2W0PA

Crystal structure of the filamin a repeat 21 complexed with the migfilin peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FILAMIN-A
publication title Structural Basis of the Migfilin-Filamin Interaction and Competition with Integrin {Beta} Tails.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 15
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0pA00
3PWJA 2GTWA 2A6DB 3OKLA 4OIIL 5TDNA 1R5VA 4EN3D 4DGVL 2ZKHL 3UDWA 4EN3A 3EOYG 3RVUD 1D7FA 3VWKD 5CJQH 3WUZA 3O2VH 4M6ML 2IBGA 4GXVL 3VWKA 5D8JH 2ZUYA 4JY4B 2GAZB 3ULVE 4LPVA 4JGJA 3I6KB 4QCIB 3PIQB 2XKSA 1I85C 1CN4A 1VPOL 3ABZA 4F57L 2JJSA 1L6ZA 1Q8MA 2ADGA 1FHGA 3G5VA 2CJUH 3KVQA 4LOUC 2QKIB 1X6NA 5HHXH 1NGZA 4K94C 2IAMC 2C3WA 4NQVB 4FNLL 3B83A 1CBVL 1F5WA 1CL7L 1S7SB 2BOBA 3KG5A 2BOCA 2R2EB 4BQ6A 2X4RA 2HFTA 1I75A 2EE3A 3HE7B 2Y7QA 4Q2ZA 5IQ9A 4FFYL 2X44D 1JZ6A 3GSUB 4JFOA 3MO1B 4Y8DC 2FHFA 2BVEA 3KYKH 4M7KH 5GGRY 1JHKL 5IUSA 5DQDL 3NOIA 1M7DB 4HG4J 1YY9C 2IQ9H 3QSKB 2A6IA 3BFOA 4GLRI 3L5XL 1S5IH 4MA7H 5EZLB 3K4AA 4N8VB 1I8LA 4YBLC 4L8CB 2XTLA 1X7QA 4ODSH 3LS5H 3QDHA 2IANE 3FB5A 3REWA 1CF8H 4XNXH 3ZDXE 1AFVL 4MZ3A 3VFNB 4XCYB 1U8JA 1ZEAH 3GMOA 3IFNH 4UV7L 4G8FB 2EE6A 4MQSB 1BVKA 3TESA 2XFXB 1S5HA 1PAMA 1T1YB 3EDEA 4U6XB 1REIA 1MF2H 2A9NL 4M5YH 4RWYL 4HF5H 5JMOC 4HCRA 3O6FC 5BRZE 3NCMA 2BVTA 5JW5A 4Q0XH 4EVNB 2HKFL 1PFCA 4OQTH 4WI3A 3HZVA 3QUYD 4GKOA 4WHTB 3IJYA 2DF3A 3QUYA 3EDFA 3NN8A 3MBEB 1S7WA 3M8OH 5JXAL 2YD9A 4RGND 3WE6A 1B2WH 4Y5YB 4OZFH 4RBPK 5E8OB 1U95B 2KZ1B 4P2QB 5I1LA 3O0RH 1JBJA 4U1MA 4JN1H 3V4UH 4M7LH 3G08A 3T1FA 2NY2B 4J1UB 2IH3A 2OM5A 1NMCC 15C8L 4ZS6C 3MRFA 1L7IH 1JNJA 1T2JA 2G60L 4QHUA 3DXAD 5H2BB 3KPRB 4C83B 2ZCKH 3N1FC 2VLKD 4NHUA 3RDTB 3V0WL 5GJTL 1AIFA 3DVGA 3U4BL 3OJDB 4DUWA 4WU7B 2VLKA 2H2SD 1CDJA 3QISA 5JOPD 1FGNH 1WEJL 1YEKH 1LO4L 5ESAA 4AT6A 1CWVA 3RVXC 1INEH 3BPCA 4MCZA 5E2VH 3L5WB 5DD6B 3SGKA 4MMXC 3TH4T 1MAKA 4FS0A 1BOGB 4OIAA 2Q6WB 4FQQA 3B9KB 4HGWA 4K7FB 1ZHBB 4KMLB 1W0VA 1NGYA 1VEMA 2PO6D 3ALPA 1SJXA 1UYWL 5BV7C 1DE4B 3NA4A 1X5XA 2HTKC 1PGRB 2GSGB 1DUYB 2CK0H 2W0PA 5E99L 4HKJB 4DVRH 4RMWA 4LARH 5MERA 3IDXL 4HSQA 4QGTA 5DZLA 5EDXA 4FG6C 1BJ1H 3HAEA 2BMKB 3FZUC 4QY8A 2EDEA 2AQ1A 2B1HL 3ZE0F 1BQUA 1CT8A 4HPYH 3U7AA 3SGJC 4UINL 1W8NA 5DQJA 5TDPB 2NQCA 2X70B 3G6JA 3UBXA 2XQYG 2DRUA 3DTXA 5CJ8A 5ADOH 2B5IC 1U92B 4HS8L 4K8RL 1MFCL 1IL1B 1QSEE 4EDXB 3PXHA 2NW3B 3DX7B 5EOQH 3GKZA 5ESQA 4P3WA 1JF6A 1TTFA 5I76B 3GJEA 3QUMH 1IEAA 4OCSH 3QWQB 1F3JB 4EBQL 2OK0L 3OXRA 5M7QA 5T5FL 5EULV 2R0LL 1M05B 5CZKA 2A73A 1QRNB 5FXCH 4DK6A 4DZ8A 3GMRB 3MV9A 4OZHE 2NY4C 2A6JA 3O3EA 4L8SB 4EUPH 4MJ6B 4NKIL 5J11C 3TWCL 2YWYA 1H3VA 4JRXE 4XCFL 3BPNB 1YEHH 5I9QC 2NLJA 1QQDA 4Q6IA 4PV9B 4JPWL 3D2UB 3NCJL 4S10A 3VGDA 5H37H 1CR9L 4W6XB 5E1AB 4G5ZL 4QRPE 2V7HA 1G7LA 3FB6B 1PQZA 3SE4A 3T0WA 5DS8A 3T3MF 5K59F 2ADIA 4QRUB 3MV8D 3L3IB 4UDTB 4QT5B 2VLJE 1GZQB 3QNZA 4KK6C 5IFJA 4GKNA 3K2UH 5D7LB 3PHSA 4PBXA 3C8KA 5E6ID 2BFVL 4UBDC 1QFPA 2B0SL 4OD3H 3B2VL 4OF6A 1QHPA 4UOJA 2EEDA 4OGXL 1T5XA 4GOSA 1EBPA 1PEWA 4ODVH 5F6IC 3LKNA 3PWPB 4ISVA 2ZCHH 3HNVL 4PJ8B 4PG2A 3HKFA 2DQJL 3VGGA 3NFSH 3WUWG 2CIKB 4Z76B 4JFDD 1AO7E 5L88L 1DBML 2NY1B 4QLRA 5IB4A 1SY6A 4IIQA 3VH8G 4JFDA 5K33A 4JRYE 1T0NA 1WAAF 2YC1B 4XBEL 3S35X 3T08A 5CP7A 1J10A 4NN5B 4Z6AT 4QXUH 1T7VA 4XVUC 4W6WB 3V6BR 4U6HA 1T83C 7CGTA 4JKKA 5J89A 2X4QA 3MODL 2HJKA 5EBMA 4NGHH 3UJTL 4RMTA 1IKFL 1J1XH 4MDJB 1FVDB 3FCTB 3LV3A 3PGFH 1LO3H 4RZCA 2F54E 3KLAB 1XFPA 3PE9A 4HUUA 4WFHD 5E2UL 1AC6A 3KXFD 4O58L 5D2NB 2UVEA 2EXWC 4UNUA 3KXFA 1D9KB 5KJRL 2Z4QB 1MCNA 3NGBB 4HLJA 4IRZL 4X8XA 2ZUSA 4L3AA 5DK2B 1OL0A 1HZHH 3P4LA 1H3GA 4X6BB 1IKNA 4S1DD 5IVXE 3PL6C 1ES0A 2FWOB 2WQ8A 4MQTB 2APVA 4KKLC 4CKVX 3EYFB 1AY1H 1BAFH 5EA0L 1LP9E 4HFWB 1AI1H 5DD0H 1CE1H 1S9WA 2IALB 4PD4J 2X6MA 1UXWA 4N90D 4HWEH 1G7PA 2XPGA 1KTDA 3CSYA 3FO9A 4OT1H 1G7MA 4OV5A 4NCDA 4KC3B 5HYQA 4C55A 5JA8B 4OD1L 1PSKL 2DD8L 4G6AD 3SE8L 4R7DB 5DC0A 1ZWIA 3RWIA 5EU6E 1T20A 1ED3B 3GSNL 2FIKA 4HUXA 1TTUA 4PPTA 3BIAX 2EDFA 3VRLE 3HZMA 1QFOA 2OI9B 4U2YA 2UZXB 5CJXA 4CGTA 1Q0YH 2YZ1A 3N1MC 5JW4M 1VKXA 5JOFB 4WTWA 3Q5TA 2A9MH 2R1XA 5AUMA 1NCAL 5JDSB 3IU3A 3RL1A 3MRNA 2RJMA 2YA1A 2HN7A 3X14B 5KG9B 4OLVL 2GJ6B 4YWGL 5INDA 2JJTA 3BEWB 4BQCA 3HI6L 2FATL 5FM4A 5C0FB 3NACH 4DN4L 5MEPA 1PBYA 1SMAA 2IAND 5FO9A 3KDMA 5D1ZD 3FT2B 1A6AB 1R5IB 1WWWX 1UB6A 5D1ZA 5DVKA 3JV4A 1P84J 4M8VA 1Q0XH 3MR9A 5D1XC 4PR5A 4L4VE 2OTWB 2H3NB 4NQUA 1IC4H 3GI9L 3D25B 2FGWH 5BRZD 3EYOB 3MRLA 3VWJD 5BRZA 1CFVL 1KCSL 3LKQB 3VWJA 2GUOB 4OZGA 3RZCD 3G6AB 1UM4H 3RZCA 3DUSB 4QXGH 4KI5F 5CCKL 2BJML 4PY7A 1YNLH 3ISWA 5TGBA 4PJ5B 3ARQA 4YJZL 3QG7H 5E8NB 2M26A 4CADB 1QR4A 3CU7A 1FIGL 3SDYH 2K3TA 3VXRE 3LQAH 1R3HA 3BKCH 4JGUA 5F89A 5GS3A 2ORBL 1A1MA 3I3BA 3L3JB 4PRDB 2VYRE 2J88H 4P59H 5FKPA 4BUHA 3CFJA 4XPHH 1DP0A 1BFVL 4R4BA 2OQJA 3UJJL 1RJYB 1M7XA 1MI5B 4HJJL 4QRQB 3SGDI 3PG2A 1X5ZA 5KVDH 1FYTD 4P46B 2O5XL 4FTVB 1FL3B 4JN2A 1FYTA 3OR7B 1KB5A 2YSSB 5F3HB 3MLZL 1ERNA 1WTLA 4YPJA 1I7TA 4NO2A 3WXVL 3BZEA 5D9SB 32C2A 2IG2L 3F8UB 5GGSB 3QCVH 1NLDH 5JQHC 1Z9MA 1MCPL 3F7RA 3P4MA 4YHKL 5DJZA 2AV7B 3W9DB 3H7LA 4JKLA 1J86A 1JPGB 3MLTB 1INDL 3BKYH 5JIPA 2VAAA 4D0CA 4O00A 1L0XA 3TCLB 2PTUA 1HXYB 3B3IB 3KLDA 5C9JB 3HHRB 2DJ4A 4RMSA 5HBBA 5I19L 4Y19E 1QO3A 3KJ6H 5J6GB 4AK1A 1KEGL 5F9DC 3T2NL 1QSED 4F2MB 3BXNB 1ZANH 1LE5A 4PJBE 3DO7B 3ZO0A 1MUJB 1QSEA 4HC1L 5FK9A 2XG5A 4HLZH 1A4JB 3S4SA 1T0MB 4Y4HD 2DQGH 2GT9B 2C1OB 4PRIB 3IKCA 5CGTA 4XNZB 4JFZH 3BHBB 1SBSL 4Y4HA 3BPOB 5I8CB 4JO2L 3RUGB 1K4DB 1FVCB 5F9AC 3RWGA 3DPBA 2ENSA 1NFDA 3MCG1 3V0AC 4URTB 4L29A 4AQ1B 1MAMH 3IDYB 1BEYL 2BNQD 3BO8A 2P45B 2WSKA 2OL3L 4K9EH 1U8IB 2BNQA 4HWZA 2IBZY 3ILQC 1KYOK 4X4YA 4Y2OA 4FXLA 4JO4L 2GTZA 3RGVB 4NN7C 4RFEB 2Q3ZA 1FE8H 2VLJD 1SM3L 1ADQL 2ERJC 1GIGH 4HHAA 2VLJA 4OIBA 5IQ7H 5D7SL 1OGTB 1D5MA 3UTPE 5FOBB 2R0WL 3QIWB 4LVHC 5BOPA 3UJIL 1DUZA 1P4BL 5J3HD 2Q86A 3LKSB 1GYAA 1DEEB 1VADA 2R9HD 4B50A 1G7JB 1F90L 2FLBT 4Z7UE 2JJVA 1OY3B 1U93A 3V6OC 1KTRL 1UCBH 2V6HA 4V2CB 3DYPA 2VC2H 1BBDH 1AO7D 4PJAB 5CSZB 3RTQD 4JG0L 2AABH 1BJ1J 3CDGA 1AO7A 5DK0B 4LCYB 3RTQA 1QLEH 2BY1A 4RMVA 4TUJA 5DEGB 3WFDH 4IRSC 5GGVL 1F2XK 4Y1AB 2DB8A 2AW2A 2AXFA 2VO5A 2X1QA 4DN3L 4KHTL 5HI3C 3FZUD 3QFDB 1DN0A 1C12A 5I16A 3GMLB 3LKRA 4LLDB 2DWEB 5EUKB 4NSKA 1LD9B 2F54D 1E4XI 3H8NA 1NCUA 4PGJA 5DSCA 2F54A 5CILH 1EVUA 5SWSB 1RK0B 3V2AR 3VFMA 4U7SA 3FO2B 3WIHH 3B9AA 4JPKL 3SE3C 4NQDB 3QULA 3RY5A 3MXVH 3BX7C 1ZHLB 3PWJB 5KAQF 5F8QC 1KJ2H 2Q7YA 2GTWB 4Q9QH 3L6FA 3OKLB 5TDNB 2D9CA 3P0VH 2G75A 4EN3B 3CMOL 4M61A 3QDGA 4XX1E 5LGKA 3LVEA 1MAJA 2NY4D 3H6JA 4WTZA 4XNUL 1LP9A 4MLIA 5DHYA 3G5ZB 2FBJH 3NIFF 4RQQA 1JYNA 1Z9SA 2VDML 5F9WC 1MRFL 4BK4A 4HFUL 2EC8A 2R1YA 1KLUA 4ZTOL 2VQTA 2ADGB 4E41E 3V0VA 5EU6D 5HPOA 1LEKA 1NGZB 4M4RA 4PLJC 2BHUA 1U8MA 5EUOF 4UBDD 2AXGA 4JB9H 4RGMB 3H9HA 1TTGA 2VH5H 1MCDA 1JGEA 3LSOA 1MCSA 4GW4A 4HEME 2X4RB 2HG5A 2F5AH 3NCFB 4MX7A 5KSBB 4PJXE 1E4WL 1QLFB 4PB0L 1KCRH 3ARYA 4OI8A 5GGQH 4Q2ZB 2Y7QB 4DK3A 4HIIB 3QDJB 2JCCF 3V6OE 1FZMA 4JFOB 2PXYD 3LY6A 1T7XA 2OS7A 3RP1A 4KJPD 4ZD3H 4FMFA 4M8QA 4ZUUA 2PXYA 5IP4A 5DURB 3SOBL 1AXSB 3ARDC 1A1OA 1OPGH 1G0DA 2A6IB 5JUEH 4LNRA 3CX5K 1IZJA 3VG9B 4DUVA 4LKCB 2R4RH 2IBBA 3QJFB 3ZKSD 4XVUD 1RY7B 5HD8C 3TT3L 3BP4A 1AQDA 4ZAKD 4KGJA 4RISL 1F02I 1YEGH 2HLAB 4W4OC 2DN7A 3ULVH 3FB5B 4IS6A 4ZAKA 3REWB 1U8KA 1T0PB 4YIQA 1OTTC 2C7UA 2Q87A 4KU1A 3HN3A 1KCVH 4DKAA 1ZLSH 4G8GE 1BVKB 4XP9L 1S5HB 1ZVHA 4Z7QE 3TIDA 3VDCA 1DBKL 4LPWA 2GJZB 5JW5B 3GSWA 1IAIH 2CDFA 3IJYB 4FXKA 3QUYB 3PL6D 3O6LH 4HT1H 4K8RC 1T66D 2AI0L 2JB5L 3PL6A 1QSFE 4YK4C 4NQXB 3WFBL 4JQVA 3TO4D 4P5KA 5TQ2H 3VXRD 2FYYA 4XXCC 2QHLA 3TO4A 2X4PB 4U1MB 5EBLA 4KKAD 3VXRA 4I2XE 4LP4A 1NBZA 1CDIA 1WBZA 3T1FB 5GGRA 1AR1C 3MRFB 5DHVA 3JSSA 3S9DB 3QEQA 4QHUB 1OM3H 5IB2B 2BX5A 4PJGF 2FEDD 1E4KC 4LDEB 4N9GA 1I3GH 2OZ4H 3DVGB 5EO1A 1OAUH 2J6EA 1UWGH 2VLKB 1TITA 2FHBA 4XHJD 4YO0B 5T33H 1JZ8A 3WHXA 2LAAA 4G6FD 1N0XL 1C5CL 4OF8A 5F71A 3X12A 4YC2C 3BPCB 4MCZB 1KV3A 4ORGA 4XWOC 4PGBA 4FQQB 1S8DA 1QFWH 2DMCA 4HGWB 3LD8B 5GSVB 5L9DL 1I1YB 1W0VB 1NGYB 4PJFE 1NAMH 2DKSA 2AAVA 2L7JA 1CD1A 4LSSH 4IOSD 4YXLL 4ZNEE 2R0KL 2A1WH 4YQXL 5MERB 2X5PA 3BP7A 1U8QA 1A14H 2R2CA 5GRVK 4QY8B 2DMKA 3B5TA 4DKFL 1CT8B 3Q1SH 1A3QA 3BZ4A 1OW0C 4FFZL 7FABL 3R8BB 5K9JH 5D1XD 1QBML 1WUNT 1FNAA 3P77A 1BPVA 4HBCH 5D1XA 4I3RH 4QRTB 2VB5A 3UBXB 3DTXB 2UZYB 2CRZA 4W68A 1X5FA 5ESQB 4WV1A 3CSBA 3GJEB 3RAJH 1IEAB 4LCUB 1MRCH 4LHJB 3OXRB 4AJ0A 3B9EA 3P4OA 1Q38A 2A73B 5FGCE 4ELKA 3PQYE 4DZ8B 1CFNA 2I27N 4UU9A 2FB4H 1GGUA 3DRTA 3MV9B 2A6JB 2F19L 4NHCL 4Y5VA 4N8VG 3WJJC 1TENA 4ETQA 4O5LH 2O5YL 3CH1A 5GGVY 1LDPH 4MJ5A 4XNYL 4H20L 3RNKA 3O6ML 2NLJB 1QQDB 2H41A 2ZWLT 4J3WA 2EXYC 1IGMH 3MCLL 4XMPL 1KXQE 2V7HB 4H0HB 1G7LB 4NP4L 4PRHE 1RI8A 4LF3A 1PQZB 2MFNA 1LE9B 5DS8B 3LIZH 2ADIB 2AJXH 2NY0C 3QNZB 4NO3B 2AK4D 4GKNB 4FZEH 2Y36H 1BZ9B 3C8KB 4OFPA 4P2OC 4HS6B 2AK4A 1RIVL 3H3PL 4JO3H 3MLXL 3TV3L 5CINL 1KXTB 3R1GL 1ND0A 1T5XB 1DR9A 3EO0A 3LKNB 3MUGB 4ISVB 4L4TE 3NA9L 1IAOA 4OF7A 5LAXA 1R6VA 1RUAH 4PJDF 5IB4B 4KRLB 3GFUA 3B6SA 4JFDB 5F7EL 1RIHL 3KR3H 4TVSa 1QOKA 2W0LA 2M2DA 4JPIB 4ZTPL 2FX7H 4JFPA 4U6HB 3OKNA 3ORJA 4R8WL 2X4QB 2HJKB 5EBMB 3SKJH 4OI7A 4G7VL 3LV3B 2YR3A 4TNWF 4RZCB 3ECBA 3W0WD 4HUUB 3BAEH 4XNQB 3W0WA 3I02A 5B38A 2W92A 3KXFB 4TNVK 3KAAA 2XA3A 5MHSE 2F58H 4U33A 5KS9A 3PDOA 1G9NL 2CLVA 1SBBA 2LVEA 3IS0X 1QBBA 1ES0B 3WFEH 1W72L 4Z7OF 3HUJF 5F7DA 3GM0A 3AC0A 3ILQD 5FGBC 3HPLA 2B4CC 4ONGH 5DMIH 3AAZA 1OAZL 4MS8C 3V7MA 1CU4H 2XA8L 1UXWB 4P4KD 4E41D 1G7PB 3RPKA 1T3FB 1TQCB 4HJGA 2XPGB 1KTDB 5FYKU 3CSYB 3FO9B 2YK1L 4L1DA 2EDNA 4P4KA 1W8OA 4R4FH 3ME0A 3INUH 4M02A 5HYQB 2H2PD 1KCKA 1QBLH 5DRZA 2ADJA 4YHPB 1VACA 4U3CA 3VXSB 5SX4I 3RWIB 4WFGE 3MJ9H 1NLBL 1T20B 4C59B 1ZT1B 1HSBB 2FIKB 2X4SA 4HUXB 3VFRA 3RWEA 4KTEH 4JFYA 3HZMB 2Y06L 1HHKA 2F9BT 3KGRA 2QR0B 4MWFA 5C0CE 1EEZB 1VKXB 3K3QA 4R6UA 2R1XB 1C5DB 1XAUA 4KVNL 1Z3GL 4AH2A 2VWEE 4OSUL 3V6FB 5I8KH 5IW1A 4PJHF 5INDB 4NWUL 3DETC 4PRAA 3CDFA 1I1FA 3FAWA 3RWCB 5AYQA 3W9EB 5MEPB 4KQ3L 4UT9H 5T1DL 1BP3B 5F6HI 5IM7A 4U1KB 1QR1A 1UB6B 2BDNL 1E4XL 5D1ZB 3JV4B 5HVHB 2P8MA 3IDMB 1YMHA 3MR9B 4G8GD 4PR5B 2E8ZA 4OKDA 2NY7H 1BOYA 1U2CA 2Q8AL 3ESVF 4TSAL 3DURB 2EIDA 3VCLA 1AGEB 3VGEA 3F6IA 3EKCA 2VTFA 4M3JA 5I73B 5DFVD 1SHMA 2XTJE 2IH1A 1IGIL 2VXUH 3VWJB 4OZGB 1T89A 5TJWK 3GBML 5I71C 1TPXB 1Y18A 1RD6A 2F53E 4ODTH 5I74C 1JNHA 2VDLL 4N5ED 4PY7B 1YUHA 4PYHA 3MA9H 5IWLA 5TGBB 2ATKB 4ONFL 5GGTH 4JR9L 4NDMA 4I2XA 3FT3A 2V2XB 5EH1A 4JAMA 4LLWA 4RFOL 5TE4L 5I17A 1C16A 3RPIA 1A1MB 1WT5A 5DZOA 4IDJL 4QTIL 4XCCL 3VFGH 4TRPH 4EDWH 4X9FA 5FKPB 3DVIA 3CFJB 1PLGL 1UCTA 1RPQA 4R4BB 2OQJB 4IOFD 3RKDC 3PP3K 3L1OL 5BO1H 1IFHH 4JN2B 2UVFA 5FA3B 1FYTB 1KN2H 1KB5B 1TCMA 4MMZC 4A2LA 3P0YL 3BIBX 1ODAA 2VXVH 5GRJL 1U36A 1I7TB 3BZEB 2AJVL 4X4ZA 32C2B 2P8LA 3ZDZF 5FHBL 4CRPA 2W59A 5C70A 4HDIB 5DJZB 4GUPA 4NPYA 3QQ9C 2EDRA 1P9MA 3RZWA 3EBAA 5C6WH 4RA3A 5HDBF 3KPQB 1IT9L 2X10A 2ZOLB 2IADB 1A3RL 3ARRA 4LSDA 3MZGB 3UYOD 4W4OA 4WVRA 1QO3B 1OTTD 3EFFA 1RJCA 5C0DA 3KHOA 2XV6B 1A0QH 1LE5B 2E6QA 4KDTC 4GJTB 1ZLUK 4OCRH 5FK9B 1NANH 2UZIH 4K7PL 4MNQE 2YA0A 3S4SB 3H9YA 2AEWA 4LKXA 3IKCB 4K71B 3FONB 1CDUA 4YHMH 4M1CD 4GO6B 3RWGB 1AGDA 2YMXH 3PQYD 2VL5B 2HVKA 3L3KA 4D9LL 1NFDB 35C8H 4GQ9H 5C3LD 3S6CA 3PQYA 4L29B 3AS2A 3TP4A 3BO8B 4K8RD 2WLZA 2BNQB 4HWZB 1R3JA 2HFEB 2BRRL 4XP5H 1GGIH 1LEGB 3L3GA 4X4YB 3KS0H 1MLBB 2GTZB 4XXCA 4PRHD 5E08L 4XVTH 1EA9C 1AR1D 4PRHA 5EORH 1O7SA 5IB5B 1GZPB 3DYOA 3IDIA 3GUTB 4LHUB 4LVOB 1A6TB 4TUOB 5GZOD 5ACLA 2R8SH 1XGQB 4DGYL 2YD5A 1D5MB 3Q3GA 1XGYL 2D7NA 1AP2B 4OKVB 3G6DH 4TQEH 1EMTH 3BYTA 3CVHB 3NCCB 3O81A 1U8LA 3PABA 5LGHL 3GMMB 4XWOD 5ICYA 4ZUTB 1MFDH 3RI5K 1FNHA 1CLOH 4KV5F 1OQXA 4LCIH 4NM8L 1HQRA 1R3IH 2V2WA 3MC0A 4NQCE 5HTSA 3V79C 1XIWD 3GSXB 3OQ3B 3KYMB 5F7HA 4TUJB 3BE1H 5IMKB 1XIWA 1GJIA 1BQHA 1JGUL 4UV4L 5CJOL 1Q9LA 2GJJA 1IARB 1IGFL 3GK8L 5DR5H 3G5XA 4IMKC 1HNGA 3VGBA 1DN0B 1QPPA 3MLRH 1WBXA 5I16B 4IJ3C 3K81A 4Y8AA 3LKRB 3PJSA 5DHXB 5DJ2B 5KW9H 4NSKB 2ICWJ 4HPOL 4Y5XB 3EGSA 4UTBH 2AJSL 4PY8J 5DSCB 2F54B 1P7QA 1DBJH 2VJXA 4YUEL 4KGLA 1I9EA 5MHSD 2CGRH 3JWOC 2WANA 2FRGP 3QULB 1U41A 3UEZA 3QXTA 4KWUA 5TPWH 2Q7YB 2DQTH 3L6FB 1CVSC 2LFGA 5CS7A 2PETA 4X6DF 4TULL 2JCCB 3GKWH 3NPZB 2G75B 1K6QL 3D69A 1MCOL 2UWEB 3QDGB 4KY1H 1I1AC 1NCNA 4ZFZB 4F58L 5DHYB 3LZFL 2HTLD 2ESVA 4BUGA 1DLFL 1KBGH 2Q76A 2PYFA 2VERN 3K0WA 2XWJB 3OKKA 5FYKL 43C9A 3ZL4H 3ESUF 3I3EA 2Z9TA 4GBXB 5I6XB 4OLXL 4GRWE 2EXYD 3IJHA 3RU8L 1L6XA 2R1YB 2N7AA 1D5IL 1MHPH 4V1DE 3V0VB 2NY0D 4KK5C 3VMNA 2QBWA 1MVUA 4GAJL 4LLVB 1LEKB 2VDRH 3MUJA 3OPZH 1KELH 4LRIC 1YJDL 3P30L 1U8MB 1NBVL 2AXGB 3G5YA 4UT6H 3H9HB 3SDAD 3LSOB 1JGEB 4GW4B 2AJUH 4JY6A 4MX7B 3SDAA 5C0CD 1RULH 1WLHA 5C0CA 2ZUWA 1SEBB 5A2IH 3L3DA 5HHMB 3PWLA 4G6ML 1FZMB 3RJQB 1R3LB 3QXUA 5JW4N 2WW8A 3SBWC 4GG6E 3D18A 2PYEE 1GPOL 5HYIA 1ORQB 1A1OB 3GSNA 3IFLL 2DJSA 3RX8A 3QR2A 5DD3H 2J12B 4YHLL 4LNRB 1AC0A 3C60C 4WW2F 3HNSL 4RMUA 2BVQA 4MA8L 2D7MA 3BP4B 1AQDB 1KJ2A 3G6JF 1C1EH 3C6LA 4IS6B 4ZAKB 4H26A 1B4JH 3W5MA 1V3MA 1JE6A 4YIQB 3SY0B 3O45A 2C7UB 4M6NL 1OAQH 5T5NF 1WZKA 1J0ZA 3O2DH 3VRJB 3OXSA 2XTJD 3D39B 1R24A 2RFXA 3TIDB 4D9QD 4X98A 5IG7A 5K9KA 4P9HL 3GSWB 5FF6A 3QNYA 5KN5A 4X0KB 4AIZA 3QG6A 4POZD 5EZJA 2VKXA 3Q6GL 4LPYA 4FXKB 4TTDD 4LEOA 4X83A 5DO2D 5T3ZH 3BT2L 4NNXA 3ZHLA 3QCTH 1A22B 4OZIE 5TFSH 4Z7WF 5T1LB 2OBGA 5FV1L 4P5KB 4K3DH 2FYYB 4LLYA 5I8EA 3TO4B 1C08A 5EBLB 1QNZH 1PG7H 3S37L 1WBZB 3LDBC 5A2JH 5EOCH 1JGVL 2PR4L 1A2YA 1EEUA 3QEQB 4YXKL 3OBAA 4N9GB 5EO1B 4H8WL 3TJHC 1RZJC 3DWTA 3T4AB 4G3YH 3WHXB 1FYHB 5I1CH 1HWGB 1F4AA 3X12B 3HG1D 4G6FB 4K7PY 5CD5C 3HG1A 3UTQA 4PGBB 3AY4C 1RFDH 2CLZA 4YX2H 4FQ1L 4R97B 1D3CA 1OP9A 1CD1B 3ARPA 3QA3B 2Q3AA 4HX1A 2P5EB 5E95B 3OG6B 1KN4H 3NPSC 3BP7B 3KPSB 1U8QB 4XVSL 5IOPA 4KJWD 2FL5A 4M1DL 3S97C 1RZ8A 3BN3B 3BZ4B 3OKYA 1DL7L 3L3HA 4YXHH 1M6OA 1VFAA 4XP4L 1S78D 3MLSL 5E70A 3BIKA 4MNQD 3FQWA 3ZTNL 1J5OL 4MNQA 1JFQH 2NXZC 3EHBC 3BVNA 1FNEA 4ZXBD 2BSSA 4FOMA 1QACA 3AFLA 3C2AH 4OGYL 4ZXBA 4WV1B 2GW5A 4HIEA 3HS0A 4F7PA 4WO4C 3TA3C 3EOTH 4YNYA 4ACPA 3ULVF 3P4OB 4EXPX 5TE6L 3MOAH 1CFNB 2EICA 3DRTB 4HC1A 15C8H 4Y5VB 3IKKA 2D7TH 4ETQB 1H3TA 5JLZA 4G80A 3CH1B 3QRFM 4X6FB 3I6LE 2FNBA 4MJ5B 4PRBA 4AEEA 3RNKB 5C92A 3C8HA 5DJAA 5T3XE 4C4KO 1LO4H 5DF0A 2CUHA 4WUKL 1RZFL 1TJHL 4LF3B 4KI1A 2Z91A 3EO9L 3S3PA 4JM2C 4A2MA 3P11L 4N0YH 3JTTA 4CN4A 4U1HB 5FGRA 1JI2A 3X3FH 3V5DA 5ALBL 4DQOH 2AK4B 1QUNA 3D9AH 5FYJL 1HNFA 1KPUA 1ZHNA 1ADQA 1UKQA 5EBGA 1ZHKB 3MJ7A 2VSDA 3TBWB 1IAOB 5FB8A 5LAXB 4X6CE 1A7QL 3NAAL 1NMBL 1Q72L 1XGTA 4JKPL 3S96A 1MQKH 1EEYA 1Q9WA 3IFPA 2HWZH 3QHFL 3KYAA 3HUJB 4BM7A 4D3CH 5B4MC 5DD1H 3JWDC 3B6SB 3QQNA 3GJFH 4PJCE 2FEEI 4MVBC 4GMTH 3ZDXF 4JGMA 1JWMA 2YRZA 1DQML 3E3QC 3VW3L 1FNSH 3GHEL 2AEQH 2OSLB 3OKNB 3PHOA 5EFIA 4H1LA 4Q9RH 1PDKA 5IBLC 4IOIB 5JNYA 3CVIH 4D2NA 2APTA 1VFBA 2YPLE 3MOBL 3UAJC 1MREL 3DX8A 3W0WB 3I02B 4PJ7A 1CXLA 3K4ZA 5JORA 5B38B 4FQLH 4Y4FA 3WNNA 2B2XH 3GDBA 5KS9B 2YRPA 3PDOB 4CW1A 3KS0J 4Y0GA 1F4WH 3MACH 2DKUA 5D7JC 1JWSB 4YFLF 5DRXA 2W60B 2YXFA 4JPWH 4YDIL 3FOLA 4HWBL 2VIRA 3WSQH 4MAYC 3I50L 1FPTH 3MYJA 3AAZB 2FR4A 2X9YA 2BCKA 3VD9A 1CICB 2AQ3A 2X4UA 2PNDA 4RAVA 4Q9CA 3QXDA 3HI1A 4D9RE 4V1DD 3MLPA 5T1MB 4HJGB 4QHKI 2R56H 2B1AH 4P4KB 3UBXG 3LB6C 5KVMC 4LEXH 3C5JA 2BC4A 3CLFL 3HCVB 1JZ5A 1WZMA 2Y5EA 4O9HL 1N5AA 4BSJA 5DRZB 2ADJB 3AB0C 3TH3T 1F6AB 1NDGA 3DROA 4PJEA 2RCSL 4CU6A 4MAUL 4YBQD 3VFRB 2X4SB 1QEWB 4I18B 5GS0L 5ID0A 4MJ4A 5EZOH 3ZMRA 4JFYB 3ARBB 1HHKB 4FP8H 3QPQC 3SQOL 4MWFB 4O4YL 1DDHB 4TYUA 4WHYH 3SDXE 4KXZH 4GG6A 3OKEA 2VXTH 4JZOB 1PY4A 3LKOA 5IW1B 5B8CC 4NN6C 3VH8A 1G7HA 5FYLL 3WCYA 1DVFC 2A83A 1I1FB 4YZFE 1FDLH 3ULUL 2NY6C 1CFSA 1ZLWK 2WUBH 4IMLA 5BMFH 1YEEL 2FJFB 1T03L 5IM7B 4DKEH 1QR1B 4YHYB 3CXDH 2NY3D 2VLRE 2WBJC 3EJZD 2P8MB 3E3QE 3GIZH 1R0AH 1RZIB 5CAYB 4N0CD 4PJIA 4ZUWB 3RWDB 4BZYA 2Q8BL 3O9WA 1EGJH 3VCLB 2VE6A 5TH2B 4KVCL 5I0ZA 2N4IA 4OJFL 3FT4A 2MKLC 5EOTA 5CZXC 4OZHF 4HJ0D 3HI5L 3IU4L 3TT1H 3ARFD 1Y18B 5HYSA 3GMPA 3F7VB 3ARFA 1CGSH 5AYUL 2DQIH 1JNHB 4M6OL 1OGAE 4LCCC 3RL2A 4Z77A 1CK0L 1AD9A 4TSBL 5C07E 4X5LA 4NDMB 4QEGA 4ONOA 3GHBL 4I2XB 3FT3B 1M4KA 2IPTH 3BUYA 4JAMB 5KSAA 3O11A 4LLWB 4X7SH 3IDGA 1C16B 3H9SA 3RPIB 4I3GA 1UACL 4HK0B 4XGZB 4PJ9A 5I1HH 4FFVC 4OF3A 2AJZA 5DUBA 5B39A 5ERWA 3V95A 3BQUD 5ILTH 4YBHA 2J8UA 4F9PC 1JN6A 1NCDH 3BQUA 1CXFA 5AWNL 4S11A 1I8IA 2XY1A 3SKMB 3N85L 4TOYH 1OP5K 5ECJE 1AGBA 3EOBA 5HHOB 4G8IA 5E5MB 4J3SA 1B6UA 1JJUA 2W9EL 3KPPA 2X41A 1QYGH 4L3CB 4BSWB 4P99A 2W0KA 4GUPB 1RK1A 3VXUE 4WWKD 4A6YL 1TETL 5E24E 1T6WA 4MJIE 4LU5H 3FOMA 4WWKA 1DBAL 2K1MA 5E00B 5FDWB 5FV2A 5MI0B 4POUB 1ACZA 3S34L 4L3EE 3HRPA 1ETZA 1N7ML 3W11C 2B4CH 5C0DB 1KIPA 1ROWA 1FORL 3O3DB 4BA8A 5D5ME 2WQRA 4WJ5A 5J13B 3HE7C 3P40A 4PGDB 3IXAA 5CSBA 5IVXF 1FN4A 1BQLL 4M1GH 2DBLL 2X4NA 1FH5L 4GG8B 2DLTA 4ZYKA 3DIFB 1LP9F 1OCWL 2HVKB 3KNBB 3L3KB 1JGLH 5HGBB 3JWNC 5JHLL 1I3VA 3UTTD 1QFUH 1BZ7A 4U1GB 3UTTA 4XWGH 1TZGH 2DQCL 5EOCJ 5JXEC 4F33A 5D72L 2M1KA 2C5DC 1EFXD 3L3GB 5EO9A 1MCBA 1EFXA 2NZ9D 1KCUH 3ZE2F 4RAUA 3SE9L 2OR8A 5MP6H 4R3SB 3TBVB 5I2IB 3N0PB 4WI9A 5F70A 5KANG 3RWHA 1IC5L 3Q3GB 2EIBA 3VRLF 2VUOA 3VRIA 5J1SC 4NO5A 4JPVL 1BZQK 4MQ7A 1OF2A 1UADC 2DLFL 4KDWA 4WY7H 2F5BH 3PABB 4HKZB 2JTDA 5CD5D 3MBEC 5ICYB 5IESL 1KTLA 3P2TA 1N59A 5DUMH 2EO1A 4NQTA 3UC0H 3QNXA 4X6CA 1HQRB 3GM8A 43CAA 4Y5YC 2DQUH 1WWAX 2HT4C 1YJDC 4YHOL 3D1MC 5ICXA 4PJCA 3TO2A 5ISZA 5JPMA 2AV1A 4NC2B 3WKMH 3PDGA 1Q9LB 3NBNA 4GSDH 3G5XB 4KJQC 1X5HA 4QRRD 4R2GB 5EO0A 3RDTC 1YEJH 4KK9C 4QRRA 3C2SA 1WBXB 3MV7D 4Y16D 1QRKA 3PJSB 2YPLD 3MV7A 4GRLA 2MCPL 4Y16A 5LGJA 2OP4L 3KYOB 3EGSB 5DYOA 2YPLA 5HVWA 1W0WB 1P7QB 4ZQKA 5L8JB 1UKTA 1FC1A 4NQEE 5IJKA 2G5RA 1BEYH 4FQIL 3B9KC 3G9AB 2HLFC 2V2TA 1IAMA 4KMTH 4PRPD 1L9MA 4WO4D 1EJOH 3TA3D 4LRNH 1N6VA 4PRPA 1RIUL 4WO4A 1EVTC 1FG9C 5JMRA 3WN5A 2I24N 1S7QB 2YD2A 5CEYA 3FHAA 3GSVA 4HUWA 4HXAH 3RFZC 2ESVB 1G84A 4D9RD 1NH6A 2PYFB 2Q76B 4P9HC 3Q5OA 5SV4A 4U0QB 3OKKB 3UO1L 43C9B 5JDJA 2R0WH 3Q0HA 4WW2B 3NABH 1QVOA 3QFJD 4ENED 4BKLA 3U4AA 3IJHB 3IF1A 5KVGH 3QFJA 1EXUA 1G6RH 3SDCB 3KPMA 1IE5A 1W72A 3S4SG 1E0OB 3WS6A 3L95A 4XBGA 5GGSY 1EPFA 3QPXL 1P69B 1S9YA 4KKBD 4K23H 1U58A 3OKDA 2XKUA 4BJLA 5KSUB 3P3YA 3G5YB 3TVMD 4EEEA 5FYKE 3OJMB 1JMZA 3TNNB 1FBIH 3LPFA 3TVMA 4UILH 4JY6B 3SDAB 1KEMH 2R69L 2E7MA 4ELMF 4L8SC 5FA4B 3ARED 1YY8B 3PWLB 3TLRA 3AREA 5C2BH 3BPNC 2V5YA 3D18B 5B4MD 2FEEL 3FQXB 2VLMD 4P2QE 3GSNB 1JTOA 4MVBD 4OFKA 1YPZA 3HZKA 1NQBA 5I1EH 1NCWH 2BVQB 1KJ2B 1WBYA 1M7IA 4PJBF 1HILB 1BFOA 4K55A 3KPRE 3K1KC 3C6LB 2BHZA 3I75A 4H26B 1OD9A 5GS1A 1XMWA 12E8L 2AJ3B 1YN6B 2DQFA 1NGPL 3QI9C 3VDBA 1S7VA 3OXSB 4K3JL 1R24B 4CAGA 2AK1H 2XTJB 5IG7B 4PJ8C 3BP5A 5FFLA 5DMYA 3KWWA 5KN5B 3WFCL 2NY1C 3HR5A 1Z6JT 3LCYA 3M1BA 4ZO7A 2DJUA 4AIZB 1OGAD 5L0QB 5D7JD 2VDMH 1F8TH 5DI8A 4LEOB 4KRMB 1OGAA 4BH8A 5D7JA 3HA0A 5C07D 3C08H 5FUOL 4MAYD 5FM5M 2XQBL 1D6VL 5C07A 4NFDA 1K2DA 2SEBA 4MB5A 5E8DH 5I8EB 1PYWA 5GXBB 4QF1A 3U2SA 1J18A 2BVPB 1A7PH 4EQ2A 4TVPL 1G0XA 4P23A 5I1DA 2VXSH 1UT9A 3FO0H 5B3JE 5D93B 3HLAB 1A2YB 4MDIA 1A6VL 4Z7UF 5D2NC 3WNOA 4P5TA 3TBTA 1D9KC 3NGBC 4I0PD 1F3RB 3F7YB 4U1NA 1KUMA 1CIUA 1OSZA 4I0PA 4FN0A 5IT2L 2E9JA 3T2QA 4OCYH 1GC1L 5ADPH 4R7NA 1SEQH 3HG1B 3UTQB 4WTZG 1KOAA 3GRWH 2CLZB 1QRNE 5ESVA 2FO4A 5LQBH 1FO0H 4JFEE 5I8OH 5F3BA 3D5OF 4PG9B 3JWOH 2D9QB 3QCUL 3VXUD 1OWRM 4G43A 2X4TB 1K5NA 4RIRB 3NTCL 5FEBA 4MJID 4NQSA 1DVFD 4HX1B 3UROR 3VXUA 1R5WA 2VLLA 4BH7A 5B8CA 5DQ9A 1KJ3L 3KPTA 1DVFA 2QADD 3LRSA 5DC4B 4L3ED 2EE9A 3MZTA 3N9GH 3S88L 5IOPB 4L3EA 2FL5B 1FAIH 2J4WL 2F15A 2ZUVA 1RZ8B 4KQ4L 2WBJD 1FRGL 1JRHH 5C0JA 1M1SA 1TJIH 3L3HB 5FHAH 5JIIA 1M6OB 1VFAB 3DSFL 2WBJA 1TZHB 3MRJB 1SY6L 3BIKB 5D7LE 3FQWB 1A6UL 1A5FH 1NCCH 2OI9C 3OGCB 1HHJA 1FNEB 3BVNB 4ALAL 2QQQA 2BSSB 25C8L 2HH0L 5DEFA 1IEBB 3PWPE 4F7PB 4GAYA 1J88A 2DDQL 4X80H 1DSFL 1A6ZA 1QKZL 3A67H 3UMTA 3IGAA 1A6WH 3NFPA 1IM9D 3S36H 2AVGA 5I1JL 4OM1L 5JLZB 1T1ZA 4G80B 5CSGA 1S9VA 4QHMA 3GMQB 5FCUL 1GSMA 5EWIH 4HIXH 2VZ3A 3IAGC 3HRZA 3CSGA 4S1RL 4FA8A 1RVFL 4M93B 2Z91B 4TSCL 4Z7VA 1FL6A 1HOCA 3JTTB 4GW5A 4PJXF 2QQNL 1ACYH 3TYFB 3IDNB 3EYQD 5D2NE 5C86A 3V5DB 4AG4H 1EBAA 5CEZH 2A6DA 4G6JL 3FMGL 4YXLH 2OR9H 1KPUB 1VSCA 3GNML 4JANA 1ZHNB 2UUDH 3AS1A 1UH3A 5FB8B 1XGTB 1FP5A 3MLUL 4MA1B 3S96B 1EEYB 1Q9WB 3QQ3A 4DEPB 4JY4A 3K8MA 2GAZA 3IFPB 1F58H 3UTZA 3I6KA 1BQSA 4MXWL 1YQVL 3H9ZA 2HP4A 4M7JL 3GEWB 1JWMB 4K3HA 2XRAL 4RGOH 5GSRB 1JWUB 2ICWB 4JO1H 1CXHA 3V8OA 5CBAB 1JTPA 2QKIA 3SKOA 1BX2B 4H1LB 5C0BD 5IB1A 5BOZG 4NQED 4WW1A 5C0BA 2ZOKA 4BSVA 1U8PB 5T3XH 4NQVA 5JNYB 3GSOA 4NQEA 4P46C 3QHZL 3ULUC 3DX8B 1JHLH 2R2EA 3MRKB 1CLCA 3HE7D 4PJ7B 1HINL 4M43L 3BKMH 1MFEH 3HE7A 5EU3A 4Y4FB 1F42A 3GSUA 3O3BA 4RSVA 1YYML 2WWMD 4OM0H 3J7HA 4CW1B 4LASH 5TF1H 1RZJH 2ZUQB 5GIRA 2C1PA 5DRXB 2GJ6E 2VIRB 4MJ2A 5JXED 1UM6H 4LSRH 4P49A 3MRMB 3TBYB 5CZVL 1I9IH 1HE7A 5HPMA 5EZLA 3HPJA 4NKDA 4XH2B 4L8CA 1GGTA 1H8OA 3CFBA 3MYJB 4NZJA 1RU9H 1KLGA 2BCKB 4RAVB 1I9RL 3QXDB 4N8CL 3OAUH 3SCMB 3H3PH 4XCYA 4TPRH 2MTPA 2ZJSL 3C5JB 2NTFB 4G8FA 3D48R 4KH2A 2WZPD 4XNZC 1G9ML 4XPTH 5GGUA 3BPOC 4U6XA 5FYKD 5C0ND 3EDJA 2ICCA 3EW3B 2CSPA 4PJEB 1JNLL 3ZDYF 4PJFF 1KENH 1NCBL 3RJDA 5ID0B 3IDYC 3MBED 3K2MC 1I4FA 4JFHE 2BSED 2Z8SA 4HW6A 3MBEA 1GRWA 2R2BB 3B8YA 1X5KA 4L9DA 5L2JB 4U7KA 1S7UA 4KFZC 4DAGH 1HHHA 4PJ5E 4PD4K 4PBWD 3ZYJA 3RGVC 3BP6B 4LSPL 2NY2D 1G7HB 5IVNA 2A83B 5BW7A 4J1UA 3KPRD 2XWTA 4HQQH 3PHQA 2X9WA 3RDTD 4IMLB 5JOEA 2D7QA 4LHQB 3KPRA 1S3KL 4C83A 1MSPA 3QIWC 4OD2A 3WLWD 3K8KA 1AQKH 4WU7A 3ZT6A 2G5BB 1X4YA 2NY3B 1U3HC 4PJIB 4LIQE 3O9WB 1MFBH 1HEZA 2VE6B 3LAFA 5FYLE 1MI5E 5CGYC 3B9KD 4AEHL 2HLFD 3FT4B 4FTVE 4PLKD 3VFOA 4MD4B 3ULUE 2VDPL 4XP6H 3RVVC 1AE6H 4K07A 1DE4A 3WHE1 2VDKL 3LEVH 4PP1C 5F96H 5HYSB 3ARFB 3LQZB 1HXMA 1F4YH 4U6VH 3VG0L 4Z0BH 3RL2B 1JPSH 1YMMB 2I25N 4Z77B 1AD9B 3MBXL 4OBRA 1RUPL 4U3XA 4DWHA 1ZA6B 3SO5A 3BUYB 5KSAB 2DKMA 4FZ8H 3FQRA 3IDGB 3WJLC 2Y5TA 3H9SB 1KF9B 5CJBA 3LS4L 4PJ9B 4U05A 3JWDH 4NNPH 4F7CA 5B39B 5ERWB 2B5IB 2IPUK 1U92A 5B38G 5BVPL 3OGOE 1CDYA 4JDTL 4CUCA 2J8UB 5IHZA 1JN6B 2NY5L 3G04B 2NW3A 3BQUB 1J0IA 4PRIE 1I3RB 5E6YA 1I8IB 5I76A 5EC1A 1HQ4A 1GGCL 4UNVA 1QRND 3UDWC 4OSUH 4EN3C 4X5WB 2OLDA 4LVEA 1M05A 4WTXA 4JFED 3W2DL 4BQ9A 1QRNA 1AGBB 3EOBB 2ZG1A 3NH7H 3GMRA 4OCWH 4G8IB 4JFEA 4PB9H 3VWKC 5FO8A 1LK3L 5FECB 3S8WA 3KPPB 5ANMA 5AG8A 1F00I 4MB3A 3A6CL 4P2RA 3D2UD 3CVHL 1AH1A 5T1KD 4PV9A 3MUZ1 4JY5L 4S1SL 1RK1B 3FJTA 5T1KA 1KIQA 1SYVA 2JJSC 2WBWB 3HMWL 5E1AA 5DMKA 4F8TA 2X89D 3ZKND 4WWKB 4NM4H 3QAZB 3D0VB 4LSQH 2DYPD 5D7LD 5E2JA 1EDQA 3IT8D 1ETZB 2DYPA 5D7LA 4RGMC 2IGFL 5DA0B 5IHUL 3MGOB 2VXQH 4YDJA 4X4XB 4WJ5B 3PWPD 5EZIL 3PWPA 1KT2A 4XPBL 1IBGH 3T2PA 1TJGH 2EH7L 4G6KH 4PJAE 4ZYKB 4Z76A 2KZWA 3V7AG 1G7QA 4U31A 2Y23A 4ZG1A 3MNWB 3UTTB 4W4NA 5DWUL 4Y1AE 1I8LC 3ARGD 1RUMH 1LO5A 3TJEH 4G9DB 2DQEL 3OV6A 3ARGA 1EFXB 5FUZH 4ODHH 4RAUB 4PTTB 4WI5A 1ZTXL 4JHZA 1ZV5A 1C5BH 1IQWL 3KLHD 2HA1A 3BGMA 4WWID 5A1AA 3FCTA 1S7RB 2E27H 3K4DA 3KLAA 4ZPTB 5ICZB 5JZ7C 5SWSE 1I3UA 3RWHB 1CD9B 3W5NA 5C0RH 4D8PA 4L4JA 5GRJH 2IFFH 5EC2A 4MQ7B 4NQDE 5DK2A 4CU7A 1MJJB 1OTUC 3H42H 5FHBH 1KB9J 1PKQA 3QUYC 1HIMH 2ZPKH 1UGNA 2FLRT 1KTLB 4X6BA 5JHDD 1N59B 2XZQL 4MNHA 1IGCH 2FWOA 3QNXB 5JHDA 4BQ8A 4RGNC 3ZHDA 43CAB 1UM5H 2OJZH 2R23B 1Z2KA 3THMH 5KZCB 1Y6NR 2OMNA 5F9OH 3QZWA 5ICXB 3TO2B 4NZTH 5ISZB 3O3AA 4IRJB 2AV1B 4E9LA 2DTSA 1WSST 1YC8A 2HFGH 3ARXA 4EOWL 3GI8H 3OX8A 5EO0B 1RMFL 3V6ZB 4NRZA 4MD5A 4QRRB 3VGHA 1NBQA 3A6OA 3B43A 4GRLB 3MV7B 4G9FA 4Y16B 5CGMA 2ADFL 2H2SC 3HC4L 2YPLB 5DYOB 1SMOA 1VGEH 1I7ZB 4HK3J 4N0FA 4HV8B 4X7TA 4TNWK 4S1QL 3ZYIA 2KH2B 2QHRH 2UYLA 3BPLB 4F37F 3SGKC 1FZOA 1DQDH 2CUIA 3QH3B 5HDOA 3C8DA 2EDKA 3LD8C 4QGYA 5J06A 5KSBE 1K3ZA 4ODXB 3MRGA 5EBWB 2DOCA 3P9LB 4OUUA 5A2FA 4XAWH 3QDJE 2GJ6D 4KPHH 4ELMB 1MFAH 2LTQB 2Y6SC 4PS4H 4PRPB 3X14A 5I66A 4LSUH 5D71H 1UH2A 3V5HA 2AQ2A 3GBNH 3WN5B 1FFPA 5CJQL 2W9LA 3M07A 3O2VL 3GSVB 1NUNB 1Z0NA 5D8JL 2Z92A 1I9JL 4I13B 3BWAB 3FT2A 3MCKB 5GISH 1A6AA 1KACB 1HI6A 4ZOCA 2KKQA 4EIZC 1AXTH 1N6UA 3MRHB 4G7YH 2DM7A 4BKLB 1VA9A 3IF1B 3O4OB 1QTYT 3NIDE 3QFJB 1EXUB 5C8JB 3OL2A 4HWBA 4XTRC 5ID1A 2CJUL 5HHXL 3EYOA 3L95B 4XBGB 3RKPA 1S9YB 4WNQA 1U58B 1S7XB 4O02H 4JFHD 1KPVB 2Q7NA 1PJ9A 5GPRA 3ROLB 4IHOB 1MPAH 3TVMB 1FL5A 1GCFA 5L2KA 3NIGE 3STBA 4PJ5D 4X5XA 4JDZA 3T0DA 3AREB 3KYKL 4M7KL 4PJ5A 4B5EA 4XPGH 4Q6IC 4CADA 5GS0D 3LMJH 4JKWA 2IQ9L 3E1F1 3OG4B 3N1QC 1YPZB 1K8DA 3HZKB 1S5IL 4MA7L 2OTUA 3W39A 3SE4C 4ODSL 1DFBH 3LS5L 1UC6A 1M7IB 3VXTB 1BFOB 2DQHL 1DN2A 4MSWB 5E03A 2OR7A 2VLKE 5FYLD 1MI5D 1ZEAL 1X4ZA 1MCHA 1RJYA 3IFNL 4P46D 2DQFB 1MI5A 3ULUD 1UB5B 4I1NB 5JOPE 2CR3A 2EKSB 4F15C 5JQ6H 1S7VB 5CHNB 4M5YL 1MF2L 3OR7A 2HRPH 4HF5L 3BP5B 4PG2C 4Q0XL 1B3JA 2X1PA 4L9LA 3KWWB 4OQTL 3HR5B 5GGSA 4IIQC 4YAQB 1C8PA 4ZOAA 2RHEA 3DSNA 5FYKH 2UY7A 3GO1H 3M8OL 2AV7A 5C08D 3QIBD 4BH8B 3W9DA 1VESA 5C08A 3MLTA 3QIBA 5L8KB 2H32H 3N50A 1B2WL 2O61B 4HULB 1T7WA 2YBRA 3O0RL 1PYWB 4JN1L 4NUGH 3V4UL 4M7LL 3U2SB 1EH9A 3D3VB 4P23B 5I1DB 4N0UA 1L7IL 3BWUC 2EKJA 3FN0H 3T3ME 3O8XD 2ZCKL 3U1SH 4F2MA 4Q97A 3BXNA 5I1AB 5IHBA 4PRID 1RUKH 4P5TB 3O8XA 3TBTB 4MNGA 3CFCH 3MLVH 5CBEA 2C1OA 4PRIA 4U1NB 1FGNL 1YEKL 3QUZD 3DMMD 3VMOA 4I0PB 1OSZB 1INEL 3QUZA 3DMMA 2LAGB 5E2VL 2MKWA 3HMXH 1IKNC 3BRGC 4TVPE 1WIPA 3QDMA 3BKJH 4LQ1A 5ESVB 2FJGA 3MV9E 5F3BB 5CP3A 2CK0L 4G43B 1K5NB 4DVRL 4LARL 2JJWA 4BH7B 4D94A 1R5WB 2VLLB 5GQBA 5DQ9B 1JMXA 5E7FA 4NN7B 2XYCA 1PG7X 1CD0A 2P24A 5HHQA 4X9BA 4NJ9H 4WEBH 1RJLB 1LGVA 4NJAH 4LSTH 4OCXH 4P2YA 2ITDB 4HPYL 2FHCA 3DI3B 5DDHA 5DUPH 5FM5O 5F21B 1DEEA 2XN9B 5ITFA 1G7JA 5ADOL 3QEGH 1IGTA 4A6YA 2P4AB 3U6RA 1HHJB 1NPUA 5CJXC 5EOQL 1MY5A 3I84A 5CSZA 3E2HB 3QUML 2E6JA 4OCSL 4ZSOB 4MCYB 1JNNL 4PRNB 5DEGA 2JJTC 4KJYA 4Y1AD 2XY2A 2E7HA 4IRSB 1UJ3A 1A6ZB 4Y1AA 3VFSB 4JFDE 2EC9T 3AM8C 3NFPB 4GRWF 2NXYD 4IM8A 4YFEA 5D1ZC 1S9VB 4QHMB 1YEHL 5HVHC 3AXLA 3GMLA 1XCQA 4XT1C 4LLDA 4R90L 1UA6H 2DWEA 5SX4H 2W1NA 5SWSD 3HRZB 2E7LA 1RK0A 1CFQB 4B0MM 4Z7VB 4NQDD 2I9LB 5I73C 1FL6B 1B0RA 1HOCB 4N1EA 4Q74A 4O2EB 2AXHA 1P7KA 3K2UL 3VWJC 1ZHLA 3KXFE 5A3ID 3MNVA 1TPXC 4OD3L 3RZCC 1VERA 1AHWB 2CK2A 5BVJA 4JANB 4FQXD 4ODVL 4N9OB 1PKOA 2QQKH 2D3VA 5AZEH 5GJSH 1FG2A 2ZCHL 4NCC1 4FQXA 4POYA 2B39A 2IMMA 2XZCH 3G5ZA 3NFSL 4NKOA 1URLA 4B7IA 3QQ3B 5IFHH 4DTGH 2CKBH 3UTZB 4JHWH 1NSNH 2O93L 1INQA 1GOFA 2ARWA 4LLUB 5D7IB 4HXBH 1V5JA 3FQNB 3BEVA 4N90E 2VQ1A 4QXUL 3WIFB 4HKXA 1GOHA 2DI7A 3SKOB 5KTEH 5IB1B 4NGHL 4OGYH 3BD5A 1J1XL 4WW1B 5IF0B 5C0BB 2ZOKB 1H0DB 4BSVB 4E42A 1WQVT 3PGFL 1LO3L 3OZ9H 3GSOB 3VXSE 4NQEB 2CH8A 4F80A 2BVOA 4GXUN 5KSBA 1X4XA 3BGAA 1QLFA 3QDJD 2E6PA 4DFHA 5L7XH 5EU3B 4HIIA 3F7QA 3QDJA 1MNUH 5HYJD 1TZIA 3O3BB 4OZIF 1HZHL 3NVQA 5DURD 1IAII 1MCCA 5HYJA 1HH6A 5K93A 5C6PB 5GIRB 2C1PB 1D6EA 1AXSA 1CGUA 3ARDB 1GHFH 1OVZA 1AY1L 1BAFL 1AI1L 5HPMB 4LKCA 5DD0L 3HPJB 4NKDB 3QJFA 1CE1L 5F1IA 3CFBB 1KLGB 2HLAA 4HWEL 3FRUB 3OAYH 3MMEA 5D70H 5E94A 4ZFFA 4OT1L 2MNUA 1K4CA 4DVBA 1T22A 3MRBB 5JZ7D 1MCKA 5IMOA 3O6KH 4WI4A 5LJYH 4M48H 4G42A 5INCA 4Y4HC 5GGUB 1XGPA 1NUFA 4Z8FH 2EH8H 3CC5A 2GJZA 1OTUD 5K9QI 5IGXH 5E4IA 4OZGE 1I4FB 2QSQA 3H0TA 3ZT5A 4QHLA 2NMSA 4XXDB 1Q0YL 1BLNB 5C6TH 1BIHA 1QFWI 2A9ML 2NY5C 4NQXA 1S7UB 1KNOB 2E7BA 4XHQA 1HHHB 2X4OA 1NBYA 2E8YA 4JZJB 2X4PA 4UIKH 3I2CH 3NACL 4O51A 5D2LF 2XWTB 3PHQB 4LVOC 1MREH 5IB2A 4C4KT 4OD2B 3KLSA 5EU7E 1HKLH 4DGIH 1Q0XL 2NX5A 4YO0A 5IV2A 4LSVH 5J3HC 4WI6A 1IC4L 2XXCB 5FO7B 2R9HC 2FGWL 5GS2H 1HEZB 1EJ6A 1UEMA 2IBZX 2J1KA 1CG9B 4YGVA 1AD0A 5F7WC 3VFOB 3PNWA 5E2TH 4CL7A 3OSKA 5GSVA 1FYTE 2P7TB 2ICWI 1M71B 2BK8A 3RTQC 1I1YA 4PY8I 1UM4L 5C09E 2Y6SD 3U7YH 4N0RA 1WGOA 4QXGL 1HXMB 3EFDH 1YNLL 5IW3A 4OGAD 1T7ZA 3QG7L 4LLMA 4H1LG 1VEOA 3OB0H 4JZNA 3T3PE 3SDYL 1MJ7H 3LQAL 3RX5A 3BKCL 3UPAA 3FQRB 3U9PL 3JV0A 2Y5TB 3AU1A 4QRTA 1DEDA 4XTRD 1V8HA 3QQ4B 1TXKA 4F7CB 2Z31A 2J88L 4P59L 1OT2A 5F93C 4XPHL 3CZFB 5IHZB 1SVZA 4O4YH 1OSPL 3DUUB 4KKNA 4TVPD 4LCUA 5EC1B 1HQ4B 4X6CF 3BDYH 5KVDL 5CUSH 4LIQH 1Q1JH 4RNRB 1EERB 3MV9D 1NFDE 2V5MA 1FFQA 3VD3A 4JFEB 3UP1A 5FO8B 3ULUH 2K7QA 4HUNB 3QCVL 1U0QA 1LNUA 1NLDL 2BNQE 4HUVA 5ANMB 1WAAA 4FABH 1CLZH 2VOTA 4P2RB 1FJ1A 4GBXC 5I6XC 5HHVH 3AVEA 3F58H 3WXWH 5T1KB 1KIQB 2ZP0T 1SYVB 3BKYL 5DMKB 1BD2D 5JR1H 4OCMC 3O2WH 1A64A 1LE9A 1BD2A 1F3DH 3O41B 4I5BB 1EO5A 4NO3A 3KJ6L 5F97E 2DYPB 1DQQA 5CEXA 2DI9A 1BZ9A 3TZVB 4HS6A 4P2OB 1HHGB 1ZANL 1L0YA 2PTTA 4YDJB 1CIDA 2EEAA 3V8CA 1X5YA 2DQGL 3HE6D 4JFZL 4KK8C 1KT2B 3MUGA 4UUJA 3U9UA 3HE6A 1NGXA 4I77H 3DO3A 2PXYC 4OFVA 1G7QB 4LK4A 1CDGA 4KJPC 1MAML 4K9EL 3NIFE 4OLWH 4EJ1C 4Y2DB 2MCG1 1LO5B 1UVQA 5GRXG 4JPIA 4YR6A 3ARGB 4ZAKC 3WKNA 1PG7W 3I3DA 5D6CB 2P44B 3EJJX 3MJ8B 1FE8L 1FAKT 3BGMB 4JM2F 1GIGL 3EOAB 2ZUUA 5IQ7L 1MCFA 2KPNA 4XNQA 1PZUB 3NZHH 2L7UA 5H94A 1RUQH 2ZCLH 2YOCA 4D8PB 1OP3H 5EC2B 3SDXF 4U1LA 4RX4D 5CKGA 1B4RA 1PKQB 5HYSG 2PCPA 1UCBL 4RX4A 2VC2L 4X9GA 1BBDL 2CQVA 2JCCE 4MNHB 2CRMA 4LCWA 5JHDB 1T80A 1T66C 2AABL 2UWEE 4LAQH 3QDGE 4YZFF 1J8KA 4JQVC 1QLEL 3MRDA 5DTFB 1AGFA 5DVNA 3TO4C 3KPLB 1BF2A 3QZWB 3F7PC 1RZKC 3O3AB 1JI1A 3CSPA 4KKAC 5LCVH 3EYSH 1GL4B 5EG6C 1VDGA 1T3FA 1LO2H 2JIXD 3OX8B 5J4MA 2KDGA 1WICA 2DIBA 1N4XH 2JIXA 5B39G 2CR6A 4NRZB 4MD5B 2FEDC 3VXSD 4RCAA 2VDOH 4YHPA 4G9FB 1P5UA 2OTPA 3VXSA 5L6YH 5CILL 4XHJC 2EC9U 4N0FB 4X7TB 1ZT1A 1HSBA 1UG9A 4KRPB 1OAXH 2MWCA 3CCHA 3R06B 2Z8RA 2UYLB 2HVJB 1FZOB 3WIHL 5J12B 4CMHB 3RRQA 2ARJQ 3MXVL 2HKHH 3MRGB 1UWEH 2QR0A 4R97C 1KJ2L 5C7XH 4OUUB 4Q9QL 1EEZA 2YD1A 5HHME 3X17A 3TGXA 1C5DA 3PGCB 3P0VL 3SQBA 3V6FA 5I66B 3U30B 3CXHJ 5I1GH 5M95B 2H6PA 3V5HB 1NMAH 2EIEA 1FFPB 1JPTH 5IK3A 5I1IH 1HKFA 3RWCA 3ARTA 1CYGA 3AM8A 3V9FA 4JG1H 3W9EA 2FBJL 2Z92B 3PV6A 4BK5A 4U1KA 1HI6B 3UTSB 5CIPA 4BFBD 3IDMA 3DV6B 4PJGE 4BZ1H 4G8EB 4HZLA 3JV5A 2VR5A 3DURA 5ID1B 1MCWM 1AGEA 1WZ1H 1JL8A 3ZTJH 5IESH 1HHIA 1N64H 4C57C 3FTGA 1J0YA 3TEUA 3D39E 4WV1C 3ZT7A 2ICES 4WNQB 5BZWB 4JB9L 1MJUH 2VH5L 5DT1H 5E6ZA 1AJ7L 5F88A 5HGHB 1L0QA 4R26L 3WDIA 2F5AL 3SDDD 1IAIM 3BD4A 5GGQL 3SDDA 1FL5B 4Y5VC 5L2KB 5AZ2H 4X5XB 3RIFF 1HYSD 4JE4B 4JDZB 4ZD3L 2ATKA 1P4IH 3C5ZD 3BYYA 1JYXA 4P3CH 2V2XA 1OPGL 3C5ZA 4P3DA 5JUEL 4I3SH 4KZDH 1K8DB 1NCTA 2R4RL 4ZS7H 2OTUB 3W39B 4WEMB 1K9TA 4I48A 3BSZH 5DJYB 5I1KH 1YEGL 2XWBA 3QEQE 3PXJA 1F4XH 1CFTA 4UAOB 5D5MF 3ULVL 4OQ1A 4ZO9A 4U0RB 5D4QA 2XKNA 1F6LL 1KCVL 5DGRA 5D1QD 1ZLSL 3E6FB 1A7OH 3IJSB 5HJ3B 2AGJH 5D1QA 2ENYA 1NANI 5C09D 5FA3A 2AEPH 2VMFA 5KVFH 5C09A 4XMKH 4XC3H 3LH2H 4L9LB 1IAIL 3ARVA 2H8PB 1U3JA 1H3PH 1QFWM 1F6FB 4GMSH 4HCRH 4HDIA 1G6RB 5JO5A 3O6LL 2GSIB 2Z93B 4HT1L 4OLYH 5HDLA 4J6RH 1RQ5A 1UFUA 2EZ0D 5ITBH 2P5EE 2QSCH 2YKLH 5C08B 3QIBB 4B53A 5TQ2L 3KPSE 3KPQA 2ZOLA 3QIUA 1KSRA 2IADA 2YBRB 2HFFA 1KTKE 5CMAA 4PUBH 3S5LA 4KROD 3WDHA 4N0UB 3LEYH 3QO1B 1FLTX 2VDNH 1OM3L 1I3GL 2OZ4L 3ARUA 2XG4A 1OAUL 1KC5H 3O8XB 1MVFA 1UWGL 4MNGB 4FQCL 5F1NA 5CBEB 2H26B 3UYRH 1YEDA 5IBTH 5T33L 1SQ2N 4KHXL 4YH6A 4DCQA 3FONA 1VFOA 4X4ME 5IROA 3QUZB 3DMMB 3TN0D 2VL5A 4OF5A 3MXWH 3ILPB 3TN0A 1RV6X 4ZO6A 3QDMB 1QFWL 3PP4H 4CMMA 4P57A 1YECH 5DJ6A 1NAML 2FJGB 4WCYH 2HFEA 1LEGA 2N7BA 4XC1H 2JELH 4LSSL 4XRCA 2ID5A 1MLBA 2A1WL 3VFPA 2A2QT 5FM8A 4UTAH 4XI5D 4P4KC 3FB7A 1NAKH 4AL8H 4LHUD 2P24B 5HHQB 1A14L 5IB5A 1GZPA 3UYPA 5SX5K 4LHUA 3GUTA 1A6TA 3Q1SL 4TUOA 5CD3B 1XGQA 2H2PC 5K9JL 3HAEH 5IHLB 1AP2A 4K2UH 4OKVA 3FFDA 1U6AH 4HBCL 2MPAH 5DDHB 4I3RL 4I18C 3CVHA 4YEFA 4J3UA 2OXHA 5ITFB 4ZFGH 2AK4E 1BVLA 3GMMA 1IGTB 4A6YB 3U6RB 4JQXA 4ZUTA 3ZZ1A 5DJ0B 3M17A 5DLMH 1YNTB 1MOEA 1LO0H 2JB6B 3RAJL 1BBJA 1MRCL 3BISA 2CMRH 3WUWB 3QUXA 3H3BC 3T0EA 3GSXA 4WRLA 3KYMA 5HDQH 4KJYB 3SGEH 5IMKA 1UJ3B 3HUJE 2FB4L 2BNRB 3WD5H 1EO8H 2O5ZH 1A3LH 4O5LL 4I9WE 4QTHB 5BZDA 1LDPL 4YHYC 1FV1A 1B0WA 4OTXH 3AXLB 2NXYB 1XCQB 5F7MC 3REVB 3CDYA 5DJ2A 2BNUA 4LPTA 3O4LB 4ZDHB 1FQ9C 1IGML 3C09B 4Y5XA 3RA7H 3U46A 4QYOB 2YPVL 4J3OC 1ZOXA 4OLUH 1A21A 1GAFH 2AJXL 3LIZL 4GAGH 3TPUA 1FO0B 3RQ3A 2WBKA 4LP5A 1B0RB 3IDJB 3C6SB 4BZ2H 4CBPA 3W0WE 1P7KB 4FZEL 1WIUA 5HI4C 2Y36L 3NFNB 3MUY1 1YYLH 5DFVC 3E8UH 1T89C 4JO3L 1QSZA 1FLRH 2V9RA 3V4VH 3C5SA 3MNVB 2ZSVB 4LMQI 1HH9A 2EDTA 3F62A 5KS9E 4HKBA 3QDGD 4ZFOL 2JCCA 5BVJB 4LPUA 2UWEA 5DD5H 1FG2B 4FQXB 1P6AB 1I1AB 4ZFZA 5IWLC 4N5EC 1RUAL 4NKOB 2C26A 3S36X 1F3DJ 2XWJA 1I1RA 4GBXD 1ZGLB 3VJ6B 1R3KA 2ZUTA 3A6BH 3KR3L 4GBXA 5LBSH 1INQB 3EYVA 3OTTA 1EIBA 1WT5C 1BGXH 3VXOB 4KZEH 3BEVB 2VQ1B 1A6UH 4HKXB 3ZE1E 2FX7L 4WFFD 1CQYA 2DI8A 4LLVA 3SKJL 1BM3H 4E42B 4IOFC 3BAEL 2BVOB 4M62H 5I30H 2RR3A 2CXKA 3D0LA 5HHMD 6FABH 3B2UD 1XT5A 1MWAA 4KK8D 1SEBA 2WUCH 1U8NA 2F58L 2WK2A 3DVFA 4WUUA 3BDXA 3MLYH 4NO0B 2D4FA 1TZIB 2R1WA 3F5WA 1R3LA 5HYJB 1HH6B 3U0WH 3HC0A 1D6EB 3V7AE 1P9MC 1ORQA 3WFEL 1XEDA 4EI5B 5F72S 3HC3H 1OHQA 4Q6YA 3BN9D 4UDUA 4F3FA 1N2RA 1UQSB 2ZG2A 1RZ7H 5MI0C 3UCRA 3ZKQD 5B3JF 4ONGL 5DMIL 1G7IA 5F1IB 3RX7A 3SO3B 1EHAA 3EZJB 4YGAB 1WF5A 5ALCH 1CU4L 4YDKH 4JFQA 3MMEB 5E94B 4PJGA 2J2ZA 3SY0A 3TPKA 4ZFFB 3HNTH 4R4FL 3LHPH 1K4CB 3INUL 4DVBB 5AD0A 1T22B 4NRYB 1S7TA 3D39D 3L7EB 3S98A 4WFED 3VRJA 1QBLL 5IMOB 3D39A 4G42B 1XF5A 4OAWB 5INCB 1XGPB 3V5KB 5EPMA 3CC5B 4HAGA 3UPRA 3MJ9L 3LQAC 4M1CC 3BUTA 4X0KA 4U1GC 4KTEL 3H0TB 4JM4H 2DQDH 1Y0LB 4QHLB 4EKXA 4NNYA 1MHEA 1H5BB 5T1LD 1BWWA 4Z95H 4X99B 5JIKA 5T1LA 2OX5A 5SWZB 1F45A 5I8KL 4GW1B 2X4OB 4AEFA 1NBYB 3E0GA 1YNKH 4E5XA 5E8PB 4J4PD 4DW2H 3QEQD 4O51B 1KPRB 5E9DD 4UT9L 4J4PA 2RQ8A 5FGSA 3ZLQC 5E9DA 4F9LA 5LXGH 3MRPB 5GZOC 3PWUB 2ZUXA 4XAKD 5F7LB 3T4AA 1QLRB 2NX5B 2YA2A 4KTDH 5IV2B 1IC7H 4KDVA 2NY7L 4HIHA 4ODUA 1J9CT 2QL1A 1D5ZB 3EYUH 2EYSB 3MV01 1PX4A 4NWTH 4YGVB 1AD0B 5DJDA 4AMKH 3PNWB 5CZVH 3S7GA 5HHOE 1ORSA 1XIWC 1MIMH 2MJWA 4C56B 3QA3A 2P5ED 3H3KA 4JDVA 4ODTL 4M3KB 4N8CH 4OFYD 2P5EA 3KPSD 5F1SA 4OFYA 5LWYH 3DRQB 5DXWA 3MA9L 3KPSA 5GGTL 4CDHA 4LLMB 5TQ0H 5JPNA 2QQLH 1N6QH 4OI9A 4XPFH 3AS0A 3GSQA 3CUPA 4JZNB 3RHWF 4XVJH 4OQTA 2GK2A 4H88H 4CVWA 4D0BB 1EUUA 5ACMA 3AU1B 4K9EC 4AEIH 5I75B 1MJ8H 4U6YA 2Z31B 3MFFA 3VFGL 4U1JB 3ROOB 4EDWL 2NXZB 4U4BA 2V9QA 4I0KA 4OZFA 4X4MA 4YLQT 5H35B 3Q6FA 3LEXB 1OTSD 2YD6A 2BERA 5IMLA 5BO1L 1IFHL 4K94H 1SJHA 4YHZH 1KN2L 3K46A 1DANU 5E4EB 2VXVL 3D85D 3FO1A 3LN9A 5GRZA 1L4IA 4PJDA 3D85A 3VI3E 2HTLC 1KB5H 1VHPA 4UNTA 1LNUB 4HUVB 4PGEB 3I9GH 4X6FA 5FDYA 1FJ1B 2YD7A 2I9TA 4ERSH 4J23A 2R4SH 1UKSA 3SDCC 1MEXH 1V7MH 4RDQG 2LVCA 1BD2B 5IIEB 3WNMA 1CGXA 3VXMD 1T4KA 4U1HA 1YQ2A 1Z9OA 2D7OA 1DQQB 2I07A 2MHAA 3U7WH 3VXMA 5CEXB 1H3WM 1QD0A 1U91A 1A0QL 2PTTB 3SDAC 1FSKB 4OCRL 5IVZA 2UZIL 1ZHKA 5DMGC 3QUKB 4UUJB 3U9UB 4YHML 3HE6B 1NGXB 2VWEC 3KPOB 3TBWA 2VZ1A 2YMXL 4TUKH 2FSEB 1Q9OA 1OAKH 35C8L 4GQ9L 3HUJA 1WC7B 3TNMA 2DL9A 4I9WD 3C87A 2GYSA 4JQIH 2FX9H 2J5LB 4XP5L 4PGCB 1GGIL 2QLVB 3TYGH 1UVQB 4YR6B 3C6LC 3QUMA 3X11A 2OSLA 4JDTH 2ITCA 4XVTL 5EORL 1I8MA 1ONQA 4IOIA 1V7NH 1KFAL 4F7TB 2D31A 4JFFD 2R8SL 4EUPA 2I5YH 4JFFA 2XTJC 5H94B 3ALWA 3G6DL 4P9MH 1EMTL 1K8IB 4Q7DA 3T8XA 5JW4R 5C0EA 5I18H 3CLEH 2D03H 3STLB 4U1LB 3VFTB 5L0QC 2FX8H 2E9IA 4NCC2 5BXFA 1G0YR 1MFDL 2PCPB 2Y07H 4POZC 1JWSA 4TTDC 2ZNWA 2W60A 4LCIL 3WIIH 1KGCE 5DO2C 4LCWB 1R3IL 4PJHA 2R0ZH 3MRDB 4KXZI 4LL9A 1AGFB 1CICD 2XZAH 3JUZA 3BE1L 2ESVE 1E6JL 1CICA 4M4PA 5J1AB 5CWSB 5BV7H 3OB8A 2P5WB 4GKSA 5T1MA 5DR5L 3F12A 4HWNA 4Z7NE 3RVWD 1A4KA 2JIXB 3MLRL 2XIDA 3HCVA 4S2SA 5AEAA 3ZKXB 4XPAH 5F7KC 5KW9L 4QNPE 2YEZA 1J8HD 4UTBL 3ULUF 1F6AA 1DBJL 2VZSA 5BJTA 1J8HA 1XF2A 4UB0H 1NC4D 5GRVL 1FGVH 1D5XA 1QEWA 4I18A 3U4EA 5SX5H 1YEIH 3ARBD 3CCHB 1NC4A 2CGRL 1YDPA 1AGCB 3CFIC 3ARBA 4X6EA 2AJYH 4AZ8A 2V17H 2HJLA 1E6OH 3CFEA 1DDHA 1J11A 5TPWL 4N68A 2DQTL 1LHZA 3GKWL 4JZOA 2H6PB 3BJLA 4KY1L 4BYHA 2IQAA 5IK3B 4XMLH 3DYMA 3UZQA 4U3HA 2X7LA 1MIEH 1FC2D 4HGMA 3MRCA 2NY6B 1KBGL 2ARJA 3PV6B 2FJFA 3RGHA 1GGBH 4P4RB 4KJWC 3MTRA 3ZL4L 1DQLH 4R0LA 3STZA 2LU3A 4K7PX 1LDSA 1ZLVH 5CIPB 2GKIA 2JF1A 1RZGB 4TN9A 1RZIA 5JW3H 1MHPL 1S78C 3K1DA 4ZUWA 1IC1A 3RWDA 4U7MA 5HXMA 4GAFB 4HZLB 1P7HL 3RUGF 5TH2A 2EIZB 1HHIB 2MQCA 2VDRL 5GRUH 3FTGB 4ZXBC 3OPZL 1KELL 4YE4H 5HI4D 3NCBB 5I15H 1DBBH 1WTGT 4I0CC 4UT6L 4ODWA 4AENB 5F88B 4D9QE 2AJUL 5KVEH 3CK0H 2APXA 1RULL 3F7VA 4JHAH 3K7UA 3SDDB 3LRGA 1ZAGA 1CZ8H 4LDLB 1CDCA 1L7TH 1DQJB 5E8EB 3N06B 1WWCA 1UEYA 3WL9B 1DLHA 1U2HA 1EK3A 5B22A 2Y9RT 5DD3L 3C5ZB 4P3DB 1NL0H 5IFAH 3E6HA 1OARH 1GVIA 1EFQA 4M93C 4HK0A 4FQHA 4XGZA 4I48B 4Y7MA 4YDVA 2XWBB 2A77H 4RA0C 1CFTB 1MLCA 3BW9A 1C1EL 1B4JL 3UPCA 5C0AB 1OAQL 2XKNB 3SKMA 4PJAF 3CFDA 3O2DL 2Z35B 5J8OA 3QWRD 2BZDA 5D1QB 5A40E 5HHOD 3F65A 3GJFK 3QWRA 3CNKA 5HHOA 1P2CB 3HG1E 5C09B 4KAQH 4MA1C 4JKMA 5E5MA 4DEPC 3MYZA 2EDOA 2NZIA 3OJ2C 1I9JH 3QZWG 5HYFA 4L3CA 5GHWH 4BSWA 5JO5B 5T3ZL 1A7NH 3QCTL 3U0PB 5TFSL 5E00A 5FDWA 2W0FA 1OOAA 3QIUB 4K3DL 1QNZL 2OXGA 1PG7L 2HFFB 5CMAB 2JKXA 3S5LB 2WINA 5EOCL 2VZVA 4F8QA 4KROB 4JVUA 1RZKH 3O3DA 1IM3B 4Y4KD 1Y6MR 1MRDH 5DHVH 5F1NB 4Y4KA 4Y4FC 4HIJA 4PGDA 3FFCD 2H1PH 1EHLH 4G3YL 1OAYH 1YEDB 2VZTA 1E27B 4GG8A 4DCQB 3FFCA 5I1CL 2J6EH 3SKUD 3DIFA 3OKOA 4AY0A 3KNBA 2ZUQC 5HGBA 4YHIB 1FFNB 1LVEA 2I60H 3TN0B 1G6VK 3KPNA 1RFDL 1CI5A 2PTVA 4YX2L 3HFMH 4CMMB 4AIXA 1BJMA 4P57B 5DJ6B 2DWDB 5DMJB 4HMCA 4NOFA 2V5TA 2ZNXA 4PP2A 4XRCB 4QHNA 2DQHH 2PKDA 4OGZA 3VFPB 3SCMC 1RURH 4R3SA 3TBVA 5I2IA 1KN4L 3GIVA 3FB7B 1F2QA 4QOKB 4APQD 1CLYH 4I8DA 4RFNC 4APQA 4YXHL 4LLQB 1FVEA 1T2QH 4LQFH 3FFDB 5KSBF 3RWJB 3SJVD 3VFUA 3SJVA 3V52H 4YBQC 1JFQL 4HKZA 1BVLB 1X9QA 2GCYB 1DZBA 3QRGH 4FQJH 2H32B 3NCYP 1HDMB 4OFDA 4XP1H 3M17B 3C2AL 4CVZB 4OLZH 5FAAA 3MLWH 5FYJU 4NC1C 3MRIB 2YUWA 4X6DA 1BBJB 2CLRB 1T21B 3VA2C 3QUXB 3EOTL 3T0EB 3MROB 1SVCP 3MOAL 3TBSB 4OV6F 4R2GD 2JJUA 4FQ2H 2VL4A 2D7TL 5IW6B 1XH3B 3NIDF 5BZDB 4N1CA 4U1SB 1P53A 4KRNA 3P4NA 3DXAA 4GRMA 1FV1B 1NDMB 3EAKA 2APFA 3R0NA 2NY3C 2BNUB 3EJZC 1XF3B 1P7QD 3KYOA 4UT7H 3U46B 1A7RH 4ZUSB 5SWQB 3O9WC 4N0CC 1W0WA 3LPWA 2FD6H 4M5ZH 4MQXD 3TPUB 3WNKA 4N0YL 5EUOB 4IEFB 4KUZH 3X3FL 1BIIA 4PJ7E 4NZRH 4DQOL 2YWZA 3BMVA 3NIGF 4LGPB 1OWWA 3C5SB 3FN9A 3HB3C 4HJ0C 2PO6A 2GFBB 3D9AL 1KGCD 4GKZA 1HH9B 3ARFC 5D96B 4HKBB 3X3GH 1ZKAA 2RAMA 3RY6A 1S7QA 3PUCA 5ACZA 2ESVD 2J8HA 2R29L 3S37X 4K3EH 1MQKL 2HWZL 4D3CL 5IB3A 5MEND 5DD1L 5KSAC 4QRSA 3P9MA 3S3SA 2CIIA 5MENA 4WW2A 1R3KB 3SHSA 4GMTL 3SDCD 4W81A 4R4ND 3LPGA 4L8DA 2UY6A 3EYVB 3MREB 4PJ9C 1VFMA 1ITCA 5DJCA 3SDCA 1FNSL 1MCEA 3VXPB 5F7YC 2AEQL 4Q9RL 3BQUC 1RHFA 1J87A 4MA3A 4EXKA 2QTEA 4EIGB 5TE7H 3CVIL 3R0MA 3DGGA 4NUJA 5KSUA 3IS1X 1N5YH 3CDCA 1JNNH 4UIMB 4PJEE 3TNNA 3CGTA 3BESR 3D0LB 4F37K 5DFWH 4FQLL 1MWAB 5DMGD 5FA4A 4ZOEA 1U8NB 5GRYA 2W9DH 2B2XL 1YY8A 4WUUB 5IEKB 2R1WB 3F5WB 1F4WL 3MACL 4NC1E 5A16B 3FQXA 3HC0B 4H5SA 3JBG7 4L5FH 4R90H 4Z7WA 4PREA 3WSQL 5FOJA 1CQKA 1JZ7A 1VCAA 4WWKC 4F3FB 3WIHA 4UDUB 1N2RB 4JREB 4GH7B 1T5WA 3H7BA 3QAZC 2FH8A 1FPTL 1G7IB 5E5RB 3C6LD 1HILA 5FKAB 5AAMA 5TDOB 3MV8A 4JFQB 2X40A 2R56L 2B1AL 4PJGB 1VEPA 4LEXL 2AJ3A 1YN6A 5E6IA 5AD0B 3BZFA 4OIIH 4PJIE 1S7TB 2EDWA 5CLWA 4DGVH 1XF1A 2ZKHH 3QI9B 3QXAB 1XF5B 5EPMB 3WS3A 2CKBB 1JPST 3UPRB 1MCJA 4M6MH 2C3VA 1X5IA 4GXVH 2WWKO 3PGDB 5EZOL 1BVZA 1OD7A 4NNYB 4FP8L 4CU8A 4LNVA 1MHEB 1VPOH 4F57H 3T09A 1YMME 2VXTL 3L3OB 2NZ9C 1NKOA 4X7CC 4E5XB 1UENA 1FDLL 2BVPA 1CXEA 2XI9A 3MJGX 4AM0B 2WUBL 4FNLH 5BMFL 1CBVH 3HLAA 5MEOA 1CL7H 8FABA 5E9DB 3H9SE 1MY7A 4DKEL 4EI6A 1W0YT 3AUVA 3CXDL 1R0AL 3GIZL 5KOVC 1G1CA 1JRHI 3F7YA 1TQBB 4FFYH 2J8UE 4KUCD 3WEXA 4HIHB 4ODUB 5IMMA 1EGJL 4ZO8A 1JHKH 1I7RA 5DQDH 5DJDB 3ULVD 4BFGA 1UXSB 1UZ6E 2GK0A 2VUYA 3L5XH 5EIVA 3TT1L 1ORSB 4DKDC 1WISA 4PG9A 4IRJC 4M7ZB 2X4TA 1CGSL 4JDVB 1UWXK 4RIRA 2DQIL 1D5BB 2P42B 5MEQA 4WDIA 1AFVH 3TC9A 1UH4A 1MQ8A 3ZE2E 4UV7H 5ETUA 5JPNB 4GRLC 2IPTL 4Y16C 3GSQB 3CUPB 3CIQA 4X7SL 3JVGA 2A9NH 5C3TA 4RWYH 1U9KA 1TZHA 3MRJA 1TCRA 5I1HL 2M8XA 2HKFH 3BPLC 5C2UB 3SKNA 1J12A 5IJKC 2D0HA 3DHJA 4U6YB 3MFFB 5ILTL 3OGCA 3QT2A 4OZFB 1NCDL 5JXAH 4GT7A 2WIIB 3Q6FB 1IEBA 4TOYL 1A02N 2LTQC 5IMLB 3TH2T 3G9VA 3WN5C 1SJHB 2E9WA 3FO1B 2OZ4A 4LPCA 3QJHB 4UQ2A 4PJDB 3UTTE 3CJJA 3D85B 4BFEA 4MZ2A 4NYLB 2G60H 1QYGL 2IANA 3EJYD 3DHMA 3V0WH 5GJTH 3U4BH 3GMQA 5DRNA 2I9TB 1G9NC 4H25A 3S35L 3O4OC 3WFHA 1WEJH 4MGXA 3VDAA 4ENEC 4QXTA 2VABB 3GMNB 4LU5L 3B9VA 2R15A 3WS6C 1NAMA 1J0KA 1T4KB 1UJTA 2XQYK 2B4CL 3TYFA 3IDNA 3VGFA 1QZ1A 4TTGA 1RJZA 2I07B 2MHAB 4KKBC 3VXMB 1U91B 1UYWH 3TVMC 1X5LA 4WI7A 5IVZB 3L5JA 5E99H 4WGWB 3LKPB 4M1GL 3IDXH 3ETBF 5DK3A 1MFNA 3AREC 2V5RA 1Q9OB 5E5UB 1JGLL 1S9KC 2B1HH 3FQTA 1TVDA</