2W0PA

Crystal structure of the filamin a repeat 21 complexed with the migfilin peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the Migfilin-Filamin Interaction and Competition with Integrin {Beta} Tails.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords FILAMIN-A
total genus 15
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0pA00
2NZ9D 2N7BA 3V5HB 1NDMB 2A6IA 3U7AA 1JFQL 4J3VA 4Y4FB 1VPOL 2CD0A 1G7PB 3I85A 3QIBC 4ENED 4KV5E 1IGIL 2AEQH 1HSAB 4JFXB 5F7HA 5KW9H 1OT1A 4X6DF 3O4LB 1JF6A 1XMWA 2BHZA 5A2KH 4UT6H 1P1ZA 5E2UH 5F3BA 5DHVH 4XCEB 1UEMA 5KSUA 2ENSA 4LSVL 2VITB 5GGTA 5I75B 3LV3B 1MCOL 4OKVB 2IAMB 3VXMA 1KFAL 4UAOB 3SE9H 1II4E 1JNHB 4J3UA 3I6GA 4HWEH 1UWXH 4YAQA 3FFCE 4UT9L 1QR1B 3T4YA 4R0LB 4HUKB 5HHQB 3QJHA 1VKXB 4Y7MA 4MQSB 5JPMB 1E4WH 1NC2D 1N5YH 5E6IA 4RAVB 3BX7C 4LDLB 4HLJA 1NGWA 4P5KB 4JY4B 4N0YH 4PRIE 4IRJC 3D2UA 4U6TA 5F9WB 4AQOA 4LL9A 4DVRL 1RZKL 2VABB 2NPLX 4I9WD 2PYED 2AEPL 1GH7A 2XZQH 3UJTL 1A6WL 2FHCA 1IM3A 1UM5H 4NO0A 4R90L 2I5YL 4FFZL 4XNMA 5ENWB 4KVCL 4Q74A 3QEQA 3MJ8A 4OCSH 3RWGA 3WL9A 4YXLH 5KANG 5H94A 1IC4H 1X5LA 4W6XB 5HHME 5IVXA 1C5DA 1CF8L 4Y2DD 1HWHB 3B5GA 1C5CL 1KLUB 1ZLWH 3ZE0E 5IMLB 1IC7L 2CGRL 3LB6C 1FN4A 5DD5L 2OMBA 1MCOH 3ARGB 2OXGA 3T4AB 4M00A 2IALB 3JV4A 4G8FB 4GXUN 3LS5H 2NW3B 3QXWA 3MCLL 3KR3H 1AH1A 1KACB 1KJ2L 4MD0A 1UQSA 4M5ZH 1CLOH 1S7VA 4G7VH 3MV9A 3QSKB 3HE6B 3BZFA 4ZXBD 5ILTL 2YXFA 5D1XC 1HHJA 3ZSSA 1KG0A 3VXRE 1HOCA 3WD5L 4P2CG 3GMNB 3BKML 2GAZA 5DLML 1A1MB 3X13B 2R0ZH 1NBYB 1TETH 3CXDH 2OM5A 1RZIA 2G75B 3L5HA 2UYLB 4XC3L 2ATKB 3QXDB 3U0TA 1EGJA 4ZYKA 2GJ6B 1QSED 4ZFOL 4RWYH 4J12A 5CZXD 1DR9A 4ALAH 5CZVL 1D6VL 3LAFA 1Q72L 1QRNE 3BJ91 1E4XH 2IQAA 3U83A 3UBXA 3EO0B 2FD6L 2GJ6A 3QZWB 1PKOA 3L3OB 3F6IA 4HS6B 2EXYD 1I3VA 3RZWA 3SGKA 2CDEA 1SJXA 4G6JL 4U1SA 1FFPB 2E9WA 3Q1SL 1ORSB 1NGXB 1U8OA 3RKDD 1SY6H 2YA0A 4M6MH 4KJWC 4K7PY 3QAZC 4I8DA 4NKIH 4XP5L 1JMXA 1UXSA 5A16A 2QHRH 4KPHL 2NY1C 4Y1AD 4CNIB 4JY6B 1T6VN 1EEQA 3MRBA 4JPIB 4KFZC 4DKFL 3D48R 1ZE3C 3FT4A 1J18A 1F5WA 3QUYB 1ZHBB 3T4AA 2Z35B 1WZKA 3PP3H 4DOHE 3AM8A 4Y5YC 4P2QE 43C9B 2BSSA 2D0GA 4TUKL 3E6FB 4FTVB 4FQIL 1NFIA 4KZDL 3RWGB 1XH3B 1RURH 4APQD 4XBPB 5EZLA 3KWWA 1NBZB 2XTJE 5HSFA 1S9YB 2FBJL 4LCCA 4WUUD 2ZZUT 1S9YA 4ZTPL 3MGAA 3SDCC 1CYGA 4P5KA 1U2CA 1FFNA 4WI8A 3MOBH 3VE0A 1QNZL 1AHWB 3AB0C 5D2LF 5KANI 3EFDL 4JM2C 3W2DH 1INEH 2PO6D 2YXMA 5D96B 3V4PL 2EYRB 1MJJB 4X7CC 4N9GB 3UPCA 4LSPL 4JO4L 3MYZA 1ORQA 4JREB 3IF1A 4MYWB 4PJIE 2BMKA 4HJJH 3O41B 4H0IA 3IDNA 4MHHG 4IJ3B 3BZ4B 2GSGB 1MFDH 3HMWL 2J8OA 4K8RC 2QQNL 3TCLB 3U6RA 1WGOA 3KPPA 1D5XB 3GJFK 4NWUH 2VISA 1XGRB 3W9EA 3ARUA 1OP5K 5TDNA 4JFPA 3I6KA 3A6CL 3C5SA 4LCYA 2H2SC 4OSUL 4PRPA 5HVWA 1NC4D 2EDTA 4RGNB 2R23B 4WY7L 3I3BA 5GRJL 4WWKC 1YJDH 5D1ZB 2EDRA 2OTUB 4MB5A 5FHBL 2ZUXA 5JQ6L 4U3CA 5EN2B 5ABDE 2VKXA 4HIHA 3F8UB 4F58L 3ARBA 5GGUA 2I27N 4G80B 2IC2A 4AEEA 1CD8A 4XMKH 4JKMA 5TDPA 1D9KD 4G6KH 1ACZA 4JPVL 5HVFB 3VWKB 2G75A 4YUEL 4LGRB 5AYQA 2V17H 3QWRA 2DDQH 1I1FB 4DOHB 2MKLC 4JCLA 3QUYD 4YDLC 4LNRA 2AJXL 4XCNA 5F3HA 1AGCA 4RAHA 1F58L 4JJ5B 1QLRA 4LCIL 1I1RA 4KTYA 3QDGD 4OZFG 5DZOA 5E70A 4N8CL 4KJWD 3MRCA 3MYJB 5E9DA 4R26H 5EPMB 4E0RA 3D0VA 1FE8H 4WEMB 3FZUC 5E1HB 1FQ9C 2DLFH 4OF8A 1AXTL 5T3ZL 3RUGA 1A47A 1KPVA 5F44A 3NAAL 5DZNA 5HHMD 3U30B 3OAZK 2JTDA 3MLUL 2EE2A 1IGFH 1VACA 5IVXB 3ZO0A 4MNQA 5H35B 3WHE0 1T1YB 5E03A 4ZFGL 2EIEA 5DTFB 3TNNA 2K1MA 4XNMB 4GBXC 3PWUB 3HRPA 2DQIH 1GSMA 4YHKL 1L7TL 1OTSD 4OAWB 5L88L 4XB7A 5I9QC 5F21B 5JOFB 4RAVA 3LN5A 3WKMH 2DD8H 1EVTC 5EU5B 1RULL 4GW5B 1I8KA 1R0AL 4HS3A 4PRBA 3BPNB 3MACL 4NN7B 1ZVYA 5FHBH 5I66B 1Z3GL 4FQ2H 3LD8C 1Y6MR 4HUXA 3MROB 1MNUH 1KJ2A 4GS7B 1S7UB 4AENA 3ARGD 3TM6A 2V9RA 2ADJA 3FONA 4NM8H 4WI5A 4X4YB 4KRNA 5SWQB 3VD4A 2NY3D 2C3VA 2ARWA 1N59B 5I8OH 3AS1A 1BQSA 1SHMA 3DVFA 2FZ3B 4YHLL 3LVEA 1L7TH 4J4PC 2GFBA 4ETQA 3EZ8A 1Z0MA 3LQZB 1NCWL 4KQ4L 3VWKC 4TVPD 1MREH 4NUJA 3OXRA 5E1AB 3KJ4B 3QCTL 5FDWA 1H0DA 1JV5A 3GJEA 1YMHA 1ZA3A 2X1OA 1GGTA 3SDYH 3P77B 1D9KB 3EYVB 1IGFL 1NDMA 4MNQD 4BQ8A 3C5ZA 4OUUA 4S1DC 5AZEL 5HYQA 5CKGA 1CL7L 2CK2A 3OKKB 1OAZL 3EGSA 3ZTNL 5FO8A 3JTSA 3BISA 3QHTC 4U1MA 3O3DA 4YDVA 4FFVD 5KVDL 3B9EA 3UC0L 1B90A 4BH8A 5SX4I 4LCWD 2Z9TA 5DHVA 4B41A 4GRWE 4J3TA 4XWGL 1F3JB 4I5BA 4B0MM 1MCPL 1HILA 1YPZA 4G8GB 4XCYA 1MAKA 1KLFA 4K55A 5IHUL 3WMSA 1JHLH 2GT9A 2NNAB 3BH8A 4NDMA 3OQ3B 1BBJB 3DXAE 4QWWC 5DT1L 1U9KA 3RKDC 4K8RH 5EU4B 3O3AB 4JPVH 4Y4KB 4FP8L 4KMTL 2QKIB 1DBML 3VDCA 2L7JA 4X7EC 4G8IB 2CRZA 1P5UA 3AVEA 4MWFB 3KPSD 3OGCA 4TUOB 1NANI 4IIQC 1YMMA 4BFIA 2BVTA 5CZKA 3I02A 3EYSL 4KHXL 1QBAA 1OSPL 4LASL 4M6ML 1S9VB 2APTA 3SGDH 2XYCA 4MX7B 5FCUL 5FO7B 4Q2ZA 1N5YL 3JWDH 1TZHB 4OFVA 3W81A 4H8WL 2F74B 1OB1B 4APQB 2BVQB 4KROD 3CSPA 2V5TA 3TIEA 2F9BT 4GRMB 4Q0XH 2GK0B 5BS0A 3SDAC 1FYTD 1OGAA 1JZ5A 1U93B 1A2YB 1KFAH 5CBAA 3DTXA 1GPOH 3ULSB 1J5OL 2XRAL 3PIQB 5IB1A 2HVKA 5B21A 2W1NA 1IC5L 3TV3L 1EDQA 4XC1L 2NX5A 4L3EB 1KEGH 4RWYL 4K3DH 3CK0H 1YUHA 2C1PA 1WC7B 1UGNA 4M7LH 2VXTL 5F97E 4RGNC 4UT6L 4KKNA 2P43B 1N64L 3HE6C 1U8IB 4WJ5A 3MNZA 4EUPB 3VFVB 3C6SA 4ORGA 5DR5H 5GS0H 2ADIB 1G9MH 3V6OE 4GAJH 1UM4H 5D7LE 2IBZY 1XZ0B 1A21A 4HX1B 1BM3L 4O58H 2CUIA 4XVJH 3LN4A 4WFHD 2H26B 4ONFL 3WXVL 4BQ9A 5GZND 3Q3GA 3DLQR 4NZDA 3O81A 3NCJH 1T1XB 4I3RL 2P42B 4AIXA 4A6YB 3MBXL 4NCDA 4BUHA 3RPIA 3GO1L 3QDJE 1EO8L 1OARL 2MCG1 2C4FT 5C9JA 1N3NB 4UU9A 3EIFA 1NMBL 3M1BB 4X7TB 1GGIH 2X4SB 3HR5A 4G8GD 4FQQB 3RZCB 1VEPA 2EDOA 1PY9A 5FUCE 5CEZH 1JGLL 1PVHA 1S3KH 4JGMA 3INUL 4Z0BL 4FFZH 5ANMB 3MRPB 5DJCB 2H8PB 4K94L 4KPHH 1UB5B 4QRRD 4MCZA 3X3FH 1FFRA 3NFPA 4NKDB 5AUMA 1NAMB 3X14A 1XCTB 1ZGLA 4I9WE 3QHFL 3WHXB 2NTSP 2VDLH 1HHKA 1RK0A 4YHPA 2H32B 4D9QD 3HCVA 4NNPL 1BFVH 2J6EH 2D2OA 4I77L 3ARFC 5F9OH 1G7HB 2XZCH 4KQ3L 4PYGA 4DAGH 1MCWW 1VFBA 1TZIA 3AU1B 5GHWH 3WS3A 3MGTB 3H2WA 4K7FB 5D93C 5DUBB 3UTZB 2JJSC 2P1YA 3IFNL 3FRUA 1YYLL 1Y18A 3GBML 1EO8H 2WV3A 2E27H 2C9AA 3C9NB 1KEMH 4OLEA 2FGZA 3OL2A 4Y89A 4LPXA 4AEIL 5DD6A 1PZUB 4EDXB 4OV5B 5MEPB 1M71B 5LXGL 4NQDA 2W9EH 4A6YH 1JZ7A 3ZTJG 1MLCA 3IXAA 1P4IH 4QHLA 3WEXA 3TBTA 1OD7A 1K8DA 3RRQA 1G0DA 4Z7VE 8FABA 5HYSG 5HDBF 4M03A 1RJZB 5EUKA 5JOEA 1A4KA 5FO9A 4M9PA 5C0EA 1BBDH 5DJ8A 3TT1L 5JW4N 4AG4L 4HPOH 5HJ3A 2FX9L 1I85A 2Z31C 3SKOA 4W4NA 2XZAL 2QR0A 2OQJB 1NCDL 2CLZB 2C4XA 3QCUL 4WW2A 3GMPB 4X0KA 3SO3B 1N26A 1NUGA 2A1WL 4P2RE 4O2EA 2IEPA 2RGSA 3QUZD 3VXNB 3WS6C 4FFVC 4PJFE 1I7TA 2LABA 2FIKA 2VDRL 3IS0X 3LPFA 3B9KB 3GI9L 1MCEA 3CH8A 1CLZH 3L5JA 1F3RB 5FHAH 3RQ3A 3HAEA 5HDQH 1CD9B 1CFNA 4DKAA 5C8JB 3EYFB 4F3FA 4OQTH 1V3KA 1EJOH 2BY1A 2EDKA 1VGEH 3D0LA 1G6RB 2KUTA 1FDLL 3G5XA 3GNMH 4TUJB 4U31A 1KENH 1H15B 2VDRH 4BM7A 5GS2H 2XXCB 1M71A 1SM3L 4X6CB 3TJHC 3BP6B 4QTIH 1WAAA 4ELMF 4JVPA 3O6FC 1HQ4A 5IVZA 4K8RL 4LBEB 2O5ZL 3QJFB 4PJ8D 1HZHH 5T1LD 5BO1L 1A6UH 1FV1A 5C09D 4I2XB 3BFOA 5CJBA 4QOKD 4HUMB 1EZVY 4YPGA 3QFJB 4J4PD 1YA5A 2NR6D 3SY0B 4QXUH 3VXPA 2Z92A 3IU4L 5I8CA 2R29H 1MCPH 4MSWB 4KKAC 1ZANH 2C1OA 5SWZD 5TQ0H 4O5LL 1MI5A 3WXVH 2OZ4A 2VL5A 3PHQB 3RWCB 4HIXH 3UZVB 2YEZA 3MRRA 3CVHL 3GMRB 3CLFH 2UWEA 1K6QH 3QUZA 1CLYL 2ZUQC 3DX6B 5HGHA 2VDNL 3B43A 1TCRB 2ZUYA 3VXUE 3F7RA 3FB7B 4JM2D 3L3OA 3SE8L 1JWUB 15C8H 5C0GA 5EBMB 1XT5A 3VFMB 3N85H 3BN3B 3DETD 4RNRB 5GRUH 3MA9L 1SEQL 3EDEA 5JOPE 1KTDB 3D85A 1UH2A 1GPOL 2R0KL 4IMLB 5DA0B 2J88L 2DLGA 4PRAB 3EBAA 1C16B 1YECH 2XTJD 4Z95L 5E5UB 1DN0A 3TZVD 3ULUE 3CVIH 1BIIB 2GQHA 1QBBA 4LVHC 1T2XA 2V2XA 1GIGH 4Z78B 1CDIA 4X80L 4KMLB 3VI4E 5JHDD 3HLAA 2WWMD 4P57B 4MVBD 1LK2B 1FO0L 2Q3ZA 3NH7H 1M7IA 2R0WH 2HJKB 3GIVA 2E6QA 3ZYJA 5F1OB 2XY2A 3GSUA 1R0AH 3DI2B 4D3CH 3ZKSD 2IQ9H 1PX3A 4OZHE 4EVNA 3THMH 5I1GL 3PXJA 1VGKB 4KRMB 1DBMH 4H8WC 3E2HB 4EUPA 1JNJA 5A43C 2PETA 3FFCB 4YHKH 2F54B 3QI9A 4MJ2A 5C0DA 5D96C 1F13A 4M1DH 2F53E 5CJOH 1A7BA 2AV1A 4LLDB 3WN5A 1JHLL 1A1NA 3G5ZB 1A6VL 4HAFA 3U4EB 3WFEL 4JRYE 1XF1A 4XPHH 1BQLL 5BQ7A 5I1KH 1LO0L 2EDYA 3H3PH 3FQXA 4UTAL 5J6GA 3EW3B 3X3GL 1ZHKB 4HH9A 4JPKL 4D0CA 1KCUL 2XKNB 4Q9RH 4WDIB 3H9HA 4F8QA 5EU6A 5T1DL 2P44B 2VDKH 2HT2D 3I6LD 3AREC 4HF5H 3V6OC 3FQUA 4PY7B 1AKJA 2EEAA 3BP5A 4JKWA 1S9VA 1HYRC 4LSDA 5T1KD 5I1JH 4DK6A 5ISZA 3TA3D 4HKBA 3VXRB 1S7RB 2X70A 1TCMA 4I4WA 3GRWH 3VWJA 5DRZA 1UCTA 2AGJL 4NQSA 2FX7L 3GBNL 3CZJA 4DGVH 3WUWA 1LMKA 3K8MA 1DBBL 4LKCB 2VLRD 2WQ8A 1N7MH 1X7QB 3VXTA 2V7NA 1BBJA 1UWEH 4WNQA 3QNYA 5J57B 4JKPH 3X12A 5ITFA 4JFXA 4WW1A 1IQWL 4NZRH 3PWNA 4P46D 4ZXBC 1A9BA 3WFHB 1QACA 4MNGE 1JGDB 1JNNH 1EX0A 4KK5D 4DUXA 4Y1AE 1J10A 1G7MB 2LVCA 2XY1A 3GBLA 1RJLA 3P9LB 3UBXG 5I76A 2P8LB 4OZIA 1DQLH 1QSFD 4NRXA 3RX7A 2Z31D 1KCSH 5CJXA 1QKZL 5EZIL 3U82B 3EGSB 2YKLH 3QIBA 3OJDA 1MIEL 3RY6C 3NTCH 3BZEB 1U92B 1FL5B 3S4SG 1KUMA 3QFJE 4WW2F 3GMOA 25C8L 2E3VA 1DVFA 2KKQA 4MDIA 1NKRA 5DMIH 3T0EB 1U36A 4IOSD 4PLKD 3VA6A 1HINL 3ZE1F 1XR8B 4HDIA 4ZXBB 3TA3A 5ISZD 3RAJH 1N2RB 3CUPB 2EC9U 1FGNL 4ZSOE 1CGVA 2J8HA 1PJ9A 1RQ5A 3FFCD 4X6DE 4S0TD 3TWCL 5DJAB 4WU7A 3V4UL 3QP3A 4PP1C 3W82A 2JJUA 3RVWC 4U1NA 5KVDH 2OLDA 3WSQL 2MNUA 2YMXH 4O2CA 3SN6N 2FWOB 2LU7A 1HH9A 2XT1B 5EO1A 4N8CH 1DFBH 3MLYH 4H20H 4OCWL 1IKFL 2FSEA 4D2NA 1BZ9B 35C8L 4P4RA 2HJLB 2IGFL 3CU7A 4GJTB 1HHHB 5EOTB 1NCNA 4P5TA 4G5ZL 3CDCA 3KVQA 4PRBB 1NJ9A 4OIIL 1MEXL 4J8RB 3MOAL 4KHTH 2DDQL 3H42H 5JOFA 3D3VD 2DQJH 4KKLD 3FQTA 4J3XA 2EDWA 3WFZA 5GRWA 4ZS6C 5DFWH 2YD1A 4WO4A 3VWJD 4PJIB 2BVOA 1FVEA 3FQXB 3WYRA 3FB5B 3D9AL 5ACZA 3QUXB 2BSRA 3I50L 2ZCLH 4M02A 1RY7B 1I9RH 4YK4B 2AV1B 4LLDA 3PP4L 3PHOA 3PV6B 2CSPA 5J13C 3GSRA 1K2DA 5ERWB 3VD9A 2UZIH 1YJDL 4X9GA 3P40A 4DUVA 3IDJA 3LRGA 2DI8A 3GZKA 4PJ5B 3B8YA 4JRXB 2FR4A 1G9NH 2NY2B 5DQ9B 1I8LA 3VFGH 2F53B 4Y16D 1YYMH 4HLZG 5CWSB 5JDSA 3H6JA 3GKZA 2IADB 4OLVH 2VAJA 5ITBH 4X4ME 4X6CF 1K8IA 2OBGA 3BXNA 1MF2H 3HMXL 1FSKC 4M1CC 2GCYB 3EJZD 3S35X 4EI5A 4MXWH 4HUVB 4N1EA 3PWPD 4JGUA 2DQJL 3GBNH 1N4XH 2P5EA 1AO7A 2R4SH 1I3RA 2CPCA 3T3MF 4BZ1H 1VSCA 1MEXH 3K4DA 3QUMH 5HI4C 4IOIB 1XF5B 2DN7A 5FYLD 2H2SD 5FIEA 3V0AC 3T1FB 5DI8A 2X05A 4NWTL 2IBZX 3PL6A 1ZT4B 5KSBE 5E2JA 3NPSC 2P45B 4FQXA 2FJGA 2DJ4A 2E9BA 5DHXB 5C07E 2PXYD 2C3GA 4PB9L 4ZXBA 3QXVA 3ZHDA 1A1OA 3P30H 3U48A 1CLOL 2GTZA 2X4QA 3OGOE 4EBQH 3QDHA 3ISWA 3FKUS 3S4SA 1I1YB 3A6BL 1U95A 2BVEA 4LHUA 3ESUF 2Q7NA 4XZUB 4Z77B 1INDH 3LS5L 3RVXD 4ORZC 1C5BH 2JIXA 4CVZB 3VFOA 1FG2B 1Y6NR 5J7CC 5IFJB 3VWJC 2C1OB 2FGWL 2WQRA 4M5YH 3IDYB 3MV8D 1YEEL 5HY9B 1UFUA 5KVEH 3PDOA 4P5TD 4E42B 4HBQA 1MVFA 4CVZA 4Y4FD 4MVBC 3I84A 2DQTH 3LB6D 4E41A 3ARFB 2DL9A 1VDGA 5L7XL 1FDLH 5DRNB 3I6LE 2NZ9C 1MJJA 4P2RB 4WU5A 5EBWA 3VXRA 1SVZA 5IT2L 1FIGL 3RWJA 5H8DA 2EIZB 1EXUB 4WVRA 1XGTB 1UT9A 4KTEL 1DUYA 1JZ4A 4EOWL 2YUVA 1H15A 5I2IA 2BK8A 1FFNB 5HGDB 4RMTA 3RDTB 3S37X 5BV7H 1GGBL 1ROWA 5AD0B 4M48H 2BY2A 4D0CB 3P0VL 4LCCB 3GSWA 2FJHB 3STLB 3BI9X 1KJMB 1HYSD 4OFYA 3B9VA 4KI1A 4N0UE 4NC0B 2NY2D 5E7BA 4GG6A 1XH3A 4PLNC 1BFOA 2VLRE 3QFJD 2VLKA 5CIPA 3A67L 3P0YL 4U1LB 1I7UA 3PQYA 4XI5C 3DYPA 3QCVH 1BBDL 2V5SA 4PBXA 4JO4H 4HKJB 4C4KT 1E27B 3C60C 1SJHA 3QQ9C 4ODBD 4XPGH 5ICZB 3QG6B 4YDKL 3BKMH 4HGWA 4YHYB 4QRSA 1DUZA 1DBJL 5I0ZA 3FHQA 2OL3H 2P48B 5F1NB 3K2UH 5D5MA 4JY6A 4NNYA 4YFLF 3SBWC 1LK2A 1UZ6E 1G9EA 2R15A 4U1KB 3P4NA 5D7IA 1KEML 3MRDB 4MJ5B 1EHLH 5CSZB 3B9KC 4K2UH 5HTSA 3T0EC 5IEHA 2VLME 1CICD 3O8XD 1IFHL 1NCAL 4OLUL 1BOYA 2EDEA 4K9EC 5C08E 1AGFB 4BUGA 4MCYB 5CD5C 1DEDA 5DD5H 3BT2L 4BYHA 4RBPK 3ULVF 5ACMA 4O9HL 1QSFB 4WFED 3TH2T 3VFRB 2FDBP 1SM3H 1NGYB 2JB6A 2QQQA 3W11D 2JIXD 2I5YH 1GGCH 4R6UA 3MBEC 4ODXB 3UTZA 1ZTXH 1T1WA 4ODWA 2QHRL 2PYEA 5EC2B 3KPNA 1FFOA 2YHGA 3PNWA 3RGHA 2CLRB 3QUXC 1PSKH 3LKNA 3L3KA 1QRNB 5L9DL 4G6JH 4KK8D 1YEDA 5AEAA 4D0DB 1PZ5B 5I1HH 4WU7B 4O9HH 4PJCE 4OZFA 3KPRD 1U8NB 4LQ1A 3SE9L 1U8LA 4IDJH 2J88H 1N2RA 3L1OH 4F7EA 1BLNA 2IH3A 4H1LG 3DGGB 1LK3L 3DXAA 3EJJX 4Z7NF 3TT1H 3BAEL 4XNUH 2H6PA 3WO4C 3N85L 2AK1H 2XQYG 4YGAB 3KPOA 4HUWB 5LVEA 4MXQC 5JR1L 2G2RA 5C0AE 1AGBB 4KI5C 2OL3L 1FO0A 5ENWA 4PV9A 3UYOD 3HZVB 1T89C 2R2BA 3QXAB 1XGPA 5JLZA 5KJRH 2HFFA 1DQQB 1MCFA 2LQRA 1T1XA 2VL4A 3G9VA 3HZKB 1OW0A 1FSKB 4Y19A 4EIGB 1RIVH 3U0PB 3HC3L 2CMRL 3CFEA 1T2QL 1X6NA 4MAYA 2OR9L 3C09B 3NABL 4LOUD 4WW1B 5A1AA 5T33L 3OZ9H 2W0LA 4NOFA 4NJAL 4LEXH 2IH1B 4ISVA 5F1KC 2ED7A 4PUBH 1MCRA 2DKMA 3MRJB 5E4IA 2YC1B 5BMFL 1YUHB 2VMFA 2ZKHH 4ZOEA 4NC2B 3PGFL 1T5WB 3KPRA 3MRKA 3E2HC 3T65A 1ND0A 3BUTA 4IRSB 3VFPA 1YJDC 3R06A 4FXLA 1U58A 1FPTL 2ORBH 5KOMC 2EC9T 3K8KA 2J1KA 4U3HA 3LS4L 1RZJH 4MNGB 1SMOA 1Q9OA 3EJZC 2FIRT 5D2LB 3GI9H 3CX2A 2V2TA 3IRPX 3MJ9H 3PGFH 4E9LA 1RK1B 4Z8FL 5DGRA 5CJQH 1UZ8A 2G5BA 4YQXH 1B4RA 4JFFA 2IANA 2D0FA 4HK3N 4FQCH 4MD4B 5JHDB 5FF6A 1S9WB 3ARFA 2EEDA 4ZUUB 2BDNL 4TRPH 1H8SA 3MLXL 4JFFD 2M26A 3VU2A 2R69L 1ZA6A 3QDAA 1TXKA 5J9PB 3IDIA 4GBXD 4I0PC 4JFYA 5IBUB 1HNFA 1A4JA 4GRLA 5KW9L 2DRUA 2VDQL 4GAYB 4TTDD 4YK4C 4G9DB 4ZFFA 4ODHH 3KPLB 3DECA 1YPZB 1CFTA 5AZEH 5DURB 4XRCB 1CG9B 3ALXA 5IM7A 3PWLA 1WFNA 4GS7C 4KTDH 1UJ3C 4LSSH 4NM4H 5HHOD 3T2NH 1ZEAL 3D3VB 1FAIH 5T1LB 3F65A 4XAKE 3W0WA 4ELKA 5FO8B 2DKSA 3VDAA 1R5VB 3G5VA 5DK2A 5JZ7D 5M7QA 1DANU 4PJDB 4AIZA 4Y16C 1PQZA 4NQCA 4NRXB 1LEIB 3GFUA 2VNCA 4OUUB 4M1GH 3P4OA 5J6HA 4ZUWB 5ADOH 3P4OB 3HI6L 2X4SA 3ZT5A 3GI8H 2J6EL 3ILQD 3R1GH 4M48L 3DGGA 1J0ZA 4KJQC 3O4LE 3SJVA 3QNYB 1EEZB 2I9TA 2RB8A 3D39E 3VXTB 3G04B 4X98A 2AJYH 1J12A 3BXNB 4M6NL 3BDBA 2PF6A 4P9HC 4D0DA 3MRMB 2FECL 5D7KE 4UOW0 2YD2A 2W38A 3MRQB 3OKEB 5E6ZA 2FL5B 4LVEA 2B1HL 1QVOB 5GRVK 4DCQB 1S7UA 3OAZH 1J8KA 2VR9A 3WNOA 2PYEB 3NCEB 1ES0A 2DIJA 4I3GA 3WIHH 5I1DA 2E7LC 4L3EA 1UM6H 1ADQA 1ZT7B 2MHAB 3FCTA 4FFYL 4PG2C 3U1SL 4ZUSB 1DBKH 2R1XA 4QHMA 5EU5A 1HHGB 4PJAB 2Z31B 4TSCH 4LBEA 4PJIA 4G42A 4PRDB 2X4OA 4R4NC 1FH5L 1QPXA 1IQDA 3W0WD 3RGVB 3R0MA 3VFPB 1A7RH 4FZEL 4LMQI 5HVHC 2A83A 2F5BH 2O61B 1MJ8L 2HRPH 1I9EA 5HVGB 1FCCA 4OFIA 4MNGA 3T0ED 3N0PB 4F7TA 2WMPA 3MXWL 4D9LH 5F7YC 3MUHL 3FO9B 1YMMB 4OZGF 1B0RB 1HH9B 3T04D 4PJ9A 1RV6X 4Y4HD 1H8OA 2BNRA 4WUUA 3VGDA 2CDFA 3MCKA 5DJXB 2NW2B 2XRAH 3T1WA 2Z8WC 2GY7B 4L4TA 25C8H 5ICYA 3ILQC 3NTCL 4F57H 5ICXB 2I9TB 5I1LB 3UAJC 3PQYB 5EULV 5F3HB 3QUKB 2UUDH 3AS2A 4EQ3A 4S2SB 3BIAX 5F8RC 3CGTA 4AY0A 4RRPG 3LQAL 1EO5A 1JTTA 1XGYH 3QUYC 2AKRA 4J2XA 1IGJB 4D8PA 3W11C 3SDXA 2F19L 5TFSH 3VH8A 1OWRM 2XWJB 5I16B 1OTUC 3ZDYF 3G6JB 5HGDA 1RJCA 3RDTA 3Q6FA 2NY7H 3IXAB 3DXAB 4MA8L 3HE7B 4OB5H 5F71A 4NQVB 4PJBE 1P9MC 5IM7B 5FYKE 4AIOA 4WV1C 3WUZA 1XFPA 4N5ED 5DT1H 3CFBA 5HYEA 3OPZL 2NLJB 4OD2A 3U7YH 4QWWD 2VAAB 1MY5A 4M9OA 5DJYB 4DGYL 3GUTA 1LO2H 3CD4A 1J1PL 5MENA 1TFHA 1D5XA 4QT5A 1RHFA 1HXMB 2A74B 4TQEL 5KS9B 1GHFH 3CSBA 1INEL 1JI1A 3BESR 5ESQA 5T1KA 1R5IA 2EE9A 3BMWA 4KK9C 4YWGL 1JPGB 2H2PC 2ADJB 5K93A 4FHBD 4RMSA 3HS0A 3IF1B 3ZE2F 3QO1B 3C8KA 4U1GB 4YNYB 2YZ1A 1FZOB 4P3DA 4ZG1A 5DJ6B 2G5BB 3V0WL 1WF5A 4YBQC 4ZUTB 3B5TA 3ZKQD 1KJVB 4Y5VC 1TPXC 3ZDZF 3G5XB 1Q9WA 5D7JB 1DE4B 1HSBA 5EWIH 5DUML 1JRHH 5EUOF 5TE4H 4HZAA 1AP2A 1IGYA 4EXPX 3IJSA 4XPAH 4YHLH 5FB8B 2BNRD 3WNMA 1QLFA 4PJ9D 1TPXB 5CJQL 4Z7WB 2OSLB 4MA8H 3TNMA 3TESA 3OB8A 3LOWA 1A1NB 4JR9H 4Y5VB 4K3EH 5HHVL 3RPIB 3O2WL 5KTEL 1A0QL 4HUVA 1AC6A 1WZ1L 2W65A 4XP9H 3NZHH 1FPTH 2ORBL 2BVYA 3DVIA 1KIPA 3QDJB 5I73B 1QZ1A 4YHZL 5KOVC 3MV7D 4ZODA 4N0FA 3SKOB 1FL3A 2XN9E 4RFOH 5JZ7C 5JPNB 5L2KD 2EYSB 1FL3B 4HFUL 1D5IL 2DD8L 3BO8A 2OXHA 4HUNB 4ODSL 4ERSH 1JYXA 1H3VA 3Q2CA 5C0EB 2YN5A 2QQLH 5MENE 1DBBH 3UTOA 3GSOA 5E94A 5B38B 4IOFC 4XNYL 5HD8D 3V8CA 1HYSC 2NX5B 4F7TB 2HVKB 4ZFGH 2CRYA 3TBVB 2WBJD 2BSRB 3QQNA 4PJCB 5TGBA 4PJBB 1S78D 1C12A 3NIGF 5DGQA 1IGCH 3IJSB 1LO3H 1T3FB 2X9YA 2HT3D 1J05B 3NVQA 2P49B 2OI9C 4WWKD 2VRAA 1S7SB 1QSZA 2ZWLT 1JTOA 1WICA 5DS8A 1YC8A 2NR6C 4JFEB 2XXMB 2FBOJ 3IKCA 5IMKB 3BH9B 3OKNB 3RWJB 4HIIB 1VFBB 4HJGB 4MHHI 4LSQL 2YWZA 2OI9B 4XPBL 1RURL 5HYJD 4X5LA 3JUZA 3U1SH 2E7HA 3PJSB 3TN0D 3PHQA 4HKXA 3PQYE 1XGRA 1BWWA 5MERA 4IDJL 4HIEB 1CS6A 1MCKA 1DSFH 4S11A 4BFEA 3K46A 5EC2A 1URLA 1E0OB 4C56D 3OHXB 4POZD 1BOGA 4ZPVA 3BH8B 4YEFA 3BH9A 4WUUE 1T04A 1WBXA 4Z7VA 3S98A 2NXYB 3WLBB 4PRHA 3ARGA 2FJGB 3G6JE 1T0MB 2LAAA 1GYAA 4JM4L 2YBRA 1PW3A 3VFRA 3VFWA 3LKQA 2NYYD 1U8JB 1X5FA 5I73C 1YEJL 1ZVHA 3O3DB 3KJ4C 2AJ3B 4XX1G 3PGCA 3JTSB 3C5JB 2NY6D 1FRGL 4UMGA 5TE6L 5JDJA 4J6RH 5DVOA 4W68A 1U3HA 3J7HA 3S97C 4DZ8B 4FQ1L 4M1CD 4JPWH 4NWUL 5IV2B 4W4OC 3IAQA 2N7AA 4WHDA 2FD6H 1I1AD 2F15A 1KT2B 1MFDL 3HMWH 3LN9A 3RA7H 5J56B 1JYVA 4QCIA 4OLUH 5FV2A 4P9HH 4Y2DA 4MB3A 1Z0NA 1MAML 2ZJSH 1ED3B 2V7HA 4NZUH 2VLLB 1A4JB 4GQPH 3WDIA 2HYMA 3OG6B 1QLEL 2W9DH 1YY8B 4ODUA 1JUFB 4MXQD 3VXMB 4HXAL 1S7TA 1K6QL 3O6MH 5SWQA 2DLTA 2ICWI 1YN6A 2PTUA 5F3BB 4XP4L 4CVWA 1CDJA 4Q9BA 4YC2B 5DURD 4Q9QL 3KJ6H 4NCC1 4YDIL 3P73B 3UTTE 2N56A 1RJZA 5EUKB 3BKJL 4PRHD 2FJHA 3STLA 3IU4H 2YPLD 1CFVH 2JB5L 4HS3B 3MCLH 3TO4A 4PJGE 2WWKO 2EH7L 5DK0B 3WFEH 1A5FL 4PGZA 3UP1A 5GGSA 3BPOB 3ARPA 1OGTB 3MODH 1NFDE 3VGHA 5ALBH 1CTNA 4YXKH 4NNXB 2P5EE 4WDIA 2NY0D 4NQCE 5EOCH 3GSNH 5IROA 3H7BB 3D3VE 3K1DA 3QH3A 4PJAA 5F7WC 5DO2C 4OF0A 4J6RL 3C8KB 2FWOA 4PJDE 4FTVE 4Z8FH 3ARBD 3K8LA 5C07B 3MRKB 1E6OH 1V7ML 1QFWL 3DHMA 1I8MB 1LP9F 1WT5A 3MRIA 3CIQA 1JPGA 5FGSA 2XTLA 4H26A 1E4XI 4Y4KA 3DMMD 1KTRL 1YY8A 3TJHD 5CCKH 3DPBA 4G6ML 4P2YA 4O00A 1H5BA 5F96L 2FL5A 5EIIB 4R2GC 1XIWD 2R2EB 3FOMA 3RIFF 4LCUB 3IFLL 3DMMA 4GQ9L 5EU3A 1EAPB 3MV7E 4J3WA 5EUOE 5DJAA 2AK4A 2VLKD 4NN6C 4M5YL 1MY7A 1HQRA 3HLAB 5IMMB 3MRPA 1XIWA 1GZQA 1ADQL 1OGAE 5FM4A 3JV4B 2B2XH 1GAFH 5L8JB 4MNHA 1I1CA 1FO0B 3N1QC 1TJHL 2B8OT 4LARH 2XV6B 5M94B 5D4QA 3DRQB 4QOKE 2V6HA 4N1CA 5IBUG 1U3HC 1IGTB 4PRID 5GGVY 2AEQL 5BVPL 2D31A 2Y6SD 1MQKL 4PD4K 5FYJH 1AE6H 1VA9A 3GB7B 4HGKC 3GJEB 4X6EB 5TQ2H 2YD7A 3CFCL 4NGHL 4LU5H 1NCBL 5E2VH 2PXYA 4YDJB 2HLFC 1BF2A 1LO3L 1I8IA 4OZFB 4JRYA 3QZWG 1G7MA 5L2JB 3MUJA 3I6KB 2NW2A 3A67H 3OKMA 4LSRH 4JZNA 3TV3H 2B2XL 4YHOH 2FATL 4M62H 2HLAA 3EOBA 2GJZA 3MMEB 1WEJL 3MLRH 4HUXB 2P5WD 4F15C 4PGEB 1CF8H 4QNPE 2GSGA 4HUUB 1IC4L 3OSKA 3HAEH 3IFLH 3LKPA 3NN8B 4I3SH 1CVSC 1YYML 3C09C 5GRXG 4JO3H 2EXWC 3FQUB 3PG2A 4PY7A 1CVRA 3UO1H 4HMEA 5HHOB 1A6ZB 3EO9H 4HKBB 1QSFA 3RGVA 4KKCC 3NZHL 4PFEA 3VXRD 1J1XL 5BOPA 4CN1A 4G42B 4PRDA 4TSBL 2BCKB 5C07D 3VE0B 2HN7A 3ZTJH 3QUXD 4JO2L 3DROB 1WBYB 3MNWB 4P3WA 4QHMB 2DMKA 5JMOC 5IEHB 3ABZA 4OCXH 4JN2B 4XNZC 3D9AH 2Y25A 1VACB 4XPAL 1JPTL 5D7IB 2BNQA 4XXCA 5J6GB 3V0VA 4UTBH 3KWWB 1QFWM 1QHOA 1YEHL 1GGIL 5K33A 4A2LA 2NXZC 1YEFH 3MR9A 4LVNB 1T03H 2JE8A 2RQ8A 4CW1A 1JWMB 4UV4H 2F53D 4Y16B 4GKSA 3QAZB 4XPBH 3OAYK 3G08A 3PF2A 3CVHB 3QG6A 5E4EB 3QNXB 3UAJD 4P57A 4ZAKD 4XWOC 4CMHB 4QY8A 4Q9QH 4ONFH 3SE3A 4PYHA 2YMXL 4GMSL 4Z78A 2ADFH 1BM3H 4XVTH 1DN0B 4HXAH 2PR4L 1NLBH 3TJEH 4DGIH 4KK8C 4LRNH 3SDDB 4C56B 4IEFB 1ZHLA 4U6HA 3SGJC 1KIUA 1IGYB 1AP2B 2BHYA 4UUJB 2YK1H 5T3XD 3OJDB 5GISL 3AMLA 4KKBC 2RJMA 5D7JC 5T5FL 1EMTH 3RI5K 3W0WB 3DV6A 4ELKB 4P4KC 5ETUA 5GS3A 4NFCA 5HHNA 4P46C 3LKRA 3ZE1E 1KB9J 1U6AL 1R3LB 4JRYD 5EBMA 5KS9F 2KQNA 3C5ZB 1OAQL 2KZWA 3LKQB 1U8PA 2XZCL 5GSVB 4WWID 3JWDC 3D85B 4OFYD 3RUGE 3O9WA 1A7NH 4IOFD 4KRLB 1MIML 3DX8B 2IMMA 2I9LB 5I8KH 4Z7VB 5FCUH 4EOWH 5E1AA 3UZQA 3X3FL 5DHYA 4JHZA 6FABH 3QO0A 1MNUL 4LSTL 2GFBB 1KYOK 4UT7H 2MPAL 32C2B 3QUZB 3HRZB 4JM4H 2JCCF 3QIUD 2EYTA 4MA1C 4PRPD 2H1PH 5L7XH 3VFOB 2APVA 3ZDXF 4IJ3C 4U33A 2RHEA 3O41A 3WKML 2R2HA 3MLSH 5IK3B 4LDOB 1OP3H 2AQ3A 1S7RA 2EYRA 3K1KC 2K7PA 4M6OL 1ETZA 1VHPA 4CU7A 1FNFA 3SY0A 2P5ED 2AEWA 2YPVL 3HZMB 4FABL 4PJ8C 3E8UL 3AB0B 4P23C 1CZ8L 3HFMH 3RVWD 1Z2KA 1BD2E 4WGVB 2V2WB 3CMOL 2IGFH 4IIQB 1HQ4B 5DMKB 3DV4A 3CFKA 3LKOA 4H20L 1K4DB 3HNTL 2C7UA 4MA3B 1FORH 5H94B 4IOIA 1N0LA 1G7QA 1JNLH 1NGPH 1IBGL 2BP3A 3RDTC 4UINL 5BVJB 4R7NB 4HF5L 1ZHNB 3GSQB 1IMHC 3E6FA 5ID0B 4YBQD 43C9A 1DN2A 1ERNA 3H3PL 1IAMA 5GS0C 1QSEA 4LSUL 4MDJB 5HI5D 1T83A 4YUEH 3WIHL 5FFLA 1CICA 3FO9A 5EO9B 3HZKA 2XTJC 1AJ7H 2BY0A 2WIIA 4B5EA 5LGJA 4WFGE 2HT4D 3QNZB 4JDVA 3OKDA 2O5YH 4N5EC 2OYPA 4PJ9C 3SCMD 5DJ8B 4NHCL 1HI6B 5FUZL 4DN4H 4U1SB 3BRDA 4CADB 1QLFB 5L0QC 5JQ6H 4MB4A 3GSVA 4KHXH 5IJVB 5BZDB 1K4DA 2IFGA 1TQBB 1MJUH 4PJ7F 4D9RE 3GSWB 2VERN 2XTJB 5CP7B 3ARRA 5JO5A 3BUYA 3QRGH 5DRWA 3KPOB 2BNUB 3W5MA 3OJMB 2V2WA 4DEPB 4J23A 1YMMD 1TZHA 1KULA 3LRHA 3VG9B 1TVBB 2H2PD 4J8RA 1GOGA 4MX7A 4PJXA 3GI8L 4KMTH 1NBVL 3C2SA 3FRPA 1F3DH 5GS1A 4K7FA 4PJFA 5HGHB 4P2RA 5HHPA 1AO7E 3DO3A 1KN4L 3WJLA 1GOHA 4PV8B 4K71B 4WTWA 4KJPD 1BFTA 3ARFD 4ZTOL 1WTLA 4NPYB 5IJKA 4WI6A 2J2ZA 2EYTB 4P2RD 1YC7A 2IFFH 1OPGL 4DZBB 5F1IA 3TJEL 4UQ2A 4DGIL 1NLDL 4H88H 3FQRA 3RWIB 2YD5A 4NFDA 3S37H 4EEEA 2HT3C 4ODXA 1GZPB 3RZCD 5DJYA 3DURB 3NZ8B 3ZHKA 1MCQA 2I9LA 2IPUG 2N1KA 2F5BL 4I2XA 1P84J 4S10A 1Q38A 4M93B 1NLDH 2YPLB 4JPKH 1K5NB 4Q9RL 4MGXA 5DVMA 4Q7DA 4FQQA 3RZCA 3SCMA 3HI1A 5BXFA 5I1CH 2Z8SA 4LCIH 5T1MA 4KRPC 1LO0H 3WJJA 1G6RL 3GSNA 4ZTOH 4AT6B 5DQDH 1A6VH 3S7GA 2BDNH 4TRPL 3F7VA 1SYVB 5I15H 4GG6F 2NTFA 8CGTA 1IKNA 2DQCL 5CSZA 1OP9A 3T3PE 5DQJA 3HR5B 3SDXB 4JFED 1K4CA 3NACH 4OTXH 2QTEA 4U6HB 5GJTL 5MEOA 1NEZA 5C9JB 1N0XH 4PRNA 4WCYH 1MH5B 1LNUA 1F97A 1UJ3A 5I71B 1NCCH 3QUKA 4JANA 1CCZA 3KS0J 1QR1A 1L9NA 4X8JA 4ZOBA 4M6NH 2UV3A 3C6SB 4U49A 1N8ZB 5D5MF 3IDIB 1WSST 5C0NC 3ARWA 2VITA 3JV0A 4WO4D 5ID1B 3L95B 4CW1B 3PGDA 4XTRD 5E95B 2QSVA 2A6DB 2VLKB 4I0PA 3PIQA 4HPYL 5HYJE 5DEGA 1UWEL 4YXHH 1S5IL 4LPCA 4OI9A 4MLIA 1BD2A 5C0CE 3TPUA 2XZAH 3GSRB 3MNVB 5FYLL 5D6DA 5T3XL 5BZWA 1D6VH 1RZ8A 1YNTB 5HYFA 3IAPA 5E2TL 4PLOB 1T2QH 3H0TA 1EBAA 3FB6B 1T7YA 3QIWC 4LSSL 4MJIB 3V5HA 4NO5B 3DSFH 3PUCA 1V8HA 3EO1B 2EIZA 2X4OB 5I1EL 2BVQA 1F8TH 4MMZC 1FE8L 2AV7A 4OZIF 4IHOA 3UTSA 4P99A 4GRLD 1F4AA 1OQOA 1VERA 4LK4A 5IWLC 2ZG2A 1WAAF 2HRLA 4M5ZL 4XXDB 5IOPA 3MRHA 4U1JA 2UWEF 3RI5F 4OCYL 5CP3A 4M7LT 2NNAA 2XICA 5BO1H 1MHHB 1IEAA 3L1OL 5L8KB 3HI5L 1JN6B 1RZFL 2P5WB 2B1AH 3HC4L 4JAMB 1S7XA 3HE7C 1CDCA 3E3QE 5EU4A 4XAWH 1U95B 4QRTB 3WKNA 5DYOB 3VGFA 1QA9A 1A7OL 2D03H 1XGQB 2HG5B 3ILPA 2JK5A 5J0BA 3IJYB 4CGTA 4WI2A 4EN3C 1A64A 2MCPL 5CCKL 5IMLA 4N0YL 1T89A 4WY7H 4X80H 1RUAH 5KN5B 4X7TA 3EDKA 2WZPD 1R5VA 3G5VB 4JO3L 4XB8A 4M7ZC 3QEQB 1F2XK 1S8DB 2AJZB 2VXVL 3IYLW 1R3KB 4NQED 5MEQA 1AIFA 2HLFD 5E5MB 3R1GL 3BGMA 1Y6KR 1FBIL 4JDZB 3ES6A 2VLMD 3KPTA 4JRXD 2RIKA 4QHNB 3VXUB 4DEPC 5C0IA 4ZQKB 3DMMB 5JPMA 1NC2B 3X12B 4JRXA 3SE8H 4YIQB 3IDJB 1PG7X 5MP6H 1WCBB 3QEHB 4LRNL 5CIPH 3LY6A 5DJ2A 3EFDH 1KNOB 1QBMH 5KG9B 2XFXB 4ZFOA 5KSVA 5GPRA 4XVTL 3P9WB 5E9DE 4MJIE 2O5XL 2AJUL 1E28B 3ZLQC 3HG1E 4L4VA 2Q86B 1ZAGA 5BVPH 5C0FB 3TZVB 1AR2A 3OB0H 2ZSVB 2XG4A 5D93B 4X8JB 5B39A 4L8CA 2Y5TB 4PJHE 4TVPH 4XNUL 4FNLL 1G7LB 2PCPA 2YRZA 2IPKB 4Y4FA 1T7WA 2PO6C 3SCMC 5H35A 1NEZG 3UPAA 2CGRH 3MJ7A 3RHWK 2WANA 2PYFB 5GIRA 2FSEB 5F9OL 4Y4HC 3R06B 2F54E 2VLJE 2OK0L 1SYSB 1JPFA 3B9KA 3V79C 1W0VA 3QHFH 3V52L 1T5WA 1UXWB 4R90H 4WEBL 5MHSD 1J0HA 4JQIH 5JHLH 2L7UA 4G6MH 3RTQA 3EYSH 5IB4B 2DM4A 5ICZA 1WLHA 1HEZB 3GSXA 5FA3A 5IT2H 1IARB 4NO2A 4QHKJ 3PXHA 3TO2A 3EDJA 4HSQA 4EVNB 4OFKA 1JJUA 1AGCB 2XPGA 5FYJD 4CJ0A 1GZPA 1GC1C 3FTGA 3MYJA 2B5IB 4U0RB 1W0YT 5DJDB 2HTLC 1JMZA 1X6LA 43CAB 2EH8L 2EIBA 3DRTA 2NY0B 1TVHA 3QXAA 5JLZB 5ALBL 3TBTB 3M17A 4GW4A 2YPKA 5C0RL 4NQEB 2OR9H 3OXSB 4TVPL 4XHQA 4L9DA 5DFTA 2OTWA 3ARBB 3UZEA 5FK9A 3N1GC 2AK4E 3O6FB 3J8F7 3NCJL 4I3RH 4NC1E 4PBVC 4R0LC 2R0ZL 4P4KB 1CFBA 3CFCH 4GRWF 4P5MB 1H3UA 5CAYB 3NGBB 2BNUA 4P59H 4BH7B 5EN2A 1JFQH 1G9ML 1IT9L 4G7VL 3DOSA 4P46B 4E42A 3FB7A 4NSKA 3OR7A 5CINL 4HWUA 1S5HA 4LLUB 3RWDA 3I2CL 1B4JL 1RD6A 4KKCD 5TF0A 1I9JH 3RL2B 1U8QA 4E5XB 3QCVL 4R96B 1JZ3A 2F8VA 3OKDB 1IC5H 1F11B 2IANE 3L3KB 3VG9C 1PYWB 2VL5B 1HHJB 1OAYL 3VMOA 5A2IH 1IAKB 3KYAA 3FAWA 4JFFE 1NCWH 2WW8A 4KQ4H 5C6WH 1A14L 4NHUB 4I77H 1MUJB 5J4MA 5IW6B 1PFCA 4ZNCD 3DBXB 5C2BL 4Y88A 2IALA 4FQJH 2P8MB 3M8OH 3RJDA 2H32H 3GM0A 1WZMA 4LLWB 1PSKL 1RUAL 1LEKB 1FZMB 1S7SA 4M7JL 3KPMB 3QPXH 3QPQD 1CDGA 2XI9A 3S8WA 3BP6A 5SWSE 3BKYH 3BGFC 3HKFA 1MPAH 4OGXH 4GLRH 3B83A 4P23A 3UJIH 3PP4H 5B38G 3F5WB 1P7KB 4NO0B 2B4CL 4QTHB 5C09A 3VH8G 3L5XH 4PGDA 1IAII 4RMQA 2FLRT 5KVEL 2E6JA 1F00I 4KUCF 4C54A 1LDSA 3U9PH 4FG6D 4ZOAA 3ULVE 4OT1L 2D0HA 1UH3A 5F1NA 2MSPA 4CDGC 1E6JH 5HYJA 1A5FH 1LD9A 1PGRB 1NDGA 1G6RH 4GKOA 2W59A 3GMLA 2P24B 1T20A 2ADIA 3BIBX 3MLUH 2ZUVA 2QQKL 3MRLB 4XH2A 4BK4A 1CR9H 1S7QA 3D39D 3OAUL 2QSCH 1I8LC 5D2NC 5IBLD 5KSUB 1ZS8A 4F7PB 1Q0YH 5CIPB 3LKSB 1FNGA 3WHE1 1JGVH 3S37L 3TNMB 1GCFA 1UXSB 4HXBL 5DSCA 1KJMA 3CNKA 4POUB 3JWNC 4AEHH 5HYIA 2ZCHH 3CCHA 4P46A 1NGXA 3MCG1 5AD0A 2PKDA 3WEXB 1KEGL 1Q9WB 5D7JA 5E2TH 1QQDB 2L0DA 1X5KA 5FO7A 3P11H 3BPNC 4NN7C 4LPTA 4QOKB 5FOBB 4RFEB 4U0RC 1RSFA 1CDHA 4V1DB 1NANH 1TENA 5HI4D 3QXDA 4QEGA 3BWUC 1HWGB 2ADGB 4Q0XL 5CILL 1RZIB 1BGXL 2BXYA 2CIIA 4TYUA 4ODSH 3DV6B 4OQ1A 3ZYZA 1NBYA 5M95B 3RFZC 3C5SB 1TJIL 4L8BB 4O4YL 4OF7A 2DICA 4I2XE 4UUJA 4F37F 3C60B 1FAKT 3QPQC 2ZNWA 2ZOKA 3IFPB 4X9IA 2XZZA 4FZ8L 1C1EH 5K9KB 1UQSB 4B7IA 1NSNH 5L2KA 5GQBA 2WSKA 3REWA 1HHKB 3UEZA 5JW4R 2J4WL 1HOCB 1FIEA 3A6CH 1KPRA 5BW7C 5BRZD 3EHBD 4XT1C 1XR8A 1S7QB 1BF8A 1S7VB 3RVXC 4XZUA 4F57L 2HFGH 1YEEH 4UIKL 1A6AA 3FN0H 1Y0LA 4KUCD 1FC1A 5IVZB 2BOBA 5JA9A 7CGTA 4DGVL 5E8NA 5MI0B 4OZGB 3KYNB 4AM0B 2BNQB 2C5DC 1J87A 1JHTA 4XWOD 3V4PH 5DD1H 1AXTH 5T3ZH 1C7TA 1KB5A 5I18L 3GHEH 4JY4A 5IESL 5J11C 1A3LL 1I1AB 2OCFD 3EYVA 4KJQD 3WL9B 2XN9A 4R4FH 3DUSB 3VJ6A 3L5IA 3FB8A 5KSAA 2R56H 1ZWIB 2FIKB 2X09A 1IEBA 4JEGB 3ECBA 3V4UH 3PL6D 4O2EB 1P53A 2D7TL 5J12C 2DF3A 5CKAA 1LGVA 1MLBB 4ZFZA 5D71H 3VRIB 1N59A 4DGYH 2MQ0A 4NRZA 3TFKC 3QRFM 1T0NB 4BSWA 2NXZD 5D70L 1XZ0A 5FYKD 4KVNH 4PJ5A 3WBDA 4OZFH 4ELME 3IVKB 4DK3A 1A4KB 2FYYB 1DL7L 4WWKB 1N5AB 2ICCA 2JCCB 4UIMB 3MGOA 1K8DB 3OKMB 2DLHA 3ZDYE 1F4WH 1QKZH 4U6YB 2W07A 3QEUB 1JRHI 2GSIA 5C0IB 1YPZE 1WWBX 4EDWL 2OR8A 3TCXA 4KJPC 4DQOH 4OAWA 1IQDB 3F7PC 2GK0A 1LE5B 3QEQD 5LCVL 5E5MA 3O2WH 3T0AA 2F74A 3BP4A 3MACH 5KTEH 5DJ0B 3AREB 2AJZA 3QIUC 3Q1SH 1X4ZA 3MBED 2ZCLL 1RULH 5GGVH 3FQWA 5HGGS 1JGEA 4CU6A 5A2FA 5GJTH 4HS8L 1JRHL 3FFCA 5HGAA 3SPVB 3C87A 4M61A 1Q72H 3UTQA 4NYLA 1FYTA 3BHBA 1B0WA 2VDPH 1BJMA 1EMTL 1U3ZA 3WHXA 3DX7B 1MVUB 3X14B 1CI5A 2FJFB 4OUOA 4Y4KC 35C8H 2Y9RT 4LVNC 1A6TA 4I0KA 1AFVL 5LQBH 1J0JA 3G04A 1WT5C 4LF3A 5GSRA 5TPWH 4BFGA 5DJCA 2R2EA 2XPGB 1E4KC 1OP3K 5KSAC 5KSBA 3ETBF 4WHTA 3D69B 1ACYL 2G60L 3N9GL 4NUGL 3REWB 1DBAH 4CVXB 4CJ1A 4WRLA 3KLAA 3V6ZA 3VG0L 4F2MB 1CD0A 1C16A 4BJLA 2C3HA 1ZK9A 3RGVD 1U92A 1I3GH 1D5ZB 4NN6B 1CD1B 4XBEL 1FGNH 3UYRL 4IHOB 3UTSB 2Z91A 1N3NA 4UU9B 1DBKL 4G80A 5EO0A 1EBPA 3ROLB 2ZCKH 5FM5O 1G7JB 4RGNE 4HC1L 1BEYH 4HAGA 4XI5D 1A6PA 1KTLA 5B22A 1R24B 5DF0A 2KQMA 3MJ9L 2BOCB 3FMGH 5DK0A 1AC0A 2VQ1A 2UVFA 4HWBH 5J13B 5AG9A 2CR3A 4TSAL 3L3DA 4Z7OE 1UWGH 3U6RB 4ONHB 1EEUA 4PJGB 4WHYH 3VD7A 5DRXB 5JW3L 3QIUA 4OSUH 3T0WA 1MIMH 3DHJA 5DRXA 4NZTL 2XFXA 5KSVB 2I24N 2A6JB 4HIJB 5JHDA 2F5AL 1A14H 2E9IA 2CR6A 4XH2B 3FT3B 2ESVD 2BNQE 3EYUH 1JIBA 5D9SB 4JANB 4X6CA 5JW5B 1ZWIA 3RNQB 4PG9B 4APQA 1DVFD 4JFHD 4FS0A 1MH5A 4QO1A 2MQ3A 2HVJA 3DX9A 3OKOB 1G7JA 3RL1A 2ZCHL 4JGJA 5CINH 1WFTA 1FJ1B 4GT7A 5C0BE 1ZHKA 4NKOB 3O45B 3VFTB 3ZL4L 1M7XA 3F7VB 5DLMH 5DTFA 3U4EA 3OGCB 4TUOA 3MUGB 4KDVA 1J7VR 4GKNA 3DIFB 2EDDA 4CU8A 1WIUA 4JQXC 1T22A 3GHEL 4HD9A 5DJZB 3SEPA 2W0FA 1K5NA 3TGXA 3SO3C 3FJTA 3QDMD 1T0MA 5K9OB 3KXFE 5C70A 5E08L 5FYKU 1P6AB 2IF7A 4XPHL 4IMKC 3WS6A 3B3IA 3FT4B 2YPLE 1QA9B 3TP4A 1SBSH 2GJ6D 3REVA 2ZG1A 4YHIA 4F15B 2WNGA 1ZGLP 4JFZH 3CDGB 3GMMA 1JZ8A 3C2AL 2ZUTA 3S36H 1IAKA 2FJFA 4YQXL 4F33B 1BFVL 2W91A 3VRJA 3VFSA 1Q8MA 1IGMH 3QXUA 4HEME 1FNEB 3BWAB 2CDEB 1DZBA 4WTZA 4KC3B 5HGAB 1FO0H 3NH7L 3HG1D 1R3JB 2EDHA 3OKNA 2X4RA 4LRIC 1NFKA 3V4VH 3TFKD 1J8HE 3B6SA 2CUHA 5I8KL 3M8OL 3MRFB 5IGXH 3T0BA 4ODVL 5SX5K 4CAGA 2UUDK 4I3SL 3S34L 2BNQD 3ULUC 4DW2L 2A73B 4F7CA 4F7MB 1DLFH 5C08D 4UDUB 2HTLD 4YJZL 4M1GL 2PW1A 4MS8D 1EHXA 1NMBH 1DANT 5J3HD 1H3TA 2FX9H 4LCYB 1LILA 2AXJA 5TH2B 3GMNA 2E6PA 5CFHA 3ZDZE 4FNLH 2EH7H 3VRJB 5GISH 5AWNH 5D1QD 1MI5B 3LH2L 3I2CH 3CDGA 3GMMB 2ERJC 4AEHL 2DJSA 2VDNH 3IVKA 1Q9KA 2D4FA 5D8JL 2CKBH 1PG7L 5EOQH 3TYGH 1X5XA 1P4LB 3HR6A 2BSTA 5ANMA 1EGJL 1M05B 1KIRB 4TVSa 4K3HA 1UM4L 4GAJL 4LHJB 1OM3L 2PTTA 3L5WA 3BDXA 5ILTH 3V95A 3VD3A 5CMAA 4GO6B 3G5YB 2FHBA 2IG2H 3SQOH 3IJHA 4Z7NE 4L1HA 4L29A 5KVMC 3MZGB 4QTHA 5C09B 4Y5VA 5I19H 3NCFB 4R7NA 1GAFL 4OGZA 5E8DL 5GGRY 1T1YA 3O45A 3IFNH 4L8SB 5FKAB 3T0XA 2R1YA 3MRNB 1MFNA 4H0HB 1C5CH 5IQ7L 1ZSDB 2PNDA 5JXED 1UJTA 2HTKC 4NNYB 2H26A 2VXSH 1S7WB 2DQGH 2P5WE 2P8MA 2DQEL 4PIRF 3RNQA 4QRSB 2JELL 4Y19E 3F58H 1MFAL 12E8H 1EJOL 3VXNA 3OKLB 3FT3A 5FOJA 2DWDA 4PJ7A 2GKIA 3MNZB 1MRCH 3QPXL 3EO9L 1UACL 3BPLB 3RIAF 3O3BA 5A40E 1OLLA 4Z7WF 3RX5A 2NYYC 2EZ0D 1KIRA 2JELH 4OLXH 4WEBH 3TBWA 1KYOJ 4XCNB 4YPJA 1ZVSA 1Q1JH 1HDMB 2QLVB 3KLSA 1Q9KB 1CTOA 1P9MA 5IQ7H 2AS5M 1HXMA 2A74A 4HCRA 3L3DB 4M4PA 4U1HA 2BC4B 2X44D 1JHKL 5SV3A 2Y36H 3GUTB 4TNWK 3EYQC 3BQUA 4RX4D 4DUWA 5F6IB 1LHZA 4HQQH 1D5MB 4HH8A 4W70A 2AQ2A 1QPPA 2GK2A 1RIVL 3MX0A 4PD4J 1DQTA 5DC4B 4JDZA 2AW2A 4LSQH 3A6BH 3SDAB 2Q7YA 1UC6A 1I3UA 4MJID 4OZGE 4CVUA 4JREC 5IBLC 5E6YA 4K7PL 4NBZB 4O2FA 5EBWB 3BPOC 3JWOH 3VGAB 3AY4C 4Z7VF 2WUCH 3QDGB 3OXSA 3E1F1 2QSTA 1AD9B 1X4YA 4JFOA 1MI5E 1CFQB 2FH6A 1MQ8A 3TPKA 3GKWL 4NFBA 1V3JA 3BUYB 5DRWB 3FRUB 4KXZH 5TDNB 3UXFA 1YEKH 2PYEE 2X42A 2FNBA 1Q94B 2DTSA 5GGQL 3SKNA 3LH2H 5GZOD 4QRRA 1FNEA 2DIBA 2NXZB 2EXYC 2VXUL 3LEXB 3RIFK 1RUKL 4F33A 3ARYA 4QY8B 5FYLH 3WFDL 4TVPE 4UV7L 1OD9A 5LGHL 5ICYB 2QADC 3VXME 2J12B 2R8SH 1P7QD 1DLFL 1I1YA 1S7XB 3TBSA 3WFCH 3O6FD 4HPYH 4WTZG 5I8OL 2M2DA 5BV7L 2BJML 1HKLH 4M3JA 1U3YA 4OM0L 3V4VL 2Q76B 4LLMB 1ZSDA 4BQCA 2VXQH 4FQ2L 4JRWA 5I30H 5CGMA 1A0QH 1WV7T 2OJZL 2OZ4L 3RWEB 1NCCL 2UZXB 3SJVD 1QFWH 3INUH 5HYSB 1X9QA 1I3RB 1A7OH 3EJYD 1NAML 5CS7A 3VGEA 4KH2A 1AHWC 4PPTA 3PWPE 3SKUD 5D9SA 1RZGB 1U0QA 4HC1H 3OXRB 5EOCL 4TULL 1FZMA 2FZ3A 4N8VG 3GJFA 2ZPKH 2R1XB 5LWYH 1QFHA 4G7YL 2VUYA 2BRRH 3CXHJ 1RU9H 5JW5A 1WCQA 5F88B 3LKPB 1VFOA 3T4YB 2XA8L 3ARDA 4JM2F 1ES0B 2FYYA 4ORGB 3H3KA 3P9MA 1NBQA 1PDKA 2VSDA 3AAZB 3MROA 1IKFH 4PTTB 2DWEB 2WAHA 1K2DB 4S1RL 3EDDA 4LHQB 1PYWA 4MZ3A 1DBJH 4HWNA 4R26L 3ZT7A 3ZL4H 3GJFB 3LN5B 5DUPL 4HKZA 4Z0XA 2R1WA 3OR7B 5LBSH 1C08B 3JV5A 3UTSD 1KELL 2M1KA 4RGMB 5D6CB 3VFUB 4QHUA 2X10A 3EOYG 4MAYD 3HPLB 3BYYA 3U46A 4AL8H 1AD0B 1HXYA 3U30C 5GGRA 5IB3B 2OMNA 4G6KL 2F5AH 1S5IH 2QADD 3S35H 3QWOB 5EO1B 1MIEH 5ECJE 4NT6B 3V7MA 2VXVH 1J0KA 4YLQT 1BZ7B 3GSNB 1QYGH 5IEKB 2YOCA 3VD5A 3DSNA 4ZD3H 1A3RL 4P23D 2QKIA 2GIYA 4JB9H 1G0YR 2WBJB 1L6XA 4WUKH 3TYFA 3ET9F 1EAPA 2DQFB 4P2OA 4JFQB 1MHHA 1AGDB 3CC5B 5I1AB 3EOAA 4NZRL 1AGDA 3CC5A 1OAUL 5C0CD 3ROOA 3KDMB 2IPTL 4JKPL 5FECB 1QP1A 1DL7H 5K9KA 4G8GA 4XCYB 1HEZA 5E0QA 2MTPA 1JGUH 1Q9LA 2DQIL 3JTTA 1PBYA 3BD3A 1TZGL 2DBLL 5DHVB 1C5DB 1IKNC 4ZUVB 1CXHA 5IVXF 1QO3A 4FQPA 3IFOA 5D70H 3BHBB 1F6AA 1H3PH 3MOAH 5INCA 2IAMC 4NT6A 1VFUA 1WISA 5H37H 3SPVA 5DD3H 3ZKXC 4JVWA 4WFEE 5E99L 1I3GL 2Z93B 1P2CA 5K59F 1DFBL 3HE7D 3MLYL 2R2CA 1KPUB 5H37G 5IBTL 1OSZB 2Z8RA 2NY3C 3CAFA 3ARDC 3R8QA 3TO4D 5I1IH 2X5PA 3QEUA 1A9BB 3WFHA 3W39B 5FDWB 1CL7H 4UBDC 4L8CB 4WWKA 1BX2B 2VISB 4L8DA 2BC4A 4YAQB 4ZS7L 4ZTPH 5INDA 1AR1D 4C59B 5DVNA 5IB2B 3STBA 4L4VD 1IGCL 1RUPH 5KVFL 5J1TC 5CD3B 2XA8H 4I0PB 2IAMA 3QUML 4MAYC 4N1HB 4KZDH 4UIMA 4U1IB 3IDNB 3U7YL 5CZXC 2AAVA 4OLZH 1KCRH 3EOTH 4PTTA 5DMIL 4LPUA 4TULH 1BREA 4N9GA 3NCYP 1DQML 2YA1A 4JHWH 3GMLB 4GKZB 4MDJA 4PGBB 1HSAA 1MRDH 1I8KB 3P4LA 2WUBL 5D6DC 3FB8B 4OCRL 4P2OC 3VXSD 2Y4SA 2OR7A 4F58H 1KT2A 3OWEA 4X5WA 4WUKL 1CBVH 5IHLB 3G6JF 4LSTH 1AXSB 2WP3O 4LQFL 1R3KA 5MEQB 4OCRH 4O51A 3UCRA 3C5JA 2BJMH 4L5FH 4JR9L 2LVEA 1MRDL 2O5YL 5FGCB 5BV7C 1O0VA 1ZLUH 4LCCC 3S35L 5CILH 3HI1B 4L3EE 1RJYB 4P0DA 4HUWA 4QXTB 2YBRB 2BSSB 4CMMA 2W9LA 3KPQB 1PLGL 1CXIA 1T83C 1R3IL 3ROOB 4JKKA 2ESVE 4R4ND 5E2WL 3IDYC 3WE6A 2APBA 5L2KB 2GEEA 4XC3H 1QEWA 4DZBA 2XQYK 4UILH 3MFFB 4KV5F 2R2HB 5IK3A 4M43H 4QKXB 2X4TB 4G9FD 3MUZ1 1F11A 1MJ8H 1MVUA 1QNZH 2HRPL 2Y72A 4Z76B 1X4XA 3GIZL 2ICES 4UINH 5C0BA 2VDQH 3BQUC 3OX8B 3JWOL 4L4VE 2CLRA 1A3LH 4G43B 4RCAA 4O5LH 2UZYB 2Q8AH 4FG6C 4KDTC 3MLVH 3RNKA 1OPGH 1QFUL 1D6EA 3U46B 4X99A 4QOKA 2FEEI 4LEOA 5IW1A 3S96A 3U0WL 5LWYL 3SGKC 2MKWA 4L3CA 2V17L 3QUMB 1WFUA 2FCBA 4OT1H 4KY1L 4LLQA 2DBLH 4GAGL 3D25B 4MAUL 2LE9A 5JUEH 4K8RD 2ITDB 4WGWB 5FYLE 4QTIL 5DDHB 4V1DD 5IJKC 1KLGB 1NAMH 1OGTA 2A9NL 4WI9A 5AYUL 1U3HD 1X5ZA 4RDQF 2HT4C 2B1HH 3X13A 3TBVA 4L3AA 3MNVA 2KH2B 4J1UB 1ZHLB 4UT7L 2AJYL 1TQCB 4GUPB 1MFEL 4MSWA 3B2UD 3DYMA 4ZD3L 3PP3K 3DVGA 4NHCH 1NDGB 2B0SL 2NY2C 1QG3A 2YZ8A 4PREA 1MHCB 4PRIB 3NGBC 4ZFZB 3QQ3A 4XAKD 2X89A 1CWVA 1HIMH 4RFNB 5BRZE 5IB4A 4UOJA 5ID0A 4PLKC 4LEXL 3H9SB 1R5WB 2CIKA 2QSQA 1JWMA 2FX7H 4MNQE 4AG4H 1F4YL 1ZEAH 4PRNB 2E8YA 3VFTA 4C58B 1B4JH 2HJFB 4HV8B 2NY1B 2DTML 1K4CB 4F3FB 5IQ9B 4HV8A 3MC0A 1CLYH 5CGYC 4X5WB 4RDQG 1P7KA 1LEKA 4TOYL 3ZKMC 2EE3A 3TH4T 5TQ2L 3MV7B 1J8HD 2NY4D 1JNLL 1PKQB 2DMBA 5DJ6A 2Q8BH 5LXGH 3QQ9D 3O3UN 1EXUA 1AXIB 5TQ0L 4IRJB 3G5YA 4YNYA 3GMPA 1A6ZA 3O6LH 4U7KA 3PWVA 4MJ4A 3FO1A 3H8NA 4TSCL 3UX9B 4OM1H 4LP5A 1RU9L 4PREB 3P0GB 3T3ME 3MRBB 4JPIA 1XF2B 3FQRB 3RWIA 4JFDD 1P1ZB 1K3IA 1LO5A 5EIQA 4LRIA 5FA4A 3ULUD 3SGEH 1MWAH 4L1DA 3CH1A 4P4KD 2O93L 2NY4C 1Q1JL 3BW9B 3K4AA 2R0LL 5TH2A 4XVUD 3WIIL 2BOCA 4QHLB 1VEOA 3PL6C 1G7PA 4RMWA 5F96H 1KTLB 2H1PL 3EDFA 4N90E 2OZ4H 3L7EB 4F8TA 4NBXB 5AZ2L 4LHUB 2X1QA 4FQLL 2MMXA 3TT3H 4XP5H 4F7MA 4HWZB 4F7CB 5FHAL 4V1DA 1A7QL 2Z93A 4LOUC 4S0SD 4PJXB 5GS0D 4LLQB 1GGCL 3ROLA 4OCNC 1A7PL 1F6AB 4RQQB 3G6JA 2Z91B 1Y18B 1JGLH 1WIPA 4PRHE 1YECL 1P84K 5DI8B 1MHEA 4H25A 3DRTB 2R8SL 3MGTA 3DRQA 4PUBL 4XGZA 5SWZA 3VA2C 3CX5K 4YXKL 4S2SA 3OX8A 3OZ9L 1HI6A 4G3YH 1FVDA 1JF1A 2YPKB 3CZFA 3O9WC 4F7PA 3NABH 1ZS8B 5BS0D 1CQKA 3HC3H 1EA9C 4GG8B 5AUMB 2VQUA 3VCLA 3MQIA 2VJXA 2A6KA 1FGVL 7FABH 5B8CB 3CFIC 3ZYOA 4X7SH 1Z5LB 4LU5L 4J3OC 3B3IB 3CSGA 4WHCA 3TO2B 4GMSH 4NZJA 2YWYA 3QDME 4WO4C 4K7PH 3GSXB 4TNWF 2ZUSA 5ERWA 1AD0A 1HXYB 4NJ9L 4JHAH 1CGSL 4OD1H 3JUYA 5HPMB 4PGDB 4U3XA 4L9LA 3MUGA 4OF3A 2HP4A 1X5YA 2XKSA 1JTPA 4RIRA 4ONGL 5C0RH 2NY5C 4XP6L 4O51B 3BP4B 3FB5A 1XIWC 1FVCB 4P2QA 3L6FB 3TN0A 3KXFB 1AXSA 2QADB 1LE5A 3DV4B 4PS4H 2K3TA 3FQTB 4P49A 2G5RA 4H8WH 2PCPB 4IM8A 3VXMD 4JG1H 2SEBB 3N1MC 1BFSA 5BZWB 4N8PA 1M05A 4QRRE 4PGBA 1MFBL 4URTB 3WFBL 3HZMA 4TSBH 1UACH 4W6YB 4XXCC 3TLRA 4KMQA 2GTWB 1F02I 1G1CA 4K94C 1LP9A 1U8IA 5F72S 3TA3C 1FYHB 2W0KA 3GM8A 5T3ZD 1QVOA 4Z7QE 2Y7QB 1YN6B 3P3YA 1B6DA 4U1IA 2A38A 3FMGL 2CLVB 4UT9H 4IDLA 4YBLB 5DJ2B 2YN3A 4ODUB 3KHOA 1DSFL 4MAUH 5JUEL 3SQBA 3QEGH 1EEZA 2B1AL 1BHGA 5DMYA 1F3DJ 3TA3B 3NFNA 1UJ3B 5T33H 3VXQB 1IFHH 4QCIB 5GRZA 4Y8DC 3VJ6B 2CUMA 2D31B 3GO1H 3C60D 3BEVB 5GSVA 2DM3A 4NQVA 4M4RA 1CGUA 1PKQE 5CJ5A 1R3JA 3LKRB 4JQXA 3Q5YA 3KJ6L 5D1XB 2OTWB 4LKXA 2MJWA 3M45A 2HKHH 3JWOC 3GIZH 4DFIA 2KZ1B 1BZQK 4U0QB 3ZTNH 2W9EL 1I7RB 4A6YL 5BXFB 2XNAA 1XIWB 2P8LA 3SCMB 5LQBL 4R3SB 2DMCA 1Y0LB 3O8XB 2DTMH 1A6AB 2VXTH 5EA0H 1DDHB 2AK1L 4M8QA 2P5WA 4ZFFB 5IMOB 3H9YA 1IC1A 4G9DA 4BZ1L 4CBPA 1XGQA 1LK3H 1CQYA 2WLZA 3IB4A 4APQC 4P9HL 3O8XC 3FFDA 2HMID 1X5IA 4LKCA 1RZ7H 5IVXE 1HILB 5C09E 3IT8D 1QSVA 2YUWA 1X3DA 5TF1L 2XNAB 4RZCB 5IIEA 1FRGH 4BH8B 2X41A 1KV3A 4KK6C 5DRZB 1PX4A 5C07A 2X2YA 2KDGA 1G9NL 5LCVH 5HHPB 4BZYA 2CKBA 2ICWA 4PJFB 2PYFA 1Z3GH 3I9GH 5IFHH 4JJHA 1TTUA 2MOVA 1MCWM 3OKOA 2ZSWB 3DMMC 2V9QA 3H9ZA 1CK0L 3VI4F 2BRQA 1WBYA 4QHKI 3WIIH 1QQDA 2EEBA 4O02H 4UDTA 4BELD 1IZKA 3O3EA 2NY1D 1DQMH 4QGTA 2ZCKL 2Y23A 5TDOA 2ITCA 4PJBA 1BJ8A 1N6QH 1ND0B 3PQYD 4L4TE 3RY4A 4U6YA 1HDMA 1E28A 3C6LC 5FM5M 4DKEL 5IHUH 2XIDA 3QIUB 5FM8A 3VXOA 1SEBB 3CPLB 5JIIA 2D7TH 3BPCB 3BKJH 2CO6B 3DARA 3AAZA 3MLVL 1N8ZA 4OCWH 2AI0H 3P30L 3DWTA 2ESVB 2EXWD 3B2VL 1EK3A 3BVNB 3LEVL 5FAAA 2ZOLA 4XHJC 2DKUA 1CGYA 1O7VA 5F88A 2I07B 4Y2DB 4M7KH 1SBBA 3QR2A 2WINB 4R4FL 4M43L 1NAKL 2EKSA 1OTTC 5HHOE 3ES6B 4X98B 3O0RH 1T4KA 3P4MA 4PJEB 4FMKA 4NQEE 5A2LH 3RAJL 5CBEA 5EU7E 5F7EH 1LNUB 2E7CA 4LLYB 4HEPG 4RISL 4PJ5D 1G7QB 1T2JA 5FDYA 2OP4H 1R3IH 4MA3A 4X6FA 2GJJA 3H7LA 4LVHB 4PJCF 3OB0K 1RUML 3ULVC 4I18A 5DMKA 3QUZC 3VFWB 3P0VH 2YPLA 4YXHL 3KPMA 4HCRL 4H5SB 3STZA 3L3HB 3I3DA 3TN0C 3O11A 1MCJA 4Z7QF 1RFDL 6CGTA 2B0SH 3MV8B 5GZNC 2B5IC 2VIRB 3ARXA 2D7NA 1I7ZA 2YSSB 2F19H 5TFSL 1X44A 5B3JF 5GSRB 3MRCB 3TBSB 3VRLF 4IRZL 2UWEB 4HIEA 3SDXF 1T21B 5ESVA 4PJXF 2EDQA 3HS0B 4Z7UF 1I9RL 4YFEA 1IQWH 1H5BB 1M1SA 4RFNC 5T3ZE 1MCBA 4OZ4A 4IBLT 4U1JB 2ILLA 3R8BB 2HTKD 4NSKB 3ZKXB 3TF7C 2VKWA 5GGTL 3C5ZD 1AY1H 3QFJA 1ULVA 4XVSH 4PJHA 1CXKA 1V3MA 2NLJA 4OD2B 4RAUA 2CQVA 3W0WE 5IHBA 3V0WH 4G5ZH 1KELH 4Y0GA 1TJGH 1T3FA 1Z9MA 4NKMA 1X5GA 1VENA 4MJIA 4X6BA 1C12B 1SY6A 1U41A 3H0TB 5HDBE 3L7EA 4ZAKA 4GAFB 5GGSB 4F37K 3K7UA 4PRPB 5CSGA 1Q9OB 4OQTA 3LEYL 1OTTD 1OL0A 3VFSB 1N5AA 2JCCA 3IDGB 4H88L 3BE1L 5C0CB 2B7DT 4ETYA 1AQDB 2D9CA 4Z9KB 3VMPA 4ZS6D 3K4ZA 5D5MB 4FMFA 3PDDA 3FHAA 3PGDB 2QL1A 2R4SL 4GH7B 4HGWB 2X4PA 3OG4B 4NRZB 4XVSL 3AROA 4R97C 5F89A 5GGTH 3MXVL 5KBNC 5LAXB 2FX8L 4EI6B 5LAXA 5C86A 4OIBA 1TTFA 1T20B 4UQ3B 5ISZE 2V7HB 3ECBB 5F7LB 2OX5A 4KWUA 4WEUD 4QLRA 1KCSL 2R9HC 4LHUD 1MFCL 4K3JL 1B0RA 1SYSA 3DUHA 1DQDH 4X4XA 4BSJA 1MPAL 4KZEL 3V0VB 5MEOB 3W5NA 2CRIA 5FB8A 2VXQL 4FXKA 1RZJC 5DQJB 2Y06L 4YO0B 1YNKH 3LQAC 4FA8A 2HN7B 5DVLA 1KJVA 5BJTA 5E8EB 4PG9A 2BCKA 4KKBD 4WFFD 3DNKA 3E3QC 2IAND 4FTVA 2LAGB 1AJ7L 2V9TA 1QRND 1DLHA 5L0QB 4PJAE 5H2BB 1MCIA 2ZSVA 3UTPE 4UB0H 1HHIA 3BIKA 3WFDH 1KCRL 3QO1A 3AGVA 2OP4L 1T1ZA 3SDCD 4E41B 5E8PB 1LDPL 3MLZL 3MA9H 5F1SA 1NFDA 4MQ7A 2APWA 3DVGB 3OMZA 1M6OA 2HFEB 3SOBL 2B4CC 1ETZB 5IP4A 5GGQH 5F1IB 4ONHA 4V2BA 4QT5B 2JF1A 2NXYC 3NPSB 1JGVL 1OAKL 3EAKA 1J1OL 4NPYA 2E5EA 1SJEB 1YZZA 4ZQKA 3MV9D 3O9WB 2OJEA 4YWGH 1C8PA 2NQCA 2J8UB 3S4SB 4HJGA 2KL6A 3MSPA 4HIIA 2AJVH 2R29L 1KJ2H 5DHYB 1WIOA 5C0AA 1TJGL 5GS1B 3D25A 3CX5J 1FYTE 5IMKA 3MTRA 1PY4A 4RFEA 1P4BH 1XR9B 3MV8A 4HQQL 2BFVL 4NO3A 1WJ3A 1LO4L 3Q6FB 5JW4Q 1HINH 3L3HA 5J1AA 4PG2A 1W8NA 3PL6B 5EZOH 5D1QB 2CK0H 5CP7A 5JO5B 3U9PL 1IE5A 4UIKH 2UYLA 1LEIA 5HHNB 3WLWC 2AKRB 3RTQC 3V6ZB 5F6HI 4PJCA 1S9XA 3BWAA 3THML 3ILPB 1FNGB 1CXFA 4NN5C 4Z76A 4XVUC 2YUXA 1H3XA 1TVHB 3D18A 4NQUA 1TIUA 4WI3A 2R0WL 1G6VK 1T4KB 3LS4H 2LFGA 3HE6A 4WV1A 4XRCA 3TVMC 4QF1A 4FZ8H 4WFHE 3HUJA 2VWEC 2AK4B 4JKLA 1W72L 4CL7A 1JE6A 3HPJB 4LCUA 2X4NA 1GIGL 5DC9B 4HX1A 3BEWB 2ZOLB 4EN3D 5D72L 1BGXH 4M61B 3UTQB 5TF1H 3WXWL 1TQBC 4PJ5E 4PTUA 4PS4L 3U2SB 4PB0L 4JFDE 3FN3A 5LGHH 4D9QE 2XACC 4HFWB 1T22B 4Y16A 2VQTA 3WIFB 5IR1A 1DEEB 3QG7L 3MNWA 5MI0C 2X40A 3HNVH 5FF6B 3T2NL 1L4IA 5DWUH 3IXTA 1NL0H 2IANB 3IDMA 4DWHA 1OTSC 4ZO8A 4KTDL 2C7UB 3LHPL 2VN4A 4H0GA 1U2HA 3PWPA 3EO1A 4JFFB 1NGZA 4IIQA 3KNBA 1UYWH 2NY3B 1MAJA 2VE6A 5GXBB 4Q2ZB 3FT2B 5HHMB 4CDHA 3DBXA 1GRWA 2DL2A 2ZSWA 3LEVH 2DQHH 2HH0H 4R0LA 4KU1A 1I4FB 5JNYB 2FB4L 4MJ6A 4Z7UA 2A9ML 4OFDA 5AG8A 2CKBB 2GITA 1JNHA 3RX8A 4IRSD 3MA7A 4G8EA 1A9EA 2Q86A 4L4VB 3T77A 3QHZH 4OJFL 5TE7H 3NN8A 4GRWB 3FQNA 4JZJB 5KG9A 4R96A 4XBGA 4PGEA 1YEHH 4U1GC 3ZE0F 2EH8H 3HMXA 2EDBA 32C2A 1E4JA 5D7IE 4N8VB 4EN3A 5JXAL 4OD3L 4NNPH 1KBGL 3FN9A 4YDLB 1ODAA 4LLAA 3QDMA 3S9DB 4MA7L 3U0PA 2XN9B 1VGEL 4K07A 3MLTA 1B88A 1A7QH 1EJ6A 3F7YB 4S1SL 3NBNA 3TBYA 4NKIL 3V6FA 4Y5XB 1JHTB 4RGOH 3BGMB 3I75A 3HE7A 1CL7I 3HUJE 3F58L 2ICWJ 5EO0B 1BPVA 1VEMA 3LMJH 3FOLB 5T1LA 3KYNA 3A0OA 3BDYH 4IS6B 3M17B 4GW4B 4I13B 1FLTX 3NA4A 4NN5B 4J4PA 3BEVA 1FL6B 1HQRB 3SKMA 1JK8A 1D9KA 1CFTB 5IB5A 4S1QL 1BD2D 1RUKH 5MEND 4LSVH 1S78C 1J9CT 1Z9SA 4M7ZB 5CSBA 1FFQA 2WBJC 3QWRD 3LDBC 2Y5EA 4KUZH 2L4OA 2WK2A 4L4TB 5DEFA 1U8KB 3MJ6A 3MUY1 1DTUA 2FECI 5C7XL 4NGHH 3QIWA 2RAMA 2CDFB 3B2UC 5E56A 1UXWA 4EJ1C 1FYTB 2CJUL 1TDQA 4TPRH 5K59E 3IRZA 3O6ML 2X70B 4FN0A 2GTWA 1ZANL 4IRSC 3LHPH 3D1MC 1JGEB 4GMTL 4LARL 2E27L 5FCSH 2XWTB 2PW2A 1BP3B 3CSYA 2ZUUA 3GBMH 3B8SA 4XC1H 3UTPD 4UNVA 2A83B 2DLIA 5B39G 3CDFA 1ADQH 2V5RA 3BSZH 2XKNA 3ULVH 4XPTL 4DAGL 5BZDA 2R1WB 5C2UB 3HTLX 3U4BH 4IRSA 4GQ9H 3BDYL 3WV0A 4RIRB 5FV1L 3O2DL 3T65B 5HI5C 5D1QC 5IGXL 5IR1B 5SWSA 1ZT7A 4HUUA 1RZJL 2GY5A 1FG9C 1QBLL 3TPUB 4JO1H 3QFDA 1Z9LA 5E8OB 4Q97A 5IG7B 3GGWB 3EOBB 5AZ2H 4QRUA 3ORJA 2J5LC 4Z0BH 1JVKA 1QFPA 3O2DH 1FZKB 5E9DB 4N0FB 1ZLSH 4MAYB 1UWXK 2X7LA 5EZJB 1N0XL 5AYUH 3RBSA 2HJKA 1CDBA 3HG1B 5JXAH 1MWAL 4FXGA 4JRYB 5GRVL 2PUQT 4QF1B 3QXTA 1F90L 4XAWL 2W65B 3RWHB 3UTTB 2A77L 2X89D 3ULVL 4QNPF 3HC4H 5BRZA 2DOCA 3MREB 2R2BB 1R3HA 1M7DA 4PJHF 5BVJA 4XHJD 3T0EA 4PP2B 1AGBA 2HWZL 4P23B 3SKMB 5DVKA 2BNRE 2AJVL 5IV2A 2C26A 3CFKB 3OF6D 2FB4H 4WI7A 1PQZB 4NQCB 2Y1VA 5DK2B 4TPRL 2VLJB 4O58L 5DD0L 4HGMA 4NO3B 4OGAC 5I71C 2HG5A 5CEYA 4PRHB 2BX5A 5TPWL 1U8JA 4X7SL