2W0PA

Crystal structure of the filamin a repeat 21 complexed with the migfilin peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords FILAMIN-A
publication title Structural Basis of the Migfilin-Filamin Interaction and Competition with Integrin {Beta} Tails.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0pA00
3LKOB 4MNQB 3S4SA 2CR6A 4K71C 4NNXA 1G1YA 4Y0GA 1PYWB 2ITCA 2NY5L 1MQKL 2Z4QA 3D9AH 5LQBL 1QBAA 5I15H 3HCVA 2P4AB 5D5MF 5E56A 4HLJA 3RGHA 1J11A 1ERNA 2W9LA 4P57A 3GBNL 4W6WB 1PZ5B 5IMOB 3HPJB 3B6SA 4U1SB 4M4PA 4MNGB 1IFHH 3I02B 3HZYA 5D2LF 4YPJA 2V2TA 1FIGL 3V7MA 3K2UH 4D0DA 1FAIL 1U3JA 4R0LC 5GRUH 4DQOL 4K23H 3MUZ1 1JGUH 4QOKD 4WO4B 3ZTJG 4KQ4H 4MD0A 2HG5B 1D6VL 5FOJA 3MLSH 3KS0J 1BFTA 4YHLH 3TA3B 3VXUD 3TT1L 4YXKL 3W0WB 2CUMA 3QIBD 2YR3A 4JZNB 4JFXB 2R0KH 3DYMA 4IHOA 5DDHA 1J1PH 2PYEA 4LASH 4WRLA 2YA2A 3KJ6L 3W5NA 5CBAB 1LO4H 1MNUL 2P47B 5D2NA 4WENB 1VFMA 2EKSA 2ZPKL 4N8VG 5JHDE 4FP8H 1FRGH 5GRXG 1NUNB 4JFEA 3MO1A 3ZMRA 1BF2A 3KXFB 4MA1C 3IFNH 1RMFL 4L4TA 3FHQA 3H0TB 3QXVA 4LHUG 3O2VH 3UAJD 3HC4L 4WJ5B 2DWDB 1C1EH 5IHLB 2E7HA 1RIVL 4Z7QE 9CGTA 3AVEA 1JV5B 2DQFA 3ZE1F 1QACA 5D6DA 5J6HA 2VL4A 4HJJL 2FSEA 4DFIA 3CU7A 4P2RB 4PGDA 1XMWA 2J4WL 4PJGB 4MAYC 5K9OA 4UILH 3QG7H 1QSEB 4F58H 3GGWB 4QRRD 1XGUA 3QCUL 4YDVA 1HHIA 2W1NA 4NFCA 3K80A 4OLEA 4POZD 3QA3B 2OL3L 4XB8A 3L7EB 2G2RA 4LRIC 5EOCL 2X05A 3T0BA 2JJSC 4EXKA 1FBIL 4D9RD 3T1FB 4DWHA 4HUUA 4F7MA 1E27B 1AGFA 1LK3H 4UBDD 2NY0D 2ZOLA 1I7TA 1X9QA 1CFSB 2NX5D 5C08E 4FFWD 2XKUA 2WANA 4MS8C 1T5WB 3FN3A 3LMJH 4Z7VE 4U6VL 3S88H 4KHTL 1X7QB 5DEFB 5CSGA 3OKEA 4XWOC 1MJ8L 4MXWH 4O2FA 2M26A 2GAZB 4HSQA 1RURH 3P11H 2ADGB 1ZVYA 1LHZA 3PGDA 3UPAA 2GSGA 4NNXB 4MDIB 2Y9RT 2EDEA 1R3JA 1M7XA 3MJ9H 2Z4QB 5C71A 2R8SH 5L88H 4WGVB 1JUFA 1I9EA 3STZB 2K7QA 5C07A 1PG7H 1JNLH 4P57B 3T65A 3JWDC 2ID5A 1S9KC 4GW5A 1VADA 3MA7B 5BVPH 3HLAA 1Y6NR 3BEVB 1U58B 1CFVH 4RMVA 4X6CB 4XMKL 3ZT7A 4DEPC 1EZVX 3EYUH 2XN9E 2A0LD 4CDGC 1VEPA 1YMME 3IDNA 4U1LA 5GGTH 5GZND 1UENA 4MD0B 5ETUA 3S6CA 3F7QA 2NTFA 4M9OA 3D18A 1J86A 5BS0B 3CFEA 4PJHB 2FL5A 4P4KD 5C2UB 1JK8A 5K93A 5GS0L 1N59A 3CVIH 5CS7A 4IHOB 3N06B 4NM4L 5DDHB 2J8UA 1JZ2A 2PYEB 1R3HA 1YN7A 4U6XB 3GSNL 4PREB 1CDIA 5D2NB 1B90A 1RQ5A 2EKSB 1ZT4A 4EI5B 5C0FA 5ISZD 2HT3D 4HEME 5KOVC 4R97C 3DPBA 3UBXG 4JFEB 1HQ4B 4NYLA 4NBYB 2WBWB 3SGDH 5CJBA 3UTQB 1U6AH 1AY1L 1UA6L 5IR1B 4ZUUB 4YPGB 4IRJA 1X5YA 1WSST 5KSBA 2VZ3A 1MPAH 4QOKE 1GCFA 3QG6B 2DLFH 4BH7A 1WZ1H 1ZHLA 2ADJA 3LY6A 4KPHH 3FT2B 2GK0B 5GQBA 2NXZD 4ELMB 2VISA 3S5LA 5I1JL 2DQFB 3VXUE 5BO1L 4JREC 2ZUSA 5DI8A 1RJLA 4XVTH 5EC1A 3ULUH 3QPQD 3ZYZA 5J6HB 2NY4C 2B1AL 2GSIA 4O2EB 4OD2A 3KDMA 5F9JB 4YHOH 4PGDB 2AJZA 2ZCLH 5I73C 4RGOL 1IQWH 5HHNA 4J3XA 1NEUA 5K9OB 2QADD 2FEDD 3D87B 2KKQA 2DL9A 1OLZA 4NN5C 2B5IC 4DOHB 3QYCA 4BQCA 4YDVB 2FHFA 1HHIB 4WI5A 2DWEA 4AIXA 1VFAA 3O9WD 2R0ZL 1CK0L 2Y72A 2FDBP 3P73A 1DQDH 4HUUB 3P9MA 2VLMD 1AGFB 3Q5TA 1IM9D 4P3WA 2ZOLB 1INEL 4LLYA 2E8ZA 1H8OA 1UZ6E 2DQTL 1NC4B 1XF3B 1D5ZB 4PJEA 1ZLWK 5FHAH 3C60D 4TVPH 1IZKA 2BNRA 3OKEB 1DBAH 4O2FB 5KVFH 4F33A 5IP4A 2R56L 3RTQB 2F74B 3VFWA 1MWAL 3MV7D 4PB0L 4LARL 3QCVH 1T2JA 2A1WH 1HKLH 1RVFL 1H3UA 1T1YB 4OLVH 1UB6A 1MCOL 1RIUH 2DDQL 2J8HA 4I3RH 4NZUH 3WV0A 3M1BA 4LCCC 1JUFB 3KLSA 3PNWA 1ZT1B 4LAJH 3SDXF 4ODBD 1HH6A 3BGMB 5C07B 4BSVA 4EI6A 5FGBA 4LSVL 4QRRE 3S35L 1IEAA 2APTA 5D5MA 1VADB 1Z0NA 4R90H 3T4AA 3KYMA 4FTVA 4U7MA 4UDUA 3FN0L 1UACH 5TH2A 4D9RE 5DRWB 3BE1H 3L3DB 4M7KL 3ARVA 4K3DL 2RQ8A 4JFPA 3T2PA 5C6PB 3WIHL 4PJIA 5JNYA 3D3VB 5I16B 2NX5E 2VXSL 1EMTL 4WFHD 3IDNB 2FLBT 4U1LB 4ODTH 3VGEA 2W9DH 1II4E 2NTFB 1S9VA 4Q58C 5JDJA 2MFNA 4K07A 3LQMA 1CGWA 5HYJD 1A0QH 1LP9B 2IH3A 4U31A 5ITFA 3LS4H 3PHOA 3RY5A 3VXQB 4QXGL 1RU9H 1JK8B 3QO1A 3PWUA 1TZGH 5E6IC 2J8UB 1KCUL 1A47A 1YNKH 3PGCA 4HBCL 2K7PA 3KVQA 3J7HA 1YN7B 5ICYB 5LGHL 1J8HD 3VXTA 4E5XA 1Q72L 5C0AA 1IGYA 4TRPH 5JA9A 3VFUA 2DQDL 4RAHA 1HHGB 5I6XC 1R6VA 4DTGH 3RFZC 1A7QL 2Y36L 4YHKL 5C0FB 3IF1A 1B6UA 3BJLA 4QRPA 1MI5A 2J3SA 15C8H 5J8OA 4D0BA 4HUKB 1HCFX 1KNOB 3VD4A 2YPKB 3VWKD 5INDB 4OIIH 4IRJB 4P46C 4UT7L 3MZTA 4NO5B 2EH8L 1JHKH 5KSBB 1OGAA 3B8YA 3O3UN 4BH7B 3MJGX 1ZHLB 3V6ZA 1I3VA 2FIRT 3BPLC 3EYSL 3RVUD 4EEEA 2RGSA 4H8WH 4Y2OA 2VYRE 5JOFB 4O4YL 3G5VA 3GRWL 3OSKA 3FO9B 1U3HC 4Q9CA 5IFAH 1RJLB 4XP5L 5EC1B 1JZ4A 2ARJQ 4R8WH 1MCPL 1Q9OB 2GSIB 4KMTH 1DDHA 4OLYH 3QQ4A 4AG4H 3O2WH 2W91A 2AJZB 1XZ0B 3BDYL 3Q5OA 1HYSC 1YNLL 2JJWA 3PQYD 2NY3B 2V7NA 3X14B 5ISZE 4U1JB 3S35X 2AS5M 1HINL 3KPSA 3WFCH 3I50L 5DEGB 5DUML 4XP6H 2DWEB 4JCLA 4JM4L 2EC9U 1FZJA 3UYRH 2VC2H 3P9MB 3DSNA 5IROA 3A67H 4K9EL 5SWZA 4H25B 1V3JA 4PJEB 4ZMAT 2BY2A 2V17H 4GRLA 2A2QT 2QSTA 4IOIA 3WLBA 3LHPL 5I76B 1UVQA 3ARFB 1JFQL 5GHWL 2O61A 2R0LL 5I1AA 3ME0A 1CF8H 5IJVB 3MLXL 4Z7NE 2BZDA 4GXUM 1YEKL 1J7VR 3IRPX 1CGTA 1OTTC 3B9DA 5DC9B 3L3GB 3ULUC 1RUQL 4WO4C 3PNWB 1JN6A 2NMSA 1PAMA 3VI4E 2EEBA 1F4XH 1UYWL 3TA3C 2GI7A 1ED3A 2MHAA 3CZFA 2C26A 5D5MB 4RDQF 1A6UL 4L8SA 3T4AB 3KYMB 2HFGH 3JZ7A 5ENWB 2L0DA 4UDUB 4BFGA 3MV9A 5TH2B 5IEKA 4Y1AD 1PBYA 2VLME 5D2LB 3CVHB 2DQHH 3CFBA 2QR0B 3QHFH 5HXMA 1KTLA 1S9VB 2VL5B 3NPZB 4L3AA 4PJ8D 2IH3B 5ITFB 1QD0A 1QEWA 1YECL 5EFIB 2ATPB 3PHOB 3MV7E 5DRNA 3LV3A 3ROLA 3OKOB 3PWUB 1Z0MA 5JIPA 5DSCA 1YMHA 3OX8A 4GMSH 1IAIL 1D9KA 1M1SA 1S7WB 2AEQH 1M05A 3PGCB 3UBXI 5IB2A 4E5XB 1LEIA 5C0AB 3OKMB 1GZPA 1S7UA 3DOSA 5DGRA 3VFUB 4K3EH 1IT9H 5E2TL 1DEEA 3KPLA 2W65A 4U2ZA 4G7YL 5IK3A 1J0IA 4YHNA 1HWHB 4QRPB 1MI5B 4YLQT 4NSKA 3N85H 3G6AA 4D0BB 4B7LA 4LSTL 3BZ4A 2QSCH 4N0UA 3BVNA 1U95B 4KI5F 4KJYA 2EDBA 4HKJA 1X3DA 5KSUB 4WUUB 5EN2A 5DK2A 3ALPA 4C54A 2BNQD 4CVXB 4TQEL 4I18A 4IEFB 2WINA 2IG2H 5HYJE 5DD5L 1IC5H 3NTCL 1QLEL 4PS4H 1ZWIB 2Y4SA 3IKKA 3BQUA 1CICB 1AJ7L 1ZLVH 4NQVA 4CU6A 2D03L 1Y18A 1DDHB 1NCNA 2NY2B 5E9DA 5BVJA 1H3GA 3QQ4B 1J8HE 1R3LB 3MRLA 4UOJA 3FB5B 4Y2DD 2A9ML 4XHJD 4R4NC 4KDVA 1EHAA 2Y5TA 3WJJA 4AYFA 2X1PA 3KPSB 3G5XA 2R2HB 3QEUB 2JKXA 5K33A 3L9RA 2VDML 1C12A 1GGCH 5ACMA 2YD7A 3UO1H 1FZJB 4WW1A 1KPVA 2AJYL 5DUPL 1S7VA 3I84A 1MLCB 4HIXH 1JGLL 5SWZB 4ZOCA 2UY6A 4WV1A 3OAUH 3FT3B 4LSSH 2UYLA 4G8EA 4IOIB 5HVWA 1UVQB 4OTXL 1PKQA 5GJSL 2R69H 4IMKA 4H20L 4M1DL 4WHTA 5F7FA 4GAGL 1NCCH 5E8NA 4XPHH 1T22B 4Z95H 4OD3H 4R7NA 3FQUA 3DXAB 4N0YH 5TPWH 1N7ML 4AIOA 3N1FC 1JN6B 1EVUA 5DYOA 3MLWH 4LCWB 3PQYE 3CMOL 5HVFB 4OV5A 3BXNA 2MHAB 3CZFB 4GG8B 3FQWA 5TQ2H 4PJ5D 4NZDA 4TUJB 4KMLB 4Z5RB 5JR1L 2D31B 1QNZL 2HFEA 1FZOA 3OG6B 4ZFZA 3NZHL 3UMTA 3WE6A 5D2NC 4JN1H 2WIIA 5HI5C 2H32A 2EIZA 5IB4A 3HE6A 4JFHD 3CFBB 4EI5C 1MFDH 3P9LA 4G6KL 1KTLB 2HTLD 4ONGH 5FM8A 3IDYC 3QPXH 4U1MA 4EIZC 4F2MB 5E2WH 5AYUH 4NCC2 4W4OA 4I0KA 3E3QC 1IQDA 2BSSA 3NPSB 2DL2A 4NWUH 4NUGH 5DSCB 1YMHB 3OX8B 1D9KB 5D7IF 3A6CL 4LPYA 1IGMH 1KLGB 1M05B 1DSFH 2R2EA 3QEGH 3GBLA 4V2BA 5SX4I 1HI6A 3ELAT 5KJRL 5IB2B 2Z92A 1S7UB 1QA9B 1KJVB 4MJIA 3ZL4L 3KPLB 1M6OA 3LZFL 5D6DC 2VZSA 1EUUA 4XPAL 4NSKB 2CK2A 4JHZA 4Y1AE 3NVQA 3BZ4B 5JMRA 1SBSL 4UINH 1FGNH 1T04A 1Z9SA 4TSAH 1NGYA 1DQQA 5DHXB 2H41A 5EN2B 4K3JH 4OZHA 4Z7QF 2BVPA 4JHAH 4KKBC 4I18B 3TYFA 2WINB 3KR3L 3CVHH 3JSSA 1CDBA 1YQ2A 3S34L 2Z35B 3JV4A 4FG6C 3BQUB 3P4LA 1L7TH 1T5XA 4NQVB 1EJOH 1PY9A 2NR6C 3U83A 3S96A 2VLJD 1IGIL 5E9DB 4DJMA 5HHMD 4ZOBA 3THMH 3H9HA 4LCUA 4MJ6A 4QY8A 5HHXH 3RTQC 3CZJA 1JHTA 3UP1A 2AJXH 3L95A 3RU8H 4G6AC 3TN0B 3HAEA 3L9RB 1C12B 5B4MD 2W38A 4HUVA 4M1GH 1BREA 3PIQA 1KPVB 1RUKH 1S7VB 2WWKT 5KAQG 3AS1A 2OYPA 2BNQE 5HDOA 5FYKL 4OLWL 2BFVL 2IAND 1QFWI 1Q94B 3DSFH 1OP3H 2AQ2A 4IJ3C 3QIWD 4HLZG 4NQED 3JTSA 1BFSA 2B7DT 4G5ZL 2CXGA 2VH5H 3FONA 5E8NB 4TNWK 4JFDD 3I2CH 2CIIA 4RRPA 4IBLT 1OHQA 3FQUB 4KV5F 5C6WH 4JPWH 2CKNA 1FV1B 3O4LA 5ACZA 5JW4Q 1SYSA 1FC1A 4PFEA 5F96H 5K59E 4Y5XA 5DYOB 4OV5B 2GUOB 1BVZA 2CGRH 2BCKA 1Z9OA 5FECB 4KHXL 1P1ZA 3SDXB 4X9BA 4CMHB 1BX2A 1VFUA 4MA3A 5I15L 3DVGB 2DRUA 1FZOB 4JGJA 4Q97A 2NY1D 3A6BH 4LP5A 3WE6B 3G9VA 5KSAA 3VFSB 2VDLL 2NTSP 3QQNA 5BJTA 2H32B 2EIZB 3OBAA 5IB4B 4U1IA 3NFPA 1SMAA 4ZAKD 1IFHL 4NGHH 5MENA 5IB1A 4U1MB 4YFEA 3LVEA 3K2UL 4PGCA 3HS0B 4X7DC 2IADA 5GRUL 5IIEB 4K23L 1JGUL 5JOPD 1GZQB 5FA3A 5DJDB 4IRJC 4RAUB 4OV6F 5F6IC 3OXSA 3MLSL 2HRLA 4GRMA 4YHLL 2PXYD 2Z92B 4OF5A 4FN0A 4HQQH 4CN1A 1X5GA 2FO4B 4MJIB 2R0KL 3TM6A 4PJ5E 1NKOA 3I9GH 5GRYA 1YQVH 3QWQB 3MX0A 4LASL 4L4VA 1YJDH 1G7MA 1LO4L 4JFQA 1FYTD 1N0LA 2D7TL 2YD4A 4U0RB 5MERB 1T04B 5EA0H 3IAGC 4FP8L 2W92A 1NGYB 2WP3O 1FRGL 2NY3C 1ZHNB 4JFHE 2ARWA 4URTB 8FABA 2Z8VC 2BVPB 2FLRT 3MRGB 3IFNL 3MOQA 5F9DC 3TYFB 3BW9A 2VO5A 1WEJH 2LVEA 4PTUB 4RMRA 3GO1H 3O2VL 4KJWC 5B8CA 2FX7H 1F4YH 1IAKA 1BBJA 5DVKA 1UGNA 3D48R 3S96B 3ZKMC 2GY5A 2BSTB 3OR7A 1SY6H 2FJHB 2PF6A 4OFKA 5CHNA 1VKXB 4WI4A 3OGCB 1GGIH 1IEBB 3H9HB 4KTYA 4LCUB 4MJ6B 4QY8B 4K7FA 4ETQA 3ARFC 1ORQA 4UOW0 4EDWH 4J4PA 3DX9B 1FNEB 3HRPA 1BVLA 5E95B 3HAEB 2VSCA 1VFBA 4HUVB 4UILL 3PIQB 1J9CT 4JKWA 3QG7L 4F58L 4JG1H 2R4RH 1CN4A 5CEYB 2HVJA 1HSBB 5FGBC 3VH8A 1EXUA 2B4CC 3C8HA 3GZKA 4LLWA 2RB8A 3QO0B 4M1CC 5IESH 5IMLA 2F53A 3QUKA 1LK3L 2F54D 3JTSB 2YD8A 1T3FA 3QI9A 2GQHA 1IZJA 3FONB 3IFPA 3LMJL 2VLJE 1XR9A 4G80B 2H2SC 2QHRH 3S88L 4AQ1B 1KJ2A 2IPUG 3QDAA 4RQQA 2VN4A 1I8IB 4BKLA 2LAGB 4MXWL 5HHME 5F7LB 3O4LB 1F02I 3G9AB 1CZ8H 4ZTOH 1RURL 1E28A 3QDMA 5GPRA 1QLRB 4IS6A 2BCKB 5J1AA 5DMGC 43CAB 1CLZL 2AV7A 1P1ZB 3SE4A 3MJ9L 5LGKA 1ZA6B 3UTSB 2BRRL 2R8SL 1SJXA 3AS2A 1NQBA 4PV9B 1EHLH 5C0EA 1PG7L 1JNLL 4WVRA 5KSAB 5DJAA 5BJTB 1A14H 4X5WA 5BVPL 4G7VL 2CO6B 2D0GA 4LLUA 1CFVL 4OZIE 2IANE 3OAZK 5HVHB 1WK0A 1F8TH 5DC0A 3EYUL 3FO1B 4NQEE 5F1NA 2R0WL 4RFOL 5DQDH 5GGTL 3MV8B 4KK9D 5FA3B 3RP1A 1INQB 1N3NA 4JFDE 5DJ0B 3VRLF 2WUBH 4O02H 2V2XB 5KOMC 1AKJA 3BX7C 1AC6A 3SGKA 4BFIB 4XT1C 4V2CB 2I5YH 4MD4A 5D7IA 3F6LA 3E6FB 4C57C 1A1NA 3A0OA 3JWNC 3SDAD 1HKFA 2IQ9H 3NIGF 5IV2A 2YD2A 3CVIL 4X4ZA 3Q6GH 1CICC 2VXQH 1BQUA 4HW6A 1C5DA 4L4VB 4MVBC 2IC2A 5ALBH 2NY2C 1A7BA 4X7TA 5IM7B 1T03H 1UH2A 2CPCA 5TF1H 1RK0A 1BLNB 1OAKH 5CJ8A 2EXWD 1G0YR 1J05A 1MCEA 1U6AL 3CCHB 1F97A 4ORGA 3W5MA 2EDNA 1MHHA 2R2CA 5DMIH 3STBA 5B8CB 5C0GA 3H42H 5JOPE 1OTUC 3AY4A 5IROC 5HYSB 1MPAL 1BBJB 1C5CH 2DLFL 1WZ1L 2KDGA 1XH3B 4KPHL 1I7UA 3WYRA 3EHBD 4WWKA 4XVTL 2HN7A 1T0PB 3BP5A 3GSQA 1T21B 4ETQB 2AXHA 3KYNA 4YHOL 4J7RA 4QCIA 5T1MA 2ZCLL 1IQWL 4PJFE 1S5HA 1VFBB 2Y25A 1FYTE 3UZVB 1DFBH 4G8GA 1PG7X 3VFTA 3O2DH 2GY7B 2GTZB 4LKCB 3F8UB 4X5XA 1GGBH 4M7JH 3KNBA 4HHAA 3VH8B 2H6PA 3LEXA 4LLWB 1CDUA 2EDTA 3KPOA 4Y16D 4QXTA 1DQDL 1RV6X 3UPRB 1KN4H 3OPZL 2F53B 1JP5A 4JG0H 1F3RB 3ARWA 1T3FB 2P8LB 2FECL 2YWZA 1A9BB 1ZS8A 1MFNA 2AJVH 3ARQA 4Z7NF 1KJ2B 4RQQB 5FHAL 5T1KA 1UKTA 1FNFA 4LIQE 4TVPL 3MJ8B 3SGEH 4U3CA 3T0VA 4BKLB 1DBAL 4P2QD 4MGXA 1P7QD 1VGKA 3MRDB 2EO1A 2CKBH 3WL9B 3QCVL 2PTTA 2A1WL 4IS6B 4WNQA 4MAYD 3CSYA 5EB9A 5D93B 3NPSC 4OLVL 1RIUL 4MB5A 4I3RL 4NZUL 3WEXB 1D9KC 3QWOA 2EYRA 5C0EB 3JV0A 4UNUA 4YHYB 4FQLH 1CBVH 4K3GA 3DGGA 5F1IB 4R90L 5IB5A 4JQVA 5AYQA 2DKMA 1UACL 2R1YB 3L6FA 3BE1L 3PWJA 4P99A 4MS8D 2F54E 4C59B 1IL1B 4LAQH 3TPUA 5F1NB 4CRPA 4ODTL 2W9DL 4C56A 5HHQB 5AZ2H 2FR4B 1XEDA 4JFYA 1A0QL 4I18C 3LS4L 1JPFA 2JELH 1RU9L 1Q9LB 1U8KA 2EECA 2I24N 1QBLH 4HF5H 1TZGL 5DURB 3V6OA 1EEZA 1L9NA 3BQUC 1YNKL 5CGTA 1QSFE 2VLLA 4HFWA 2BMKB 5JHDB 1P9MA 4KKLC 4TRPL 4ZFGL 4NQSB 2VN7A 4X7TB 3UEZA 4HKBA 4DTGL 2JIXD 3QUZA 1PLGH 3HNVL 3X12A 4LSUL 1YEEH 3WJJC 2N4IA 4QRSA 15C8L 1ORSA 1RD6A 5KANG 2DF3A 4G8FA 3VCLB 4ORGB 4TPRH 1MHHB 4OIIL 4YR6A 2QSQA 1ZAGA 1JHKL 4LF3A 2VZOA 3C6SA 3MRRA 4HJGA 1IC7H 5EO1A 3EZJB 1I7UB 2YA1A 4H8WL 4YO0B 3SO3B 3QIBA 4WV1C 3CJJA 4WWKB 3REVB 5IFAL 1DLHA 5IBTH 1KGCE 4NKOB 3BP5B 3GSQB 4R8WL 3UCRA 1DQTA 5B38G 2Z8WC 3PDOA 3KG5A 2AGJH 5JIHA 3EOAA 3KYNB 4KMTL 5HYQA 1NBQA 4OLYL 4IMKC 4AG4L 3O2WL 3KPRA 1CL7L 2BVQB 5T1MB 4OZFG 5KBNC 2VUOA 4P2YA 4GG6E 1KOAA 1N6VA 5FF6A 5JUEH 4KGJA 5SWQB 3DTXB 5HGAB 4J1UA 1YC7A 4YHMH 4I4WA 3X13A 3WFCL 3KNBB 1MCWM 1ZK9A 4HHAB 4XP6L 3OTTA 1EX0A 4YAQB 1JPTH 4WIQA 5C08B 1A4KB 4QXTB 3UYRL 2VC2L 3LIZH 2A6IA 4HJ0C 5GJTH 1X5KA 2Q76B 1FAKT 2LE9A 3A67L 4MWFA 1AFVH 2WLZA 3FO2A 1T83C 3QFDB 4GW4A 5T3XH 5JIKA 2V17L 3O0RH 2NY4D 3HE6C 3PWVB 2X7LA 4X8JB 4XHQA 5HJ3B 1KULA 2HYMA 1KJMA 4APQD 2GFBB 1CF8L 4Q6IA 3CLFH 2PTTB 4WNQB 1BGXH 1LDPH 2IBZY 3CSYB 2EEDA 1P69B 4S0SD 4WCYH 4Z76A 5T5FH 1EERB 3EYVB 5C0BE 3DI3B 2VQTA 1CFTB 3U4AA 4AEIH 2QTEA 1F4XL 1JZ3A 1J88A 1QKZH 5T1LB 4JRWA 4I5BA 1CFQA 3DGGB 2DIJA 3NFSH 2HFGL 3HE7D 5IW1A 3AM8A 4XNXH 4L8BA 2COQA 3L6FB 3EO9H 5JOEA 3PWJB 1G6RA 1Q9KA 1XIWA 1YMMB 2R1WA 4HUWA 3PL6B 4PTTA 3MNZB 5ELIA 5J7CC 3TPUB 5JQ6L 3WNKA 2DQHL 4U0RC 3M07A 4UTBH 5FYJU 2EZ0C 5GIRA 3QHFL 3TZVB 1GAFL 1NL0H 3LQAH 2BVTA 3VFMA 4JFYB 2HLFC 4P2QE 3PHQA 1CXIA 2YMXH 1JPFB 3NFNA 4MB4A 2MCG1 2E7BA 1U8KB 3ZDXE 4R3SA 1QFUH 3RKDC 4GMSL 2GITB 2AEQL 1OP5K 5B3JF 3KS0H 3GDBA 3UTTA 2X89A 3LRGA 2X9WA 1GGUA 4K3EL 1IT9L 5DQ9A 7CGTA 1FL6A 4HIJA 1S7TB 5C92A 4LOUD 4QRSB 3N85L 1PVHA 3T4YB 3MJ7A 3H6JA 2IAMD 3FZUC 1EAJA 3WJLA 2QSCL 4QOKB 4YR6B 1FZKA 4Q2ZB 4LF3B 2FIKA 2ICWJ 1U3YA 3MRRB 3TJHD 5IVOA 1TPXB 3VXUB 4GAFB 1BFOB 4N0CD 5IBLD 3U48A 2ZSVA 1CD9B 1TZHA 3QIBB 2IG2L 4AIZB 1F00I 4HS6B 4L3CA 1IC5L 1AR1C 2ZUVA 5CMAB 4DFHA 3NAAH 3CMGA 4FQIH 3QXDA 4XCYA 4LNVA 3EOAB 2JCCA 3B3IA 2ATKB 3IU3A 4HPYH 3KPRB 2C1PA 4KAQH 2R9HC 5J3HC 4KZEH 3Q6FB 5FF6B 3N1QC 3LPWA 4PRBB 1IAII 4I4WB 3X13B 1TTUA 4QF1B 4NC0B 3GMQA 3WN5A 4U3HA 2GEEA 3W11C 1GGCL 4LLMA 3QEHA 3UO1L 3VXRA 2YC1A 2A6IB 2H2PC 4HIXL 2GJJA 4R26H 3TBWA 2IMMA 3VJ6A 3C2SA 4MWFB 1PFCA 1MFBH 3FO2B 3HRZA 1FFNB 1A1OB 5KSAC 5CZVH 1TVBA 3OAUL 4XNUH 4GW4B 4F8QA 2EIBA 4LSSL 3K4AA 2XPGA 3U7YH 1MCSA 2J6EH 3AUVA 3AROA 5GSVB 1JRHH 5HVHC 1NCBL 2R69L 1C5BH 1AI1H 3O3EA 3RWIA 2XNAA 3ZTJH 4BH8B 1HYSD 1NCCL 4XPHL 4Z95L 3JV5A 4MCYA 5JZ7C 1U8IA 1EAPA 4ZDHA 2HAZA 1A6VH 4N0YL 5TPWL 3V52L 5ABDE 3OJ2C 4OCYL 1LNUA 1SM3H 3MLWL 3VDBA 2DYPD 4PY8I 4XBEH 4ZUTA 4I5BB 2GJ6A 5TQ2L 3WBDA 5IW1B 5H2BA 4F7TA 2NY0B 1UB5A 2LVCA 2NX5B 1Q9KB 3E8UH 4HUWB 3FQXA 25C8L 4PTTB 1VEOA 4JN1L 5TGBA 3FB7A 3QQ9C 1MFDL 5EOQH 2V5TA 4GXVH 4ONGL 3QPXL 1AD0A 3PHQB 3LKNB 2CMRH 5E2WL 5DD1H 5AYUL 4KI5C 2EDOA 2HJKB 5DK0A 3NFNB 4NWUL 3B9VA 4NUGL 4WO4D 2EC9T 5GRVL 5F88A 3FL7A 1FORH 2XT1B 4X6EB 5B8CC 1IGML 1DSFL 3TA3D 3DWTA 2CH8A 3QEGL 3W0WD 1JZ7A 1G7IA 1Z9LA 3V6FA 3RWDA 4XXDA 1V5JA 2P45B 5IMKA 1KUMA 1FL6B 3N0PB 1X6LA 1PW3A 3QUXA 3ZYIA 5T33H 3QUMA 4J4PC 4M61A 1QP1A 2G9HA 4IDLA 3AS0A 4UINL 1FGNL 4RFEB 3HA0A 4TSAL 5KG9A 2FIKB 3OJMB 2X4OB 3HUJE 4K3JL 3LOWA 1WFTA 3IJHA 5FA4A 4JHAL 4UV4H 4QHUB 3NCBB 5EIIA 4P4KB 3CVHL 1CT8A 2BRQA 3DHMA 4YXHL 5F1KC 5BW7C 5CZXD 1CDYA 1L7TL 4YDJA 3VD5A 1E4KA 1EJOL 3QXDB 4L8DB 4HMEA 4XCYB 4LPXA 3QI9C 4UUJA 2P5ED 2C1PB 5C0IA 2ZG3A 3H2WA 5ISZB 3THML 1FE8H 1MJ7L 5BV7B 4TNVF 1KPUA 2NLJA 1J0ZA 1OCWH 2AJXL 4P2RD 2EE2A 1IC1A 3RU8L 1T89A 1U9KA 2N7BA 3GMQB 3GJFB 3T2NH 1DL7H 3WN5B 1JWMA 3I85A 2VAAA 3FB6A 5D93C 3QEHB 3SE4C 2BERA 1KSRA 2DI7A 4HV8A 5I66B 4KK8C 4M1GL 1ACYH 1CE6B 2B1HH 2Z93A 3P4NA 1RUKL 4Z7OF 2AERT 1T1ZB 3VJ6B 3GI9H 2NXZB 4JQIH 5FK9A 3HRZB 4YHYC 3MGTB 4YBQD 1TVBB 3U0TB 1WWWX 3DECA 3SBWA 2XPGB 5IQ9A 4TUOB 1JWSB 5K9JH 3DSFL 1P6FA 5DRZA 3RWIB 1QRNA 2VH5L 2FH8A 1RZGA 2OJZH 3I2CL 5F9OH 5I1GH 5K9KB 5L2JA 4ZDHB 2QADB 4DUXA 1ZT7A 4JPWL 3KPNB 1RJCA 1X4XA 5F96L 4C55A 1WT5A 3QRGL 3O9WB 2CGRL 3MZGB 4ZUTB 2R15A 4JANB 2GJ6B 1VSCA 5SX5K 3QNXA 5D6CA 2D7MA 5EU3A 4F7TB 1IM9B 1EEQA 1FSKB 1K8DA 1UB5B 3VXOA 5GISH 1AGEA 3NCJH 3A6BL 4DZBA 1ZOXA 3W2DH 1U91B 1EEYB 5F89A 4XAWH 5TGBB 5HYIA 3VW3H 3FB7B 1RIHH 1T66C 4WW2A 4IOFD 4NGHL 4JZOA 2YOCA 4E41A 5TDPA 4PYHA 3MV7B 4BK5A 1AD0B 1DVFD 3RZWA 2BJMH 5DK0B 2LAAA 4KMQA 3TFKC 3EYQC 2OI9B 3P30H 3R8BB 4JPKL 3GSUA 4OFPA 3TIDB 4ZO8A 2IJ0C 3LQZA 3AY4C 1U8JA 5J12B 4ZFOA 3WKMH 3RVTD 4L9LB 4F9PA 3V6FB 4HQQL 2X4UB 5T5NG 3SO3C 3HG1A 4MNQE 5IMKB 5DA0B 4WWKC 4KH2A 4X9GA 2E5EA 3KPMA 5FDWA 5D71H 2QSVA 5KSVB 2IBZX 3I9GL 1YQVL 3BHBA 1YJDL 2G9HB 2N7AA 4UZGA 1LMKA 1VB9A 4AH2B 5DWUH 5EA0L 1QYGL 3DV6B 4JFED 4JRYA 2BY0A 3IJHB 5IT2H 4L4TD 4DZ8B 5HYJB 2JB6A 1U8LB 1U8MA 1HOCB 1WEJL 4XH2A 2XTJB 2ADFL 4TVSa 3GO1L 5I30H 2CDGA 2G75A 5IMMB 1A64A 2FX7L 4ZO7A 1G9NH 4YDJB 4P59H 1J8HB 4U6HB 3TNNA 3U0PB 1LO3H 1QFHA 1A5FH 4UUJB 1SY6L 3W0WE 3WFDH 4EQ3A 4AENB 5DC4B 2X4SA 3SJVA 3TVMA 5LXGH 2K1MA 1A7PH 2VZTA 1RZKH 3JTTA 2NLJB 5CD5C 4CKVX 3TH4T 4EDWL 4MXVE 5GRWA 1NCUA 1JWMB 4NOFA 3VWKB 1BVKA 4WTZG 3VFGH 2Z93B 4W70A 3RAJH 3ES6B 4JG1L 1OAZH 4KKBD 4XZUB 1L4IA 2HMID 1LO2H 1N4XH 4P3DA 2R4RL 5FK9B 3KXFE 2MQ3A 3LS5H 4CAGA 1JHLH 2HJFB 3BH9A 4NDMB 4JQVC 1DCLA 4RMWA 5FKPB 4D2NA 4NUJA 5IESL 4MZ2A 4BQ9A 3QXWA 5DRZB 3FT4A 1RZGB 5I71B 2QHRL 5L2JB 1HDMB 2P5EE 2XG4A 1QBMH 1K6QH 1ZT7B 3S4SG 3BO8A 3GK8H 3PQYB 2AK1H 2V5RA 3ULVD 4LBEA 1CZ8L 3TZVC 4G6AD 4WU7A 4ZTOL 1WFUA 4OB5H 3O45A 2P5WD 1HN1A 1NJ9A 4HC1A 4P2RE 1P7KA 3B43A 5D6CB 3GIVA 5CWSA 4PJGE 5BV7H 1BIIB 3JWOC 3V6OC 1K8DB 5D1QD 3VXOB 1EHLL 4N90D 3TBSA 5F7YC 5DJ2A 1P9MC 3H3BC 3GJFH 5IWLA 5F89B 4LQ1A 1A14L 4ZPVB 3PGFH 3CDGB 4KVNH 1ZEAH 4Y5YA 1KT2A 1OTSC 1FG9C 3PJSB 4ZSOA 5JXAL 1YNTB 3FQRB 4NRZB 1F8TL 4XGZB 3ESUF 2MMXA 1TCMA 3OJDB 4DKDC 3IDIA 5DQDL 3MRBA 3WCYA 5F7DA 1FNGB 3GSUB 2WUBL 5K9QI 4O02L 1U8JB 3BD3A 3LSOA 4MAUH 1TPXC 2I5YL 3IJSA 1P7HL 1A3LH 4RA0C 3QIBC 4L29B 2IQ9L 1P6AB 5IKCB 2ICEA 1IBGH 2FHCA 2WWKO 1BOGB 3KPMB 3Q6GL 4FXKA 4Y1AB 1AGDA 2VXQL 4M7LH 1NKRA 4F7PA 5F70A 5HYEA 1KG0B 5ALBL 1ADQH 3SDYH 3DX8A 2FX9H 1RSFA 4NIKB 1T03L 5KVDL 4P23A 4PJ8B 4MDJB 1OAKL 2JB6B 3CFDB 1JPSH 2VDPH 1S7QA 4M5ZH 4CVZB 4IRJD 2F19H 4KVCH 2CDGB 4TULH 5DMIL 4EVNA 5EZJA 3H42L 4CL7A 4LVOB 3MUJA 2DMBA 4JY6A 3HTLX 4HUNB 2OXHA 2DKSA 5FAAA 1T4KA 3DYPA 4MMXC 3SCMA 2VOTA 1R5IB 4JLRA 1W2KT 3BN9D 4GG6F 3JTTB 1D5MA 3MACH 1MIMH 2CLVA 4AT6A 4R7DA 3VFPA 5LAXA 4JKPH 3L5XH 2BC4A 5D2NE 4Z7WA 1BVKB 4RISH 1RZJC 1WFNA 1JTPA 4HWZA 2XWTA 3PP4H 3O2DL 4X0KA 2BNQB 1PG7W 4JFEE 4QHKI 1KXQE 2VABB 1GGBL 3ARBD 4M7JL 5T1DH 4POZC 4L4TE 1E0OB 2Y06H 4QTHA 3BH9B 1X5AA 2YK1H 4X6DA 3AM8C 1KN4L 1NEZA 4UBDC 1MCJA 4JG0L 1XIWC 1KBGH 3MLPA 3HZMA 4FFWC 5D1XD 2AJVL 2BNRD 3P0YH 3SGDI 5C0DA 3BO8B 3RIAK 2EYSA 2R1XB 2A6DA 2ESVA 4QHNA 1UWGH 1BFVH 3EJYD 3O45B 2CKBL 1Y0LB 1T7VA 4O51A 1QVOA 4CU8A 3F7PC 4G6JH 4M43H 4OZ4B 5DJCB 5EU6A 5DK3A 1I8MB 5CWSB 5GSRA 2A73A 2QEJA 3SGJA 3LN4A 3TYGH 5GXBB 4DOHE 4FQLL 2UZYB 4KI1A 2FZ3B 1CBVL 3D69A 5A1AA 4QXWA 4M1CD 4FTVD 1JNNH 2VIRB 1IILE 2X1WL 5IHZB 1UXSA 4OCWL 2IMNA 3IDXH 4X7CC 1HIMH 4HS8H 3RHWK 5CAYB 3BP7A 3WJLC 1WIOA 2B8OT 3CFCH 4LAQL 4R4FH 2A0LC 5BXFA 2KZ1B 2OTPA 5GZNC 5H94A 2XA8H 3VXSA 5JW4R 4CU7A 4EUPA 3ULVE 2VR4A 1FVCA 4HGKC 2QJDA 3IJSB 2P5WE 1OF2A 2JELL 1MHEA 4PJ5B 3MMEA 4WFED 5J56B 2FECI 1QBLL 4HF5L 5JPMB 1KTKE 3GJEB 1TNNA 3SOBH 2C7UA 4FXKB 4U1HA 3K8MA 4I9WD 4HIHA 2YN5A 1HXYB 4JFZH 4N90E 1Q9WA 1KEMH 3DX8B 1XF5A 2JB5H 4OSUH 2P1YA 1I3GH 1PLGL 5BV7C 1ND0B 4PY7A 4QRPD 1MI5D 1XAUA 3VRJA 5FKAB 3Q1SH 1WV7T 2XY1A 1YEEL 3WO4B 3VMPA 4QEGA 1S7QB 1IVLA 4NQDA 4F3FA 3VD7A 4OF3A 4XVSL 1YY8A 3WN5C 3I6LD 4TPRL 2APFA 3CPLA 4PLOB 4EVNB 2DQUH 2EH7H 1OGAD 3S5LG 5EZJB 1UQSA 2WIMA 4MA7H 3AAZB 1IC7L 4HUXB 4HG4J 5ID0B 2X40A 4JY6B 2B39A 2NXZC 4LDEB 1FLTX 2IALB 4PJDF 3B9AA 2VDRH 4EQ2A 1D5MB 2J8UE 4MVBD 4AT6B 4R7DB 2NY2D 2AGJL 5LAXB 3T08A 4RIRA 2BC4B 1GL4B 5JXEA 3WHE0 5CJQH 3T77B 1GH7A 2QADC 3VD9A 1OQOA 2FEDC 5ERWA 5JUEL 2XWTB 4NCC1 2CDEB 4P5TA 4JY4A 1DE4A 3KPSD 4M3JA 4YHML 2GJZA 3FMGH 1P2CA 4Z8FH 4QTHB 4LLVB 4PPTA 1JPTL 1KLUA 1NEZB 3LIZL 5GJTL 5HHVH 5KSBE 1HEZA 2HKFH 2VLJB 4MJ2A 5E94A 3MOBH 3GM8A 1AFVL 4EXPX 4N9GA 5ESQA 5DFTA 4L4JA 5HHMB 5B3NA 4GRLD 5L2KA 5T3XL 1DUZA 1NBYA 3O0RL 1ES0A 2ESVB 1F3JB 3KAAA 3MRPA 2X09A 4S1DD 1KPRA 3CLFL 1LDPL 4A6YA 2E9JA 5CSZB 3OKKA 5EU6B 4WCYL 2OI9C 5T5FL 2A73B 3QHZH 3LN4B 5J12C 1U8NB 1BZ9A 1E4WL 5KVGH 3M17A 4AEIL 1A7OH 3LKQB 4PYGA 4L9LC 32C2B 1QKZL 4UNVA 5CBEA 4NO0A 4RAVB 2IANB 1UJTA 4GS7B 3NFSL 3MV9D 4M93B 4JM2A 4XNXL 1CS6A 3EO9L 3QIWB 4NQEB 2QKIA 2OR7A 1ZLVK 5D1ZD 4JFDB 2W9EH 1U8QA 2H8PB 3EOTL 4PJEE 4F57H 5H94B 3VXSB 3QWRA 2P48B 4UTBL 2BNRE 5DMYA 2P24A 3B5GA 1NL0L 2BNUB 3C8KB 1AXTH 3LQAL 4G42B 4JO4L 2YMXL 5EU4B 1MSPA 2XTJC 5CP3H 1WBZA 1CLYH 1D9KD 3MMEB 3QIUA 4CDHA 1QFUL 1WIPA 2MKLC 4PIRF 2C7UB 4NFBA 1J1XH 4XTRD 1E4KC 2NY1B 2E6JA 4BUHA 1NGZA 4HIHB 4DGYH 3D1MC 2F8VA 3BD4A 1IAOA 3MCLH 2E6QA 5D5ME 5C3TA 1NMBH 4Q9RH 5A16A 2CXKA 4FTVE 4PY7B 1KYOJ 2LV4A 1UG9A 2LABA 3QJFA 1MIEH 1T89C 5CJXA 1W8NA 4F3FB 1YY8B 4ACPA 4PJIE 1CR9L 3VWKC 4UT9H 3CPLB 1A7RH 4FQ1L 1OPGH 4HULB 3WXVH 1UQSB 1HCVA 2G60H 2WM0A 2PXYB 2VITB 4UNTA 3RVUC 1KEGH 4FQQA 5LJYH 4P5MA 3IJYA 4AK1A 3SBWC 2Q86B 4AJ0A 4ODXA 3NAAL 4WFEE 4FQIL 3RY6A 2L7UA 4KKLD 3DURA 3FO0H 2XKNA 5GGUA 4GG6A 1FYTB 4HPYL 5C0AE 5B21A 5I71C 4I9WE 4KAQL 4ZPTB 2IEPA 4KZEL 5ERWB 4KKAC 1LEGA 4JY4B 4TSCH 5DD6A 1DE4B 4YHIA 4OUUA 4QRPE 1MI5E 1ZANH 2GJZB 3LRSA 4YHPB 1P2CB 1WT5C 1UXWA 1FL5B 1L0YA 4HXAH 3SY0A 5FO9A 2FRGP 3MA9H 3I6LE 4O58L 1KC5H 1KIPA 3O6FD 3IXAB 1BD2D 1HEZB 1HH9A 3PV6A 1OGAE 4R26L 4XPTH 5GRVK 1EFQA 4UAOB 1MFBL 1XGYH 4E9LA 3GMOB 4YBLB 5CZVL 4XVJH 4XNUL 5EOTA 1KB5A 1DUZB 3U7YL 3L3KB 4WW2C 1ES0B 3EFFB 2BVOB 2J6EL 1WCBB 5DJ6B 1G7HB 3ZE1E 3DO7A 2JK5A 3MRPB 3OQ3B 1C5BL 1AI1L 5IJKA 4PRDA 1KPRB 4WI3A 4PRHA 2J12B 1BWWA 2Z91A 4MA8H 4DN3H 4G43B 1A6VL 1K9TA 1JF5A 2CQVA 2P49B 3VE0A 1SM3L 3M17B 1E4XH 2N56A 4XBEL 4ZUVA 1N5AB 3KPSE 4F9PC 3V7AG 4HT1H 5CBEB 4D9LH 4HJ0D 1WF5A 1A6WH 43C9A 3O6KH 1WZKA 2F54B 5BQ7B 1QR4A 2EO9A 4MQ7A 1OAXH 3E8UL 3OKLB 4Z7UF 4G9DA 3HE6D 3S97C 1U8QB 2ZZUT 1K85A 2P24B 5EOQL 3MLZH 4GXVL 5TDOA 4FMKA 4PJ8C 5ACLA 1H0DA 4Y88A 2CMRL 5DD1L 1XCTA 4OQTA 4OFDA 2YRLA 4WU5A 3D6GA 1FORL 2KPNA 4LVOC 2DM2A 4RGMB 2NW3B 1H3WM 5GGRB 4PD4K 1UT9A 1RUPH 2CIKA 2UZIH 1YEIH 5A16B 4I2XA 4PRPA 3MV9E 3QJFB 1OW0A 2EC8A 5L0QC 3DVNB 3V7AE 5T33L 1VENA 3U2SA 1OP3K 5C6TH 4HWBH 3P0GB 2EZ0D 5FCSH 4GSDL 4OGXH 4ERSH 4UU9A 4JDVA 2YSSA 3QZWA 1EGJH 4UV4L 4G9FA 2SEBB 2NCMA 2WK2A 3SDAB 1GYAA 1FO0B 5BMFH 3QXAB 3TC9A 4XP4H 2ZKHL 3HR5A 3GMPB 4ODXB 3DURB 1GRWA 4PJDA 2YWYA 5GGUB 1CWVA 3WUZA 4MXVF 4GG6B 4KTDH 5T5NF 4LNRA 4XNMA 5C0JA 1T20A 1U2CA 2HVKA 1KCLA 2VNCA 5CEXB 3QULB 1F11A 3JV6A 5EUOF 1OCWL 3TPKA 4OUUB 5GGVH 4R0LB 5TE4H 3LRSB 1I8LA 5FOBB 4U05A 3T2NL 1UXWB 1DL7L 4PJ7E 1B0RA 4QYOB 3KPQA 4WTWA 4N0UE 5JTWA 2HLAA 2W60A 4PJ9D 1JBJA 4R96A 1ACYL 2B1HL 3QRFM 1J0HA 1HH9B 3HNSH 3GI9L 2WBJA 4JQIL 1NDGB 5D70H 3C87A 2EDXA 3BIKB 3I75A 5DTFA 1AR1D 5DJZA 5EOTB 1KB5B 3MODH 3FN9A 2YRPA 5HYFA 3ZKQD 5K9JL 1J5OH 1KV3A 3DO7B 2JK5B 4B41A 4U1NA 4PRDB 2E7LA 5ID1A 4NQCD 2ENYA 5D7SH 2OJZL 2Z91B 2EEAA 5I1GL 3TBYA 5DHVB 1ONQA 2OTWB 4FABH 3X3FH 4XMPH 5ADPH 2H9GA 3CNKA 3LH2H 4ZUVB 5HGDA 5CEZE 3QR2A 3W11D 5HI3C 1N6QH 5LG1A 1ZVSA 4Y16B 4EJ1C 3TH3T 1EK3A 1JVKA 5GISL 3NCJL 4ONFH 4CMMB 1BD2E 5EH1A 4G9DB 4L1DA 3W2DL 4LLDB 5I2IB 4XAWL 1RIHL 5EU5A 3OKNB 4NN6B 2ICWB 5MEND 4P2QB 4YNYA 2HTLC 5E4IA 5TDOB 3U36A 1PKQE 1H0DB 5DS8B 1KTDA 3VFOA 1XCTB 4LIQH 3MROB 1EHXA 2OZ4A 4WU5B 2X4NA 1KLFA 3P30L 5F3BB 1WAAA 3QDGA 3WKML 3G5YA 1FLRH 1VPOH 2CIKB 3HE7A 4ISVA 4PRPB 5D71L 1EIBA 3ARPA 2CSPA 3DX6B 3F5WA 1CD1B 3U2SB 4P0DA 4C4KT 4N68A 3HKFA 2OJEA 4N8PA 1K5NA 5DZLA 5DWUL 2X2YA 1H9VA 4I13B 3NN8A 4UU9B 3QZWB 4J8RA 5JLZA 4ODSH 2XFXA 2X41A 2RIKA 3JXAA 3MGOB 4Y4KD 5I30L 5F21B 1GIGH 3REWA 3T0EA 4ELKA 1FG2A 2YPVH 2P8PB 1G9NL 4P59L 5ICXA 1WICA 1LO3L 4PJDB 5J1SC 1A5FL 2XRAH 3GUTB 1D6EA 1HHHA 3WFDL 3G04A 4PJBA 1T20B 2JIXB 5LXGL 3HAEG 4MJIE 4Z9KB 3G5ZA 5IFJA 1RZKL 1F11B 2XQYG 3JV6B 5FB8A 1SEBB 2P7TB 4PGEA 3D2UD 4P9HH 3KPQB 3F12A 5B4MC 1W72B 2W60B 3VGAB 1HXMA 1DJSA 3VFGL 3RAJL 1WCQA 2O5YH 3SGJC 1OAZL 2K9UA 4HK0B 4Y4FA 1N4XL 2WBJB 4OZHE 3MRNB 3LS5L 3B83A 3I75B 4GKSA 1Q8MA 3RL1B 5J9PB 4GKZA 5DJZB 4OLZH 1JHLL 2RFXB 3WHE1 1QHOA 5I1LA 5EIQA 4M93C 4AEHH 4RRPG 3SKNA 1I75A 3QIWC 3BH8B 3QI9D 3BUYA 4Y19D 4U1NB 4IIQB 4NPYA 4FFYH 5EBLA 3WS3B 3SE9H 4MLSA 5E2VH 1FO0H 4R97B 1CYGA 1QBML 1K6QL 1ONQB 3GK8L 1A9EA 2AK1L 3ZE2E 3QDMD 4MJ4A 5F6HJ 3ARDD 3CK0H 4OB5L 1MJJB 3GMNB 4RDQG 1U92B 4KK8D 3KLAB 2EIEA 5BV7L 3QQ3A 1KENH 3HPLB 2EE9A 2NY1C 1XF1A 3BUTA 3OKDA 1DLFH 3H7LA 2NY4B 5GS3A 2DAVA 5EU5B 4KVNL 1DBBH 1NLDH 1ZEAL 4UQ2A 4Z7UA 3ULSA 4YNYB 1F2QA 1U42A 4JDZA 4U33A 2JF1A 3MNWA 1CLOH 1Z5LB 3U36B 4HS3A 1EO8H 2IPTH 4APQB 1S3KH 4JAMB 3ULVF 1KTDB 4X99B 5I73B 1BHGA 2VERN 3WNOA 4D94A 3O3BA 1NAKH 4PUBH 3MRIB 5D72H 2X4NB 1XGQB 5CJ5A 1AKJD 1VCAA 3O4LE 4MAUL 4ZYKB 3MLYH 2PXYC 4NZJA 3TO2A 3QDGB 3G5YB 1ZVHA 1A3LL 3GFUA 1K4CA 3HE7B 5DHVH 2PCPA 1IBGL 1G7JA 4ISVB 3DGCR 4RBPK 4M7LL 1F6LL 4OZFH 5DRXB 1QO3B 4XX1G 1ADQL 2R2BA 3SDYL 1X44A 1QLFB 2FX9L 1K5NB 1TQCB 2AEPH 1T7ZA 3SO5A 2H1PH 5MENE 2GK2A 5JLZB 1JPSL 2VDPL 4CUCA 3AGVA 4M5ZL 3EYQD 3MREA 2F19L 4KVCL 1TIUA 4TULL 5BZWA 4ELKB 1YYLH 4H26A 1FG2B 1W0VA 1S7SA 4HGMA 2ZUWA 4F8TA 5AUMA 5ICXB 3BEWA 1I9RH 4UAOC 1D6EB 1B9ZA 4ALAH 3FRUA 3IXTA 5F8QC 3G04B 3U82B 4PLJD 3G5ZB 5IFJB 1TJIH 4ZNEA 4UMGA 5FB8B 5ESAB 4NKDB 4PGEB 2XQYK 3MACL 1MIML 4FQXD 2IAMB 4JKPL 3L5XL 1QFWL 1S7RB 5EUOA 5HGHA 4G8GD 4BQBA 4RISL 1HXMB 3VH8G 5DMJB 5HDQH 3PP4L 3STLA 3SDDD 3Q0HA 3K1DA 4IRSD 4XX1E 5T1DL 2APXA 4P4RA 1YA5A 5ESVA 3RWJB 3ZSTA 4K8RC 4KI5E 4GKZB 1CGVA 2I9TA 5I1LB 2YK1L 4JM2C 3IKCA 3SKNB 4XBPA 5J6GA 1QUNA 1KBGL 1B0GA 5F72S 5I6XB 3ZTNH 5T1KD 2CLRA 3DV4A 1BQSA 3GSXA 1NAMH 4IDJH 4KK5D 3P0YL 4M3KB 3D85D 5CUSH 5FYLD 3RJDA 5CD5D 5D7JA 1UWGL 3G6JF 2FHBA 3SHSA 3JWDH 5GGSY 4G6JL 2X4RA 4M43L 3SKOA 1JNHB 1GHFH 4XBGA 1GGTA 3CC5B 3QIUC 2DICA 3QUYD 3QQ3B 5JHLH 3TYGL 1WBXA 4HZLA 4YH6A 3UJIH 4RGMC 2ITDA 3C09B 3N1MC 3OKDB 1FZMA 3NBNA 3LKRA 1JNNL 1QHPA 3RWHA 2GCYA 1W72H 4Z7UB 1I3RA 1XF2B 5E8PA 3IDXL 3GNMH 1HIML 1A2YB 4HS8L 2UZXB 2C3HA 4J23A 5DD0H 2EDQA 5CJXC 3CFCL 4R4FL 4Y19E 2DD8H 5A3IC 4C56D 1MREH 4KK9C 5IVXA 2XA8L 1EV2E 2ZCHH 1AO7D 2PTUA 4X6BB 4S11A 4ZXBA 3TO2B 2DYPB 1XF4A 4X4XA 2QQLH 4PG9A 2QQQA 3QDME 1U8PA 1K4CB 3SDAC 1KN2H 1NUDA 4JEGB 1NFIA 1G7JB 3SOBL 3SGEI 3RY6C 2FEEL 2VKXA 3EBAA 2BVEA 1RJYB 4JFZL 4PR5A 2R2BB 1KEML 1WISA 3QUZD 4PJIF 2JB5L 4OSUL 5C1MB 1I3GL 1OTSD 3TESA 2WW8A 3Q1SL 4OCXH 1DVFA 2WBKA 2BVYA 2OL3A 1D5IH 3EYOA 2EXWC 3G08B 4JY5L 5CKGA 5B39A 2DQUL 2EH7L 4H26B 1W0VB 1S7SB 4MA7L 5I1EL 5AUMB 1AD9A 1LGVA 3BEWB 4H88H 5LGJA 4FQCH 3IU4H 3IXTB 5D7IE 3EHBC 2A6KA 1CXKA 1L6XA 2OM5A 2ZUQC 1UWEL 3K81A 2A77H 2VDRL 1ZGLA 3IDGB 4EN3A 3BKML 4ONOA 1LD9A 5F7NC 5HHOA 3KPRD 1BP3B 5IJKC 4OCLC 4F15B 5EUOB 5CJQL 4WI8A 2DM3A 4PV8B 4UIMA 3ZLQC 2PTVA 1AIFA 4HH9A 3UC0H 4OCRH 3STLB 2E27H 5SX5H 4UIKH 4FNLH 1NGWA 3MGAA 3FMGL 2F15A 4Z8FL 3BAEH 4YGVB 1GJIA 1YPZF 1R0AH 1IMHC 2I9TB 4XRCA 4Y16C 3MBEA 2DBLL 5IEHB 1NBVH 3IKCB 5HHVL 3FHAA 3LKSB 1K8IA 2HKFL 4XBPB 1FFPA 5J6GB 3W39B 3MOBL 1B0GB 2P5EB 3VI3E 1MRCH 6FABH 3OXRB 5J89A 2CLRB 3DV4B 3RZCA 3GSXB 1HHKA 4QRTA 1J18A 1MY7A 1T6VN 1WJ3A 3SE8H 4NN6C 1EFXA 1V8HA 5D7JB 4QHMA 5JORA 1JWUA 2GTWA 5GGVY 2VMFA 1PQZB 5LCVH 2X4RB 3X3GH 2ARJB 4V1DA 1RUAH 3HZKA 3PP3K 4HAFA 3QHZL 3LB6D 4KUCF 4G8GE 2VZUA 4X6FA 4H1LA 5MP6H 1WBXB 3HMXH 3GSNA 5KVGL 4KU1A 1A7OL 5C0RH 4ODUA 2W0PA 1FZMB 2NXYD 1NBZA 1AE6L 4I77H 1I4FA 1YEJL 1A1MA 2PR4H 4HMCA 3MYJB 2AQ3A 4ZUSA 1F5WA 4E42A 3EZ8A 1XIWD 5E8PB 1FH5H 1OW0C 1N8ZB 3GMLB 2PNDA 3B8SA 3S37L 4J6RL 3U4EA 1F6AA 3MRKB 2DTSA 1DZBA 2W9EL 5DLMH 4F57L 4JFFD 4PRNA 1MAMH 4DUWA 3HFMH 3OZ9H 1NGXA 2P5WA 1AXTL 1XF4B 5FYLE 3S4SB 4PG9B 1MCKA 4KV5E 4S0TD 2ITCB 4L8CA 1CLYL 3HCVB 5D1QA 3UTTD 3SE3A 1J1XL 2X89D 1CXHA 5EBGA 2V9TA 4BJLA 4DGYL 3B6SB 4PR5B 5HI4D 3DLQR 1KIQA 3MCLL 1DUYA 3HZYB 5C0CD 2V2TB 5IUSA 3LCYA 3QP3A 4Q9RL 1FNSH 1KCVH 4C83A 5EORH 4Z78A 4D0DB 2UY7A 1DVFB 5I1IH 1MIEL 1I8LC 2B2XH 3O11A 4MZ3A 4UT9L 1A7RL 5B39B 1OPGL 3VGAC 3WXVL 4X83A 1CXEA 2G60L 4C56E 1AO7E 2WBJC 2E7MA 1MH5A 1KEGL 1H5BA 1OVZA 2A6KB 1P4LA 2X4QA 1BECA 4YXLH 3PWLA 3RDTA 1ZHKA 1DBKH 5F7UA 3MR9A 5TFSH 3V6OE 1MWAA 3FO0L 1ACZA 4G3YH 4Y89A 4W81A 4IIQC 2F5BH 4HWUA 4PJ7F 4M9PA 4UIMB 1AIFB 3IDYB 3MO1B 2VDOH 4HH9B 3NCFB 4TSCL 1RZFH 4L4TB 2HH0H 1ZANL 1NGWB 1FN4A 3AU1A 4NJAH 4XNZB 4F7CA 4R2GC 4PGBA 3VXRD 4XRCB 4HXAL 2A9NH 3MA9L 1RZ8A 1KC5L 4XPTL 2C3XA 3S37X 2MSPA 1WZLA 3WIHA 4JN2A 1XGYL 5FYJD 1UH3A 3DUSA 4KK6D 4XVJL 3CX5J 2IQAA 1HHKB 4QRTB 4CBPA 1EFXB 2FSEB 3SEPA 4APQC 5JORB 2GTWB 2IH1A 3VXPA 4MA8L 3G6JA 5GGRY 4DN3L 3KPRE 4I8DA 3HZKB 1X5LA 5IHBA 1XGUB 1GSMA 3Q3GA 4X6FB 2Z0BA 3PDGA 4KRPD 1QSVA 2DLHA 3ARBA 1H3VA 4ODUB 2G2RB 1E4XL 4Y5VA 2GJ6D 4AY0A 1NBZB 4DVRH 4HT1L 4D9LL 4F7MB 1YDPA 3MC0A 3HE7C 1A6WL 4ZUSB 3O6KL 1I7TB 4Y8DC 2VXVH 3WKNA 1OAXL 4DGVH 1WUNT 5D1XA 3CSPA 1TQCC 5LKNA 3MLZL 1NGXB 5C70A 4FZEH 2P5WB 3KYKH 2ZOKA 4YDIH 3PGDB 4XNYH 2Y07H 2GSGB 3QXUA 4KTEH 1R3JB 3QFJD 4JJHA 3GRWA 5D8JH 3LD8B 3T0EC 5D1QB 2M2DA 3T65B 2X9XA 1AP2A 3V2AR 4RX4A 3T2QA 3H9SD 4KUZH 4BUGA 4GW5B 5CLWA 5GRZA 4NT6A 4XPFH 1X5FA 3K46A 3HLAB 1JRHI 1DUYB 1RUPL 2GIYA 2UZIL 1YEIL 4FA8A 3RWGA 3BP4A 4IJ3B 1CXLA 4C83B 3QUXD 3H3PL 2OQJA 3RIFF 3P4MA 3T3MF 4Z78B 2F8OA 1U8OA 4LOUC 1N0XH 5MEQA 4X9HA 4QXUH 2IAMC 5C6TL 4HWBL 4J3TA 4MX7A 2Q87A 5ETUB 1MEXH 2PN5A 3D18B 2YHGA 3GSVA 4HAGA 3U4BH 2EDHA 4JFFE 4OGXL 3TJHC 4ERSL 4M8QA 3QT2A 5A2LH 1EGJL 1MUJA 3CFEB 4N0CC 5IBLC 2FL5B 2XTJD 1OY3B 1P4LB 2X4QB 1N59B 3VRLE 4WI7A 5BMFL 2VZ1A 3PWLB 3HC4H 2X1OA 4LPVA 1R3HB 4XP4L 2XZCH 4RMQA 1JJUA 2X4TA 1A3RH 5JW4M 3UTTE 3NIGE 4KTDL 3WS6A 1SVCP 1ZT4B 4CADA 3PV7A 4N1EA 4NYLB 5C0CE 5LVEA 5EC2A 4LU5L 5GGVL 3BYYA 5TE4L 3BRDA 1T80A 4LCYA 3AU1B 4OZHF 4F7CB 2DN7A 3U9PH 4PGBB 4AEEA 5F6IB 2AV1A 5DVLA 4K7PH 4PJAF 5IG7A 1BZ7A 2ADJB 1YPZA 2ZCKH 3HNSL 1TZIA 2VISB 3S5LB 4LL9A 4JN2B 5D70L 2AP2A 3C09C 3O81A 3DUSB 4NNYA 1I1RA 5DI8B 3MODL 1MLBA 3AXLA 1RK1A 4OD2B 3KDMB 1J5OL 1QRND 3ZE2F 2V5MA 5ICZA 4QGYA 3UX9B 5C3LD 1MQ8A 2EYTA 2JCCE 3S36H 5HHNB 5D7SL 3CUPA 4XP9H 2YD5A 5EUKA 3HN3A 4KKAD 4FABL 5I74B 3X3FL 4XMPL 5F7HA 5ADPL 3ARBB 1VFAB 3HNTH 5GS2D 3LH2L 4Y5VB 1G7PA 1IE5A 5CINH 1N6QL 3P73B 2HJLA 3ARED 3C6LD 4MNHA 4GUPA 3QH3A 5FM5M 3L3OA 1S9WA 4LLYB 5CP7A 4OF8A 3VXRE 1QR1A 4ONFL 3S9DB 5D1XB 2HTKD 2BNRB 1G7LA 1XGRA 4X9IA 2W07A 2CR3A 5FYJE 4F33B 2VDNH 3V6BR 3TJEH 4XCCH 4E41D 3VFWB 4LHQB 4XAKD 2HFTA 4XMKH 5FGSA 1K4DA 4AL8H 1IAIM 3OHXA 2R39A 4LIQL 1P84J 4R9HA 1UB6B 3N1PC 3QJHA 4LMQE 3IDMA 2VXUH 1KIRA 5DMKA 3M1BB 4KJPD 5DT1L 4D0CA 1WWCA 1HH6B 4BSVB 1JI2A 4EI6B 1IGTA 5C86A 1IEAB 1MHCA 3FAWA 3MUHL 3PXJA 3HG1D 4NT6B 1FLRL 1VPOL 4FTVB 3IDJA 2GJ6E 5BCAA 4LDLB 1O7SA 3BP4B 1U41A 2OMBA 2CD0A 2VDKH 4OD1H 1XGTA 1AHWA 2OQJB 4JFPB 5E08H 5JNYB 4PJIB 3BP6A 5F1OB 3S98A 5D1ZA 1UCTA 2WMPA 4F15C 4JRYD 35C8H 3GSVB 2ILLA 4PP2A 2AK4A 3TCXA 1MUJB 4G6FD 2X6MA 4LHJB 4ODSL 1B4RA 3QO1B 5EULV 5I9QB 3QFJE 4X5LA 5CZXC 3VWJA 1MCWW 4B0MM 3ULVH 2YPVL 1H15A 1P84K 3ARSA 3VXTB 1IGYB 2GT9A 2YKLH 2X4TB 1NLBH 3BJ91 3P77A 2DIBA 2XRAL 2YXMA 3SJVD 3H9SE 2Q6WA 3TVMD 5BO1H 1IAMA 3IF1B 3GJFK 4WEBH 3HB3D 3VG0H 3RGVD 5D7JC 4PJ7A 4PJXF 1T0MA 3OAYH 4P9HL 4YJZL 1YEFH 3WUWA 4JFOA 1CQYA 3HI6L 4WFHE 2AV1B 1OGAB 2R4SH 5IG7B 1QTYT 1BZ7B 3V6ZB 2O5YL 1YPZB 5JMOC 1TZIB 2XA3A 1J8KA 4OI7A 1BBDH 3ARTA 3G5VB 4XCEA 4YBQC 4NNYB 2YZ8A 4JJ5A 4KZDH 2XTJE 4OLZL 1MLBB 3AXLB 3EKCA 3TT3L 4I3GA 1CGYA 4AEHL 5FYKU 1TNMA 5FGRA 5I1KH 1PEZA 4FFYL 3SE9L 5E2VL 4U6TA 5EUKB 3L3HA 1FO0L 3ZZ1A 2V7NB 1ZHBA 2E3VA 4X4MA 3CK0L 3C9NA 5F7MC 4GAJH 1VESA 4A2MA 1G7PB 3BFOA 4L3ED 1B3JA 1AGCA 2RCSH 2HJLB 1N5YH 4GUPB 3QH3B 1NC2A 3L3OB 4MHHG 1S9WB 3O6FA 1BD2A 5CP7B 1V7MH 1QR1B 3NIDF 1UEYA 4GRLB 1DLFL 5KZCD 4LKXA 1G7LB 1REIA 3JVGA 3OL2A 3WLBB 3D0VA 1I1FA 2VLKD 1DBBL 1NLDL 4IOFC 2O61B 3LKPA 4AZ8A 5I1AB 3QNYA 1DQJA 1CLOL 4MYWB 1UM6H 1EO8L 2IPTL 3ARXA 1S3KL 4XNQA 1R5WA 1K4DB 4RMTA 1DVFC 4Z0XA 1QRNE 3WIHH 3OHXB 2WNGA 5MHSD 1NAKL 4PUBL 3IDMB 1KIRB 5D72L 5LWYL 5JDSA 2C3VA 3IAPA 1ED3B 1IGTB 3MLYL 4YWGH 5KS9A 3RVTC 5HI3D 2AI0H 4QLRA 3WFBH 4L8SB 4MXQD 4OF0A 2AXFA 3IDJB 1GC1H 2CJUL 3MV9B 5IEKB 4QRUA 3E0GA 4N5ED 5EIVA 1AHWB 4HBCH 3BGFB 2YD1A 4EN3C 5LGHH 1Q72H 3HR6A 3MLUH 5D1ZB 3AC0A 1AGBA 1EUTA 2G5RA 1LDSA 4Y8AA 3ZT6A 5DQJA 2YEZA 4P23D 1NMAH 2NQCA 1D5XA 5L6YH 2AEPL 4PP2B 2H1PL 3O6LH 1DBMH 1KCSH 1QEWB 5GGQH 4E41E 4XAKE 2DQGH 5DRNB 3WFHA 3LV3B 4OCNC 1HHJA 3ROLB 4XNZC 4XP1H 1J12A 1CGXA 3SPVA 1YYLL 3RWFA 3MBEC 4PRID 3WXWH 1H15B 1LEIB 2GT9B 5E00A 2I60H 1GZPB 4Z0BH 4F9LA 3SQBA 3SCMD 4ALAL 1DEEB 5EO0A 2Q6WB 2VKWA 1ULVA 2W65B 3WDJA 5IK3B 2XV6B 5B3JE 3HG1E 4YHNB 5ITBH 1MF2H 4BZ1H 3WNPA 1TJIL 1SQ2N 1MCDA 5GZOD 3G6AB 4PJ7B 1QQDA 1T0MB 4N0UB 2B4CH 3HI1A 2LU7A 3BVNB 1NFDF 4OLXH 4KJYB 3BDYH 1JZ6A 5C09D 5GS0C 4HKJB 4M5YH 5E8DH 5HDQL 5DK2B 5E4EB 1B0WA 4JRYE 4ZS7H 2HMIC 3RUGA 3R1GH 3NABH 4CW1A 4PJAA 4XCEB 1NDMA 1H3TA 1EEUA 3VI3F 4JJ5B 3MRMA 1B88A 2V6HA 4H5SA 1V7NH 1Y18B 5EPMA 5E8OA 5BVJB 5FUZH 3PG2A 1WGOA 3MRLB 1JF6A 3ZTNL 4IDJL 1NAML 3VGGA 2Y5TB 3HMWL 1ZHBB 2ESVD 5CUSL 3SJVE 3ULVC 3G5XB 3JWDL 4FZ8H 5C2BH 1AXSA 1AGCB 4WW1B 5EU6D 1GHFL 2PO6D 4PJ9A 3V5DA 3LD8C 1QBBA 2KQMA 2DQCH 3O6FB 1BD2B 1A7NH 1T1XA 2X9YA 5JHLL 5D1QC 3SE3C 1NGPH 4ZODA 3VRIA 1UYWH 4WV1B 3UJIL 2H45A 1MOEA 2UYLB 4LKXB 1RULL 4G8EB 3D0VB 1W72L 1FVEA 1PKQB 1SJVA 2R23A 2V7HA 3T8XA 5T3ZL 3QNYB 2BSED 1WC7A 1M71A 3GNML 4WHTB 4XNQB 1R5WB 1JPGA 2YUZA 2PYFA 4Z0XB 4NQCA 4R4BA 2ZUXA 4R7NB 5DD0L 3WFEH 3MV01 3U7AA 4D8PA 3VXSD 1MREL 2DMKA 3K4DA 5JDSB 5HD8C 2ZCHL 2EDLA 3BXNB 5DZNA 2QQLL 2X5PA 3FQWB 2AXFB 1KN2L 3D9AL 3VFVA 3RDTC 4QRUB 1M7IA 2HFEB 5FM4A 1R3KA 4ZFZB 2YPLA 5H8DA 4HX1A 4LPTA 2WIIB 5JO5A 1AGBB 2E7CA 1KTRL 3HE6B 3ILQD 3T0DA 3V5KA 2NY6D 3P9LB 1RI8A 4OCXL 3F7VA 4ZSOE 2Q7YA 4NQDD 1IQDB 2FBJH 1YYMH 2BSSB 3MNVA 3WFHB 1D5IL 1H8SA 5I19H 2C3GA 4WFFD 2ORBH 1N6UA 3SPVB 2Q3AA 4KQ4L 1FGVH 2R2EB 3ZHDA 5MHSE 1HI6B 1KXTB 5F71A 3D25A 1I9JH 3BWUC 3FRPA 4H88L 4FQCL 5SWSA 3IU4L 4XCFH 5ANMA 1D5BA 4HFUH 5I1CH 1M6OB 5DD5H 3B5HA 3MUGA 4OCMC 1J1PL 3EDDA 5E6IA 3BN9C 4QHLA 2A77L 3WMSA 2E6PA 2X10A 3B9EA 4BQ6A 4LVNB 3DBXA 5JXED 1GPOH 5DUBA 1JYWA 3HI1B 1T7YA 1CGSH 3W9DA 1GC1C 3T2OA 4PJXA 4GO6B 1DQQB 2NY7H 4P5TD 3BD5A 3UC0L 4OZHB 4HWNA 4OCRL 2E27L 4N1CA 5DD3H 5I74C 4UIKL 3GHEH 4FNLL 2E9IA 3T3PF 3ARBC 2HRPH 1NEZG 4U49A 4CW1B 4PJAB 5HGBA 1NDMB 4Y5VC 3BAEL 1R0AL 1C1EL 3JV4B 2FEEI 4WDIA 4Y4KA 1R5VA 1T5XB 4P46A 2JE8A 2ZG1A 3KHOA 4H5SB 4LGPB 3L1OH 1NBVL 5E8OB 3BMWA 5IGXH 5E8EA 4XCNA 3FCTA 1JGLH 4PRIE 1XR8A 3UYOD 1MRCL 6FABL 5L2KD 5D1XC 2NNAA 1G7QA 4NC2B 3DARA 4UB0H 1U3HA 3FJTA 5GGTA 3SE8L 2OX5A 2WP3T 1JHTB 2NZ9D 2YD9A 2FGWH 3L95B 4WGWB 5KN5A 3D2UA 2DI8A 3EJYC 5LCVL 3X3GL 3MYZA 4PJ9B 1RUAL 4Z7WE 4NWTH 1EA9C 1S5IH 4K7PY 1T1XB 3IGAA 5C09E 5I8CA 5MP6L 3HMXL 4NKIH 5BRZA 1MVUA 5C0RL 3O8XA 4K8RD 1CIDA 5C9JA 2D2OA 4NO0D 4JKLA 2UUDH 4Z7OE 4I77L 1PYWA 2PR4L 4JM2D 1FVEB 4X6DE 3T8XB 1WC7B 1M71B 5L8JB 4Y19A 2BDNH 8CGTA 1LE5A 4PG2A 3CH8A 4EUPG 2CIIB 4NQCB 2EICA 1F6FB 2D7QA 3HPJA 1GOGA 5DLML 3RVWD 4QNPE 4PP1C 4D8PB 5ACZB 3QWRD 1SYSB 4MNGA 4ZG1A 3I02A 4Y5XB 4PLKD 4LSQH 1MAML 1GOFA 3P11L 3HFML 3ARDA 3OZ9L 3HC3H 2ESVE 4K9EC 2O5ZH 1ZGLP 1A8JH 1F3DJ 2KH2B 3K2MC 3QIUD 1BX2B 5L88L 1VACA 4MA3B 4CNIA 5I9QC 1M7IB 5EU6E 3QCTH 5CEZH 5KJRH 1MCHA 4GBXD 1G84A 4HX1B 4NQTA 2BXYA 5JO5B 5TF0A 4P2CG 3QNZA 4U1IB 3WS6C 3NFPB 4JZNA 3ZL4H 3ZDYE 5MENB 4M02A 1FNSL 5IB1B 3LZFH 1KCVL 5EORL 4PGCB 2IADB 1C8PA 2Q7YB 5I1IL 5A3ID 3MNVB 1NUFA 2B2XL 2BP3A 1KB9J 2YBRA 3H3KA 2C4FU 3ORJA 3OXSB 2DIAA 1BEYH 4GRMB 1Q0XH 1BM3H 3VA6A 1NPUA 3VXSE 2PUQT 1A6PA 1GVIA 4M7ZB 2ED9A 1UCBH 1GOHA 2YUXA 4LFHD 1AQKH 4HMDA 4YXLL 4RWHA 3MUGB 1AQDA 4X80H 2DWDA 4TNVK 2MKWA 5FCUH 1YY9D 3ZE0F 4NO2A 2APBA 4LHUD 5TFSL 1G7MB 4BQ8A 4JFQB 5FHBH 5HBBA 1JV5A 1TETH 5DUBB 2F5BL 3K8KA 3W9DB 4F37F 1R3IH 4PJXB 4BA8A 1UM5H 2VDOL 1S78D 4HCRA 8FABB 4I3SH 1NFDA 4LEXH 2CDFA 3BW9B 5IHUH 3EDEA 4JE4B 4OJFH 3NOIA 4NJAL 2H32H 2LU3A 4NQDE 4Y4KB 1R5VB 2Q1EA 2A9NL 4WFFE 1IAKB 4LPCA 5M7QA 5E99H 4P49A 1KCRH 3GGWA 4C58B 1IKNA 4YUEH 1DP0A 3OR7B 3FCTB 1XR8B 5CHNB 4XPBH 3L7EA 4GRLC 2JCCF 4K7FB 3ULUL 3CIQA 1MCCA 3GB7A 1ORQB 1E27A 3ZKSD 5KN5B 3D2UB 2XN9D 1BVLB 4FQXA 1NCWH 1CFSA 2YUWA 4PRHD 4S1DC 1T5WA 3UJTH 3FFCD 1X7QA 3P3YA 3SDDA 2WSKA 2HVJB 4IRSA 2FD6H 2ADGA 5KW9H 1EXUB 2HT2C 5C9JB 4RBPH 4L8SC 1CDHA 4DVRL 3TF7C 4MDIA 5A2JH 4KHXH 5IMLB 4BYHA 3QUKB 3C5ZA 4OF7A 1AHWC 1W0YT 2VXVL 3QI9B 3STZA 3BGFC 4Y19B 4DGVL 1LE5B 3IFPB 1XR9B 4FQJH 5D1ZC 2VDLH 2IPUK 3CSGA 5H37G 1JYVA 3BYTA 3MA7A 5KVFL 3D85A 5L2KE 2AEIT 3OG4B 1FNAA 3BEVA 1BF8A 1NANI 1U58A 1E28B 3QDMB 3ARDB 4U0QB 4X6CA 1MCBA 4FZEL 3KYKL 1I7RA 4YDIL 4XNYL 1HKLL 2Y07L 5J1AB 2MNUA 5FO7A 4KTEL 2AV7B 4GW1A 4U7KA 4R6UA 1VACB 5D8JL 2Q8BH 1RY7B 4CNIB 3BIBX 5J57B 3QUYA 3VWJC 4JHWH 2FBOJ 4XTRC 3LN5A 1G0DA 5DJAB 4KUZL 3HAEH 4NKMA 3BISA 3ESVF 5BS0A 4X5WB 4XPFL 1Y6KR 2C4XA 4PJHA 3QNZB 1OAQH 4S1SH 4LLUB 4FFZH 4PRPD 3R0MA 2VR5A 2OR8A 2YN3A 2F8XC 4D3CH 3NACH 4U6XA 1N0XL 4QXUL 1YEGH 4PREA 2AABH 2D7TH 2VSDA 2YBRB 1N3NB 3TO4A 3U30C 1E4XI 5IQ7H 4EI5A 1MEXL 1AKJB 1TJGH 5F8RC 1AO7A 3U4BL 5E4EC 4MD4B 4LFHG 2MCPH 3IB4A 1HQ4A 5D7IB 1VEMA 4G9FD 1A1NB 3UTQA 5IV2B 4Q6YA 3I3EA 5FFLA 5IR1A 4ZUUA 4YPGA 1AQDB 3HC0A 1CGUA 2XZCL 4NO2B 1C5DB 4U2YA 4IRZH 3QG6A 1F90H 1JE6A 1JYXA 2V9RA 1A3RL 1LILA 3JUZA 3FT2A 2GK0A 3KYOA 4ELMA 2GW5A 4DN4H 4HUMB 1DANU 3GKWH 2EDJA 3IFLH 1RK0B 4YIQA 4RMSA 1NFDB 4O2EA 2CDFB 3IRZA 4NO3A 5F9JA 1J05B 4JKMA 3U9PL 5C0GB 5D7KD 3NA9H 4K7PL 2Q8AH 1X5IA 3O6FC 2ZCKL 1VFOA 2EDWA 3RI5F 2WBJD 4OBSA 1X5HA 1BWMA 5IF0A 3B9KD 2FGZA 4O00A 2HN7B 3JVGC 1EBPA 3GB7B 4JDTH 1S7XA 3BKYH 2AJUH 3GSRA 1IGCH 4FQXB 3ARGD 4QCIB 3CXDH 1NC4A 3S36L 1XF3A 1D5ZA 1S5HB 4KJQD 4XP9L 4G8GB 5H35A 3VFTB 3GSWA 3SDDB 4X5XB 3RTQA 1OAUH 4ZD3H 2F74A 4IRSB 1CFNA 2H6PB 3LEXB 3HNTL 4R2GD 2XIDA 3KPOB 4M6MH 5CINL 1PY4A 1T1YA 1CLZH 4WY7H 2BRRH 2AW2A 3ARUA 3NA4A 2C5DC 3C5ZB 2DI9A 1ZT1A 2ZUYA 4UT6H 2J5LC 4N0FA 1ZS8B 3BGMA 1I3UA 3UTZA 5T1KB 5IW3A 3BPNB 4GJTB 4MD5A 3D85B 4QKXB 5D96C 3F7RA 4G7VH 2VDNL 5JA8B 3TJEL 4XCCL 1VGKB 4JGUA 5DRWA 3L3DA 4KXZH 4CJ1A 1I7RB 4W4OC 4AL8L 5FO7B 4GW1B 3D3VA 5I16A 1KELH 4PRHE 2R0WH 4H0HB 4RFOH 2VXUL 3QWOB 3QUYB 2EYRB 3FFCE 3ZHLA 4LEOA 4FHBD 4ZS6D 3QBTB 3QDGD 3LN5B 2IFFH 1MCNA 3WLWC 4NKMB 1LP9A 4F9LC 2FH6A 5IB5B 3QEQD 3VFNA 3VXQA 1OWRM 4TUKH 3ILPA 3IAQA 2MPAH 2VDKL 4OD1L 2E9BA 3I6KA 3RX7A 4QWWD 1HNFA 4G6MH 4WW2F 5EU7E 5E08L 5ICYA 4LVNC 4DVBA 3O6MH 5DVMA 3S3JA 3IDUA 4GKNA 3RVVC 1HHGA 4K7PX 3QZWG 3TO4B 4JFFA 4C56B 4P2OD 4M03A 3NCMA 3BRFA 1EO5A 35C8L 1AO7B 4PLNC 1NH6A 1FPTH 4IMLA 1KJ2H 1RHFA 1KNOA 3BPCA 3T0ED 2YPKA 5INDA 3HC0B 1EEZB 3ULVL 4NO5A 2VLLB 2EDRA 4HFWB 4NFDA 2A38A 2YKLL 2BHUA 3S36X 1NLBL 1OSPH 3KYOB 4HKBB 1P4IH 5M95B 1P53A 3QUZB 5JOFA 5C0CA 4RGND 3FO9A 4TTDD 3X12B 4YZFE 4WEBL 4I2XE 4YIQB 3VG0L 1ORSB 1Q9OA 4PRPE 4NO3B 4G8FB 2DM4A 3PP3H 4HK3N 3HZVA 3KGRA 1YEFL 1XZ0A 2R4SL 3C6SB 4PJ9C 4CJ0A 3PE9A 4HJGB 5EO1B 4Y4FD 3X14A 4U1JA 1BBDL 1IM3A 5IF0B 2EDKA 3WFZA 5DEGA 4FQHA 1B4JH 1DLHB 4G9FE 1OT1A 4PS4L 4KZDL 3PDOB 1S7XB 2L4OA 3OPZH 5HYQB 3GSRB 2VQ1A 5I1KL 2I07A 3LPGA 3NCEB 4PJDE 2NZIA 2D7OA 4H25A 4S1QH 2OCFD 5H35B 4MCZA 3GSWB 2HT4C 5I76A 4Y5XC 3ARFA 4J1UB 4MQXC 5IVNA 2HFFA 1CFNB 4GAJL 4NBXB 5IJVA 3DX7A 2RCSL 1N5YL 3L3GA 3RQ3A 4HCRH 4XWGH 1V7ML 1A02N 5D7KE 2B0SH 4N0FB 3UTZB 4WEMB 4MD5B 2X7LB 5ENWA 1PJ9A 4RSVA 4MQTB 1KJMB 3OV6A 4Q6IB 1UM6L 4JCMA 5CJOH 5D2LA 4OD3L 3RPKA 3CVHA 4Z76B 4LEOB 2QR0A 2VL5A 4YWGL 3D39D 3EDFA 2AI0L 1CFQB 4M7ZC 3WFBL 2NXYB 5EFIA 2ATPA 4PJCF 3VFNB 1GC1L 5E1HB 4L8BB 3OKOA 3ILPB 1S7WA 1FFRA 1G6RB 1XIWB 3I6KB 2R1WB 4DVBB 3MLUL 4GKNB 3OKMA 4ZFGH 2BK8A 3FOLA 3RNQA 4JFFB 5J11C 3L5WA 5GIRB 1NMAL 5L6YL 3NCYS 3VFMB 3HNVH 4XC1H 5F9AC 3O6LL 4LSUH 2I27N 4LCIH 1DBML 1KCSL 2XY2A 2LTQB 5FGCE 5GGQL 2WAHA 1X4YA 2DQGL 3QFJA 4IMLB 1W0WA 4R3SB 4XP1L 3BPCB 4Y4KC 4HD9A 2F9BT 2Q20A 2VDQH 1U95A 3VXMA 5FYLH 1URLA 2FJFA 3Q48A 3UTTB 3WXWL 5KSUA 5KANI 4WUUA 2I60L 3H9SA 2XWBA 4Z0BL 1WAAE 2ZP0T 4CVXA 3QDGE 5DQ9B 4HIJB 5C0CB 1CD0A 4YDKH 5ITBL 1MF2L 2DLGA 3QEQE 4BZ1L 1ZWIA 4BZYA 5JW4N 1CICA 5TJWK 4OKVA 5F7KC 2IWGA 3MJ7B 2F5AH 2B4CL 3HZVB 4B50A 1CL7H 1FZKB 5AAMA 1MCIA 1R3LA 4OLXL 4M8VA 3FB5A 2C9AA 1LWRA 4M5YL 5E8DL 1T7XA 4K2UH 3N9GH 4EZMA 4YHZH 2Y1VA 4ZS7L 4ZOAA 2ZSVB 1IM3B 1TZHB 3DO3A 3R1GL 3NABL 2R2HA 3O8XC 3QEUA 5FDYA 4FQHB 3W81A 1ZSDA 4L3CB 1SJHA 3T0EE 1V7NL 5ILTH 1MLCA 1MRDH 2JCCB 3OF6A 3B3IB 3IU3B 2VQ1B 4WI9A 5FUZL 2I07B 4PG2C 3V8OA 3FT3A 4PJBE 4MCZB 3JWOH 5HHXL 4L5FH 5D7JD 4Z7WF 3TGXA 4RGNE 4L9DA 2HFFB 3ARDC 3EOYG 1Z2KA 3NGBB 3MSPA 2ICWI 4FZ8L 1FIEA 5C2BL 4LLMB 1ZE3C 4E0RA 3DX7B 1T22A 1MFAH 3ZSSA 3VXRB 2YC1B 3DXAA 3TBWB 2DQCL 1A7NL 1DQMH 4JO3H 4X6DF 1NGPL 4LCWA 3BESR 4GG8A 3P40A 2BY1A 4TUJA 4QNPF 1J0KA 2DBJA 4Z5RA 3BI9X 5IFHH 2D31A 3O3EB 2XNAB 5E70A 4P5KA 5A40E 2P44B 4MCYB 1U8IB 3WFEL 1EAPB 5JQ6H 2DM7A 3CSBA 1V3MA 1TQBB 3DVIA 4P3CH 1Y6MR 1LNUB 1UADC 2L7JA 4ZXBD 1TVDA 3SGKC 1GAFH 3MTRA 4KRPB 1JGVH 2F58H 4M6NH 4F2MA 1SY6A 4P9MH 4JO1H 2JLLA 2QL1A 5J4MA 1I1YA 3AREA 3RNKA 3C6LA 5H2BB </