4ICWA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
DQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Centrosomal protein of 120 kDa
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icwA00
1E8XA 2CHWA 4JPSA 3KWUA 4HVBA 2YRBA 1W16A 3L16A 4OVUA 3R7RA 4GNKB 4ICXA 3W57A 2QZQA 2WXPA 2WXGA 1DJYA 1DQVA 4BFRA 4IQHA 4KITB 5H4YA 4DK5A 5EDSA 5G55A 4Y1SA 3ENEA 4ANVA 2A5UA 5CCGE 3N5AA 4F91B 1RH8A 2JQZA 3ML9A 2Q3XA 4QAMB 1TJXA 3ZIMA 1E8WA 4TS6A 4KZCA 3QR1A 3TL5A 2ENPA 1V27A 3OAWA 4PS3A 3T8MA 1CJYA 1GMIA 4L23A 2K4AA 2ENQA 4WWOA 3F01A 3PRZA 2DMGA 2NQ3A 2WXKA 3GPEA 3RPBA 1BCIA 4F1SA 5JHAA 3F04A 1K5WA 4FA6A 3FBKA 3OHMB 1DJXA 2K3HA 2V4LA 2WXRA 2UZPA 3LJ3A 4FHKA 2Q0ZX 3L08A 4EZJA 2WXLA 4FLHA 3QR0A 2D8KA 3QARA 4L1BA 3HN8A 3ZW3A 3PFQA 1DJWA 1YRKA 2CJTA 2EP6A 2N1TE 1DSYA 3QAQA 3HIZA 3CSTA 3L4CA 4J6IA 1BYNA 2Z0UA 5T8IA 1E7VA 4PS8A 3IBEA 4A55A 4TUUA 4NPKA 4WAFA 3NZUA 4AOFA 1UOWA 2X38A 4FJZA 3W56A 4XZ4A 3HHMA 3PREA 1WFMA 2ZKMX 1UOVA 3QK0A 4WWPA 2LHAA 2CHXA 5KJ7E 4QJ5B 3CSFA 1UGKA 1WFJA 3M7FB 3MJWA 4DNLA 2WXNA 3APFA 3TJPA 1TJMA 2QZ5A 4ANWA 4L2YA 2ISDA 4PS7A 4QJ4B 4LT7A 3JZYA 4LDCA 3DPDA 4LCVA 2Y3AA 4HLEA 2WXIA 1DJHA 2ENJA 4GB9A 3SD5A 2WXMA 4BGDA 4NPJA 1QASA 1DJIA 4FULA 2WXHA 4ANUA 4XE0A 1E90A 2CHDA 1QATA 3F00A 2FJUB 4MJJA 5G2NA 4OVVA 2FK9A 4AJWA 3PS6A 3NSJA 2CHZA 3APCA 5H4ZA 2CJSA 1DJZA 4Y1TA 3FDWA 3L13A 3L9BA 4FHJA 4V11A 3S2AA 2NSQA 3NZSA 1W15A 4IHBA 4EZKA 4URKA 3RDJA 2RD0A 2YOAA 4XX5A 4WWNA 4TV3A 2KI6A 4WEEA 3KWTA 1DJGA 1E8ZA 4NP9A 1BDYA 1E8YA 3DBSA 3B7YA 3R7QA 3F05A 4FJYA 3APDA 3ZVVA 1A25A 1HE8A 2DMHA 4ICWA 4NS0A 1RSYA 3L54A 3QJZA 5CCJA 1E7UA 3L17A 2BWQA 5JHBA 4F93B 2R83A 2WXJA 3PYCA 2B3RA 4ANXA 2CM5A 2WXOA 4FADA 2K45A 3TWYA 1RLWA 3P2BA 3ML8A 2WXFA 4EZLA 2WXQA 4G11A 3IM1A 4QJ3B 5CCHE 2CM6A 4F92B 4KZ0A 4L1LA 2A4ZA 2K8MA 2NCEA
chains in the Genus database with same CATH superfamily
3ZR5A 4MJ2A 2I7SA 3BP4A 5JORB 4FE9A 4JG5A 3QIBB 3QQXA 2X9XA 2P42B 3VRLF 3ABMB 1TTRA 4ZUVB 2FO8A 2WC7A 3BH8B 4JMNA 1CFSB 3FOMB 1K72A 4G1EA 3MKKA 4U6XB 5BVJA 5LCVL 9PCYA 2FZ3A 3KNBB 4Y19A 1I1AA 5CZVL 2FSEB 3NJGA 4EKXA 4WKZA 1I3GH 4HU2A 3OR7A 5FLVA 4IBVA 1TOXA 3H3PH 1REIA 4GBXC 2DQTH 4LBAA 2AXGA 3KVPA 1ROCA 1GHFH 1R5VA 3I75A 4B97A 4P99A 3VD4A 4MXVF 2X6MA 4P06A 4PGEA 1YEIL 5EO1A 4I85A 1NCIA 3DJRA 3FSAA 4LSRL 3CXHJ 3WSQL 3K46A 1OTUD 3OGCB 1EMTL 2ZCKH 4NPKA 3ZDXE 1LGVA 5BQ7B 3L3IB 1Y0LB 2Y5EA 4WWPA 5JIHA 1HHHB 4X6DF 4P2RD 2JELH 2DZEA 3CMOL 3KPTA 4L0PB 3BIAX 4K71B 4OB5H 2AI0L 2KS0A 4QHUA 4YE0A 1J0JA 1B4LA 4J3SA 4MJ6A 1PZCA 3FL7A 4KHXH 3KPSA 3QZPA 1Q0XH 4RMRA 1Q0YL 3TP4A 1Y1DA 1E67A 4OV5A 2XQBL 5F3HB 2EXSA 4G9FD 3LKSA 4AUJA 3UBHA 3HA0A 2FX9H 3CFUA 3UJIH 2LAAA 4BFOA 4JL2A 1G7LB 1A4CA 4ENEC 2E7DA 5AZUA 1RERA 2IH9A 4MAUH 3S2AA 4OM0L 4XVJL 2JKNA 4APQB 4MHHI 2ZTBA 3O2DL 5GS2D 5FUOL 2I9LA 2HAZA 2PO6D 2R2HA 4JMXA 3QI9D 4KKNA 2UV3A 2JJTC 3KDMB 3V52L 3FTYA 1MWAH 4MGXA 3OM3B 2OK0H 4K23H 1E4HA 1MFCL 4K3EL 1LP9A 4MLSA 4QTFA 5E51A 2Y7NA 4AKQA 1RKRA 3NCJH 4MA7H 5LG6A 4NB7A 1F4YH 5BW7A 5C97A 1BZDA 1FNSL 3R4RA 3SDDD 4BSVA 4JB9H 3L7FA 2ZKHH 3TURA 3MUHL 2XN2A 4HKJA 4KDVA 4K71C 5ALCH 3X3FL 5AAWA 3LNDA 4QWWD 2VT0A 1OGAA 4WGVB 2K45A 1MLCB 2WIIB 4FFVD 4WTZA 2RJMA 5IBTL 1CWVA 4JG0L 5DUMH 4U1LA 5T1KA 3BDBA 4Z76A 2CK0H 4PJFB 2E9GA 5EEYA 5J6HA 3I3BA 2L7JA 3AS2A 3QW9A 3C6LA 1OAYH 4AMWA 4F8QA 1XEDA 5IMKA 1SHMA 1KCBA 3CFBB 4LF3B 1NCBH 4JFHD 3AQDA 3WUWG 4PBXA 1JAEA 4OLXH 1HJCA 3UAAA 5H4YA 1ADWA 1XB8A 3G5VB 2Z1PA 1HFUA 1HEZB 3FH5A 3IU3B 3WNMA 2VTFA 3L5HA 1L7TH 4XP6L 4BZ1A 1BWMA 2VUKA 2WZPA 1E8WA 1YSOA 3RFRA 4J3XA 2WV3A 1NINA 2V2WB 2GPZA 4XN7A 5IF0B 3SCMA 4OLYL 3EZJB 3ARBA 2R29H 3LKOA 4PJDB 1XGRA 1DVFC 2NY6B 2NTFB 1GY2A 4P3DA 2EDQA 4HPYL 1EJFA 2E7LC 1RZKL 1VFAA 4JRXB 4X7SL 8FABB 5LO7A 3QJVB 1S7QB 3PV6A 3TU6A 4J6IA 1N8ZB 4CSZA 4IRZH 2DBLL 1M7DA 4LVEA 3T3PF 2D9CA 2YBRA 4K9JA 4QRTB 5DJYB 3TV3L 3CMGA 1WWCA 2GG1A 3QR2A 4MMXC 5CMAB 3SDDC 1AZUA 2VXSH 1KCVH 3HUJF 5JXEC 4QJ5B 1J8HB 5LXGL 2D03L 4MCMA 3P4NB 4PLNC 3TO2B 3L48A 3UC0H 1O6VA 1INDL 2WUBL 5FGCB 1E6JH 3HE7A 3OKKB 3VI4A 4UUJB 3STLA 1RZFL 1OE2A 2XZQH 4ORZC 3DO4A 4IJ3C 4XP1H 1N18A 1YUHA 4D94A 4ODXA 2FD6L 1GS6X 4LAQH 1YPZF 5DDHB 3RGVB 2XZCL 3RILA 1XL6A 4DQOH 1TQTA 2BFGA 2EQDA 5GJSL 3PWUB 4GMTL 4Z5RB 4MSWA 3WFBH 1YEJH 1G1YA 5DYOB 2P9RA 4AJWA 3NJXA 2EUVA 4X0KA 4PHXA 4UNUA 4GMTH 3WY1A 4AI7A 4PJHF 5EO0A 4HV8A 4I89A 2XPYA 5EZLA 4ZPVB 1QSED 2KZ1B 3TBCA 1FV1B 1OP3H 3TBYA 4QUOA 5CGYC 1M3JA 2PYED 4TVPD 4HWZA 2WGNB 2CO1A 1MCWW 4JHWH 1T1XA 1OSPL 1U8JB 5TF1H 4HWBL 1CXFA 3NQIA 4X50A 1HILB 4XX1G 2FHBA 3WN5C 5IVXA 1EJ6A 3SDDB 3B37A 1A6VL 1T5WA 2K3TA 1OM3H 2YQ3A 1GGCL 4O51B 4QHMB 1FFNA 3F84A 4PRIB 1XIWC 4QRTA 4EI5B 4LZKA 1U3HB 4U2ZA 2BWIA 3CXFA 5JIPA 1JPSH 3FSOA 4HZLB 2NLJA 1S3KL 5I28A 2JI3A 5IGXH 5FEBA 1EEQA 5AAMC 2WP3T 3E6FA 1OP3K 1G6RL 4BEIA 2X6AA 4HKBB 3NCCB 3KBEA 4JGUA 4Y1SA 3NMEA 4I7ZC 3X1BA 5CCGE 3N1MC 4ODHL 2X3AA 4TQHA 1FJ1B 4UQ3A 5ANMB 4CRPA 1EHLH 1NGPH 3OX8B 3ARBC 4JPQA 5JLZA 3O2VL 3VD5A 1R3LA 1FP5A 1V54B 1FWXA 3D85B 4UQAA 4Y4FA 3IWUA 4BZ1L 2WOBA 4MMZA 2Q10A 3EUDA 3WY2A 4FL4C 4DUVA 4XC1H 3D3VB 2K3HA 1WHOA 4NT6A 4H2CA 5BOPA 3GMMA 3H85A 2VLRA 5DJ0B 3VFTA 2DQIH 5AW4B 2B5IB 1WPCA 3S3DB 4LHUB 3SEPA 2WB1A 2FECI 3FT2A 3E8VA 1PIGA 2A1WH 2B15A 2EXWD 3MBXL 4JX0A 4L4TE 2VDKB 4G6KH 1TVHA 3CCHA 3ULUC 1PLAA 4BFFA 5T1LA 4WKXA 4CA4A 3QRLA 2EXTA 1BYOA 1RURH 3RZCC 1VEMA 3SYQA 1WFJA 1NEUA 4UT9L 3JV0A 3HE6A 4ABUA 4UTAL 4M7LL 4Y4FD 4AW4A 4TNEA 2XWDA 2AAVA 2WYZA 1XGQA 3BSGA 4TLKA 2EUXA 2AQ2A 2GSGB 2DLTA 3B2VH 3MGTB 4MDIA 4KZDL 1CR9H 1UWFA 2Y3NA 1UUNA 15C8H 1IFHH 1P53A 4PSPA 2OJ1A 4XE0A 5D2NE 4JRYA 2RGSA 3BHBA 2VDRH 5AALA 4P5MA 4U1GC 2WQSA 3B3IA 4HHAB 2BJML 2F1BA 4M62L 2NXZD 4OGQC 4QMEA 4Q6YA 1JWMB 5FYJL 1QUNB 2EDNA 1HX0A 3TC9A 2YEZA 4B9PA 3UPCA 4ZXBD 1OQXA 3S5YA 3CBKB 2R51A 4A7GF 4F24A 2Y23A 1WBYA 4EZKA 2A9AA 1HN1A 4XO9A 2PO6B 1I7TA 1IC4L 5GQBA 3B7UX 4OCWL 3R06B 3GUTA 4QY8A 1EXHA 3B7YA 4HS6B 5HHOD 1HSBB 1RQ5A 3W37A 5ECGA 1NPJA 3VXTB 4JO2L 1UOKA 5LUMA 3S0PA 1U8QB 3TF4A 4Z7UE 3Q1EA 3ES6A 5FS5A 3JWOH 4GSDL 2CNYA 1U8KB 3T65B 1I1YA 4GH7B 3BXNB 4MCYB 3I9PA 4Z6AT 1U3NA 1NAMA 1YEIH 3THMH 1ACYL 5DMGD 3AU1A 4BUHA 2Y5TA 2NY7L 5JZ7D 4KHTH 2HG0A 4XZUB 4AMKL 1J9CT 4UM9A 3PPSA 1A3ZA 2OS7A 2QQNL 2P28B 1GYCA 3WNLA 4ORGB 5AVWB 4YSEA 5KVDL 1ZCRA 4D0BB 4Z7OE 1MHPL 3PNRB 3AC0A 3VB9A 2F61A 1E5AA 3L9YA 3BW9B 2HKHL 2V9TA 3HE6D 4I18A 1D2OA 1BLIA 3H4HA 1HAUA 3QRGL 1OAXL 1E4KC 4NYLA 3D05A 1JFQL 3RPKA 4PJGA 1AGEB 3UJTL 3DTXA 4GI6A 3D0AA 1ZY9A 1FQ9C 2VGLM 1J8KA 4UU9A 2PCPA 4JFZL 2HFFB 3CU1A 4Y2DB 5IM7A 5IB5A 1KCSH 1RZQA 2NQDA 2QGCA 2Y5TB 4OGYH 4I77H 2QTVA 2ZXWB 3RL2A 2A77H 5DRZB 2X42A 4PD4K 2C9AA 3ZGIA 4TKWA 2X2YA 5ACZB 3DX1A 2YWYA 1RZGB 1EFQA 3QK0A 4AQOA 1EQWA 1UG9A 5DWUH 3GSVB 2CH8A 1U8QA 2IGLA 3MU3A 3SBQA 1UZ6F 2WLIB 5DYFA 5TE7H 1THCA 2QZ5A 1BD2B 2MCMA 3GKZA 1EIBA 4NN7B 5HDQH 3ESUF 1WFOA 5SWZE 2H2SC 4OU3A 3S48A 3UEQA 5I1GL 2E6PA 1EEUA 2YR3A 1FVCA 1MVUA 2WGXA 2ZOLB 2F7IA 3BKJL 3O45B 4YDNA 1UA6H 5DURB 2ICWB 3KGUA 2Q7YB 3U36A 1PMYA 3H6AA 2XN0A 2DEXX 3H2PA 4EEEA 4Z7WB 4JRXE 2VC2L 4A2DA 3LKNB 1E2VA 1M71B 2BSRA 1UVQB 5AW0B 1R24A 2C9PA 4NJ9L 4R97C 3VG9B 3T8XB 5KN5B 1VZIA 2VO5A 2F58L 5DEZA 3ALPA 2UXGA 3HBGA 5DMKB 4CVWA 3VXNA 4DT2A 2YOAA 1BM3L 2APFA 4CC1A 2ZONA 1IBGL 4DKDC 3QQ9D 2YOCA 1KJMA 3OKNB 5LG1A 5E1IA 5IB1B 1MDAA 1D9KB 2VSDA 3FAWA 1JHLH 2QVIA 3BO8B 1KBPA 3EBIA 2VZVA 1TO4A 3NFNA 1OAKH 1UD6A 2PYEB 3QDMA 4B5EA 2CDFA 3QAZC 4HFWB 5ABAA 2IEPA 3AQYA 4I2XA 4PJBF 4WO4A 2XZCH 4U7KA 1YEKH 2XG5A 3APNA 1EEZB 2YAMA 2ESVA 2HA1A 3ELAT 5DK0B 3RKDC 3AUVA 3QVAA 4HC1H 5JDSA 5ACZA 4G11A 4IU3A 1E4WH 4G71B 1X5YA 1R3JA 2G3NA 2OMXA 4QXTA 5KEZA 4U33A 5CN2A 4POUB 1AXTH 4ZX4A 3DRTA 3B7RL 2HT2D 3U46B 5I73B 4FABL 2J1KA 5DK2B 3C2SA 2AEPH 3RBSA 2BVOB 3ZHDA 1CL7I 1A5FH 3LZFL 2VXSL 2C1PB 2EYRB 2X4QB 3KYOA 3MMEB 3HNVH 3RFZC 5ETUA 2A9MH 1TTGA 3FKUS 2AMGA 2X6BA 4JE4B 2AVGA 3S37X 2VKXA 3Q1SH 1A65A 3NJLA 3HNSH 3ML9A 3CZEA 1P5UB 1BZ8A 3BZDA 5FA3B 3BEVB 3BGMA 4S2SB 5C92A 3Q8FA 4XXDA 4BM7A 4X4ZA 2D7TH 3NJVA 3W39B 5CCKH 4M03A 5SV3A 2X3CA 1PLCA 2DV6A 1COBA 3KPPB 5BUAA 3WS6A 1S7UB 4IIZA 4POZC 1LK2B 4AC2A 1AYRA 5DFTA 4WHTA 4IOSA 3JWNC 1NH6A 3P73A 4ZMOA 3HIZA 5TE6L 4TQPA 4LIQE 4XPHH 2YSTA 3P0VH 4PRBA 3GBNL 3ROLA 1I3RA 3T2PA 4UTAA 2HPTA 4Y9EA 5BQ7A 4HK3N 2VZUA 3FQTB 4NM8L 5K93A 3GI9H 2XBTA 5D72H 3RA7L 4GXUM 4P4KC 5BS0B 3JYBA 3P73B 3RWIA 3U25A 3FB7B 1EVUA 1BD2E 4GKZB 1IGMH 2J71A 4OGYL 1LDSA 3BMWA 4ZAKA 4RESB 2A9CA 1QTPA 4K8RL 4Q52A 4R2GC 5F88A 4F3FA 2X7LB 1UC6A 5E4EB 4LOFA 7CGTA 2WKLA 3IFPA 4MBOA 2HG5A 4HJ1A 1P4BH 5KSBA 3B1TA 1QBLH 3BLKA 3QUMA 4PJAF 1J1OH 1MJUH 3DV4B 3VW3H 4GRMB 1SJHB 2DMCA 4R2GB 4DVBA 3GGWA 5DUBB 1CICA 5DMJB 4G70B 3WFZA 1DLFH 1Z5YD 5EG6C 4KBPA 2WCPA 5JW3L 2Y7LA 2AEIT 3HG1D 4FLQA 1J9QA 1GC1L 4I48B 4RMWA 2ZYSA 5IR1A 1CF1A 3V4PH 4KRPD 4ORGA 4J23A 1UD2A 2XPGA 3QJXA 4DZBA 4AE1A 4MB5A 4FJYA 1K3ZA 4DVRL 4CC0A 1LILA 2CXKA 1R19A 1SXNA 2Z9TA 4G7QB 2ZUSA 5I6MA 2C4FT 3FQUA 5EU6B 3QI9B 4KVPA 4MNQE 4JY6B 4B41A 4WI0A 4ODTH 2UXFA 4RX4D 3MUUA 2QPEB 4N8CH 2ZKYA 1RUML 4P57B 1XBRA 5C0FA 4IKLA 1L0XA 2HH0L 2AI0H 3NG5A 4TTGA 2OL3B 1E5UI 2W0KA 3CZFA 4HVBA 5CN1A 4NQCA 5KYUB 3TO4C 3BKYH 3BUYB 4J3TA 1RZJH 2JJSC 1R3HB 2VMJA 4Z7NF 4P4KA 3E2HC 4RFEA 5I8EB 4A6YA 3OMIB 4M3JA 1U33A 1X5GA 3TJHD 5I6NA 5ADOL 2KZKA 2NXYB 1MHCB 3NH7L 5H94A 1VB9A 1YYCA 3KLKA 4V1DD 5DJ8A 1WD9A 2FEDD 3L6FA 5EEVA 2Z31A 3O3DB 4YZWA 3ARBD 5C0CE 3DDGA 1N0LB 1FAIL 2XXCB 4XOAA 4HJEA 1PZDA 4PW3A 1H3PH 2Y7QA 4AIXA 3TBVA 3RYMA 2ZSVA 4LCUA 2N7SA 4FHKA 4HLJA 1WZKA 4MHHG 2Q7YA 4KNUA 3S9DB 1T1ZB 3C60C 4QOKB 4V2BA 1Q9WA 2R1XA 3DX3A 3ULAB 1NGXB 4GUPA 4AZ8B 2HLAB 2X70A 5AWNL 5HGDA 3HE6B 5FA3A 1FFRA 3HZYA 2BNRD 4PW4A 3VQ1C 4G7YH 3IVKA 4FN0A 2YJQA 4OSUL 5E9DA 5JHMA 3VW3L 1MJUL 1TENA 3GMRB 1FE8H 4AT6B 4WI0B 2FJHA 3FB8A 2XG4A 5J89A 1YJDC 3GSRB 4A7QA 4WK4B 5DRWA 4X6BB 5HJ3A 3QWRD 1PYWA 5DRXB 2QR0B 5CINH 2ICWJ 4GB9A 5CZXD 5DC4B 5JXAH 2OTUA 4AQ1A 4BKSC 3AADB 3AUWB 3VFSB 3Q05A 1CI5A 1LWRA 4P2OB 1PEZA 2GEQA 4NZFA 2X4OB 4JFOB 4KQ3L 5F7DB 4DP4X 3M1BA 2ARJA 3I85A 1OOWA 2AKRA 1JF1B 2FIKA 2J5WA 3NSDA 2O26U 4OKVA 3CHOA 4IRJD 4DCQA 2OLDA 4YDKL 3FRUA 3SDCB 3VNYA 5G4MA 2ALWA 2E7BA 3ZDZF 1WWAX 2ITDB 4N1HB 4HWUA 4XPHL 4NUJA 4ZMWA 3BAXA 4D0BA 5F3HA 5FO2A 3DMMA 1RD6A 3AXLB 3SGDH 5LNDA 4OTXL 4XMUA 3BZ4A 3VI3F 4GS7C 2W0FA 2ZP8A 4KWUA 5KYWB 1IGJA 5HI4D 4KJWC 5A16B 3GTVA 1OWWA 2DMHA 4OIAA 1L3WA 4NWUH 1DSFL 1NAMB 3ARDA 3L54A 4H88L 5J56B 3EJCA 4CW1B 3JTTA 3IDGB 3MLWL 3X3GL 3P0YL 4N85A 4KK8D 3V4VA 3ZY7A 5LAXB 3FTVA 3LDBC 4FGMA 1T6VN 2BRRL 4QDGA 1AHWC 1V7ML 3QYCA 1T5XB 4LHUG 1U8NB 3PWPD 2WBJD 4FQ2H 4KJQC 4RMSA 4Q6IC 4DK6A 3TCXA 4HGWB 4JR9H 1D7CA 5D2NB 4BA8A 4BDVA 1A7NH 1QWUA 3RY6A 2XUWA 4YZFF 2IBZX 4ODWA 5MEOA 4DEPC 2FDBP 4J1UA 5ECJE 5AVXB 1HJBC 1D5BA 3K2MC 1A7OL 5E8OA 3QDAA 4MD4B 1U3JA 3RVWD 3JVFC 3VSVA 1PX8A 3IYLW 1Z9NA 4EBQH 5DHYB 1LL1A 3K6FA 1K2DB 1A6UL 2X4UA 4JLRA 2AC0A 1OAKL 4F8NA 3GFUA 3KPLB 1XTMA 1CXIA 5TDPB 4XBPA 2CUMA 3IJHB 5E0FA 2Y5QA 4DGYH 2DQGH 2XQYK 4N8PA 1HSAB 1WBZA 4EF3A 1FL5B 3TBWB 4AEEA 3EHBD 4AGOA 5KBPA 4PFEA 2JF1A 2G5UA 3KVQA 3O8XA 3PREA 3KEHA 3RZCD 3NRQA 3U0WH 2ZYIA 4L4VE 3IETA 4YLBA 4UANA 1OCRB 1TCRB 3U0PA 4I1PA 3B9KA 1W2KT 5E08H 2AFNA 1CU4H 3WO3B 2FJGB 4QJ4B 1EZLA 3TV3H 4S1RH 3SDAB 1QRNE 1SM3H 3FFCA 5HYQB 4AK1A 3IAPA 3T3MB 4WWKC 2MNWA 1DVUA 3WTYA 1C5DB 3ZYJA 1I1FB 3SQBA 3BRFA 1CF8H 3ARGA 1OF2B 4HPYH 4OZHB 3SQOL 1FYTB 3D85A 4Y4FB 2BY0A 25C8H 1PD1A 4MBRA 1G9NL 1HWWA 1ZLWK 5JW5B 1KGXA 3LKRB 4HDIA 3A5VA 4NQXA 4PJ7B 4GINA 2IDUA 3CLWA 4KPHH 1QPKA 3Q0HA 4A68A 4YGVA 5KANG 5JORA 1UXWB 3EXLA 3ULVF 1CFBA 1IAKB 1AKJB 3L5XH 1TJHH 4FNSA 2AHIA 2ZG2A 4KTDL 4MXQC 4OLEA 1PZUB 1P6AB 1QLRB 3UTTB 4N0UA 4EUPB 4X8XA 1DDHB 5F44A 2UX7A 4ZYKB 3F05A 1S7VA 4ZK8A 4G43B 1X6LA 2Y36H 4CAGA 1HQRB 2BNQA 3MRCB 4B9FA 3T1FB 1SXZA 2BWQA 2ZOOA 1FHNA 1OZUA 2A74B 3N0PB 3BHBB 1FBIH 1QSFD 2AQ3A 4N8VG 3HCVB 4ANXA 4DO4A 3ARGB 1TPXC 4LDOB 3RGVD 4TSBL 5HYSB 1MI5A 3IM1A 3WEXA 5ETUB 5C08E 2GSGA 2ZT9C 1JGDA 4GI8A 3P4MA 3W5MA 1FNLA 1E0OB 2QVTA 3MR9A 2YRBA 2JQAA 4MJIA 5JW4N 1BQHG 3O6MH 4Y5VA 2WQXA 2HLFC 2XWBB 3F83A 4KITB 3KDMA 4ZBJA 3IXTA 1BFSA 3SO3C 4F7EA 4YHYC 4XNMA 4FNQA 3HCVA 3NJMA 4OLWH 1F41A 3AMKA 4DH2A 3IVKB 4Z77B 3NGBC 4PJIF 4XPTH 4KKCC 1JGEA 4ZPTA 1SNRA 1UJ3C 2R4RL 1NOLA 3IDYC 4G43A 4R0LC 2ZP0T 4J2XA 5GRVL 3D39B 3TBTA 1KACB 4JO2H 2KT6A 3QPQD 3X1FA 3V9FA 5ES4B 3ZE1F 4F3FB 4G1MA 1D5MB 4CU6A 4JPVH 3WKMH 2Q0ZX 4Z7IA 5JXED 3MHZA 4OCWH 1T5KA 3BPLB 1ZLUK 1YAIA 1IGFH 4XZUA 3BH4A 4XPGH 2ZQKA 1TKWA 3UTSE 3AY2A 4ZMVA 3HNTL 3VFWA 1PLGH 3BXNA 4D7BA 2LVEA 4DK3A 5IW1B 3ZRCC 4DUXA 3FMGL 3NABL 5AW7B 3CMOH 2AJZA 1IFRA 5C8JA 2KHAA 4H4NA 4RAVA 2HT4D 4V1DA 1M53A 4NQCE 5JQHC 4KTEL 1BIHA 2AK4B 3RU8H 5KS9F 3HJ0A 1SF3A 3VWKA 4OZIE 1KIRA 5A2JH 2NRDA 2BVYA 3FB5B 3COOA 3S5ZA 5L8KB 1L0PA 1LYQA 4D0DB 3AB0B 4MB1A 3PWLA 3BVTA 1TO5A 4LCWA 5DSCB 4LVOB 2DM4A 1VEOA 4DZBB 3Q8EA 1OD9A 3V7MA 1Q9LB 4OKDA 3RNKB 1JCVA 1N5AA 4ZODA 3M1CA 5SWSE 3RWGB 3SJVE 5IMOB 1I8KA 2K6YA 4YDJA 2R2BB 3NIGB 1E8ZA 4Y0GA 4FQ1L 3X12A 1MVFA 3DC0A 3DECA 1IEHA 3IMBA 3MV11 4IRSC 5BUPA 4POYA 1BREA 2KL6A 3UFIA 5DO2C 2FX7H 2WWKT 1DBML 3BWUC 3T0DA 3WLBA 2IWGA 4OIIH 3ZQXA 1VFBA 2CDGA 4PRPE 4BKTC 1B0GA 1MLBA 1RZKC 4HOMA 4LARL 1BZ7A 5H37A 3PHAA 3EGXB 5IB2A 4OLUH 1JSYA 4JQIL 1NMBL 2XX1A 3RWDB 1CQKA 1KIPA 1JF6A 4ICXA 2H6PA 5HDBB 5IGXL 4WW1B 2WLYA 1PDKB 2EVFA 1G4RA 4G9FB 1VLXA 1MPAH 3GJEB 3MLVH 2YAOA 1VAHA 2Y1AA 5IB3B 1CG9B 1C5BL 1WYJA 1YG9A 2P8PA 4OFQA 2IOMA 2UWEB 4JM2C 2OX5B 1GKEA 2OW7A 3H4FA 3D50A 3UL4A 1SBSL 4W4OC 1NOAA 1Q9WB 3EJJX 3LKNA 5G5DA 3HLKA 3FQWB 5IFJA 2B8OT 4HXBL 2IDTA 2KH2B 2YWZA 3G5ZA 4HK3J 1JNNH 4DETA 4XNQB 4X98A 1MZYA 1N6VA 4FQQB 4JJHA 4XT1C 3MNZA 1ZHLB 1SXSA 3CFMA 4ILDA 4QRUB 3GZOA 1DQLL 4YFLF 1BBJB 5CXPA 4KROB 3QHZH 2EAEA 2VYRE 4MB3A 3LKRA 2PW1B 3ARED 3KLAA 5I1EL 5IB4B 1HXMB 1JRHL 2VXQL 3BGAA 3LXBA 1PGRB 2V5TA 2Y2YA 3CSFA 3QJFA 3UCQA 2VN4A 3VFSA 1NCCL 4PYGA 3SE4C 2H3KA 3MV8D 3HRZB 3GMNB 4LLWA 5F6IC 3CFEA 5B8CC 1AXSA 5KUKA 1IAOA 3A3YB 5C0EB 2FJHB 1H6TA 3HI1A 4MNQB 3F7YA 4P9HL 3FQ1A 4D0CB 4ANUA 4ZXBB 2CO7B 3HFMH 5DD0L 5KVFE 4WDIB 3MRFA 5MEPB 4AC4A 3MNDA 3EJTA 3OR7B 1YYLL 1FG9C 2OQJA 4KY1L 1HDMA 3FW6A 3QDMB 5FOBB 2E4FA 3EFOA 4GAYA 4V11A 4PJBE 1CDIA 2BHFA 3P3UA 5LQBL 5F9WC 4YEFA 2C9RA 4OBSA 1KJMB 4TPRH 2KLSA 2WZ6A 5AKSA 3RDTA 3BH8A 4LHJB 3S5LA 4LQFH 4AYEC 3FU8A 5E08L 2VH5L 1E27B 3BCFA 3EJPA 4K5PA 2Z7UA 4JVPA 5IOPA 2XPZA 1SOQA 3PWLB 4HK0A 1MUJB 2NY2D 5I1IL 3U2SB 3PWPB 5E8PB 2VQ1B 2HTKD 3CN1A 4JQXC 32C2A 3JZ7A 2Z34A 5HYFA 1WZLA 4KI5F 5CNHA 2VQUA 4AJ0A 2ZCLL 1ZSHA 1L9TA 1OT1A 2IH1B 4QEGA 1DEEB 3E3QE 1AE6L 1AQKL 2K7PA 3LRSA 4FRWA 3F7VB 4OLXL 3H9SB 1E28B 4DEPB 4HFUL 1QQDB 3US0A 1LNUB 4GFTB 2AABL 4WFEE 3G08B 3QJQB 5E5MB 1S2EA 5LAXA 1IJNA 2GJRA 1QO3B 3G04B 4H8WH 5KOVC 1CLYH 2NY5L 3IE9A 2UX6A 2H0JA 4PJ8D 4NNXA 2VCOA 1Z3GL 2OL3H 3GBEA 2FQGA 4MJIE 4QYOA 4FEMA 4HMEA 5ICYB 4J8QA 5IOPB 1F2QA 2H8PB 1E9PA 3ARRA 4HHAA 3SOBL 3QRFM 3NJNA 1NC4A 1QBAA 3LMJL 4NIYE 5DZAA 5BZWB 2KMWA 4AQ1C 2OCCB 2RQEA 3RX8A 1NCAH 4JDZA 5EC1A 2Y1VA 1B6DA 1TZOA 3EBAA 1AQDA 1OF0A 1A6TA 5D7JC 4LKCA 4JR9L 2H3NA 3D25B 4L1BA 3S3CB 5FM5M 2AXJA 2BRRH 2F5BL 2VLMD 3D87B 4YHOL 3DXAD 2VLLA 1CBVH 5K59E 1HAWA 1K5NB 3QCUL 3MRGA 3MLWH 1U4EA 3QXUA 3QXAB 4FXKA 2FSEA 4JFFB 2FYYB 2FHFA 5HYEA 1GIGH 5JHLH 1NLDH 1VESA 2X1WL 4QLRA 1BJ1J 5LGYA 2CMRL 3WHE1 1BVNT 4UV7L 4OF0A 5GZNA 3W9DA 3NT0A 3MLUH 1P6WA 3PF2A 4UTBH 2RQ8A 2OSLB 4GKZA 1A4BA 1J87A 3C9NA 2BNRB 3QXTA 3JZYA 3GRWA 5HHOE 2Y3AA 4X6BA 1DVXA 4OH2A 2QKIA 4N0RA 2HUEA 3UZQA 2P43B 3MRHA 4QRRE 4L8SB 3H6JA 3OR6B 3ZUCA 2HSIA 4FQLL 5J12C 5D7IF 1J7VR 1HCYA 2XXFA 2EYTA 1IQWL 1ETJA 2VIRB 3DHMA 3HUJB 2PYEA 3HZYB 3OX8A 4IJTA 4ALAH 4Y9GA 1BGXH 4MA1B 4ZYKA 5TQ2H 3MRBA 1BMGA 1CDGA 4NHUB 2DB8A 3P9WB 4LSRH 1OM9A 3E0GA 4LNVA 3NZHH 2Q87A 2BS71 4H44C 4GKNB 1MIML 4JREC 5D70H 1MAML 3CLFH 1F3RB 3BESR 3RUGA 3VDAA 2WK2A 2Z4QB 1GHFL 4JKMA 4X6DB 5I66A 2BIQA 3FB6B 4PB9H 4F58H 1EDHA 2F2HA 1KT2A 2WXJA 3N1GC 3C2AL 3NCYP 1MCIA 2F19L 4A1RA 4XMLL 2J5LC 7FABH 2VSCA 2H1PH 3ZTCC 1Q38A 3OTTA 1MY5A 3TTSA 2DDQH 1M05A 3DIFB 3P9LB 1HXYB 2BOCA 5DZJA 2QTEA 4O02A 3A0OA 1I7UA 4BHUI 1K4DB 1RV6X 3U4EA 4LPWA 1BD2A 2CA4A 5F6HJ 3RKDD 3W82A 4QXTB 2OPCA 5DR5H 2Y6SD 1MCNA 3BUPA 2NYYC 4EIUA 4K5NA 1FZOA 2MPAH 1DSWA 1A14H 2A74C 5DMGC 4P2QE 1UM5H 1W0VB 1NCOA 1KLGA 1VFUA 1M2VA 3NFNB 2BXYA 3QDJE 4AL8L 2DOCA 3QUKB 4DKFH 5IEKB 3KJ6L 4MAYA 3WUWB 2CIKA 5D8JH 4PRDA 3O4LA 3HZKB 1CFVL 4OGAD 5DMKA 1UD5A 3ZW3A 5M94B 4I3RH 5C9JB 3CDGB 2OMUB 3DYMA 2R23A 3Q7JA 5E9NA 5CGYD 2GCYB 3FCSB 1E5ZA 3MRRB 4KROD 4YK4B 4JFDA 2QPSA 2NDFA 1N3NB 1YEDB 3D08A 5ANHA 3PAUA 1FL3A 3EYFB 1BG9A 1CXKA 1J8HA 2GY5A 5E2TH 3LKSB 5DMIH 2CGYA 4FD0A 4FQIL 2LU5A 3WFEH 4K3JH 2WLLB 4YSPA 1U8CB 4U1KA 4PS7A 1U92B 4AYDC 5DS8A 1KOAA 3OB0H 3P4OB 3WKQA 1QR1B 3EGSA 3LPPA 5CD5D 1NDTA 2G30A 2BERA 2CLVB 3MV9E 2VR8A 3Q8AA 1NJ9B 3RTLA 1JGUH 4PTTA 1VZHA 2VR5A 4GRWB 2L04A 4K3DH 4OVVA 1RUPH 3UDWA 3GJFK 4PV8A 4ZFZA 3TBSA 2EIKB 5E9DE 4XVTL 4XNYL 1MRFL 3MNVB 3VSTA 3HKZA 3OJVC 4WHYH 3VXRE 4HS3A 4LIQH 1BA9A 3S37L 3LXUX 2NUTA 1CBJA 1Z3GH 2HFFA 4PJGF 4FXKC 4MNGA 4YS4A 2BIIA 4QTIH 1XMWA 1RIUL 4NM8H 4X5WB 2KPWA 1WT5A 2ZOKA 3SN6N 1BECA 3HRZC 1FVEB 4JJ5A 5FIEA 1WFTA 2AABH 2NY2B 3QJZA 4I18B 5IK3A 5KSUB 3SKNB 3FC8A 5E00B 3EGDA 1BQRA 4K94C 4P0DA 4YE4H 5TE6H 2K78A 3F6JA 3EOBA 5G4NA 4P2RA 4ATWA 1LEGA 4PJ8A 3JV6A 1DFXA 3H55A 1MEXL 4MASA 1R75A 4X6CA 4LVHC 1EZVY 1ZTXL 2WJ5A 2V7HA 3WE1A 4YHIA 3VXUE 4NP4H 4B50A 3CLEL 5HGDB 3CZGA 3U0TB 4R4FH 3HEIB 4TLSA 2EIMB 5IWLC 4GS7B 3D07A 4PJDF 4JQXA 1F00I 3AAZA 2AEPL 1ZWIA 2OZNA 1QW8A 2BCMA 2XV0A 3VO0A 3QPQC 1CTNA 2Y07L 2VR9A 5EOTA 1DE4A 2FSDA 3I2CH 4FNLH 5FO9B 4HUVA 5GRUL 3RE0A 1LEGB 2Q3ZA 4GY4A 4N2HA 5CLTA 5FK9B 5LAPA 3S2CA 1QI3A 4ZUWB 1NAKL 1XL4A 2R1WA 3A6OA 4PGBA 5AW6B 5C0BA 5B38B 4GXFA 1SDAB 1OCCB 2B4CC 4GSXA 1ZLVH 3KBFA 1UOWA 5JA8B 1MSPA 4K7FA 3TH3T 4KK5C 1PLBA 2B59B 2P8LB 3GTTA 1NKRA 3I84A 3ZKNC 4H25A 3MGTA 4MDIB 4JO3H 5ICZB 3IB4A 3GKWL 4X7TA 1EHAA 3L95A 4PI0A 43C9A 1F1AA 4H20H 3UPAA 4ZQTA 3QEGL 1R47A 3U9PH 2L4OA 3ECUA 4JPIB 1KLFA 3KXFB 1S78C 2QDWA 5D4HA 3O6LL 4PRHE 2EDMA 3FOLB 4P59L 5SWSB 3SJVB 4UT6H 4HCIA 2QFPA 3T0WA 2CZNA 4LSQH 2WVVB 5FYKH 3OV6A 4M6NH 4XWOC 3WE6A 4PB0H 1KN4L 1AKPA 2DWYA 1K8DA 5H4ZA 3SKJH 3WJMB 3TH4T 3GXUB 4O58L 4G6AD 5GSRA 4X5QA 1LP9B 3ARFB 2QSTA 3BKJH 1WZ1H 3CK0L 1RUQH 3LRKA 3QUYC 5I1GH 1QRNA 3VQ2C 3MLTA 1AI1L 1NC2D 3RVTD 1Q72L 2I69A 1KTRL 3NSCA 4NDMB 4ZMLA 4A2EA 5DWUL 5EH1A 3WXVL 4NS0A 2VRQA 3D6GA 4LP5A 3U4AA 2MPVA 1DEEA 3BE1H 4KMLB 4PJ9A 3SYCA 1U8IA 3UTTD 4DHLA 4OLUL 3WEMA 2B3RA 1OALA 4J1UB 1CI3M 1YDPB 5AW9B 1SF5A 1XZ0B 3QWQB 5EOCL 4M8QA 5EZIH 1LXMA 1ZANL 3AT0A 3MXVL 5A2IH 4XNAA 1S5IH 3LEXB 2R0LH 1LTXA 2XJKA 1DBMH 1W9XA 2R1YA 5JHDE 3CDGA 2VR7A 5AD0B 2V37A 2LFEA 4LFHD 4S1QL 1D5MA 1X5MA 3VCLA 1ZMYA 3KWWB 5A2CA 1YN7B 1X9RA 3QWRA 1YPZE 1OAQL 1L3NA 4RNRA 2Z4TA 3ZE2F 4NKQB 4N8VB 3AMLA 4D7PA 4BD4A 1GYAA 5CR1A 5A16A 2A4CA 4PS3A 4D8PB 1JK8A 2E0PA 5EO1B 4KK6D 3R06A 3C6LD 3DX2A 3O3AB 3GUTB 4M43L 3UTZB 1K5WA 3K0WA 4J7RA 5EWIH 1YQVL 1NUGA 4BH8A 2BHUA 2WSDA 5ANME 4QOKD 1IBBA 1N7ML 3T3PE 5F2FA 1PKOA 3OKOA 2JCCF 3EYQD 4OF8A 3KYMB 4X0KB 5HHVH 3QP3A 3JWNG 4F5CE 4FJ6A 3VMPA 5B39G 1ZSDA 4PJBB 1NGYA 2C1OB 5E00A 4X99B 3FO1B 2OR7A 5EHFA 4JHAL 3MODH 2PW2B 3ARFC 3AS1A 5EPMA 3L1FA 4WTWA 4HXAH 4ZAKD 4BH7B 1KWKA 3FO0L 4L2YA 1UADC 1QFPA 2VABA 1I3UA 3B56A 4YWGH 3HNTH 5CS7A 1RUAH 5IVNA 3BN9C 1UWXK 2MQ3A 5E2WH 4RETB 4XPGL 1H8LA 3L3DB 1QX1A 1HINH 1WA0X 3LV3A 3PQYE 1KXQA 5KVGE 3K1DA 4PRHB 4OCNC 4P3CL 5C09D 1UENA 3NSJA 3V6FA 1KIUB 1BXVA 2APTA 1Q8MA 2WLJA 4ATTA 2E4TA 5EU4A 1CG9A 5IB1A 4HU8A 2R4RH 3G6JE 1YY9C 2FX8H 2IGFH 3LIZA 3CDFA 3MLYL 1QLEL 3O4OC 2GBAA 4L8SA 5D6DC 3AM8C 2YARA 3QQ9C 5CHNB 4XPTL 2ZSVB 4LCUB 3O11A 1NGWA 4EZMA 5F7FA 5A2BA 1ETZA 3HTLX 5HHQA 1O5PA 2EICA 5CJXC 3CBRA 2GY7B 3HC3L 3J2PA 4L1DA 4BQ8A 2ITEA 5IHWA 4R7XA 3POCA 5J9PB 3UBXI 1UQSA 2YZ1A 1XFPA 4G6KL 1A6ZB 5D55A 2CM5A 5CEZE 4AITA 4GSRA 5T33L 3STZA 1TTBA 3KL3A 1XWVA 4QHNB 3LN5A 1BOGA 3N1PC 3SDCD 1M6OA 3T6XA 2QVFB 3FCSA 1YPZA 1JPEA 1GR7A 1WA1X 1G9NC 2B39A 1O9ZA 3FQRA 4GW5A 1V8HA 5HGGS 3U2IA 2RCSL 4IBSA 2GHZA 2K7QA 4U1LB 4AIOA 5CLYA 3M07A 3KPSD 2Y6SC 3QIWD 5KYNA 3V0JA 2BM3A 3FRPA 1N6QL 4GO8A 1IC7L 4ZW6A 5JW4R 1ZT1B 4HCFA 3L5IA 4JZNB 5D7JB 5JQ6H 2ENSA 4FA8A 2HP4A 1OEZW 3D7PA 5DEFB 5KJ4A 4MA3A 5KG9A 1LHZA 5E0QA 2HVBA 5GRXG 2ZXBA 4YHKL 3OXSB 1G9NH 2OZ4L 4G3YH 4LLYB 5IHHA 3TYGH 3QUYD 1CFQA 3NDZE 2CUIA 3K81A 4JDVA 4WSJA 5J13C 1D3CA 3L3JA 3VG9C 5AG8A 3QO0A 4ZO8A 3LS4L 4Z0XB 4DVBB 3GHPA 5SV4A 2X4TA 3ROOB 2IH1A 3RWJB 1OP9A 2E27L 1FNHA 4FQCH 1A6AB 4PP1D 5DHVA 4Q9BA 3VXPB 1KIQA 1EH9A 5IMLA 1VACB 2BO0A 4Y1AD 5J9PA 4U3SA 3D2TA 4ZAKB 4EMZA 1QNZL 5A6MA 3U0WL 4RLDA 1AJ7H 2XZZA 3OKDA 4PRNA 2R2CA 2GSIB 5ALBL 3VYOA 4OQTH 3WJJA 2VL5B 3EDJA 3BVXA 4HIXL 1NA8A 1YJDL 4X6CE 3LSOA 1JWSB 2DQHH 3ETTA 4M6OL 1M4KA 3QUKA 1NEZG 5AZ2L 4O00A 3TBBA 5IIEB 1OE1A 3OGCA 1YEJL 3GYRA 5AL8A 2NY3C 1CFMA 2G3XA 5GJSH 5JMRA 4G5ZL 4L8BB 3SO5A 4WK2B 2IH8A 4K5MA 3WD5L 5KVEL 4FI8A 3MLTB 3GSQB 4XP1L 1R5VB 3B9DA 1BAFH 5ADPL 1MREL 2DL2A 3L9EA 5D2LB 5GGRB 2R4SH 4NN6C 1UASA 2W5PA 1SY6L 4B53A 1RIVL 2VWEE 3RLSA 1T3FB 1IEBB 1F86A 1KCVL 4ZW5A 4F57H 5F9JA 4BRJA 3VXUD 2QKIC 3RGHA 4TULH 1QD0A 5EORH 1P5VB 1PSKL 5FCSH 5EEUA 2WNXA 3QPKA 5EEZA 35C8H 1YNLH 3P3RA 2X88A 1NCJA 2HUHA 3H9SE 3KHQA 3P2BA 4FQXC 4I13B 4Q89A 4BWWA 1XAKA 2JB6A 1FVEA 2A9BA 1ZVYA 4JJ5B 3N06B 5A1AA 4AZ8A 4TUOA 5I8KL 2MIZA 3L3HB 4HWEL 2XKUA 2EACA 5EUKA 4FQXB 4BWUA 4WU5B 1KPRA 3DVGA 3G5ZB 5TDNA 3EJQA 4FNPA 1WWWX 5EULV 3RDTD 8CGTA 3M7OA 3QDGD 3TT3H 1N12A 2A0LD 2FB4L 2B1OA 2EEAA 1CICC 3MO1A 1N0LA 2R9HC 4QNPE 5AL0A 4RZKA 3L6FB 4GG6A 1UXSA 2A4EA 2VM3A 4PH8A 3BZEB 1KFAL 4HDIB 4NQXB 4PJ7A 4U6YB 1IIKA 3QORD 5CIPB 3OLIA 4PJCE 1W6LA 3WUZA 2VM4A 3QCTL 3OKNA 3OAUL 5DQJA 5JHAA 4HKXA 1EGJH 3DPBA 2E9BA 3FSWA 3GHEH 1NGWB 1DJXA 3ISRA 4G80A 2EDTA 1WEJL 3GEWB 2R2EB 2Q2EB 4FCAA 2OJEA 4UQ2B 5C0IB 1B2YA 4YAQB 1HNGA 4AY0A 5EIQA 4M48H 3HI6L 1DBKH 4R96A 2DWSA 4RFNC 3VGAB 1KB5B 1SN2A 3H7BB 4P57A 3T9WA 2OULB 5DHEA 3X3FH 3KWVA 4XZ4A 2GIMA 5GRWA 3UH8A 4ISVA 4HKBA 1FNSH 1OAJA 1FL3B 3II3A 3K72A 3H2WA 4ZW3A 1P2CB 2WO3B 3C5SA 4ELKA 3RAJH 3GXIA 3F3HA 3WGUB 2H0FA 3O9WC 1FI8C 3DPDA 1QTSA 4G7RB 1TJGL 4XBGA 3K4DA 1IAII 3T04D 2EDHA 3F7LA 3MUY1 3TVMC 4D9RD 2BDNL 3HUJE 2YD2A 3DHPA 5GSRB 1LK3H 5FFOA 5HGAB 3V9EA 1IKOP 3T4YA 3UJIL 1SJMA 3PXHA 4XPAL 4UQCA 1T0MB 3MLRH 2UY6A 5FKAA 1ZT4A 3FUHA 4EE2A 3LNHA 4PGCA 1HH9B 1EZUA 3WO4B 1X9QA 2BOBA 4Z7VF 4URKA 5F9WB 2H26A 4KC3B 2VDLL 3HG1B 4N86A 4ODWB 5CJQL 1TETH 4R8WL 4U1IA 1BVLA 3KVDD 1UD3A 3QEQD 4L3EB 1TEYA 2XETA 3O2DA 3QXDB 2C7FA 4IIQB 1GPOL 2AK4A 4LCWE 4WIQA 5HI4C 3T4AC 5J5EA 2DKUA 2QSQA 1A25A 1AR1C 4APXB 5I2IB 1OTUC 4FFZA 3SKOA 1SEBB 2X4RA 2D9QB 2ZCKL 5FAAA 3PJSB 4KX7A 4CMHC 4YDVA 4N4YB 4AEHH 3MRKB 5IBLD 3VCLB 2FCBA 3ARSA 1NSNL 2D7NA 2B2XH 2EYSB 2OBGA 5DEGB 1T04A 1WD8A 2PWDA 3KMDA 2Z7WA 4CMMA 1QVOB 3VRJA 1JNHB 3ZPDA 4N3UA 3RUGE 1Z5LA 3AXIA 3FCUB 4DVRH 4UOJA 1KJ2L 4M5ZL 3O0RH 3T65A 1HK6A 1Q94A 1S8DB 4KZEH 3LH9A 3WJLA 1I8IA 2I5YL 5DHVB 3ALWA 3KPNB 5AUMB 4XXDB 4UZGA 3TWCL 3TLRA 1PG7L 4YH6A 5E7FA 3QEHA 3MBEC 4O02H 4H8UA 1EXUA 4LASH 3FPYA 5DJXA 2V2TB 2FGZA 5F1IA 2B1AH 5ILTL 1AOZA 1PIFA 4XNXH 1R3IL 5TDOB 1ADQA 3MJ7A 3V0EA 1YRKA 3JQOB 4GP5B 2OMYB 1RFDH 5D96B 4C55A 3TVMB 2WWMC 5HJ3B 1M2VB 2HPOA 1E7VA 3TOPA 4G42A 4EO5A 3QULA 2JCCA 4CVUA 2WQRA 2ZKMX 3SHSA 1FH5H 4OI9A 4R6UA 5BRZD 3ZZLA 1IAIH 4CNIA 2FGWH 3BMVA 1TVBB 3UAFA 5EEXA 2ICWI 2FATH 5L8LB 3D5OF 4AE0A 4IGBA 1YC8A 5E5UB 4CL7A 4TUOB 5B1JC 3O2WL 4BYHA 1KDIA 2DWTA 2WM0A 2X9WA 4L0ZA 2X1OA 5F7YC 4F9LC 2WBJA 5D9SA 4WTXA 5TJWK 3E8UH 2AAAA 4FQHB 5A2FA 1KCRL 2FO1A 2VLKD 5A3IC 5CBAB 2Y2TA 1CLOL 2RH0A 4JDEA 2ZP9A 4OUUA 2XICA 1L7IH 1J1PH 1MHCA 1HVXA 4JG1H 4Y2OB 4XN8A 5BMFL 4JN2A 3T3MF 4YHPA 4G80B 3HKFA 4QRPB 4XN5A 5L7XH 4WW1A 1G84A 3WIHL 3AB0C 3MV9A 2IAAC 2LLGA 5CLXA 3MRBB 1LO2L 5EU4B 5DJ6B 3VD0A 1N26A 1PY9A 3DETC 5I18L 1OSYA 1LMIA 3DNKA 3T0BA 1PPIA 1ICTA 3ARFD 1J0ZA 3MOBL 3U0PB 3VXMD 4ODUB 2AJZB 1J0HA 4LCYA 1ND0A 4XMVA 1CDYA 4LAJH 3BSZL 3IFLL 4IRJB 4QTHA 4ZX6A 1IT9L 1J1XH 5KZCB 3LNGA 4TUKH 5DF0A 1PBYA 4PJGE 4WFED 4DQAA 4ONGL 4FP8L 1MRDL 2HFTA 2OSLA 5MP6L 1JHLL 4Y2DC 2OYLA 3T0EC 2N59A 3WU1A 3NIGE 3O3BB 2WUCH 2WLKA 3PJSA 4DP7X 4N2CA 2O5XH 2AK1H 3QG7H 3KZ8A 1LO4L 1G94A 3MYJB 3QR1A 4DP0X 4NM4L 4M4RB 2NZ9D 4M8UA 2PABA 5FM8A 1A3RL 2WLNA 3W81A 4PJAB 1ZGLA 1I1RA 1UJ3A 2CXGA 4ETQB 1R9FA 1NBVL 5JO5A 1BIIA 2WXRA 3QZWB 3AREA 1D9KC 2BXZA 5M7QA 3A67H 1DJWA 1KGYE 6CGTA 4L3CA 3B2PA 2EZ0C 1T0MA 4YHLH 5F71A 3WEXB 4W4OA 2B59A 2GVYA 2P8LA 3SCMD 2MCG1 5B8CB 1EHKB 4M00A 3IDXH 2P7TB 1D5IH 2XFXB 3G6JB 4U1HB 5L88L 3GXTA 2AITA 3M7FB 3C6SB 3IU4H 5LKNA 3B2XA 1UWGL 1VSCA 4C56A 4XBGB 1NM4A 2GTZB 1QQDA 5K59F 3VI4B 1FNGB 5MERB 3EW3B 1XCTB 4U3SB 2AJSH 1KCSL 4XAKE 2MQGA 3GZPA 2GK0A 2WXHA 2ZUQB 3V0HA 1JD7A 1IEAB 3IF1A 3SDCA 4NNPL 1BQLL 4P2CG 1ED3A 1FZMA 4Y2DD 1BWWA 1UH4A 4OCXL 1IJ9A 3TX4A 1JGEB 2NR6A 2GAZA 3CH1A 1FNEA 1OAXH 3QUHA 3DO3A 4JPKH 4N1EA 2G2RA 4P2OA 3WEAA 5LGJA 3T6WA 1DVTA 3S36X 4Y7OC 3QDGA 4IRZA 2J6WA 1E8YA 2ESVE 4P5TD 4TLTA 4ELMA 4M1DH 2K4WA 2KQNA 4FERA 2BS9A 3NJHA 4WQOA 1MFUA 4JFFD 3LPGA 5DLMH 5K9QG 2FHCA 2VZSA 4J12A 4KHTL 2JB5H 4AMKH 2C9UA 3IFNH 4K7PX 2IGTA 2FT8A 4PREA 3CX5J 1CLZH 3LH8A 3DX7B 2CRYA 4ADIA 3VSUA 3SE3C 4WO4B 5IFAH 3GS4A 1KPRB 2FLRT 4FMVA 1FF5A 1KZYA 1AXSB 4CKQA 5AYQA 4X9YA 1ODUA 5L88H 1M6OB 2Z91A 4JHUA 4LQ1A 3D39E 4BH7A 4HIIA 3WIIL 3HN3A 1T66C 5J11B 2R56L 1PQZB 3B2UC 4CDHA 4YHYB 1G9MH 1Q1PA 3BKML 3NP4A 5K5YA 4U1JA 1U3ZA 3ARGD 2AP2A 5D71L 3IGUA 4ONHB 4QYOB 5CAYB 1FJ1A 4UQ3B 5I0DA 4D0DA 1ZHKA 4R9HA 4N24A 1QBMH 2JK5A 2WHVA 4MYWB 3EYQC 3KM1A 3GPEA 1K9TA 2F6AA 2XT1B 3IRCA 4HS8H 4KQ0A 3G5XB 4HPOH 2W9DH 2NR6C 1JL8A 5EOQL 4LEXH 4RSYA 2C5DC 1T4KB 4UT7L 3LZOA 1JERA 5C07A 1NZRA 3OVUB 1ZRUA 4LEOA 1P4IL 4XB3A 5DD5L 5T1DH 3RI5F 4ACTA 4A55A 3AFLA 1TCRA 1MJ7H 4LNRA 4X9IA 4D9LL 2M83A 1A1MB 1NEPA 2V9QA 4M7KL 4NRZA 3FT4A 4XHJD 1QWHA 4ALAC 3NCWA 4JFQA 4O51A 4QHMA 3WLWC 5C0RH 5C0DA 1UM6H 4BA0A 4WWKA 3ZDWA 4F8PA 2J1WA 1KENH 1RJYB 3OWRA 3PP4L 3P11H 3VD1A 4Z8FL 5T1KD 2R0WH 3KPRA 3EBHA 3PQYA 3SGEI 2JCCE 2DICA 4Z3EA 2BNRA 3GMOA 4QRQA 2A1WL 2YPLD 2EKJA 3N85L 2X89D 3T77A 4X8JB 1U93A 5JPNA 1LE5A 2GEEA 2WINA 3OMAB 3B5HA 1K8IB 4AVKA 4YDVB 3V4VH 2W9EL 2VDRB 1U8PB 1JS4A 1XIWA 3KJ4B 1J8SA 3BGFC 3Q01A 4FNUA 4PCKA 4U1MA 5F7EL 3UAJD 3FF7A 4GQ9H 5EBMB 4YXKL 4NYLB 1BSIA 3PS6A 3EOYG 5D1XA 4FZ8H 4NQVB 4BCXA 4UQBA 2OQJB 4KKBD 2J55A 3O2VH 4NRXB 3QQDB 2YK1H 4OCSH 4P2OD 2IPKB 1IM3D 3CC5A 4PEEA 3DJTA 2ZUYA 1MFMA 1FC1A 5D7LB 5HDBE 3RURA 5JO5B 3V9CA 4CUCA 2ZXEB 2YC1A 4Y89A 1IRAY 3DX8B 4JHZA 1BQKA 3C5ZA 5KG9B 4OZGE 1ZV9A 4PGCB 1DCEA 1WIPA 1Z9OA 3GDBA 5EMYA 2EVHA 1JG9A 4OFYA 1JN6A 4LLAA 5CJOH 2YGPA 2XACC 1PCSA 2GUOB 1W72L 2IWFA 1AR1D 1LO3H 5EUOB 2Q2LA 1GGIL 1L9QA 1Z1WA 4C47A 3O2WH 3ROLB 5T3XH 1IE5A 3FQRB 4GW5B 5FHAL 4G6JH 4GIPD 1F8TH 5K1VA 1ZS8A 1S7VB 3EGSB 4RFOH 5I5RA 5K69A 3L16A 3P4OA 4BELD 4E0RB 4X7TB 5C08D 1A6VH 5C8JB 1CURA 4GW4B 4XNQA 3MBEB 4M8QB 3SPHA 3ZKMD 1X5KA 1B4RA 4G8GB 2MH4A 4P23D 4P2RE 3STZB 5CLWA 5G55A 2QPUA 1G6VK 3EYFA 2BP0B 1ZS2A 4HW6A 4Y9BA 5EC2B 4XMTA 4Q6IA 4I4WB 2EDOA 4AVIA 1P5UA 3S88H 1YN6B 4JG9A 1F4AA 1QSEB 3RX9A 4RGNE 3ULSB 1XT5A 2DWXA 3K4AA 2YJLA 1ZLSH 4OI8A 4JGNA 1ROWA 4X4XA 2QMJA 4EI6A 1SDDB 3WUWA 5LWYH 4HKXB 4LF3A 1PG7H 1J8HD 3GI8H 3NCMA 3LN4A 2CLZB 1CCZA 2ZJSL 1XGTB 1NWPA 1YMMB 3CFCH 2IQ9L 3EH3B 5JDSB 1UWXH 3MRFB 3BZ5A 1OW0A 1D9KD 3LV3B 2X1XR 3OB8A 4XMKL 5HDBF 5INDA 2ID5A 3UC0L 4DAGH 4O2CA 3N6YA 3QEQA 4F20A 5AB9A 1BFVH 4FFYH 3RP1A 1FL5A 4CBPA 3DYPA 4PS4H 4KRPB 4PJ8B 4R83A 2VJ0A 4MXWL 5JUEL 1V05A 3FHAA 4MJ4A 3WDIA 1GS8A 2DM7A 3HAEH 1TVBA 4OD3H 5GRJL 3C08L 1HIML 4BK8A 4G7SB 4C56E 1IB5A 2DLHA 2QDVA 4Q9QL 1Z0NA 2DLFH 2G2NA 1HCZA 4LCWB 5DSCA 5KN5A 4LLQA 4PJDE 5F9JB 5DJ8B 5B1KA 3OKOB 1UVQA 4JPWL 1XR8A 2BP0A 4RQQA 5FOJA 1VGEL 1HKLH 4ZFFB 5CZRA 3RUGB 1NANI 4KRMB 3U6RA 4JCLA 4J3BA 4N25A 2WYHA 2H5UA 3FJTA 3KWTA 3BPOC 1WV7T 1UD4A 3T0VA 5C0AD 4I0KA 1WGVA 4CN1A 1R5WB 3TN0A 4MNQD 4ZMAT 3TIDB 1UKTA 3H9ZA 3BD3A 3KG5A 4YHIB 2D31A 1Y1UA 2DYPD 4MZRA 1HH6A 1NL0H 3CZKA 4OLVL 4AUYA 3SCMC 4P5RA 2VLKE 1BVKB 2BZ7A 1JPGA 2CK0L 3B5GA 3FO2A 4NN5B 1KYAA 4AENB 2W38A 3FXIC 3EYVB 5KVEE 5J3HD 3EJYD 1WFNA 4Q4IA 1C08A 4PY8J 2YKLL 1ORQB 3BH9B 1ZLUH 4UZSA 1E3ZA 4F9LA 5DD1L 3PL6A 3PWJA 1G6RA 1CS6A 2B77A 1FDLL 2VDKH 1ZLDA 1ASOA 3OQ3B 1RULL 1PTZA 5FO8A 1R17A 3DUUA 4RWYH 5FLUA 3H9HA 1FGNH 2CJUL 2M8XA 1ZGLM 1S7SA 3HMXL 2J1ZA 3FONB 5JHDA 4TVPH 1MY7A 3VYNA 3X1EA 2K8QA 1CICB 4YDMA 3TL5A 4I0PB 4AKPA 1K5NA 2P5WA 1THAA 5DD3L 5K39B 3QUXD 3EOAB 1CJYA 2B16A 1GMIA 2AKRB 2FIKB 3KNBA 4IIQC 4JDTL 2I25N 3WELA 3QXDA 5KTEL 4PCSA 1OT4A 3BPCB 3BP5B 4PRDB 5CO1A 5E9DD 5EFIB 5B1BB 3TEYA 4R4NC 3IDNA 3PWVB 3T77B 1GSKA 3U30C 4X83A 2WXLA 3V6BR 3IMRA 3SGJC 5CILH 2ARWA 2Z0UA 3HS0A 2DQEH 1ADQL 1A4AA 1KEML 4EI5D 3EYUH 3KGSA 2QHRH 3UG3A 3CFQA 3QJFB 5E8OB 2SODB 1NCNA 3IKKA 3N44B 5DD6B 2XTLA 4AYMC 2DLGA 4XP9H 5F97E 4HWEH 4J5VA 5IV2B 2BY3A 1NJ9A 3BRGC 4ZQKA 1MIEH 4FYTA 3SE8L 3CXDL 3F85A 3FU3A 2CLVA 4BBWA 1YA5A 2HLAA 1CXHA 2X70B 4ANKA 4DKAA 4WCYL 2J2ZB 4Z7AA 1ILSA 4BDVB 4KK8C 1HXYA 2O5YH 2W80C 1X9UA 3L2LA 3BAEH 3KPPA 5IHUL 5J6GB 1SHXA 32C2B 4NPYA 2DN7A 3D51A 4CGUB 5CEXA 1RIVH 5IF0A 3TJEL 2BNRE 2YEZB 4UDTA 4NLHA 2G0KA 3SZKC 4C83B 3T8VA 3D3VD 4S1DD 5I66B 1KELH 1G7IB 5B38G 3LH2H 2FTAA 1QSZA 4NQTA 3FS9A 5AOZA 4OLZH 2IANE 4NO2A 3WD5H 1URLA 4XOBA 1JZFA 3L81A 5LCVH 1J86A 4I5BA 1XEUA 4LU5L 2OFQA 2J88H 2PCFA 5D5MF 3RIAK 1MCEA 1AHMA 1KJ3H 2IADA 3GWJA 3DVNB 3MA7A 4F2MB 1AGBA 4UM9D 1DBJL 1CPUA 1PNCA 1ZDQA 1G4MA 4X9BA 1MJJA 1V55B 3O8XB 1AS8A 1VA9A 3I9GH 2NX5A 2RHEA 3E9UA 2A4ZA 1CE6A 4Y19D 2ADYA 2EKSA 4RAUB 4QXGH 1VKXA 1NC2A 2PXYA 4JRWA 3KDPB 3BAIA 3LN4B 5IB5B 1LLAA 4YHML 2ALAA 2WXGA 3ZIYA 4QRSB 2Z8WC 5I1KH 3FN0L 2AF2A 3RWGA 4G6JL 5DMYA 1LD9A 4ODVL 4B5ZA 4Z3FA 1YMHB 5CJBA 1YN6A 4V33A 3RFZB 2AJUH 1XH1A 3ZTNL 2XY2A 1IEBA 4Z7QF 3L7EB 1A0QL 2BK8A 3MXWH 3T8MA 1MRCL 3K2IA 5FYLD 4X5RA 3T0EE 3KBHE 3O4LD 2RA1A 3M88A 1PZ2A 5T3ZL 1WS8A 1IM9A 5J12B 3UTZA 2Q7AA 4H0IA 3U36B 3FUEA 4KGLA 3ILEA 4NZUL 5KSAC 3FB7A 5GIRB 1OGAD 3KPSB 3PNWA 3ZZQA 5HHPB 1PFCA 4N3TA 1J5OH 4Y5YA 4MKMA 3QFDB 4KKQA 4U1GB 2DQ6A 4WAFA 1P84J 1MNUL 1OP5H 2VISA 3HMXA 3HJEA 2ODHA 4OT1H 4BFBD 1A1NB 2FEJA 3BJ91 3GRWL 3NFSL 4Y1AB 4MTMA 1T2QL 3P9MA 5HVGB 4FNTA 3MNWB 5AKVA 1TQUA 3P3TA 5EF2A 1I9IL 3ULUD 3K8KA 4Z7WE 3BQUD 3B8SA 2AZAA 4N2BA 5F1NA 3W38A 3ZL1A 2I60H 4NQSB 2E75C 1B0GB 1MLBB 2R0ZL 3H56A 4LCCC 3IETB 3RG1C 1FSKB 2NY5C 3A22A 2WZ0A 4IRSB 4JFED 4ZUUB 3U83A 2BSSB 5C0RL 4R4BA 3FFCE 2W94A 3FQUB 5EU6A 4LEBA 4I0PA 3P2DA 1JV2A 1ITBB 1AGCA 4DP5X 4JQVC 3TVMD 3AJ7A 3R8QA 4Z77A 5DD5H 1TG8A 1A64A 4U1MB 3C8KA 1G0DA 4KY2A 2CSPA 3CDYA 3VGFA 4ZOCA 2ZWYA 2G3MA 3HW7A 5SWZA 2C26A 2E6JA 3ARFA 4B3VA 1E4XH 2C1PA 2X4QA 4XCFL 2Z92A 4IMKC 1PEWA 5CLZA 4IGBD 5CU9A 2VLJB 3SPJA 3PHQB 5DVLA 3N40F 3NGBB 1F90H 4HJGB 2WN3A 4C4BA 3HZMB 2W81C 4XOCA 3L5WA 4IRSA 5C3IA 1JI1A 5AB1A 1L9MA 3BD5A 3BVWA 4GQRA 3BEWB 2EILB 3MYZA 4JPIA 2HCZX 3X11B 3GB7B 3KLHC 3FT2B 1ID2A 5PAZA 2OA9A 1KTDB 3R7RA 4TTDC 5J57B 1U30A 4KQ4L 4WWKD 2MKLC 1DJYA 1C1EL 1DQVA 1Z9LA 3LZQA 1U2CA 2BOLA 2X4PB 4OAWB 3ENEA 2GI0A 4UTBA 3SOTA 1C5CL 3N5AA 4F37K 2VDNL 2JQZA 4JO4H 3JBG7 3NESA 1U36A 4XX1E 5KYXA 1J8RA 1RUKH 3FU6A 5HI3D 1BPVA 4DKEH 2LABA 4PJ5E 1C7TA 4KTYA 3BYYA 2W65B 3VWKC 1DQDH 1UUSA 5HHME 4G82A 5ISZA 4PY8I 1AR2A 2GC7C 2IAND 1KGUA 1WZMA 2W60B 3LJ3A 4Q74A 3RHWK 5E2JA 1XCXA 6PAZA 1EJOH 1L9SA 3DRQA 1JUFA 4WEBL 4NSKA 3I9AA 1UB6B 3KLDA 1HHIA 4KDTC 4J3OH 4LSUL 3CVHL 3FTSA 4NQDA 1VENA 4YXLH 4ZS7H 2HMIC 4NRYB 3ZSSA 2EE0A 1HI6A 3O41B 5FDWB 1JIBA 2UY7A 2J25A 3L45A 4E9XA 1MF2L 5B7FA 3ECWA 4TMPA 3CAFA 1MFDL 5ESAA 3OMNB 3DI2B 5C3LD 4KXZH 1XGTA 4EI5C 4PAZA 4BZ2H 4ECNA 2AJSL 1AFVH 2YQGA 4OJFL 2YGVA 4BRVA 3CG8A 2P5WD 3D0VA 9CGTA 1Z5HA 1KMGA 4OCMC 4CADA 2VITB 4WY7L 3O6FA 3OKEA 5L0QB 4NC2B 1RSFA 3D0LA 5HDRA 1QATA 2F1AA 3F00A 1KV7A 5CJ8A 3KLAB 5IB4A 1YEHH 4O2FA 1D5IL 4M93B 4LOUC 4P2OC 5DFAA 1DJZA 3FDWA 5C08A 1D9KA 3BT0A 2WNKA 1B2WL 5CJXA 2NW3B 3H9HB 2F15A 3PGFL 1IAKA 1VADB 3TT1L 2XYBA 4RISL 1S3RA 1A7RL 2O5ZL 4HZLA 2OMVA 2H8PA 4M9OA 3W0WD 4B9KC 1HZHH 2ZWNA 4NN7C 2QGEA 2Z8SA 4FG4A 3MLZH 4UQIM 4IBQA 2O5XL 1EAQA 5EUOA 5I74C 3A6BH 1CE1H 1ZEAH 4QJ3B 2FIRT 4R84A 2ICWA 3TIDA 1UGNA 2NCEA 3BPNB 4KMQA 3SDDA 3VRIA 4JPSA 1MWAB 1W8NA 1B6UA 1J0YA 1MQ8A 1XSOA 3ZOAA 5TF0A 3MFFA 1GAFL 2WIMA 4H8HA 4DOHE 3OPZH 4U1IB 4DGVL 4NERA 4W9IC 4QPEA 1CGSL 2UZYB 1IT9H 4MA3B 4K2UL 4J6RL 3I02A 2Z93A 3QNXB 4B60A 2IFFL 3D48R 3EF4A 4OKVB 4PG9A 4N8UA 4R90H 5I30H 4DESA 4XE5B 4XB8A 5C0BD 4BFIB 4P5MB 2OMUA 3ISWA 2L7UA 3PRZA 3TESA 4KKPA 4ENZA 3RPBA 4XR8C 2H0PA 3FQ4A 1OGPA 4XTRD 5FF6B 3WIHH 2KUTA 5FUCE 3CLEH 3NBNA 2VOTA 3PQYB 1ZTXE 4PMEA 3C8DA 1QG3A 3ZE2E 3CNKA 4YSSA 3MOAL 4HMDA 4PG9B 3K91A 4GAGL 4KU1A 5I5IA 4ZZKA 3ERXA 3DSNA 3VXSE 2VMDA 2CO7A 3EIFA 4M93C 1CD8A 4XNMB 1BHGA 5CWSA 4YMPA 4I3SH 1W8OA 1UACL 2A6DA 2VM9A 2B1HH 1FYTE 4NBYB 1E4XL 4FLOA 3KXFE 4LHUA 3KLLA 1XIWD 3W0WE 4KVNL 3HRZA 2UXVA 4O4YH 2ZWLT 4Y4FC 1TCMA 3JWNH 1MW2A 5F7MC 2R29A 4NCC1 4K94L 1NCWH 3IJEA 5DHDA 1XH2A 4ACPA 3FUNA 2I9LB 2R2HB 1QZ1A 3JT2A 1NOFA 4WEUD 2J8UF 3FHQA 4KK6C 4XMWA 5EA0L 5FYKE 1XF2B 1GTFA 1PW3A 4YSDA 4BFEA 5J0BA 2NY1C 2O1AA 4PVMA 3V0DA 3EDDA 3QPXL 5L4MA 1UWEH 3LS5L 4RCAA 3BIKB 4L8DA 1FL6B 1Z9SB 2GITB 3FSZA 2RAMA 2CALA 3OMZA 3VFNA 1PL3A 4BWTA 1JNLL 4P4KB 1R1CA 1WAAE 1SYSA 4RFEB 1T7ZA 1KJ2A 3ZHKA 4U0RB 1RMFH 3Q6FB 5IP4A 4FQJH 2CAKA 3I6LE 2VB5A 5F7LB 4E9WA 2GTZA 2QSCL 3APDA 4K55A 5EUOE 4NNYB 3NFSH 5EZPA 3L7EA 3WOVA 3I74A 4ICWA 4O2FB 1YEFH 2YRPA 1BG1A 5EPMB 4OZFH 3KLSA 4HT1L 1MFEH 3OR6A 4AYBA 1TQBB 3MCG1 4CNIB 1P5VA 3UTTE 1WCBA 1G43A 2WXFA 4X9FA 5GS1A 3QXVA 4HUCA 4N90D 1U95B 1YLBB 1KCWA 4FQIH 5E1AA 1SEQL 1SHWA 1SVZA 2WKOA 2V9UA 1WO2A 2V5MA 2CCVA 4NAQA 2PCPB 5LGJB 3GJFA 1WBXA 3TASA 2MWCA 3R0NA 3OJ2C 5C0CD 4BJLA 4MB4A 2VDNB 5CIPH 3OAWA 3GRBA 4FZEH 3DA0A 3HAEB 2ZZUT 4M8RA 1MHEB 2VSMB 1P7QB 2Z8RA 5AW1B 1RVFH 2WAHA 2ATPA 3FBKA 4RGOL 4NZ8A 3LKQB 2V4LA 3CPLB 4DKFL 1RZJC 5H35A 1N5AB 2AJVL 5FYKD 2FH8A 4OZGA 4POZD 3KPRB 3TZVA 1TQVA 3QAQA 1QFUH 4GUCA 1B4JH 3SGDI 2RACA 3CDCA 3IBEA 4U1NA 5JW5A 3V4UH 3MRKA 1FHGA 3QAZB 2JWYA 5H37H 3W56A 2VW4A 3IMSA 4LCYB 3ASNB 1KJ3L 4PQXA 2KQMA 4UOW0 5SWQA 3WFDH 3C60A 4BE6A 5IQ7H 3O45A 2DDQL 3GS7A 1T6BX 3I6KA 4JM2F 1IGCH 2ENJA 2H1PL 3D8MA 4HUWA 4JAMA 5DA4A 2H0EA 5GZOD 3QZWA 3ZLQC 1OGSA 3ILQD 3G5XA 3MLZL 1AY1L 2D3JA 3IDGA 4JY5H 5A2KH 2YPKB 1TYEB 3OL2A 1GGUA 5DEFA 2HT3D 3K6SA 1YEEH 2ZNXA 1YEDA 4LPVA 3VE0B 2CR3A 2K9UA 4N0CC 2YPVL 4BE5A 3D09A 1KPUB 1N67A 2QGDA 5KJRL 3C87A 4PJ5A 1ASPA 1AG0A 4U1JB 2R69H 4AEIL 3RB5A 3L3KA 2MRYA 4J39A 4PJHA 1VADA 4C4KT 1UH3A 4AK2A 2BIPA 4OM1H 5DVOA 4KUCD 2CIKB 1ZA3B 5GZNC 1AOHA 5JOEA 2F53D 1A2YB 4YHZH 3PP3K 1IQWH 4ALAL 3C6LB 3GHEL 4LSTH 3D85D 1YEGH 4L2LA 1AMXA 5E4EC 2GABA 3RWHA 3WL9B 4DCQB 1MH5A 4MDJA 1AG6A 1Q1JH 1XGUB 1H9DA 1LO5A 1P2CA 2SEBB 4QHNA 2VERA 4Y5XB 5ICXA 1NFIB 2CDEB 4NO0A 5LNGA 1ZGLP 4KROC 1FIGL 4OQ1A 1K8IA 1R5IB 2ZX7A 1H8OA 1DTUA 3LZRA 1TVHB 3CCHB 1U3HD 5IW6A 3MFFB 4EI0A 2XVLA 3TVMA 2YUVA 3BUIA 3N1FC 4PJXF 3RVWC 3MRMB 5GXBB 4GNKB 1MF2H 3SBWA 4CKVX 2VXVH 4ZTOL 4ZNEA 4UQ2A 4B9IA 3CX5K 3FUDA 3V4VB 2XWRA 4KKLC 2RTTA 4LDLB 4CW1A 3QCUH 5IROA 1YNLL 3T1FA 5C2BL 3BP6A 2PW1A 3HPJA 2ZOWA 7TAAA 4M1GL 4XCCH 4Y4KC 4QRRB 3VSQA 2AGJL 4NSKB 3ZTJG 5GZOA 5KJRH 4NPYB 3DRQB 4RWYL 1KBVA 3BZ4B 2PPCA 1EFXA 4OCYH 3BSZA 2L8AA 2H32A 4L4TA 2HN7A 3NFPB 4TQEL 3WDHA 4FLHA 1WBYB 1I8AA 4MNHA 2J2ZA 3AS0A 4MA1C 5FGBA 3ZL2A 4HJ0C 2H47C 2DQFA 4PJCB 2YA0A 3ZT5A 1F58L 4OFVA 4I88A 3ZDYB 4FC3E 4PR5B 1MHHB 3ZZ1A 2CO3A 3F6LA 4AV4A 2X4RB 3AG2B 1C5DA 1Z9MA 1N6UA 3FTGA 4JFDE 5GS0L 3SGKA 4GKSB 3VXQA 5DJCA 2QMKA 4PGEB 4GBXA 1T1XB 3DK2A 4WHDA 4XPFH 1QFUL 2AJXL 2JKTM 4ZMYA 2XV6B 2UZXA 2CHDA 5F96H 1QNZH 3WLBB 2NXYD 2V17H 4RGOH 3REVA 1MFNA 5ITBH 1WLHA 2DWDB 2IOOA 4HIHA 1QFWH 4JFXA 3HR5B 3DVNA 3WHXA 1SOXA 4AG4L 4PV8B 1HIMH 1B0IA 1F4XH 1PCXA 2FE0A 3ZDYF 4P2QD 2EC8A 1JVLA 3L3GB 4WV1B 3VGDA 4X7FC 2V2XB 1HHJB 4ZMXA 1I7ZB 4U6HB 3IFOB 4IHOA 5GGTH 3C8KB 4LMQE 4K0OA 5LN4A 4NUPA 4H0HB 3CE1A 3QNFA 4YVUA 5KBLA 3SYPA 3BDYL 2R0ZH 3TO4B 3DX9A 3HG1E 5GGUB 3F62A 3CSYA 5JQ6L 1CZ8L 1A8JH 1VFOA 1X7TA 2IPUK 4W68A 1IGIH 3LXAA 5DI8B 2VAAA 3H7BA 2VQTA 2X3BA 5KS9A 1UOLA 1F3JB 4LPTA 3WAKA 4KKRA 3D06A 2EDWA 1S7QA 1N59B 2HVJA 1WFUA 4NKMA 1F42A 4Z3GA 1AZCA 1U8NA 3P9MB 4MFHA 3MBED 4JM2A 4IBUA 1T20B 3WS3A 1C7SA 4U1HA 1RAMA 3CVCA 5TE4H 3U7YH 1J5OL 3BQVA 3MLSL 3GSNL 4U6YA 1KEGH 1HEHC 2GUOA 2YAFA 3ZIMA 4UIMB 1QUNA 4Y8DC 1OLLA 3NZ8B 2E7HA 3Q48A 3RL1A 3BPNC 3S3PA 3E9TA 2NX5E 2YD3A 1RZIA 5F9OH 3AREB 1I8MB 2ADGA 2AEQH 4UINL 1BZ9B 4M3KB 3R1GL 3ZTNH 1NBYA 1NCWL 2VDPL 4H8WC 2J6EL 2WB7A 3II2A 4CU8A 1K3IA 2NPLX 3FFDA 1G9MC 5IHZA 2MMXA 3CZSA 3ECBA 3ZDZB 2KC0A 1ORSA 3K72B 1G7HA 3MGAA 4L29B 4ONOA 1LO3L 3RVVD 5JMOC 3IJ7A 5DQ9B 4ZUUA 5F7DA 2B1HL 3BQUC 2AQRA 5K9JL 3FTXA 2TSBA 1LDPH 4UB0H 2V17L 1KG0B 1ZHNA 3GT6A 4I18C 4Y5VB 1BP3B 1FNFA 1J11A 3DXAE 5CZXC 1OWRM 2I07A 1BLNB 2NY1B 3NCEB 2ATAA 3JWNE 4Y4HB 3VFTB 3GXMA 4GMSL 3QWOB 4YK4C 4YWGL 2DAVA 2YK1L 4OCSL 4Z23A 4ZUTB 5FYLH 5DVNA 5HYSA 4PBWD 2D73A 3GMRA 1A1NA 3GSOB 3HFFA 3FO0H 2Q86B 5B4MD 2BW4A 5BV7C 1ZOXA 2HFGH 5EOCJ 1AIZA 2F74B 5GPRA 4YXKH 3VFVB 5L2JB 4QAWA 3E38A 3TZVC 4H1LG 4FQ1H 1ZLEA 5BXFB 2IADB 3PIQB 4F2MA 2OI9C 1S5HB 5EC2A 1XGYL 4U05A 1DQKA 3GXFA 2OSXA 3BO8A 3QHTC 1GGBL 4PRHA 3S4SG 3LRLA 5L2KD 3QIWA 4FKEA 5DWPA 1VFAB 3JWDL 2WPGA 1UT1A 4FG0A 1ZKAA 5CBEA 3HC4H 4XCEB 2PO6A 2FT6A 2UVFA 3MREB 4IBYA 4A6YL 3FNKA 3D18A 5IROC 2HJLA 2AMUA 2G60H 5EBWA 1Z9SA 1CMOA 4AQAA 2IH3B 4M43H 4ONHA 4PJHE 2ETWA 3CVIH 2N3JA 4TVUA 3C6SA 3BP6B 5C9KA 1L0QA 3LAFA 2X4PA 4OAWA 4ZOBA 3QJOA 1P69B 3MLPA 3SKNA 3I6GB 3HE7D 5IHLB 2BRQA 3CZUB 1G7HB 3UTPD 3R8BB 3C5ZC 2AEWA 4WTQA 4FTVE 1SXBA 2WTOA 4Z9KB 4QLWA 1FO0L 4G59C 5IVXB 5A43C 4X5WA 4B27A 4XHQA 2IAMD 3CVDA 3FUFA 1H15B 2WQUA 3FU0A 4GP4B 4WJ5B 4PUBL 5C0AB 3DOSB 2PLTA 4M5TA 5JTWA 1UJ3B 3IDYB 4E42A 1T03L 3UAEA 5DS2A 2Z7YA 3S8FB 2JCCB 4ZPVA 1T4WA 2F53A 2NT1A 2WMPB 1YHPA 3BKMH 4WKZB 5I6XC 4GSUA 3RL2B 4PN6A 2CO6A 4O5LH 1W80A 4DF9A 5AB2A 4XMXA 3B4NA 3GXDA 1X5HA 3KGTA 3VAEA 2ZXAA 1RY7B 2ZOTA 2P49B 4GI9A 3NA9H 5D1QE 5GZND 5F7NC 1FFQA 4KJYB 2H3XC 3FQNA 3KPQB 1KSRA 1MJ8H 3IDJA 1O9WA 1NIDA 1RHHA 3EHBC 4TRPH 5DHYA 2MQCA 4A7TA 3C5SB 4ELKB 1NANH 3IAQA 2E47A 5FCUH 4Q97A 1XZ0A 1GYWA 4Q2ZB 1EO8L 3AM8A 4MQ7B 1A6ZA 4PB0L 1K6QH 3HG5A 4CJ1A 1S7TB 1MQKH 4R2GD 43CAB 4P04A 2A3TA 5DVKA 1KB5A 1USQA 3NIDF 4E0RA 3NN8A 4F5CA 2VDOH 2R8SH 3M6DA 1WE5A 4XVSL 5E8DH 1IGCL 5TGBA 3A6CL 4JCWA 4CBZA 1W72A 4NOFA 5GGSA 4QIRA 5JPMB 5IQ7L 3O3EB 4LCCB 2Y36L 1NAMH 2NZ9C 4AEFA 3TF7C 1BQLH 2YN5A 3BOVA 4J4PC 2YXMA 3WJMA 3UYRL 4PRBB 1HC1A 1RIHL 1ZT1A 2GW5A 3ARQA 5HHPA 5I24A 1AZNA 2F53B 1JD9A 5CUSL 3EYSL 1FCGA 4PVLA 2EDLA 1T6WA 3O81A 2X9YA 5AVTB 3TNNB 3KPMA 3MUGA 4WWNA 3PWVA 3SKMA 4BCZA 5F1KC 5C7XH 5F72S 5B1AB 2D3LA 3RBGA 5E1QA 3ULVH 1FZJA 4YVNA 1P7HL 3HZVB 4AYID 1CF8L 2XNAA 1G7MB 5F1SA 1SMOA 4E9QA 4DN4H 4MS6A 2YD9A 3S36L 3QDGE 2YHGA 3QFJB 5JUEH 2PYFA 3SBRA 3C75A 5CSZB 3B2UD 2FQEA 5F7WC 1BX2B 1VPOH 1L6PA 1KZQA 1BFVL 3BWAB 1ZHBB 1G6RB 4IEFB 1MEXH 3ASOB 3IKCB 4PU2A 5ICUA 5E1HB 2IQ9H 1YNTA 1FNAA 3GLAA 2XN9D 5D2LF 4MVBC 5C0AE 5INDB 4KUZL 1U0QA 2A5UA 4YBQC 1IC5L 1FNEB 4Z1PA 2NXYC 4YE4L 1Z2KA 3B3BA 3V6OE 2EDKA 1WT5C 1AANA 3V5KB 1KTLA 3PV7A 3MJ6A 4ZTEA 3UTSD 2P8PB 3NCXA 4XODA 5MP6H 4EN3C 4OF7A 1BCIA 4E41E 1LJMA 4P3DB 1K4CA 4O2EB 3MRHB 1R0AL 3OHMB 5HYJA 3S88L 3AVEA 1RMFL 1QZNA 3IN2A 5JPMC 1EPFA 2MTPA 3C5JB 4C56D 2VLRD 1AC6A 5FKPA 1W8EA 5C70A 2VNCA 1IQDA 5KW9L 3BI9X 3LRGA 4QRPD 1U91A 5IWLA 4UDTB 4LLUA 5AW5B 3IRZA 4DZ8A 1NICA 3KH3A 1ZSDB 4PJBA 3CHQA 1IBDA 3U6XS 4PJ9B 4UYPA 1JZHA 1OE3A 4OT1L 1UXMA 1NGQH 3QXAA 4FXKB 4APXA 2XIDA 3JTSB 4L3CB 5JA9A 3WMPA 3A23A 3SDYL 1KJVB 1KGCE 2WXIA 3ILQC 3SD5A 3GB7A 4HA1A 2JB6B 4OZFG 5IFHL 1GGIH 4M61A 1QRNB 4S1SL 3VQLA 1I8KB 3WKPA 4H1LA 4PLKC 2ICEB 1FAKT 4Z3TA 5T5NF 3S6CA 2RMNA 4KDTA 5E2TL 5DVMA 1W0YT 3G6DL 1KLUB 1WBZB 1D5ZA 3UBGA 1A0QH 3AG3B 3EOTH 3I6LD 3MOAH 1T20A 1KIRB 4HJIA 3DYOA 4WNSA 1F11B 2DI7A 4MZ3A 3K8LA 5E95B 5AW2B 5FYKU 2A6KB 4Z7UA 3DTXB 3GIVB 1DVZA 2WLHA 4Y16C 4N5EC 3QEHB 1HWHB 3QUZB 2GK2A 3ZRFC 1IAIL 1PD6A 2W9EH 3QEUB 2BP8A