5JHDE

Crystal structure of ls10-tcr/m1-hla-a*02 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
GGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIGVYGYTFGSGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 239
sequence length 239
chains with identical sequence J
ec nomenclature
pdb deposition date 2016-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhdE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhdE02
3NH7L 2WW8A 2AJVH 1HYSD 4C55A 1PY9A 1MCSA 5DD0H 3INUH 4QRPD 2YZ8A 4WGWB 5FDWB 4PGZA 2ZUTA 3UZVB 3T0EB 4YHML 2HA1A 3LH2H 1BD2B 2EIZA 1OCWH 1T83A 3FN0H 3DO3A 5I1CH 3DVGA 1OB1A 3NPSC 4TULH 4KXZH 2VRAA 3MGOA 4N90D 1U8KA 1IAKA 1QO3B 1GAFH 3PE9A 4G3YH 1AC0A 2QQNH 3CLFL 4I3RL 1MUJA 4TNVK 5HGDB 4QRPA 5IFHH 4MWFA 4AEEA 4LSPH 4OIIH 4U6VL 1HSBA 3QEUB 2E8ZA 3QCUL 4FABL 5AYUH 2NY5H 4Z7QE 4PJAE 2BVOA 5A2KH 4KKCD 5DUMH 4EI5D 1QLRA 2BCKA 4KAQL 1RHHA 2AEPH 5D1XB 5C0JB 1F6FB 4LGSB 2V6HA 1F4AA 1N3NB 3GSQA 4X5XA 4GKOA 1G7JA 1UB5A 2D9QB 2VLRE 5CBAB 2IPUG 5JTWA 3H0TA 4S10A 2Q6WB 1JHLL 5K9JL 4JGJA 2AEQL 2YC1B 2O5YH 4N8CH 3BPLC 1KB9K 1CLYL 3BUYB 2OTUB 4C56D 1JUFA 5GRYA 4EI5A 4YDLB 4XP9L 4XX1E 5HHVH 1H0DA 3P9LB 5TE4L 5IMKB 1R3HA 1NGXA 3ZYIA 3HAEH 4OLWL 4P2CG 1NGPL 3O6LL 1FNEB 1ZLSL 4OUUB 2AJYL 1BBDL 4LRNL 3DLQR 4EI6A 5DHYB 5H37H 2JLLA 2DM4A 3BKYL 5D1ZD 3IYLW 5BXFA 4IRSD 3SJVB 1RK1B 3FQXA 3HE6D 1HXYA 4WHYG 4LPXA 4ZUWB 1TITA 4OT1H 3FQNA 3L3OB 1O7SA 1EO7A 2FH8A 4C56A 2HWZL 1Q1JH 5LAXB 2YA0A 5F7KC 5I66B 4OCXL 1OSPH 1QRKA 3C2AH 4PGDB 4LHUG 1DL7L 4K23L 4FS0A 1JHKH 1XF3B 3T1WA 2P1YA 4WJ5B 4NNXA 3ET9F 1XGUB 2BSSA 4NJAH 4WWKC 1GC1C 1A7BA 2DQDH 4YNYA 4HLZH 5D1ZA 4IRSA 5JHLL 1F4XL 3HE6A 2CLZB 3MRHB 3K8MA 1HCVA 1P1ZB 4QF1B 3OKEA 4HUNB 5L2JA 4LAQH 3UX9B 3FOLA 1WAAE 3DX8A 3GM8A 3QEHA 5B4MD 3S88H 5MEQA 2GJZA 3U79A 3ZKXC 3VXMB 4M7LH 4UTAL 1BECA 2VSDA 4A6YB 2PYEE 1UQSB 2W0KA 3WSQL 3PWJA 4DQOH 3BP4A 3QDHA 4TN9A 4G8GD 2ICES 2UZXB 2FL5B 3HS0B 3OKNA 3WLBB 1CFNA 1YN7A 3OAYK 2MCPH 4WUKL 1A5FH 3HR5A 4XHJC 2B7DT 5GGRY 5JLZA 5SWQA 4R7NA 4PBVC 3IDNB 1UKTA 3CFDB 3TJHD 1NBVL 1T1YB 1A1MB 1E27A 2FBJH 3H9SD 1V3LA 4P2RD 1UGNA 3B9KD 2ZG1A 1KEGL 1U8IA 4U0RB 1KCVH 4F15C 5IG7B 3CLEL 4G8GA 4F37K 4PGEA 4Q9RH 4OF8A 2F58L 4JN1L 1UM4H 4JZJB 4BM7A 2BMKB 4YDIL 1NANH 3TYGL 3U7YH 1ZT7A 3DV4B 4IRZL 3RAJH 3TCXA 1MFAH 3O4LB 4PLJD 3PGDA 5I1GL 4P5MB 4P2RA 3H9SA 3LN5B 2PTVA 2XTJD 3B9KA 4HUVB 4LCIH 3WMSA 4OCNC 5FOJA 2HJKA 3H7BA 4Z7NF 2JB6A 3P4LA 2CR3A 5E8EB 3V6FB 5B39A 5ENWB 3I6GA 5JPNA 5MEPA 4OCSL 1E4XL 2P5WD 3MV7E 4BFIB 2RHEA 4PBWD 2VLJD 4BZ1H 2VWEC 5E56A 4DZ8B 4MJIB 3ZDXE 4ALAL 3D18B 3BP6A 1DLFL 5EZLA 1AJ7H 1CVSC 4FQQB 1NGQL 4NUGH 2CIIA 1YY8B 3KYMA 3LKRB 5L8JB 2ZPKH 2ZSVB 4XVSL 4WNQB 3V5DA 4G43B 1BX2B 3B6SA 3UAJC 2P5WA 4P9HL 3JWDC 2LAAA 1ZWIA 2V2XA 3MRFB 1I8LA 2ICWI 2AKRA 2VLJA 2XWTB 4YZFF 4UINH 5DF0A 2XKNA 3T0BA 4YC2B 2A73A 2BVYA 4WI9A 3KS0H 1JRHH 3DBXA 2DI8A 3MR9B 4HIHB 5FO8B 4AEHH 3FB5A 1UJ3C 1TPXB 3V4VL 5C8JB 1VEMA 2EDLA 5GRJH 1ZT1A 4URTB 4HUWB 3DX6A 1LDPH 3BKCL 1AR2A 2EYTA 1TJHL 4PUBL 2A6KB 4OF5A 2VXTL 4YXKL 5D6DA 1L9NA 5FYJD 1T6VN 5FKAA 1MHPL 4NQXA 1HHGB 3CCHB 1I75A 4YXHL 4B7LA 1BEYH 4WV1C 4JCLA 2NXZB 1RZ7L 2A9ML 3EO0A 3G6JF 1I85A 1AGEA 3T8XB 5CBEB 4UQ3B 5L6YH 1RK0B 4YBLC 1M71A 1K8DA 2FJGA 1W0WB 1X7QA 4JPWH 4LIQL 1YN6A 4X80L 3KNBA 1RIUL 1WBYA 1JGVL 3AUVA 3FT3B 3RWIA 2HVJB 4F7EA 4QRRD 5LG1A 2UUDK 2CLRA 1KLGA 5IEHB 2CKBB 4XPAH 4Y1AB 5AWNH 4N0FA 4QOKB 4YHPA 2YWZA 4H1LG 4L3CB 1UWEL 4RWYL 1F4HA 1XGYL 1KCSH 3DVIA 3BESR 3E6HB 1FBIH 3O11A 5EPMA 4HS3B 4KHTH 1IQDB 2LVCA 4UOW0 5FM8A 4KJYA 2JTDA 1RAMA 1P7KA 3BWAB 4I0PB 2VLKD 1C5BL 4OFDA 3TM6A 2R1YB 5T1LB 1GPOL 2FHBA 2XA3A 5ADOL 4QRRA 4OFVA 1YPZB 5IW1A 1MJ7H 5E5MA 4PJEB 1FG2B 1TQBC 2H2SC 3L95A 3HC3L 4P46C 1MRFH 3ZLQC 5EO1B 4IJ3C 3MXVH 3WFCH 3KYOB 4Y19B 1HIMH 5FA4A 4DVBA 3H42L 2NXYD 3SKUD 3QUZD 5GGQH 2OYPA 2JJSA 5C0EA 2VLKA 3NTCH 4DZBB 2V5YA 4A2LA 2QKIB 2R0ZH 2B2XH 12E8H 3UO1H 3DROA 3FQUB 4OZGE 1FYHB 4E9LA 5HVWA 1EFXB 1FNGB 1JPGA 1SYVA 4S2SA 1OAXH 3JV0A 3SDXA 2AJ3A 1JP5A 1RFDL 4C58B 4F33A 3MRBA 4YHIA 5E2JA 4U6TA 3QUZA 1NSNL 3M1BB 2A38A 4HFUL 1FNSH 3T08A 5C9JA 1I4FA 2VUOA 3QULB 3VXPA 4PRAA 2CMRH 3BZFA 1F3RB 4WEUD 5E94B 1MWAH 1FO0H 2HT2D 4XP6H 3HI6L 5DVMA 2JELL 4G6AD 4HIXH 4AQ1B 3ARWA 3QYCA 3QG6B 2VWEE 4EDWL 4PJHE 1UG9A 2MOVA 4PP2A 2ARJA 4YAQB 1RHFA 4K94H 1QQDB 1MFDL 3FRPA 4DK3A 1IL1B 4ZAKD 5F7FA 4KK6D 2EEAA 2APWA 5BRZB 1F3JA 3ILQD 4Y5XA 1KN2H 3OR6B 5FAAA 2EIBA 5IMOA 4E42B 3HRZB 1EO5A 2C4XA 1QACA 3UTQB 3MLWL 2AK4E 1I1AD 1DUYA 4IMLA 4LFHD 5BOZG 5BV7L 2X9WA 4JCMA 1YMMB 4OSUL 1CQYA 2CQVA 4QHNA 1W72L 5ICZA 5GZNC 1IGYB 5K93A 4G7YL 4WENB 2W0PA 5E6IC 1ETZB 4ZAKA 1DQLH 5F1KC 3GO1H 1JF6A 1TDQA 5ESVB 4XMPL 1BLNB 4NC0B 4WGVB 3SO5A 3L3HA 2P45B 3ZDZE 3KLHD 8CGTA 3MA9H 3C6LC 1WT5A 3HI1B 3MOAL 2PTTA 4ODSH 1I1AA 4N1EA 2CUMA 4Z7UB 5ALCL 3DVNB 4TOYL 2VABB 3SE8L 4KJWC 5KJRL 1BM3L 1DZBA 1OGAB 4HK0B 4HXBH 3D9AH 3MMEB 2BY1A 3PL6C 2IFFH 1S7WA 4L8BA 4L4VE 3WLWC 3B5HA 1CTNA 4PREB 3PWPB 4PJ9C 5EC1A 2DD8L 1T2QL 3EYVA 2Q86A 4J7RA 5A1AA 1JPFA 5TE6H 3JWOL 4HKZA 3V0AC 3L9RB 4APQC 3BQUC 3MCG1 1CFTB 1VGKB 1NAML 4K9EL 4PRIE 5IV2B 1Z9LA 3WKMH 4OGXH 1VB9A 3B43A 1GIGL 5FIEA 2BXZA 3O4OC 2C3WA 2W9EH 3G08A 2PW1B 4PJBB 1VKXB 5DJXA 5JZ7C 5D1QB 5FYKU 1BVKA 1QSFD 1MVUB 2ERJC 2AJZB 1JGUH 2XPGA 3G9AB 2DDQH 5I8CB 1R3KB 2Q8AH 3CDGA 3K4ZA 4G6JH 1RJLA 4U6XB 3SDCC 5K9KB 3V8OA 4S1RH 1I9IH 5JNYA 4H0GA 4HSQA 1A7NH 5E8PA 1KEMH 3QNYB 2ZUYA 3BAEH 4KKBC 4UT7L 4HGWB 4MA1B 3LQZA 1FJ1B 4WTWA 3UBXI 1K2DA 5J8OA 4ZYKB 4ZS7H 5KG9B 4HPYL 5IP4A 2MCG1 1AI1H 1QSFA 3N1PC 4AEIL 1KSRA 4GRLB 3SGDI 4RAVB 1AFVL 3CVHB 1LO5B 1MJUL 4JN2A 4JY6A 3FCTA 3EBAA 3LQMA 2P5ED 1BIIB 4K3EL 3V4PH 1FC1A 1DQQA 4LHJB 4S0SD 2XG5A 3ORJA 3EYFA 4JO3L 1ND0B 4Z76A 2GY5A 5EG6C 1LO3H 3NABH 2HAZA 2ZUQC 1IKNA 2Y7QB 3LB6C 4JQXA 3JV6B 4CADA 2MKLC 1ZLUH 1HHJB 1P2CA 1KC5L 3IU3A 2EO1A 3HLAB 4WU5B 4DKEH 1W0YT 4KHXH 1V7NL 2NY4B 5C0CB 4C59B 1KBGH 4U49A 3IFPB 3D87B 3O6KH 4Q74A 2OTPA 4R4NC 2BNRD 2P5EA 1GGCH 1B0GA 1SMOA 3MBEB 3ARXA 3VWKC 4LBEB 5D96C 4EVNA 1ZEAH 1HQRA 3AU1B 3CNKA 3O45B 3L7FB 4JJHA 1S9KC 4M1DL 4QXUL 3TN0D 5FCSH 3KVQA 4RGOL 1FN4B 4NO2A 3ZKMC 3NVQA 1B3JA 5DJDA 5F9JB 1YC8A 3RNQA 2YEZA 3BXNA 4Z8FL 4OZFB 5HBBA 4Z95H 4GKZA 2BNRA 2R69H 2CK0H 1R5IA 1EEZA 4BK4A 3GSNL 2H3NB 5EU3A 4IM8A 5TQ2L 1RZKH 4L8SA 2F5BH 2JIXB 4QRTB 3TN0A 2YD7A 4Y5VC 2OK0H 3SPVA 3QPQD 1N5AB 1MCJA 3E1F1 1KIQA 3IFNH 3WN5C 1S7QB 5E5UB 5IT2L 2A74A 5KVEL 1M1SA 1M6OB 5D7IB 1JHTB 3RWHA 1YEHL 3FB7B 2J7LA 1CD1A 2EDXA 2ATKA 3S36X 4ORGB 5CWSB 3LVEA 4DKDC 3ZE1E 5IUSA 4U3HA 2M26A 1TVBA 4PB0H 4LNRA 1B2WL 4X5WB 1JWSB 3QDME 3B8YA 2JCCB 3D0VB 4D9LL 3S36L 5D8JL 1NCCL 3GJFB 4NRZA 1OM3H 4PLNC 5JOPD 3BRGC 3FAXA 2IANE 1YYML 2HH0H 5F70A 1YEKH 3GKZA 4PYGA 3O2WH 2YD5A 2XN9E 2PR4L 2X40A 4YHYB 1QYGL 4U3XA 4CKVX 1E4KA 3T65A 2PO6B 2J4WH 2CRMA 3AMLA 2I24N 1FGVL 1A7RL 3GRWA 2ARJQ 4WEMB 3SBWC 5CEXA 2BJML 2DQJL 4YIQA 1YJDL 5GGTH 3VRIB 3KJ4B 5DJAA 1IM3B 2VLME 4OV5B 4MD5B 5CFHA 4FQ2L 1GGBL 3LRSB 3Q1SL 1HQ4B 5IJVA 2D7TL 2JK5A 3IJHB 1FFNA 1QLEH 1QSVA 4V2CB 4LCCA 2EDNA 1QLFA 3AS2A 3F6LA 1X5LA 3MLRH 1EUUA 2X4SA 3BKMH 4OKVA 5D71H 3BRFA 4P2YA 5C3TA 2NYYC 1UVQB 3PV6B 2WLYA 1WZLA 4G9DA 4YHZH 5F7EH 3VD4A 2V9RA 3IXAB 3I6KB 3ECBB 3WDHA 4QXGL 2FJHB 4XGZB 3MLYL 2ZCLH 5F1IB 4LLQB 1J1PL 3DXAE 5GXBB 5ID0A 3U0PB 2DBLL 3O2DH 2YPKA 1LE5A 4XNXH 1CDUA 2YD4A 5IB5B 5I0DA 4X99A 3EUUA 4YHOL 1UENA 2W0FB 2ZKHL 3QHFL 2BK8A 4I9WE 1I8IB 1BGXH 5GS3A 1IC4L 4MA7H 5DJ0A 5EOTB 1KCRL 1HZHL 3S37X 1NAKH 5HGHB 2X4OB 4HUUA 1UZ8B 4M6AA 3RWDA 4JO2H 3SDXF 1IEAA 2Y9RT 5DK2A 4XVTL 3VFMB 3MUGA 1EBAA 1MFCH 2OL3B 2ORBL 1MY7A 4U0RC 3ULSB 3DETC 1IT9H 3VRLF 2VDPH 1DLHB 2Q87A 5I1JH 3OGOE 3MV9B 3RWEA 2W07A 1KT2A 3FO9A 5D70H 5SX4I 3WIHL 2WBJD 4M6OL 4X4ZA 1LP9E 4NKMA 2XQYK 3DARA 1QRND 3QG7H 4IDJL 4FXKA 4HKXB 4PB9H 1AD9A 3MRIB 2AJSL 4PRPA 4G80A 1FZOB 1QR4A 3F7VA 5TF1L 2EDOA 3MRJB 3VXTB 4DWHA 2VH5H 4M00A 4XP5L 5GIRA 3GBNH 4X9BA 1FFQA 4LARL 1EGJH 2RCSL 4GG6A 3RGVD 4OF7A 4JHWL 5DD1H 1RJYA 4M8QB 2VJXA 3EKCA 5GJTL 4GW1B 2YK1L 5GS1C 3EDDA 4JDZA 1AO7D 1PW3A 2N1KA 3BIKB 4ORZC 2GSGB 2WBJA 5J56B 3TPKA 4MVBC 1ZHKB 1DBKL 3U4BL 1QRNA 3CK0H 1S7XA 2UVFA 4J3OC 1CDIA 3PWVA 3QUMB 4XI5C 5DRXA 3MNWA 1F4WL 2NX5D 4NQDB 5FHAH 1BJ1H 4H0HB 3QR2A 4CU6A 4K71B 4Y2DA 1BZ9B 4QHMB 4FFYL 4M5YH 4YEEA 3RGVA 4LK4A 3TBWA 4Y8AA 1KB5A 3T4YB 3TZVB 1G6VK 1AO7A 5E8DL 5DHVH 4U1IB 2W65A 1KB9J 4QYOA 2WLZA 1DVFB 3ZDYE 5JIHA 1A14L 5IB3A 1DQML 3UMTA 3BGFC 4KUCD 4Z5RA 3PHQB 3EOTH 1RZFH 3S4SB 1BWMA 1F4YL 3TT3H 5BJTA 2FX8L 4F80A 1CI5A 2NX5A 1E6OL 3HNTL 2GCYB 4NBZB 1A6ZB 2FD6H 5LXGH 5JPMA 4X9FA 3TWCL 2IPTH 1KJVA 4YH6A 3RNKA 2F54E 2GSIB 2H32A 3K81A 4FZEL 3PGFL 4YBHA 4I18B 5EB9A 1OW0A 4XVUC 1GSMA 3QA3B 4KK8D 2X4UB 4R0LB 5F3HA 3T2NH 2VLRD 3IDMB 3L3DB 3EYOA 5FGSA 4GW5A 4YUEH 5I19L 5K9QI 3Q3GA 5EBMB 3S3SA 5CP7A 2Z8VC 5IBTL 1K8IB 4IS6B 3FFDA 4HC1A 1PZUB 4PJAA 3OAZH 3ZYJA 3L3JA 5IVXA 1U3HC 4Y16C 1NDMB 3WDIA 5EU6B 2YPLB 4D0CB 2X4TA 2LTQC 5B22A 1NBYB 1BQUA 4W81A 1BFTA 4NO0D 2VLRA 4LSTL 1RJCA 1U8QB 3MLXL 4YBQC 2C4FT 3VXME 3MRQA 4M6MH 5I15L 2VC2H 4KKLC 4LPYA 4U05A 1KTLA 1CICC 4I0PC 3GMOA 4KKAD 4BFEA 3GIVA 2X4RA 5EWIH 4XBGB 4GAGH 3WXVH 3RWFB 3O9WA 2Q76A 4JFZH 5GGSY 3BZEA 4NO0A 4HHAB 2Z8SA 4HCRL 4M43H 1KCUL 3V2AR 5JA8B 5HHOE 1C12B 4PJIA 3G5YA 1BHGA 1DQJB 5EZJB 4OGYH 1FRGL 3NN8B 4R97C 4AK1A 4B41A 3QO1A 4E41B 1G9MC 1FDLH 1HSAA 3EYSL 3EYUH 3MRNB 1DE4B 1WFUA 3GMRA 2FEDD 3AY4C 4MZ2A 1BVLA 3RGHA 4DVRL 5BCAA 4RGMB 4M4PA 5TDOA 4NPYA 1NQBA 2EXWC 5DJ2B 3HKFA 2PYED 1SY6L 1R5VA 3Q0HA 3CFCH 1A22B 4JM4H 3ARBD 2L7UA 4OGAD 2MQ3A 2R15A 3G6AA 4R2GB 4XHQA 3X3GL 1LEIB 1U8PB 3VH8B 5F6IB 4K8RH 5D4QA 2KBGA 1YEJH 3QDGB 2VDKL 4FQJL 1AR1C 1FE8L 1V5JA 4PRBB 4D0DB 3UTTB 2WZPD 4RZCA 2V2TB 1CR9H 5LCVH 3TV3L 3G6JB 5ABDE 4DGVH 5DD3H 2PYEA 1RMFL 1X5IA 5HYJA 1FZMA 1U0QA 3ARBA 3WD5H 5CJBA 4JG1L 3SN6N 5IBLC 1F2QA 1MQKH 4DOHB 5DMYA 1DDHB 3CFBA 1OSZA 3QAZC 3C6SA 3GMMA 5DMIL 5I8OH 1FL3A 4OZFG 2P24A 1BOGB 1CCZA 4X7TB 1QBML 3KR3H 2VR4A 3CVIH 3MUHL 2V5MA 2AQ2A 2NY0C 4MB5A 3V52L 1RZ8A 2Z91A 5JW4N 3MCKA 3NH7H 3F7YA 5ID1B 1R24A 2FX9L 1LK2A 2Y23A 1AQDB 2OL3H 4NO3A 1TIUA 4E0RB 2DQCL 4YHMH 5INCB 2GTWA 5JORA 5DEFA 1U8OA 4YDVB 1JPSL 2D9CA 3B9AA 3MV7D 4QCIB 2YD3A 5C0GB 3LIZH 1A6TA 1TNNA 2D31B 5DTFB 4YLQT 1FG9C 3BWUC 3OKKB 1AXSA 4LSVL 3CU1A 2XKSA 4I3RH 3CLFH 2NY6C 1U8LB 4ZTOL 1I1YB 1V3JA 2XA8H 1FIEA 4K7PY 3QQ3A 1EEQA 2EYSA 1KFAL 2DM7A 1Y18B 4U6VH 4H5SA 2W59A 3L1OL 3P0VL 4ZS6D 3TBVB 3RFZC 3QCUH 3MV7A 1NLBL 2GKIA 5C0NC 2EIZB 4KAQH 2A0LC 3DVGB 3I02A 2Z92B 3MGOB 4PV8A 2AK1H 1U8KB 1AP2A 1QNZL 4Y1AE 1JZ6A 1ZTXH 2GYSA 1JHLH 5HI5C 5K9JH 1MUJB 2AEQH 4QRPB 4MWFB 1FNHA 4PTUA 5FA3A 5J11B 4RMTA 1CLYH 1KN4L 2ATPA 5D72L 1HSBB 4AQOA 4N1HB 4XP9H 5ANME 5TE4H 2BVOB 4NKIL 1GGTA 4OF0A 3KXFB 1CBVL 2BCKB 4OLWH 1NGPH 3QWRD 3O6LH 1ZLSH 4CMHC 1RHHB 2AJYH 1BBDH 4LRNH 3SDAD 5HI4D 1HCFX 1M7DA 2K9UA 3BKYH 4X5XB 3GSQB 35C8L 1G7JB 2R23A 4FQXC 3RY5A 3MOBL 4WWKD 1WZ1L 4MS8C 3UYOD 3SKNA 2HWZH 3F58H 3MJ8B 1G7MA 3IXTB 1PJ9A 4ENED 4OCXH 1HOCA 4PD4J 1XFPA 1DL7H 4K23H 5DJ8B 5JOEA 2W91A 4EI5B 1IGCL 3LKQA 2DIAA 3QWRA 4NN7C 1H0DB 2ARWA 4JO1L 3SDAA 1IAIM 1R3HB 4DN3L 5F71A 1M4KA 5CGYC 3O0RL 3CFJB 5JHLH 2PXYC 1F4XH 4EI6B 4LSDA 1GOGA 3GKWL 3R8QA 5CAYB 4LCYA 3QHZL 5BXFB 4WWKA 1AIFA 3FQXB 3R06A 3IGAB 4XHJD 4LGPB 4DFHA 3HPLA 4OLYL 4UTAH 4C56B 4GG6F 3LY6A 2FNBA 4R26L 3V4UL 5CEZL 4OD3L 3WSQH 2F8XC 3SGEI 1FGNL 2IWGA 1NCNA 4NBXB 3NZ8A 3ULUL 5C0BE 3MJ9L 3CFKA 4NNXB 3BDBA 1RVFL 4WUKH 2BSSB 1J05A 4P3CL 1P7QD 3O2VL 1NCWL 4JO4L 5D1ZB 4YNYB 4S11A 4ZDHA 5J4MA 4ZMAT 1MQ8A 4R3SA 1KJ2L 1NBVH 1W72A 3OKEB 1U6AL 4P3WA 3R1GH 3FOLB 2NY2C 1OLLA 3DX8B 1AD0A 3QEHB 5HHNB 1BQLL 5MEQB 2K7QA 1JTTA 4U1SA 1ZA6A 3CSYA 1KEGH 4JDVB 4WFFE 2CD0A 1JVKA 4MGXA 4ZG1A 5HJ3A 3CLEH 1MFBL 1CDGA 3PWJB 4XPGL 3BN9C 3BP4B 4LEXH 2F58H 1A6UL 4JRYD 4JN1H 5DVKA 1P7QA 4NWUL 2VR5A 4YDIH 1NEZA 1V3KA 1CFNB 1YN7B 2HTLC 3TYGH 2B1HL 4IRZH 3HR5B 1MEXL 2Y6SD 1Q0XL 5SWQB 4R7NB 4MNGB 4BSVB 5I1GH 4OZGA 3HZKB 1JGLL 4J4PC 3MLVL 1G0DA 4YFEA 1E27B 4LRIA 3IU4L 3C60B 1ZLWH 4KGLA 2E9IA 1U8IB 3OB0H 3OKOA 4JRYA 4KUCF 1JTOA 4G8GB 1NAMA 1E4XH 4PGEB 3GGWB 1GXEA 4BA8A 5JXAL 2AK4D 3S4SG 2AGJL 5IROC 3TIEA 3OAZK 4XNZC 1KIPA 4ALAH 2ICWA 1G6RL 4N0UA 4R9HA 3UAJD 4PIRF 1DLFH 3PF2A 1ZT7B 43C9A 4EZMA 4Z7QF 4Q9QL 4MJ2A 4QRUA 4PJHA 4PJAF 1IKFL 2DM3A 1NGQH 3RDTC 1S3KL 5IVXF 3H9SB 3B9KB 5EULV 5BS0B 3MLSL 4OJFL 5FYLE 3HHRB 1MCDA 5BVJA 3KJ4C 4RFEA 1VEPA 2JB6B 4P9HH 1H3PL 1WC7A 2AK4A 4JREB 4D0BA 5B39B 3QXDB 3I6GB 5JPNB 5MEPB 1I8KA 4QXTA 4LLWA 1JGEA 5L9DL 3TF7C 5EOCL 2A6JA 2OTWB 4GMTL 2IPKA 3BP6B 3V4VH 2BHYA 4C54A 1IM9D 4X6BA 4L4VD 3RVTD 2XTJB 4LU5H 5K33A 1UJ3A 3D3VA 2CIIB 3KYMB 4XMLL 3EOBB 1TJHH 1H5BC 4ZPVA 4PUBH 3BHBA 3V5DB 3BPNC 2NZIA 2VXTH 3JTTA 1DEEA 1MCBA 1V7MH 4YXKH 1V05A 1NCAL 4PRID 5J1AA 1X5FA 3E0GA 2P5WB 1MHPH 1ZWIB 2V2XB 2H6PA 2VLJB 4YXHH 4DN4L 2VISA 1JZ4A 1RZ7H 2A9MH 2A73B 2I25N 3DPBA 5KSUA 1IM9A 4X8XA 5DQJA 3FB5B 1NUDA 4L4VA 3ZKSD 4P99A 4HIJA 5CD5D 4LIQH 3B9DA 4WV1A 3E2HC 4XP1L 1RIUH 4L29A 5DI8A 5FOBA 2OZ4A 5GSRA 3N85H 1ZT1B 5E99L 1HKLL 2W1NA 4YPGA 3DX6B 1XR9A 3I9GL 2EYTB 3V0VB 2JE8A 4PRIA 1SMAA 2AXFA 2DKMA 1HH9A 4AG4L 3B2UD 4AM0A 5I71B 4ELME 1UWEH 4RWYH 2ZG3A 1XGYH 2HLFC 5FKAB 5AEAA 5LKNA 4NQXB 2H2SD 4HJGA 3P0YL 4Z77A 4P46D 4JQIL 3EO0B 1AGEB 3H9YA 3UPAA 1UH4A 1JBJA 3U6RB 1M71B 4YGVB 1BFOA 1C5BH 1IEBB 2W92A 2FJGB 1FH5L 1YN6B 4O9HL 3KNBB 1WBYB 5ADOH 1GPOH 2EDTA 1ZSDA 3TPUA 4F7EB 5C3LD 3VH8G 2DLEA 2CLRB 1KLGB 2Y36H 4GLRI 2V9TA 4N0FB 2R2HA 3VGBA 3N1FC 1CFVL 4EQ2A 4HULB 3KS0J 5KBNC 2G9HB 4P46A 1YMHA 3AFLA 1MCWM 3H42H 1JF1A 3O11B 1JK8B 5EPMB 4BKLA 4HIIB 2VXQL 2QQKH 3W5NA 3H9HA 1P7KB 2ZCKH 4ZUVA 4PJFA 1F6LL 3QFJD 3AB0C 1UXSA 5IW1B 2V17H 32C2A 4K71C 5DLML 3SKMA 1ZT4A 1NFIA 2FX7L 1MCNA 3L95B 5HVGB 1T03L 2NY5C 1N0XL 1ZAGA 4OZHA 3BVNA 1NDGA 3K3QA 3QZWA 1NC2D 5I9QB 4DVBB 3L3IA 2FO1A 3ES6A 5I8KL 2IGFL 1WISA 1LVEA 4KXZI 1FAIL 3HI6H 5FM5O 3VFWB 3WFDL 5C0EB 1EFQA 2JELH 2VLKB 5I2IB 3QFJA 4KMLB 5F1SA 4JPVL 4ZSOE 3MLUH 2AQ1A 3DUUA 4EDWH 2EEDA 3RPKA 1VFMA 1MFDH 3DROB 3ZDXF 1WWWX 1UFUA 1TTUA 1JPGB 1SYVB 4KQ3L 4S2SB 5GZND 3SDXB 2AJ3B 3ZO0A 4W4NA 3PGCA 2EXYC 5E6ID 1NC2A 3PWUA 3MRBB 3MLWH 2NXYB 4UT6H 5ICYA 3DOSA 3CSPA 5CMAB 1I4FB 5BV7H 5C9JB 3VXPB 3KJ6L 3BZFB 3OF6D 4OSUH 1W72H 4XNUL 2OQJA 4WU7A 4M7KL 4OZ4A 4QHUA 4G7YH 2MFNA 5IR1A 1GHFL 3K8LA 4KJWD 4TSCH 3QDMD 4PP2B 2ARJB 4JRWA 4XMPH 3RX5A 4RQQA 3CFIC 3PL6D 3CUPA 2QSCL 5E6IA 3WLWD 1F3JB 1FIGL 3MOAH 2VXSL 4PJ9D 5IMOB 4KRMB 5FXCH 1ZVSA 2XN9D 1S78C 1JGDA 4PJXE 4OZIE 4TOYH 2IMMA 3SE8H 4APQD 5AAWA 1BFVL 3OF6A 1BM3H 5KJRH 1DUYB 4NYLA 3VFNA 1R6VA 3HC0A 1H3VA 4XCYA 4MMXC 5J6GA 4TSBL 4X83A 4QHNB 1TETL 3GSXA 2DMBA 3ARFD 15C8H 3QDMA 4JY5L 4G6FD 3QFDB 5ILTL 2AXJA 2E7HA 2DD8H 3PL6A 2VLMD 4ZAKB 3TO2A 1WF5A 3JWOH 3VMPA 5CCKL 4Z0XB 4PJ9A 5D7JB 4K9EH 1NAMH 2XN9A 4KY1L 1KULA 4BYHA 1UB6A 2Z8WC 2PTTB 2I9LB 2LAGB 4PJGE 4RNRB 1I1AB 1S5HA 4YO0A 4MCZA 5FYJU 1GIGH 2OLDA 1HXMA 3BO8B 4IEFB 4FNLL 2NW3A 4F7PA 3UBXA 2I5YL 1A2YB 1CFQA 4HKJA 2E9JA 2F53E 1MJJA 2Q1EA 3ARFA 5EIIA 1D6VL 2CDFA 4RGMC 4L8BB 1N6QL 4PRNA 1YY9D 5EC1B 3EYVB 2YSSA 1YYLL 1JPFB 4HKZB 1J8KA 3VFVA 1BBJA 1G1YA 4UT7H 1M7IA 3BP5A 2EC9T 1B9ZA 3BEWA 5GQBA 1T66C 5C2UB 2E6JA 2RIKA 4FHBD 4HPYH 4LVEA 1MY5A 3MJGX 4I9WD 2OI9B 1YUHA 3WIFA 4AEIH 4K55A 1A7OL 2VKXA 4DUVA 3LB6D 1AFVH 3SE4C 1MJUH 2Q7YA 5H2BA 5DJXB 3AXLA 1X5XA 3BW9B 1JIBA 3FL7A 3A0OA 3NIGF 2XPGB 4K7PH 5A2FA 1D9KB 4K3EH 4MZ3A 4EIZC 1J0KA 2XXMB 4NZRL 3FTGB 4JO3H 4R4ND 3GSUA 1I1RA 5E8PB 3QIUC 2JJTC 1QR1A 2HT3C 3EFFB 3K2UL 5HHXL 3LQZB 5CD3A 3ZHDA 5JDSB 4PYHA 4OZGF 1K2DB 1KC5H 1QPPA 5IQ7L 4JFFE 1NUNB 3OB0K 1V7NH 2WSKA 5J89A 1NANI 2V2WA 1Q9KB 3ZKMD 3HCVA 1AGDA 2DIJA 4JN2B 3GMLB 3FCTB 2VE6B 4BQ8A 3NBNA 4CDHA 2XQYG 4LVOC 3BKJL 2FSEB 3DRQB 1N64H 1WBXA 3WHE0 5DS8A 4M1DH 4HMDA 3EYFB 3NFPA 4QXUH 2WWKT 3DJ9A 3SKJL 4Z76B 1FVCB 3IDXL 4NQEE 4RGOH 1NJ9A 5GZOC 4RAUA 5KS9E 4PJHF 4CADB 1LP9A 5A2JH 4Z8FH 1BMGA 5F44A 4Y4KD 4RWHA 1FP5A 3UPRA 1MRDL 1RJZA 3QIBD 1FC2D 2R1XA 5DJZA 4O58L 3CD4A 2FHCA 2XIDA 1YNKL 1GZPB 3LV3B 5C86A 2P5EB 1MELA 3GSNH 3IB4A 1B0GB 2E5EA 4XCFL 5TQ2H 3MRLA 4FQIL 1P4LA 2QQQA 2AV1A 1HQRB 4L8DA 1HK6A 4P5KA 4NHCL 1JZ2A 3VG9C 2X1QA 1PG7W 2ZWLT 2CK2A 1P4BL 1EHXA 3W0WE 4NO2B 4Y5VA 5KVEH 5IT2H 4Y4KA 1CDYA 3SDYL 5HXMA 1A3QA 5DJDB 2YHGA 1NGYA 3RNQB 2YEZB 1H15A 3FN0L 3BXNB 3NGBB 3QIBA 5SV4A 3HMWL 2DM2A 1DBML 1QUNA 1XR8A 4L4TE 1B2WH 1EEZB 5B39G 2F54D 3DWTA 3TESA 2DMKA 2KZWA 5E4EC 5EU3B 2BFVL 4D9LH 3KYKL 4L8SB 3S36H 4KPHH 4LSPL 4HCRA 1YYMH 2J8OA 5J1TC 4OB5L 4JEGB 4LLVA 3R0NA 2PR4H 5AYUL 2WUCL 4ZNCD 3DUHA 2A74B 3X3FL 5DUML 3SKOB 3FONB 3L3GA 5C70A 3MXWL 3RWHB 1A7RH 4CGTA 2ATKB 4EXKA 3QWOA 1D5IL 3MV8E 2F54A 4KJPD 2BJMH 2DQJH 1YJDH 4S0TD 5T3ZL 1TVBB 2DN7A 4LNRB 2QR0B 2NYYD 2D03L 2IMNA 3ZT6A 1XF4A 1FHGA 1MREL 3NCYP 4FQ2H 1GGBH 3Q1SH 3VFUB 2D7TH 4NRZB 3O3BB 4ELKA 4MA3A 2UWEE 3H3PL 2R2BB 1H3TA 4OQTA 5I0ZA 2GJ6E 3SE9L 3HFML 4UU9A 4O51A 1Q9OA 3T65B 2YBRA 5F7HA 2I9TA 4MJ6A 5DMJB 3EZJB 5H94A 3Q5YA 5JIIA 4OCWL 1XGTA 5C0AD 3F7RA 3KPNA 4QXGH 4HX1A 3MLYH 1PBYA 2WBKA 4NDMB 5IHUL 4KDTA 1J1PH 5CHNA 5HHOD 2ICCA 1Q1JL 5IJVB 2VYRE 4KMTL 2JK5B 4YHOH 1FYTE 1FFNB 4R8WL 2ZKHH 3QHFH 4LCCB 4PJFF 1DFBL 1QLFB 2D3VA 4W70A 3SCMB 3IJSA 3WFBL 1IC4H 1QEWA 2C4FU 4DOHE 4OKVB 1HZHH 4IRSC 3HE6C 1EVUA 1G7LA 5C0AA 3RIFF 1EK3A 3RWJB 4G9DB 1A6AA 4XVTH 1T20A 1ZE3C 4P4KD 2E6QA 4KJQC 1R5WB 4FRWA 2P44B 2R2CA 4ODXB 3T0AA 1R3LA 2ORBH 2GK2A 1T0PB 1KLFA 3HZVA 2D4FA 2BVQA 4ODUA 5HHOA 4F8TA 5FGCE 4QHKJ 3ARYA 5I1IL 4NQSA 5ID0B 5DVNA 4M7LL 2YPKB 4YHNA 1LE5B 4WW2A 2N7BA 2DAVA 2DQEL 2EH7L 4X99B 5DVLA 1MLBA 4IOIA 3WIHH 4Q2ZB 4M6OH 3P4OA 5CSBA 4IDJH 5DJ0B 1ZGLM 3K1KC 3RZCC 2AJSH 4P4KA 4HUUB 1TZIA 3RWDB 1A5FL 4MVBD 5KVMC 1IEAB 1JI2A 1CFSA 5BMFL 4QTHA 1XIWB 1T22A 3MX0A 5D7LD 3MUGB 4XP5H 3T2PA 1ZHBA 4Z7OF 1EO8L 4PGBB 2P8LA 1FL5A 4LARH 2BOCA 2RCSH 2PKDA 4OD1L 4JHWH 2A6DA 5I16A 5GJTH 3VFGL 3X11A 2YK1H 1LGVA 4R4BA 3DMMB 1ZLVH 4Y4HC 1DBKH 3U4BH 1KPUA 2NW2A 4JPKL 3FO9B 1JNHA 1SBSL 5GS1A 3KPRD 5TH2A 1ERNA 2VL5A 4NKMB 5E5RB 4NKOA 1X5HA 1W2KT 2JF1A 4FXKB 1AD9B 5D2NA 1EHLL 4JQVC 1R3JA 1F4WH 3LKOA 4PJDB 5D7LA 4G80B 5J1SC 3VU2A 3F7VB 1TZGL 4FFYH 2UVEA 4H0IA 3PDDA 5GIRB 4EKXA 3OHXB 5E8NA 2IALB 4NNPH 4XPTL 4GG6B 5E8DH 4K07A 2XZCL 1RJYB 5T1KD 3ZE1F 4HPOL 1HE7A 1A14H 5FF6A 1DQMH 4ZFFB 3P77B 3HZYA 3KPRA 2XRAL 2WBJB 2QHLA 5I75B 3HTLX 4XVUD 2BRQA 1F4YH 2BC4A 1IC5H 1S7XB 4N9OB 2FX8H 3FRPG 3MUZ1 1E6OH 3HNTH 4H20L 1R0AL 1ONQA 3PWVB 3TWCH 1VHPA 5DRXB 3MNWB 5C08A 2APTA 2GUOA 4J12A 2YA2A 1WUNT 2YOCA 1SEBA 4FZEH 2ADFL 3PGFH 3NCFB 3TBTA 2EC8A 1CFBA 4ZQKA 5T1KA 4LPCA 2ZPKL 1KB5B 3GSRB 4H88L 1UYWL 1MVFA 1AO7B 3K4AA 3ULUD 2W65B 5CKGA 3AREC 1U3HD 4QYOB 5L7XL 1KELL 4Y16D 3OAUH 3NFNA 2LFGA 5E2WL 5I19H 1I3VA 4HIEA 1JTPA 3E6FA 4BH8A 3D0LA 4Z5RB 3KPSE 4PJ8C 3FT4A 3HMXA 4KRPC 4YBQD 5IBTH 1CGSL 5BJTB 3BI9X 1AXIB 1QFUL 4TVPL 4NN6C 4AEHL 1QFHA 4P4RA 1QD0A 5JPMB 1CICD 5AYQA 1KJVB 1QBBA 3PV7A 4NIKB 2V7HA 2H32B 1CU4L 2M1KA 1VACA 4WHCA 4LSTH 5GS0L 1U3HA 3MLXH 4M7ZC 4Y16A 4XZUA 3L5WB 5F3HB 4C56E 4OI8A 4W6XB 1T7WA 4BFGA 1GJIA 3LKSA 4Q7DA 5I15H 3EYOB 3UYPA 4GW5B 1KJ2A 2BVTA 5CJOL 4JM2D 1Z3GL 4X6EA 5E2UL 1ZVYA 2ENSA 3FFDB 1CICA 4UQ2A 5ANMA 4PJAB 5HHPA 3S3PA 1FVEA 1HYRC 4QGYA 4EEEA 2NLJB 1HEZA 2EXWD 1KCUH 3W2DL 2X4TB 2R2EA 4GRWF 3FQWA 2VLRB 3A6OA 3FOMA 1FRGH 5IFAL 3STLA 1HWGB 4O5LL 2J12B 3EYSH 4Y8DC 4JM2A 3MRQB 4NRXB 2DWEA 4DVRH 1KTLB 5IW3A 1CXLA 3GMOB 2LVEA 1ES0A 4KVCL 1Q38A 3GIVB 1SY6H 2X4RB 1A02N 4AIZA 4NCC1 1LP9F 1RZKC 1WTGT 2Q76B 2C1OA 3BZEB 4NO0B 4PRHD 4I5BB 2LQRA 4YE4L 3BD4A 3ULVL 3MFGB 5KSBE 2VB5A 5IBLD 5BO1L 4EUPB 3G5YB 5TDPA 2VDKH 4FQJH 5FB8A 1FE8H 3QO1B 4MX7A 2VNCA 1X3DA 1HSAB 4G8GE 1BVLB 2NY0D 1RMFH 3IF1A 2JJVA 5EZOH 3X13B 4NPYB 4ZO7A 5GGQL 2NTFA 2O5XL 3RTQC 5ISZD 1JZ5A 2V5RA 4PRHA 5DMIH 4BSWA 3WNKA 5CIPH 2Z8RA 4OFKA 1SJEB 1QBMH 4P2RE 2HJFA 3WE6B 2XWJA 3V52H 5J3HC 3N06B 1D6EA 3T0XA 1K5NA 3QUZC 3F12B 3LEVL 2F5AL 1QA9A 2BSED 4RZCB 1Z0NA 3TFKC 5SX4H 2HKFL 2YD9A 4FQCL 1U8NA 1YDPB 4LKCA 4WHTA 5CJQL 3D2UD 2DQCH 4HF5L 5ISZA 1OP9A 4PY7A 3BOVA 4GG8A 2PYEB 1FZMB 2GHWB 2NY6D 1MFEL 1MRCL 1CDHA 2EDJA 3ARBB 3JVGC 3QI9B 3EFDL 1RY7B 4M1CD 2KDGA 3MRKB 5FGBA 1OSZB 4A6YL 2J6EL 3GMMB 1FL3B 1EHNA 1S7VB 4Y5XC 5K59F 4K94L 1GYAA 5ETUA 1QBAA 4FFWC 5C0ND 4LSVH 3FB6A 2Z91B 1RV6X 3MCKB 4ZTOH 5F6HJ 2A0LD 2HT2C 3F7YB 1LWRA 4ZXBD 4FQLL 1R24B 3LKPB 3D2UA 1IGIL 1LK2B 3UTZA 1KFAH 3QNXA 1EPFA 3MLTA 1EEUA 1JCKA 3L1OH 5DJYA 1WCBA 3P0VH 3V0WL 5I1DA 3D69A 3TJEL 3P9MA 2DJUA 2GTWB 4FTVE 5HI5D 5JORB 4KU1A 3ILQC 1U8OB 3CXDL 2X89D 2P8PA 4MNHB 1WT5C 4LLYA 5A3IC 2AP2A 2SEBA 4X4MA 1KUMA 5DR5L 1VFOA 2P47B 4ZXBA 1QNZH 3V5HA 1AXSB 3NPSB 1S8DB 4X4XA 4ODSL 4N1CA 3OR7A 1T89C 3O3DA 3NA9L 3QQ3B 5E9DA 4WUUE 2EYSB 4U33A 5J9PA 2MHAA 2VZUA 5D72H 4FQXD 1NCBL 5ESAB 3KHQA 1Z5LA 4ZPTA 2X89A 3MV7B 3TBSA 5FFLA 4Z6AT 4MS8D 5AUMA 2P49B 1CBVH 1JPST 5LGJA 1U9KA 3KLAA 5HY9A 3MROA 3I02B 4W68A 4N0YL 3S35L 35C8H 2DLHA 4XVJL 4PV8B 5IIEA 3VXSD 3KYNA 5EH1A 2EDDA 1EHAA 5F9WC 3MOBH 1WZ1H 5CGYD 2VLLB 5DURD 5EO9A 4OGXL 4I0CC 4NUJA 4N5ED 3V7AG 4FQXA 5FA3B 2F74A 3LCYA 4QO1A 4YHKL 4MHHI 2I07A 5FCUH 1N2RB 3SGKA 4WW2F 1IGCH 1ROWA 3BPLB 4JO1H 1XZ0A 4DN3H 4G6JL 2D7QA 1T0NA 3O0RH 3UDWA 3IAPA 5I18L 1CT8B 3VXRE 4QRRE 3FB8B 3GKWH 4QRQA 3VXSA 4RDQF 4CNIB 1UCTA 4N8VB 4LPTA 2R23B 3KPOA 2DQIL 3MRPA 2CRYA 5F89B 3FMGL 5HGGS 4OLYH 3SKNB 1F58L 3N9GH 1G7MB 4HBCL 2FO4A 4R26H 3V4UH 4ELMA 5CEZH 3GMNB 4IOSD 1HOCB 1L7IH 5ICXB 3AROA 4HUXA 1FGNH 4N0CD 3U36A 3LKQB 3C09C 3IS1X 3MJ9H 1IC7L 4H26B 1T0MA 1RVFH 1IKNC 3SDAB 4JKPH 4P3CH 3RX7A 3O2VH 1A64A 1NCWH 4JO4H 5T1MA 4BSJA 2I60L 3BN9D 3NABL 5IGXL 1KJ2H 3SO3C 2NY1D 2R0KL 3IRZA 4WWKB 1AIFB 4M7JL 3R06B 4ONOA 2HTLD 1BQLH 5F21B 1XGRA 1OTSC 1FFOB 2Q3ZA 3DV6A 3HPLB 3VRLE 3ZYOA 1MFBH 4J4PD 4NWTL 2QADC 3QCTL 1O0VA 4XPGH 3ZKXB 2IBBA 1CYGA 4HJJL 2CKBL 4N0RA 2UYLA 1YEDB 4NWUH 3NZ8B 4F57L 2X5PA 4Y2OA 1O7VA 2B1HH 4HXAL 1MEXH 2BNQE 3S96B 4ZDHB 3X14A 1JGLH 5F96L 3T0DA 3MLVH 2VXUL 3O3UN 2AW2A 1U58A 4WEBL 1AD0B 2W60B 3IU4H 1RIVL 1BZQK 4JFXA 1L7TL 1ZA6B 4U1SB 5F72S 3RDTD 1GOHA 5K9OA 5HJ3B 4H25A 4EUPH 1G84A 3TN0C 4PR5A 5JXAH 1KOAA 1OTTC 2EYRA 4OLXL 4F15B 1J7VR 1P7QB 3CX2A 1G6RH 1UC6A 4Q9QH 2NNAA 5IROA 1IKFH 5FYKL 1RD6A 1S3KH 3BFOA 4OZGB 3VW3L 4GSDL 1PSKL 5CZXC 3RDTA 4OJFH 3REVB 1D5MA 4LMQE 3ULUF 1XGQA 5CEYA 3I3EA 1H3PH 3DRTA 5DT1L 4P3DA 5TF0A 3ZT7A 3PP3H 3QUXD 4MDJB 1HHHA 2HRLA 3WFHA 1S9YA 2V7NA 3K8KA 5L9DH 2X7LA 5EOCH 1BPVA 4GMTH 1KIPB 1KIRA 4N0UB 43C9B 3O8XC 4PJHB 4AT6A 1FVDA 3IDJA 3VD9A 4MDIA 4DAGL 1C5CL 4DTGL 1D7FA 4NN5B 3X12B 1HILA 3QUXA 5LBSL 5BVJB 1NCAH 5C1MB 2ZCHL 4X6FA 1H5BA 1WC7B 4OZIA 2AK4B 4D0BB 3QB7C 5KANG 3U30B 1KPVA 1KG0A 3VFOB 4JM2F 2BY3A 3VRJA 1IGTA 1I8KB 3U1SL 4QXTB 4LLWB 5TGBA 3TCLB 2F53D 1AKJA 2IPKB 1CXFA 1TZHA 4XP1H 4KZDL 5I30L 3PNWA 3MNVA 5E99H 4Y4FD 1HKLH 1UJ3B 1FAKT 4QRSA 5T33L 1U93A 3LS5L 3I9GH 4NZTL 4F9LC 5CZKA 4UIMA 5IHBA 5JMOC 4TUKL 3BHBB 4PJGA 3PG2A 1QSFE 5KVGL 3JTTB 5KSAA 1WFNA 1I3GL 5J1AB 2ICEA 2H6PB 1C16B 2VISB 3P0YH 3VGHA 2F53A 4OKDA 4U1MB 3GHEL 5C6TL 2A6IA 1IM9B 5DQJB 5KSUB 2FZ3B 3MLZL 4L4VB 3O2DL 4Y4FA 4HIJB 4ZUTB 1FH5H 4WV1B 4CBPA 4O9HH 2WWMD 4X0KB 4XNQB 3T77B 4L29B 1NCUA 5DI8B 5FOBB 4LDLB 5GSRB 4RFNC 5J57B 5JW5A 3EW3B 4YBLB 5HHMD 2DJ4A 3EOAA 4YPGB 1XR9B 4EN3D 2CO6B 3C5ZC 3MRRA 4PRIB 2HFGL 1HH9B 1N4XL 1CXKA 4WCYL 5A16A 4XPFL 4UOW1 4JFFD 3FRUB 2EC9U 5JW4Q 2R8SL 4HJGB 4HWEL 3WO3B 4UUJA 4QHLB 2MQ0A 5JHDE 3STZA 4UBDC 2VXQH 1ADQL 3QP3A 4AEFA 5E8OB 5GRZA 1J0YA 5HGBA 3T1FA 2GTZA 4EN3A 3W82A 2G60L 5GRVL 1DP0A 1PQZA 5DLMH 3TPUB 3OXRB 2FX7H 1T03H 3CDYA 1FSKC 3SQOH 1N0XH 1KYOK 4NKDA 2BNRE 4JFFA 1TQBB 3MGTA 4PJ5A 5SX5H 4P46B 1YMHB 1B4RA 1JF1B 4IJ3B 4JFHE 2IGFH 4PLKD 4BKLB 5I8KH 1FAIH 2EXYD 3WFDH 3EHBD 4DCQA 4JPVH 4I0KA 4ZUVB 3R0MA 4BZ2L 3CVHL 4NQCE 5TDNA 2PCPA 2HKHL 4RMUA 1JV5A 4Y88A 1UWXH 2VSCA 2PN5A 3PXHA 3ROOA 1DANT 4KQ3H 4Y2DC 1INQB 4PTTA 1ZT4B 1MCLA 5KS9A 3RGVC 3W0WD 1CVRA 1LO4L 2Y06L 3CH8A 3C08L 5C09D 1AE6L 1NDGB 3BVNB 1T5XA 4M5YL 2Y07L 3ES6B 1QHOA 1PYWA 4TNWK 5I1EL 3HAEA 4M7KH 1GHFH 3BPOC 4L4TD 4X6DA 3U9UA 3UZQA 5C07D 2QSQA 3K7UA 3TNMA 1VADB 1E4WL 5CP3H 2QSCH 3BT2L 5DA0B 5I17A 2BNUA 3W0WA 3GNMH 4HWUA 1FIGH 4JGUA 3CJJA 2VXSH 2VAAA 4HS6A 2FD6L 4U1NA 5C09A 4LEOB 1NC2B 5HPMA 3ALPA 1BFVH 5J06A 1P69B 5JOFA 4G7VL 4TSBH 4L4TA 1TETH 3MV8D 5C07A 4JY5H 4WU7B 5IR1B 4OZ4B 3MJ6A 3HR6A 4LVNC 4NT6A 2RAMA 1PFCA 1TCMA 1KXVC 1U91A 3O6ML 5CCKH 4EQ3A 1YQVL 4OAWB 4ZUSA 3ME0A 3CUPB 4LLMA 5HPOA 5E6IB 4KY1H 2H26A 3HUJE 2GJ6D 3PDOB 1U8JA 1ZVSB 2HJLA 1KJ3L 4GBXD 3TBYA 4FNLH 1JGDB 1T80A 3C6LB 4YFLI 5E08L 2I5YH 2JJWA 3JSSA 3VFNB 3MV8A 4XCYB 1T66D 3NCJL 1D6VH 2RFXA 3MA7A 4ELMF 4K3HA 4OM1H 5E6YA 5IESL 3GIZL 3QDMB 1N6QH 2E9WA 4R90L 5IOPA 4WDIB 3PL6B 1I9JL 1YYLH 3FO1A 5KTEL 1G7QA 3TO2B 2UWEA 3ARDC 2IANB 3O9WC 3RP1A 1A3RL 2GJ6A 2WMPA 4PJ9B 3TLRA 5EWIL 2AS5M 1FYTD 2XN9B 4N8VG 4GBXA 4L9LC 2KH2B 4APQB 1S5HB 4YO0B 4MCZB 3BQUB 1HXMB 1A7OH 4PGCA 5IMLA 2OCFD 4F7PB 2FIRT 3UBXB 2HT3D 1CFQB 4HKJB 1NFKA 5MHSD 1MJJB 1DUZA 4I4WA 5EIIB 3O4OB 4ZODA 4G6FB 2CDFB 4MAYC 1UXWA 4O2CB 1CDBA 3PABA 5C0FA 1P7HL 4NZRH 2XV6B 4PRNB 2ERJB 5EBWA 4HGMA 5IF0A 2YSSB 5IB2B 1FYTA 4BQCA 3VFVB 1BBJB 5HHXH 3K1DA 1WWBX 1M7IB 3BP5B 1EZVY 1OAKL 3BEWB 1NC4D 3CZJA 3RVWC 5DFVD 3SDCB 2CUIA 4PRPE 2MJWA 3GEWB 5DSCA 5IQ7H 1ZHLA 4JM4L 5CSGA 1G9NL 1B0WA 2JJTA 1PD6A 5D2LE 1YUHB 3WIFB 1JWMA 3FO0L 1PKOA 2FEDC 3AXLB 3D48R 2WUBL 1N8ZA 1YEJL 3WEXA 1NCDH 3V9FA 4C57C 1MAMH 4AZ8A 3BKJH 4ISVA 3QRFM 1SVZA 3DXAB 3QIWC 3SY0A 3VGAC 4WHYH 1QRNE 4JJ5B 3SKJH 3GSUB 1NC4A 3IDXH 1KACB 1AGCA 2CO7B 2ICWJ 2ZUUA 2AABL 4GLRH 1QR1B 1RSFA 2G2RA 1E4XI 1MHEA 5MI0C 4U1JA 5CD3B 3K46A 1PZ5B 4G8EA 1OVZA 2ZUQB 1MIEH 4DKAA 1MRDH 2EDEA 4GRWB 4DW2L 3QXWA 4Y5YA 3BE1H 4KC3B 2V2WB 4O58H 4GW4A 5AZ2L 1YNKH 3HCVB 1AGDB 3T2OA 1LMKA 2YD2A 1AO7E 1PDKA 4X8JA 2IADB 4XCFH 4FQIH 1N6UA 5CSZB 1MCKA 1RZJC 4OLZL 2YXFA 4BUHA 4RSVA 1I7RA 4NHCH 5DS8B 2OL3L 4NO5A 4FG6D 2AAVA 2OXGA 3VWKB 1P4BH 5D96B 5KVFL 1NJ9B 2NX5E 3SDYH 1ORQA 4I2XE 4RAUB 1LP9B 4DKFH 3HMWH 2XOTA 4U2YA 1DBMH 3UPRB 3LIZL 2GY7B 1GL4B 3MRMA 2GK0A 3I6LE 2R1XB 1QO3A 5EUOE 2YUXA 4QLRA 2XFXB 1TQCC 3V6ZA 4PJXF 4OZIF 1U3JA 2ZUVA 3HE7C 2BFVH 2XA8L 1P4LB 3KYKH 4NJ9L 2AV1B 4L8DB 5J13C 1MAKA 4P5KB 4OB5H 3DI3B 3IVKA 1UWGL 4RMVA 2WUCH 1I8MA 3OL2A 3E3QC 4Y5VB 2E27L 5KVDL 2FR4A 3X3FH 5EA0L 3P2TA 4HLJA 3LKNA 1NGYB 3KPSD 3MRCB 5IVXE 1H15B 3MXWH 3WN5B 3PP4H 5CBAA 1T4KA 1D5IH 1CS6A 1XR8B 3ARVA 4P23D 1KF9B 4PJGF 3LD8C 5T3ZH 1KIUA 2AK1L 4ZS6C 5GHWL 2YC1A 3QUML 2D03H 1N26A 2GW5A 1ZTXL 1MREH 3VXOA 3I75A 1V3MA 5BW7C 3M45A 3H3PH 4PJ7E 2MNUA 3SE9H 4AENA 3G5VA 4LLVB 4GRMA 3KPSA 4KGJA 3HFMH 5E2VL 4F7TA 2WBWB 1ACYL 1H8NA 1YC7A 4AMKL 3BMVA 5I1KL 2AEIT 2NQCA 3CZFA 3L3GB 2DIBA 4F2MA 3B2VL 4P23A 2EZ0C 4OCWH 4ZUWA 1KPRB 5M94B 4KTDL 3QWOB 2F54B 2HYMA 3L3OA 3AM8C 4PJIE 5I73C 2WINA 5J0BA 5IHUH 3HG1E 5LAXA 4N5UA 2CDEA 4KJQD 5F7UA 3F58L 2EE6A 4F58L 4KMTH 2BY0A 4ELKB 4KZEL 4JFPB 4MA3B 4R8WH 2PNDA 1J8HE 3SDAC 5E6ZA 3WFBH 1DFBH 5HI4C 1LEKA 4UU9B 4LLDB 1UZ6F 1H8OA 2P42B 4O51B 4ZOAA 2HFTA 1Q9OB 1UM6L 4JY4A 2YBRB 2I9TB 3BISA 4MJ6B 2APFA 5H94B 5SX5K 3QUYC 4WHDA 1XGTB 1Q72H 1MWAA 3KPNB 4ENEC 1VPOL 1FO0A 2ZUSA 4HX1B 2KUTA 3RZCD 2FB4L 4M8VA 4A6YA 5I1IH 1UQSA 3VXUD 1PLGL 4H8WL 2DQEH 1TVDA 2EH7H 5HYJE 2WAHA 3WLBA 3TC9A 1YNTB 4U6HB 3IJSB 1QEWB 4TUJB 5BV7C 1CGUA 2XZAL 5JDJA 4M02A 1FNFA 1Y6KR 1X5AA 3MYJB 1G7LB 1EERB 1JYWA 4Y4HD 3VD5A 1A6AB 5KS9F 1T20B 5BMFH 1DBBL 1RUPL 3RZCA 3L5XL 1EO8H 1P6AB 5E1HB 1WIUA 2BVQB 4OD1H 3VXUA 3R1GL 4HEME 4XP4L 5HHOB 5KSBA 1RULL 3RU8L 3VFGH 1DQTA 3CIQA 4LCWE 5IVZB 4MJ4A 4WW2B 2DF3A 4JPKH 1X4YA 1SBSH 4X6DF 1MLBB 4IOIB 4WWID 4LEXL 3ARGC 1A0QL 3FZUC 2NY7L 3P4OB 4MJID 5IFJA 4H1LH 4Y4HA 2EE2A 3IFLH 5MENE 1EHLH 4EDXA 3P73A 1TZIB 1FZKB 4G5ZL 4P59L 4JKWA 4LRIC 1TZGH 3V6BR 3TVMC 2BHZA 4QTHB 2L7JA 1T22B 1S7RB 2XY2A 4JQVA 1ZHBB 2COQA 1C5DA 3QZWG 2P8LB 3JWOC 4HUKB 1IQWH 2BOCB 4LIQE 4JLRB 4XPTH 2HLAB 5HHQA 2A6DB 1EEYB 2VN4A 2XZCH 4NSKA 5E8EA 4K9EC 3V6FA 5ENWA 5I16B 4HPOH 3X11B 4M7LT 4R4BB 3HI5L 5T3XL 4BFIA 2F8OA 1XF2A 2XRAH 5ECJE 5JW4M 4R96B 2Y6SC 4MJIA 1J1OH 1KPUB 2NW2B 2HVKA 4PGJA 3WDJA 2OR7A 5GS1B 3CSBA 2CRIA 4H20H 3ARED 1R0AH 4OFPA 2VXVL 3K80A 3LN4A 1EV2E 3E3QE 2N7AA 3LKOB 1MIML 4JPIB 4FTVD 2ZNXA 4PJ8D 2ADFH 4RCAA 4NN5C 4KRPD 3MACL 4WNQA 3T04D 1OWRM 4JAMB 4G43A 5FM4A 1BX2A 5E8NB 4H88H 1UYWH 3B9VA 1HI6A 2Z35A 3ZKQD 1RZIA 3U30C 5L7XH 1KELH 2BSTA 5E2WH 4Q6YA 1X5ZA 4O02L 1JNNL 5IVOA 3VXQA 2DLGA 4MCYB 3HZYB 4HIHA 2X4QB 5FO8A 4P5TC 3AREA 4WUUD 2ED7A 2BC4B 1CGSH 4TVPH 1QFUH 3CC5B 2R4SL 4CW1A 1ZHNB 2UWEF 3BGFB 4HAFA 3I84A 4FTVA 1ONQB 3HNVH 2OJEA 3T3ME 3RKDC 4X4YA 4PJ8A 2X9YA 2RBLA 4KWUA 1NGZB 4LU5L 1SEBB 1CU4H 2DLIA 2A6KA 5GS0H 4U1GC 3SDDD 2NY3C 3CCHA 3O41B 1V7ML 3NFNB 3QRGL 4WUUA 1EDQA 5GISH 5CJOH 3VFPB 5F88A 25C8L 3E6FB 3T8XA 3D0LB 3QQ4A 4UQ3A 3RVTC 1Z3GH 5E2UH 4C83B 1W0WA 2DI7A 3VMNA 3HC4L 2JJUA 2KQNA 4HK3N 4M5ZL 4P4RB 2BXYA 2ENYA 3FT3A 3N85L 1SHMA 2V7HB 4PG9B 2FGWL 3W2DH 4MD0A 1VACB 3UBXG 2EDRA 3VXRD 1U3HB 3SDDA 5IFAH 4Y16B 4XZUB 1CD0A 3E6HA 4O5LH 2LTQB 5HDLA 2F8VA 3LKSB 3VFSA 5CD5C 4J6RL 1IEHA 1OHQA 3MFFA 3GMQA 5GJSL 3EO9L 4KVCH 4X6EB 2XICA 1WITA 1J11A 5HDQL 2R9HC 1CICB 3LQAL 4UQ2B 5ANMB 5D7KE 5HHPB 2J88L 3LPGA 3NA4A 4PJEA 5FECA 1FG2A 3B2UC 5E0QA 5DD6A 1HEZB 1F3DJ 4YE4H 3VXRA 1OP3H 3ULVH 1YECL 3RTQD 3N1QC 3P4MA 4LF3B 5BO1H 3FQWB 5L8KB 3MO1A 4U1HA 1N5YL 3FOMB 1LHZA 2Y36L 3STLB 3QH3A 2J8HA 1MNUH 2EDKA 3VMOA 4YDJB 3NIGE 2DWEB 4UDUA 5J3HD 4R97B 1LDSA 4ZFGL 2O5XH 1ES0B 1SQ2N 5AG8A 1K4DB 3MOQA 3FQUA 2QQKL 4AIZB 5DWUL 2ZCKL 3TFKD 1B6DA 3RTQA 1HNGA 2C1OB 4I1NB 5HVHC 4JFDE 2V17L 5BRZD 2I27N 1HHKA 3G5XA 2BNQD 4UOJA 4LP4A 4TYUA 1JZ8A 1FLRL 5TDPB 5FB8B 1T5WA 3LEVH 4Z0BL 3ZSTA 2F5AH 3QULA 4NC2B 4CN4A 4YK4C 4MXWL 4MX7B 4JRYE 5E94A 2HKFH 4FQCH 3ARZA 5CJQH 4HF5H 4P2OD 4FFWD 3ALXA 4TSAL 1MFEH 1MRCH 2C26A 2NTFB 1YJDC 5GGRA 3EFDH 1EA9C 4N0UE 4D8PB 4YAQA 3RVXC 1UM5L 2ZJSL 4K3DL 1IL1A 2R29L 1T2JA 3MLUL 5C0BB 2DI9A 4PRHB 4A6YH 3O6FC 2J6EH 5DEGB 5BRZA 3JVGA 4OBRA 5GGTA 2BNQA 4O2EB 2HJFB 3HRZA 4ZTPL 3QAZB 4J3VA 3RY6C 3UTQA 4GS7C 1VFBA 1K5NB 3UTSE 4FQLH 1LEGA 1IGIH 5A3ID 2NY0B 4P2OA 5INDA 1QA9B 4ZD3L 4UT6L 5KSVB 5HI3C 1U8NB 3GUTA 1SYSA 4WHTB 3V0WH 2AEWA 4PY7B 4X7CC 3TJEH 4MXQC 3NCBB 1P4IH 1ETZA 2LU7A 5DJ6A 3CXDH 1U8HA 3JXAA 3SE3A 4TSCL 3DGCR 5J12C 3D3VE 5ETUB 3PXJA 1MCCA 5DR5H 4Z7UA 4TPRH 5I6XC 5AZEH 1G0YR 3FB6B 5F7DB 3U2SA 3O2DA 3RX8A 2X1WL 1S9VB 1EIBA 4IMKA 4R4FL 4RMSA 3QUKA 3NA9H 4MSWA 3KGRA 4MAUL 3D2UB 4HK0A 3UTZB 5E7BA 1QHPA 4U1KA 3MLTB 2NY6B 1ZMYA 4K2UH 1T89A 1WCBB 1NCBH 2LE9A 5I1DB 5KAQF 4PREA 1OGTB 5HYQA 2DYPD 3C87A 4OTXL 4I48A 15C8L 4UV7L 1CGWA 5M95B 2A77L 4EOWH 2P8PB 1C8PA 3QWQB 1WCQA 2HP4A 4LKXA 4N0YH 3S35H 1CIDA 5IV2A 1TVHA 4NZDA 4XVJH 4LHQB 4ZXBB 3OMZA 2A2QT 2PW1A 4W4OC 1VKXA 1BQSA 3OR7B 5IWLC 3O3DB 3ARFC 5EBGA 4L9DA 4HFWA 4OLEA 2VUYA 1XCQA 2AJZA 2CH8A 4JZOA 4YHKH 3MQIA 2MHAB 2DYPA 2FDBP 1G7PA 2MQCA 4L3EE 5IBUB 3C2SA 1Z5LB 3OKDA 5AUMB 1ZS8A 1OP5H 2HN7A 5LGJB 5A40E 1ZANL 3KLAB 5HY9B 5I18H 4HGWA 3MROB 3D39D 2VDQL 2FATH 1AGBA 1EGJA 4MQTB 4RIRA 1KYOJ 5IIEB 3DYPA 4CMHB 3KYNB 2DQIH 3IDUA 5FK9A 3V95A 3FMGH 1H3GA 3QEQE 3IJYA 4K7PX 5EO9B 2NY4D 4YR6B 1F58H 5KSBF 4NUJB 4HBCH 4WI6A 4FQXB 3OJDA 3LHPL 1YY9C 3F7PC 2F74B 2HFEA 2C3HA 2IAMC 2I07B 1BIIA 2B8OT 1CDCA 1N0LA 1MFNA 3U46A 1OTSD 4K7PL 1IC7H 1ND0A 5IW6B 1XZ0B 4PJFE 1U2CA 2KPNA 3D39A 5IVNA 4V2BA 4EXPX 2Y7QA 1J12A 5F1NB 5JHDD 2QADD 3JV6A 2ZSWA 2DS4A 4RFOL 2I60H 5IGXH 4G6MH 4NN7B 2R0KH 5DHVA 4M7JH 2EE9A 3KPOB 2PXYB 5E70A 2MSPA 3MRPB 1IZKA 3IFPA 4OZHE 2FRGP 4YPJA 4D3CL 2FO4B 3MNZB 4ELMB 4NWTH 2Q3AA 3QCTH 4LBEA 4HJJH 2CKBH 5TE7L 1NH6A 2ED8A 3AU1A 4DEPC 2IJ0C 3ALWA 3VI4F 5JQHC 5GRWA 3U36B 2B1AL 3QFJE 2YA1A 4F57H 3GBLA 5JHDA 3ESVF 4NM4L 4RA0C 4HXAH 4V1DE 4JFHD 1N64L 3RPIA 4K3JL 1FZJB 5T1MB 5DVOA 2VZSA 4HWBH 6FABL 1OTTD 3S6CA 5F96H 2AVGA 2VXUH 4U7SA 4NQCD 1C1EL 4WEBH 4LPUA 5JW3L 1A6VL 3H2WA 4Z7OE 1RIVH 3TH3T 2N56A 1XGRB 1L7TH 3DV6B 1SJXA 1U41A 2NY2B 4DK6A 4FQ1L 5CZXD 2ADGA 1WGOA 2B5IC 4OLXH 1S7UB 1QG3A 5FYJL 2HT4C 4UNVA 5DA4A 4FN0A 4XBPA 4Y4KC 2APBA 5FYKH 3OV6A 4TRPL 2CDGA 4NQCA 1M6OA 1JF5A 3QIBC 3X14B 2O93L 3VW3H 4GSDH 1PSKH 3GMPB 5I74B 1U58B 2DTMH 5EU5A 1DBAL 1K6QL 2QHRL 5CWSA 5SWZE 3UJTH 3O8XD 4WW1B 4ZFOA 3QQ9C 4ODBD 5DT1H 1IGJA 2XXCB 2R0LL 5K9OB 1JWUA 1DANU 4H25B 2R56H 4PR5B 2EYRB 3M17B 1M05A 4HH9A 2P7TB 3QJHA 4NP4L 5L0QC 1XGPB 1DBJL 4KPHL 4OGZA 4ODWA 4ZSOB 4PFEA 1PKQE 2NNAB 1EAJA 4XNZB 3JTSA 2G75A 2W0LA 4DAGH 1C5CH 4K8RD 3O8XA 4XMKL 2VZVA 4DTGH 4ZFZB 4NRYA 4Z18A 5IB4A 3RDTB 2VDLL 3M8OL 3EJYC 5LBSH 1XGQB 5CEYB 4PJCE 2ZCHH 3HZMA 2ZOKA 3DRTB 4P3DB 4GAJL 2BRRL 1KTDA 4MD5A 1HHHB 4FFVD 5MERA 1S9YB 4Y89A 2V7NB 1L9MA 3U1SH 3U4EA 2X7LB 5A2LH 4OBSA 1HWHB 4ODVL 1KIRB 4JGMA 3MBXL 4KZDH 5I30H 4P57A 2FLBT 4GMSH 4D9QE 4F7MB 4JFEE 2D0HA 1FVDB 4PJEF 1UVQA 4KJPC 2MKWA 4Z7WE 1XF5B 4P2QE 5T33H 4AL8L 3LS5H 3IDJB 4NZTH 5EU4A 3HUJA 3I6KA 5FUCC 4TUKH 2XWBA 3MJ7A 5KVGH 1MJ8L 4RRPG 3ZYZA 1I3GH 4XGZA 1JE6A 1MOEA 2UZYB 4KDTC 4X6FB 4F9LA 4PJXB 1H5BB 4L1DA 5IQ9A 4OZIB 3NCEB 3OB8A 4J3XA 3C5ZD 1KPVB 1KG0B 3BPNB 3VRJB 1CZ8L 2B39A 2WIIB 1DR9A 3GHEH 4WO4C 4IRJD 3IRPX 1WFTA 5C6TH 3MLZH 1LNUB 1MCPL 3MV9D 4ONHA 4CVWA 1OTUC 1TZHB 3MRDB 3CH1B 3PNWB 5C0RL 3MNVB 5HGHA 2X4OA 3VCLA 4M93C 4UBDD 4QRSB 3E2HB 4NOFA 2VTFA 5D5ME 3VFMA 1JMXA 1ZA3A 4GRWE 2HFGH 2OL3A 4QWWD 4PJGB 1N4XH 4WCYH 4XPFH 4PRPD 3C5ZA 2Y5TA 4JHBA 1WFOA 2ICEB 3DSFL 4ODTL 4IRJA 3DYMA 4YFDB 5FDYA 2R8SH 1U92A 3KPPA 4HWEH 4XAKE 3C9NB 2F53B 4WW2C 4C4KO 3MV9A 3IDGA 2PF6A 4IOFC 3MZGB 4KK5D 1ADQH 2A6IB 2XKUA 1JJUA 1NMCC 2W38A 4JRXE 5T5NG 1AQKL 4XBEL 2RB8A 4I77L 4P4KC 2G60H 5JW5B 5EO0A 3MRIA 4KV5F 3ZL4L 1FZOA 2ZOLB 2VDRL 3OX8A 4X7SL 4UILL 3MRRB 4HDIB 5GRUL 4YXLL 5JUEL 5A16B 5H35B 5D2LA 3K74B 1OF2B 5F9DC 4Y2DD 5EN2A 4UNTA 2PW2B 1RZGA 5IJKA 1CF8L 4KROC 2DRUA 1F6AB 2O5ZH 3EDEA 3WJLC 1PX4A 4ONFL 5GSVA 4BZ2H 3CVHH 2C1PA 2HKHH 5HGBB 3T1FB 4TQEL 5D2NC 1G1CA 1CL7L 2GTZB 3QXVA 1PG7L 3G6DH 5C0DB 5I76A 1PQZB 2AJUL 1BP3B 1KTKE 4HEPG 3AB0B 3QDJD 1BZ9A 2VQTA 4Z7UF 3RI5K 1T1XA 1LO4H 3DNKA 4NKDB 4JFFB 2Y06H 2G5BA 3C08H 3MGTB 4NM8L 1AE6H 3O81A 3Q6FA 3REWA 3JV4B 4GAYA 2XZQL 2Y07H 2D0GA 1J5OH 3NPZB 2VN7A 3I6LD 4NNPL 5I1EH 4N9GA 4DCQB 2WM0A 3S4SA 5TFSL 1OPGL 4XNMA 2IQAA 5TDNB 4LOUC 4X5LA 2ITDA 3QNZB 1JV5B 3LSOA 1CWVA 4Q6IA 5ITFB 1S9WA 1E4WH 1IC5L 1LILA 3BT2H 3QDJA 5HGAA 3ROOB 4NQEB 5K59E 3OAYH 2GSIA 4I2XA 1IBGL 2IH1B 1OAUL 5KS9B 4PS4L 3RIAK 2B20A 2IH3B 4R0LA 1KGCD 5CGTA 1T5XB 5EUOA 1OQXA 4G7VH 1F8TL 4KI5C 4OZFH 5FM5M 1PYWB 5JQ6H 3HAEB 1OP5K 4NOBA 4B0MM 3OAUL 3U9UB 4GQ9L 3P11L 3CFEA 4JFQB 3ZTNL 4JZNA 4IS6A 3SOBH 3O6MH 3TNMB 1YQVH 4U3CA 2BNUB 3W0WB 3FN9A 4HS6B 3ARTA 4U1NB 1CGVA 3GM0A 4WFHD 1WVZA 1KJ3H 1NBYA 3ULUC 1NBQA 3ARDD 1F90L 4QEGA 5J7CC 5E08H 3O9WD 5FUCE 1LO0L 4CMMB 2FLRT 1QSEE 1DN0A 3NCJH 5JOFB 1KJMA 4L4TB 4UAOC 4MMZC 5IBUG 5IESH 5EIVA 3GIZH 4X7FC 4AYFA 3ZHLA 2RR3A 2ADJA 4L5FL 4R90H 2XT1B 3HG1D 1F11B 1A21A 3W9EA 1I9JH 5KTEH 4NT6B 3TA3C 4PJ7A 1BFSA 5TPWH 1IMHC 1U91B 2PYFB 1A3RH 3QQNA 4GT7A 3VD7A 4MAYD 4ZUSB 1ZLUK 4LLMB 1Q9WA 3PIQA 3GSVA 4LSQL 1J8HD 2KZ1B 3GJFH 1MPAL 5C0AE 4IBLT 3ARDA 1U8JB 4XWOC 5FHBL 5T3XD 1C12A 1MCIA 2QTEA 1OARL 2WP3O 4R2GD 4L9LA 5L2KE 3MODL 2XNAB 4X6CE 4RGNC 3MV8B 3RVWD 1OAYL 4JM2C 1KLUA 1X9QA 3MRNA 3MA7B 1HN1A 1ZXQA 5ITBL 3HG1A 4S1DD 3BGMA 5HDBE 4HUMB 1JN6B 1D5BB 5IOPB 2C5DC 4MAYA 1FFPB 2QEJA 6CGTA 1G7QB 3WO4C 2UWEB 2J2ZA 1J8HA 2WWKO 4E5XA 3VFTA 1TCRA 2GJ6B 3KPTA 3OQ3B 5D93C 1OAKH 1DSFL 1X44A 3AAZB 3PQYE 5HYJD 1FL6B 3QIWD 1G9NH 2OR9H 1U8PA 4PGCB 3FO0H 3RL2A 5IMLB 4X9IA 3WS3B 2WUBH 1DUZB 4I4WB 1I9RL 5IM7A 1JYXA 3GRWL 5SV3A 5EBWB 3NCMA 2ZNWA 4LCWD 5EZOL 1FYTB 5DFWH 4HQQL 2AABH 3QIWA 5CINH 1CTOA 5D2NE 4KRNA 1EBPA 5D7LE 4B53A 5DSCB 3I2CL 3QIUB 2DQTL 1AGFA 4DW2H 5MEND 1JWMB 5AZ2H 3L6FA 3FO2A 4UZGA 1WBZB 2D4DA 2VAJA 4ZNEE 1N8ZB 3WEXB 1WZKA 3WHE1 5FGCB 2DQHL 1C08B 4XB8A 4E0RA 4OLZH 4ISVB 3KPRE 3EJZD 4LCWA 3ZTJG 2EDQA 1A1NB 3VGEA 4RBPH 1TTFA 4LVOB 3DYOA 1EXUA 3LAFA 5KVFH 3BYTA 5FGBC 4XXDA 3UEZA 1TFHA 4QCIA 3HE7D 5C0GA 3NIDE 4J8RB 4GXUN 1TLKA 2G2RB 1MHEB 4U1JB 5GS2H 5C08E 1S9XA 4G8EB 1B4JL 5MENA 4KRLB 2D31A 3QXUA 2R4RL 5DTFA 5DK0A 1IAOA 4GW4B 3GSWB 3WKNA 4X8JB 1XCTA 1Y18A 2GEEA 3RWCA 1ZGLA 4G8IA 4NJ9H 1MHHA 4M1CC 3TBVA 4KI5E 2FH6A 1HH6A 1XEDA 5BZDA 1I7RB 4YHLL 2DKUA 3HE7A 4NO5B 2NTSP 1UWGH 4FXLA 4Z78A 2E27H 4MQ7A 5KVDH 5EA0H 1ORQB 3VG9B 3KXFD 2Z92A 5CEZE 2J8UE 4JHZA 4ZXBC 4OF3A 1OB1B 3HUJF 3MRMB 1ED3A 2GK0B 3ULUE 3RL1A 3OG4B 5KW9L 1K4CA 5GHWH 5BVPL 3QUMH 1A4JA 4ODHL 3P9WB 3V6ZB 4M48H 1IAKB 5I1LA 4YDKL 2Z9TA 1B88A 2EZ0D 2YKLL 1WV7T 5LQBL 1CE6A 4NGHH 3WJJC 1IRAY 2IEPA 4KFZC 2Y5EA 5E4EB 2HMIC 4MB4A 1NL0L 3D25A 3KXFA 3IVKB 5E2VH 2ED9A 2A9NL 1I8MB 5BW7A 1ACYH 2EDFA 2FR4B 4LAJH 4AMKH 4DJMA 5I1KH 1MCQA 3LKNB 1QLRB 5I1AA 1MF2L 3ZE2F 3B2VH 2IQ9L 3OG6B 3EYQC 3BDYL 1E6JL 4GKNA 1T4KB 2DKSA 3R4DA 4KTDH 5GGVL 3HB3C 1UB5B 2YD1A 2QV2A 3H0TB 2VDML 5EFIA 3MJ8A 3IXTA 3MREA 2FYYA 4RGNE 3AM8A 5DDHA 3VXOB 5DRNA 3SGKC 3I75B 4F58H 1CLOL 5DJ8A 3QUYD 4KZEH 2AXHA 5GRVK 4I13B 1PEZA 1JUFB 2B4CL 5FCUL 4AENB 1KB5L 3G5VB 4GRMB 3KPSB 3T4AA 3UDWC 4F7TB 1X5JA 2IBZY 3CFJA 1P9MC 5D9SA 3CZFB 1NGXB 1UM6H 3GDBA 4R7DA 4F2MB 3A6CL 4P23B 4IIQA 2BP3A 4N5EC 3IGAA 4UI2A 5D7KD 5L88L 1VPOH 3W9DA 2OP4H 2WINB 1HXYB 5D2LF 2FB4H 3QUYA 3FQNB 3QJFA 3WFEL 1PLGH 4H8WH 3RUGE 2CDEB 3THML 3N9GL 3VJ6A 4CN6A 1F45A 3ZKND 1L7IL 3BPCA 4UB0L 4XCCL 2BY2A 2XZAH 1LEKB 4PRHE 5GGSA 1T21A 4JKPL 1WZMA 2PUQT 4JY4B 4XT1C 1DBBH 1RUPH 4IRSB 1N7ML 3HE6B 5HHNA 4AIXA 3L5XH 3ARGD 3FZUD 1MWAB 1FO0B 1VFUA 4HC1L 2YMXH 5B8CC 5L2JB 3QDAA 4JDVA 2EE3A 3UYRL 4XP4H 5F97E 1RULH 4N0CC 3RU8H 3C60D 4JFDD 3KAAA 4LVHC 5JXEC 2GJZB 3BZDA 2ILLA 2FECL 3TVMD 5B3NA 2ZZUT 4B5EA 5ISZE 2IG2L 4BQ6A 5CLTA 1RPQA 4FMKA 4PG2C 1INDL 4MQXC 1A0QH 2NY7H 2NY1C 2AI0L 3OKNB 1E4JA 4MNGA 4OM0L 1UADC 4BSVA 3VFRA 3HZKA 5JLZB 3ARGA 1NLDL 5I74C 4G5ZH 4P59H 3QEGH 2EKSA 3RZCB 3C60A 4JFDA 5BS0D 1SJHA 3VXUB 5KSBB 4ZO8A 3TO4C 3TVMA 2DJSA 2P43B 5EUOF 4FMFA 3OJVC 2YUWA 1CGYA 4CVXA 3HI5H 5T3XH 3GGWA 1QFWI 5DC0A 4YFLF 4QNPF 3UTSD 1W0VA 4NQVA 1YNLL 1YA5A 4JE4B 1LE9A 4AIOA 2WQRA 1T6WA 1F2XK 3DTXA 5IFJB 4U2ZA 4WTZA 4Y4HB 2VXVH 4LQ1A 4EDXB 3P73B 1OT2A 1MIMH 2AXGA 3BZ4A 2NPLX 5IHLB 4PY8I 4P5TD 4X4ME 5BS0A 4OIAA 3MACH 4WRLA 3PGDB 4P2RB 3B8SA 2RGSA 1C5DB 3RKDD 1O5DT 3D3VD 5E9DE 5HHQB 3FHAA 2HJKB 4NSKB 1RUAL 3H7BB 3UTSA 3QXDA 3P4NA 3HAEG 3GI8L 4O02H 1JNNH 2BVEA 3LPFA 1XF2B 3AC0A 5H37G 2OTWA 2CGRL 2HVKB 2C3VA 5LWYL 1IAMA 2VDNL 2R4SH 4R6UA 3GJFK 4M6NL 3GB7A 3FFCD 5ALBL 1CXIA 2NY3D 4PJ7F 2LABA 4P5TA 3DO7A 3ROLA 4M3JA 3LN4B 1JYNA 4JFOA 5EZLB 3EOBA 3TNNA 2NMSA 2ESVE 5BQ7A 2A1WH 3QUXC 1WWAX 3F5WA 4FFZL 1HI6B 2OJZL 2Z35B 1WTLA 1RZIB 4GXVH 4GO6B 4PJIF 2BSTB 3B6SB 3QRGH 4BH7A 4HLZG 3DHMA 3VXQB 25C8H 4QY8A 2AKRB 3VE0A 1Q8MA 3AREB 3FFCA 4U1LA 2XKNB 1R3IL 1H3UA 1YEIL 2VZOA 3DBXB 4KVNL 3HC4H 1VGEL 4KUZL 4D9RE 4CW1B 4M5ZH 1PVHA 4FTVB 4X4YB 2OJEB 4L3ED 2VOTA 1F00I 4PJ8B 2Q20A 3FQTA 2MMXA 4KRPB 3VXSE 2H2PC 4NN6B 2AERT 2FGWH 1RZJL 3V0VA 4AJ0A 2D7PA 2BVUA 4MB3A 1Z6JT 3MUJA 3VWJC 5KSAC 1GCFA 2R9HD 4J3WA 1A7PL 3H8NA 4NFDA 1GGIL 1NGWA 4F3FA 1NFDE 4J6RH 1TJIL 4M7ZB 4WUUB 5AD0A 2PTUA 3QEQD 5F88B 5GJSH 3EO9H 3QQ4B 4WI7A 3U6RA 4Y4FC 2VITA 3FJTA 4PV9A 2E3VA 4YGVA 1IEBA 4L3EA 5HDQH 1QVOA 3LQAH 4XXCA 2J88H 5E24E 1K8DB 4O2FA 1X7QB 5TJWK 4XPBL 3C5SA 4KKNA 3GSNA 1YECH 3RWIB 4MD0B 3HN3A 1MCEA 4NFCA 2DWDA 1N5YH 1WSST 4Q58C 1L6XA 3SDDB 4LPVA 7CGTA 2G9HA 4YHPB 1JK8A 3QEQA 3VFSB 4RBPK 5B38A 1T7XA 4HIIA 2WWMC 3MFFB 3GMQB 4J2XA 2DOCA 4ZFGH 4KJYB 4F7CA 4EN3C 5DWUH 4K3GA 5E03A 3VGGA 5FECB 5DD6B 5HYEA 3VXRB 4QRRB 4V1DD 2IF7A 5E5MB 5CGMA 3P4MB 3EZ8A 3RVXD 3MO1B 4U1HB 1FLRH 1M7XA 3SQOL 1JZ3A 1WQVT 3RQ3A 3O6FD 4Z0BH 1XT5A 3QH3B 3VD3A 4MXWH 5I8EA 2D2OA 3NCYS 3HA0A 3MGAA 3O3EA 4PD4K 4UDUB 5FA4B 3VFWA 5I2IA 1L4IA 4TSAH 2EH8L 2ZUXA 2OMBA 1KXQE 2DQGL 3RVVC 4CJ1A 1UM5H 2ZJSH 4K3DH 2R29H 1OLZA 1RUQL 4V1DA 5HI3D 3OPZL 4PPTA 1OWWA 4XC3L 5ACLA 3RTQB 3DIFA 4X98A 2X1XR 4MXQD 4OFYD 4ZTPH 1Q0YL 5F3BA 4MXVE 5J6HA 1WICA 1KCKA 2EDHA 1HHKB 3G5XB 3O6FA 4JVWA 4KQ4H 1H3XA 4PLKC 2YRLA 4LLUA 1T5WB 4NCC2 3EHBC 1UKSA 1QFOA 2UY6A 5CMAA 4F33B 4UV4L 4YHIB 4Y0GA 3RY6A 3JV5A 4ZD3H 4JB9L 3QUZB 5SWZD 1GC1L 2ID5A 4PRAB 2X05A 5FKPA 4LDEB 5GGRB 1I7TA 1CD8A 3B83A 4G6KL 4YX2H 4OFYA 5E1AA 5DGRA 2VKWA 3OXSA 4IHOA 5IKCA 2BNQB 3WS6A 3T3MF 2BOBA 3C8DA 4ACPA 5D7JD 3UZEA 43CAA 3GNML 4Y5XB 1VFBB 4R4FH 3Q6GL 3MV11 1QFWL 4LASL 1ACZA 1LEGB 4MNQE 4MAUH 5BOPA 5SWZA 3EO1A