3AXLB

Murine valpha 10 vbeta 8.1 t-cell receptor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
238
structure length
238
Chain Sequence
AVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASRLGGYEQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Valpha 10
publication title A semi-invariant V(alpha)10(+) T cell antigen receptor defines a population of natural killer T cells with distinct glycolipid antigen-recognition properties
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 238
sequence length 238
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3axlB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3axlB02
5F21B 5HSFA 1VEMA 1GGIH 5D6DC 5C08B 1RUAL 1XH3A 2D7OA 4CL7A 1ONQB 2HT2C 3QJHA 4OGAC 2CSPA 4KQ3L 2ARJQ 4ZSOB 3HRPA 4R0LB 3WO4C 3IU4L 3I3EA 2V2XA 4OD2B 1A7NL 2A6JA 4YXLL 3MNVB 4XWOD 1FE8L 3O6LH 4G6AD 4Y2DD 5SWZE 2F54A 4YUEH 4PUBH 1K5NB 2JB6B 4MD5A 4HJ0C 5DRWB 3QHZH 5E9DB 4GG6E 3VJ6A 4CVZB 5FYKL 2NTFA 1NMBH 3QI9C 2C3XA 1VERA 4FQIL 1KLGA 5JW4Q 2F53D 3IDGB 5HYJD 2ZNXA 2JCCA 4WUUB 1GIGL 5IVXE 4EIGB 1T20B 5ADPL 4J12A 1EHLL 1WT5A 4G5ZH 2D4FA 3QR2A 3HFMH 1ES0A 1SQ2N 1U92B 5BV7B 3HAEG 3L3JA 3WV0A 4L1HA 3H8NA 3G9AB 4OD1L 2G9HA 4G8GD 4GRMA 4YAQB 1NCAL 3LZFL 2OJZL 4U1LA 5K9KA 4M7LH 1CDCA 4DGVL 3CXHJ 1AO7D 1S7TB 4PGBB 1F3DH 5D72H 5IT2H 1TVHA 1AGBA 3EO9H 3SE4A 1MAJA 2CRZA 5IJVA 1TDQA 2EO1A 4ELME 1AP2B 1GZPB 3SDAA 2FD6L 1MNUH 1U6AL 5DI8B 3F7PC 3G6JE 3MLTB 5J3HC 5EPMB 3QPQC 3OKOA 4P0DA 1MCLA 5GGTA 3RWJB 4M93C 4POZC 3SDXB 3O0RH 5I30H 4N0UE 3K2UH 2ZG2A 3HI6L 5BZWB 2DQTH 3IF1B 3OR7B 1LO3H 1K8IB 1V3MA 3DMMB 4F57H 3MV7A 3UJJH 3D69A 4NQXB 4U2ZA 1RJLA 3GMLA 1O5DT 4TRPH 1ZVSB 5HYQA 2H8PA 5CLTA 4KRMB 4FQ2L 1SYVA 2YRPA 2NR6D 5E5UB 1MQKH 4F7PB 1ZT7B 3ILPA 1WC7B 2DM3A 5I1GH 5IV2B 3IU3B 2VN4A 1JPST 1EO5A 4QCIA 4OZ4A 4YEFA 3UDWC 5TQ0L 2APTA 2DTMH 2ZZUT 4H26B 4KV5E 5JDJA 3LEXB 4Z7WB 1ETZA 1B9ZA 2YMXL 1BIIB 5MERA 1IRAY 4JM2B 3O3DB 2X7LA 1NAKH 2VISB 2CUMA 4HK0B 3AMLA 1CGWA 5KOMC 5IR1B 3ZE1F 3LQAC 1T0MA 5FA3B 2ITCA 3IRPX 4I13B 5ADOH 4YR6B 4NQDB 3SJVE 2E27L 1YQ2A 2F58H 1I8MA 1IGFH 3FB8B 4XI5C 4OLWL 3TBVB 3WDHA 5D1QA 2P8LA 1TJHH 5TE4H 1C16B 3DUHA 5DC4B 4ELKA 4HUVB 1OF2A 5I6XB 3MLYH 3DPBA 5KSAB 4NFCA 3MCKA 4U0RB 2EYTB 3AROA 3IFLH 1SY6H 1RIVH 3O11B 3CLFH 3NFPB 4LCUB 1S7UB 3CVHA 2YS4A 1YQVH 3EYUL 4R90L 1QRNA 4CGTA 4GAYA 4XNUL 4LHUG 1WIPA 1JMZA 3MRIB 5EUKB 1E27B 5F93C 3LEVH 5MHSD 1Z9OA 1N3NB 1AY1H 1AXTH 2ZCHH 3QDGE 1CFNA 2BHUA 4TQEL 2P46B 4E5XA 2FECI 3QB7C 4ZUTA 5DMJB 1MHEB 1F6AA 2VZUA 4P2QA 4NYLB 5EC1B 1X7QA 1XEDA 5E00B 3FJTA 3F7YB 1KIUA 3TF7C 4P2OD 5IBTL 3LSOA 5D2NC 4HS6A 1I3UA 1NFKA 4JY6B 4WDIA 1KCKA 3B2VL 1TQCB 2GCYA 4G3YH 1EUTA 4H20L 5DJ6B 2QHRH 1U8IA 3P73A 4CVXB 1UJ3A 4P3WA 4QRSB 4DQOL 1JUFB 2VLKD 4MJ6A 4H1LH 4L9LC 4EUPA 4JHWL 4RBPK 3FQRA 2VDNL 1T1XA 5KSBA 2H2PC 3UXFA 1ZGLP 1MCCA 2OZ4L 2L4OA 3PUCA 5EORL 3FCTB 3HB3D 3QDMB 1I1AB 1RZIB 1CZ8H 4DGIH 3RNKB 3MJGX 3ULUE 1QHOA 4P46D 1MFAL 4LAJH 2VJXA 5IB2A 5EBWA 4R97B 1D5XA 1IAMA 1D5ZA 1NMCC 5KANG 3PGCA 3BKML 2W1NA 3DYPA 3HG1E 3ZLQC 3BRDA 4UZGA 4LFHG 4Q9CA 3S96A 4K23L 1GGCL 2PO6B 2OSLB 2GT9B 3ECBB 3W5NA 2FJFA 3LKNB 3SDCB 1XGRA 2DD8H 5FUZH 2X9XA 5J4MA 4DOHE 5CZKA 2XXMB 4JFYB 1X5AA 1A6UL 1NGZA 5EDXA 5FHBH 1A6AA 3OXRA 4OCWL 1OAUL 4JFFD 1OWRM 2NLJA 3UZVB 1FCCA 3SBWC 5L88H 4NQED 1I85A 4LSUH 3BAEH 4DAGL 1I1RA 1HILA 1BOGA 3V6FA 1UWEL 4JJ5A 2XIDA 1F4WL 2CGRH 1QSFA 2AK4E 4P9HL 2B0SL 3ZSSA 2FO4A 2Q6WB 5DVNA 4OLZL 4MVBC 2FH6A 3RGVB 2XZQH 1RHHA 1ZHNB 4I18A 5F72S 5EU6A 1CD9B 5GRJH 3UZQA 2R8SH 5M7QA 1E28A 3HZVB 4QHUB 2WIMA 3WIIL 1MCRA 3FQXA 1U8MA 3FO0L 5L0QB 1U93B 2OQJA 3O2DA 4NQVA 5HHPB 4AEIH 4Y5XB 3TO4D 1JYWA 3TT1H 5I1EL 1WQVT 1M6OB 5H35B 3QDAA 3S5LB 3QUYA 5KJRL 3ARGA 4PGJA 4OGZA 1FLRH 3DHMA 3I6KA 3PWVA 4KY1L 4OZGA 3GJFK 1WSST 4PJ8B 4V1DD 3C5SB 5T1DH 5I1LA 1QNZL 2YRLA 4L3CA 4WW2B 5MENA 4EI6B 4JPKH 3FRPG 1EEZA 4LEXL 4MX7A 4HXBH 4Y4KB 5MEPB 4M4RA 5SX5K 1AHWB 3I85A 1V7MH 1EX0A 5I1AA 3QO1A 4OB5H 3BJ91 7FABL 1N59A 3SKJH 2IG2L 1MCPH 5FGRA 4ORGB 3QFJE 1RUQL 2C3VB 4YIQA 2OMNA 4U1GB 1IT9H 3DV6B 3QG6B 3BZDA 5HGGS 4HWBH 1A3RH 1NBYA 4NWUL 4LHUA 5F7EL 4GAJL 3GKWL 5DUPH 3FO1A 4ZFZB 3WLWD 4BKLA 4PBWD 2EDOA 3I75B 1W8NA 2DYPD 4IOIB 4KAQH 1DE4B 5K9OB 3KPSB 3G9VA 4XVJL 3UROR 1NGPH 4KRLB 4KGJA 4NP4H 1CE6B 3OGOE 3ARDA 1A1NA 3C6LB 3MFFB 3GUTB 4RGND 3FQTA 3S3SA 5H37G 2EDYA 1J5OL 5F7LB 3V0WL 1BVLA 5DJCB 5C0BD 1ZANH 1VACB 2B7DT 2GITA 4O2EB 1IKFL 3EUUA 3CH1B 5HDQL 1MCEA 4GS7B 1KN4L 1MFBL 5AWNH 2ICES 4KUZL 1S9KC 1KCRL 2YC1A 3IFPA 1HHGA 2V9RA 4QY8B 3T0DA 3MRHB 1OQOA 2Z9TA 4KMTL 4WI3A 2VKXA 1NBVH 5HHVL 5C0CD 3I9GL 1PQZA 5C0GA 3OQ3B 5JIHA 4X4XB 4ZQKB 1NSNL 3PWPB 3OL2A 1QBLH 3MRCB 4YNYA 1XR9A 3CDGA 1VENA 2A6DB 3RTQA 4XXCC 1W0WA 1QFHA 1Z9MA 3NABL 2GAZA 2FEEL 1ERNA 2HMIC 3BPCA 3KYKL 3RWDA 3EO0A 3CMGA 1UADC 2Z31B 4MYWB 2HFEA 5F7FA 3FN0L 3DIFA 4P23C 1S7QA 2P48B 1INDL 1DBMH 1TNMA 4G8IB 1YNKH 4C56A 3G6DH 3QXVA 2BFVH 1JHLH 3PWLA 3VFVB 1WITA 4WNQA 1FZJB 1E4XH 1VADA 2IANB 1FL3B 4K3GA 5EU7E 1XF4A 4ZFFB 1IEHA 1ZA6A 3LN4B 3AS0A 1P69B 1RJZB 4HPOL 4APQC 1S78C 2GJJA 5EUOE 1MRDL 2VDLH 1NDGA 4NC1E 4YPJA 5C07B 1DUYB 1H3VA 1CLYH 1MFCH 1NEUA 5F7NC 3VXSA 1FL5A 3NGBB 4L3EA 1YN7B 4UDTB 2AP2A 1RU9H 2EKSA 4HUKB 4LSDA 3BESR 1KELL 1DQMH 2Y06H 4N8PA 5ID0B 4D8PB 3L7FA 4O2FB 2W92A 1VGEH 2CRMA 3TC9A 4JRYD 5AAMA 4TUKH 4OIAA 3WN5C 3VXMD 3ZE0F 4JKLA 4KKBD 2XACC 3LKRA 4RFOH 4PJCF 4Y19D 4WU7B 4F7MA 4LCWA 4BYHA 5JW3L 2X4NA 1Q1JL 1QVOB 4HWEL 2WUBH 3NZHH 2QADB 5C08D 4C83B 2D7TL 3MV7E 1J8HA 2EE6A 1FGVL 2B8OT 3LOWA 2QKIB 1L0YA 1F8TH 2CKNA 4XGZB 4LKCB 2FLBT 4GW1A 3O2VH 3PIQA 4YHIB 4XPFH 3A6CL 3VMNA 3ESVF 3IDIA 3MLSH 2O5XH 3R8BB 1T3FA 2C4FU 3FRPA 2PYEA 5GRXG 3TO2A 3P0YH 4M48H 2JB5H 4UUJB 1MAMH 5E9DD 5M95B 3GIVA 2BX5A 1A3LH 5DWUL 1DTUA 1QFWH 1L0QA 4OLEA 4XCNA 3ZTJH 2HWZL 1BD2B 4X6DB 2C7UB 2X4OA 2BY1A 2E3VA 4WUUD 1Q9OA 1BEYH 1V5JA 1NLDH 3WJJA 4XWGH 4HSQA 2VYRE 4S11A 1DSFH 2AJUH 4P2CG 1FNAA 4RFEB 3RY5A 5DD5H 2MMXA 4PRIA 2W9EL 3UBXA 3PL6A 1MHCB 1WWBX 4N90D 3P3YA 3Q6FA 4X9IA 4Y16C 1TZGL 3PWJA 3Q6GL 5ESVB 4QHLB 4ODTL 1R0AL 1F6FB 3H9HB 5JA8B 2E7MA 3MGOB 4S1RH 3VWKC 3QXAB 4HX1A 5I1DB 5FO7A 3BYTA 1OAZL 2RCSH 4ZYKA 2JJVA 4MDJA 2H9GA 1NAMA 2ZSVB 4PJAF 5JIKA 4FFVC 4AQOA 3AY4C 3EOBA 4LPWA 4PJ5A 4LCCA 5B38G 1XCQB 4L4TB 4OCSH 3PNWA 5D71H 5K9JH 2NX5A 4GBXB 3MRKA 4OCXH 1RULH 2BNUA 5HI3D 1PZUB 1UWGH 3DMMD 4Y88A 1ZWIA 5BOZG 2Z91A 4YHLL 3OF6A 4WHTB 1L7IL 5DJXA 3S97C 1HH6A 5F9JA 3IXAB 5TDNB 1YMMA 4YBLB 3RBGA 4M7ZB 1KJVA 2VO5A 5HBBA 3KPLA 4X4YA 5LKNA 2YN5A 2VZSA 2BY2A 2R69L 3CFKB 3MLUH 1MCOH 2XY1A 1F2XK 3NACH 2Y9RT 5EU4A 1RSFA 5J56B 5DHVA 3B2UC 2C9AA 4JM2D 4B41A 1CXKA 3G5YB 3OAUL 1IMHC 2Y6SD 5MEQA 4EZMA 5FYKE 5ICYB 4DCQB 5TQ2L 1RPQA 1JGUL 3L5XL 3RUGE 1F3JB 3L95A 3K3QA 1TCRA 1LMKA 4RAUB 1WWWX 5C0JB 3DRQB 4FQHA 4NQDD 3IDNB 5I71C 4F7CB 3CK0H 2D03H 3D2UA 2P7TB 2XQBH 2VTFA 4NO0B 2ERJB 1YEDA 3I6LD 4ONHA 5CEYB 4X98B 5AUMB 1VKXB 5CP3H 4HC1H 5JQ6H 3B9VA 4WVRA 1X6NA 1OTTC 1PG7W 3RGHA 5BJTA 4CVUA 3AS3A 3TZVC 3ZKMC 1E4KC 3ZL4H 4FFWC 4JGJA 4J3WA 4KVCL 2X89D 3U4EA 3IETA 2G2RA 5CILH 1A1MA 4RWYH 3F12A 4ZUSA 3D3VA 5IESH 2VDRL 4JFOB 4MB5A 4HT1H 3LS4H 1PDKA 2VLRB 1NGXA 2Q8BH 4NO2B 5SWSD 3LIZH 5J6HA 3Q0HA 3GSOB 4YHKL 3GK8H 3J8F7 4WTWA 2J8HA 2OR8A 1P53A 4HKJB 4WV1B 5L2JB 3EYOA 5JIIA 4GT7A 1G7HB 3ARFB 5CZVL 4ZAKD 1U2CA 1RUAH 2BVUA 4JG1L 5FYKU 1HI6A 1FZOB 1SY6A 3E0GA 4PJ9C 2D2OA 5IMMB 4KQ3H 1N26A 3UMTA 4KKAD 1G0DA 5D7KD 5AD0B 4ESKA 3IDMA 3O41A 1FL6A 1F3DJ 3RWIA 1C08A 5IB3A 4Q9RL 1A7NH 4ONGL 3DBXB 4ZPTB 3ZTNL 4YXLH 4I8DA 1FE8H 4N8VG 4HUMB 4KJYB 5SX4H 1BZQK 2MWCA 3GEWB 4NNYB 3G04B 1QA9A 3BO8A 3TPUB 4DEPB 3RY4A 3UTSD 3V5KA 4OZGE 5C6TL 1BZ9B 2CKBA 5FYKH 4WI9A 4MHHG 4FQIH 4M1DL 3F58L 4MD5B 4XTRD 1SYSB 1F6LL 3FT2A 4PR5A 4U6HA 1LP9B 5LCVL 3VJ6B 2I60L 5JOPE 5ADPH 5DA4A 5IBLC 3PHOA 4EBQL 1KLGB 1PSKL 3RWHA 1AD9B 3P4LA 4X6CA 2BXZA 1FG9C 2PO6D 4K3HA 5D2LB 1FO0A 3ROLB 4R7NA 1C12B 4FQQB 1ES0B 5F88A 3SGKC 1ZVYA 4ZUWA 4M00A 1KTLA 3LZFH 2OJZH 4XWOC 1CDJA 4LIQE 1MY5A 4H1LA 1KB5L 1EAPA 4DGVH 3EJYC 1XF5A 2D7QA 4JN1H 5DXWA 5A2FA 1HH9A 4UV4H 3SCMB 2HYMA 1DJSA 2W60A 3EO1A 5K9KB 2VLJB 5KSUB 1U6AH 4DN3L 3EDKA 4FTVE 1AKJD 2AXFA 5HGDA 1QLRA 1LE5B 1X5XA 3D39D 4CADA 4K8RD 1JF1A 2BVQA 5E94B 2ADFH 1UZ6F 5CKGA 1JFQL 3Q3GB 1YECL 3NIDF 5DRNB 1MPAL 1KPVA 2OTWA 1AGCA 4OZHA 3OKEA 3UPCA 3QA3B 2DIJA 2VAAA 2XFXB 4R2GB 2RB8A 1CFTB 4Y1AE 4I5BA 3NBNA 3KXFD 3LB6D 3MJ6A 1WAAA 4E0RA 3DI2B 1CXLA 5D1XD 5H8DA 2WBKA 2B4CL 5ISZB 1FAIL 2F8VA 4TNWF 1XGPA 5L8KB 1SYVB 1A64A 5TQ0H 4PTUB 4BFGA 4YZFF 3ILPB 2AEPL 2YMXH 4HK3J 4S2SB 2MFNA 1FYTE 1L9MA 4UBDC 4XNZB 1AGFA 3PWNB 1GOFA 3W11D 3NCJL 5DTFA 1H8NA 3G5XA 2AK1L 3BPOB 5C09E 4L8BB 1BQHA 2PKDA 4L5FL 2E27H 1PG7L 4OLWH 2ITCB 3G5VB 5IW6B 2ENYA 4P3DA 4G6MH 2NR6C 1QYGL 4GLRI 3LH2L 3QAZB 5CEXB 3WS3A 4F2MB 1M4KA 1XF2A 2AJSL 3VFUA 5CD5D 1QP1A 1TIUA 5J1TC 1SJVA 3QQ3B 1HWHB 1IE5A 5T1MB 3BIKA 1NCBL 1HQRB 3ZKSD 3EYUH 4R90H 4XNUH 1CQKA 2FEDD 3MRLA 5EFIA 1GZQA 3CVHB 4Z8FL 2J88L 3VH8A 1QRNB 2NW2A 2D9CA 4TQEH 3L1OL 3QRFM 5IG7B 3TFKC 4JG0L 4QHNB 4QRRB 4JZNA 2R23A 4C55A 2IPKB 1CFNB 1DBJL 4UIMB 1VFBB 3ZTJG 1WEJL 3JWDC 3HTLX 1V05A 4LCWE 2IAMB 3T2NL 2IADB 5IBTH 1OP9A 4GRWB 3D1MC 3TIDA 1X7QB 1JE6A 2Q1EA 5FA4B 1HXMA 3QUMA 3CUPA 3O6ML 1A3QA 1QEWA 4H20H 4G80B 3FOLB 1BX2A 5D6CA 4BZ1L 4HS6B 3IJHB 1R3JB 3KYNB 3N1MC 3BX7C 4DQOH 1DDHA 5ICXA 2GCYB 3GHEL 3H2WA 3OJDA 4P5MA 2X4SA 1U8IB 1UJ3B 1JGDA 1NMAL 2VN7A 3DROA 3JV4A 4JHWH 3C08L 2OZ4H 4MJ6B 3GM8A 5EORH 3G08B 5D7LE 5DJ8A 1J05A 3FAWA 5D2NA 5TDOA 5KSBB 2Z31D 2R1WA 1LDPL 1R3LB 4LOUD 4P2OC 4FABL 5ILTL 4PJ7B 3WE6B 4Z7VA 1MFAH 2EDDA 4K7FA 4MB3A 2R1YB 3HAEB 3FN3A 5JHDD 1JPGB 3CFJB 2H26B 3BKMH 2FECL 1WIUA 2E9BA 2BNRE 4L9LA 5D7IF 1BJ1H 3RWEA 1Q9WA 3U30B 1D5ZB 4IRJC 1HHKB 4JRXE 2WBJC 2IF7A 5J06A 5FXCH 3EGSB 3PGCB 1QBAA 4AEEA 4Z7WF 2FWOA 2DIAA 2APVA 5F7KC 4Z76B 3DVGA 3FFCA 4JM2F 5CP7B 2DN7A 4JJHA 1E4WL 4H88L 1NEZG 4PJDA 1X3DA 2UVEA 4G42B 4QT5A 1OAUH 2WLYA 3MBEC 1WZ1L 4TNVK 3T2QA 3I3BA 4POYA 2VL5A 4ZTPL 4Q9BA 4DAGH 5F1NB 4KWUA 4P4RA 4QRPE 1QFUL 1A6AB 1UWEH 4P46C 1F4WH 1IAIM 4P9HH 2B0SH 4CN6A 5EOCH 3GMPB 4MNGA 3GSWA 3TBYA 3B5TA 1BOGB 1CFBA 4PJBF 1Z5LB 1QSFB 3LN9A 5K93A 2WV3A 1FFOA 3MYZA 3H9SB 4EEEA 5E8OA 1H3XA 1FDLL 4OCNC 4J3VA 2J5LB 3WIIH 4FA8A 3FO0H 5EU6B 4DZBA 3R1GH 2Q20A 5HGHA 1A7RL 4NNPL 2KBGA 1DQQA 1NQBA 2KKQA 4GKNA 3SBWA 3S35X 1IKNC 1M7IA 4JCMA 1JF6A 1DN0B 1R3HA 3AU1B 4PJFB 4JKMA 1KIPB 1H0DA 4NQVB 5HGBB 4Z7OF 1JP5A 5E6YA 1T0PB 4N9OB 4AMKL 2P5WA 3CSBA 2W07A 3KPNA 4KY1H 3WNPA 4J3OC 5HHMD 1BD2D 2CMRL 3TESA 1QNZH 4BZYA 3DX6A 1N5AB 3GDBA 3HMXA 4KK5D 4KROC 3SOBH 2XWJA 4LEXH 3S98A 3QEQA 3WNOA 4U1IB 2AGJH 5B22A 5IMOB 2BNQA 1RUPL 1W72H 1OB1B 2Y5TB 5CFHA 1YPZF 4MD4B 1YNTA 3KPRA 1B0RA 4OJFL 3TO4C 1FV1B 1RUQH 3L9RA 1WFNA 5SV3A 4X6FA 2VE6A 3C09B 4G9DB 5KW9L 4H5SB 4NRXB 5F7EH 3HRZA 4GAJH 3GKWH 2YUZA 3MO1B 1AXSA 5MP6L 4X7FC 2VXTL 3QISA 4ODWA 4RDQF 5IQ7L 3U48A 5KG9A 4LHUB 3BGMA 4OFPA 3WXVL 4Z5RA 2BC4B 2NY5L 3FO1B 3FAXA 4J23A 1JMXA 4XVJH 5FYLD 2E7LA 3MRJA 1IGTA 4TUOB 3IKKA 1XCTA 3IJSB 3LD8B 5LGHL 4LNVA 1RZFL 3C5JA 3NCBB 4LDOB 3STZB 4GKSB 1SEBA 4HDIB 1PLGL 3C5ZB 5F7MC 4V2BA 1A1NB 5KANI 1R5IA 1IKFH 3HZYA 5FCSH 3FQTB 1ZLVH 2YSSB 5HDQH 5L2KE 2J8UA 1MLBA 4M62L 1XZ0A 1KN4H 1MFBH 5IB5B 3RIFK 4KUZH 4F7EB 4PG9B 3U36B 3WLWC 4HD9A 1KCRH 2GITB 3BP4B 5IW1B 3VXRA 5F70A 4Q7DA 2X9YA 1KCVL 4ZD3L 3OWEA 3IGAA 2YPLB 4LGSB 5HHVH 3I9GH 3BPNB 2OXHA 6CGTA 3IFPB 2GKIA 5DRXB 1HHGB 1MOEA 1FVDB 3EHBD 2QQLH 5J6GA 1NSNH 2VR9A 1PQZB 4N0YH 4PJHA 4RGNC 4XVTL 2QSQA 5GGUA 2W59A 5DD1H 3NABH 5IGXL 3FHAA 4QOKA 2AJVL 3KYKH 1X5IA 3DI3B 5K9QI 3CDGB 4HFWB 5C9JA 1QR1A 4OZIB 3EW3B 3FN0H 3MX0A 4LLYB 3P4MA 3H6JA 4NO0D 2X4RB 2AAVA 3U46B 3BPCB 4B7IA 5J9PB 2X9WA 4X7CC 4JKPL 3P9MB 1IM3B 3TH2T 4U6XB 1KPRA 1NEZA 4X6CE 2EDWA 3HE7C 4UB0H 4C56B 4HPOH 4Y5YA 1MVFA 1CICD 1XIWB 2P5EA 4NKOA 3CFDB 2Q86A 4WW2F 1INEL 1L6XA 3IVKB 2A6IA 4XXCA 1WBZB 1A6TA 2XV6B 2P8MA 1INQB 4OV5A 3DTXB 1KELH 2JK5A 5F6IC 4HAFA 3REVA 1IAIL 3B5GA 2G5BA 4HEME 1NC4B 5B3JF 2ESVE 4F9LC 3LRSB 4MD0A 2N1KA 3E6FA 3GMMA 3KYOA 4APQA 4X83A 1NL0L 5JW3H 1JI1A 3TWCL 2CUHA 1RJYA 4HWEH 3ARFD 3TJHC 3MXVL 4NWTL 4G9FB 4XAKE 4XNYL 5T1KA 3VFSA 4F7MB 2D7TH 1P7KB 3WFZA 2PTVA 4GW4A 1KXTB 4EDXA 3SE3C 2VRAA 3CFIC 1DQJA 5FGCB 4E41A 1CT8B 3T8XB 3WN5A 5KS9B 5E6IB 1EXUA 4GW1B 4TSCL 4YGVB 5FF6B 4JFQA 5J13B 2BSED 5DWUH 3EFDL 3VXOB 1T83C 3C8KB 1HKFA 3QXDB 4PP1C 2HWZH 2ADGB 4KPHL 3TCLA 5E2WH 4G8EB 5A2IH 5IOPA 5IB1A 5J57B 1KIQA 3BZFB 4JB9L 3IRZA 1JPSL 2GJ6B 1B2WH 3GJFB 4PGEB 4LSTL 2I26N 1MI5E 3W5MA 4R0LC 2W9EH 2UUDK 4WFEE 2B2XL 1PD6A 3S6CA 5GGSY 3LN5B 5E56A 4Q9QL 1TZGH 1I9JH 4NSKA 3Q6GH 2F8OA 4MSWB 4FQPA 2EEDA 3VFWB 2EYSA 4ODTH 2ATKA 3JSSA 1R0AH 2M26A 4BH7B 4PGDB 1EJ6A 3CU7A 1IZJA 1GXEA 3HPLA 3WLBA 2VLJD 1OAZH 1I9RL 2W38A 1MCNA 2FHFA 3DHJA 3CAFA 2BZDA 3QWRD 3RFZC 4Y89A 2OLDA 2XKSA 4PRHE 2YZ1A 4FFZL 4UQ3B 1HHJA 1LK3L 1BVZA 3REWB 4WWKB 4MDJB 5BV7C 3PQYE 4ZUUB 3CFEB 3ZZ1A 3PV7A 2PYFA 5EN2B 5ESQA 1N0LA 5I8KL 5E08L 4LKXB 4YHLH 2PUQT 3WFHB 1CG9B 1JI2A 5IVZB 3VWKA 1HN1A 4MNHA 2XI9A 3DYMA 4LF3A 2NY3B 3OX8A 1ZWIB 1GGBL 4Q0XL 4ENEC 5BS0B 2R2BA 5D5ME 4AJ0A 1P7QA 5F9JB 3C2AL 3SDDD 3AY4A 4DUXA 2OYPA 5CD3B 1CGYA 3VXUE 3X14B 1Y0LB 4BQ9A 4L8DA 1JZ3A 1S7WA 3SKNB 5KVEL 4NQCB 1VB9A 2EDKA 2ZUQB 4HQQL 3FB6B 4K3DH 5I8OL 5INCA 2WK2A 3L5IA 5HI3C 5TQ2H 3DMMC 3L5XH 1T04B 3HS0B 3SEPA 5LAXB 3L3DA 5D2NE 1KT2A 5I1KL 4JY4A 3CCHA 3MNZB 4BQ8A 1P7HL 1ITCA 1G9NC 4G6KL 4GQPH 3CZFB 4NZTL 1L4IA 4B0MM 1CGUA 2GK0B 1YEDB 3H7BA 4M9PA 3T2PA 4X6DF 4CMHB 1IGJA 3GHBL 4C59B 4JM2C 5BVPH 3VFRA 4KVCH 3CZJA 3FQNA 2Y6SC 3BEWA 4K7PY 3UTTB 1A2YA 2HRPL 2QBWA 5I8CA 4HKXA 3NIFE 3MRRA 2XWTB 1Q9LA 5J11B 4QRRD 5FM5O 4HMCA 3F12B 4ZUSB 1IAKB 4J8RA 1D6VL 4HHAA 2F9BT 5AG8A 2YUVA 2IAMD 5I6XC 4YHKH 4GG6B 5KSAC 1P4LA 4U0RC 4X5LA 1NLBL 2JJWA 1NGXB 5CSZA 3TZVA 1E4KA 2B1AL 3QWQB 3VA6A 2C4FT 1AIFA 3MOQA 4MJIE 4MNQA 5IVXB 5ANMA 4HIIB 1OAKL 5CZVH 1U42A 3QEUA 2VZVA 5DURD 2MTPA 1MRFL 3KWWA 2IC2A 1LO0L 4LBEB 1X44A 3DOSA 4Q9RH 5IEKB 4ONGH 3ZTNH 4LEOB 5ENWA 4ODUA 4TULL 4HCRL 2QR0B 2NY2D 5E2UL 1AD0A 5IB3B 2P5WE 5GRWA 4L9DA 2HA1A 4PRDA 5C6TH 2ZPKL 4POUB 2BVOB 2ARWA 5CINL 4ZFOB 4M1DH 3VXQB 4P2RB 3F58H 4CMMB 4PJEE 3BO8B 5I19L 4ELMB 1TQCC 5LCVH 5DJDA 3QIUB 2I60H 1ZLVK 1Q0YL 5TGBA 3O4LA 1W2KT 4PJ9A 3MOAL 3DURB 4HKBB 5C0AE 1YEFL 4KTDL 3LCYA 1TTGA 4KKAC 3MUGA 4W68A 4AENA 3QWOA 2PNDA 1FIGL 2C4XA 5FKAB 5E7FA 3TP4A 1KB5H 5F88B 5T1LA 1B6DA 1I1AC 3KPTA 2JIXA 4JFEA 5GS1B 1I9EA 2F74A 1CLZL 4X6BB 1X5HA 3MJ8B 1EAPB 4U4BA 4XTRC 5B38B 4R97C 4DN3H 1J86A 1NPUA 4E9LA 5FO9A 1CFQB 3FT4B 2VXVL 3H9SD 3BIAX 2CIKB 1O0VA 1X5GA 1YECH 2PO6C 1P9MC 3SGKA 3B6SB 3RA7L 3SDCC 4DKFL 3BZ4A 1K2DA 4WHDA 4Y2DA 4CADB 5DD6A 2ZOLA 4U1NA 1EPFA 1JF1B 4HWUA 5HHOE 5KVFL 1JNHA 4JM4L 1Y18B 1QPPA 4K9EL 4BSVB 1PKQA 2BHZA 2FSEB 1JHKL 1YC8A 4NDMB 1AFVL 4WHYH 1CFSB 1DL7H 4RFNB 1T5WA 2DQJL 4S1SL 3MJ7A 4NM4H 4I5BB 1NKRA 3MJ9A 2B4CH 1MELA 1FAIH 3DX8A 3FT3A 3GSUA 1DQLH 3KS0H 2VDMH 4PRBB 1A1OA 3RGVC 2AEPH 3DVNB 4K8RC 2C1OA 4G8GA 2R0WL 1NCCL 4PJHE 4CNIA 4P4KB 3NCJH 3PGDA 3PDOA 3V4VL 1REIA 3IFOA 4QOKE 2AK1H 5L0QC 3IS1X 4L5FH 4Y5XC 5D96B 5GGRB 1U8QB 3MYJA 4XHJD 5IK3A 1HE7A 1QYGH 2OR9L 3MXWL 3NIGF 3BH9A 5F7YC 4E42A 3A67L 1RK1A 2H1PL 4OD3L 2EDJA 3KLHD 1ACZA 2AJSH 4J1UB 4KK8D 4PJ8C 5ERWB 1HYRC 3IXTA 5T5NG 5HYIA 4WEBH 1X5FA 2UVFA 1NCBH 4WW2C 5DA0B 1JYXA 2CLVA 1JBJA 32C2A 3K4AA 4XRCA 4R3SA 1FN4B 1LP9F 2FIKA 3QO0A 4OFVA 4OUOA 4Y4KC 1AHWC 4JO3H 5FHAL 5E1AA 5CJXC 2BSSB 3W11C 5DK0A 2J88H 3O4OB 4XNXL 1OAQL 1TITA 2Z8SA 4AIZB 1RVFL 3KNBA 3L1OH 1QSEA 3WIHL 5EFIB 4MHHI 4JG0H 1GZQB 5GPRA 2V17L 2D4DA 1OAYL 4HIHB 2IQAA 4U1GC 1W72A 1DBJH 4TSAH 3C5ZD 1EIBA 4WRLA 3ARYA 2AABH 2QL1A 5IF0A 1WEJH 1JGLL 3QDJE 4OUUB 3RWFB 2W0PA 3T2NH 1MAKA 3TYGH 1V3LA 3O6MH 2GI7A 4OCYL 5GISL 1HZHL 3GRWH 4M7KL 1S7XA 2BSRB 2D3VA 3KGRA 4NJAL 1SJHA 2CUIA 1OP5H 3ALXA 1F4XL 2YPLD 3HG1B 3STLA 4D0CA 3FONA 5DS8A 3MRBB 3V4UL 1NUNB 1MJ8L 3GSXB 5H2BA 2J1KA 3GBML 4N8VB 4HUUB 1BX2B 5HDOA 4GMTL 3NMEA 1NMAH 1JGEB 4MLSA 1A6VH 1QRKA 3AAZB 3BMWA 1H5BA 5DK3A 3C6LC 1CI5A 2X4QB 5JR1H 1TJIL 3C08H 3V52H 4PJCA 5EOCJ 2PXYB 5TDPB 3RL1B 3DGCR 4U6YA 4PJIF 4YDJB 3T3MF 1PKOA 3S36L 1MLCA 3N50A 3ZDZF 4HFUL 1B0GB 2NQCA 4OQTL 4ZTOH 3ZT7A 1LDPH 1I1CA 2E8ZA 4QEGA 3OKLB 4GS7C 4W4OC 4FABH 1CD0A 4WFHE 1FZKA 3O3BA 3QCUL 2AK4B 2X1OA 4LFHD 3VDBA 2R1WB 5BRZE 1M1SA 1QUNA 1ORSA 3ARTA 4M9OA 4U6VL 3MRQA 4Z7VB 3S4SG 2OP4L 1XIWD 2X40A 5A3ID 1FG2B 3W2DL 1S3KL 3W39A 3JTSB 3VRJB 1E4WH 5DYOA 5FV2A 1YJDC 2Z0BA 4H88H 2AV1A 3QXUA 5BXFB 2FWOB 2EYRB 4P2OA 1WZ1H 5JOFB 3DVGB 1G7MB 4ZTPH 1NC4D 1S9WB 1D5BB 2YKLL 4LQFL 4QRTA 3AM8C 4RMQA 1QFUH 2A38A 2RR3A 3QZWA 1RZ8B 3BKJH 3MROB 4P57B 1ZT1B 5JQHC 5IIEA 4GUPA 4I2XE 2HLAB 1HOCA 2AJXL 3WEXA 2OCFD 4U1SA 2R2CA 4IRJA 3HZKA 4GJTB 3W0WD 1UXWA 4C58B 2VLKA 4HJGA 3GMNA 1YDPA 1QTYT 3OKKB 1J1XL 5C0DA 4RNRA 3C8HA 4G9FD 3OBAA 1FDLH 2NW3A 3PHQB 2WP3O 1D6EA 3NGBC 4RGMB 2ATPB 3FHQA 3WIFA 4ALAL 1VFAA 1T0NA 2H3NB 3MBEA 5IWLC 4OLUH 2ZUUA 1A7RH 4NNPH 2X4PB 2XNAB 5BO1L 2DKSA 1D7FA 4PJAA 4X6EB 4Y2OA 3JUYA 4A6YB 1WF5A 4P46A 4H8WC 5E6ID 4KTYA 1RMFL 4D9RD 1A9BB 4R4BA 4OLVL 1R3HB 3QUZD 2DQHL 4FRWA 4AMKH 3QP3A 5AZEL 3LKOA 5ETUA 1DLHB 1AC0A 2BERA 3MODL 4GRWF 1CDGA 4O00A 4L4JA 1OSPL 1AR2A 3SKUD 2EIBA 1JZ6A 4ODVH 4LSRL 2D7PA 2QADC 1BHGA 5F7UA 2GJ6D 3GZKA 3THML 1F90L 2Y36H 2Q76B 5B8CB 1RUPH 4MZ3A 3RX8A 5CBAB 1HSAB 1HWGB 3QEQB 1IKNA 5IHUL 1U95A 1JNLL 2G5RA 1JTPA 4PD4K 4OJFH 4NQEA 1Z9LA 1BFOA 1KCSL 4X0KA 4ACPA 3QIWB 3VWJD 5KW9H 5I16A 2BMKB 5IMLA 1BP3B 4KKCD 4NT6A 3OKYA 5MP6H 2VXTH 4JFXA 4X6FB 5DJYA 2QQQA 4M1GH 5IQ7H 4NO5A 5D70L 3WXVH 2NY5H 4PJ7F 3S35L 3DXAB 4ODWB 1W8OA 5KBNC 4D0BB 1TENA 1QQDB 3X12B 3TO4A 5DQ9A 5F1IA 2OI9B 4HW6A 4GG8B 4JQIH 4MQSB 5JUEL 3B9EA 1QLFA 1XCTB 5EBLB 3BDYL 4MJ2A 3C5JB 1PLGH 5IHBA 4OF3A 5FDWB 3ELAT 5BVJB 1G0XA 5C3LD 5BS0D 3QJFA 2MKWA 4V1DA 4RQQA 1ADQL 1SEBB 2FLRT 4PY7A 2WANA 2FZ3A 3P40A 4JFHE 1OGTB 1KCVH 4ZD3H 1P84K 2HKHL 4NQCD 4F33A 1MFDL 2A73A 3LRGA 1A7QL 5ID1B 5C0FB 2VDKL 5EUOB 4GBXC 1WWAX 4XHQA 4YXHL 4UOW1 3VRIB 1ZTXL 3OB0H 2XICA 3B8SA 3E8UL 2VH5L 4Y0GA 1WZLA 4NRYB 4M3JA 4XVTH 5J6GB 2GSGB 2V5TA 5F8QC 5IGXH 3K8MA 5HI4D 2AJVH 2APXA 3MSPA 1XF1A 4YBLC 3MA7B 5IM7B 4DZ8A 2F5AH 4I3GA 4HV8A 1OVZA 3RPIA 3RDTB 2D0GA 2DYPA 3CC5A 1OTSD 1HCVA 3VD3A 1IEBB 2ADIA 2XG4A 4JKPH 5EZLB 3P4MB 4QRQB 4X7SL 1UB5A 4HPYL 3TT3L 1H3UA 1T1YA 4F58L 4AT6B 5F7HA 3UPRA 2DM4A 3CXDL 4LNRA 3EHBC 3EBAA 2IH3A 3FQUA 1KPRB 1NEZB 1G0YR 2DLHA 5DSCA 3IB4A 4Y5YB 1OP3H 2P5EB 3EYQC 4WHYG 4XBEL 5C0BA 2Q86B 2ZUYA 4XVUD 1RQ5A 3O3AA 3BP7B 3HR5B 1A6TB 3LKSB 4ZPVA 5SWZD 3X17A 2P8PA 4OV5B 4GQ9L 1FSKB 1LEGA 3B9AA 4IJ3B 2JF1A 2ERJC 3SY0A 3FB5B 2UWEE 5C0CA 2LFGA 1U8HA 2GTWA 1FGNL 1MJJA 3F7VA 1NFDF 1J1PL 4HIEA 2CLRB 1LD9A 3TWCH 1DVFD 3OR6A 2A74A 3MXVH 5I17B 3KYOB 4IHOA 4XNYH 4QHMA 1F42A 3GIZL 4PYHA 4F3FB 1CWVA 1FNGA 2FL5A 4Z77A 1GJIA 4XT1C 1UCTA 4Y5VB 1AXIB 4R7DA 1OY3B 3QXWA 2QJDA 4JO2L 3F8UB 5E2TL 3N06B 5EOTA 1AE6L 3T0WA 1E6OL 3VGEA 4AH2A 4TSCH 4FZ8L 1T6VN 3EFDH 1I3VA 1LGVA 1T2QL 4LVEA 2I9TB 5DVKA 4P2RD 3QIUD 5GGQL 4WV1C 5ICZA 4XC1H 3MRNA 2Z4QA 1FH5L 4GSDL 3O8XD 4QYOA 3ARFC 4JB9H 5C0EA 4UTAL 4NCC1 2HFFA 1JPSH 4YJZL 2YD1A 4LSTH 3PP4L 4LCIL 1CE1L 3QEHA 2FYYB 4FQ1L 2B2XH 5CJ8A 1UEYA 4TUJA 1OGAE 2SEBA 2R4SL 2ZP0T 4JRYA 3EOAB 2I5YL 2ICEA 1T83A 3VXMA 5FGBC 1HEZB 4Y19A 4DEPC 2DM7A 3BE1L 3DGGB 2XPGB 2OR7A 1I9RH 2NNAB 4OZIF 2ATKB 5C08A 4FFZH 1Z0MA 3FFDA 4LHQB 4ZSOA 4R0LA 2CDGB 2NY4D 1KN2L 4OV6F 1QSEE 2VUYA 4OD2A 3GBLA 5CJOH 3MNVA 3WFBL 5I8KH 3L3GB 1K5NA 3FTGA 5DRWA 1DZBA 5E9DA 3L3HB 4KC3B 4WTZG 4CVZA 1NBZB 5IVNA 2WUCH 1ZAGA 5CGYD 3U7YL 1S9VB 2DIBA 3SCMC 3C2AH 2YHGA 4WUUA 1MJUL 4LF3B 1ZS8B 3K2MC 1T20A 4PRPE 4W6WB 5L6YL 1JV5B 1KB5A 4RDQG 1U92A 3SE4C 5KVEH 2RGSA 2NY6B 2P49B 1G9MC 1C1EL 4LGPB 3CX5J 1CGSL 5IROC 4YAQA 4HQQH 5I8OH 1T89A 3RKDC 4HG4J 3H7LA 5E8DL 3QDGD 5AYQA 4R2GC 3EIFA 3GMRB 5I1KH 3U9PL 1S7TA 4HH9B 1S9XA 4PGBA 3NIGE 2QEJA 3HCVB 1DR9A 4O2CB 5HXMA 1H15B 4ISVB 1AP2A 3L3DB 1GZPA 1BAFL 3QNYB 1RJCA 5JXAL 5KS9F 1F97A 5DI8A 4ZO8A 3MGTB 3MLTA 5EPMA 4NZTH 4O51B 5J1SC 1CR9L 3G6AB 4RRPG 5GGSB 3RWJA 3SDXA 1CVRA 2R9HC 1RZKC 1B4JL 5BZWA 1SM3H 1P4BH 3GHBH 3OR7A 3DMMA 1K8IA 5T33L 1KLUB 1UENA 4XNZC 5E6ZA 5DMKB 1GGUA 1JRHI 4NQXA 1KPUA 3H7BB 4RMRA 1ZGLM 1IGJB 3BPOC 1VFMA 1ZVSA 3QHFH 1CBVL 3BEWB 3LQMA 4F7PA 15C8L 1A5FL 1WC7A 2P42B 5IV2A 3QAZC 5D7IA 5FV1L 4BELD 3ULUD 5I9QB 3ZYIA 4FXKB 1NLBH 4H26A 2A0LD 4Z7WA 4MA7L 2B1AH 1BIIA 4JM2A 3O3DA 5BQ7B 1X5JA 2VISA 3AS2A 1OAKH 3HG1D 4S1DD 5FA3A 1DUZA 1MRFH 4YR6A 4NQDA 3T08A 1LO0H 3GJEB 2XZCL 4XMLH 2DBLL 3FB8A 4M6OL 5A16B 3TBVA 2DI9A 4QXGL 3WS6A 3KWWB 1C16A 4HUVA 1KEGH 1ODAA 1UCBL 4TULH 2PXYD 3HI1B 3VXTB 1LO5B 4PJXE 5E2UH 3MLWL 1J7VR 2EYTA 1UB6A 5F1OB 4K7PX 4YHOL 2IAMC 2HTLD 4P5KB 2E6PA 4LCUA 1S7UA 5CINH 2BY0A 3RJQB 2EH8H 2AK4D 5K33A 3TNMB 1WICA 4PRDB 1FVCB 3MRIA 2X89A 5EUKA 1E27A 4BQ6A 4WJ5A 2NPLX 3MV9E 2FRGP 3B9KD 3MOAH 1N3NA 1QBML 1YEFH 4KTDH 4BQBA 3GRWA 5TGBB 4Q97A 4NQEE 1T7WA 1UJ3C 3K8LA 5HVWA 5B39G 5E00A 5SWSA 5BZDB 1UZ8B 1NCTA 3F7YA 1FIGH 4Y1AB 1T21B 1CDYA 2NYYC 3BUTA 3KS0J 3TCXA 1XR8A 4JY6A 4TOYL 1TQBB 1CLZH 2AEIT 4M43L 5DJ6A 4HS8L 5T1LB 4P5TB 4CVXA 4I0CC 4ZAKA 4W4NA 3V6OC 2Z8RA 3DSFL 1YPZA 2DRUA 2FJGB 1JUFA 3GM0A 4Y4FD 4PLNC 4WTZA 2VXVH 3BKCL 1PY9A 3ZYZA 1XGQB 3U30C 1ZA3B 3AC0A 4OZFH 1P4IH 1U8NB 2JJUA 3RA7H 4YBQD 5AEAA 2WWKT 3FCTA 5KVFH 4JM4H 5C09B 1FFRA 1HIML 3GSNL 1I1AA 3RNKA 2GTZB 3UTSA 3QFJD 1JHKH 3RP1A 4Y2DB 1AFVH 3V8OA 5DD6B 3EZ8A 2DQJH 1OP3K 4NNXB 4OI8A 1IL1B 1IQWL 1JNHB 4S1SH 3VFGH 1YEGL 3MRGB 1PKQB 2VDOL 4JPIB 3BKYL 3EZJB 3HI5L 1UKQA 3GNML 4I4WA 3E2HB 4MA8L 4GG6F 1J0JA 4YDIL 2F53B 5HYJB 4R8WL 2PO6A 1P9MA 5KOVC 2GT9A 3ECBA 3IFNL 3LKNA 3SDCA 2PR4H 2R0WH 5ABDE 3KYMB 4OQ1A 4U31A 5IVXF 4K3JL 4JFYA 4JANA 2J5LC 1U0QA 4MAYD 3V4VH 1NC2D 1BJMA 5JZ7D 4P59L 1U8JB 3KR3L 5EO9B 1KYOK 3HUJE 3WHXB 3BPLB 4ZNEA 2APBA 3MXWH 2OR9H 1AO7B 2Q6WA 1AKJA 3A67H 4WFGE 1CD8A 3FB7A 2H1PH 4OD3H 4ZNCD 1X6LA 3RGVA 4GH7B 4NKMB 3JWNC 1I1FB 3E6HB 2ARJA 3HZVA 3DXAD 4QHUA 4ELMF 43C9B 4R4FL 5FHAH 4GW5B 4HGWA 4AG4H 3G6JF 5HHPA 4Y5XA 4XNXH 1OAQH 32C2B 1JHTB 5D7JD 4UDUB 2FIKB 4C4KT 1M6OA 1JTOA 3JTTB 5H35A 3S5LA 2V17H 2CXGA 4O4YL 1OAYH 4N8CL 5D1XA 1NCUA 3JWOL 5HYSG 5EOQL 5D7LB 3C09C 3EYFB 2IQ9L 4ODXB 1JGLH 3C5SA 4OCLC 3TN0B 1T5XB 4WW2A 4GRLB 4EI6A 5IF0B 5GISH 1HZHH 4M7KH 1K85A 4NJAH 5MEPA 4KJQD 1I8IB 5CJXA 2BNRB 2HFGL 2ZUWA 5JPMB 3V4UH 1MJ8H 4WO4B 4JGMA 4JRXB 3ULUL 4M1CC 2DI8A 4NKIH 4RAHA 3LD8C 4KV5F 1GC1L 3BQUB 3D25A 4GMTH 4RCAA 1UACH 5EWIL 5J89A 4GLRH 2C3VA 3TBTB 3DV6A 3QG6A 1TJIH 3QPXH 5FO8B 5EZIH 5BW7A 1KJ2L 3S36H 1H5BB 1I75A 4HFUH 1S7SB 3F6IA 5GZND 4MMZC 4ZFZA 4JPWL 1XGTA 3I75A 4PJCB 4QRPB 4HULB 1CDHA 5K9OA 3QCUH 3QH3B 4HUXB 3V6ZB 4U6VH 3A0OA 1YUHA 3BPNC 5T3ZL 2Q87A 1CE6A 2OP4H 3MNWB 2J4WL 3HR6A 4NBYB 3GUTA 5DD0L 3W2DH 1ORSB 3MV7D 4LSSH 4L29A 5DJCA 3HAEH 1VACA 1ND0B 4O2EA 5GRVK 5J12B 2X44D 1UA6L 3ABZA 3CH1A 1HHHB 1KC5L 4W4OA 4MDIB 3VFTB 1FCGA 2V9TA 1NFIA 5DYOB 1Z9SA 4OSUL 4AIXA 3A6OA 2DKMA 3QG7H 4QY8A 1PYWB 3MRHA 3MUY1 3RVWC 4Q6YA 5GS0L 3MA9L 4ZSOE 3M17B 4Z7NE 4H0HB 2XTJC 1C5CL 1J1XH 4X4XA 4ZQKA 4YHYB 3PWPA 1N6VA 1G1YA 1XIWC 1HOCB 2A77L 3MRCA 3P0VL 3WEXB 3GBNL 4U1SB 5JW4R 1UXWB 4FS0A 4HJGB 1EMTL 4DKAA 4X4MA 4ALAH 1JPTL 2QLVB 2Z31A 1VA9A 1PGRB 1J18A 5GSRB 3HZMB 1KJ3L 4NFDA 3VFVA 1RMFH 4ONFL 2IBZY 2IANA 1FL3A 5JHDA 4PJAB 4ZFFA 2DL2A 3LN4A 2DQHH 5AZEH 2DLTA 5EIIA 3VU2A 3HC4H 4HXAL 3ULUF 4O9HL 3ISWA 5EB9A 1ZHLB 3MODH 1OSPH 5C07A 3WFCH 4AL8L 2Q7YB 1N5YL 4LSRH 5KVDL 4UDTA 3THMH 1CD1B 1F90H 5IWLA 3BI9X 2WWKO 4LSPH 4CBPA 5ID0A 5F97E 3GSVA 4JZJB 5D1ZB 1JNLH 4D8PA 1Z3GL 3LEYL 1RURH 4FHBD 4OAWB 3EJJX 1NDMB 1TXKA 3MC0A 1IAOB 2XOTA 1KCSH 5E6IC 2MQ3A 1TCMA 5FOBB 4JFFB 4UT7L 4JAMB 5J13C 4WU7A 5L2KB 1CCZA 4PRAB 3ZSTA 4R96B 1QVOA 5D70H 3HC3L 3I84A 3BXNB 4J3TA 5IMLB 3T65B 4C83A 2FO1A 3S35H 4G7YL 4S0TD 2BVYA 5HYSA 2QKIA 3EKCA 4XGZA 4LKCA 2MNUA 2O5ZL 4G6JL 4YHIA 4ZO9A 2ZUVA 3WJJC 5FYKD 4M4PA 4QTHB 5E8EB 2YUXA 3VW3L 1VPOL 2YA1A 4JFDE 5JUEH 4TYUA 1FRGL 4UUJA 3SDYL 3BDYH 5F1IB 1OT1A 5ACMA 2I25N 3VFPB 4K94L 2D0HA 3L3OA 1BD2A 4MA3B 4X6DA 4KKCC 1ADQH 4UV7L 4EOWL 2YBRB 1UWXK 2BHYA 1YY9C 4UMGA 4HZAA 2HKHH 2NY6D 2WZPD 1MFDH 4RFEA 1A7QH 3GMOB 4WWKC 2IALB 2VDKH 5DZNA 3SO5A 1FNFA 1JWSA 1UM5L 1NANI 4YXHH 1I8LA 4C4KO 1KF9B 4F33B 3L6FB 4YHNB 3E8UH 1ZLUK 2VH5H 3BH8B 2V7HA 5ESVA 4QHLA 4EI5B 3QI9B 3H9HA 3MGOA 4JFZH 3QXAA 5I1DA 2NY3C 2R1XB 4NQSB 1HDMB 3N9GL 1HKLH 1DANU 2ZSVA 1DBAL 3FMGH 3QFDB 5FUCE 2R2EB 2YXFA 4I1NB 2K1MA 3S4SB 1XCQA 4L4TA 1GSMA 1KLFA 3L5WB 4LPCA 4OZFG 5AAWA 3M8OL 1S5HA 3CC5B 2WWMC 4N1CA 1ITBB 4F58H 4NN5B 5JMRA 2EXWC 3DWTA 2UZYB 2ZUQC 5K59E 3DSNA 4RBPH 4O58L 1UB5B 1RZ7L 4LSVL 5DUBB 4KTEL 4BFEA 4WHTA 3D0LB 1T1YB 3IXAA 5TDNA 4XBEH 4LNRB 5I1HL 4X8XA 5GGTL 5HGAB 3WSQL 2VLME 5A2LH 2FATL 5C0BB 4UILL 3WHE1 4GQ9H 1CIDA 1CTNA 2Y4SA 3CFKA 1BFTA 3HE6D 1CF8L 1IGIL 3FO9B 2EECA 1FGNH 3CFCL 4UNVA 1J1PH 3KYAA 3G5YA 2D7NA 4ODSL 5JOPD 3DV4B 4CMHC 5ICYA 1PFCA 1ZXQA 1F3JA 1MJJB 3DUUB 3AREB 4QGYA 3GIZH 2FJHB 4MAUL 4RAUA 3JV6B 3QDME 5C0JA 4OM0H 1B6UA 3DRQA 4PBVC 3IDNA 3CLEL 2GK2A 3OR6B 3OTTA 4X9BA 1MI5B 4F7CA 2A74B 3L7EB 4ZUVB 12E8L 4ONOA 4P3CL 1CU4L 4XVUC 4JO2H 5J11C 3PDGA 2N7BA 2P7TA 2OMBA 4NO0A 1WWCA 5E2TH 5I18L 1E6OH 1IC5H 2FR4B 4X98A 5AUMA 3M45A 4FZ8H 1VKXA 1P2CB 1B3JA 1T4KA 4WI7A 1OD9A 4Z7UE 1T2QH 3ARQA 3VE0B 2X4UA 1CICA 2ZOKB 2AQ3A 2W91A 5CLWA 5GGQH 2GUOA 4FTVD 4CJ1A 4YBHA 1A21A 4GSDH 4PRHB 3MLVL 5EC2B 4UTAH 3B3IB 5L9DL 3PQYB 1EEQA 4JFOA 3CX2A 5IJKC 1CE1H 1HSBB 4WEUD 4FQ1H 5EUOF 2HFFB 3K8KA 3QSKB 4OGYL 5JLZB 3BGFC 1XFPA 3JV0A 1K4CB 4P49A 1MJ7L 1JZ8A 2R4SH 4NO2A 4Y1AD 4KRNA 3GSOA 4PB9L 2I5YH 1R3KA 1KXVC 4U3CA 5JNYB 1Y6NR 4PV8A 3EOTL 4NIKB 5E5MB 5D5MB 3ALWA 4HKJA 4WV1A 5L2JA 3LS5H 1FZMB 4KK9D 3VXMB 2CXKA 4KJWD 4P5TD 1G7HA 3ARFA 3QIUC 4L1DA 2K7QA 1EHXA 1FZOA 1OTUD 4W6YB 5IMMA 5AD0A 4MJ5B 4Z0BH 2BCKB 1KN2H 4IIQB 3TA3B 1FYTD 2C5DC 3MCLL 3DBXA 3HLAB 4ZPTA 3RTQD 4M5YL 3FFDB 3MZGB 5CJBA 4KHXL 4KJYA 3ILQD 4NNYA 4X7DC 3G04A 5C09D 3SGJC 1CDUA 5FGBA 3PXHA 3TPUA 3MREA 1BZ9A 1KEML 1EV2E 2VDQL 3BOVA 3FN9A 4JEGB 3U7YH 4DGYH 1KBGL 3FTGB 1MUJB 3V4PL 1SYSA 1S5IL 5D9SB 5GS1C 5H37H 1LP9A 4MXVE 4UT9L 3T3PF 4B7LA 1MJUH 2HVJB 4CVWA 3V5HA 5L6YH 1BQUA 3MACL 1AD9A 2DQEL 4N1EA 5C92A 1F11B 4TNVF 2WINB 5D2LA 3W9DA 1C1EH 3QUKB 4XBGB 3K1KC 3ROLA 2ORBL 1C12A 1KB5B 3ARSA 4FQQA 5MI0B 3SQOL 4U1HB 2V2WB 5GS2D 5E8DH 1KTKE 2ED7A 2XN9E 6FABL 3FZUD 4YC2B 4X8JB 3U9PH 4QNPE 2MQCA 2VIRB 2V6HA 3AXLB 3P77B 3SCMA 4LVHB 2VLJA 4RFNC 2C3WA 4YWGL 5CGYC 3KPSE 4JPVL 5KSUA 1BAFH 1JYNA 3QWRA 1S9XB 1IC7L 3B83A 4LCWD 1FFPA 1MCJA 3C8DA 1LE5A 5LQBL 2HT4D 1CR9H 4TN9A 5E94A 5IROA 3VGGA 3Q3GA 1B4JH 3BD4A 5DRNA 1PG7X 3RWCA 1MHHB 3R0NA 5T33H 5F44A 3QEGL 3QA3A 4QKXB 4P9MH 5EH1A 4DN4L 2XFXA 4PJIA 3ZDXE 4JHAL 4P4KC 3UYOD 1CFTA 4FG6D 3D48R 4FZEL 3RVXD 2WIIB 2P44B 3WUWG 3RZCB 2FB4L 5ESAA 1LNUB 3PF2A 5D96C 1KPUB 4RZCB 15C8H 4TVPL 1A5FH 5D7LD 5BOPA 2X4TB 2DQCL 2MPAL 5ISZA 5DT1L 2JE8A 2BP3A 3O2DL 3TN0D 4PTUA 4GRLD 2YOCA 2V7NB 4MA7H 1LE9B 4PJEB 4S2SA 1T1ZA 3PWPE 1RZJL 5D7IB 1U9KA 3N1QC 3V0VB 4XP4L 4UT6L 4N5ED 3PWNA 1MVUB 2BNRD 3VGDA 4X4ME 1QPXA 3O45B 4WO4D 4JRXD 5C0AB 4L8BA 2XZCH 3BQUD 3DRTB 3O4OC 5JXED 1EZVY 4M6OH 3HNTL 3U0PB 1DUZB 3E3QC 3G5VA 1GAFL 4QXGH 5IW6A 1KOAA 2H32H 2IANE 3RUGF 5CEXA 4IRZL 1X4ZA 4LLMB 3MLWH 1QR4A 4F2MA 4LPXA 4NKQB 4YHOH 1F3RB 5DR5L 3QQ3A 4QRPD 5T1MA 3U0TB 5C07E 2A0LC 5TH2B 1HQRA 4PJBB 1UB6B 3VMOA 1JRHL 4XCFL 3B9DA 1BPVA 4OT1L 1D5MA 4LIQL 4S1DC 4URTB 3UX9B 1QBMH 4XPBL 1HK6A 5IG7A 5DJ0A 3RIFF 4WJ5B 4QHNA 4KK6D 4QRRA 3V95A 3HMWL 2IPKA 4V2CB 4TTDD 5HHOB 4UIMA 1VFBA 1T66C 4BZ2H 2PXYC 2IAMA 2IADA 4ZS7L 1VFUA 2E5EA 5FA4A 5DFTA 5SWSB 2H45A 4TOYH 4MA1B 1A6WH 1BIHA 1KV3A 4HGMA 2WQRA 4G80A 4M43H 2YK1L 3FOLA 4HS8H 4X5WB 2DMBA 4LLVB 4NUJB 3IJHA 1CTOA 1R3JA 1XR8B 1U3HB 4NQUA 3H3PL 3KYNA 5E4EB 1B4RA 1MHPL 4XP5L 4FMFA 4PJGE 3U7WL 3BKCH 4XP1H 2W9DL 4ZAKB 4F37K 3X3FL 1BFVL 1YPZB 4K7PL 3TVMB 4UNTA 4XNMA 3B43A 1VSCA 1JWUB 3G08A 3MV8E 3IDXL 3RBSA 1R3LA 2A2QT 3TBSA 2VXSH 5CUSL 5A2JH 1C5DB 4PJ7A 1IQWH 3WE6A 4JO1L 3N1PC 2EXYD 3BGAA 2DQUL 1YEGH 4QWWD 2R1YA 3HAEA 3V6OA 2VDOH 3UTSB 1JPGA 3CFJA 4NOBA 2H26A 1FPTH 3WXWL 1BBDL 3HI5H 3GNMH 2ITDA 4MA8H 5DMIL 2XWBA 4OZGF 5IB4B 4YDIH 1HHKA 4R8WH 1WFOA 3BDXA 1BOYA 3EGSA 1AJ7H 1AQDB 5I1CL 1L0XA 4Z76A 3ZKNC 4I4WB 2DLGA 2C3HA 5CP7A 3KPMB 3T0EE 4YBQC 1MY7A 4RGMC 4OGXL 1G7LB 5D1ZD 4P23B 4G42A 1J87A 3JVGC 5HVFB 1J0HA 4P59H 5F1NA 3MUHL 4JANB 3KR3H 4KI5E 5T3ZE 1P5VA 3GMPA 1KJMB 3CMOL 3QDJB 4L4TE 5L2KD 5JORB 5DMYA 2P1YA 4DVRL 4JREB 1Z5LA 2LU4A 4PLOB 3H9SA 1EHNA 2B39A 1AKJB 1K3IA 4ZO7A 2A1WL 3FB7B 1ZMYA 2ZCKL 5K9QG 4AYFA 4XPGH 4KZEL 3D39B 1CXHA 3R06B 1FC2D 4DFHA 1B0WA 5B8CC 2ARJB 2DLFL 3LY6A 4LHJB 2QQKL 5JZ7C 1DN0A 1L7TL 3AU1A 4PJFA 4UQ2A 3VMPA 1KIPA 2NY7L 3X13B 4HGWB 5F6HJ 4N8CH 4OCMC 5HGBA 3JWOH 1YEHL 3KXFB 3QIWC 4KDWA 4LDLB 2ZSWB 2KZ1B 2BDNL 5KAQG 1S7VB 1U58A 4LLDB 4EN3B 3LQZB 5D1XB 2DWEB 4WI2A 1N5AA 4X9GA 3MR9B 2CDFB 1NGYB 3OPZL 3TIEB 2HT2D 4U1IA 4CUCA 2VC2L 5IMOA 3O3EB 5GJTL 1IEAB 2P24B 2HFGH 1OB1A 2N4IA 3P11L 2Y5TA 4MD4A 3ULUH 1GC1H 1FV1A 4PYGA 3ARPA 1EFXD 5EWIH 5F7DB 1JNJA 2OI9C 4HAGA 2E7LC 3V9FA 3V7MA 1A14L 3LKPB 3SO3C 4G9DA 4EI5D 1IC1A 2WLZA 3QI9D 4H5SA 4NRXA 1H3PH 3BW9B 1WJ3A 3D25B 1AH1A 3MO1A 4HZLB 4JPWH 4WCYL 4FP8L 2GSIB 2ESVD 3U1SL 2BC4A 4RA0C 4ZS6D 1ZOXA 4WTXA 5EU7C 5TE6L 1XGTB 3OJMB 2FHCA 2E7CA 4TUOA 4K71B 3BRGC 1BLNB 3IJSA 5T3ZH 2J4WH 2A9NL 4U7SA 4LCYA 5DEGA 4NC1C 5FAAA 4Y16B 5B39B 2VLRE 5DD0H 1NAML 3GI9L 3KHQA 4NJ9H 3STZA 2ZUSA 4GKSA 4MS8C 3MLXH 5EZOL 3MLPA 1YUHB 4LVNB 4Q2ZB 4HDIA 4HIJB 3C5ZA 1OL0A 3KPQA 1TVDA 2EZ0C 5CBEA 3WKNA 2YSSA 3EDEA 1WIOA 4L29B 1KC5H 1X4XA 2DMKA 1OWWA 5IB5A 2H2SD 4F7EA 4PG9A 3U36A 5GZNC 5I1JL 2BJML 5KVMC 5IW1A 3BP4A 4OSUH 5CEZE 5J3HD 3RDTC 2UV3A 4POZD 2YPLA 5GS0H 4G7VL 1NFIB 1MCSA 3MTRA 4OF0A 5TF1L 3LPWA 5DRXA 1PZ5B 3QQ9D 3WDJA 2AJZB 1IAII 1FVDA 1C5CH 2AEQL 3RWGB 4WHCA 2A77H 3P0VH 1UYWL 3ARED 3CSGA 3BYYA 4ZDHB 1HCFX 1EMTH 1KENH 4Y5YC 5GSVB 1JPTH 1MI5D 1W0VA 4WFED 3EO9L 3RU8L 3S7GA 2F54E 3K4ZA 4HFWA 2XA8H 4OZIA 4LLYA 2X4RA 1GPOL 2HT3C 5DC9B 5TJWK 1KJ3H 3U46A 1FSKC 4ONFH 5J9PA 1YNLL 4IJ3C 4JDVB 3BP5B 3P9MA 1IM3A 4U6XA 4Z0XB 3LVEA 1EA9C 3O0RL 1K6QH 3EYVB 2JCCE 2Y72A 4ZXBB 5D2LE 3EAKA 1YC7A 5GS3A 4HXAH 4CN4A 2DQTL 1XIWA 4ZO6A 2X1WL 5GZOD 5JHDB 3ULSB 3CFDA 4AL8H 4PRHD 3IVKA 4A6YH 2R2HB 4F57L 1WBZA 5IHLB 3UJJL 2EO9A 2AW2A 5EIIB 5KVDH 4R26L 1EH9A 5I2IB 3PQYD 1INQA 4XI5D 3DTXA 3PP3K 5DJAB 1C5BL 2X05A 4Y5VC 4RX4D 2X1QA 1QKZH 1V3KA 1NC4A 4CAGA 4AM0B 3GSVB 2HKFL 3ARRA 3LRSA 1DQDH 3ZMRA 4UT7H 4CU8A 4RMUA 2XZZA 3MRDA 3W0WA 2ADJB 3DVIA 1IQDB 1BJ8A 3HC3H 1EK3A 1CLOL 4G9FA 3VXUD 3HNSH 4G7YH 1KCLA 3VXPB 3BWAB 1P7KA 2IBZX 5DFWH 2F58L 3TA3D 4G6JH 5T3XE 3KDMA 5HYSB 2FGZA 1CT8A 3T8XA 4D0DB 5KS9A 2PW1B 1FNSH 5E6IA 3VW3H 2NMSA 1VPOH 4YGVA 5FF6A 3SDYH 2DQIL 5ISZE 3ZE2E 3ULVL 3ARUA 3VG0L 3IFLL 3VXOA 4I3RL 3CLFL 3T3PE 3C8KA 4K94H 2B1HL 4ZG1A 3QXDA 3SE8L 2ADGA 2N56A 4UV7H 4DK3A 4G8EA 1JZ4A 3EYSL 3BZFA 4J3SA 3L3OB 5HHMB 1AY1L 2GJ6A 3GJFA 5DK2B 4PGEA 4RGOL 3V7AE 2KH2B 2CKBL 1IGCH 2H2PD 2VLLB 1BF8A 2D7MA 4KXZI 4PRNB 2DWDB 4MCZB 4G43A 4M8VA 5DJ2B 1KGCE 3LN5A 3U82B 1W0YT 3VFNB 1EERB 3VWJA 1JWSB 5IMKB 4MSWA 3VFWA 4BUGA 1DBBL 2J2ZA 4BH7A 4PGDA 3V5DA 4L8CB 3VD7A 1U8KB 1FO0L 3F7RA 3N9GH 2V7HB 3DECA 3L5HA 1DBAH 5E2VL 3PGFH 1GRWA 1NH6A 4XPHL 1ORQB 2XZAH 2LU7A 2FGWH 4UQ3A 2UWEB 3REWA 4WWKA 3HC0B 1QRNE 3BHBA 4ZUUA 2NY6C 3CFEA 3M8OH 4MJID 4DKDC 4NCDA 4O58H 5EN2A 1MCQA 4QHKI 5E8PB 1RZ7H 4LSVH 1MF2L 4KTEH 4LKXA 3TBWA 3WFHA 4YDVA 4YQXL 1CG9A 1S5HB 5IVZA 2EDBA 5I1HH 3RZCD 5GGTH 4P2QE 3WSQH 2Q3ZA 5BS0A 1J1OL 2ZUTA 3UC0L 4UILH 3TYFB 5CD3A 1CGVA 1CF8H 2P5WD 2F5BL 2NY0B 5GIRA 3X14A 1Y0LA 2JJSA 2XG5A 3SKNA 5GGVY 4NQCA 4H0IA 2B5IB 3CFCH 3IYLW 1YEIL 5T5NF 3WD5L 3FB6A 5IFJA 2P43B 3MRMB 5I73B 2AJ3B 2M2DA 1UQSB 4NHCL 3QULB 4DWHA 1T04A 3HS0A 4MAUH 5LAXA 5FK9B 1K4DA 5B4MD 5C0AD 3MV01 4S1QL 5KSBE 3MNZA 5DD3L 2YPVH 12E8H 4P3CH 1CU4H 5A40E 5MEOB 5I18H 3WCYA 4JR9L 4XCEB 2EE2A 1WUNT 2FIRT 3CZFA 5CZXD 2F15A 5I9QC 4L4VB 3MRPB 2GK0A 5DZLA 3D0VB 1XGYH 4IDJL 2Y23A 5I15L 5DJZB 1T4KB 4JFPB 3MLVH 2XKNB 1MQ8A 3UTTA 4I9WE 2X4UB 1CICB 5ITBL 4GKZB 1T2JA 2LAGB 3DX7B 2XWTA 4DVBB 1ZT4A 2GUOB 1G1CA 1IGML 4JY5L 4X6CF 4LSQL 1LO2L 3H3BC 4OIIL 4OGYH 1IAKA 1MJ7H 3LQAL 5HHOD 2VAJA 4O02H 3QNXB 2PTUA 4PB9H 4GG6A 5GRYA 2DQGL 3UTZB 3EOTH 2VXUL 1QSFE 3TPKA 3P2TA 4HXBL 2H32A 3UAJC 5DQJB 4N0RA 1MSPA 4OF7A 1DVFA 1R3KB 2O26U 2EDEA 5IVXA 4PRPB 5LGKA 4HIIA 4PV8B 1I4FB 1U3HD 2IFFL 3U0WL 5EU6E 2BSTB 1IM9B 4HGKC 3S8WA 1I7TB 3NCYS 5IJKA 25C8L 3HNVL 3QXTA 4LBEA 4TVPE 4QTIL 2AQ2A 5IEKA 4PJFE 1U3ZA 3QUML 3MCLH 3T4YB 3TVMD 4LEOA 4LPUA 5JTWA 4M5YH 1K9TA 4KHXH 4OTXL 5KSVB 3IAGC 2QR0A 4QOKD 3IU4H 1EO8L 4M6NL 5DUPL 1J11A 3BN9C 3NPSB 2W65A 2C3GA 5FCUL 2VITA 2BVOA 2VDQH 4ZFOA 4EUPH 3BWUC 3VXQA 4P2RA 2GJZB 1KBGH 4CMMA 3V4PH 3TH3T 1S5IH 4ELMA 3QIUA 1TQBC 4FQLL 3MREB 3WFEL 1R24B 3O8XA 5MENE 2QHLA 3MACH 4KI1A 3DURA 4HKBA 2DQEH 2YUWA 1S9YA 1GIGH 1UM4L 1G7QB 4IM8A 1DANT 1KB9K 1F13A 3T04D 1EHLH 2AS5M 1CS6A 3V5HB 3GSRB 3ZO0A 2ORBH 2HJFB 3SQOH 4H25B 1QSZA 3SGJA 2J8OA 1IZKA 1BZ7A 3W9DB 4OD1H 3ILQC 3DO3A 5FKAA 6FABH 4P23D 1MCDA 2MKLC 5F71A 4BH8B 1I3RB 1NCAH 5AWNL 5ITFB 5H94B 3IKCB 4Y2DC 4G6AC 4PP2B 5GS1A 1PAMA 4X6BA 4YWGH 3MJ8A 4JPVH 5HDBE 5B38A 1IC7H 3H0TB 1S78D 3QDJD 4OZFB 1NGWB 1CFQA 1HNFA 2H41A 5LQBH 3FT4A 3ES6B 3E2HC 1KULA 2FD6H 2CIKA 3ZDYE 3IJYB 5ALBL 4NFBA 5T1KD 1FFPB 3B6SA 4ZOAA 4S0SD 1PW3A 2ED8A 2OTUB 3QEGH 3N0PB 4JHAH 2D9QB 1M05B 1T03L 2Z8WC 3HI6H 1Y18A 3M1BA 4EVNB 3RWCB 4FZEH 4BSVA 2FSEA 2ZG1A 4NDMA 2XRAL 2YA0A 1PEWA 1D9KB 1CFSA 1I8KB 4P9HC 2FB4H 5DDHB 4PJIB 1NGQL 2IPTL 3VI4E 1T6WA 1LO4L 3BPLC 1D3CA 4PJXB 2MPAH 3C6SA 2APFA 5DT1H 5F3HB 5ESAB 3SKOB 2YD9A 4FQ2H 4EN3D 2HAZA 3CD4A 4KHTL 3JUZA 4PRBA 4WFHD 2VMFA 1BECA 3SDDB 3DVNA 4TPRL 1RZJH 3T77B 3CXHK 1WCBB 5D5MF 5F8RC 3ZT5A 4XP4H 5BRZD 4UT6H 3DETD 4P4KA 3P9WB 3MV9B 1M71A 3BSZL 1CDBA 2YD7A 3QDGA 1T1ZB 4DFIA 1I3GL 4DUVA 1ZV5A 4FG6C 3RVXC 3GMQB 5GGRA 1J0ZA 3HNTH 3HMXL 5C6PB 1U8QA 1I7UB 2YD5A 2VQ1B 2O61A 1A4KB 4W81A 3U79A 3VCLA 1H3TA 3ME0A 2Z92B 4IRZH 1UH4A 5FM8A 1TZHA 1RIUL 2V5SA 1U91B 4C56E 2XTJE 4J1UA 5DR5H 5JIPA 5ERWA 3BP6B 4GRLC 3NZHL 1NCWL 2DQDL 1JRHH 1P6FA 1FN4A 4XCFH 2RFXB 3NA4A 4OT1H 4RA3A 2X1PA 3D18B 2BSSA 4LIQH 4XPBH 3LMJL 3S36X 1IGYB 3VXSE 4AIZA 4L3EE 1FLTX 4WO4C 2NY1B 4Y16D 3BQUC 5JXEC 1D5MB 4HIHA 2OS7A 5L8LB 1HQ4A 3HMWH 4M48L 2JB5L 1MAML 5DJ0B 5FYJL 4OUUA 4L8SB 3FQWB 3NIFF 4PJDF 3RWFA 4ZS7H 3KLSA 2X09A 5HVHB 1H5BC 2HVKB 5C0RL 3QUXB 1EZVX 5C2BL 2BSRA 2YK1H 2OM5A 4OF5A 3HG1A 3SGEI 3H3PH 1MHPH 2Y7QB 3B2VH 1I1YB 3MRBA 4XP5H 4HWBA 4IOSD 3GSXA 1KCUL 4N8VA 2UUDH 4FQXB 4HUUA 5F89A 1J8HE 1JGEA 3FOMB 5FGCE 3X3FH 5DURB 3AAZA 3BZEB 1BFVH 4K7PH 4LP4A 2X4QA 5A43C 4KK6C 3EOYG 3EFFB 1T22B 2PXYA 5DF0A 5TDPA 3RL1A 4TTDC 2ENSA 4ETYA 4YDJA 2VDNH 1B0GA 2PYEE 5J12C 2YD8A 4XNMB 1MCFA 4LGRB 3OKLA 5CUSH 5CWSA 4Z95L 5DFVD 5EZJB 2NY2B 4JO1H 2DQUH 2AK4A 2XY2A 3TBSB 1BFSA 4X9FA 3WXWH 1BBDH 5FECB 3DO7B 4ZXBD 4U1JB 5HHXL 5DMIH 3GB7B 4OCXL 4EDWL 5EULV 3KPOB 1U8OB 1FG2A 4YHYC 3N1GC 1V7NL 4PJEF 1DBKL 5I0DA 3GO1L 1BWWA 2ITDB 3NZ8A 1P5UA 3CH8A 4PRIE 2XWBB 3JTSA 3LPGA 3VRJA 4K23H 1GGCH 2FBOJ 4X99A 5BXFA 4OGXH 2EYRA 5JOFA 1MREL 4YHML 1G7MA 8CGTA 1S9WA 1D5BA 1MEXL 1A6UH 2PW2A 1Q72L 1RZ8A 5LGJB 4OCWH 3MROA 3HB3C 4P57A 1ZT1A 1OTTD 4YO0B 1MCWM 4KFZC 3NACL 1EBAA 2HLAA 3CMOH 3PWUA 4U1MA 4M61A 5GS2H 4U6TA 3ZKMD 4DVRH 1MCWW 5IHZA 3OKKA 1WVZA 5FOJA 2XYCA 4JFHD 4PJ5E 4KH2A 2A1WH 1Q94B 2ZCKH 3KPPB 4OLZH 1WFUA 4KZEH 3PHQA 2NX5E 1IBGL 2ATPA 4U05A 3WUWB 3RVVD 4JHZA 2H3NA 3R4DA 3S34L 3CK0L 3JVGA 2DLFH 2FX7L 2X4PA 2D03L 2XNAA 4XX1E 3V7AG 4X6EA 4JZJC 5D1ZC 3MMEB 1L7TH 5D8JL 4A6YA 2NY7H 1YMME 1P1ZA 3S37L 1MIEL 2X41A 1YEHH 1A9BA 1TZIB 1AI1L 3DX9B 5IBUG 5I1EH 5JQ6L 2ILLA 2BDNH 4UQ2B 2EIZB 1F4AA 4WW1B 1OM3L 1DLHA 3CPLB 4HWZB 3MQIA 5KJRH 4I77L 5I74B 3MLRL 3F5WB 2OTPA 1U58B 4PJ9D 2VC2H 1M7DB 5B8CA 2Q76A 5GJTH 1OW0C 2MCPL 3P11H 1HSAA 4JKKA 4NRZA 4QXTB 1N2RB 5CBAA 1NC2A 4NGHL 4HT1L 2X70B 1RK0A 3LS4L 4RIRB 4XAWL 5CMAA 1A14H 2NTSP 7FABH 3QIWA 2FX9L 4PJHF 1K8DB 2IG2H 2BMKA 2FHBA 1IC4L 3T2OA 1I7ZB 4M8QB 2BVTA 3I2CL 1KXQE 3K81A 1BQSA 4WCYH 4FP8H 2PCPA 1TETL 2MOVA 4NWUH 4D9LL 5IBLD 3JZ7A 1AGEB 3ZKQD 2IBGA 3U1SH 5KN5B 1NFDB 1ZLWK 5JO5B 3DXAA 3UTTE 3UTQB 4D0BA 5TE6H 1HXYB 3UP1A 1YEEL 5LVEA 1QQDA 4XMPL 3X12A 1EBPA 3LKQB 1FAKT 1BQLL 2HJLB 3J7HA 4XP6L 2A9NH 5D7JA 3NA9L 4GG8A 3T1WA 3D3VE 2W9LA 1N6QL 3UTPE 1NAMH 3K74B 3GI9H 5EZOH 3EJYD 4LLUB 1KFAL 5EBLA 5HY9B 3RI5K 1CL7I 4LCYB 5DEGB 5IEHA 4EUPG 5FDWA 5BVJA 4EI5C 1JPFB 1J5OH 5ACZA 1RFDL 4TVSa 2IWGA 3OXSB 3V0WH 5IKCB 5I1JH 2BJMH 2R56L 3ARBB 3KPQB 4CKVX 1OGTA 5CBEB 2IH1B 2NY0D 1LEIB 3RIAK 4MQ7B 2G75B 4G7VH 2BRQA 4ZS6C 1WBXA 5ID1A 1XMWA 3HA0A 5C0FA 3VFOA 5TF1H 3H9YA 4UTBL 5EUOA 3O9WB 1NKOA 4RWHA 2AEQH 4O5LL 4KMTH 5E8NA 3UJTL 3ULVE 4NN5C 3V0AC 3VRIA 4PY8J 1OSZB 1UYWH 4NRYA 2GSGA 1G7IB 3L3IB 3OAZH 4JN1L 1RUML 1X9QA 2GIYA 3MA7A 4UV4L 5DO2D 3RU8H 5IM7A 2D31A 5DHVH 1OGAD 2DJSA 4P2RE 3LV3B 2VABB 1JJUA 2ED9A 1GPOH 2CRYA 3RDTA 2H2SC 4JZOB 2DLIA 1W0VB 1TJGL 4OM1L 1TLKA 1YNLH 4UNUA 2WMPA 1IEBA 5I66B 5EZLA 1OAXL 1RZGB 4QRQA 4L4VD 1INDH 3VI3E 2ADFL 4MWFB 4UBDD 3VGAB 4IMLB 2BK8A 3S9DB 4AT6A 3QQ9C 2E8YA 3SPVB 2V5MA 1N8ZB 3NTCL 4R26H 3AREC 1MRDH 1OARL 3B8YA 1QSED 5FKPB 2MCG1 3P4NA 1C5BH 3U9UB 3BP7A 3HR5A 5FB8B 3LKSA 1AGDB 2P47B 4JFDB 2HKFH 1NCDL 1R5WA 3FB5A 1VGKB 3I02B 4OKVB 4MXWL 2CPCA 4PS4L 2CLRA 5HHNB 4PRPD 5F9AC 2XKUA 5I17A 1CLOH 3RVTD 5GZOC 4QXUL 3MRDB 4J7RA 4F3FA 2EDFA 3W0WB 1IM9D 2RIKA 2KL6A 1Q1JH 3TFKD 4PV9A 4Y5VA 4OZHE 3L3KB 3LDBC 2M8XA 5CP3A 4IBLT 3JV5A 1KSRA 4HC1A 1FGVH 4G6ML 3VRLE 3AB0B 2EKJA 2DQIH 3A6CH 3ULVH 1WAAE 3KDMB 5TF0A 1F4HA 3VG0H 4I3RH 3C9NA 1JZ5A 4YHZL 2I9TA 2B1HH 3SE8H 2YWZA 4HBQA 3S88L 1QLEL 2Z35B 1YN6B 2J6EL 3EYSH 3QUZB 1YY8B 1DEEB 4KKBC 3O6FB 1EHAA 4RGOH 4D2NA 3RX7A 1UVQB 2CKBH 2Z8VC 4JDTL 2FYYA 3B4NA 3TA3C 3U6RB 4IIQC 5F3BB 2LAAA 3WJLC 5CCKL 2AKRB 2ICWI 1O7SA 3EOAA 3ESUF 5DRZB 5B3NA 3SQBA 1DBBH 1TMCB 4G43B 1HEZA 1MIML 1MRCL 1OLLA 2NXZB 5HHQB 3DGGA 5C6WH 1OCWL 2XPGA 2J7LA 1FO0H 3VWJB 2NNAA 5E2VH 1EGJL 4XPHH 3V5DB 1SMAA 4IRJD 1YYML 2WBJD 1URLA 4MMXC 1JK8B 2CDGA 3E3QE 4PLKD 3QQ4A 4NKDB 1KG0B 5MI0C 3RUGA 3BIBX 1LQSR 4Q6IA 4EXPX 1MF2H 3BHBB 3L3GA 3CSYB 3MBED 3NFNB 3ALPA 3OKNB 4YQXH 2KQNA 3UYRL 3L3HA 3MLZL 1ZHBA 1D9KD 1NBZA 4YC2C 4PG2C 2ICWB 4ZFGL 1A7OL 3TBWB 1T89C 1K3ZA 1J1OH 1S9VA 1L7IH 4YDVB 4LVHC 3UC0H 3S3PA 1ZS8A 5EO1A 3D85B 1JV5A 2F5BH 2I9LB 3L5JA 1A4JB 1KUMA 4Z7UB 1NANH 1S8DB 2YPKB 5I1IL 2R69H 1YEIH 3WD5H 5C8JB 4WFFE 5GIRB 4JN2A 4YXKL 2WBWB 4NHCH 3MJ9L 3MV9D 1A6ZB 5INDB 4JQXC 3OAUH 4S1QH 3QCTL 5GRVL 5IFJB 3GMRA 4HH9A 1ED3B 4WU5B 3LRHA 2B4CC 4LU5L 1JGUH 2EC9U 1E4JA 5DD3H 3RZCC 3F65A 3HCVA 4O2CA 2FBJL 1K4DB 1H15A 4ISVA 3BUYB 2OL3L 5EOCL 3QNYA 4JR9H 3MGTA 2EC8A 4HJJL 4O51A 4KROD 3G6AA 4ETQB 4Z7VE 5CS7A 4U7MA 5GGSA 1U3YA 2ZKHL 5IFAL 4IDJH 5I15H 5CGMA 4NN6B 5CIPB 3C60B 3KAAA 1KLUA 5DMKA 2CJUL 3EJZD 3R1GL 5ITBH 4HLZH 1LK2A 2AI0L 4YX2L 3X11B 1IGMH 4JY5H 5B4MC 3FFCE 2NY1D 43CAB 3CFBB 4LSQH 1FC1A 1LO2H 1U8PB 4OIIH 4BQCA 4PJDE 2VDRH 3LQAH 1OHQA 1ZT4B 3VD4A 3SKMA 3HE6A 1FFNB 5LJYH 3I50L 4FXKA 2DQGH 5SWZB 3RKPA 2VXUH 3WS6C 5CZXC 3QUXD 3SOBL 5GRUL 4HMDA 2YXMA 5HTSA 1G6RB 4BSJA 4NPYB 1LEKB 1YZZA 4MNGE 4CRPA 5BQ7A 4FXGA 2AGJL 2HFTA 3B5HA 4XPAL 4KMQA 2J3SA 1W72L 2IFFH 3U0WH 2JTDA 5DGRA 4PB0L 2H32B 2AVGA 2R15A 3OG6B 1DVFB 2UWEF 25C8H 3GJEA 3HNVH 1QO3B 4FQXD 4QTIH 4Z78B 5A16A 1S7RA 3WNLA 4JG1H 3QUMH 5J1AA 5F9WB 4PTTB 4CN1A 3OJ2C 4LLWB 1FORL 4OTXH 3HI1A 3VXTA 1LO5A 2R29L 4Z7QE 1EO8H 2MHAB 2XN9B 4M6NH 2EDHA 3UBXG 4LP5A 4XBPB 5FCUH 1VEPA 4P5KA 4FN0A 5FM4A 5I8EB 4XZUB 4FQLH 3TNMA 4MA1C 4FTVA 2W65B 1FVCA 5JDSB 2Y07L 1RIHL 4WFGD 3WFEH 2VITB 3QNZA 4GAGL 3OKMB 3ARVA 3JWDL 1U3HC 5HPMB 5E4EC 2YEZB 3QEQE 3IDUA 1UM4H 1SMOA 3NCMA 2BNQE 3NN8B 4BFIB 2GW5A 3PHSA 3G6JB 3O8XB 2DM2A 1UXSB 4EBQH 4ZAKC 1PSKH 4FFYL 1A7BA 2IJ0C 3TVMC 4Q58C 4N0UB 1S9YB 5BZDA 1UZ8A 3BRFA 3KPRE 4M03A 4Y1AA 1T21A 1KNOB 1Z6JT 4HS3B 4GFTB 1BZ7B 4NHUB 4XX1G 5DEFB 3GKZA 3OAZK 2ZJSL 4P5TA 3DXAE 3HE7D 3TJEL 3BISA 1U8LB 2FJGA 4LMQE 2OZ4A 2PETA 2QQLL 4HMEA 4CU7A 1XGQA 5ALBH 3F62A 1FYTA 1ZA3A 1QACA 3GSNB 1TTFA 5FYJE 1U8NA 2VR5A 4KVNL 4N0YL 2CIIB 3I6GB 1HHIB 5DD1L 1EUUA 5CHNB 3HN3A 1JFQH 2NY4B 5C09A 1T03H 2HRLA 3GFUA 3GI8L 1MPAH 1AQKL 2GTZA 2UYLA 2XRAH 4N5UA 3SGDI 2R0LL 3LPFA 1NGQH 4NNXA 2IPTH 1IL1A 1J12A 3M1BB 4RISL 3MRGA 4I3SL 3SJVB 1LO4H 4IRSB 4JPIA 4WI8A 2J8UE 2CD0A 4KU1A 4UB0L 3U2SB 3VXRE 2ZWLT 1MWAB 4KHTH 3TJHD 2F53A 4LLAA 5D93B 4JREC 4QGTA 5HYJA 5HYFA 4HUWB 3C6SB 4TPRH 1NJ9A 2K9UA 4X80L 3KYMA 2DB8A 5SWQB