YEZB 4IIQB 1T21A 4PYHA 4PS8A 4U1LA 4AZUA 4B3VA 3LV3B 3QDJD 1RHHB 1ZVSB 3DVNB 4M48H 1XF2B 1OQOA 3D50A 4XBGA 1QBML 4KX9A 1I3VA 4YX2L 4OIIH 5TQ2H 5TFSL 4F1ZA 1B4JL 1XCTB 5C0AE 3MXVH 4PN6A 3RWIA 4HCRH 3ARPA 3L4YA 2XKSA 4JHWL 3GUTA 3V6FB 4KQ3H 1JN6A 3UTZA 1G6RH 3GD1C 4MMYB 1DQQB 1R5VA 2UV3A 3HB3C 3JXAA 1JTOA 5C6TL 1UACL 3P77A 5HHQB 1AGCA 3KYNA 3SDDC 4Q9RH 1DQMH 5KJ4A 3G08B 3BWAA 1MCCA 3NFNB 4R4FL 3RA7H 1T20A 3GSUB 2Y23A 4JHBA 5CXPA 2GKIA 3U83A 2G75B 5J56B 3T0WA 3U7AA 4LMQI 4F7PB 5D7IA 3RWDA 5HYSA 1N7ML 2ZSVB 1QLEH 4U1GB 3IMRA 2XXFA 4OM1L 3QCVH 2VSDA 4NO0B 4WFFD 3BPNC 4NDMA 5J3HC 1JIBA 1MCSA 1KB3A 1G6RB 4TNEA 4NM4L 2JNZA 1M2VA 1QFPA 5IFHL 1Z5LA 4M3JA 1DBMH 4DP9X 4D94A 1AQ8A 3RGVC 4G8FA 3WGUB 2WSPA 3MROA 4LQ1A 1UOKA 4WIQA 1IGTB 3FUHA 4AZ8B 1WZLA 1KTLB 1OGPA 2F58L 2HKFL 1TEGA 2NQ3A 3FU8A 3OAUL 2UZXB 2VDPL 2WQXA 4HIHA 4AIXA 3FULA 2BSED 5A2AA 1SPDA 1F4WH 1QLEB 2DYSB 1YEKL 4IOIA 1TVBA 3R7QA 3SPHA 1WBYB 3GMQA 3LN5A 3MV9B 3H0TB 3TBVA 1YN7B 3Q44A 3QYCA 3NFSL 1UH4A 2D3JA 3WN5B 4IBLT 4G70B 4ENEC 5EF1A 4B9ZA 1VA9A 4P2RB 4B0MM 1N67A 1HHIB 2MQ3A 1JSYA 3LNEA 1FSKB 2GABA 4OZHF 1LEGB 3FT4B 4IOFD 3GJEB 3CVBA 4JFFE 6PAZA 3KNBA 4YK4C 4NNYA 2BDNH 3GZPA 1XT5A 2PF6A 2Y6SC 3RJQB 3RFZA 1B2WL 5B3NA 5IHWA 4N1CA 4LVHB 1DSFH 4PTUA 2DJ4A 1G9MC 1OT4A 2FX7L 4PGZA 1Q9KB 3RVTD 1MCHA 2D0FA 5D55A 5GZNC 4OM0H 4XGZB 1YMHA 5LLIC 2DBLH 3CVIH 3QAZC 4QR7A 5EORH 2A3TA 2PYEA 3AG4B 3RWFB 5D2NE 4RISL 4D7BA 3L5HA 3U0TA 3VDAA 4XR8C 4HEPG 3SO5A 3BHBA 1ZLWK 5JLZA 1Y7VA 3VB9A 4NZUL 4Y2OA 3UJIL 3L3JA 5KG9B 1XZWA 1GGBH 2UY6A 4C4KO 4UT7L 4HGKC 3GS4A 2HKHL 3N42B 4NI6A 2FEDC 3P3SA 4NP9A 4P4KA 1YEGL 4H20H 4IK7A 3HPLA 1CTOA 4OZIA 1CU4H 1U8JA 3IGAB 2ZP9A 1ROCA 5AW6B 4PJGB 3KPNB 2R1YA 2BPBA 1NKRA 1AO7E 2MQ0A 4OLWH 2DQJL 2VM4A 2VRAA 1ECYA 2H4EA 4TPRL 3GNMH 4M56A 5DHYB 4KRLB 1O0VA 3FCTB 4LLDA 1R0AH 1HHKA 4YH6A 3BPOC 1KLFB 2I9LB 2P80A 5IV2B 4NUQA 2YRLA 2WTRA 4GS7C 1RU9H 2N3JA 3JVGC 4WEMB 4AYGA 1S9KC 3O4OC 1IARB 3RTQA 1ZHKA 2DQMA 2OZNA 3L3HA 5I6NA 3UP6A 5T5NG 1A1OB 3GGWA 1MREH 5L4IA 5GGVY 1U3HD 2ENPA 1MFEH 4P57A 5LO7A 4L23A 1FVEA 5TK2A 3T0XA 5IVNA 1OCZB 1XGUA 3VXPB 2DLHA 5ID0A 5BJTB 5IW1B 4IBYA 3PHSA 5BO1L 4CL7A 3D0VB 2DMHA 5FYKD 3K71A 5AENA 4OLXH 1XCQA 1MAKA 4OQTL 3HBGA 4RGNE 1QUPA 5T5NF 5HVFB 1HQRB 3CFKB 4TNVF 4ZOCA 2VMCA 3PGCA 2X4SB 1IC0A 4LSPH 1T89A 1H6UA 1IAIM 4X98A 5HGHA 1EJ6A 5E7BA 4A38A 5KZCB 3D2UA 4HHWA 2W80C 4B7LA 4WV1A 4EXPX 4LLVA 3TNMA 4PGJA 3SPIA 2F19L 4PJHB 1MHHA 2VW6A 2XN9B 3SB3A 4AIEA 2XWJA 2ICWB 5HYJD 4UIKL 1AHWC 4B53A 3GSQB 1SDDB 1TNMA 4ODUA 3LD8B 1I8MA 2EIMB 3EUDA 3QXVA 4HHAB 3TN0C 5F2FA 3VXOB 5IF0B 4LKCA 1Q9OA 4L8CA 1RJZA 1TZ8A 4MCZA 3II2A 4RIRA 1ACYH 1HU8A 4OD3H 3I6GA 2B59B 1UVQB 3ZHLA 1ND0A 1WITA 5J6GB 3HHSB 1HOEA 2K3HA 4WAFA 3ZU8A 5LCVA 4ZFFA 1RERA 3SYPA 3ZE1E 2VN7A 5FB8B 1GJWA 4XB8A 3KPPB 3LRSB 4I4WA 5LWYH 2XJLA 4G6MH 1T1YB 2W0PA 3UO1L 3HI5L 2QPSA 3MBED 4L5FH 3KPSA 3LS5L 1WS8A 2X1QA 4N20A 3ULUH 2OS7A 2ZKMX 4RMTA 3SKNB 2F1BA 2DQUH 3VXSA 3ZHKA 1O6SA 4FYRA 3T6QC 4ZX5A 2CBTA 4ELMF 1JVKA 3BH8B 3BP7B 4OJFH 4AYEC 5I5IA 5LXGH 2BSTA 4B9CA 3PP3H 4H7VA 4N90D 5I1KL 3BOVA 1AGEA 1IM9B 1S9WB 4ZPVB 4HIPA 2RMNA 3CN1A 1S7TB 4MMXA 5C08D 3HE6D 3WNIA 2CO7A 4FNSA 3WY3A 5ANMB 5TDPA 4EIUA 1FYTB 2XY1A 3HRPA 4I1PA 2VXVL 4LHJB 5TDOB 3BP6A 3QZMA 3WIFB 4NO5B 4XVJL 4WLCA 4NS0A 2JVUA 3HN5A 4FNQA 3RAJH 2WQWA 1NIBA 3IXTB 4TULL 2JIXA 2X6UA 3PDOA 1SN5A 1F3JB 1DR9A 1WO2A 2BJML 1U95A 2XWEA 3INOA 4APQD 2BFGA 4F2FA 3QH3A 2D7PA 4LXFA 1F13A 5D7IF 4FI7A 4ODXB 3X2QB 2E0PA 3GK8L 2BRRL 3IWVA 4ZPTB 5IOPB 2R1WA 1FI8C 1QASA 3MNDA 3PUUA 3O6KL 2BY0A 3RB7A 3VCLB 4XCFL 1YYLL 4QD2E 2HJLA 2AK4B 4FFZL 4WI0B 1Z0MA 3FTGA 4OTXH 5F89B 2Q9OA 1I1RA 5G2NA 4QLRA 3GKWH 4XP5H 3TGXA 5AAMA 4N2NA 2WXQA 1BAWA 3WTTA 4R2GB 3T3PB 1VEPA 3D08A 1K4DB 3D6GA 1F8TL 2A77H 3F7VB 3FYEB 1BEXA 3I6LD 4H8WC 4W9CC 5I18L 2EEBA 5DS8B 4A2FA 1RULH 5B3JF 5F0MB 4NBXB 3GI9L 3ZMRA 4XXCA 5AKSA 2Y36L 4FTVD 4N2OA 5MEPA 1UM4L 5CIPA 4KNQA 2RH0A 4S11A 1OPOA 3ABLB 2OZ4A 5ESAA 4ABQA 1QKZL 3SGKA 4KHTL 1Y0LA 3SKMA 4BIKA 1HWGB 5E95B 3B7RL 4KHXH 3ZR6A 4W9DC 3SDAD 4RGOH 1OCRB 2AXFB 4Y8DC 3TH3T 2H26B 1G1YA 4PI0A 4DO5A 3U7WL 1S4IA 4AYFA 3NJIA 4YWGH 4QOKD 1VRSA 4KXBA 3FB7B 5B8CC 4Y5YB 4BRJA 1JWMA 3BVNA 4KO7A 4XNQA 1K4CA 4OLZL 1RZ8B 1EGJL 2VXQH 3UH8A 4QRAA 3RPIB 3ISRA 3LSOB 1UWYA 3Q1EA 4L8SB 4P2OC 3NK4A 2FO4B 1UM6H 1PJWA 1NIEA 3NZ8B 1A8JH 3DK0A 4AVJA 1ADWA 1VADA 3RWEA 4KX7A 2GT9B 1U8HA 1MAJA 1N19A 3B9AA 4B27A 1CGUA 2FRGP 4HJ0C 4JPVH 3MLUL 5HBBA 4F2ME 3Q2VA 4F93B 1AY1L 4LARH 2Y7OA 4HGMA 5EN3A 1WGOA 5EU7E 2ICWJ 3CZJA 5ABAA 4JHAL 4LCIH 4R84A 1UA6H 2IFFL 2VYRE 1CQKA 1QR1A 2A6DA 2ADJA 3CQQA 4J2QA 3BRDA 4BQ6A 1BQLH 3U4EA 4OZHB 5BNXD 3QNYB 1QA9B 1MELA 3D39B 5FFOA 1NL0H 2R1XB 1LO3H 3F58L 1FORH 1RUPH 5IJVA 5IROA 3BDXA 3WOVA 3GI8H 5E03A 2A9AA 3H9HB 3J2PA 1ZTXH 4XODA 5F7BA 3V0AC 3TBBA 1WH0A 3TN0B 2P7TA 1PS3A 2CDGA 2L4OA 4X5PA 3WV0A 2XFGB 4JB9L 3TBCA 2B4CC 4PWKA 2FQGA 5E2UH 3BZ4B 5F9WC 4JM2F 2X3BA 5E4OA 1YY8A 2XBTA 3HC4L 1Q1JH 2ENJA 3ZL4H 2I69A 1MVUA 2N56A 3O4LD 5EBWB 5KVGH 1PAZA 4ODTH 3QJZA 2H5UA 4JL2A 5HYEA 3MOAH 2C4FT 3QSKB 4ODSL 3DXAE 5LDSA 2WZAA 2G0LA 5JDJA 3AXLB 4L29A 3HS0A 1IFRA 3QXAA 1YEJL 2TRYA 4H88L 2A2QT 5GGQH 2VXTH 3W56A 2QR0B 3LQMA 4KZEL 3LVTA 3CLFL 4W9HC 3VW3H 3BH9A 4QHLA 2J8HA 3UC2A 1UWEL 5FKPA 4P5MA 2X9WA 1JPGA 2C4XA 3DGGB 5C0RH 1UEYA 1KENH 2XWTB 1ZS2A 2K8MA 3JWDH 1FCGA 1F4XL 1RURH 1I1AC 4O2EB 4AL8C 4YSQA 3QO1B 1BJ1J 1ZWIA 4R7VA 4O02A 5DJ0A 2XN1A 4RQQA 1L4IA 1WG3A 4L4VD 4ZRGA 3SE3C 5ICZA 3N55A 4J3OD 2BNRE 2CNYA 4Z3FA 4G6JL 3CFJA 3PXLA 4MYPA 3IXAA 3DNKA 3UTSD 3ELQA 4WWID 4BKLB 5C97A 2WLIB 3VACA 4PMFA 3BLBA 3BZEB 4I3GA 3HI6L 2X4QA 4HSCX 4HHGA 5B39G 4OFIA 1JGUH 2WQUA 2APWA 2ZCLL 3JTBA 2ADFL 4QAMB 1TTFA 1GIGL 3LS4H 1U3YA 1YYML 5FW7A 1OOAA 3RHWK 1O7DE 5DFVC 3QIWD 2I07B 3IKKA 3QA3A 3NPZB 2JKJA 3TIEB 4NYLB 2HFEB 4FQJH 1XSJA 1ZHNB 4HAFA 4WU5A 3WFEH 4KRPD 5EOQL 3M17B 1NMCC 3V8OA 3WL9A 4UM9B 4N1HB 1X5FA 1EHAA 5IBUG 4MBOA 3ARGC 3D3VA 3NABH 4QUOA 3FUIA 5FW8A 4AQ8C 5F72S 1IGYB 3QYNA 1KXHA 4LEXL 2YRZA 4I0PB 2IH3B 2VN3A 2ZOLA 2CA3A 2F54A 4GMSH 2X2IA 5C3LD 1XEDA 3VXMD 3UJJH 5EZLA 4X5WB 4OF0A 1I75A 3BSZL 3DJRA 3C6LD 1BFVH 1L6ZA 2Q3XA 4FXKA 4QHKJ 1G5GA 5TDNB 1JZ8A 4JDVB 3CVHH 1MDTA 1U6AH 1CS6A 4QXUH 2VMFA 4WW1B 2XJKA 2WXHA 2A83B 2QKIC 3TA4D 4XBMA 3IRZA 4I1NB 4P0DA 2WAQA 4DPBX 2A6IA 5CBAB 4JJHA 3TXAA 4ENZA 2NY4C 4DKEL 4M3KB 4F8QA 4Q2ZA 4RRPM 2NUTB 4D0DB 3SE6A 3RVWD 3I9PA 1U3HA 3FPYA 4PQXA 1KB5A 4PV1C 5FF6B 4L8DB 3V5HA 1G5AA 4I2XE 32C2A 3GSNA 4ELMB 5HYQB 4ADIA 1AZCA 4I8DA 4LEEA 6FABH 2X6VA 1WWAX 5E2WH 5KOMC 2G5BA 4BGLA 1WEJL 3AADB 3CVHB 4X50A 2AHIA 3O6ML 4UAOB 3E6HB 1CXEA 1AQMA 1UD4A 3MRHA 4P2OB 3QNXB 3T4AA 4HQQH 4EDWH 2VE6A 3H42L 2YLKA 1SVZA 3EJCA 3IJYA 4DGVH 1N9PA 4FQ2H 2P47B 4QRQA 2K0RA 1XF3B 2MPAH 3RIFF 2X2YA 1RY7B 2JLPA 2YZ8A 2EVFA 5DLML 2ZG3A 5FWRA 2B4CH 4Y16D 4N5UA 5DA4A 2NLJA 5D1ZC 5IT2H 4HJEA 3ROLB 2WLLB 1OWRM 1NOFA 2DV6A 3B3IB 3EFFA 1BBJB 1N0XL 3KVQA 1AYOA 3MA7A 2YPVH 5LGJB 1FNFA 3CDZA 5MP6L 1MFCL 4PLJC 4S1DC 4YBQD 2BVPB 4HFUL 4LSTL 5DYOB 5EU3A 3X3GH 2A9NL 3ULVE 4YDKH 4GP8B 3QBTB 2D4DA 2KZWA 4DPRA 3NA9H 1XWVA 1ZIAA 3CAFA 4P46D 3VFUA 3OX8A 2NY7L 2WQ8A 5IR1A 4ENED 2YJQA 1N4XL 1DLFH 5KYWB 1MRFH 3NSFA 3NCYS 4WI6A 3BCFA 1J0IA 1LO2H 1OB0A 2AV1B 2F74B 3D7PA 3OF6D 4KDTA 4OGXL 4JUSA 1OT2A 2J6EA 5JHLH 1LO4L 5FO8B 1SEBA 1JYNA 3C8KB 3LKNA 2QSVA 4S2SA 1H8LA 4Z0BH 4FXTA 4PY7B 3EIFA 1ORSA 1CL7I 2OSLA 3N44B 1FV1A 1T0OA 1TQVA 1DLHB 2ENQA 1TCMA 3F6JA 5DMGC 3JV6A 3LNHA 1S78D 2CUMA 5GZND 2VL5B 4LQFL 7PCYA 5KS9F 4OFYA 1QRND 3FUJA 4OCXH 1II4E 2OYKA 3ZYZA 4PW3A 3BQVA 4W9JC 5E1AA 3TWYA 1WD8A 3ULVL 2JJTC 4YZFF 5EBMB 4R7NA 2Q3AA 3L4XA 4XOEA 4P05A 2B3IA 3EFDH 1OF2A 4JRYD 5I8CA 2YKLH 3N0PB 4KMQA 2JB5L 5GHWL 1JJUA 4V33A 1FJ1A 2VKXA 5C0FB 2PN5A 4F7KA 3QQNA 3EO1A 1IC7H 3NN8A 2GCYB 3O3DA 1OP9A 3E9UA 2UY7B 1SJXA 3KCPA 2PYEE 4XWGH 1U36A 2E9BA 2M83A 4PGCA 3L7FA 3WIHA 4BCXA 2VABA 5I28A 4Z7UF 3AMKA 3EOYG 3HZYA 5G4OA 3MRNA 2ARJQ 1XEUA 5DO2C 4PRHD 5DZOA 2UXGA 2CO1A 1FZKA 3FU9A 3RNQB 1QRKA 2D2OA 1J8HD 1TQBC 3GHEL 4PJ7A 4CN6A 4R8WH 4UOW0 2JMRA 2OXGA 1AGFB 4G9FA 4EI5A 1KT2A 4WF7A 1I7ZA 4XZUA 5C0CA 1FRGH 4XMTA 2R2CA 4O2FA 5FECA 1YEDA 4HOZA 4QJ4B 4OZIE 1URZA 3SKOB 3ZPDA 1OLLA 1A6UH 2VW4A 5B4MC 2H3XC 1IVLA 3DSFH 3S96A 5AG9A 1ZA6A 4FTVA 5GGTH 2QVKA 3G5ZA 4XNZC 3HPJA 3SYAA 1AZUA 4JFEB 2Z7YA 1FFPB 2VCOA 2IMMA 2Q1EA 1CGXA 4B9PA 3HCVB 3WY4A 5DWUH 3GXPA 4F24A 3BISA 5JPNC 3G5VB 2LQRA 2X87A 4P23C 5HHMB 3SDAA 4U3SA 1LEIB 4PJ8C 4D8PB 3VFNA 1JMZA 2OI9B 4MJID 4JM2B 4QOKA 2HYMA 3UTPD 2YAMA 5FGCE 1IGML 1YC8A 1UA7A 2KERA 5FAAA 5ERWA 4FJYA 2QKIB 2KLTA 4URTB 1PTZA 3QUZD 1DVSA 3R4RA 1GGIH 3FNKA 3N9GH 1M7DB 4M4RA 1KMGA 1BW8A 3QCUL 5TD4A 3OLGA 3WEOA 3KEHA 3BAEH 2VZTA 5TPWH 3QIUB 1S9XB 1VCAA 1ZVHA 5IMOA 6TAAA 1HKFA 1IQDA 4HK3N 4M1CC 2AXWA 4JDTH 4JCWA 4L3EA 4OT1H 5DU7A 5DVPA 2VSCA 5C0GA 3UZEA 3PNRB 5M94B 3F7YA 1CD8A 1S7WB 4WHTB 5F3BB 4G7RB 1BD2A 4A6YA 1Y6KR 2K70A 3HLAA 3OGCA 4TUOB 4AQ1C 2CLZB 3Q2NA 4GSQA 4V1DB 3QR1A 3FTUA 3QEGL 3P11H 4YSAA 3I75A 3GSRB 1PSKH 1YDPA 4AM0B 4BGDA 3QRGL 2A9ML 4NZRH 3W3BA 1MJ7L 3EGSB 1HEZB 2WBJB 1H8OA 4UT9H 5E8NB 3NIGF 1T4KA 4NP4H 4Z23A 4E9XA 4NN7B 3MJ8A 4OD2B 3OKOB 1GHFL 5IEKA 1M53A 1LGVA 4JFTA 2V9UA 4BZ1L 2JQMA 3TBTB 1UWGL 4KFZC 3KLQA 3DYPA 5ID1B 1KEMH 3LEVL 1A9EA 2HH0L 2Y3NA 4BSVA 5DJ8B 4DP1X 1JPSH 2QZ5A 1OWWA 2OR8A 1A4JA 4EN3B 3RI5F 2CCLA 1KYFA 1LEGA 3IBEA 1M7XA 4PJBB 4G3YH 1KELH 5FYKU 3VXSE 5F7MC 2EUVA 5B39B 1IC5H 3MYZA 5CLXA 2YFNA 2RAMA 5HVWA 2AK1H 1NANH 2F2HA 4N68A 2H3NA 4N2DA 2QV4A 3LNIA 4P4RB 3D0LB 4WVRA 5MI0C 3HI1B 4UQAA 5KYXB 3FFDA 3HR5B 3LEYL 1AMYA 4XAKD 3RY5A 3MCLL 3SCMD 5CS7A 4DN3L 5D7LD 2XVLA 1E43A 2EDBA 2M1KA 3PFQA 4L2YA 2DLIA 1EDYA 4MA3B 4NC1C 3MBXH 1X9QA 1BV8A 4ZUWB 4LLQB 1LDPL 2YBGA 5I75C 2P8PB 1LVEA 4NWUH 3ARZA 4CMMB 3AWEA 2R83A 2ADIA 3KEDA 1BM3H 5AB0A 3NEEA 5LCVL 1SF3A 5FDWB 3M45A 2DQ6A 1IGJB 4HC1L 1C5DB 2KZ1B 4MXQD 5T1MB 1LEKB 1NCTA 4WU7A 3GMOB 2BVQB 4AMXA 4O51B 2DDQH 2KBGA 4MNHB 4FD0A 4J4PA 3TFKC 5BW7A 4X8GA 4M4PA 2YUWA 2W9DH 1THAA 4PHXA 4F3FB 2OJ1A 4HETA 1OGAB 3IGAA 1WK0A 2A6JB 3UTSA 4WUKL 4JAMB 3EW3B 2IOMA 4DKFH 2DWEA 3C60B 1EZLA 3FH7A 3THMH 1SUHA 4G8AC 3ME0A 2D3LA 4CNIB 5GXBB 2IXQA 1AKJA 4KVCL 3KJ6L 5BQ7B 2EKJA 1KLFA 4JJ5B 4OUUA 2DIAA 4KK5D 3HBPA 1CYXA 1M1SA 4WWKA 4HCFA 3V0VA 4CDHA 4IRZA 1QOKA 2NDGA 4N8UA 4HVBA 2W81C 3QIWA 4H8QA 3E3QC 4JQXA 4QRUB 4Z1PA 1VF5C 1X7QB 3INUH 2FX9L 1IZJA 4K3DL 5D7JD 4JRXD 5AOJA 1DQTA 1D2OA 3RDTC 4KMLB 4B9KC 1U8LA 4PS3A 1YCSA 3LH2L 2VMDA 5JW5B 5CEZD 3LRLA 5EZOH 4HS3A 1XTMA 5I15L 1UD6A 5ETUB 1IFHH 3HRZB 5DURD 1IT9H 5DRWB 3NQKA 4NPJA 3B8YA 3KH4A 2KQMA 2GVYA 3QJQB 4EKXA 2J1KA 5DVKA 4FQHA 1XL4A 3C6LA 4XNZB 1EAOA 3VXQA 2DM7A 5DQJA 2W1NA 4ZYKA 5B1JC 1PAMA 3S5YA 3VFOA 4U0QB 4M6OL 2IBGA 4XCYB 2W65A 2H1PH 3MLXL 2LAAA 1I3GL 3PAUA 2HRHA 3O2VH 1EXUA 3ZKMC 3VXOA 1MWAA 4P23B 4POYA 1HHGB 1MCBA 2ED8A 4LKXB 4PJ8B 4KRMB 4IDJH 3QHFL 4EZMA 4GI9A 2O5XL 4YHYC 4HJSA 2H3KA 3EOAA 1PZDA 5DD0H 3SDDA 2DWXA 4O5LL 2YXWA 4PB9L 3GF8A 4EQ3A 5C0IB 3QDJB 1LMKA 5GGRY 3TT1H 1O6TA 2GUYA 2XWBA 3GBMH 5AL0A 4HFWB 2BS71 3VFWA 3VRLF 2IANA 3A4DA 4OB5H 3S5ZA 2XOTA 1COBA 3D25B 2K9FB 4KRNA 2EH8H 2UZIH 5KS9B 2NX5A 4NO3B 4FHKA 3X14B 4KKZA 4LP5A 5I19L 3EYQD 2ROYA 3L5JA 4AYBA 5IUCA 1HHHA 1P53A 1HH9B 1QBBA 3RGVA 3CN4A 1NWOA 1OSYA 1SM3H 4TNGA 3CZFB 1V7MH 4K9EH 2UVFA 3OMZA 3T6XA 2IQAB 1J0YA 2CJTA 4YGAB 1OIOA 2CNZA 4Z77B 5JUEH 3UTTD 2OMYA 5IBLD 3MJ9A 4M1DL 2PO6C 3UJTH 3UBHA 4Y9EA 1JZ6A 4JG0L 1B4RA 1A5FH 4Z7UB 2TAAA 4KKCC 1PLGL 5GIRB 1IEAB 2DIBA 2X4TB 4NZFA 4A7UA 5CHNB 1I1AD 3CHRA 2FATL 2X0UA 1KXVC 4JS7A 4J39A 5B22A 5EC2A 5IFJA 4BA0A 4GLRH 1H3GA 2N7BA 1KV3A 3WLWD 4MAYD 3P4OB 3NJXA 4ZPTA 4WO4C 1OE2A 4U1NA 1DN2A 1DN0A 2R2EA 3BYTA 3FT2A 3Q5OA 3T65B 1AQHA 3B6SA 1QR4A 1NGZB 2AK4A 4UTCA 3U1PA 5CP3A 3TA3C 4JGNA 5MI0B 4WI0A 2YSTA 3SHSA 1FCCA 2HFFA 4L4JA 3BP5A 1OKEA 5BUGA 4I18B 4YHOH 5GZNA 4AJYV 3R0NA 1P4LB 1HOCB 4NI3A 5DFVD 1QRNA 2HLAA 1W72A 2Q2EB 4X0KB 4AT6B 3TEZA 5KN5A 3V5KA 2Q8BL 2VOTA 4D2NA 5EDXA 4L1TA 1M1XA 4WCYH 5T3XL 2X4PB 1DL7L 1J9CT 4MLSA 4XX5A 4JKWA 3AG3B 5IQ9B 2EE3A 3L3IB 4GQPH 3H1ZA 2L8AA 1RAMA 1SXZA 4YC2C 2JF1A 2HA1A 3O9WC 1DVQA 3QIBD 2FT6A 1CYWA 1P7QB 4NQCD 2AJ3B 1T04B 1NLDH 2V9TA 4QPEA 4BV1A 3GLDA 3KPMA 3VYOA 4FLOA 4LFHG 4PP1D 3WAJA 4DAGH 3VB8A 4EF3A 2EE6A 1INDL 2DIEA 4HU8A 5C09D 3BIAX 3T8VA 4U6HB 4PRDB 1CFTB 1J8HA 4OZFH 1OCWH 1D7CA 3ZYOA 3IGUA 2E7MA 2C1PA 3D3VE 4NGHH 5C0NC 5KBLA 2HG0A 3EDFA 1KGCE 2O5NA 1SRDA 3KPRB 3N1QC 3JVGA 3BN9C 3ZLQC 4DKAA 1RZQA 3DPDA 5EOTB 2F54E 3UG3A 1CXFA 4N0UA 1WV7T 1B4LA 4BCYA 3V4PA 3RIAF 3AWGA 4Y1AB 4J3OG 4ZDHA 5DD1L 4XVUD 1KBPA 2QQNH 5FV2A 3DOHA 4PGDB 3BO8B 1MVFA 1JNJA 35C8L 1VKXB 1BXVA 4M1GL 1U93A 4ZX6A 1DEEA 3TBYB 3BKYH 5I26A 4OZFB 1AZZC 5K59E 4A7GF 1AZVA 4PUBL 3RFRA 1HVXA 4J3OF 1YNLL 3RZCD 4L9DA 1P0SE 4CRPA 5EB9A 1AP2B 3UPRB 1MRCL 1J9SA 4EBQL 5IKCA 1RVFH 5HPMA 2ADYA 5HGBA 2FYYB 3QR0A 1X5IA 1DBBH 4NKOA 3OMAB 4MKTA 4ZFGL 1E6OH 1W0WA 3JQOB 3T0VA 4MJ4A 2YN3A 4UAHA 3RNKA 4LDEB 3PIQA 1LP9B 2OMZB 3BPCB 5MEQA 1XR9A 1AHWA 5FYKE 3H9HA 3BVWA 3TN0A 1ITCA 4WW2C 3ZT6A 1HT6A 2V33A 1QUNA 3I2CH 4HX1A 1XD1A 4WKZA 3ZE2B 2V5TA 1T66C 3FHAA 3A6CL 1KBVA 1QPPA 3EJZC 1G94A 3D52A 2IDCA 3DA0A 4IJTA 2CO3A 2YKKA 1OF0A 3CDYA 3P30H 2JXMB 5CN1A 5IBTL 1WAAE 5EDSA 4BBWA 1CGWA 4MJ6B 12E8H 5HYJB 3FQNA 4PREA 3CLEL 3AXLA 4IW4C 2VISA 1SDAB 3G9VA 4KMTH 3NJJA 2EZ0C 1YUKB 3MRLB 3BP4A 5TE6H 1GAFL 3ZDYB 1G7MB 4E9VA 3PJNA 3DGGA 3TO4C 5B21A 4QLWA 1UENA 3V52L 4Z3IA 5DK0A 3WKYA 2H2SC 1GR7A 5L6YH 2V6HA 1JV5B 1N64L 1R5IA 3S97C 1UADC 4P07A 3MBEB 1HSBB 4GG6F 5KW9L 2QFRA 3WLBA 5F1NB 2CQVA 3G5XB 4Q74A 3RWJB 4Z8FL 1WA0X 3HKFA 1H3VA 5GRYA 3U0WH 1KEGL 1TZHA 4KTEH 3MNWA 1MAML 4DQOL 3Q2CA 3UPCA 5AD0A 2GAZA 2VRKA 3P73A 1DJZA 3VE0B 3FU7B 4BD4A 1KBGL 3SQBA 4XN7A 2PCFB 2IAMD 5TQ0H 5JIPA 1SDYA 1AQDA 4NHUA 5KSBF 4WO4B 4IDLA 4M7KL 3MV7D 4KK6C 5C08B 4X4XB 5A2IH 4X0NA 3HE6B 4JLRB 4OZ4A 3E38A 4KXZH 2FX8L 2BP5M 2L0DA 3HN3A 5AWNL 4TSAH 2G0KA 4BQBA 1VFUA 1FUNA 3OGOE 1J1OH 1UB6B 4WNQA 4KWUA 2WKOF 1MHPL 4XMLL 2BHYA 4W68A 1YC7A 4P2AA 4CGUB 4Z3GA 1WGVA 5I66B 2FWLB 2YD6A 3O2DL 4CN1A 4M7LH 4APQB 2KDYA 1MZZA 4CMHC 5I1EH 3E2HC 3M07A 5KVEE 3CNKA 1KXTB 3WFCL 1ML0A 2G3NA 5EWIH 1AS6A 3E6FB 4ZMPA 2EDXA 4U6VH 1R17A 1TO5A 1THCA 4BHUI 4L37B 2BNQD 2BWDA 3MXWH 3T0ED 5TDNA 1OAQL 1WIPA 2HRPH 4GJTB 3KPQB 1D9KD 5HHXL 5KYUA 3J7HA 1QFUH 2O6PA 5K9JL 4PJ7E 4WW1A 5KEZA 4ZOEA 5ADPL 1Q8MA 1Q9LA 4ZUTB 4CJ1A 4YNYA 3U9UB 4G9FE 4CKQA 4N9GA 4FADA 3I6LE 2M2DA 2ZF8A 4UT6L 5C0CE 4ZQTA 1U4FA 4HBCH 5L0QC 5J6SA 2CJSA 4WI8A 5E6RB 1K5WA 4JW3A 1TTUA 1UKTA 4JM4H 3LPWA 5AALA 3ABMB 3OC8A 3EZ8A 3NT0A 3BD5A 4JMNA 4FTVE 3EDEA 5B8CA 4FERA 4JCLA 5FOBA 1B2YA 1AHKA 2FJHB 3S35L 3TT3L 1OALA 1YUHA 4TLTA 3VGAC 1JNLH 3C8HA 1EEYB 1U4EA 5FYLD 5G5DB 1CI5A 3LB6D 5C8JA 5HJDA 3AB0C 3KXFA 1MG2C 2NR6C 3EBHA 5CWSB 1X9LA 1NGWB 2DQIL 1K9TA 4RAVA 2CR3A 3DROA 3EO9H 4IMLA 4A2DA 3FMGL 2CKNA 3IDMB 4QAWA 5E99H 3ZXAC 4DN4L 5IMLB 2VJ0A 1H9DA 1XGRB 2JKNA 5HHNA 3AITA 2O5YL 5J11C 2R69H 2UXFA 2ENSA 5F7DA 3QDGD 2HVKB 1DFXA 2VLME 4ZXBC 3WNNA 4Q9CA 4RWYL 5K1NA 5BOZG 2JKRM 5CJQH 1PX3A 5C9JA 5AYUL 4XZ4A 2AXGA 2DQDL 3W81A 1NDGA 3DO3A 2B1HH 3JYBA 4Z3EA 2VLJA 1B88A 1K8DB 1X4ZA 2H0JA 4L3EE 4WKXA 4IJ3C 1ETB1 3VQMA 3W0WA 4ADGA 1HYSD 3WKNA 3FPXA 1CLOH 4X6DA 3C5JA 5ECJE 4HXBH 1KCUL 1BD2E 3DX1A 4WW2B 3FUEA 3E8UH 1D7BA 3Q1SL 3EFOA 4MA8L 2GY5A 3KGSA 3CFIC 1WIOA 1NCNA 1ZANL 1WICA 1V7NH 2CKBA 4D9LL 2OTUB 2V0AA 3TC9A 3ZYJA 1EFXD 3QQ9C 4P3DA 1EEZA 3ZN6A 2ZYHA 1N8ZA 3L6FB 5E9DB 3B1UA 3QWRA 2BCKA 5FOJA 1PKQB 4M48L 3KLKA 5T33H 1WFJA 3D18A 3NG5A 4OIIL 4FMFA 5TQ2L 2J6WA 4YHML 5EU4A 4E5XA 1N3NA 2SODB 3PQYA 3OVUB 5DRZB 3MXVL 4HCRL 2IF7A 1Z66A 2CO6B 4NKDB 3H7BA 3CZEA 1ZS8B 3S2AA 1CDBA 3KVPA 3TO4B 4YHPB 1NBVH 2G2RB 4I3SH 2YPKB 4ZS7H 4Y5XC 2COQA 1D5BB 1I1AA 3QZBA 1P5UC 1JRHL 1HXMA 1KCLA 2Q7AA 3O4LB 2H8PB 4Q9RL 1DQML 4J3OH 4XPAH 5AB2A 3J27A 4TF4A 3FT3A 3RA7L 4TVPD 2IBZX 1ZV5A 4QHMA 2BP0A 4JFHD 3V0GA 4D0CA 5IMMA 4AGPA 1WHPA 1OAKH 1Z3GH 4K8RD 3D85B 1UZ8A 5FCUL 3QCVL 1SYSB 3LXCA 4HMEA 3KWUA 1OTSC 4I3RL 1H3WM 2W0FA 4LCVA 1I7TA 4LVNC 4OUOA 1CFSB 4MLIA 4C54A 1DBML 1LL1A 4KU1A 1CTMA 4LSQH 4KXAA 4TQ8A 2YAPA 2J2ZB 3X1NA 3GUFA 3TCLB 5TF1H 2L7EA 4WSKA 4GKZA 5CP7A 4BQ9A 4NEHB 2WUBH 2GK2A 3LZNA 3OZLA 1LHZA 4MA7H 3BGMA 3UTSE 4KKAD 5DT1H 2K78A 3C09C 3WKPA 1NCIA 4OCLC 4NQTA 2XXMB 4HS6B 4PD4K 3ARGA 3FW6A 1ZV2A 3PP4H 2LU7A 1F4WL 1XSIA 4QRSB 5EO0A 4MRCA 1H0DA 5IB1B 4AQ8A 1J8SA 3HAEG 3F6IA 2FZ3B 3ILQC 1BOGB 2YWZA 4KVNL 3QIBA 5JIKA 3BZ5A 3G5VA 4FRWA 1QHPA 3L95B 3F00A 4GSUA 2FB4H 3HG5A 4G8EB 2D0HA 4AITA 3QFDB 1QAWA 1RPKA 2ARWA 4CADA 3L9YA 1NBZA 1QABA 3OQ3B 4KRPB 4R0LA 3KYKH 4Q6IC 1E3FA 2BDNL 1AR1C 2CDEB 3SJVB 2QKIA 3BEVB 2NXZC 1HXYA 4RBPK 4NKIL 3IDUA 3TO2A 5D1QD 1DSFL 4WUUB 3L3KA 5I76B 2D31A 4OM0L 3WY2A 1A6VL 2XIIA 3CFTA 1MQKH 2DBLL 5EORL 5INCA 1RUMH 1RZ7H 1DBJH 2G3XA 3VXMB 3B37A 3VNYA 1I4FB 1DDHA 1FGNH 3IM1A 1CIDA 3CFQA 1S7QA 5BO0D 5ENWA 1SJHB 1CPUA 4PJFF 5I1AB 4G1EB 4QRTA 43C9B 5IGXH 3GSRA 3CPLB 3G04A 1BVZA 1TCRB 4YDIH 1E6JH 1FFTB 1AZRA 4QHUA 4H20L 1JYVA 2FNWA 4GG6B 1OEZW 2DD8H 1RIVH 3BMWA 2DZEA 3X12B 1CU4L 5JR1H 1A6ZB 1JTPA 3EYFB 4OFKA 4ZMLA 5AKRA 3WKMH 1UT9A 2ZXCA 4N0YL 2PPDA 1OTUC 4JFXA 2DKMA 5D1ZA 2WIIA 2X0VA 3GNML 1BXXA 3VI4F 4ZUVA 3TBSB 2IANE 5T3ZD 2VITB 1R0AL 3V5DA 3IE4A 4UMSA 5BZXA 5CGMA 2NRDA 5KSBB 4S1SH 1UWXK 4KJQD 1QVOA 1RU9L 2NX5E 2PO6D 5F8RC 3Q8BA 4PJBA 2ZXGA 4JQIA 3AG2B 5GRXG 2AEQH 1CDJA 2J43A 3LNDA 3HNTH 5DJZA 2GUOB 4IJ3B 2PW2A 2OLDA 4QHNA 2E6PA 4AM0Q 1MREL 4CKVX 2XQBH 3MRDB 4P4RA 1MFEL 1RP9A 4JPWH 5EN2A 2WLMA 1GA2A 1I9JH 1URLA 3L5IA 4BZYA 4Y16B 5CSZA 5I1LA 4Y4HD 4OLXL 1BPVA 5CNHA 2FEEI 5JA9A 4F33A 2XFXB 4IKKA 2EILB 2V3EA 3CGTA 2DF3A 1HINH 1JZIA 3IDXH 4LSPL 3D06A 5KYYB 1LDSA 2EABA 4NPYA 5T1MA 2AJZA 2CM6A 1L9RA 1MCKA 2P5ED 5DI8B 1ZGLP 4P46B 2NZ9C 4MNHA 1GS8A 3SN6N 5DD3H 2VQ4A 3CSBA 3PDDA 3R06A 3N40P 4YSSA 2ZWYA 5F7FA 2JJTA 4EI0A 4YL9A 4L8BA 2A4EA 3TNNB 4QF1B 2GTQA 1E9QB 4KDVA 5ESQB 1JZDC 5CEYA 3RWCB 1ACYL 4OD3L 3TYGH 2OK0H 2AK4E 3B2UC 2FR4A 4NUJA 3JWNC 2LLGA 3LKOA 3VXUD 3CH8A 5BQ7A 3K8KA 4HKZB 2IAMA 1BZDA 2WWNA 3IU4L 1RXLA 3T3PE 2Q3ZA 3ZTJG 5LWYL 4G6ML 2PTTA 4NFBA 4G6KH 4L5FL 2R39A 5D6DA 2WTPA 3ULUL 1YEHL 3MZTA 4AX3A 4QRPA 2X4RA 1KFGA 1ZA3B 1J88A 1RZGB 2DQUL 3CHPA 3OKEB 4GP5B 4LBEB 1DQLH 5CZXC 2AW2A 5JHDD 3NQIA 4C56D 4TLSA 4OJFL 1YEFH 3BN9D 5LXGL 4M9PA 4M7JL 1CXIA 3BAYA 1E5CA 3DTXB 3FB8A 1CZ8H 4OY9A 1UCBH 1MCEA 2QADD 4R5VA 5HJ3B 3C09B 4FKHA 1F1AA 3VFGH 3WY1A 4MJ5B 4HDIB 4OJDH 2BNQA 3FQXB 1I7RA 1HEHC 4LO9A 4PRHB 4XPBL 1J8HE 3PS6A 1A4KB 5JW4R 1G9ML 4P5TD 1D9KA 5E8PA 4NJ9L 5LBSH 1NGYA 2I32A 1X9RA 3I9IA 3ISWA 4XCCH 3RAJL 4OGAC 1I7UB 3K2KA 4KKNA 5JPNA 1QWNA 2WLYA 3RE0A 4IQHA 1BLNA 2X6BA 4MXVF 4ANWA 2B5IB 4LKXA 2ESVA 4N0UE 4KO5A 2XTJC 2CBOA 2EDKA 1G7IA 5DA0B 3B8SA 3LEXA 4Q6IB 2VR6A 3HEIB 1MFDH 4AV0A 2NXZB 3P0GB 3MRQA 4LLMA 2DW5A 1Q0YL 2HG5B 3FO2B 3FUMA 1BGXH 2FH8A 4HXAH 4KKBD 2HUEA 4OTXL 4U4BA 3GKWL 4XP5L 2YAOA 5DJDA 3SGEI 2Y7QA 3MRGB 3VFRB 5ISZA 4F57H 1GXEA 1RULL 1FLRH 3TCXA 4LLUA 1YG9A 3O41A 1GOGA 4ABVA 1F6FB 2J25A 3MACH 3DVIA 2TRHA 4MJIB 5C6PB 4O9HH 4Z7IA 4X4MA 4AQ1A 3KVDD 3TP4A 2ZONA 4NQUA 4X7FC 4XN8A 3VFVA 3M7OA 4OF8A 5GS1C 4RFEB 3ETSA 3QUZB 3QUXD 4H1LA 3U30B 4AKOA 3TESA 1MCNA 1ZLUH 2BVUA 4KHXL 3DK2A 4IM8A 2VUKA 1L7IL 1SXAA 4RGOL 2A73A 2XTSA 1P6WA 1SOKA 5IVXA 2I26N 3DRQB 1BMZA 3ENEA 2ZKHL 5D7SH 1YNKH 2AQPA 2TSAA 1PGRB 3HG1A 4YWGL 4LCYB 2MFNA 4C83A 1CF8H 2F5AL 4HH8A 2WINB 4L0PB 4EUPA 4G11A 1O5DT 3K0WA 2IOIA 3EJQA 4UILH 3VWKB 4OQ1A 3VFMB 2IG2L 3IPBA 3RQ3A 4GY4A 2IGFH 3JVFC 3HAEH 1OP3K 2VZ1A 2ED6A 1HFUA 1XGQA 4NWTH 2AFNA 3ARBC 2VMJA 1AH1A 1DHKA 1JGDB 1UM6L 1PCXA 2COVD 4IRSB 2WZPA 3CZSA 2ZXEB 1P4LA 3VJ6A 5EUKA 4JPVL 3QDMA 4HKXA 5IB3A 3BUYA 2FWUA 1EVUA 4LARL 4TYUA 4NQEB 2C3WA 3PWPD 4M5YH 5LJYH 3DO4A 3QI9C 1UA6L 5H37A 4W4NA 3HAEB 1BQLL 1F18A 2CRZA 3BQUD 1TQTA 2WO3B 5A6MA 4ZQKA 3M8OH 1LO3L 1UFUA 1RUPL 2R2BB 2IMNA 3FQUB 5DRXA 3GI8L 1Y07A 4LSUH 1MF2H 5CZVH 3CK0H 4CSSA 3SCMB 2DQHH 3W9DA 4XPFL 4AWJC 2QHLA 3C9NB 3AREC 2OAAA 3LOWA 1WC7B 3NRFA 4PGEA 4HPOH 5E6ID 5TH2B 5E2UL 1R34A 3WCYA 5KSAC 4KZDH 3Q48A 4I87A 1Q1JL 3PNWA 3MV8B 2YS4A 5AVWB 1SEQH 5KVGL 4ODTL 3MOAL 4PJFB 4PJIB 3D48R 5EOTA 1R4XA 5AVYB 3P54A 5HGAB 5SX4I 2W60B 4MMZB 3GDBA 4GSXA 2HLFC 1L0QA 1QLRA 4HWZB 3OKLB 2OYLA 3RDTA 1UB5B 5GGQL 2AKRA 1CT8A 3GO1L 3VW3L 4MD4B 5D93B 5CEZH 4JG1H 3LKRB 1ICTA 2ZF9A 2AQQA 2F15A 3EO0A 3FFCA 4L2LA 4ZAKC 3FF8A 5C0RL 1KENL 5AYTA 4IGBD 1NKOA 1NOAA 4OZFA 4UIMA 3JWDL 4ELDA 1RURL 4UDUB 5DC9B 2L3BA 1T1XA 3FS9A 2HT4D 4OLYH 3W82A 1T1WB 3VI4B 3O6FC 1DSWA 2YD8A 3GMNA 3QULB 4FNPA 4N26A 4UU9B 4N87A 4QRRD 1MLBA 1GC1C 2JK5A 4WTXA 5D7JB 3UYPB 3NJHA 3L3DB 4JRXB 5B1JA 2A6KB 1D7FA 3ZTEA 3U46B 1PZ5A 1TLMA 4S1RH 4LBAA 3GJFH 1INQB 5D5MA 2VZ3A 5FK9B 3CFEA 3I74A 1IBDA 1F4YH 5JW3H 2CAKA 4K5NA 4NT6B 5D1QA 5KYWA 3OZ9H 3GSOA 1JGUL 5IREA 1JCVA 1SF5A 3SEPA 2GK0B 5DURB 4BE5A 3LS4L 4P9MH 2OBGA 4G6AC 3KXFE 3OKDB 4KC3B 4A7TA 2WW8A 3WNJA 4CVUA 3MRCB 4K3JH 4FQJL 2JKLA 3QUKB 1WFNA 2ZP8A 4HSQA 3WFEL 5EUOF 1CF1A 1I85A 3OB0H 3C08H 2YAQA 2OP4H 3NABL 5I8EB 4G8GB 4YHIA 1ZT1B 2H0FA 3GJFB 4ES9A 4YGVB 2P5WA 1CE6B 5CKGA 4M8QA 3T1FB 4GMSL 4MZIA 2LW3A 2G60H 3DOIA 1XR8B 3X13B 5EEZA 1EWHA 5AVQB 2WQVA 5GSRA 3ZTJH 3UJJL 2GEQA 4NQVA 1G7PB 2VLJE 4ICWA 3W0WE 1CFNB 3QWNA 4FLQA 2AGJL 3E80A 4X6DE 4E9QA 4FYSA 4ODWB 3W39B 3RX5A 2UUDK 5DGQA 1SLVA 4A2EA 5GS1B 2BW4A 1U6AL 2K7QA 2EXSA 4EDXA 4CA4A 3ZT7A 5IQ7L 2GHZA 3SPGA 2ID5A 3ML9A 5F1NA 4K0OA 2P46B 2JWYA 3ASOB 2A7BA 4MD0A 1WDAA 2PO6A 3QORC 2NY1C 4RMUA 5F7EH 1I1YB 1IBGH 5BRZB 3LKSB 4HMCA 2I7SA 3F12A 2F8IA 5HYIA 1H8SA 1D5ZB 2NXYC 3QDAA 4RDBA 4M93C 2QPDB 1KXVA 4HIIA 1X5KA 2V7NB 3V4VA 5EZPA 1YMMB 1UKQA 5GS0D 1BZ9A 2C7UA 4Y4HA 2VJXA 1HQ4A 2EQDA 4WO4A 3VI3F 5E2WL 5EG6C 4KZCA 4U1MA 4PWGA 3JT2A 4PLKC 3R0MA 3PQYE 5AUMB 1T0MB 2P24B 4H13C 4W9EC 1AQKH 1ES0A 1NAKH 2XN2A 3DOSB 3Q9PA 5CILH 4HQQL 5DJXA 3UTTB 5HHOD 1NCOA 5DZAA 1AXIB 2QGDA 3QHTC 3SSGA 5IQLA 3TA3A 3QO0B 4AUUA 3HE7C 3G6AB 1IIIA 2MNJB 2OMTA 1B90A 2CMRH 5ABDE 5CBEB 4DGVL 3ML8A 4FQ2L 1TJHH 3K46A 1JFHA 2ITFA 2ZUXA 4HZLB 2C26A 4DTGH 2B4CL 2F7RA 1SYVB 2KUTA 4CSPA 5I1IH 4HUWB 4PRNA 2X3CA 5IT2L 2CKBL 3QI9B 3ZIMA 4MAYB 4IS6B 1LO5B 5MHSD 2O26U 4XN9A 2BZDA 1F42A 3EBGA 3KYOA 4MS8D 4YVUA 2BWQA 2RCSH 2QV2A 3QEHB 3AAZA 1OB1A 2NSQA 4YFEA 1AD9A 5EEWA 1IEHA 1XXFC 2NYYC 3BW9B 1SLXA 1FIGH 4A7QA 3DBXB 3NA9L 1OARH 2DKSA 3VSUA 1BIIB 2H0PA 4YS4A 1BZOA 3O9WA 1A3LH 4RETB 4XX1E 3S5LA 5K9QI 1IO4C 1DE4A 1O7SA 3HZVA 3KYMA 3U9UA 5ITFA 1DLFL 2WVTA 1RZKC 1MRFL 5JNYB 5DHVH 3CN0A 1UH3A 5BCAA 1Z9PA 4RAUB 5SX5H 2X09A 1LO2L 2VZVA 1SXSA 5E2JA 5DUBA 4ONFH 4MQXC 2P9RA 2V37A 2D3VA 3N41F 2ZAGA 1QSED 4IYKA 5JHLL 4TQHA 3AC0A 4JRFA 4RLDA 1Q90A 2CPCA 4U1JB 1ESOA 5JHDA 4GUCA 4Z0BL 2XC8A 2YA1A 2GB2A 3MCYA 4MZ2A 1TSRA 3ULAB 5BV7C 3B5TA 2EDDA 3P0YL 2JCCA 2J5LC 1TZIA 4NQCB 2X41A 1LE9B 5F7UA 4OCXL 5DHVB 5CUSL 1YEEH 5A40E 4EVNA 5ALCH 4FYQA 4AUJA 3D2TA 2DKUA 5GJSH 5CKAA 1OP4A 5C09B 2OMWB 4WSGA 4YE4L 5EEYA 2OCFD 4X9BA 4P5TA 1NM9A 2MNWA 3EFDL 3K1KC 4U6XA 4ZAKB 4P5SA 3REVB 3IDNA 1J0KA 2YKLL 1XGRA 1E5BA 1UASA 5DVMA 4LL9A 3IMWA 3TU6A 2AZAA 1NJ9B 1S7UB 3OAWA 3QEQD 1JZ2A 5CU9A 2X1OA 1IGCH 2J1XA 1S8DB 3O6FB 4DW2H 4JBSA 3B9KD 1IC7L 2IWGA 3VXNB 1CXHA 2HJFB 5IQNA 1AG6A 4MB5A 4HG4J 4IBUA 4ZO9A 4XWGL 5DEFA 3MLSH 4YXHH 4XB3A 3RL2A 3L5XH 1TTGA 1KYOK 2VZOA 5DS2A 43CAA 2WUCL 4POUB 1W0VB 3BVXA 1EEQA 2OX5B 4JZJC 4DOHE 5EEXA 2FTAA 4R4ND 2Z0UA 1XCWA 4V1DE 1SN2A 3STLA 3EH4B 4QTHB 3RZCB 2R69A 3QAQA 2N1KA 1FRGL 3MNZA 5T1LD 5F88A 4DGIH 1PG7H 2HTLC 3ABZA 3GSVA 2DPKA 5EFIA 1A6UL 1DZ0A 3GIZH 5E9DA 5KVFE 3B7TA 3ZE0F 3ZHFA 3N1GC 1TF4A 3CVDA 5JPMC 1G1OA 1JNNH 1VZHA 2HVJA 2X1WL 3KBPA 5GGTL 3BN3B 3UIZA 4Z7VA 3KLHD 4TLKA 4OKDA 5KBPA 2D03H 2OTWB 1S7RB 3QZWA 5SWQA 2ZWKA 4JNXA 1A1MB 1AIFA 4V11A 1CLYL 4X5LA 2ATKB 2PLTA 1H3UA 2DWDB 1W16A 1K6QL 1FVDA 2XUWA 4PJBE 3UTOA 3TO4A 2OV0A 5DMJB 2V2WB 3V0FA 1RL1A 1DVFC 1WTGT 5L2KB 4R96B 1OTTC 3KHOA 3MREA 3TOPA 1U8MA 1CG9A 3WEAA 1KLGB 4X80H 2R8SH 3CC5A 1ECZA 3W11D 3RUGB 4JPQA 2EUXA 4HH9B 4N2IA 3FSAA 1KIRA 3BSGA 1HWHB 1UXWA 1CIUA 5AVZB 3I9GH 4WJ5A 3VRIA 2NY1B 2Q10A 1NUFA 1B3IA 1VPOH 3N9GL 4HIEB 1ZGLB 5SV3A 1MSPA 4S0SD 3OHMB 1ZXQA 3H54A 1N8OE 2NXYB 3QUMA 3BAEL 5TPWL 4HIJB 5KVFL 1FE8H 2NYZA 1HZLA 1ZCRA 5ICXB 3A24A 3L9RA 4OT1L 4G42A 4JDTL 4LESA 4RCAA 3TYFA 3V95A 2VAAB 5J1TC 3SKUD 2ICEB 4XMPH 4LCUA 3FC8A 2NZIA 1AE6H 5BVJB 2LGNA 3IJHB 1WT5C 3P11L 1FNEB 1OGAE 4NRXB 1PSKL 3PWPA 2X4UA 4XI5D 2V8LA 4JQIL 4OGZA 4MCYA 3VGBA 1MDAA 4NZRL 4HPHA 4XVSH 2WZ5A 4Y19D 3C5ZC 3OKMB 4J8RA 4UT9L 1JI1A 3L48A 4NP4L 5DJAB 2YAFA 25C8H 1E4KC 4Y8AA 5CN2A 3SDCD 5LVEA 2XN0A 5IZ7A 3K81A 5FKAB 1OAUH 3ZDXE 1KEML 1DO6A 1HL9A 5IMKA 1U91B 3Q9QA 4EI6B 5EZJA 4LCCB 4YHNB 1JPSL 3MV7B 3PF2A 1LQBC 2F7IA 1T0NB 2PUQT 4Z7WA 4FFVD 2FD6L 3QC6X 5FUCC 2H7WA 5HI4D 5IIEA 3S4SG 4QRPE 1CICC 4G3YL 1KELL 3SYQA 3DURB 2EXTA 1BVLB 3NIDE 3PL6C 4UB0L 3SQOH 1IC5L 1NIAA 3FN0H 5EUOB 4Z7OF 2AK1L 2B14A 1OSZB 1HH6A 2V2TA 3D0AA 4N3TA 1S7VB 5HI3D 3RWGB 5GGUB 4HUUA 3NCCB 4B41A 3KCWA 3QS2A 3EJUA 2JI2A 2VO8A 2XTJD 4FI8A 3LXUX 1MH5A 4L3CB 5E6SB 3MBXL 3APNA 2AVFA 1BM3L 2UYLA 4XP1L 1N59B 5IB4B 3T0EB 1ZT7A 3DV4B 3EYVB 1PFCA 3L7EB 2FQEA 3SPCA 3GLEA 4K2UH 5FYLH 2LVEA 3D9AH 3ARWA 2J5LB 5C6WH 1VZIA 1OAJA 1P7KA 1TCRA 1UZ6E 2DDQL 5DK2B 2PABA 4HWEL 4HWUA 1GS7A 2W9DL 2XPGA 4K94H 2NR6A 3NSXA 5F6IC 4A68A 4F5CA 4PG2C 2ESVE 1VGKA 3WS3B 4NJAH 4HUVB 1T2QH 3CH1A 1C08B 5ESVA 4JGUA 3KG5A 1R3IH 4GUPA 4RMSA 3QQDA 4DKFL 1DSYA 3THML 4H8VA 5EIIG 4Y9BA 4N8VG 3FRUB 5T5FH 3VFSA 3LN4B 3WHXA 1DJGA 4ZXBA 2FLMA 3TBSA 2Z0BA 3SE4C 1NC4A 2VL4A 3VMOA 4Z78B 3VI3B 2VSKB 1A6TB 4K23H 4FLSA 5ISZE 2PCYA 4FN0A 3A4EA 2ALWA 1T83C 1AIZA 2YC1B 3K6OA 3AT9A 4FQXC 3IETA 4OKVB 5A2BA 2ZUVA 2GIMA 4X4ME 2X70A 3AQDA 4JANA 3DSNA 4FJ6A 4WFHD 5LGHH 2MHAA 3MFFB 3QDGB 1NQBA 2BMKB 4RNRA 2CK0H 2Y07H 5CD3B 3EG9B 1IFHL 3WTVA 3CJJA 2L7UA 4KY2A 4RMQA 5JPMB 1C12B 2BSSA 4PJDF 4QXVA 5IVXE 5IESH 3MYJB 3OHXC 4PJAF 2B9AA 2J3SA 1F2XK 4B5EA 3HG1E 4BFIB 1E5AA 2VIRA 4AH2A 4LCWB 4AEFA 5JZ7C 4GFTB 3L4UA 3FUNA 2O93L 4W9IC 3JTSB 1B0GB 1OP5K 3DMMC 4GEJA 2H1PL 5LN4A 2MEJB 1DUYA 4C8XA 1M56B 2CGZA 2A38A 3TNNA 4C4UA 3L1FA 2NCEA 2D7TH 1RUAH 3CMGA 2LU5A 3MRPA 4IDJL 1YLBB 4JFDD 4Y5XA 1EFXB 5CGYC 1P5UA 3N41B 5DD0L 1A0QH 3AW5A 4Q14A 1A1NA 1IGFH 4TVPH 3Q3GA 1CWVA 3TONA 3OR6B 1MCOL 1E42A 3TT1L 5E8DH 2X4NA 3GEWB 4NC1E 3LJ3A 3QDME 3VRJB 3PWVB 1TZGH 1I3RB 3GMLB 1CGTA 4K8RH 4DZ8B 5IK3A 4OB5L 3MLVL 4NENA 5C0AD 3ALWA 4FGMA 3AGVA 2DYPD 1XGPA 2EH8L 3HUJF 2K45A 4P59H 2Q5BA 4HBQA 1WYJA 4XH2B 5IB5B 4OGQC 3ULSB 2FSEA 3REWA 3RPBA 1OANA 2JTDA 3MLRH 3B9VA 3FQTA 4TTDC 2AJSH 3CFDB 4XXWC 2DJSA 1JRHI 2R29H 1CGSH 2N01B 4IRJD 4JFVA 2KC0A 4W6XB 1MW1A 3UL4A 1BX2B 1SM3L 3VGHA 1RI8A 1V7ML 3JUZA 4RH4A 1ADQA 3RU8L 3EOTH 4JFHE 2X4OB 3VWJD 3C5SA 2MQGA 3GRWH 5FO9B 3CN2A 4HDIA 3C5ZB 5JUEL 3MLTB 5EU5B 3UBXA 2H45A 1S7SB 3UJTL 1A5FL 1ACZA 2F7PA 4QY8B 3TZVC 3IDJB 1WWWX 3CHOA 2KPWA 3ARTA 4ZFZB 3F01A 2MKLC 4K7FB 4C4KT 3KPRE 4LE8A 1GH7A 4HK0B 3E3QE 1JPEA 2QHRH 2VDMH 1K5NA 2OYPA 4LHUD 5DYFA 4UNUA 4Y1AE 2KS0A 3DX6A 1FZMA 2R0LH 5CEXB 3ORJA 3STBA 3TIDB 3KZ8A 4Q6IA 2HRGA 1E9PA 3ABKB 3DUSB 3PL6B 1TVHA 1JG9A 3FFCE 3FTSA 4DPAX 4AIZA 1C5CH 1JF1B 1DQIA 5GGVH 4RMRA 1SHWA 1UZGA 4H25B 5A6IA 4YHOL 1JNHB 3HKZA 3WEXB 1PIGA 4MSWB 3IFOA 4OF5A 3KJ4B 2EO7A 2VN4A 4PWFA 2VC2H 3V6OC 3NJNA 5FA3A 3H2WA 5AZ2H 4P3CH 2VDMB 4WCYL 3HA0A 4JFFD 3AY4C 3DX9B 1BECA 1LP9E 1UWFA 3FO1B 5ICUA 4UQ3A 4PS4H 1CR9H 5D5ME 1FA4A 1BEYL 3PWUA 1KJ3H 2QDVA 3IJSB 4PTTB 3IF1B 4XPTH 3PWNA 4XWOD 3B9KA 2B08A 4UV4H 1BMGA 2UXTA 3ZE2E 3AS2A 2ZSWB 1NLDL 4NFDA 3UACA 4L4TA 4HUKB 3OXRA 4QNPF 2WN3A 1IM3D 1CC3A 2Z35A 1BQHA 4ZOAA 1CO1A 4HMDA 1OCWL 4GRLC 1BP3B 2ODHA 5T3ZH 3W5NA 4NGHL 3UDWC 3PHQA 3KR3H 1X5ZA 4W4OC 3RVXC 1FAIH 3QORD 4CVZB 2P5WE 3N50A 4NQXB 1GJUA 4A55A 4FQXB 4E42B 1Q9WA 2VLKA 2ZXBA 4MXWH 4Y5VB 3F7KA 1MI5B 3ZDYE 1TQUA 4GB9A 4APXB 1AO7D 3QNZB 2QQNL 1FF5A 3BESR 4X5XA 1A66A 2HSIA 2YEVB 2VDNH 3BVTA 4OF7A 1KPUB 4AXWA 1ET7A 1JDDA 2C9XA 1EAQA 4H0GA 4HEMA 5C0JB 3D4CA 2OL3H 2P8LA 2Q6WA 4UNTA 4Y4KC 3QWOB 1DBBL 2YOCA 4I0CC 1U8KB 4ODHH 2DY2A 5ADOH 3GC3A 1E6OL 2BOCB 1PZSA 4POZC 4V2BA 1EAPA 2QVFB 5G4MA 2CO2A 5EA0L 1J8KA 5ILTH 1YEIH 5AKTA 3LNGA 2UWEA 4K3EH 4Z7OB 3CSPA 2AJXH 4LPCA 4R5TA 3VXRB 4RGND 2VDNB 5B7EA 1PY9A 3S4SB 5J8OA 4TSCH 3IGLA 4U0RB 1QNZH 4I5BB 1FO0A 2R56H 1P6FA 1X6LA 2WCSA 3OWEA 1JUFA 5JOFA 1QLFA 2OL3B 1JGEB 1MFMA 3U79A 2DQCH 1SY6H 4KO9A 4MVBC 2P5EB 1EJFA 1BSIA 3GSXB 2G3ZA 3OAZH 5F3HB 2K3TA 1SGKA 1HNYA 4IU2B 4BUQA 2DQTH 3LZOA 4I0KA 1V5JA 12E8L 3ELAT 3TTYA 3DGDA 2X0WA 2VAJA 5C0DA 2DQFA 2Y2TA 2CDFB 3PAYA 4JO8A 3EKCA 4J23A 4KMTL 3ZZQA 3V6ZA 4Y19A 3NCEB 2Y5EA 1J05B 1N0LA 5DR5H 4N3UA 3BDBA 4YN3A 5HI5C 5TE6L 4PJ9D 4FABH 1Z7JA 3C87A 4J8QA 5E8EA 5A2JH 2RR3A 5LXVA 4J7RA 2MTPA 4FNRA 3VXUB 1R5WB 4PI2A 2F7OA 4YAQB 1LK2B 4QMEA 2ITEA 1QEWB 4BH8B 3B9EA 4LSSH 5L6YL 1TEYA 2HN7A 3U6RB 2K4WA 3H56A 4FXGC 4BK5C 1FVCA 5EIIB 4N8VB 2PWHA 5IHZA 1J1XH 3L3DA 4K71C 1L6PA 5C7ZA 3ZGHA 1EX0A 4U1HB 4RESB 3TZVB 3U0WL 1HZKA 5EU6D 2YGNA 4KTEL 5KBMA 1XVSA 1EDHA 4A66A 1EHLH 5JHDE 4G1MB 3UOAB 4C56B 4CBPA 4FQLH 1CJYA 3EF7A 1PJ9A 1IKFL 3MRKA 2JCCE 3TH4T 3HG2A 3EHBC 1UJ3C 2IPKA 2ZWSA 3QEUA 1X9UA 5D1XD 1TVDA 3OJDB 1V3KA 1G0DA 2R4RH 3QUKA 4ZODA 3US0A 4PJDB 3VSQA 1MHEB 4PJAB 3RP1A 1NFDF 2YPLD 2EVGA 1GL4B 3DJTA 5K5YA 2EH7H 4R4BA 2B39A 3G6JF 2V5MA 4TN9A 1UQSA 3BKCH 5TTRA 4M7LL 4FLHA 3ZKND 2YXFA 1MLCA 5I1EL 1U92A 4KK8D 1ZK5A 4EOWH 2AEPH 4N0FB 4Y4FD 5DJCB 5EWIL 4E41A 4HW6A 4JE4B 3WUWA 1HJBC 1DVXA 1IKNA 5EOCH 5HXMA 5HHPB 4O2CB 3VX0A 1IZKA 1Z9NA 3MRIB 3MXWL 4P2QB 5EC1A 1XIWD 2YUVA 3W39A 2HRPL 3PPEA 3OQRA 5J9PB 3FQWA 1QFUL 5SWSB 4HIXH 5IG7A 5GRUH 1C5BH 4FOMA 2EDJA 3EBIA 1J1PH 4XN4A 4MD5B 3ZSSA 5IJDC 3MQIA 3LKSA 1A7NL 3BKMH 3O11B 4YDLC 2B8OT 1A4CA 3HUJB 2PTVA 2C3VB 4JM4L 4K7PX 3FTZA 5E9DE 5KWYC 1KCWA 2DLEA 3BFOA 2X10A 4X6FB 2KKQA 4BFGA 3UG4A 4QT5B 3VD9A 5GGSB 4Z7VE 4JDEB 3OB8A 4X6EA 1TQWA 4AQEA 4NSKA 5FYJE 3MRBA 1JNLL 1PEWA 1D5XA 2FJFB 2Y5TB 3QUXB 2F68X 4OI8A 1D5MA 3ARBA 5A7EA 1RKRA 2RQEA 3CE1A 4XO8A 1B3JA 2QQKH 4X99B 3LRKA 2EEXA 5FS5A 1PF3A 1XHHA 4I48B 4J6IA 4LF3A 2GC4C 3GEFA 4NZJA 5B38A 3L3OC 4KY1H 2DOCA 4ZO7A 3MTXA 3ZZLA 4PR5A 4GRMB 4XP4H 5FHBL 2CIKA 3VD3A 5I1DB 1BF5A 4UQ2A 3Q6FB 5I23A 4UBDC 5F70A 5DQDH 2R69L 5GS2D 3ZZ1A 1KCSH 2XG4B 1E2VA 4F7CA 4FEMA 3GB7B 3HC0B 2CH8A 5AOLA 3VFTB 4U1KB 4Y4KB 4JY6B 1D5RA 5CJQL 4BSWA 4JFDA 1XH3B 3ARRA 1F2QA 3KS0H 3O3BA 4FCAA 2B1HL 4XBEL 1R3JB 1RZJC 1UA3A 4GW5A 2LOEA 2R0WH 4KO6A 4YR6B 1CLOL 1S9YA 4HXBL 5D2LA 1F90H 4DP4X 2AJVH 4TOYH 1WCBA 4DKDC 6CGTA 2KPNA 1KGJA 3E8UL 3GMRA 3AREA 3JSSA 2DH3A 4GG8B 4NNXB 3PWPE 2DYPA 5AW5B 1BFOA 5TGBB 3WS6C 5KSAA 1S7XA 2XZQH 1EHXA 1AGDB 3AVEA 4RA3A 4YDVB 4PHZA 2BZ7A 1AMXA 3MUGA 3IS1X 1ASOA 2PW1A 3DPBA 2FJSA 1AS7A 2PNDA 3HS8A 4LU5H 5T33L 5FGRA 3B43A 3BEWA 2V7HB 3QPQD 4E0RA 4PGBA 3QJFA 1UATA 3VWJA 1ZLDA 3A6OA 5J89A 4K15A 4Z7WE 1AD0A 3QUYC 3QUML 3LKQB 4KI1A 3JZYA 3OXSB 2VR5A 2H6PB 4HP5A 3L5WB 4FFYH 3LPOA 4ZAKA 1CQYA 2ZICA 1NBVL 3T3MB 4ZS7L 1BBDH 2FSDA 2IALA 1AGBA 2P49B 3OR7A 4R7DB 3DXAD 2W95A 2BZCA 3O6FA 4XPAL 4WUUE 3WXVH 2XLLA 4KROD 4E36A 1JK8B 1A7PH 5IVZB 3B5HA 1XBDA 4FXGB 4QCIA 2ZKYA 3IFNH 4GMTH 4ZFOB 1Q72L 1U8PA 4HU2A 1XZ0B 1EERB 2XNAA 4PWIA 3RVUD 1ZT4A 1J48A 3EYOB 5AOKA 1E28A 3IDIB 2H2PC 3IFPB 5AVXB 4JRLA 3F7PC 4YXLH 5DUMH 3WJLC 5F7HA 2EXWC 3TBWB 1R33A 4LSQL 1UJ3B 1F11B 4YBLC 5TF1L 4F5CE 3ZO0A 1CFQA 3CSFA 4QI3A 4DESA 3NCWA 1EO8H 1OAYH 2WUBL 4LSRH 1RK1A 4MA7L 2WANA 3FH8A 4QRRB 3IT8D 3GSWB 5DT1L 3QJHA<