4ICWA

N-terminal c2 domain of human cep120
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
130
Chain Sequence
b'DQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrosomal protein of 120 kDa
molecule tags Transport protein
source organism Homo sapiens
publication title N-terminal C2 domain tandem of human CEP120 shows lipid binding properties
rcsb
total genus 24
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4icwA00
3QR0A 2DMGA 3F01A 4ICXA 1DQVA 3JZYA 4KZCA 3L17A 1DJWA 4JPSA 4NS0A 3B7YA 1DJZA 3FDWA 3TJPA 4ANWA 4F92B 1BDYA 3QARA 2CJTA 4AOFA 5EDSA 3APDA 2QZ5A 2CM5A 4IHBA 2RD0A 2WXIA 2Y3AA 2FK9A 2B3RA 2A5UA 2FJUB 2NSQA 3QR1A 3HN8A 5H4ZA 2NCEA 3P2BA 1E8ZA 3T8MA 2CHWA 2X38A 4L2YA 3M7FB 1BYNA 4F91B 4FADA 1WFJA 3ML8A 5CCJA 5T8IA 4F1SA 5G55A 2K8MA 4EZLA 2K4AA 1DJHA 3FBKA 3R7QA 1E8YA 4HVBA 2WXQA 4XZ4A 1DSYA 3ZIMA 4DK5A 4Y1TA 3SD5A 2Q0ZX 3HIZA 3S2AA 4ANVA 4XX5A 2WXNA 5G2NA 3F04A 1CJYA 4ANUA 4FJZA 1UGKA 3ENEA 4OVUA 4NPJA 3W57A 4L23A 3KWUA 2JQZA 4L1BA 3TL5A 4FA6A 3N5AA 4BGDA 2WXMA 3DPDA 1RSYA 2YOAA 3PRZA 4WWNA 2Z0UA 1E8XA 2R83A 3IBEA 4QJ3B 2WXPA 3PREA 2QZQA 4DNLA 4MJJA 3QAQA 4NP9A 1K5WA 1YRKA 3L13A 4FJYA 2ISDA 4A55A 2N1TE 2ENPA 4ICWA 4GNKB 3MJWA 4WWOA 5JHBA 2NQ3A 3KWTA 1QATA 3RDJA 4IQHA 3L4CA 3LJ3A 1BCIA 4BFRA 2LHAA 4LCVA 4FHJA 3PS6A 3CSTA 4L1LA 3APFA 4LT7A 4ANXA 2UZPA 5H4YA 3ZVVA 4TV3A 4KITB 2DMHA 4G11A 3L54A 4XE0A 3QK0A 1W16A 2CJSA 2WXOA 4GB9A 4FHKA 2BWQA 4WEEA 4QJ5B 1E7UA 3NZUA 2WXKA 4AJWA 3NSJA 4Y1SA 1GMIA 2D8KA 3L16A 1A25A 4PS7A 3APCA 2WXJA 1TJMA 1QASA 2CM6A 2ENQA 2K3HA 3HHMA 2V4LA 3GPEA 4HLEA 2WXFA 4WWPA 3QJZA 5CCGE 4QAMB 3ZW3A 3IM1A 4QJ4B 1UOVA 2WXGA 1RLWA 4WAFA 4F93B 4URKA 3R7RA 5CCHE 3L9BA 1E7VA 3PFQA 2WXLA 1E8WA 1E90A 3L08A 4V11A 3TWYA 1HE8A 3OHMB 2WXHA 4KZ0A 4J6IA 1DJYA 2EP6A 2A4ZA 2CHDA 3CSFA 3PYCA 4TUUA 3F00A 5JHAA 4TS6A 3W56A 1DJGA 2CHXA 3NZSA 3RPBA 4OVVA 3ML9A 1UOWA 4LDCA 1TJXA 2WXRA 2ZKMX 4FLHA 4PS3A 5KJ7E 1DJXA 1V27A 1DJIA 2Q3XA 1RH8A 3F05A 2KI6A 2K45A 2CHZA 4EZKA 4FULA 2ENJA 1WFMA 4PS8A 4NPKA 1W15A 3OAWA 3DBSA 2YRBA 4EZJA
chains in the Genus database with same CATH superfamily
1U8MA 3QR0A 5I8CB 4JM2C 1UFGA 5KTEL 4YHLH 1FO0B 4M7KH 5EU5A 3N44B 4N2MA 3L3DA 2CDFB 3RUGE 1JHLL 3BSGA 3BP6B 2ZCLH 1U8NB 2GJZA 1E0OB 2Z31B 3R19A 5T3ZL 1J1XL 5JXED 4QCIB 1J87A 43C9B 3N40F 3I6LE 1YY8B 3FT1A 4TKWA 3L7FB 4O02B 3LN9A 2P5PA 4HUWB 4I0CC 5E7FA 5B7FA 2EC8A 1E8YA 1UVQA 4L5FL 3S36L 2W9DH 5F9AC 1RPUA 1NBZB 2QKSA 3VM7A 3OVUB 1FIGL 4G8FB 3FT4A 3QUXC 4ECNA 5DHXB 1UTDA 2H2SD 1DZ0A 4NPJA 1A14L 1TQVA 3US9A 4HS8L 5LNGA 3UYRL 4XAKD 4KKZA 2WXMA 1D7FA 3QISA 2AXGB 4P9MH 4AVKA 5IMOB 2OCCB 3VTTA 4XPHH 2VR7A 3EGXB 4E5XB 5DT1L 4PLJC 3QJVB 4P4KB 4OD3H 1T1YB 4TSAH 2BP8B 3LN5B 5ETUB 1S6NA 3RAJH 4L3FA 3T0AA 2A74B 1ZT1A 4K3EH 4LASL 4S1RH 1KG0B 2X4TA 5IVXE 2YPLD 1G9NH 3K46A 4TSBH 2QV2A 5D4QA 5JOFB 3MTXA 4GH7B 5F1IB 4U3XA 1MN4A 1QHOA 4XZUB 1ZHLA 1NOAA 1EFXD 1MJ7H 3LKOA 5D93B 1FFNB 3GC3A 1YNLL 2C26A 3EBGA 4TTDD 4XXDA 1L9QA 2R27A 4HXBL 3ZDXE 1LO5B 1B9ZA 4BRVA 2F8IA 1GC1C 1S7RB 3UAJA 2X05A 4D0BB 2APFA 2D3NA 2X1OA 4XP1H 3UG5A 1GZHA 3DX2A 4JDTL 1IEAA 4TQ8A 5J1TC 1N70A 4WVRA 3GI8H 4HJJL 1KJVB 3UFIA 1I1AA 1S7XB 5K59F 2ESVB 1DN0A 4JKPL 1KBGL 1P9MA 2QMJA 3TT1H 2LU4A 4DSYA 3UAAA 1CLOH 3N1QC 4JO1H 5IK3A 2ZUQB 3JTTB 3MRIA 5IEHA 1TJGL 1P5VB 2I27N 1BVKB 1X9RA 4P57A 5HHNA 3C60C 1MCKA 1JXGA 4QR7A 3O11B 3L2NA 4R3SB 3VM5A 2F19H 3ZE0E 4NERA 2OCFD 1LD9A 2DD8H 3QQ9D 2QHRH 1INQB 2GC4C 3C09B 1QNIA 2QDVA 4HU2A 1FL5A 1KBKA 1CE1L 1MCIA 2JCCA 3L4TA 2BVPA 5TQ0H 3O6MH 5D4IA 3CX5K 1JF1A 2ADFH 2JJTA 4MA7H 3V8OA 5BZDA 4KUZH 1DJWA 2PTTB 3LPGA 2P44B 5TGBB 1LO4H 4R96A 2AJSH 5DVKA 4ANWA 5CR1A 1PYWA 4QF1A 4EQ2A 5L2JB 5DD0H 3OAUL 2B16A 2M8XA 4UIKL 1T0NA 5J3HC 2NXYC 5E9DA 3UP6A 3ZGHA 2WLIB 5EZJA 1CQYA 1HXMA 5LO7A 4QYOA 1JI1A 1J1OL 2PF6A 1F4YL 4PS4H 4IOIB 1FRGH 3MGOB 4MD0B 4NFDA 4XCYA 2NQCA 5EHFA 5ESVA 3VXSE 3MLUH 4NO5B 5CS7A 1ADQA 4GBXB 4UZSA 5IHHA 1YUHA 5KS9F 2Q20A 1F90H 1TZHA 3AWEA 4M6AA 3VXSD 2BOBB 2AJYH 2LTQB 3B3BA 4PJEA 4J8RA 2GI7A 3PDOA 5I75B 1T0MB 3ZRSA 5ABZA 4JO1L 5AAMA 3WMPA 4ANUA 1QBLH 2DWEA 3EJTA 4HBCH 3FOLB 1OM3L 3K71A 4ZPTA 4R7NA 4WHYH 2NX5D 3NN8B 1MPAH 1LTXA 5IB2A 1Z9NA 4IU3B 3RPIA 3ZMNA 3VNYA 5I30H 2WB7A 4JLRA 4O4YL 2A9AA 3NEXA 3ZZLA 2VITB 2P8MB 2WXPA 5D1XE 1GXEA 4RDQG 2HLEB 1PY4A 2RA1A 4K23H 2D31A 3CSPA 4ZUUB 5IJCC 1AQ8A 4WUKL 4LSRH 5JXAL 3AG4B 3TBVA 5B22A 3RA7L 4AMWA 1XF4A 3Q2WA 3QZLA 1OSZB 1PF3A 2VAAA 1AIFB 4U1IA 2EE2A 2VMDA 2VXUH 4QYAA 1SRDA 2F7QA 5IROD 4BUQA 2V7NB 1LYQA 1QRNE 2MEJB 4EDWH 3BUIA 5I1KL 3CLFL 2WKGA 4OJAA 1WFTA 3QUZB 2AJZB 3G3LA 4OF6A 1HSBA 1NBQA 2HPTA 1ZKAA 4RFOL 3NRFA 4NQED 4TYUA 1XAUA 5AOIA 1WD9A 1DUYB 4CC4A 3D3VE 2B08A 5KSVB 3AW5A 4PJ9B 1X5XA 4XC3L 4OT1H 1E5CA 1ORSA 3O3EB 4JKKA 4WFGE 3KJ6L 1I7UB 2DTSA 4NC1E 5FECA 2M26A 3D4CA 2VO5A 3KLAA 4N1CA 4P48A 2VLJE 4JG5A 2MNJB 1EH9A 3Q5YA 1RJCA 5C70A 4P3WA 3DXAB 1R3LA 2O5XL 4NO3B 4ETYA 2R0KL 3B4NA 3GZOA 5HI3D 5DMJB 2AEQL 3UADA 3X17A 1ZJAA 3W11C 2X4NA 4UWQB 5FOJA 4KTDH 1FYTE 1CE6B 1MCWW 2KC0A 2X4UB 3ABZA 3T0VA 3ZXAC 4S0HA 4HH8A 1YNTB 1HAWA 4Q9QH 4M5SA 3S4SB 4M1GL 2I7SA 3QUMB 4Y4FD 5HDWA 2B3IA 1NGZA 3IJ7A 4JFEA 2GFBB 3HVDA 4P05A 4U7MA 1WT5A 3VXRD 1K3ZA 3FO9A 4K8RD 4XBPB 3U0TB 1MHHA 2WMPA 4X6EB 1A7QL 2FTAA 3CHPA 2JVUA 2FO4B 4P5TC 3H9HA 3UX9B 1QFOA 2Q5BA 4IBYA 4AEHH 3MRPA 5FYJH 5FO2A 4K73A 4DQAA 5BVPL 5HHXL 4HUWA 1IAIL 4HPOL 4X8JB 5GZOA 5I9QC 2WXIA 4PWGA 3JVGC 4GSQA 4XMLH 2GSIA 3QXDB 1SF5A 1KPRB 1NC4D 2XN9A 2PCFB 3MFGB 1Z7JA 3N85L 4MJID 1FGVH 2C5DC 4N0CD 4RWYH 5D7JC 1XF5B 5L0QC 3X1NA 5JUEL 3MN8A 1QFWL 2NY1C 3TEZA 2YPKB 3ECVA 2R51A 1MCDA 4YHYC 1OXYA 1NIEA 2UVFA 3UAJC 4P5TB 4HZAA 1ZA3B 3WI9A 5BO0D 1NCWL 2BP8A 3LN5A 2OTPA 5GS0C 3N5AA 3S3CB 3MRGA 3I6SA 3HA0A 1I1AC 5GGQL 1N8OE 3QNZB 1XR9B 3HHRB 1I9EA 4FXGC 2R39A 1IEBB 2A1WL 3IAPA 2J71A 2W07A 4KKRA 4IOSD 5F9OH 4DNLA 1UGNA 1WGOA 1JZ7A 3ZUNC 3I9GL 1TO5A 3TPKA 2DQMA 3KLLA 1JCKA 4U1KB 4MZ2A 4PJIE 2VR4A 4N85A 4KHTL 2E9WA 4Y7MA 3SB3A 1M71B 3FB7B 3IXTA 2DQDL 1BIIA 2JV6A 5KSBF 3VXPB 3I02A 1BMZA 1ZLVK 4X6CE 1QLFB 4YIQB 3I6GA 3EKCA 4Y7OC 3QO0A 1CBVH 2EE9A 2R15A 5F7DB 3UJJL 4O2EB 2HCZX 3U4BH 3BEVB 5D1XC 2OMTB 1ES0B 3KH3A 3FUMA 1AP2B 1DJSA 1SQMA 2VXQA 3QIUC 3L7EA 3UTPE 1QNZL 1U3NA 3D25A 4UOZA 5LXGH 5JHMA 4QLWA 1JNLH 2VUYA 3SBRA 5F72S 5DJAB 2JCWA 1YMHA 3MI6A 5FKPA 1Q8MA 4K5NA 3VGFA 4LCIL 4MD5A 2D3LA 4Q9CA 3RTQC 3O11A 3CZSA 1NLBH 1T2JA 5D7HA 4UT6A 3ZU8A 5I17A 2B39A 1I1YA 4FNQA 4G6MH 1OHZA 1BVNT 2EICA 3H85A 1LJMA 1UQSA 2QQQA 1QSFA 5DMIL 4Z7QE 5TTRA 4Z7QF 1MIML 1QSED 3OKDA 4LF3A 4M02A 5TH2B 2GABA 3V95A 2KI6A 3VFTB 4LB8A 2VW6A 4HEMA 4OQTA 3ARFA 9CGTA 1ET5A 3LYRA 5CZXD 4BKLA 2K8QA 1KJMB 2PW2A 3HE6D 4MA7L 1Q9WA 4UUJA 5KYWB 3VI4E 4UAHA 1R4XA 1PLBA 3NEEA 4ZTOH 1AZRA 3VFPB 2W1NA 1LWRA 2W0KA 3CFKB 4LGSB 1OAUH 1YUHB 4KMTH 2OYPA 3OKMB 3QRGH 3PJNA 5HDBE 3LRHA 3UTZB 3ESVF 2X70B 1FVEA 1NGXB 1SLVA 2HLFD 1NCIA 3AXLB 3LHAA 3EFDL 2FB4H 1ZD6A 5ANHA 4FADA 3NN8A 3QA3B 2F1AA 2KPNA 3NCJH 5GGVY 4BCZA 4RFNB 4E0RB 1DJHA 1I4FA 3KW8A 4XOBA 3K5RA 3A6BH 2H1XA 3QHFL 3VXUB 43CAB 3S96B 3C6LC 3BGFC 2XOTA 3P4NB 3DOIA 1F3DH 4B9GA 1OSZA 1H8NA 2FDBP 2OSWA 1K72A 3ROLA 3SY0A 3V4VL 3WLWD 3WFZA 4HFWB 3MR9B 4UQ3B 3TWCH 5H94A 4ENZA 3SOBL 5CSZB 3BKCH 3U79A 3D2TA 2Z7UA 3C08H 3II2A 4IMLA 3EOBA 5HDRA 3QUZA 2WOYA 5JDJA 5LGHH 2OR7A 3AY4A 5KVGL 5D7KE 4QJ5B 1IM3D 1QPXA 2UXVA 2XBZA 2E27H 5FGSA 3VXOB 4BZ2A 1WRFA 3QG7L 4H25B 4X8GA 1OSPH 4HS8H 3LEXA 5F70A 4OZFA 5IVOA 5BRPA 3QXWA 1I8LC 1FYTB 2EDNA 2ZJSL 4O5LH 3RKPA 4Y2OA 3Q13A 4AC4A 3D1MC 3MDJA 4FQIL 3TA3C 4J6RH 3GFUA 2WLJA 3CFCL 3PQYE 1BEXA 3WJLA 2LT9A 4WO4D 3D05A 5C0AA 1JWSB 2XIBA 2BFGA 3D85D 4MJ4A 2ZUUA 3FO0H 1CE6A 2ZUYA 5DQDH 3FQ2A 1ZDQA 4ONFL 3RBGA 1RUQH 1D2PA 2YAOA 1QG3A 1DVYA 2EDYA 3MV8E 3N0PB 4F8OA 1QAWA 2PXYC 4QTIL 3OXSA 5ESQA 2VZSA 4JFVA 5HSFA 4JO2H 3HMXH 1KYOK 3IDJA 1MHHB 4G43A 1QRNA 2ETWA 1HZLA 4IRSD 4WW2C 1I9IH 2YA0A 2B59A 3FRUB 3L4WA 4W9DC 3T3ME 4TQPA 5K39B 4JJHA 4QRRA 3HC4L 4LEEA 3V6BR 3N1FC 5KYYB 3NRQA 4HV8A 4YC2C 2A4CA 4YBHA 1D5MB 1QO3A 1DFBH 5CCKL 4PJFE 4Y9BA 1Q9LB 4HF5H 1HEJC 4AITA 1X7QB 5AALA 1DLFH 4LU5H 1YN7B 1ZT4A 3DBXA 1OLLA 4KMLB 4JPSA 1M2VB 3I50L 2CO1A 3GK8L 1X5IA 4N8CL 5AYUH 5FDWA 2X4SA 3DX6B 4IDLA 1DSFL 2IOOA 2F9BT 5KSBA 1HIMH 2VN4A 2Y5TA 3II3A 3BISA 1NGYB 1FZJB 4G8GE 2J6EA 1OP3H 4DOHB 2PWDA 3SDYH 4Y9GA 2PR9A 3LIZA 5T1LB 5B3SB 2YN5A 5KVMC 5HVGB 4M5TA 3L81A 3PXLA 1FAIL 2GB2A 1XR9A 1CI5A 4ANVA 1AZCA 2PW1A 2ZNXA 3HAEG 4L37A 25C8H 3JZ7A 3E6HA 2WSKA 1WPCA 5FA3A 4P59L 4G9FB 2Y06H 3CFBB 4U1KA 3V6OC 1XF2A 1ZIAA 2IJ0C 3WTWA 2LABA 3GINA 1AE6H 4NI3A 2B4CL 4W1TA 4AJ0A 2OTUA 3OJDB 3MNWA 4M7LH 1P7QD 4MA8L 1RFDL 4JLRB 4PSRA 2K6WA 4LVHB 1HILB 2DB8A 3MJWA 3N42B 3PGFH 2J1KA 1IMHC 2WY3B 1NIBA 1U3ZA 3HI5H 2DZEA 2K7QA 3IRZA 3FQYA 5LGYA 3BI9X 3L7EB 1BLNB 1GL4B 2DQDH 3D25B 5DEFA 4G70B 2BP5M 3NIFB 5DRNA 1NFIB 3K2UH 4FQ1H 4QHKI 1R24A 3Q5OA 4Y1SA 4ZSOB 5ILTH 3FOMA 5B3NA 3PWVA 2CK2A 1QEXA 4MD4B 1BF2A 2YMTA 2CM6A 3R1GL 3EDKA 2A9BA 2WUBH 1MWAA 4GUPA 2EC9U 3SDXE 1UQSB 4AW4A 2FLMA 4I87A 5K9JH 2JJWA 5F71A 1UB5B 5DQ9B 3QP3A 4GFTB 5D7LD 2XVBA 4BWWA 4IW4C 1P5UC 2YGQA 1OEZW 1TZIA 5DLML 5I1KH 1NSNL 2FT7A 1P2CB 5IHBA 2PW2B 1XXDC 2XA8L 3SPVB 1EAOA 4Z9KB 4M7LT 3O2VH 5AAPA 5I18H 1IKOP 3ZRFC 3MACH 4AL8H 2H6UA 4N0YH 3PGFL 4FABH 4TNGA 4LIQE 5T1JA 3ETBF 4OCSH 4FI6A 2GFBA 5DFVC 4ZFGL 3VI3F 4XBPA 3T6QC 1N0LA 5EEZA 5F88B 3L1EA 4ACPA 5CCKH 5F89A 3C6SA 3QA3A 2ITCB 1HH6B 1L9MA 1I8IA 4IHBA 5IUCA 3D4GA 2V2XB 3QJFA 4OGQC 1OGTA 4X8JA 4NPYB 2IGFL 1Q0XL 4N1HB 1YEFL 1U3HC 4CC4C 1FZKB 2YWYA 4R7XA 4X9IA 3MRMB 3FHQA 4JQXC 4BKTC 2C9VA 2KL6A 1NBYB 1FYHB 1N68A 1S7VA 4JFHE 5D9SA 4JHWL 5ACMA 4HFWA 5CBAB 3L5XH 4I85A 2B15A 1IARB 1ID2A 1HQRB 3IJYA 4KXZI 2IEPA 2WO2B 3KL5A 4O2CA 3KPMA 3WNIA 3LAFA 2BWDA 3KYOB 2LAAA 3FB5B 2BX5A 2BIPA 4NN5C 3MLXH 4Q14A 4UTAA 4A04A 1MNUH 2QVFB 1WT5C 1RQ5A 4P23D 4X7EC 1BCIA 3KLHC 4FHJA 1OHQA 2APSA 5C6PB 7PCYA 1UB6A 2YUWA 2DQIL 3BAIA 1ZHNB 2L04A 2K70A 4BFIA 2XWJB 4G8AC 4ZO7A 4BXSV 3OAYH 4A66A 3G04B 5ITBL 1BIIB 2UWEF 5C3TA 4JANA 4WHCA 3MREB 4F33A 4OCMC 5GGSA 3QO0B 4DN3H 1S7UB 3E8UL 5KVEH 3WIIL 2ZUSA 4OZFG 3FFDA 3HMWH 1IAKB 1I7RA 3BP4B 3GLAA 3HFFA 2J55A 2X6UA 4PJDB 1AP2A 1QHQA 3TU6A 3KM2A 3UEQA 5TF1H 3RWDA 5D1ZI 1UOVA 4LBEA 4WAFA 1CVRA 2VR6A 3L9BA 1BM7A 2J2ZA 1J5OH 1PKQA 2WN2A 3O3DB 4YE4L 2TSAA 1D3CA 4J6IA 4FQLH 1KXTA 3C5JB 3W56A 2NPLX 3U9PL 4WI3A 3HCVA 3RWHA 6PAZA 1AYRA 5DJ0B 3QEHB 4DUVA 3NSXA 3UAEA 3DOSA 5A2LH 3DUHA 3MLXL 4PJDE 1FRGL 1O7DE 1WIPA 1TMQA 2NY6B 2ZG1A 1DFBL 3F2LA 2YR3A 2P7TB 4IRSB 2MPAH 1S78D 5EZIL 2A6DA 3VXUE 3K2IA 4NJ9H 3N06B 4OGAC 4Q89A 2VZ3A 4LL4A 1XB8A 2XYBA 5D2LB 5FYLD 4M00A 1MCWM 5F7BA 3BAXA 3H9SE 5JHLL 3MLTA 4WHTB 3GBNH 12E8L 1UYWL 4UBDD 5CZVH 4NKMB 1QTSA 1TNNA 3BHBA 2WBWB 2V9TA 2WYTA 4LK4A 4XBEL 5HYSB 4PTUB 2F54B 5C0JA 4LSSL 1TENA 1IM3B 1KYAA 2WCSA 3KLHD 3C5ZC 5IM7A 3DPBB 5HJGA 2VC2H 1KB9J 2Z92A 3JQOB 4X6DE 5CCJA 5L88L 1AGDA 4YXKL 5GZNC 1EFXA 4W9KC 5CINH 2DF3A 2EDEA 2DLFH 2QBWA 1YYML 3TBTB 3QT2A 4L29A 2BO0A 4I1RA 3FU7B 1AO7A 4E0RA 1NC4B 3NCBB 5D5ME 3W38A 4J28A 2R1YB 4A7QA 2AV1B 2QR0A 3EGSB 3ERXA 3FUEA 4OCWL 1DQDH 2A9CA 1OAUL 1PSKH 2ZWNA 2BFVL 3P0YL 1FH5H 5BXFA 2OW7A 2FVNA 4KDWA 2D0HA 5GS0H 1JGDA 1VEPA 1Z0MA 2QZQA 5F9WB 1XGPA 2IGTA 3LKPA 4PRPE 3RNQA 3RY6C 2CAKA 3VFNB 3W9DB 3HNVL 4Y1AD 1U93B 2Q87A 3WEBA 4NRYA 4AL8C 2VRKA 3QDMD 1F4WH 2VDLL 3T2PA 2GJ6A 2UX6A 4G9DB 4Z7AA 5DD1L 1MLCA 1MWAB 1KN4L 5I6LA 2AEPL 2XDHA 1LMKA 4OLEA 5HJDA 4TL5A 1TYJA 2D8KA 3FL7A 3LXUX 1X5LA 2XZAL 3R1GH 4X5RA 3FFOA 3OGCA 3MRQB 3PL6D 1IQDB 2GK2A 4YHKL 4MA1C 1UCBL 2BIIA 5DJXA 5EORH 5FUZL 4GKSA 4L18A 1MVFA 3F5WB 3KPRE 2I9TB 5DZOA 5GGRB 3JWOC 3G5ZB 5C0BD 4X5XB 2IWGA 2WXHA 3TN0B 1N3NB 2YEVB 1FYTD 3N41B 4JQXA 2W9DL 2YJQA 3OX8B 3U30C 2FX8L 2HSIA 5E95B 1U9KA 4JFFA 2Z4TA 4M6NH 2R0KH 2BCKA 1AH1A 4ZDHB 3T4YA 4X6DF 5HJBA 2YPVL 4FQ2L 1UXMA 1WH0A 4I3GA 3T0ED 1KJ2B 3N43F 3VU2A 4AH2B 5F3BB 4LHUG 2RR3A 1C1EL 2VNCA 1RERA 3IU4L 1HZHH 2OW6A 5CJQH 5KBDA 4DN4H 4JFUA 4PYGA 2Z34A 5I16B 2BXYA 2F1BA 1YN7A 3DUSA 1CZ8H 1G7IB 1ZHBB 4EOWL 3MODL 3UP1A 4PJXA 3MXVL 3JT0A 4ONGH 2MQ3A 1L9OA 2TRHA 3QZMA 2Y5TB 3D9AH 3P2BA 3UZVA 2ZG2A 3W3BA 2XZQH 4PWJA 4YC2B 1WFNA 4TTDC 5AEAA 3TJHC 1BZ8A 1HQRA 4AKQA 3WAJA 1JPTH 4YFLF 2DQFA 3FBKA 5CZXC 4HKZB 3WENA 3KPMB 1FGVL 3NSFA 1UC6A 3O8XD 4DW2L 3GB7A 2VQ1B 3LB6D 4KKPA 1Z9OA 3A4FA 3LNFA 4FQQA 4FJZA 5JXEA 5KBMA 1RZ7L 1CBVL 4L37B 2Z7YA 4FL4C 3OKEB 1S7TB 1XTMA 3T8VA 3V6OE 4BK5C 1MZZA 3OXRB 3INOA 5FC9A 1RURH 3HR5A 4M43L 3LZLA 4X5WA 1UH4A 4FEIA 3JVFC 4ZX5A 1U3YA 3AY4C 1DYZA 4OM0L 2ISDA 4XI5D 1HSAA 1EXHA 4FMFA 3ILQC 4EBQH 1KBVA 4PRHA 4JFWA 4KJQD 4G8EB 4DIXA 2DMHA 5DJYA 5EU7C 3SDDA 2DQ6A 4P23B 1T80A 4FFWC 2JKJA 2JKIS 2FH6A 2Y5EA 3MCKB 3LD8C 3DV4A 1D6VL 5FYLL 2BHUA 2ZSWA 4NLHA 1TJHH 1NFIA 4U2ZA 1WP6A 1BHGA 4HKBA 2WQSA 1SN5A 3ALPA 1JXDA 2GSGB 3OPZH 4Y4FC 1GJIA 4HEPG 5EH1A 5LG6A 1YEIL 3NACL 2PXYA 5GXBB 4Y0GA 3DOSB 3GMMA 1XB3A 3O6KH 1VAHA 1E90A 4JZJB 2APXA 1HE8A 3ASNB 3D39E 4MAYA 5GZNA 4Z0XB 3AWFA 3OV6A 5FUZH 3TO4A 1E9OA 1XXFC 5DYOA 1TMCB 1UOWA 4KRPB 5T3XE 1BAFL 2IV9A 3D50A 2OSLA 3UBXA 1Y0LA 1IFRA 3ARUA 2K78A 4FYRA 3K2KA 3MRFA 2OMXA 5DJ2B 4CMHB 3FYIB 4KKLC 3VUAA 4WO4C 1A4KB 2NY1D 3BIAX 1MSPA 1LEGA 3U6XS 3TH3T 3HS0C 5T3ZD 1TFPA 3U4EB 2EDXA 2VZUA 1K85A 3T71A 5KVDL 3HZMB 2O5NA 4PRBB 4NRXB 3UTQA 4EO5A 1MW0A 4A7VA 4L29B 4P5KB 3S3BB 2DYPA 4HJIA 1MFCL 2DKMA 3V0JA 3HUJF 1RIHH 3QNFA 4LCUB 4ELMA 2PCYA 2AXFB 4D9LH 5JTWA 3PAYA 5ISZD 5I1LA 4LEOA 4BH7A 4FP8L 2EZ0D 1T1ZA 1EHLH 4AIZB 4YXKH 4OD2B 5D2NB 2MSPA 3BDYH 4M6MH 2JIXA 2W0FA 1YMMA 4PD4K 3BAEH 4OQTL 3TPUB 1S7VB 3J2PA 3QS2A 3PGDA 2Y4SA 4GG6F 4Y4KD 3UTTA 2MOQA 3DLQR 3TV3L 1E5BA 1IGJA 1WK0A 1RVFH 1DVFD 1YN6A 1SMOA 3L4ZA 3IJYB 2IOMA 5DK3A 5GZOC 3D4ZA 3VXNB 1L0PA 3ZSSA 2BSED 3M7OA 4HMDA 1NFKA 1R5VA 4DO6A 1NCHA 5A6IA 3MRBA 2CLVB 2XKNB 5D7KD 3WUZA 2VDLH 4ZO6A 4IQHA 2DLIA 5FUCE 2VQ4A 3TC9A 3MXWL 5JOPD 2E86A 3OC8A 3FKUS 4RGMC 4JAMB 4U6XA 4GAGH 4AQOA 3BKML 4Z3JA 1TTCA 3BPOB 4KROB 4LP5A 4DZBA 2VL5A 3TZVC 5DJXB 4MQTB 1J11A 3AUWB 1E2VA 3QUKA 5ESAB 3F5WA 5CF3A 4OFVA 2GJPA 3DHUA 1P4BL 4KJWC 2JKTM 3TN0A 4S0TD 5IVXB 1ITBB 4NN5B 2R29L 1VDGA 3V2AR 1I7RB 2BMKA 3L3JA 1NOFA 1IBDA 3KPSA 3O9WB 4P5MA 4A2HA 1Y7VA 3FH7A 5CEXB 3KZ8A 3V5KA 3R7RA 1MVYA 1VB9A 3OPZL 3RX9A 2QQLH 4O58L 1OGAE 2LU3A 3K72A 1Q0EA 1FVDB 3V5HB 3BPOC 4JS7A 1KJ2A 1RJZA 4KROC 4PFEA 4CVXA 4M7JL 2KDYA 5AKSA 4WSGA 3ZTJH 4EN2A 2BIOA 5CLTA 5I19L 3QAZC 3SYCA 3FPYA 1AXSA 5LXVA 3NZHL 1HOEA 1PG7X 3R4RA 4M62H 4RMBA 4E41E 1F4YH 2Y1AA 2J57A 2VUKA 3HJ0A 5AOLA 3K6SB 1AGBB 1Q1PA 2YQBA 3KXFE 2CNYA 1F97A 4N6QA 2OP4H 1G6RB 3GUTB 3ET9F 1G9ML 3MLTB 2VXSH 3UYRH 2DQFB 4Y1AA 2FYYA 4NAMA 3TBSA 5CD5C 4PPTA 5CFHA 2AEIT 1X5JA 1QFHA 2X2HA 3GB7B 3VD4A 1QP1A 4JFYA 1LEKB 4JMNA 4U31A 2OL3L 1IM3A 5DK0B 2HKFH 3ML8A 2CQVA 4HIHB 3ROOA 4F27A 3W39B 2K8MA 4ABWA 4J2QA 4DEPB 3RKDC 5JPNA 2WJ7A 3LRLA 2VDPH 3QIUB 5EOCH 4GIAA 3GHBL 4WKZB 3SYAA 2IBZY 1CU4H 3MYZA 5GZOD 1GOFA 1A47A 3S98A 3A24A 3T0DA 1MW1A 4IBSA 5AVQB 2G5BB 4HC1H 5EZLB 2FQEA 3V0HA 1YNLH 3KPPB 4OH2A 4R9HA 5CJ8A 3Q01A 4FI7A 4KJYA 3MJ9A 1JNLL 2IALA 3RB5A 4W9ZA 3VNZA 4KQ4L 1V54B 4OLZH 1R3HB 2AJUL 5F3HA 2Q8BH 3O4LB 3PAZA 3TZVD 1G7QB 3K7UA 4V2CB 4JDTH 5E24E 3C8KA 3FFCA 2ZSWB 1JAEA 1INDH 4DFHA 3BP5A 4Z5RA 2YPVH 3BH8B 1A21A 1LO0L 4U2YA 1EUTA 1X9UA 3BUPA 3KMDA 1I85C 1OE1A 3ZE1F 1R9FA 3VRLF 2GSGA 5AOMA 2CJSA 2R69L 3VRLE 1AC0A 3TBYB 4WDIA 4QT5A 4EN3D 5I66A 1LO3H 1MLCB 4N2KA 2YAQA 5LCVL 1SVCP 1GMIA 2OL3H 3MACL 2WVSA 1U3HD 1OALA 2Y7QA 5J1SC 4XN8A 3M1BB 3FT2A 3TO4B 2EIDA 1JSYA 1VFAB 1AXTH 2V4LA 2D3JA 5LG1A 3RVUC 3U6RA 3ZTJG 5KSAB 2QVMA 4CUCA 2UVEA 4HLZG 5FV1L 3DX7B 5JW5A 2B1HL 1FA4A 1U8CA 3FQUB 5CEYB 4LFHG 1FBIH 3QUML 3VWKA 4JO4H 1J8HD 2AQQA 3WIIH 2XUWA 5T5FA 5IP4A 3KPRD 4E41A 1F4HA 2ICWA 3B6SA 2ICES 4FDWA 2K3TA 1GGCL 3AS3A 4G80B 4XCNB 4BJLA 4ELKB 5B8CA 5I5RA 1GZPB 1OV8A 3MRDA 5C1MB 1ZT7A 4OM1H 1DR9A 1DJIA 3B8YA 2WBJD 2GTZA 3ZYOA 5JW4R 1KIPA 2Y25A 3HAEA 3DMMC 3RDTB 2BCKB 3QI9B 1FNAA 1SOSA 3H3BC 4GKZA 4HCGA 3T4YB 5IZ7A 2AJ3A 3DK2A 1SY6A 3IDIA 5AVVB 1L6ZA 3JWOH 3RLSA 4EI5D 2IAMD 1KIUA 3MKGA 5F8RC 2B1OA 5KJ4A 3QJQB 3L3IA 1OM3H 2AABH 3IS0X 4HBCL 1HCFX 5D7IE 1JP5A 1Z9PA 1IBHA 4ZMLA 5I16A 4BDVA 4HWEL 3DUSB 4Z0BL 5LN8A 1F8TL 3B9DA 3EBHA 4QNPE 3FT3B 1BM3H 1IE4A 3CVDA 5SWQA 4AGLA 4LL9A 4BSVB 2JI2A 3SGEI 1KLGB 3FQTA 1V3MA 4YR6B 2WLLA 3RDTC 5I1CL 4Z7VB 1TTAA 1GC1H 3TT3L 4YN3A 3QCVH 2DQEL 4B5ZA 5J13B 2J1ZA 3P2TA 4R4FL 2DM3A 1XIWD 4IIQB 5D7JD 3FTSA 2DQTH 1M42A 3BGFB 2HVJB 3NZ8B 4LHUD 5T1DH 1QACA 3BD3A 1HINH 2VERA 2GPZA 4NNYB 1UUNA 5AOJA 5I24A 3ISYA 2P45B 4NO0A 5J0BA 3KYMB 1RZJC 1TQTA 4J3OF 2IH1A 3QEGL 1A4JB 2CWRA 2XG5B 5DS8B 5EBLB 4NLAA 2IQAB 3L3KA 4YWGL 4NCDA 1JTOA 4OT1L 5GS3A 2AITA 3OXRA 3HR5B 3QQ4A 3WNMA 3B37A 3JWOL 5GZND 3HG3A 1JYXA 4ELME 4W9CC 2V5TA 5DHVH 5CUSL 1CGYA 3M8OH 4KJQC 1UXWB 1RPKA 1AKJB 4OIBA 5H4YA 4QRSB 4PBWD 4MNQD 4NKOA 3LNEA 5JYLA 3QZWG 3BAKA 4KAQH 1DBAL 2CDFA 3MBEC 4HGWA 4NN6C 4XTRD 5FHBL 3WAKA 4PB0H 3ETSA 5BZXA 2IAMC 3HHSA 3DV4B 4BIKA 1P5UA 4HX1B 4TVPE 5E0QA 4Z7QB 1XSKA 3DVGB 2KLRA 2Y7NA 3WO4C 4AK1A 2F5BH 2TSBA 3S8GB 1YY8A 5DUPH 2DKUA 5IQNA 5E5UB 1R3JA 3TFBA 5I30L 4CVXB 2XWTA 1HAUA 1EX0A 1H5BB 1BX2A 2OM5A 2A38A 3CFMA 1EMTH 2XXMB 3NJHA 5FGCE 2YWZA 4M61A 3TTYA 2IDTA 4LDOB 8FABB 3GMMB 5B1CA 4DW2H 5ISZB 1RZJL 4JZJA 3SDCC 4Z77A 3CK0H 3X14B 1GKOA 4M29A 1ZGLB 1QBAA 5DJCB 2HVBA 1Z9LA 4OGZA 4A7GA 3DX8B 1KCRL 1KTKE 4PH8A 1QVOA 2E56A 2HFGL 1QUNA 1URLA 3V7AE 3ZZQA 5F7AA 1Y0LB 3MX0B 1R47A 1KYUA 2IH3B 3ZTCC 2CIIA 5C0BA 3MVSA 4M62L 4ESKA 3PDDA 1KFAH 1ZWIB 3KE0A 4RMVA 2PPCA 3H42H 4U6VH 4ODHL 3SY6A 5DURB 4M6OL 4I0PC 3N9GH 4IRJD 1PLGH 3LKOB 4IHOB 1L6PA 2DWSA 3U9UB 4JRYE 1FFOA 5T3ZE 1E5YA 2BSEA 2V5MA 3ARPA 2CM5A 4LVOB 4N6RB 2Z91A 3EJZC 1X3DA 3KEHA 4I2XE 3UTQB 5I26A 3EFOB 3FCTB 2IADA 3GSWA 1I9IL 3EYFB 2AVFA 3LPFA 4TNFA 4C55A 2NCEA 3D48R 4MZ3A 4ZK8A 3CXHJ 1PKOA 3KDMB 1S7RA 4OFYA 1SJVA 1YNTF 4NQDE 4YDKL 5TF0A 1TLKA 4GBXD 4LSSH 2EZ0C 4KXDA 4WK4B 1J7VR 3BH9B 5DZLA 4L4JA 1JPEA 2E47A 2R29H 2QL1A 3WD5H 2F74A 1R5IB 1AD9A 1UGKA 3MRJB 1MWAH 2V8LA 3O4LA 4PGZA 4J3SA 5DCCA 1N6QL 1JK9B 2ROXA 3GTTA 4QD2E 4NI6A 3NEOA 5JOPE 1THCA 4KI5D 1JN6A 1I3RA 5IJBC 1SFHA 4P2OD 1NSNH 4GW5B 3T6ZA 3S7GA 4U1HA 4WNQA 2BP3A 3OAZK 5C0DA 4JNXA 3P9LB 1TTRA 5F7EL 4LOEA 1T83A 3PP4L 4M7ZC 4Q4IA 4WDIB 1K5WA 3G6JA 3H3PL 3GSQB 5J6SA 2IBGA 5T1LD 1R5VB 3CVHA 2DIAA 4FQXA 4X7SH 1PMYA 4LCIH 1RZKC 5E8NA 1JGUL 2BVPB 3N91A 4KGJA 1FJ1B 1JGIA 3KL3A 3EJQA 1E65A 1FAKT 4J4PA 1F1AA 2KMWA 4G6KH 4IMKA 4JM2D 4PJEE 4YBQC 5TGBA 4Z1PA 4XNXH 1FPTH 2DLHA 3CHQA 4WFGD 5GQBA 1V3LA 4LGRB 3B56A 3WNJA 2I60L 3VXME 1QR1B 4LLQB 1MCOH 1JS4A 4FTDA 5I23A 2HA1A 3L1GA 4XWOD 4QYOB 4M8UA 3BGMB 3ZTDC 2R0LH 5J5EA 1A9VA 2ICWB 1BFOA 1CPUA 4K3HA 1UASA 3P0GB 4NO5A 3U7YL 5CCGE 2XWZA 1D5IL 5IQLA 2CIKB 3HZYB 3P0VL 1WV7T 5C9JB 4J2XA 1IGCL 4FP8H 4LOUC 4PJEB 5EEYA 3KPSB 4D7BA 4UNVA 1Q9OA 3RDTA 2FBOJ 2O5YH 3QI9A 5AFAA 3IDNB 4AYSA 1GVIA 1G1YA 3L4YA 3BD5A 4HYTB 4P04A 2LFGA 5SWSD 3RPIB 2CHXA 3O6LH 3Q8BA 5A16A 3WS3B 2QELA 3V5HA 2DY2A 3FSOA 3AM8A 2G9KA 1ETJA 2APWA 2VITA 3CSGA 4RGOL 3WHE1 2MCPL 3EHBC 2BHYA 4X6CF 2A9NL 3HG1A 3WKYA 1UENA 2ZCLL 5BOZG 1RAMA 1L9NA 2KZKA 4U6HB 2D7PA 1M1XB 4L4VE 2BNRA 4WV1A 3FT3A 4BSVA 2VLKD 3I6KB 1LNUA 2NT1A 2YRZA 1DO6A 5MP6H 4CADB 1E27B 5JW3H 2SEBB 2ICEB 4YDZA 5F8QC 3QDAA 4GRLB 2DQIH 4NKDA 4F7CA 1IBGL 1G7JA 3O4LE 5FX3A 3VH8G 1VKXB 1HSBB 1N2RB 2X0VA 5MENA 4PI2A 3MLRL 5CR8A 3G6AB 5D6CB 3R06A 1EDHA 1DLFL 1KZQA 1YEGH 2ITEA 5F9JA 5EF1A 5ECJE 5DZJA 3SKOA 4YQXH 1VCAA 2ZOWA 1BA9A 4H8WH 3LPOA 3GKZA 3MNVA 4HIHA 5IBTL 3GKWL 3FTUA 3LZFL 3VVWA 1UM6H 5LGHL 1GCYA 1CE1H 5CM1A 5IGXH 4WKZA 5DD5H 3TBWA 2YXMA 3NCFB 3FH8A 2WP3T 4WY7L 3F7KA 3BRFA 4R4ND 1YC7A 2KQMA 4ZW7A 3ZX1A 3VH8A 2QPSA 2V5SA 1H3GA 4FHBD 3ARDA 5ACLA 4ZUTA 3VXMA 1GGTA 3S5LG 3S4SA 2WINB 4U1SA 1G7HA 2H47C 5DC0A 3INUL 1VHPA 5C2BL 4NUJB 1ZOXA 4O2FA 1NBVL 3RY4A 1HQ4A 1WZAA 2CKBL 1M4KA 4DETA 4OSUL 3VFGH 3GWJA 3X13B 2UZPA 4HJGB 5FO8B 2YC1A 2Q1EA 3BH8A 4QHMA 4X4KA 4WEBL 4YGVB 4UQIM 3I85A 4W70A 1MVUB 1A7NH 1B0RB 1YEGL 1MFEL 3RVVD 2OTWA 2GVYA 4RCAA 3DO3A 4QOKA 1JRHI 4W6WB 3BVDB 5CLZA 4RAUA 5KW9L 1WIOA 2NY3D 3GZPA 5H2BB 1TNMA 2X7LA 3C6LD 3F58H 3RVXC 1OCWH 1IC7H 3F7VB 5CZVL 1QHPA 3FU9A 5DJCA 1TF4A 1HEZB 4QRRD 2FEJA 5I6XB 4OI9A 2NR6D 1MLBB 2I5YL 2MIZA 1H15A 3GIVA 4ONHA 3PWNB 3V0AC 5BUPA 3WLWC 2MKLC 3CPUA 3QS3A 2ED9A 2O26U 2FWSA 2DWTA 4GPVA 2BNQE 1UWYA 2C4FU 4Z7UE 3TEYA 4RDQF 4G5ZL 2ZYHA 2Z35A 3EYVB 2QPEB 3B6SB 5J9PB 3KXFB 4EXPX 2Z4QB 4GXUM 3AG2B 1F6AB 1WWBX 3WTYA 2W07B 1KIQB 1TLMA 1EV2E 4ZNCD 2MQCA 4ODSL 5E9DD 1FFPB 4ZMNA 1SEBB 1LEIA 2OI9C 4D9QD 1UHVA 3SPHA 2BVOA 4NHUB 1U8KA 3VQ1C 2HXAA 2C4FT 3WO3B 2DLGA 3A4EA 2BNQB 1D9KA 2IH8A 4LLWB 4PJ7F 2MHAB 5FK9A 3FO2A 3PHAA 4HGKC 1IFHL 2GC7C 4XOEA 5IQ7L 3VDBA 4Z78B 3BH9A 3V6FB 1SLWA 3EJSA 3BEVA 4HU8A 2RH0A 1ES0A 1QBLL 5CBEA 4QHPA 4MCNA 4HIXH 2DQGH 5HVFB 1R17A 3NGBB 1VEOA 3F7RA 1GIGH 1EJOL 2WZ6A 2C3HA 2XQBL 5I0ZA 1I3RB 1DDTA 2VXSL 4MQ7B 3CQQA 1ZEAL 4O9HL 3CVHH 1NPUA 3OR6B 3K81A 1WFUA 1C16B 2VM4A 4JN1L 4PJGB 2DYRB 1I1YB 2Y7MA 2CJUL 2NCMA 3G9VA 4CN1A 5FUOL 5HHXH 3CVHB 2UWEB 4H0LC 1CFNA 3RTLA 2UXFA 1KXVA 3GMLA 4JJ5B 5F7EH 2CR3A 3QXTA 5HYJA 4AQAB 3UZQB 3VYPA 2XNAB 1A4JA 1IBYA 4P2RE 2IQAA 3L3KB 1EGJA 3GEFA 4NWTL 2R7EA 4XMZA 3DMMA 4J3XA 5C0FA 1BBJB 3RX5A 2PR4L 5KJ7E 3SBQA 3MUHL 3NFPB 2VMJA 3SN6N 2WVVB 3A4AA 1DQQB 5GGRY 4K3DH 1MOEA 1IAOA 4LKCA 3RWGA 4I3SL 4FQ2H 4M8RA 2CKBA 1CFBA 4IRZH 2J12B 4ZT1A 4HGWB 2XQ0A 1S4IA 1T5XA 4WZ9A 2GKIA 3THML 4JR9H 4MXQD 5GGUA 1ZTXH 4DN4L 4IOFC 3BDBA 4Z23A 4L8CB 3CAFA 2NYYD 2ZG3A 3FQRB 3N0AA 3B2UC 4DTGH 1ZVSB 3B7TA 2OMWB 5C0CA 5K9QI 1N9PA 2F7RA 1A9BB 3H7BA 5E1AB 1Z1WA 5F93C 3AG3B 4TTGA 3I84A 4D9RE 3BD4A 1DVZA 3P73B 1AIZA 1VLXA 1Y1DA 3RUGA 3VXRA 3RAJL 2FGWL 2ODIA 3G5XB 4PRIE 2D4FA 1JPSL 3CHSA 1A6TB 5DFAA 4ZMYA 5ACZB 1P4LB 4TS6A 4POUB 1ZE3H 1XF1A 3Q48A 2WBXA 3RPBA 2PO6B 1FCCA 5F9DC 2EVHA 4WEMB 2P4AB 4HUXB 1AQDA 6PCYA 2NY5C 5MI0B 1MELA 5J11C 1OT2A 8PAZA 5H8DA 4N8PA 5C07A 1HHIB 4PJBA 4CAGA 2ENJA 2E8YA 1SNRA 3F12A 3EOBB 1H6FA 1A6UL 1SM3L 2CIIB 4YXHL 3MA7A 2XV0A 1ZWIA 1B0GA 5EOTA 3SGDI 2Y07H 4H25A 1R3KA 1MI5A 3LEXB 2OSXA 1HTYA 1VACB 1KCSH 1U91A 1Z5YD 5LWYH 2CCVA 1JZ5A 2O61A 4XMWA 3NCJL 4A67A 4X4XB 2IAMA 5D72H 3TF7C 3GSOA 1OTUC 4WFFD 3HZKB 2NX5E 2ZAHA 2E9BA 2Q8BL 4FTVB 4P5SA 2GAZA 4U6YA 4AK2A 2H0PA 1D6EA 1F1DA 1YEEH 2JELL 3AZUA 1EHKB 4WJ5A 1T0OA 3EF7A 2HJKB 4KXBA 4Q7DA 2FR4B 3LN4B 4XMVA 4PJFA 1G6VK 4NQCB 3VXMB 2QVTA 5B39A 4L4VA 3HNVH 5C0GA 4YHPB 2HX7A 2PUQT 5CXPA 4FABL 3IMVA 4NUJA 1IGIL 2X2UA 4BFFA 3TXAA 3QULB 1OPGL 3IDJB 3PQYB 4Y2DA 4MQXD 1JK9A 1IT9H 2EH7L 1E4XH 4KZDH 3RHWF 5A2BA 4QNPF 4HAKA 2H32B 2XWCA 5DRWB 3VACA 4XN5A 3ZKND 1A5FL 5FO8A 2AQ1A 1SN2A 5FA4A 2H3NA 4MWFB 5TQ0L 2OL3A 5KYYA 5MENE 2QVKA 4RGNB 5ALBH 5K93A 4XVJH 5DTFA 1R46A 1BAFH 2Z64C 3CIQA 1JHTB 4X9HA 1RMFL 1JGLH 3GNML 2J8OA 1G9NL 3E8VA 4GKOA 4B9PA 4FE9A 4L3CA 2WCPA 3QE5A 4FNRA 4WEEA 3EW3B 2ZX5A 2WQWA 1HWHB 5C8JA 3Q8AA 2VLRA 2R1XA 4XVSH 5I8EA 3QNXA 4DP0X 1PD0A 1MLBA 1K4CB 4RNRB 3C60A 3QHZH 3EBIA 4IJ3B 4G83A 5TE6H 3D4YA 3BMWA 5FEBA 4KK6C 1KUMA 4PJ5D 4XODA 4YX2H 3MCG1 5D6DC 1XZ0A 4OAWA 1OPOA 3F58L 4CNIA 1JPFA 1U8PA 5E5RB 3ZE2E 3R0NA 1YEKL 3EJCA 4LLUB 4XCEA 1U21A 4JPQA 4XHQA 1KIQA 1MW2A 4QXTA 2NTFA 3QQ3B 1NEZG 3ULVH 2AK4A 3WKMH 2VLLA 2B1AL 3CVCA 5BZWA 1JYVA 3FN0L 1WBYA 1KEGH 4G7VH 3AGVA 3UPRB 1BOGB 5H35A 4W6YB 1P7BA 2HLFC 1T20B 2XBDA 4H0HB 4JX0A 3WS3A 3I9GH 3FTZA 3IJ9A 3RGBA 4ODSH 3L6FB 3PDGA 4NXKA 5GRVL 3M86A 4F2MA 3ZQXA 5KTEH 4PTTB 2ZSVB 4Z78A 3ARGB 1XQ4A 2YFNA 1AGFA 4OD1L 5TDPB 1CLCA 3HJEA 2FHFA 3SQOL 1JWMA 1KCLA 2CBMA 4NNXA 1LNUB 3TGXA 1FNEB 4IMKC 4UIKH 5I6MA 1WCBB 3H1ZA 4RGMB 4DCQB 3V4UL 3MRRB 2HRLA 3SGKA 1N4XH 2ED8A 4TUOB 3T8XA 3OR6A 1AHWA 3TIDB 2EO7A 2XJLA 3S36H 2A73B 3N43B 4HWZA 4B9YA 3L95B 5C6TH 1XSJA 4GUPB 1KJ2H 2Y1VA 3SKOB 1EGJH 5IB3B 3RILA 4YFDB 1EFQA 3RGHA 3LNGA 2Z8SA 5FUOH 3VSQA 3SGJA 2DQEH 3PHOB 5PAZA 1ZPLA 5C0FB 2BHZA 2H26B 3UZEC 1NCCH 4OKVA 3S3SA 1HHJA 1AYOA 2BY3A 1EZSA 1ETA1 2BW4A 3ARTA 4BZ2H 4IBUA 2WINA 4PJHE 4U1SB 4X5QA 2X9XA 4FLSA 3K6NA 4HZLA 4Y8AA 1A4BA 1OSYA 1IGFH 4MJIA 3QC5X 3LH2H 4HQQH 4FD0A 4PU2A 1C7TA 4J3UA 5DHYA 3X13A 2D2OA 4XPBL 2YC1B 1UKQA 1I8IB 1ACXA 4KRMB 3PIQB 4EUPH 5IB4A 3LS5L 4YHOH 3SE8L 3PV6B 3QJFB 3P73A 4DZ8B 5C09A 1JGVL 4PRID 1FZKA 2HMID 4DVBA 5BJTB 1A6TA 4LGPB 4EI6B 2YZ1A 1D9KD 3IU3A 4QTHA 1P4LA 2XWEA 1GSMA 2X7LB 1QSEE 3GRGA 4NHCL 4EUPG 3F7VA 5AUMA 5AVRB 3RY5A 1OIOA 4HT1L 2D7TH 1H15B 3GIVB 3GBEA 5TE4H 4E9RA 5CJ5A 1FC1A 1YEJH 1WBZB 2XY2A 3UIZA 4HDIB 3BCFA 1YEIH 3ZKXC 2L7JA 5F7YC 4ODBD 4GKLA 1DBKL 1SOXA 1GSKA 2WWKO 4FNTA 5F1IA 4A63A 3BWSA 3B9VA 1ZHLB 3MMEA 4FXLA 2WLYA 5D7JB 1U58B 3B9KA 4LPVA 2J1WA 4QRBA 4B60A 2QQLL 2FE0A 5IEKB 2P5ED 2YHGA 3CN1A 1MEXL 4FTVA 2AQ3A 2ICEC 1RIUL 2P5EE 2R0WL 4XO4A 3HPJA 4Z3GA 3O8XA 4NBZB 2FJUB 1G94A 5I74B 2WQXA 1UM5H 2IVFC 4EJ1C 1ASOA 1XSOA 3V4VH 4ZW6A 3HC0B 1GGIL 5K1JA 1CDHA 4OM0H 4GRWE 4DEPC 3TO2A 4XNQA 4ONFH 2DMBA 4EZLA 2V9QA 1KGYE 4PWFA 1AANA 4LOUD 2NUTA 1QBBA 2W8CA 7PAZA 1AXTL 4J8QA 1U95B 3LH9A 3ARFD 4M56A 5MEND 3OHXB 5EC2A 5E8PB 3O3DA 1FPTL 3T2LA 3UDWA 5DD6A 3ZSTA 2F8XC 1XGYL 1PZCA 4KK8D 3IYLW 5C86A 5B7EA 5J06A 3AB0B 4XCFH 5ALCL 3ZOAA 3QDME 3GHEH 3ULVC 3AADB 4ODTH 5CSBA 1N7ML 1BSIA 4X9GA 4L3CB 2VISB 3GRWH 1VENA 4JG9A 4KMTL 2EXYC 3U1SL 4HAFA 3HRZB 3CDYA 2NXYD 2R23A 4K5OA 2BSBA 2QT6A 1E5AA 3I3DA 2VTFA 1PZSA 5D2LA 1BLIA 3NJMA 4OFDA 3WTTA 1CXEA 4PG2A 4UM9A 5AD0A 2VXTH 1S9XA 4R4BB 3V52H 1YVLA 3L54A 2QKIA 3VX0A 1CDJA 3AQDA 5DUMH 5EG6C 1EHNA 3HC3H 2HKHL 4R0LA 5C07D 3PP3H 2WWMD 1JPFB 1U8PB 3L3OB 2F08A 2CKBB 1KBPA 4LSPH 2ZKYA 4PW4A 4MFHA 2EDQA 4QHKJ 4HIIB 2AABL 1MXDA 3WN5A 2CUMA 4CKQA 1U8NA 2GJZB 2CR6A 2MOGA 2Z31A 3B2UD 4F9PC 5C0RL 1WBYB 3CV5A 2P8PA 4PY8I 3WE6B 4NRZA 5EU3A 2O6PA 3UPCA 3WHXA 2YK1H 5IB2B 3JXAA 2CO3A 4UTBL 1YPZE 2FO8A 3NOIA 4CW1B 3GXDA 4TNWK 5EO0B 2B4CC 4BSWB 1MF2H 2QR0B 3EGSA 2GJ6E 4GAAA 5GGTH 3H6JA 1ZSHA 1CXIA 5TFSH 2G3MA 4L05A 1FNHA 1FHGA 2E59A 1M7IA 1BREA 1J48A 3KS0J 5I1DA 1OE3A 2XTJC 2BIQA 4YHML 1NBCA 2VM3A 3KW7A 1CGVA 3E2HC 4L4VD 3FCGA 2V7NA 2B1HH 3IJHA 3QG6B 4KDTC 3V7MA 1HHIA 4PJBB 2LQRA 2HX9A 1BZDA 5EUOB 5B1BB 3NJGA 3QZPA 3VD7A 2EEFA 2AJZA 1UWGH 3Q3GB 1KC5H 3UO1H 4FNUA 4N3UA 4LEBA 1AD0B 2XPZA 1ZRUA 4ODVH 1B4TA 3BOVA 1AG0A 4FI8A 2EYRA 3EOYG 1LO2L 2H2SC 3FSWA 4GUCA 3OGCB 1L7IL 3UTTD 2IAMB 4U1NA 2M2DA 2DKSA 2PPAA 3HZKA 4WFEE 4WFFE 2X0WA 1DQJB 4ZZKA 4AEFA 3BIKB 4RH4A 4GKSB 4F2ME 4PB0L 1HHJB 4DH2A 1CLOL 1YEWA 2Q2EB 2K9UA 1AGEB 1IKFL 2VLRD 3VWJD 1J1PH 2R4RH 1FG9C 4NQCA 2ZAGA 3SCMA 5IW6B 5EB9A 3PV7A 1NCCL 2DMCA 5E03A 3BZDA 1F8TH 5JMOC 3A21A 1NGZB 4JFEB 3RIAK 3RU8L 1UJ3C 4JFFB 1PX4A 4Y2DB 3VGHA 2WMPB 3APMA 2VGLM 4JY4B 4G7RB 4ZTPH 3MRIB 1PQZB 3NA9H 1ED3B 1QPKA 3L13A 1S78C 2J6WA 4LHUA 1ZVHA 3MLPA 3LH2L 1XGRA 4AC2A 1CDYA 1PG7L 1SXAA 2ED6A 4LHQB 3WSQH 4ANXA 4LVNC 3O9WD 4PMEA 1ZCRA 4ZMQA 2J5LB 4P46D 3X1GA 5BQDA 4P3DA 3QFJD 1NUFA 2VXVH 4JHAL 4JZNB 1OF2B 1E28A 3CWGA 4JEGB 2OMBA 3GTNA 3V6OA 3LS4L 3IDGB 1RUPL 3SQOH 1XZWA 5M7QA 1G1CA 3TVMB 4A6YL 4A2LA 5F1NB 4ZD3H 1KCVH 2A6IB 5T3XD 3NZHH 3RJDA 4W9GC 4FMKA 4HKZA 3S9DB 5GRJL 3MGOA 1E4KC 3FTGA 3WIHL 4F2EA 2X2IA 1BVLB 1KGUA 1SJEA 3MJ7B 5E6IC 4OJDH 2F58L 5LAXB 2EP6A 1M6OB 3TYFA 3KGRA 1S7TA 4MNQB 2NTFB 4U3HA 1NTDA 5IF0B 2EDJA 1HHKB 1KGJA 3UCQA 4KO6A 2VZVA 2YARA 4XVUD 3SDDD 4J3OC 3UPRA 5E9DE 5MEOA 1WAAE 2VDNB 4IU3A 4JY5H 4F5CA 5CLYA 1XH2A 1JJUA 4HG4J 1HFUA 3GSNL 4FF9A 4FERA 1NMBH 4HUCA 1U92A 4TNVF 4Z7VE 3RGVB 5JIHA 4D0DB 5CEZL 2NNAB 2ZXCA 4HHGA 5E1QA 4RISL 4IDJL 3LRMA 1E6JH 1OAZH 2BOCB 5D5MB 1PTZA 1WHOA 1CXHA 2ARJA 3LS4H 4EPSA 4OLVL 1SQ2N 1OGSA 5DD0L 2FQGA 4KOBA 3CC1A 3FU3A 3SDYL 1V7ML 5J56B 1IL1B 7CGTA 2VERN 1TU2B 3QQNA 1HXYA 4Y89A 1ZV5A 4GQRA 1H3WM 5EF0A 1XCQB 1FLRL 3B5TA 5GS2D 4YHOL 1DE4A 3SE8H 3HBZA 2D9CA 4GIOA 4KNSA 4LCYA 1F90L 4CDGC 1KCUH 2DM4A 1RJLA 2YBGA 4BELD 3CJJA 5LGJB 4FTVE 4YOKA 3MV9D 1Z6JT 3IN2A 4IGBB 3F65A 4NENB 1CFTB 3H8NA 2H26A 1D7BA 4NBYB 1A7BA 1SVZA 2XX0A 3LKNA 3NCMA 3OKYA 2O6FA 1F56A 4A55A 4OZIA 4PJ9C 3NJNA 2YEZA 4EKXA 4KZDL 1LXMA 3WD5L 2BS9A 4PBVC 1IGMH 2X70A 1NEUA 4B41A 2HKAA 2A6JB 4KDVA 2R29A 2WZPA 1PG7H 2VDQB 4ZO9A 4NRXA 3WSQL 3QEQA 2ZWYA 1B2WH 2ZP9A 1K6QH 5GJSH 2VC2L 4IGBC 1RZGA 4HXBH 1OTUD 2VDPL 5EOCL 3DGGB 4LMQI 5D1QA 3FQ4A 5IMKB 1CG9B 4LCUA 2ZX7A 1CTOA 3QJUB 4YZFE 3IF1A 1FLRH 1G0XA 5BJTA 4N2GA 1KLFA 1JYWA 1N64H 1M7IB 1GPOL 1QEWA 2DQJL 1H9VA 2UY6B 1N6VA 3FF8A 3HNSL 4YK4B 3CN0A 4KMQA 4YQXL 2W0FB 1MRDL 2F8VA 3KPOB 4FCHA 3KGUA 4BK5A 3STLB 4ZMZA 3MR9A 7FABH 3QG6A 5FYKD 3FSZA 1PY0A 5EUOA 4GMSL 2Y36L 1CS6A 5FR3A 4K0OA 5AW1B 3KXFD 2AMGA 3Q3GA 1ZTMA 5I9QB 2AERT 4DFIA 3ZQWA 2E3VA 1FE8H 4ABUA 2XKNA 1F4XH 2N56A 4O51B 2FSEB 3C08L 1NGPL 4XPTH 2APBA 3S8WA 1NJ9A 5DD3H 1NL0H 2WN3A 4TSBL 2EDBA 1M7XA 2VL5B 3BO8A 4MYPA 2BY0A 4JO3H 4LOFA 3TEUA 3DDGA 3O8XB 5DURD 3RX7A 5A1AA 1KXQA 1XGUA 3GLZA 1IBFA 3B2XA 3KPQB 1AZNA 3EOTL 2PWEA 4HGMA 4OBRA 1G4RA 1F42A 4PCKA 1I8LA 4YSOA 2MQGA 4N86A 5FS5A 2WXNA 1G9HA 3U0WH 3JSSA 4TNWF 1UATA 4YPJA 4GAYA 3QIWD 3SODB 5E99H 4GLRH 3BWUC 4UTBH 2QQKL 2Z1PA 3EYQC 3HEIB 3OHXA 3ZT7A 3S6CA 3MLVH 3QSKB 4YAQA 2Y72A 1U4FA 4F3FA 5DVNA 3KLDA 3MSPA 3MNZA 3P3SA 3D2UD 4R5VA 1X7TA 1GS7A 5DGQA 4GW1B 3BVNA 1MH5B 4DP5X 1AXSB 1M1SA 1A5FH 1H3PH 1QLRA 2F1EA 4XAKE 5L7XL 1VCBC 2LVCA 2FEEI 3ELAT 5KSBB 4OLXL 1MFDL 1X5ZA 3UGXA 2COQA 1L5GA 2VR3A 3QNYA 3B7RL 3QO1A 4ZUVA 4YSEA 3X3FH 2RFXB 1LM8V 5E8OA 5IVNA 4FQPA 3EDFA 1HCZA 2YPLE 2BVYA 5IMMA 3CZJA 4NQUA 4R0LB 3HTLX 5KG9B 1LEKA 4IKKA 5KBPA 4OY9A 1LL1A 2X09A 1G1OA 3HS8A 2IC2A 2WXFA 2BSCA 5TD4A 2WSPA 2COVD 1ZGLP 1NGXA 3H9SA 3KR3L 2HJFA 3EZJB 1N67A 3WIHA 5IOPA 2WKOF 3UTSD 1FO0H 3PFQA 3IJSA 1MHCA 1O6TA 3UROR 2ZOUA 4OCRH 3WV0A 5EO0A 4TUKH 1LDPH 4DKTA 3QJOA 2FJFB 4OJEH 4N0YL 2IALB 2CO7B 2ZIDA 3S96A 4AY0A 1AC6A 3CQPA 1TQCC 2JXMA 1M2OA 2NYZA 4XNZC 2JB5L 5IR1B 4R6UA 4YVUA 2IV8A 2JKXA 3MQIA 1OCWL 1WA2X 2QADB 5D5MA 3UACA 1KTRL 3RVWC 4AE0A 3ARQA 3IJHB 4YSDA 3HVNA 3FUIA 4NZ8A 1WTLA 3VFVA 3ILPB 5TDNB 1V05A 1N5AA 4PG9A 4IMLB 3A6CL 2D73A 3UYPA 1FFQA 2IGLA 2HTLD 1RK0A 1TU2A 2P1YA 5J3HD 4CN4A 1X6NA 3OJ2C 5AG8A 3HE7A 1R6VA 4TUJA 4DGIH 3F6IA 4I3RH 1JV5A 2OV0A 2R2BB 1DSWA 3EO0A 1GCFA 1L9TA 3CVIH 4M48H 3HNTH 3UL4A 1XH1A 3ISWA 4TVPL 4FTVD 4KH9A 3ZUCA 2IDCA 4X7SL 1T3FA 3QJHB 4O00A 4DK5A 1Z5LB 2EEXA 1USQA 1CICA 3KHOA 3QXAB 5B38A 5C0AB 1C8PA 1J86A 4R26H 2W94A 5SV4A 3T0EA 2R59A 1RUPH 1X5FA 1JGEB 1RV6X 1YAIA 2EIKB 4JFDE 4KXZH 3RFRA 3SD2A 5IW6A 4M03A 5DA0B 1KGXA 4G7SB 2YSTA 3QDGB 4H4NA 4TQIA 3TCLB 2NY1B 3WEAA 1PD1A 4TL4A 4MYWB 5FGBC 2CSPA 1HZHL 5DS1A 1GR7A 4JRXD 3SQBB 5IB1B 1J5CA 2B59B 3FRUA 2ITCA 3FQ1A 2Q7YA 1YECL 2X6BA 3AG1B 2V2XA 1OGTB 2X6CA 1T7ZA 2CJUH 4LCCB 3ARSA 3SPJA 5DUJA 5EZOL 4JGUA 2P9RA 3R0MA 4OTXL 2NY0B 2FWOA 1UM4H 3QFJE 2Q76B 4GJTB 4YXHH 4HOZA 1KLGA 3FQTB 3ARGD 4NGHH 2AFNA 4P0DA 3A67L 2ENQA 1PNDA 2ZE0A 4Y5XA 3STLA 1RSFA 3VG9C 5KYXA 5GS1A 4NX0A 1XGTA 4M4PA 3U25A 1T7VA 2A6IA 5E23A 4G6FD 3B2DC 4AXWB 2APVA 2ZZUT 4JRYB 3TWYA 1LP9E 5GSRA 5KS9A 3FCUB 2WIMA 4JQVA 4OBSA 4X6BA 4KK8C 5B4MD 1MHEA 2PW1B 4NNYA 1A6WH 3K6FA 2FSEA 5LAXA 4GIPD 3W1ZA 1ZIBA 1X44A 2IH1B 3BUBA 4MNQA 4MMYB 5DS8A 5FA3B 1JK8A 5IF0A 4WTQA 4XB3A 2ESVE 3QQ4B 4V1DD 4UDUA 4D9QE 3GF8A 3O6FD 1BW8A 4I4WB 2GIMA 2AS5M 4NPKA 4FFVD 1B4JL 1BFVH 1X4ZA 2CZNA 4L8SA 4RSYA 1RZIB 5I2IA 4JANB 1HYSC 1ONQA 4NM4H 3VXSB 4R2GD 3D51A 2B7DT 3TJPA 3ZO0A 3APDA 1EWHA 4MHHI 1UT9A 4A6YB 2G60L 2OZNA 3B5GA 1UJTA 3IDYC 4MAYC 2WQVA 2CUAA 4UOW0 4B9CA 5JXAH 1D5IH 1A3LL 5CD3B 3DV6B 5EUOE 1IO4C 4OGYH 3ZR5A 3SKJH 2YD6A 2ZCKH 3GSNH 4F8PA 3UYOD 1Z3RA 5BQ7A 2XWBA 1BVNP 3QQ9C 4F3FB 3EDJA 2OS7A 1V3JA 3KYNA 3JTSB 3MRKB 1GKEA 4DGYL 2RQ8A 5HYQA 2F53D 1M3JA 1WEJL 2YGPA 3WTSA 1FAIH 4YWGH 5I8OH 4ODWA 2IF7A 4AX3A 1X5HA 4M9OA 1UB5A 3OAYK 3BJLA 2YGVA 1TETL 2GG1A 4N87A 3TWCL 1BOYA 1W8OA 4QO1B 2R69H 1CFTA 1XD0A 2VW7A 3FU6A 2FUQA 3MX0A 5DDHB 3SPVA 2ZPKL 2XVLA 1KXQE 2Y36H 4WHTA 4NQDA 5C0BB 1J05A 1H3UA 5JHBA 1GC1L 1UD5A 2J8UF 2VIRB 4PVLA 1SOKA 3SDAC 3NH7L 1OZUA 3FUJA 2HLAB 4ZXBA 5HHMB 1T6VN 5KG9A 3TT1L 3VJ6A 5AYTA 1YQVL 2WWOA 4LSVL 4FAAB 1SGKA 2IBBA 3MROB 4NFBA 3TEXA 1EHLL 3DPBA 3L3DB 5TFSL 5FYJL 2Z92B 1LP9A 5KS9E 4I9XA 1AGDB 1CLZH 2ARJQ 3D34A 4LPWA 4AE1A 4Y9FA 1OE2A 2CDGA 2IADB 4XNUH 2AF2A 4YSRA 5IBTH 1A7OL 5EBWB 3LQMA 1HH6A 1T4WA 2PCPB 4X6FB 2EXTA 4LQFL 1RIVL 4F7TB 4HJSA 5KBNC 3EO1B 4J3WA 2EH8L 4P46A 4A39A 1GA2A 1GOHA 1YSOA 2CO7A 4I3SH 5IREA 4XP1L 5C6TL 1KLFB 2FX8H 4MXQC 4U1JA 1YA5A 3E1F1 4KPHL 2F74B 4X80L 1TO4A 5J89A 1O7VA 1XGPB 1UADC 3KPOA 5I1GH 3BZEA 2YAPA 3ESMA 2HWZH 5KAQG 3WDHA 1XGQB 3K6DA 1NIFA 4MZIA 4XP6L 2VDQH 3H4FA 1QMUA 1TQBC 3ILPA 4PV9A 4P4KA 5TDNA 2CHZA 1YLBB 1BPVA 2Z9TA 3AABA 3FB8B 4Y2LA 1NLDL 3AITA 1TTGA 3P9MB 2A74A 1A4AA 5AW2B 1INEL 5MEPA 5DFWH 3VFMA 4GUQA 3MLVL 3S3JA 4XX1E 1NMAL 1BJ8A 1IV8A 2VR9A 5HHOA 2IWFA 5DUBB 1IGTB 3UTTE 5LJYH 3IMUA 4UM8A 4YEFA 4J5VA 3RRQA 4MKMA 4F24A 4APQD 2JQMA 1RJYB 3VDAA 1OOWA 1KEGL 3N1PC 5CJOL 5CD5D 5IW3A 1VGEL 5HJ3A 1IC4H 1U8JB 5C0ND 2CHWA 4D0BA 3HB3C 3MREA 1G6RH 4PLJD 4LSRL 4UV4H 1BQLL 5C08E 4N25A 3ZHFA 2OMVB 1H8OA 3KPQA 3QEUB 3A4DA 3KHQA 4UTAH 4L4TD 3HG0A 1M3IA 1SJHB 1OP4A 3EGDA 4RZCB 1BFSA 3TCLA 6FABL 4E9YA 4H8WC 3DX1A 3O2WH 5J6HA 1L4IA 1WIUA 1EEYB 4JO5A 5IK3B 3VSVA 3KNBB 2F54E 4WGKA 4LBEB 2YKLH 1AVAA 4PRNB 1W0YT 4AM0B 1S9VA 2PMZA 3FQWB 4P57B 1TZOA 2DL9A 5EFIB 1A3RH 3TBBA 3G7TA 3BPNC 4PG2C 2Q8AL 5HY9B 1J9CT 2JK5B 4JR9L 4I1NB 4K7PL 2ZP0T 1I1FA 3M07A 1F3DJ 3ZDZF 4EMZA 3MNZB 4H13C 1INEH 3GMOB 4RVBA 4JPVH 1EGJL 3ABGA 2P8LA 1G7IA 1ZHBA 2VDPB 3BVNB 5FFOA 4HOMA 3N42F 2AI0H 3I6KA 2P7TA 1QLRB 4IRSA 5J7CC 3IPEA 4JQIH 2IPUG 1OVZA 4U1LB 4KFMA 4JFXA 4G11A 1HT6A 3JBG7 1OAXL 1PYWB 2Z31C 4IOSA 1MWAL 1OAQL 2H5UA 2DQHL 3MHZA 2H8PA 3DJZA 5HTSA 5GS1B 1Z66A 5GISL 3RI5K 1XVSA 4YXLH 1ITCA 1KTLA 2JKSA 1S9WB 1OD9A 5BS0A 5B1KA 3Q1EA 5AYUL 4GSUA 4QRPB 3E9UA 4HUKB 5F9JB 2K3HA 1UT2A 5AVUB 2UX7A 4AGPA 3U46A 4UAOC 4W4OC 5K9JL 4LRNH 2V7HB 4ZX4A 1VERA 3CC5B 4POZC 2EACA 2NYKA 3LNDA 1JK8B 4YK4C 4AEHL 3O6LL 4GKNA 3O3AA 4V11A 1ZVYA 5IOPB 1NFAA 3U0WL 3PQYD 2X9ZA 4JDEB 1MHCB 1PZUB 4HG4K 4F15B 2F61A 4H1LA 4GS7B 4MDIB 2R1YA 4Z7NF 2AV1A 2FJFA 5DO2C 4UT9H 4YZWA 3F64A 4I0KA 1T7YA 4MRBA 4BUHA 3GS4A 4ZUUA 4IBVA 4E5XG 1G7HB 2HTKC 4ZMWA 2EQDA 3O2DL 5CUSH 4A6YA 1KFGA 4XPGL 4ZOEA 2XIIA 5L9DL 2VWEC 3TA4D 3IB4A 2W59A 5F1SA 3Q06A 2NY2C 4RWHA 4FX5A 2JCCF 4R90L 3TOPA 4F57H 3RTQD 1DJZA 4L3EE 3CHRA 3G6DH 4KRPC 1BQHB 5IB5B 4QHMB 4YSQA 2OPCA 2XWBB 2A6KB 5F6HI 2K0RA 3DJTA 1FE8L 3DYPA 3PHQB 2ZJSH 1J8HA 3KYNB 4ZJ9A 3IKCA 4OCYH 4Q4EA 1UH3A 4D8PA 2OTWB 4FFZL 3J7HA 4UB0H 1CD0A 2BRRH 1JV5B 5G55A 2K6ZA 4WSJA 5FECB 1MDTA 1YEDB 5IW1A 1KV3A 2PYEE 2V6HA 3HE6C 1HWWA 3MRQA 2NY5L 4GOSA 5E00B 1HEZA 5G2NA 2YD4A 3KPLB 3BRGC 2OSLB 4FJ6A 5DDHA 5F0LB 1U8HB 3PWPA 4NP4H 5DJ2A 2X4NB 5C3LD 2E8ZA 1FV1A 1ZLVH 4B9FA 5GGRA 2V0AA 1PGRB 3MUY1 1P1ZB 4X5XA 3V0GA 4AQEB 1WAPA 1F3RB 1N5YL 3GXFA 4IS6A 4DP7X 2JB6B 5BS0E 1U8OA 4BQ8A 3MV7D 1PFOA 4GP5B 4RAVB 1LP9B 4HHWA 4MDJA 3I9PA 1QATA 3SQBA 5IFHH 4FMVA 1YEHL 2X3BA 4JVUA 3H9HB 2Q7YB 3MRPB 1ZE3C 1TQSA 4XO5A 4F7TA 4LLWA 1LDSA 2XTJE 2J8HA 5FK9B 5F3BA 4EI0A 1D5BB 1JMXA 3V6FA 3L5WA 1TPXC 5FF6B 3IGAA 2HVKA 3NIDB 4TPRH 1W0WB 4JRLA 4ZFQA 5I0VA 1NGWB 3EYSL 1L0QA 2XBTA 3WJMB 2ADIA 1G5GA 5EEVA 2JWYA 1IGJB 1CICC 3HFML 5DHMC 1EAJA 4FFZA 1C16A 2VXTL 5L8LB 2H32H 4PGCA 3LOWA 1TZ8A 4C47A 2OJEA 3DRQB 5BV7L 3VFMB 1WZLA 4MJ5A 3QUXA 1N4XL 3PG2A 4XPAH 3UTSB 4GY4A 2JSFA 3ESOA 3OSKA 4UCFA 4AMKL 35C8L 4YBLC 1EZLA 4XP9H 3UZQA 1CFSB 3P11H 3MYJA 4JAMA 4K9EL 4U6XB 5J4MA 1G7MB 2G2RB 3VGDA 1HYSD 2YRBA 2ZKHH 4HK0A 4A68A 4HXAH 4MRCA 2UWEE 3REVA 2A0LD 5C0CE 1WA1X 2EJ1A 3NFPA 1ADWA 3WXWL 2XG4B 4JFPA 3CMGA 1T89A 4PJGF 3IU4H 2OFQA 1X9QA 5F7DA 1V55B 2NY6C 2OLDA 4HCRA 2OMTA 1FN4B 5EZOH 3ASOB 1HS6A 4FNLH 4P23A 4N2DA 2EUWA 1ECZA 4UV4L 4WUUB 1MAKA 4XOCA 3F6LA 3EAKA 3ARFC 5A6MA 3VA6A 5HHPA 2P49B 2C1OA 4JFDB 5T5FH 2V17L 3RWCA 3SJVE 3D5OF 4IJ3C 1FVDA 2ICWJ 1DSFH 4HKBB 4MD5B 1S8DB 3SD5A 3ULVD 1NEPA 3B9EA 4QXUH 5DR5L 5EDXA 4DOHE 3RUGB 1A6ZA 3G5XA 3FRPG 4PJXF 4PGDA 4JGNA 1UA6H 3ILQD 5GRJH 4JHVA 4MSWA 4NAJA 3JTBA 1MI5E 5FAAA 1KCVL 1E8XA 4G1MB 3VFWB 4YHIB 2G5RA 3VFTA 2MNWA 3TV8A 1Q90A 4PN6A 5HDBB 1AGBA 2Y2WA 3ETBJ 4XP6H 3RVXD 1ERNA 2NUPA 2EVIA 2XQBH 2ZWZA 4Y4FB 1Q9WB 4UUJB 4NZJA 1OAXH 4ABVA 4QRPA 1H5BC 4HT1H 4DP9X 4Z3HA 3ATFA 4LCCC 1T1XB 4JQIL 4JRXB 3U46B 4UOQA 3ZKSD 1ZGLM 3CFNA 2CDEB 3BSZA 4MMXA 1UD2A 4BFKA 4PWKA 4F8LA 2NT0A 3ROOB 2Z65C 1S5IL 4NQTA 1QBML 1XF3A 1IM9D 1T66D 2DOCA 4R7DB 5ANME 1MFVA 3V0VA 4M1CC 4Y5YA 2VDOH 3IS1X 4JDEA 4Z7WA 4MKTA 4M5YH 5SWSE 5IIEA 2IDSA 3NJFA 2DYPB 4N8VA 4GO8A 4PLOB 5LBGA 3BPCB 2HKHH 3AS2A 2B8OT 2G3NA 1GGCH 1YQVH 5JHDD 2N59A 4BH7B 4YHPA 3MUJA 1JNHA 2VDRH 4OD2A 4U1JB 1AY1H 3RUGF 2RALA 1NPJA 3KD4A 3CZNA 2QVIA 4H26A 4WHDA 1V10A 4K3GA 5L2KE 2HH0H 2I32A 1RLBA 3FRPA 5I0XA 1RL1A 1CQKA 4G7YL 4L3ED 2KQNA 2N0KA 1J0IA 1SXSA 3QIBC 4Z5RB 5ABDE 1QLEH 1EZVX 5GS0D 3IMWA 4F7PB 5TPWH 1YN6B 1CO1A 3CZKA 3FB6B 4Y16C 1HI6B 1WA0X 3Q1SH 4K4KA 3LVTA 5T33H 4NQXA 2BY2A 3HAEH 1QABA 1MCBA 2CLVA 3DC0A 1U4EA 5DHVB 5I71C 1R3IH 4DGVH 4X98A 3VX1A 1U8LB 1A7NL 3DARA 3NYKA 3FMGL 3VXUD 5E0FA 2JKNA 1GHFL 5K9KA 3GQFA 1HHHB 3CU7A 3DX7A 5DT1H 5EV7A 1ZLSL 2H7WA 4RNRA 5JW5B 2MPAL 2VLKB 3RFZB 1J0JA 4WTXA 5IJVA 3P54A 4PRDB 4KKCC 5I0WA 2JQAA 3AM8C 5IVXF 2YBRA 3S34L 2IPKB 3VCLB 3WFEL 5DQJA 2E6PA 2H9GA 3FT0A 4P2RB 1UZ6F 1FL6A 1JWUA 3EFFA 2XRAL 3LNIA 4WUKH 2NZ9C 4LLUA 2WWNA 1ND0B 3MV7E 2BLFA 4QRPE 4S1DC 4FLRA 4GXVL 1YJDL 1X5GA 1YYLL 3QH3A 4JDVB 4WNJA 3VFUB 4RSVA 2FX9L 1DQTA 2WNKA 2LFEA 5C71A 4BFNA 1FZMA 3GMNA 4K3DL 3AROA 3NFNA 2X4RA 3SDAA 4PJCE 1M7DB 1JHLH 1KB5A 5D7SH 4IKNA 4V1DB 4PTTA 2BNUA 4JM2B 4HJEA 4YHLL 3GSUB 4BE6A 4NB7A 5JYMA 1SFDA 2P8LB 1SUHA 5B3JE 3DBXB 1CD9B 5B8CC 1RUMH 3OKOB 5F7LB 1MCJA 4B9KC 1AQKH 1BP3B 2VDML 3MLRH 1FNEA 3IBOA 1SEQL 3O3BA 4PJ7A 2MCAA 3NZUA 3WJMA 1OGAA 3FQXB 4GQZA 3N50A 3KCWA 4LFHD 4TF4A 4GAGL 1CZ8L 3D09A 3RZWA 1S9WA 2O5XH 3HG1E 1BM3L 1EJOH 4P46C 2PP7A 4NQEE 2XCMC 5A7EA 2ZTBA 3BGAA 4JW3A 4OTXH 3DRQA 3D9AL 3EHBB 2DD8L 3ARBC 2AI0L 4P23C 1JFQL 5E1GA 3VWJB 4PJHA 1OQOA 3AU1A 4PP1C 3NJVA 4K9EC 4PJAF 2Y6SC 1H9DA 2WYHA 1NAMA 1UZGA 4R4FH 1ORQA 4EI5B 2YD1A 4V2BA 3ZPDA 3LEVH 4PVMA 3WY1A 3NPSC 4A6YH 4ZYKA 5HPOA 3H4HA 3DO7B 1I1RA 2ORBL 4OW6A 4FQJH 4OKVB 2YD2A 5EZLA 3NBNA 1AY1L 4B50A 1WCQA 4OGYL 4OGXL 4KK9C 1DN2A 1NANH 4QRTB 3VFGL 2EIZA 4JFPB 1XH3B 2XT1B 2HN7A 4KXCA 3B2PA 4FLQA 1GIGL 2G4EA 2J25A 3ZYZA 5ICYA 5DZPA 3W37A 1ET7A 2EE0A 5GHWL 1FN4A 3AREB 3N6YA 4KTDL 3TCXA 4MX7B 1IILE 1UURA 5FYKU 5GGVH 5IT2L 5KVEE 4WW1B 3KGTA 1A3ZA 4HIJA 2VE6A 4JY5L 4R84A 5DRNB 1UCTA 2ZXAA 3KGSA 4AT6A 3BP5B 4MQXC 3MV7A 3ZYJA 5CMAB 3FCBA 4JKMA 2O6EA 3GXMA 5D8JH 5AB2A 5KVDH 2ZT9C 3HN8A 3Q5TA 3OZKA 2FZ3A 5DMYA 4NQCD 1XCXA 5H4ZA 3HN3A 4DZ8A 1CLVA 2HYMA 1SBBA 4IRJC 4XBGB 1KB5L 3GKWH 3LZFH 5D1XA 4DVBB 5AVZB 5I15H 4F1ZA 4YHKH 2EECA 3IU3B 4W4OA 4X0KA 3BN3B 4N5ED 5DQ9A 1D6VH 1UWFA 5A3ID 5EORL 1J9QA 5D7IB 4UU9A 3PLYA 3U6RB 1CN4A 3DECA 2OX5B 1X5AA 5FCUH 5E9NA 2NUPB 4FRWA 3RVUD 2IANA 4D0CB 1FGNH 4QOKE 4K55A 1NZRA 1JXKA 3QDHA 4PR5A 3IDMA 2K7PA 4HJ0C 3VFSB 3AT8A 3FSVA 2AAVA 1KLUB 2ADFL 2GY7B 3EADA 4XCNA 1ZA6B 5BPPA 4J3VA 4X7TB 4ZFOL 5ICZB 3CSYB 1NDMB 3P4MB 3RDJA 4BBWA 1FFOB 1XF3B 3E6FA 4LCVA 1S7WA 5AW8B 3V0VB 1N0LB 3QUXD 4PJAE 3KLKA 4N24A 1NCAH 3FCTA 3GSWB 1AOHA 2BJMH 4UINL 5G5DA 3A23A 2BSSB 1V7NH 3D2UA 1MW3A 1INDL 3IPBA 1A7PH 3KDMA 2VJXA 3EH2A 4O02L 1JZDC 4W9JC 3V6ZB 4BFGA 4L8DB 2VDOL 1KTCA 5KYNA 4GMTH 1GGUA 1BWMA 1PW3A 4KQ0A 2YRLA 1J0ZA 1R19A 2C3WA 3GIZH 3GS7A 2HUHA 5DF0A 1JNHB 4FCAA 3SEPA 3ZDZE 4H20L 3COOA 4JVPA 2W81C 2X2JA 2GEEA 4NJ9L 3MBWA 4XNQB 1VZGA 2WXGA 4YL4A 5AAMC 2X4QB 2G4GA 4IBQA 2XHNA 2GIXA 3MO1B 4UQEA 3BYTA 1CXFA 1OARL 5E8PA 5EC2B 3BC9A 3QQDB 2YAEA 4M8QA 4UYPA 1MNNA 2BH0A 4ZMVA 1SDYA 3G6JB 3KPNB 2YD3A 4FLHA 3D0LA 1KNOA 4LCWD 1ZPUA 1VRSA 2D9QB 2PTUA 4UDTB 1TPXB 1YJDC 3MA9H 4FQXB 5DEGB 5EZPA 1GYUA 4XVJL 1ZLEA 3FB5A 2JIXD 5KJRH 4PHXA 2R9HC 3UTSA 2GCYB 5HXMA 2P42B 1BQSA 3ZTNL 3QFDB 3L3HA 2XG5A 2F53B 2IAAC 4R8WL 4UANA 2L4OA 2W91A 3H54A 4RMTA 5DVPA 5IQMA 3JV6A 1DVFA 1G9MH 4JFFD 1TEGA 4UM9B 1E50A 1MRCH 2WVUA 2Z31D 3OG4B 4HK0B 4DPAX 3REVB 5AD0B 5IJVB 2EXSA 3MU3A 2YKLL 3O4OB 4F33B 4OV6F 2XG4A 1UXWA 4L4TE 4JFOB 2FK9A 4YDJA 2P48B 2B3RA 5A3IC 3GIZL 1E3ZA 4LSQL 3CH1A 4PJCB 5CGBA 2CGYA 3KG5A 1A7RH 1EEQA 2P80A 1KTBA 4PREB 1HWGB 1ZLSH 4PV8A 4E36A 5E6ID 1XAKA 1WHPA 4I18C 4AEEA 3BDXA 4FXKB 3U6XA 5L88H 1JZ4A 1DZBA 2J2ZB 1PKQB 4Y9EA 1UZ8A 1R3JB 3ESPA 3RNKA 4BSWA 4FG4A 2OMYA 2ZCHH 2D7OA 4ZBJA 2BNUB 3TVMD 3NK3A 3G08B 1JPGA 2V33A 5DO2D 1HL8A