1ZLWH

Fab 2g12 + man8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH01
3D18B 1T66C 5DI8A 1A64A 5FECA 2BMKB 4DZ8B 4Z18A 1OT2A 3T3MF 4YH6A 2R29L 4ZAKD 1ADQH 2BP3A 2NX5B 1I9RL 2NTSP 4HWZA 4AEIL 3F8UB 4F7TA 5JPMB 1IT9L 1O0VA 4O51A 1QSFD 4GW5B 1EZVY 2C4XA 3DUSB 2CRZA 4LHJB 5C0BE 4N8VG 4ZDHA 4NUGH 4TSAH 2BCKB 1PJ9A 4M7LH 5CEYB 3UROR 3MZTA 3ZHLA 2UWEB 4C4KO 3RI5F 3MROB 3QDGB 3BXNB 3NCYS 3HCVB 5FIEA 5IW3A 1BAFL 4X99A 5D72H 1MCCA 2NZ9C 5F7KC 4JZJA 2EE6A 5JOPE 1N2RB 2UVFA 4QHMB 3GKZA 3C5SA 4NZRH 5E9DB 3NA9L 4LEOB 5TDOA 3JVGA 2AV7A 4HCRL 2E6JA 2VXQH 1BEYL 5MHSE 3D1MC 4Y19E 3C6LC 1H15A 2VDLL 1OP3H 5DRNA 1S7TA 1ACZA 3IJSA 1MPAL 3FO0L 4JFDB 5F93C 5TE6H 3MCKA 3TJEH 1KLUA 1KC5H 1EPFA 4DEPC 1U93B 5H37H 4U1LB 4CVUA 1QTYT 1ZLWH 5SWQB 1F4YH 1I1AA 4OD3H 4YXKH 4R26H 2XQYK 2Y7QB 1XZ0A 5T3XL 5JXEA 1JE6A 5HYJD 4L4VB 3DVGA 1QRND 5T1LD 1KCUL 5I66A 1YNTB 3QUXB 4YDLB 5JIPA 1EUTA 3L1OL 5DJ8A 5ITFA 2AK1L 2R9HD 3PGCA 1DFBL 3O0RH 1PW3A 1QFWH 3TCXA 1EFXB 3S88L 3QEQB 1QSEA 2P4AB 1GXEA 3G5ZA 4Z7QF 5CIPH 1FDLL 1JFQL 4NKOB 2G60L 3EJZC 1TTGA 3PE9A 4Y5YC 3MUGA 1GC1C 2BVOB 2GJ6B 3JTTA 4PBXA 4L5FH 2ZZUT 3GJEA 4KAQH 4EBQL 5CJQH 4D0DA 5IB4B 3FRPG 5HYIA 1AGEA 2W9LA 4KJPC 4XMLH 1AXSA 3L5XL 1HIMH 4LSUH 2W65A 4NRYA 4P2QE 3P73B 2CLVA 4F2MA 3EBAA 1E4XH 4HLZG 2CSPA 1G1YA 3ZE2F 2HVJA 3GSQB 3BN9D 3X12A 1QR1A 1E27B 3OAYK 3PHSA 3QUZC 3T1WA 2RGSA 4HWNA 3BAEH 4NOFA 4KPHH 3UTSD 1TVHA 4X5WA 4HX1A 3L6FA 3CSYA 3FQUB 1XR8A 3G6AA 4YHIA 2HWZH 4OB5H 3V6ZB 4RWYL 3HAEH 1HCVA 4MAYB 5IB5A 3S35L 5DVNA 3VXSE 1IFHL 2DQCH 3CCHB 2NZ9D 4S1SH 1LD9A 3DMMA 5SV4A 4OI8A 1IQWL 2NNAB 1ADQL 1QVOA 5DJ0B 2HFEB 5KANI 5KS9E 3OV6A 5C08D 3D0VB 4XP9H 5EZJA 3TCLB 3LEVH 2A77H 1NBYB 3VH8B 1JIBA 5HPMB 4NUGL 1VADA 2PXYC 4TSAL 3OX8B 4M7LL 2LU3A 4H1LH 1I8KB 3C6LD 3N9GH 2E3VA 2X40A 3O6MH 5ISZB 4HDIA 1ULVA 4NKMA 4L1HA 4YXLH 3CFBB 4TUOA 2MOVA 4JRYA 3UZEA 1HZHH 4XBEH 5D72L 2OM5A 5E1AA 2DDQH 4TULL 3RL1A 1S7WA 1T4KA 2UZYB 1NKOA 4NKDA 1CTNA 4XCCH 4C56A 5DSCB 1YPZE 4HUNB 3SJVE 1CLOL 4NZRL 5D1XA 4MXWH 4H0HB 4G42A 4FA8A 5C9JA 2FJHA 5GXBB 3FT2A 4RGNB 5DHYA 1GC1H 4WNQA 4HKXA 3GSNB 5JMOC 2I26N 3RPIA 1LK2B 3MLZH 1GIGH 5IHUH 4JFQB 4WFED 2FX8H 3TJEL 5DD5H 2GKIA 1RZ7L 4MCYB 3KLAA 3LKQB 4K94C 4MXQC 4MQSB 1HDMB 4CU6A 1F4YL 4PJAF 4OD3L 3OXRB 4MLSA 4YXKL 3EJZD 1T1ZB 4LCCA 3TN0A 4NO0B 4MGXA 2R23B 1AQKL 3NGBC 4N0YH 4MLIA 4DQOH 4I0PC 2DOCA 3LS4H 4P5TD 1KLFA 5EWIH 2VXUL 3PDDA 2ZSVB 4K8RC 3PWPB 1K9TA 2CQVA 3SGJC 4ODUA 2WLYA 5I71C 4KJPD 4KMTH 2H2SC 3DXAA 4QWWD 1ZSDB 2P7TB 2NY7H 2WUCH 1P84K 4JN2B 1D5MB 4XCYA 4LSSH 4H20L 1PG7X 2JJTC 3IDIA 1XGRA 2RB8A 2AEQH 3VFMA 1ROWA 1RZKC 1EJ6A 2BNQA 1NGPH 5IFAH 4OBRA 2VDNH 3QUZD 2DD8H 2X4RB 1TNMA 1PY4A 1U91B 4XMLL 3WHXB 1OLZA 4JKKA 4HIXH 3DX9A 2FH8A 2EECA 1M7DA 1S9XB 4LSUL 1SEBA 3IDMA 4Y8DC 3GNML 4PRNA 1XCTA 2QSTA 2NY2C 5GISL 4H0IA 5FA3B 3IXAA 4ZAKB 3NFNB 4D0BB 2SEBA 2N4IA 1U3HA 5HHQB 1QSFB 3BAEL 4TPRH 4JQVC 4KPHL 1WBXA 1MCSA 9CGTA 4XWOD 3RVTC 1MOEA 1YMME 2PXYD 4PYGA 2XWBA 3T4YB 1D7FA 1KNOA 1OWWA 3HZMB 4HMCA 3WJJA 4OB5L 5AD0B 4XZUA 5IBTH 1R0AH 1TQCC 1ORQA 1U58B 4PY7A 4NQTA 3LPFA 1DQTA 3GSWB 4K94H 4Z8FH 1LP9B 1OSZB 1YUHB 5GRUL 1CQYA 3LEVL 1A5FL 2A77L 4ODVH 1DN2A 4XXCC 5FGBC 1UG9A 2IGFH 2VR4A 3N9GL 5F1IA 5C0AA 3VXMD 2DF3A 4RMQA 4BQBA 2EKSA 3VXUA 2PTTB 4YXLL 3WKNA 1OHQA 1N6QH 2Q76A 1JWUB 5SWSD 1HZHL 3TPUA 4XBEL 4K8RH 5F7HA 4JQIL 4F7CA 2IALA 4G6JL 3S8WA 4CJ0A 4NWUH 2YUZA 5SX4H 1S9VB 3I75B 4RFNB 3OHXA 4XCCL 4WGWB 3I3EA 1S8DB 3A67H 4B7IA 1Q9OB 1VACA 4MXQD 1PG7W 4FXGA 1BFTA 2FNBA 3QEUB 4KRPC 1JGUH 3VGBA 5HYJB 3QIWA 3VFGL 2CUIA 1QRNB 5T1LB 3PL6A 2VWEE 2X5PA 5F3BA 1MHCA 4PJGA 1JGVH 3MLZL 4OLZL 4I0PD 4BFIA 1FL6B 1Q0YH 3UMTA 2X4UA 4K8RD 5TFSH 2FX8L 2J12B 5DD5L 3AC0A 4HW6A 4QEGA 4MZ2A 4JLRB 1JF6A 1ZLVK 4XP6L 5DUBB 4XTRD 4KH2A 4D9LH 4AT6A 3SBWC 3EOAB 5D93B 3SOBH 5HVGB 3X13A 2HKFH 1KELH 4NT6A 1G1CA 3IDJA 4N0YL 4P5MA 4QF1B 2YD9A 4IJ3C 3LS4L 4I0KA 2IQAA 4MNGB 1S7RA 3UTTD 1TZGH 4LRIC 3FB8A 4NO5A 3N06B 3QXVA 1ONQA 3UJTH 5DHVA 2NY7L 5CIPB 2AQ3A 3X11A 3NOIA 3FHAA 3MLUH 1DUZA 4LSSL 2NY2D 3U6RA 5CD3B 2CDGB 3H7BA 5DJDA 5JOEA 4QHKJ 4ZOBA 3WFHB 2BC4A 4NQSA 1YJDC 4HK3J 2VLKA 1YEFH 1LE9A 4XNMB 2AEQL 3TC9A 4YDKH 3VI3F 3T0EE 5IFAL 1EHAA 4EXKA 1GCFA 2VDNL 2DBJA 4GAGH 2DD8L 3LB6C 5FDYA 2VQ1A 3UTSB 3ULUE 4MA7L 3T77A 3B2UD 1QG3A 1JPFB 4GG8A 3LRSB 3RWCA 4HIXL 4Q2ZA 3IFOB 1MWAA 3V2AR 5KSAC 1HHJA 4JM4H 4N8CL 3ETBF 4MJ2A 1MCHA 2F5BH 2J4WH 4BK5A 1WAAF 3KPLB 1FFNA 3B9KA 2WIMA 3SDXA 2XQBH 4NHCL 4R7DB 2RAMA 1A6AA 3PJSA 1TLKA 5B3JE 1QHPA 5C08B 1FG2A 1UACL 4PJXE 4XH2B 4FZ8L 2CLRB 4YHZH 2EDLA 4PJ5E 4ORGA 3C6LB 3QUKB 4R90H 3IAGC 5ECJE 5JIHA 4PJAB 4R3SB 3HAEB 4KKNA 4LEXH 3ULVE 2NW2B 2AJYL 4PJ9C 2HLFD 2D0HA 4NJ9H 3WUZA 1YYLH 5KJRH 3BPOC 3D0LB 1F4WL 4DEPB 5DUPH 3GK8L 5BXFB 3JV6A 3LS5L 1E6OH 1Z9MA 3JXAA 2FYYA 5K9OA 1ITBB 4Z8FL 4MNHA 4D9QD 2VDRL 2LAGB 5FUZL 3STLA 4ODVL 4EZMA 4M3JA 4KRPD 2E7HA 4H1LB 3RUGA 3CX5K 4KTEH 1XEDA 2Q7NA 3ARWA 5CHNB 3OB0K 2HMIC 5SV3A 1AR2A 1FC2D 1WIUA 3HI6H 3KPMA 1N6QL 4P5KB 4B41A 1MREH 2VR9A 4I2XB 2KH2B 4O5LH 5A2IH 1ZV5A 3K74B 4K7PX 4NWUL 2IFFH 1EAPB 3GIZH 3QQ3B 3CXHK 4APQC 2DQGH 4D8PB 5JO5A 4LAQH 5I18H 4EIGB 1AKJD 1A3RH 1FQ9C 1C5DB 4P4KA 1KV3A 1JGUL 5FA4A 4F7PA 4Y5YB 2YPLA 3VWKD 4Y4HD 4KU1A 3B83A 1NBVH 1NCAL 1YJDH 3INUH 2E8ZA 3P0GB 3I6LD 3MFGB 4GS7C 2Y06H 1JGVL 4P5TB 1Q0YL 5M7QA 3IDYC 5TFSL 1H9VA 3T08A 3TV3L 2E8YA 3DJ9A 2IBZX 1DE4A 1CZ8L 1G0YR 2DWEB 1GVIA 2BHZA 2Z91B 2LVEA 1GGCH 1L0YA 3MR9B 2NLJA 4ZUSA 3VFSA 4D9LL 3WIHH 2DYPA 1M05A 5DFVD 4PRHA 2VLRE 3KXFD 1XF3A 2HKFL 2AAVA 1KELL 4IRJC 4NNXA 1DQJB 1NCCH 4Y89A 1IGYA 5C8JA 2IANA 3B5HA 2XKSA 5C0IB 3KPOA 5DQJA 3W9DA 1AE6L 4ZUVA 1FVDB 3UJTL 2C3VB 1ZK9A 1OPGH 1MJ8H 5L9DH 5KSAD 3NCJL 3MLUL 3NVQA 4X6CF 2XN9D 5ITBH 4OFPA 1QBAA 3N0PB 3QI9A 4DK6A 3TNNA 4YDKL 4G6AC 5MERA 3V95A 4U1SA 4YE4H 3JWNC 1DVFA 4ZD3L 4J1UB 3VJ6A 2CDEB 4M3KB 1EO5A 2PXYB 3CMOH 1T0NA 3K3QA 2J88H 3CDCA 3B9VA 1QACA 1B0RA 4KK9C 4JM4L 2V9QA 3VFTA 1M7IB 4PJ9D 1D9KA 1NCUA 2F5BL 2J4WL 2Z35B 1ODAA 2FDBP 1DANU 2XQBL 1MCIA 5JW4Q 4NZTH 2GAZA 4KK6C 4PJFF 1IC1A 3HI5H 5IF0A 2B20A 2ERJC 2A83A 3KPQB 1BJMA 4MQTB 3VXMB 1MSPA 3SGDH 3HUJF 1DQLH 4LEXL 5FO7A 1B2WH 2D0FA 4NJ9L 5CSZA 5SWSB 3B5TA 3FOMB 1IRAY 5DUPL 5ID1A 2DQIL 5KTEL 3H8NA 1E6OL 3PDOB 4CJ1A 3GMQA 3O3DB 2KL6A 4APQD 3NIGE 5KN5B 2H8PA 5D2LF 5TDNB 1UEMA 5EUKA 1FLRL 3U4BH 2J8HA 3PQYA 5KBNC 1YECH 4KTEL 4LCWA 4LQFH 1OW0C 4I0PB 2HG5B 2PKDA 5B22A 1JZ2A 2VRAA 4FMFA 4BYHA 2DQEH 3HI6L 3MA9H 3LD8C 3OKNB 5I71B 1MREL 2G75A 4O5LL 3PABB 3MLXH 4F9LC 1RIHL 2IMMA 4FNLH 2IFFL 3DI2B 3TBYA 2DQGL 4YHYC 4LAQL 1HHIA 3WN5A 1I1RA 5I18L 3QA3B 1FGNH 1RJZB 3I85A 5EU5B 4X9GA 3KYNB 3GMPB 1NBVL 4FQ2L 5CEXB 4V1DE 1YJDL 4IRJD 2Y06L 3MRMA 5GRJH 3JV5A 3UTTB 4Y2DA 4NRZB 1KJVB 4JY6A 2D0GA 4LSQH 6FABH 1M71A 1FC1A 1MQKL 4QXUH 4GSDH 1Z3GL 1D5BA 4OCXH 1GGCL 1T6VN 1UCBL 1RUKH 5K9QI 3WIHL 1QBMH 3EAKA 3NCCB 4OGYH 4K7FA 3MACH 3F12A 2CRYA 1UB6B 1KCKA 3BJLA 5JNYA 4G6AD 1AGFA 3PNWB 4PV9A 1NGQL 3LKPA 2EDQA 5JXAH 4WWID 1RZ8B 3V5KB 3VI4E 1G7JB 4KUCF 4G80B 1DEEA 4OIIH 3F7QA 1YDPA 4JO1H 1KEML 4Q6IC 4M6AA 4AM0B 1OPGL 5L9DL 2GITA 4OCWL 4CVZB 2IAMC 3OAZK 4KK9D 3U7WH 1KTLB 5HGAB 4S2SB 5B38A 5ITBL 2DS4A 2YMXH 5JOFA 1G9MC 1TQCB 3HRZB 1HHGA 4O2EA 4HIHB 1GH7A 4KK6D 5IIEA 3VRIB 5I1DA 4E42B 5IMOB 4YE4L 3EFDH 4X6FA 5D1QB 3CVHA 3H9SE 2IBZY 2PYEA 3FONB 2ATKB 3CMOL 5DJXB 1B6UA 3DPBA 2WIIA 3MRFA 3WFBH 4CVWA 2J88L 2YHGA 5KOVC 3GMNA 5EO9A 5JDSA 3RRQA 4WO4A 4QRPA 1A6WH 2IPUK 3ZT5A 5MEOB 4U1MA 3NMEA 3VRJB 1I9IL 3K80A 1CICA 5BZDB 1JGLH 4TTDC 3UYRL 4OI7A 1CFNA 4NZTL 5CCKH 1U8MA 3HE7A 1MNUH 5FHBH 3G5XB 3HI5L 3ORJA 2B5IB 2YD5A 4KRPB 1N59B 5CJBA 5DJAA 4U7KA 4JO4H 5D5MA 1T1WB 2BHUA 3DX6B 1IVLA 4M1DH 2XTJB 5FYLH 4MD4A 4F7MB 1DQLL 2YC1B 2GYSA 1FV1A 4JRXE 4CW1A 2XACC 4K2UH 3UTQB 1I8MB 5GGVH 3E6HA 2HJLA 4PGDB 5D7SH 4LIQL 4DUXA 1AKJB 1TTFA 5HHOD 2BSSB 1OF2A 4AIZA 3MPCA 1UVQB 1CD1A 3VWKB 2A6DA 4Y4HB 5DLMH 4KV5F 3SPVB 4KK8C 1YECL 4Y8AA 4NSKB 3P4MB 5FYLD 5MENA 5INDB 3NFPA 1S7VB 3MLWH 4LQFL 5SX4I 3WJLA 1FYTE 4GKNB 4IJ3B 4LLMB 5EIQA 4X6CB 5GS1A 1Q8MA 1NBQA 2DQEL 3MA9L 1BVKB 5IFHH 1M7XA 1LEKB 1AP2A 4FNLL 5BRZE 5M95B 4Z7WA 3IS0X 1FBIL 3W39B 1FGNL 1NGYA 3WDHA 4N8VA 2LQRA 3CUPA 3KXFB 1ZGLB 1B0GA 4XCEA 1G9MH 3QAZC 5FOBA 1F3DH 3WUWB 4QNPE 1UKTA 4OLXH 4GRMB 3OB8A 3Q3GA 3U0PA 1S5IL 4WFHE 2XY2A 5GRJL 4I5BB 5JLZB 1RK0A 1OSPH 3HZKB 3QFJE 1WF5A 1W2KT 2YRLA 4X4ME 1S7SB 1H0DA 4LSQL 1CDHA 4OQ1A 1T1YB 2ADFH 4DN4H 4YO0B 4GSDL 5J12C 4OCXL 3ZE0E 5KSAB 4NRXB 4PY8I 3MFFB 1QLFB 3KYOA 3VMNA 2IAMD 1RUKL 2XN9B 1YQVL 1QBML 5D2NC 4OGYL 5GGTH 3MACL 1A3QA 4NYLA 3NCBB 4XNUH 3MOAL 2B7DT 2EDFA 2JCCE 3U30B 2VIRA 1J10A 2VZ3A 3RA7H 1ZVYA 2NMSA 2VLJA 5JXAL 1F3RB 3MGTA 4OIIL 4GW1B 3ARTA 4O00A 4JO1L 4CGTA 3LV3B 4YHOH 1M6OB 1N6VA 5DVMA 5IFJB 4WV1A 4ONHA 3ZKQD 1RHHA 3DRTB 4NBYB 3HC0A 4DCQA 3BPOB 4JJ5B 1P2CA 2YMXL 4TTDD 4YEEA 1WC7B 4O2CA 5IM7B 1EERB 3UYPA 2VSDA 1RAMA 4OFKA 4IOSD 4L4TE 3VXOA 5EO1B 3ZSTA 4F3FA 3ARBD 4I1NB 2DLIA 2R0WH 4L9LC 1VFBB 1EAJA 5IBUG 1PQZB 5L0QB 3FT4A 5D7IF 3BH9B 5E5MA 5GGUA 1KIUA 3TYFA 4OUUA 3W5NA 3TLRA 2J8UA 4RMTA 1OP3K 1DBAH 3WFBL 5C0CA 1A6WL 4YWGH 4Q74A 4LNVA 1JGLL 5FCSH 5C70A 5ESQA 1TFHA 5CCKL 1ZLWK 5I1IH 4APQB 3PHQA 4JFYA 3QH3B 1MCKA 1MNUL 5FHBL 3QIUC 3FRPA 3WNLA 4JO4L 3HNSH 1EBPA 4KK8D 2R1XA 5J56B 5JR1H 4M1DL 1CFSB 3M8OH 2FJFB 4HH8A 4IMLA 1J11A 2HTLC 4HWBL 2NYYC 3IDYB 4NQEE 3NN8A 3QG6B 4JFZH 3V5HB 3BOVA 1I3VA 1C5CH 4JZNA 4XHJC 4LARL 5FYKE 5D7SL 3O6FD 5FGCE 3QO1A 1UWEH 5JHDA 1N64L 3C8DA 4BKLA 3MLSH 1JN6B 1NMBL 1TCRA 3QXDA 4IRJB 3FQWA 3MV7A 3OKLA 4Y1AA 1SJEA 4HMDA 4UT9H 3STBA 3W11C 1N5AA 3QXWA 1EGJH 5IFHL 4PGZA 4MD5B 2BVUA 5T1KA 1J5OH 3TESA 4QXWA 3MV01 4R7NA 1I7UB 1R5WA 3Q6FA 3RTQA 4GG6B 1KG0B 1XR9A 5F97E 4WY7H 3V6FA 3QISA 4IIQC 5DC4B 1NC4D 4KDTC 1W0WB 1ZT1A 3RVWC 4DZBB 4N68A 1G9ML 4Z7NE 4OLXL 2CDFA 3C9NA 5BQ7B 3CLEH 2PTVA 3V52H 1OSPL 5D7LD 4LNRB 4JZOA 1BVLA 5DGQA 1OAXL 4R0LC 4DN4L 2ADFL 2NTFA 4RWHA 4XC1L 2W0FB 4GKSA 4PJBB 5FCUH 2BY2A 5GGTL 3OQ3B 1YEHH 4MWFA 3IDNA 1P4BL 3OL2A 4ODSH 4XNUL 3ZZ1A 5JHLH 1J1XH 4Z5RA 3IDGA 2AXFA 1JZ3A 3RA7L 4ALAH 3AVEA 4EOWL 4Z7VF 3PGDB 4JFFD 4X7TA 1NFIB 4OLWH 2ERJB 3LSOB 2OR9H 1G7LB 4AMKH 1LHZA 5DRWB 4AIXA 4YHOL 5D6DC 1P84J 3KGRA 4BUGA 2VDQH 1EEUA 2BVQB 4S0TD 3DNKA 1NSNL 2LU4A 3WEXB 5FB8A 2HLAA 3CDFA 3QUZA 3V9FA 1ZANH 2IBBA 3DOSA 4HS3A 5DRZA 1MJJB 3D87B 1T3FA 1G9EA 3JUZA 2R0WL 1Z9LA 3GKWH 2E9WA 2GY7B 2JB6B 3STZB 4BUHA 4HWUA 3C8KB 3KR3H 1UM4L 1D6VH 3RNQA 3W82A 3MRRA 5F21B 4FABH 1CK0H 3P9MB 1XF2A 5E24E 1FVEB 3M07A 2HTLD 1KSRA 2NYYD 3KNBB 4KI5E 4YWGL 4CNIA 4P99A 3LD8B 1WWBX 1JF1A 1A1NA 4XHJD 1VGKA 3SDCC 2OTWA 1A1OA 4TVPH 5FKPB 5I1IL 2FH6A 4KROC 4YHYB 5DS8A 4UTAH 5HYSG 2LE9A 3P4LA 3MA7A 3VXQA 5HHOB 5C6TH 5KSBA 1MHEA 1F90L 5IW1B 4GUPB 4L8DB 5I6XC 5IR1B 3HNSL 4R2GD 1CIUA 1NMAH 2WANA 1VFAB 5JR1L 3V6OC 4GBXC 2ADIA 1K5NA 2YSSB 3M8OL 4MB4A 1M4KA 1WVZA 3W11D 1ZHNB 4IDLA 3BZDA 4PJDB 4PRID 4YEFA 3EYUH 2UUDH 3Q5OA 2BOCB 3VA2C 5EIIA 5ICZA 3JSSA 3PUCA 4TVPD 4AY0A 3BX7C 5I19H 5LKNA 1UWEL 1I8LC 1IGTB 3HC4H 1C8PA 5E4IA 2FIKA 5EH1A 4PUBL 5L2KE 5B21A 3ULSA 3P4NA 3KPSA 3BMVA 3BKCH 3MLSL 3RVWD 5H94A 5I76A 3ZKSD 2HJKA 1NH6A 4IMKA 1IM9D 4F58H 3BI9X 4MCZA 2C7UA 5IEKB 3ES6B 1AO7A 2H32H 3LN4B 4I3GA 3MRKB 1J5OL 2GT9A 3CVHL 5BCAA 3DVNA 1WFNA 5DDHA 3EO0B 1BD2E 2IAMB 3B6SA 4WY7L 5I8KH 5D7IB 4UNVA 1AGCB 1UZ6E 3G9VA 1OTTC 3RDTA 5D7JA 1U95B 1OTUC 1FZKB 4U2ZA 3SGJA 1KJ2H 1RZIB 3CLEL 2EKJA 1IEBB 2CGRH 3V52L 2R1WB 4ETYA 3RX5A 4HUKB 2QR0A 3MV8E 4FQQB 1IGMH 1JYXA 1OWRM 1OAQH 5KS9A 5EFIA 4ZFZA 4WFGE 3AMKA 2UYLA 2WUBH 3AU1A 4OIAA 1I1CA 5FCUL 5B39G 4GAJH 5JORA 3G6JB 3QWOA 3LEXB 1YEHL 5D7KD 5JHLL 4ODSL 1WAAA 4HAFA 1J1XL 3OR7B 2V5TA 5CMAA 4QT5A 5F7FA 3ARBB 3LHPL 4ALAL 4OLWL 4IOIB 1SY6H 2OR9L 4AMKL 3MJ9A 2BSRA 2P8LA 4JB9L 1WICA 2CK2A 3BYYA 4QRQA 3BUYA 4YZFF 5TE7L 5C09A 1QEWB 2W9DH 4DUVA 1RZGB 4S1DD 5HPOA 1VENA 3BP7B 3FQNA 1HINH 4HUVA 2FWOB 1K6QH 2AQ1A 3BP6A 4JGJA 2NY0D 3SDCD 5DD6A 2I60H 3D5OF 4ZFGH 1HYRC 2DJ4A 4JQVA 3VE0A 5F6IC 2D7TH 4W4NA 3GSXA 2AJ3B 3FRUB 3AB0C 1I85C 1RJYB 5FM4A 1Y18A 3BSZH 1XIWC 3KR3L 1IC4H 1KJMB 4GBXD 1CK0L 2X9WA 1R3LA 1AH1A 1CFBA 2HT3C 2QQQA 3WL9A 2EE2A 1S7UB 4J3VA 2DRUA 3PXHA 2GTZA 2EDRA 3O6FB 1XT5A 4LLUA 4TVPL 2F53D 4GAYB 4JFED 1L4IA 4UTAL 4QRTA 5C6TL 4KUZL 1MAMH 1CN4A 1KTDB 2C1PA 2H2PD 3GUTA 4U6HA 1NMAL 1IEAA 4X98B 5JW4N 2F9BT 1LO0H 2CKNA 2GJZB 4Q9BA 5EULV 1Z0MA 2GK0A 4Z77A 3IJHA 1FRGH 4PJHE 1JWSB 2Y36H 5DK0A 2BOBB 25C8H 4QRSA 1FE8H 3EYSL 5J12B 1PG7L 3R0MA 5I19L 2WINA 3G6DH 2DI9A 3HC4L 2FB4H 4EI6A 5D2NB 1NC4B 3P4OA 3H0TA 2NY4C 5CWSA 3QULB 1IKNA 4HGMA 4DAGH 1OTTD 4ZUTA 1DUYB 4LLWA 3LN9A 2HFFA 4F58L 2F5AH 3H2WA 3TIDA 4WEBH 5JMRA 1CIDA 4GMTL 2P8MB 5D7LB 2Q1EA 3ARYA 3VCLA 4UINH 1VHPA 3ESVF 4ERSH 3CVHB 5LGKA 3RGVA 1ZGLP 4EVNA 4RAVB 3CXHJ 2MCG1 5C0JB 4FMKA 5KVDH 5I8KL 1HXYA 5JOPD 4JVWA 3QXTA 4I4WB 3WS3B 1L9MA 2J5LC 2EEBA 2Z8RA 3IU4L 1P1ZB 4LHUD 2FR4A 1HOCA 1ZVHA 3VFOA 4Y19D 2WBJC 4JFFB 1KJ2L 3GFUA 4L9LB 2BNRB 3CH8A 3SY0B 2CGRL 2D03H 1MCRA 1CDUA 2KQNA 3NIFF 1FCGA 2GSIB 1OAQL 4KJWD 1UWXK 1NCWH 2WUBL 2JJVA 5JQ6H 3DURA 5DA4A 2E9JA 4KKLC 2WZPD 3C5ZC 5F96H 3NPSC 1YNKH 2QQLH 1KIRB 4KGLA 2C3WA 4XBPB 4DK3A 4NQDD 4PJFA 1SY6L 4AL8H 4BSWA 3OKEA 3NFSH 2IQ9H 1XIWD 5E00A 2IG2L 4PS4H 3ZKXB 5IESH 1FN4B 5HHME 5FYJE 3CXDH 2HT3D 1RQ5A 3HUJA 4FZEH 1FZJB 2W07A 3MNZB 1HINL 2V2XA 1IM3A 4GLRH 4LKXB 3VWJC 5DD0L 4AEHH 4ZFGL 5CEZH 3DARA 5AAMA 2D7TL 4OUOA 1I1YA 4LQ1A 4R2GB 3O3AB 3V4PH 3OKOB 3BSZL 3D9AH 5C0RH 5D2LA 1IC4L 2XICA 4PJ9A 1BZ9B 4PREA 2ZOLB 5HHPA 4PRIB 3SKOB 3NIDF 4YX2H 4ZNEE 4P2QD 3D3VE 3HE6A 8FABA 3M17B 1JNNH 5DMIH 1OQOA 3OR6A 4PRPA 2YZ1A 4UQ2B 3BVNA 1JNJA 1MAML 1VEOA 2P49B 2VYRE 1A7PL 5LBSL 1KIPB 5C0NC 1RY7B 1FAKT 3CPLB 2NY4D 3V0VA 1LO0L 1IM9B 1FO0L 2RIKA 4ELMF 2G2RB 4X9IA 4JFOA 3R06A 1JGEA 4DFIA 3Q5TA 4JN1H 1YEKL 5DEFA 25C8L 1FE8L 3O4LD 3SE4C 1WQVT 4OCSH 5EOQH 4HUUA 4JPWH 1IKFH 1DBML 1KPUB 1HKFA 4H5SB 3T0EA 3ARDC 3I6KA 5EBMB 3U46A 3EOYG 3S5LB 1V3MA 2EH8H 3QRGL 3ARRA 1P6FA 1K3ZA 1G6RL 1CXLA 1CBVH 1MY7A 4ZODA 1EH9A 3FAXA 1BJ1H 5IV2A 3VFWB 4MYWB 4M8QA 3WXWH 1T0MA 4U6VH 4XBGB 2R69H 5E8PA 1Y0LB 3QNZA 4WEBL 2WBJD 1FVCA 3BIKB 2JTDA 3EYFA 2H32B 5BW7A 3UPCA 5FO8B 2A2QT 4UINL 4ERSL 4I48B 1BGXL 1FNLA 4CMMA 1RIVH 4L8SC 4B7LA 5IVZB 1MFAH 3RWEA 4XRCB 2O5ZH 2OJEB 5KVDL 3VMPA 3RNKB 4GAFB 4YFLF 1NFDB 1X5YA 2FGWL 1GAFH 2GSGB 3SJVD 4FTVE 5LVEA 4KKLD 1J86A 1XGUB 2JJSC 1M1SA 3C5ZD 5E03A 1KJ2B 1RV6X 5E99H 2GY5A 3NABH 3VXPA 3ZDYE 1DZBA 4D9RE 4UV7H 2D03L 4YPGA 4UT7H 4HBCH 4OZFG 4F80A 3VXNB 3GB7A 4X4YB 3DX8B 4I9WD 3TBTB 3MGOA 3EZJB 4PJ7F 3WIIH 3GM0A 4OZFH 4RGOH 5DFTA 1S5HB 3REWB 5IUSA 1HXMA 3BRFA 5JQ6L 5A2FA 2NY0B 3SDCB 3VWJD 3CDGB 3M1BA 3RWHB 3U7YH 5IJVB 2ATPB 4WHDA 1YNKL 2QQLL 4U3XA 3QQ4B 1NCDH 4NC2B 1RZJC 4AL8L 5I6XB 3TH3T 2VITB 1Q9LB 2C1OA 1V3JA 5TGBB 4JFHD 1QLRB 2PO6B 4PS4L 1I3RA 5IESL 2EDBA 3CXDL 5E8OB 5EA0H 1OB1A 4FZEL 1OGAD 1UYWL 1KIQA 1WFUA 2M2DA 3ZKNC 3DBXA 3I3BA 2F53B 4JFEB 2Z8WC 4AEHL 1QKZH 4PJ8C 3BIAX 2ED7A 2QQNH 2A74B 3K1KC 5FGRA 4D0CA 5E56A 2UVEA 3AS3A 5ESAA 4TSCH 1KLGA 1F00I 3EDEA 3WNMA 4QHNA 3V4PL 1IZKA 3ZDZF 3D9AL 5C0RL 5IVNA 2F58H 2AK4A 1DQQB 4U1KB 5J4MA 1NUFA 1FFPB 1C5BH 4U1GC 5DEGA 1MCQA 4YX2L 2ADJA 4HPOH 1T5XA 4P2OC 5EUOF 1BQSA 3GSVB 1JNNL 5DMIL 3V4VH 3R8QA 1NUDA 2XI9A 3VFRB 2E6QA 3B8YA 1ZLSL 3UTPD 4Y0GA 3OF6D 5C0BB 3ILPB 1FO0B 1UB5A 4WJ5A 3AFLA 2OR8A 3NZ8A 3REVB 3BE1L 3P11H 2F19H 4WI9A 1K8DB 1YMMD 4K3EH 2B1HH 5JW5A 1LEIB 4X83A 2DTMH 2R4SL 1QFUH 3VMOA 1Z2KA 2M1KA 1RJLB 1TVBA 4L3CB 3IDXL 1EEZA 5C07A 2WQ8A 1H8OA 5EOQL 2I07A 4LASH 5T1MA 1ORSB 4JPWL 2P5ED 1IKFL 3O6LL 4X6BB 3MJ9L 4EDXA 4GKZB 2ICWB 5HJ3A 4OV6F 1G6RB 3DWTA 3X3GH 2EH8L 1LEGA 4LHUB 5HYQB 1ZHKA 4QOKD 2X4OB 5KG9B 1MLBB 4U6VL 2R69L 4Y19B 2F8VA 3PWNA 1A3LH 3ABZA 5EPMB 1E4JA 4U1JB 1PGRB 3LZFH 4HK0A 4WHTA 4Y7MA 1ZT4B 5KW9H 1RIVL 1UWGL 1UJ3C 4XXDB 2DAVA 4PG9A 1EEYA 2CLZA 1MFAL 4AQ1B 1F8TH 2O5ZL 1U8OB 1GGBH 4R9HA 4R96B 5K59F 4NPYA 4F33A 3ECBA 4DOHE 3IRZA 3ROOB 2JE8A 3PWLB 3NCFB 2K1MA 2F54D 5F6IB 1HHKA 1QFOA 3G04A 2FX7H 3BP5B 4NQDB 5E99L 1KBGL 3GMLA 3P40A 2YZ8A 5EZLA 3OJVC 4UT7L 3IT8D 4Q6IA 1NLBL 4HBCL 1MVFA 1XIWB 2OLDA 4PJIF 3PP3K 4UT6H 1PKQE 3WIIL 5C0FB 3KPPA 1X5LA 1T1XB 4YNYB 5IOPA 5IP4A 1WEJH 1BZ7A 4GKOA 4LGPB 1OP5H 1A7QH 4ODXA 1W0VB 4KHXL 3B8SA 3RVXC 1KYOK 4NQUA 4PJ8D 2HRPL 5ANMB 1INQA 4P3CH 1NCDL 5ICYB 3K2UL 4KTYA 3RIFK 2QKIA 4EUPG 1UM6H 3O3EA 1NANH 4KXZH 3L3IA 2X4QA 3W81A 5FYJU 1Q94B 4O9HH 5F89B 5EA0L 3V0AC 2XXMB 4KRLB 3FN0H 4P2QB 2X4TB 3IVKA 4ZPVB 2CPCA 3TIEA 2ARJB 4FRWA 1MJ7H 3CFIC 2EO9A 3BD4A 3RWDB 2Y07L 1F11B 1QKZL 5EBWA 1CT8A 5DK2A 2VSCA 1QD0A 4LCYA 5E08L 4JFXA 2VDPH 4OF8A 4TSCL 3VGFA 4HIEA 4LVNC 5DRXB 1RUMH 3DTXB 1X44A 4ZUUA 2F58L 4L3EA 2XOTA 3MNWA 4I8DA 4P23B 4MJ6B 4AYFA 1C5BL 43C9B 4HS8H 3TFKC 1CXFA 4XI5C 4MSWB 3ARQA 3O4LB 4HF5L 3D39D 3S9DB 3VXSB 2QJDA 5I1HH 1JBJA 4XWGH 1NCBH 3DHJA 3V4VL 1X5FA 2D9QB 1HCFX 5HDBF 3L3HB 4LLQB 4X8JB 5I73B 1FP5A 1U8PA 1BQHG 2YD3A 1A0QH 1HILB 3FO9A 4PJ7B 4PJ5D 3P11L 2F19L 3B9EA 2FZ3A 2WBJB 3MLTB 4K3EL 2B1HL 4RAUA 5F6HJ 4TUJB 2ICWI 5LG1A 3HMXA 1GZPB 1QFUL 4JEGB 3CFJB 4JM2F 4DTGH 3C60C 3O9WC 4JDVB 5C3TA 4LASL 4ESKA 2BSRB 4OLYL 2CMRL 4Z78A 4OZIE 3KDMB 1T21A 1QSEE 4U1NB 5TJWK 3WFCH 3X3GL 1YPZB 5E2WH 4EEEA 3Q6GH 3A0OA 3SJVB 1XF4A 1W0YT 2XWJB 3C5ZB 3LKRA 2AJXH 4RNRB 3NPSB 1DLHA 3GI9H 1A3LL 3GJFH 1U8LA 5L7XH 2OTUB 1ZTXH 3KWWA 1OVZA 1WCBA 4NM4H 2CD0A 5E6IC 3LZFL 4Z7VA 1QFPA 5DQDH 2RR3A 3D85D 4PB0H 2AI0H 3QUYC 5ERWB 3LH2H 5GGRA 1AGBB 5TH2B 4XMPH 1CD9B 2YD7A 1R5IA 4JY4B 3MNVB 3WKMH 3VWJB 1P4LA 1BF2A 3E8UH 1EGJA 5GJTH 4WCYL 1K4DA 4NFBA 5DTFB 5E5UB 3HI1B 2H3NA 4QYOA 3D2UA 4RIRA 3LY6A 4M6NH 4DKEH 1RD6A 2AKRA 3O45A 4UT6L 5GRVK 2XZCL 4JFPA 1XGPA 3BW9A 3GBMH 1EBAA 4NKIH 2AJZB 5F1NB 4P3WA 1JHLH 1UADC 1WEJL 4OQTH 1CXIA 1LDPH 5F3HB 4PRBA 2J6EA 3C2AL 4HJGA 5TE4H 1KJ3H 1A7QL 2DKSA 4RQQA 1Z9OA 1ZT7B 2HFTA 2R2CA 4N0UA 4HV8B 1NMCB 3TBSA 4P3CL 3MRGB 4JANA 4GRWE 4YIQA 3MV9D 2X4PA 1PZ5A 1UM6L 4LFHG 5ETUB 4GLRI 1G0DA 3MQIA 4EXPX 4RX4A 1ZLUH 2CK0H 1Z0NA 3P3YA 1C08A 3FN0L 3T0XA 2AW2A 4XI5D 2XKNB 1GPOH 3L3KA 1HQ4B 4M6OL 1ZA6A 4FQ1L 4ODTL 3QIUA 1MJ7L 4CBPA 2DQDH 5BZWA 4TNWK 2DKUA 2AV1B 4N0RA 5DJZA 4C56E 1RSFA 4NQCD 4P4RA 3QFJA 3HHRB 3C6SB 3HRPA 3LQMA 4X4MA 3T8XA 3GRWA 4LLVB 1A6VH 1RUML 1RMFH 3CH1A 4NO2A 4HHAB 1YMMB 4UIMB 2FJGB 3RWGB 1N0LA 4MQ7B 1I1FB 4HS8L 1A6PA 5C6PB 5LWYH 4AEEA 5INCA 1U2HA 1UT9A 3C60D 3KPNB 4ODWB 3O9WD 4HGWA 2P5EB 4PP1D 4L8SB 4XWGL 4YHNB 1NCBL 3B5GA 1HH9A 1KOAA 4LPXA 1X5KA 3FTGB 4PJIB 4L8CA 1DEDA 4FQXA 2Q6WB 5ENWB 4OLVH 3FAWA 4WHYG 1A0QL 4ONFH 4MS8C 5ACZA 4LAJH 1CVRA 2MQ0A 5I1EH 4DTGL 4OD1H 4MNQE 2XWTB 2Y6SC 4M7JH 3U9UA 4O02H 3P77A 5E6ID 3VG9C 5TF1H 4J3OC 2P5WD 2EH7H 4IIQA 3RWFB 4YDVA 4L4TA 4LGSB 3BPCB 5HYSA 4HKBB 4ONOA 3FB7A 3QUYD 3WFCL 2CRIA 2Z9TA 5E2WL 3Q6GL 3CU1A 3MBEC 3FFCE 1Q72H 3MJ6A 1HWGB 1NCNA 1Q9KB 2AJXL 2OSLB 3GI9L 2KZWA 4X4ZA 1OGTA 3I6GA 4GW4B 5L7XL 2BNQE 3IETB 1ZTXL 4R0LA 2JLLA 3QUMH 4WI4A 3EHBC 1LNUA 5TDPB 2MMXA 3MUJA 2VZSA 4N90E 4HIJB 4Y88A 5LCVH 3IXTA 5DZLA 4PB0L 1J0IA 2V2WA 3QFDA 1I7TB 2G5RA 1KFAH 2BDNH 4XMPL 1EX0A 4HXAH 1ZE3C 4BJLA 2Q3AA 2PW1A 5AWNH 5T33H 5GJTL 1DSFL 1U8HB 4PJ8B 5CKGA 3AY4A 2XTLA 3CFKB 3BKJH 2HKHL 2MSPA 3ARGC 4NQEA 2VLLA 4NJAH 1PD6A 1CD8A 2O93L 4UDUB 2ICES 2EYSA 2CIIB 4UAOB 4ZQKB 3MMEB 5LAXA 2XIDA 2IADB 3GBML 3TNMB 1C12A 4NKIL 4U1GB 5CAYB 3JUYA 3MJ7B 1B4JH 4UB0H 1SQ2N 2D3VA 2ICEA 4ZXBD 2PN5A 4HJJH 3S4SG 4OQTL 2YRZA 1LDPL 4WUUD 1CFTA 4TRPH 4X4XB 5TE4L 4LLDA 1TCMA 4YQXL 3PHOA 4GO6B 5ABDE 3QXAB 5F8QC 1B88A 2A1WH 5HVHC 2D31A 2ENYA 2UY7A 1NBZA 1MHHB 1Q38A 3QZWB 2J7LA 3AM8C 2CK0L 5FM8A 3BD3A 3K46A 4X9BA 3V4UH 1F3JA 2JJUA 2CIKA 5B39A 1GPOL 3D39B 4X0KA 2OI9B 2YD4A 4ZFFB 2P8PB 5DYOB 4NCC1 5MI0C 1YN6A 1BOYA 5I17B 2PUQT 2DQDL 4ZS7H 3TYGH 3V6OA 3CFEA 4GBXA 5J1TC 1IBGL 4PJXB 1A6VL 2FO1A 2QV2A 3CU7A 1RMFL 3MYJA 4W70A 4NQXA 4PJ5B 3H9SD 4G8IB 3RVUD 4NNPL 4GRLC 1FFRA 3FB5A 4HH9B 4MS8D 5ICXA 2F15A 2NY6C 2HRLA 2H1PH 4WI8A 1CCZA 2YD6A 2XRAH 3S37H 3O8XC 3DO7B 5LWYL 5C0DA 1FH5H 1CTOA 4PR5A 3OGCA 4CADA 5HYFA 2FD6H 2VUYA 4JKWA 3VXRA 1AY1L 2F74B 3DECA 5SX5K 4I18C 3V5DB 1X4XA 3LKSA 3TO4A 1AI1H 3MBED 1J1OL 4J12A 1CFQA 1LO5A 4ONFL 3G9AB 1QHOA 2V5RA 3TT1L 2R39A 2NY3C 4FQJH 3DV4B 3ARFA 5GGSY 4XP5H 1WZMA 3GMMB 4MJID 1CGSH 3T4AB 1GJIA 4YC2C 4M7JL 1RJCA 3EHBD 5TF1L 2VZTA 4JRXD 4WWKC 3BEVA 3WNKA 1RZFH 2EH7L 3D85B 4ZUWA 3U4AA 4J3SA 4EDWL 3QEHA 3MXWH 4KJQC 5J0BA 3MO1B 4JO3L 1HHHA 4JQXA 1ZVSB 3KYKL 4Z76B 3OJDB 4WVRA 5E8NA 1Q72L 1UM5H 1R3KB 2DQTL 3BQUC 4MB5A 3GJFB 1JPSL 2EC9U 5BJTA 1WJ3A 1WFOA 1MCBA 5HGHB 8CGTA 4LCIH 1OTSC 2C4FT 1I4FB 3ARGD 3GIVA 2ESVE 4Z9KB 5K33A 3Q2CA 4P57B 1ED3A 3QUML 4RDQG 4DGIH 3IF1A 4PV8B 1S78C 1N5YH 2V9TA 2WW8A 4RBPH 2M8XA 4KJYA 5HGBA 1AHWA 3S96B 5GSRA 1N7MH 1PZUB 2BDNL 1FIEA 3EOBA 4HS6B 4HXAL 4HSQA 5FKAB 5AWNL 2VLRB 1P4IH 4Z7UF 4NJAL 3CLFH 3MJ8A 1T04A 4OT1L 5DQ9B 3MREA 3GHBL 1HSAB 1F4XH 4J4PC 1UXSB 3X14A 5BVJB 5D1ZD 3S36X 2OQJB 3DUUB 1B4JL 4UB0L 3DSFH 4PRDA 3IRPX 3PWJA 4OD2A 4HJJL 1MIMH 2BVYA 5D6CB 2VZUA 1NANI 4TRPL 1XCQB 3O6KL 4QTHB 2I9TB 4LSVL 3BDYH 5EOCJ 3R1GH 1N8ZB 1I85A 4NQCB 2AJVH 2A1WL 1JL8A 5LQBH 3IAPA 2C5DC 3TZVC 5ALCL 1J8HA 1NGXA 1VCAA 5ADPL 3SDYH 3RUGE 3MRBB 4GRLD 1W72A 5IW6B 1BD2A 2NY6D 1TPXC 1WZLA 1UKSA 4J7RA 4ELMA 2JELH 3O8XD 4N0FA 3C60B 1KXVC 4FP8H 3TO2B 1QQDB 3O9WB 4UDTB 1V7NH 5DJ6A 3I02B 2H26A 3CC5A 4Y16C 5HHNA 3TYGL 3FZUD 3HC3L 4MAUH 4YR6B 3H9HA 4MDIA 5AUMA 1GZQB 5C2BH 1T7VA 2EDJA 2XPGA 1LO2H 3PV6A 5CP7A 1A2YB 2UWEE 5D9SA 2JIXD 4FG6D 1DTUA 2ADGA 3FCTA 3QDGE 5J7CC 2H1PL 3FN9A 2XRAL 4CDGC 4HUWB 4ZFOA 3ZTJG 1FNEB 1FH5L 1MRCL 5AYUH 3KS0J 3RGHA 2DM4A 2P5WB 3PGFH 4OSUH 1P5UA 3IFNH 1NL0L 5E9DE 5KSUA 4KJQD 1CE6A 3O4OC 3RL2B 1MRDH 3QIBA 2D2OA 4M48L 3MRLB 4LHQB 3BQUD 1FPTH 3F58L 4MX7B 5F9OH 3E3QE 3JV0A 4NQVB 1OAKH 1FZOB 2YUXA 4JFDE 3QWQB 2J6EL 4BQCA 4XP5L 5I8EB 1CGSL 1OTSD 2IANE 3IKCA 1L7IH 4HKZA 3F7YB 1SYSA 4MXVF 3UJIL 3FOLB 1JWMB 3MXVH 1RZFL 1S78D 5IWLA 3KJ4B 3MXWL 2YRPA 5FYKD 5F7UA 2R1YA 4KKBC 5F7DB 1KB5H 2I9LB 3AXLB 2A6IA 1UM5L 3PF2A 5F7NC 3WIFB 3ZDXF 1VB9A 5ESVA 2WQRA 4FFWC 4XNYH 5EU3B 4V1DB 2PETA 1H5BA 3QUMB 4LCIL 1EXUB 2BVPB 3GMRA 4DGIL 1F2QA 3EJYC 1A4JA 5F44A 5I0ZA 1N5YL 4RMVA 4J4PD 3DX7A 3HPLA 4QRRA 1NFKA 4YDJA 4A6YH 4NM8L 4BSVA 1N7ML 3ISWA 1WISA 4ZXBB 5BS0D 4JCLA 3UTZB 4HZAA 4JPIB 4WUUB 3ARUA 1SYVB 4XCNA 3EYOA 3QJHB 4CVXB 2DKMA 2W0PA 3VU2A 2UV3A 3VFVA 3HLAA 3CLFL 3SEPA 1A9BB 5EN2A 1N3NB 4LLYA 4UOJA 3W0WD 3TZVD 1CS6A 1F4XL 3JZ7A 4JDZB 3H42L 4ETQA 5E2VH 2GFBA 4OZHF 3DSFL 3C5JB 4G5ZH 3MRJA 3SO3C 4JO2H 1R24B 2YEZA 2OJZH 3T0DA 3DGGA 3DETC 3RJQB 4F37F 5EUOA 5D71H 3T09A 3KLSA 3R1GL 4YBHA 2VR5A 3CZFA 4HUXA 2AJVL 2BSTB 1HSBB 1EDQA 3QCVH 5DZNA 1OAZH 5FO9B 5I1CH 2G5BA 4X6DF 3QJFB 3H9SB 4OZFA 3W9EB 4NC1E 32C2B 1OGAA 1SVCP 1RUPH 1R3JA 3CAFA 1MCLA 4TVSa 4S10A 3F7PC 4K3GA 3THMH 5DK3A 3SDAC 3WLWD 2JELL 4FP8L 3U2SB 5E8EA 1QA9B 3KPRD 1CDBA 3BT2L 3QHTC 2CKBH 1F45A 2X4SA 4RRPG 4MAUL 3CNKA 2R2HA 3GO1H 4YDLC 5C2BL 3WSQL 3SKNA 2JF1A 1HI6B 4KKCD 1BOGB 1LO2L 4RZCB 1P7QD 1FL3B 1TJHL 3JTSA 4P2CG 3TBWB 5DT1H 4YHKH 4LDOB 4G8EA 2EXWD 5C7XH 4MJIB 1QP1A 3UC0H 4UBDD 3CMGA 4LKCB 3UZVB 2DWDA 4L8BB 4HC1H 4OFYA 3V7AG 4JRXB 5GHWL 3ARDA 3PGFL 3OPZL 3V0WH 4LPWA 1I7ZB 3IFNL 3T3PE 2Z93A 3LCYA 5CZXD 5IBLC 2YA0A 4JPVH 5FYKL 3HZVA 2XZZA 1NGZA 2EZ0D 5KANG 3HS0B 5L88H 3EO1A 4NZJA 1FPTL 2Q86B 4FFWD 4UMGA 3RZWA 1OAKL 3K8LA 4NN7B 1FYTB 3ARGB 4U1IB 1L7IL 2VLME 3FO2A 4O2FB 2AJSH 3EJYD 1K4CA 5GRXG 5IHZA 5HHVH 3ALWA 5BRZB 1NGWB 3O2DA 4WW2A 4PGJA 1IL1B 5GIRB 2O61B 4QOKA 5C2UB 2J3SA 3G5VA 1U9KA 1KB5L 1VEMA 5CP3A 3QCUL 1B4RA 4YAQA 1HEZA 3RZCA 4F57H 4XNYL 5HI3D 5FDWB 4CMHB 4G9FD 5C71A 1ZHLA 5DC0A 3T3ME 3AS2A 4NDMA 5HVHB 5IROA 3SKJH 1VA9A 4ZNEA 2OTPA 2VZ1A 4F8QA 3GSRA 5D1ZB 4ZNCD 3N50A 1BX2B 4FHBD 1J0JA 3GDBA 4PJEF 3SN6N 2F54A 1YA5A 2FL5B 3VFNA 1T7XA 4PBWD 3DETD 3LKOA 1A1MA 2AEWA 3VGEA 1ACYH 2Y5TB 3VXTA 2JCCB 1IAKA 3TVMD 1CFVH 4G8GD 2V7HB 5DJCA 3OSKA 1NDMA 3MRQA 4BFGA 2RHEA 3DV6B 1KTKE 3JWOC 3PWUB 3VGAC 4QHUB 1IGCH 4Y5VB 3GM8A 3MV8D 1JI1A 5F1SA 4BSJA 3O8XB 2HAZA 4XNQB 3SDAD 4JO2L 1TIUA 4X6EA 1A6ZB 5A3IC 1TZIB 2G9HA 2OJZL 4WDIA 4P2RD 4U6YA 2ITDB 4QXGH 5D71L 1D5ZA 1KYOJ 1QSFE 1JYWA 4MQXC 1J88A 4RGNC 4YHPA 1EV2E 3QCVL 4YK4C 4Z0XA 2AXGA 3SDDB 4KDWA 3UPRA 5I1CL 4NO3B 2JIXB 4JDTH 7FABL 2X1WL 4N1HB 2FIRT 1RUPL 2ITCB 4P2OA 1MCOH 1BHGA 2Z4QB 4YPJA 3P9LA 4YC2B 4FTVA 4JM2A 4U1HB 5DJ2A 4JHAH 5IG7B 4PP2A 5DO2C 2H6PB 1TVDA 3QDMA 2CKBL 1P7KA 1SM3H 2X89A 1U0QA 4HMEA 5IBLD 3GO1L 1EVTC 3WFDL 2B2XH 2EDYA 2OXHA 4XGZA 2MJWA 4EUPA 2NW3A 4M1GH 3D25B 1ZHBA 2XNAB 1MUJA 3BQUB 4Z7QE 3JWDH 5IQ9A 4ZG1A 1F6AB 1ETZB 5C7XL 5KAQG 3UC0L 4IHOB 1ZA3A 4HC1L 3QNYA 1R5VB 1AIFB 4RFEB 3V0WL 2R29H 3U4EB 1UQSB 1U92B 1T83C 2LFGA 5IMKB 1A6UH 1I9RH 3L9RA 2FSEA 2MWCA 5FGCB 1QBBA 4JKLA 3VH8G 3HR6A 2VDML 3BZFA 1U3YA 3L7FB 3HPJA 1JYNA 2IH1B 4XMKL 5L88L 1TMCB 1HH6B 3ZE2E 2XA8H 1VSCA 1YY8B 4PG2C 5FF6A 4EN3C 1MI5D 3L95B 3TA3A 1UJ3A 1YQ2A 2ZUUA 5E94B 1I3GL 3ROLA 1TTUA 2AJSL 5IHBA 3WLBB 3OKKA 2A6JB 3EO9H 4ZAKC 3JWOH 4LOUC 3BHBA 4LPVA 3UEZA 3O81A 5T5FL 4A2LA 3L3OA 1KB5B 1JPGB 1JV5A 1S9YB 4HKJA 4WU5B 4C57C 1G84A 1VDGA 3NA9H 1BQHA 3BH8A 4YFDB 4BZYA 5K9KB 1MLCB 1BEYH 1YEGH 1EK3A 2YA1A 3BO8B 3HFML 3ET9F 4F57L 1H8NA 1JNLH 3ARED 5FM5M 2VDLH 4OFDA 2ZSWB 5ISZD 4MNGE 3SKJL 2DIAA 2HN7B 4ZPTA 3W0WB 3TZVB 2R2EB 3TGXA 1OCWL 12E8H 1JZ7A 3OKMA 4XNZB 1TJIL 5I2IA 3O3BB 1YEDA 4KVNH 1MCDA 4C83A 3O2VL 5A3ID 1X5GA 4U3HA 2HJFB 5T3XH 1G9NL 5KAQF 3MUHL 1J7VR 3V79C 2YKLH 1JNHA 2VE6A 4MQXD 2YPKA 3UTSE 1CFVL 1I8IA 3L1OH 4UI2A 3CZJA 3MCG1 5ACLA 4PJCF 2DIBA 3IFPA 3UBXB 4AH2B 4Y4FA 1SBBA 1DFBH 1IGCL 3ZL4H 1GHFH 1H3GA 3F65A 7CGTA 2N56A 4RFNC 1U2CA 2MKWA 2X7LB 3CD4A 3K1DA 1WLHA 2D7NA 2RFXB 2VISB 4F8TA 3KPRB 5KSVA 1NC2A 5C08E 4ISVB 2PR4H 3MV9A 5DO2D 2UZXB 2GUOB 5JHDE 4QY8A 3ARXA 5J1AA 5IJKA 3VD9A 1BBJA 1MRFL 1SJHB 1P7QB 3I50H 5L8JB 2PCPA 1D6EA 4JDTL 3PWPD 4PJAE 1KPVB 5L2JA 4BQ6A 3L5XH 5DJYB 4Y1AE 1MCOL 3P30L 3FO1A 5FUOL 4BQ9A 1ES0B 2XZAL 3KLHC 1NDGB 3LN5A 4PGCB 2Q7YA 2IFGA 3EFFB 5CBEA 1BFSA 2CKBB 4F7EB 2NQCA 1EEQA 4QCIA 4WW1B 2B2XL 5CILH 1F42A 1PFCA 3QXUA 4G8FA 4M1GL 1WWCA 3RWIB 5ALBL 5F9JB 1BIHA 2DTSA 1PKQA 3BP4B 3JWDL 3MRPA 4WFEE 4PJEB 4PTTB 4XAWH 2VAAA 2BNUA 4EN3D 4RWYH 1YMHA 4I2XE 1DDHB 3S35H 5C0EB 1G7MA 1IFHH 2VOTA 5EOTB 1GYAA 1X7QA 3BN9C 5ID0B 4GXUN 4XX1G 2KZ1B 1IQWH 4LOUD 1A6UL 5B4MC 4MA1C 2XFXB 4LVEA 2EICA 5IVXF 5MEQA 5J9PA 5L2KB 4NHUA 2FO4B 3QO0B 4G9FB 2XA8L 5SWZD 5E6IA 4XT1C 2WP3T 4M5YL 3WFZA 1BLNB 5D96B 5F9WC 4J8RB 3QUYA 4UU9B 3EO9L 3JWOL 4TULH 3DRQB 5EZIH 1E28B 1SJVA 1PEWA 3WE6A 5D70L 1MIEH 1XGTA 2X44D 5IB3B 3SO3B 3BGAA 1CLOH 3BZ4A 1MH5A 6CGTA 4OF5A 1IQDB 3I2CH 3RHWF 4I3SH 2Y72A 1YEGL 4K23H 5A1AA 5IB1B 4EI5A 1JNLL 5J6HA 2VN4A 4RFOL 5DMKA 3TVMB 2MTPA 4G8GB 5HGDB 5EC1B 3L3JB 3IGAB 3FFDB 3JV4B 5H37G 2DLFH 1T80A 1K2DA 3FQTA 4P3DA 2R15A 3IS1X 12E8L 3FQRA 3CGTA 1RZ7H 2OP4H 3MV8B 5DGRA 3IU3B 4H26A 1HQRB 3CFDB 2OZ4H 1MCFA 3FT3B 4KVNL 4FS0A 3SDAB 1B0WA 4P2RB 1MVUB 2OCFD 2A73A 2X70B 1AQKH 1S7QB 2NZIA 2YKLL 2EIDA 4H25B 4UNUA 3UBXI 4M4PA 4XPHL 5KSBE 4P46A 2ZCKL 2VXUH 1SJXA 2IPTL 1LP9F 1FZMB 1AD9A 3O11A 4OGXH 1LE5A 2ZCHH 3ZL4L 1GHFL 1JUFA 4OZIA 2L0DA 4JCMA 3S34H 3T1FB 4AENB 3AROA 4Y4KC 3KLHD 3BEWB 3KYMB 1INEL 3L3DB 4OTXH 1U8JB 4H20H 4NBZB 1ZWIA 1FFOB 1BQLH 2QHRH 2AS5M 3G5YA 2PR4L 1WCQA 3CSBA 1A6TA 4YGVA 3FB6A 1BIIA 3OKDA 2D7OA 4P5TC 4NUJB 4BH7A 3VXME 3DVFA 3I50L 5EO0B 3ARPA 3KPSE 3TWCH 4FXKA 3F5WB 4QWWC 3SCMD 5J3HD 5B8CC 5SWSE 3GNMH 1T5WA 1BECA 1NLDH 2V7NA 4XB8A 3SQOH 5GZOC 4Q9CA 1AO7E 3S4SA 1CXHA 1LILA 5GISH 3MRIA 4LMQE 5JW3H 4YBLC 3U36B 1OARH 3CDYA 2X9XA 2Y4SA 3F7VB 3WXVH 4XPGL 3ME0A 3QNXA 5B4MD 1AQDB 5BO1H 3BKMH 3AAZA 5CILL 5H2BB 1L6XA 1UZ8B 2BY0A 3KLDA 3HAEG 4MMZC 1U8NA 5IEHA 3UPAA 1MI5B 1IAOA 1GGYA 1G7QB 3K4AA 4XAWL 3VI3E 3MSPA 2R8SH 2NXYC 2OL3A 2VL5B 5K9JH 4PJHB 3QEGH 2WK2A 4JKPL 2EYRB 5E2JA 5JW4M 1NJ9A 4PLKD 2ZOKA 3MRHA 3RWJA 1VKXB 3MBEA 4U33A 2D7QA 4JVPA 3G08B 4NNYB 4PJCB 3HG1A 4ZO9A 4H1LG 5GRUH 1A5FH 2EYTB 2DN7A 4XWOC 1WT5C 4Y5XA 4M9OA 3AREB 4OLEA 1VGEL 1WAAE 4OKVB 4JREB 3UTOA 2YS4A 5JTWA 2MPAL 2ARWA 3FHQA 4Z7UA 2VN7A 3BN3B 4JQIH 3VGAB 3ZYZA 4G6JH 5GSVA 5EZIL 5C09E 1WBZB 1MIEL 2OS7A 1JF5A 3PWVB 4K07A 4LRNH 4X7SL 3I2CL 4I3SL 1XF5B 2BSED 3GSUA 1I1AC 3TBVA 4E41A 1Q9WB 4PGBB 4K23L 1QO3A 3VFGH 4ZO6A 1AGDA 4M4RA 5JXEC 1A4KA 5H35A 1R3HA 4QLRA 4OLZH 1A22B 1LO4L 2P42B 4JHZA 4YK4B 5LGJA 2DLFL 5IK3A 1KPRB 1H8SA 4LSPL 4M1CC 1IGJB 1XH3B 3MBXH 4MJ5A 2OP4L 2R4RH 4JAMB 2OZ4L 1X6LA 1T22A 4XP6H 3TJHC 4PGEB 5C0GB 4Y4KD 1H3VA 1XGYH 3TM6A 1NAKL 5HVWA 3AGVA 5K9QG 1WBYB 1W8OA 4ZTOH 1U8IA 4MNQA 5I16A 3AM8A 3EYVB 4HZLA 4R4NC 1IGFL 1AD0B 1D5XA 4OGXL 4LF3B 2ZCHL 2ZWLT 5I8CA 2CRMA 3DYPA 5IVXB 1BFOB 4OZ4B 3S34L 1FL5B 2XQYG 4XTRC 1JK8A 1FORL 3ZYJA 5GZOD 1IC5H 3FFCA 4OTXL 1BQLL 2QHRL 4D9QE 3MOQA 4R4BA 5ELIA 2DQHH 4ENED 4FQHA 2ED8A 4LCUB 1X4ZA 5A2LH 4M7KH 2EDDA 3MRNA 5GS3A 1S9WA 2VC2L 2PYFB 4MA7H 5EU4A 3TWCL 4KVCH 4OZGF 4QHKI 4QO1A 4MD0A 4EN3B 1NLDL 3SQOL 4N8CH 2NXYD 5FAAA 3KVQA 5JW3L 3D3VB 2MHAA 4I18A 1MFEH 3DROB 5EC2B 3O41A 1OARL 4HIIB 4NHCH 5EU6A 4B5EA 1NAML 1RU9H 2EIZA 3WXVL 4F15C 3SKMA 3UO1L 5BO1L 5IMLB 3BKML 1UACH 3LKNA 4HFWB 4FZ8H 4N9GB 3P0VL 5HY9A 3I6LE 5CKAA 5LGHL 3B2UC 3M45A 2YD1A 3BGMB 3L5IA 4X6CE 3DIFA 5CBAA 2O26U 5SWZB 3QHFH 2F8OA 1TZHA 2AJYH 4WWKA 2R8SL 1BREA 5K9JL 1JRHH 4ELKA 3QEGL 5I1LB 5IB2A 1CG9B 1F4WH 2X4NA 3GK8H 3UYOD 1KCRL 3LS5H 3GSOA 3MUZ1 3P0YH 3QDJA 3TH4T 3IJYA 1U8KA 4L29B 1UXWA 2VDRH 3KXFE 4DVBA 1JHTB 5I1KH 4XVSH 5FUZH 1G7HB 2X1QA 5D1QC 4Q7DA 1EIBA 4PTUA 4RA3A 1YN7B 1I1AD 4WU7B 3BWAA 1CR9L 5DMJB 5JPNB 4OAWA 5JXED 4J3WA 1X5AA 1WV7T 2IH3B 2HLFC 1JGDB 5GGSB 4PJFE 4M1CD 4U6XB 1K8IB 4F9PA 2L4OA 1C1EH 3IAQA 4X7CC 3VFPB 2YBRB 1WTLA 2DQFA 2XN9E 3EGSA 3NAAH 4HQQH 5BOPA 2WWKT 2EE3A 3RY6A 1O7SA 2ZUXA 4QRUA 4U3CA 3TJHD 1Z5LB 4S1QH 5BV7L 3HUJE 4LRNL 2B5IC 4OZHA 1QSED 5A16A 1J0HA 1U8QB 3S3SA 2A6KB 1D5IH 1NCAH 3A6OA 4YBQD 3TPKA 5F88B 4E5XA 2XTJC 3TN0C 1FGVL 2RCSH 2OK0H 5I1AA 2JK5B 5J6GB 4D3CL 3TV3H 2FECL 4R4ND 3MBXL 5BVPH 5BS0A 3VDBA 4MDJB 1WSST 5D2LE 4X6DA 1CZ8H 2R4RL 3VFUB 3GBNL 3GGWB 2X05A 1QUNA 5MEPA 1XGYL 3VWKC 4Y4HC 5E6ZA 2HVKB 2O5XL 3HZYA 5KVMC 4PRPE 4XB7A 1S7XA 1J05A 1I7RB 3GZKA 2IPKA 1ND0B 2OMNA 5EBLA 3BISA 3FQXB 3D48R 4IS6A 2GIYA 4A6YA 4ZTOL 4X9FA 2Z31A 2Z92B 2APTA 4RA0C 5DD1H 1AE6H 3SCMB 2W60B 4PFEA 3T65A 3WV0A 3GMOB 2GTWB 5E2UH 4GQ9L 3L7EA 3NCJH 1IC5L 4IRSA 1KT2B 1RK1B 5DFVC 4Y16A 2ZUWA 1C16A 4PRAA 3BZEA 4MA3A 4X5XB 5DHXB 2DQHL 5IMMB 4S11A 2AQ2A 2V2TA 2A0LC 1FNGB 3DMMD 4MA1B 5A2KH 2ESVA 5F7YC 1QFWM 4M7KL 4ZD3H 3MRCB 4KFZC 3ARSA 4KVCL 3MRDA 4M61A 5FM5O 2PW2B 4X80H 4UQ3A 4ZYKB 1G7PA 3HR5A 2E7CA 3LRGA 1PBYA 3E6FB 5F9WB 5FK9A 1NAMB 1II4E 1MFEL 2H9GB 4BH8A 4JRYD 5TQ0H 1RU9L 1KTRL 1NEZB 3B3IA 3U30C 2FLBT 3L3GB 4E0RA 4C56D 2VABB 2P48B 4M7ZC 3L5WB 3U0TB 5D1QD 2P24A 2EDXA 4G43B 4OV5A 5D1XD 5HVFB 3QHFL 3PIQA 2YXFA 1DN0A 1PYWA 1JRHL 2YPKB 4TUKH 1A9EB 3OZ9H 1G7IA 2DQIH 2R2BA 1QPPA 4GFTB 5KTEH 3P0YL 4QHLB 4ZSOA 4RRPA 1T20A 43CAA 2GCYB 4LBEA 3WYRA 3E0GA 5I1KL 4R4FL 4XVSL 1NEUA 1XGQB 3OXSA 4WRLA 3D69B 1FLRH 5L0QC 3AUVA 3D18A 4WFFD 2XTJD 2BRRH 3TN0D 2BMKA 3QIWC 1ZS8B 4DZ8A 2CJUH 3PL6C 5CUSH 4QXTB 3LQZB 1PY9A 2NX5A 5DR5H 1B90A 1C1EL 1BQUA 1RIHH 5JPMA 4GW5A 3GEWB 3DUSA 1RHFA 3NAAL 4HQQL 4OCRH 5BV7B 4Y4KB 3DXAD 1Q1JL 2VH5H 4S1QL 2BCKA 5CEYA 5IKCB 4OZGB 5I75B 3WUWG 2UWEA 3WD5H 1D5IL 4FQ2H 4G9DB 3QWRA 3MROA 1KF9B 3QDGA 3BXNA 4UUJB 3HCVA 5EZOL 1UH2A 2RCSL 5AZEH 2OK0L 2BNQD 3BD5A 1EVUA 1FJ1B 2X1PA 3UX9B 5BVPL 1N2RA 4L1DA 4Q0XH 4QHMA 1MQKH 1HYSD 2AK4E 5E9DA 4KV5E 5B8CB 1Z3GH 4LEOA 4HULB 3SO5A 1UCBH 5DI8B 1PVHA 5FECB 4YBLB 4WENB 1A7NL 1JZ6A 4M5ZH 4JFDA 3ZE1F 2A0LD 1NGQH 4YLQT 2ORBH 4CN4A 4HWZB 3MLRH 4WTXA 4F7TB 1U93A 5DD1L 4U1LA 1U3HD 4O51B 4B53A 1WZKA 4ZDHB 5SWQA 1KEMH 4LDLB 2VERN 3BRDA 5E2UL 4OCWH 2NXYB 2Y7QA 2Q20A 1EJOH 4L4VA 5C07E 1URLA 3TP4A 4X99B 1YNTA 3QUXA 5HHOE 1E6JH 4U05A 3WNOA 2IBGA 4JZJB 2XKUA 5GPRA 3BGFB 4G6KL 5AEAA 3OTTA 5FYLE 3C5SB 2Q87A 1EFXA 5TDOB 3QEQA 1V05A 2AV7B 1T7ZA 3RY5A 1H15B 2VDKH 1DQDL 3I3DA 4NKOA 4X80L 5C0AD 5DRNB 1S7TB 2R0ZL 3IJSB 2BVOA 2GJ6A 1I9IH 3VXUD 1IZJA 3UYRH 3MCKB 1KLUB 4Q6YA 5TQ0L 5IB4A 1PLGL 2K9UA 2VB5A 1I1AB 5I9QC 4LPUA 1T89A 1XZ0B 3P73A 1MFNA 1MFCH 5A2JH 3S97C 3QIWD 1L6ZA 3DVGB 3GSQA 3PL6D 5I66B 4TUKL 4WEUD 1E27A 2AXHA 3OZ9L 5DJ8B 2VQUA 5ITFB 3PGCB 5D7IE 3S7GA 4LIQH 1QSEB 2YR3A 4NCDA 3RVVC 3G5ZB 3OBAA 5DHVH 1N4XL 4HFUH 3FQUA 4P4KC 2NY5L 3V6ZA 3MUGB 4MAYA 3JTTB 2BRRL 1NUGA 1R3IH 3GJEB 2CJUL 3CCHA 5CUSL 2NNAA 3AS0A 4D0DB 5F72S 1Y6NR 5DJ0A 5DR5L 2YWYA 2HFEA 1AGEB 3D0VA 1U42A 3TCLA 2CXKA 4OCRL 1AXSB 1NBYA 3VH8A 1FBIH 5HPMA 2W65B 2VH5L 3OX8A 4NRYB 5I74C 4EJ1C 4W4OA 4F2MB 1I8KA 2CLVB 1MWAH 4HXBH 5ISZA 4K55A 3WD5L 2FECI 3QSKB 4PJGF 2HVJB 3K4DA 3X12B 3CFBA 1QR1B 1CDYA 2VLKD 5AZEL 1S5IH 3OB0H 2C4FU 1MF2H 2OX5A 1KACB 3CIQA 4D94A 1P69B 5DSCA 2BZDA 4Q0XL 4L3EE 1TVHB 4X5WB 1TDQA 5IVOA 5I15L 4HX1B 3L6FB 4HCRA 3CSYB 1XR8B 3G6AB 4YHIB 3MLVH 3QR2A 1YQVH 2N7AA 2Z0BA 1F6FB 3GSNA 5IB5B 1T2QL 1LK2A 3MOAH 4F15B 4M5ZL 3QI9C 3B9DA 1UJTA 1LD9B 3DMMB 2BHYA 4JFQA 1QVOB 1XAUA 2ORBL 3MLRL 4IDJL 4Z7OF 5EZJB 4MCYA 3LKQA 4K7PY 1KENL 4I3RH 4OCYH 3RY4A 4FFZH 1GOGA 1HDMA 1VADB 5E8DH 3OXRA 2YK1L 1L7TH 1T1ZA 4HDIB 4NKMB 4NO0A 5GGQL 1EJOL 2R23A 3LRHA 1AXTH 4TUOB 4ONGH 3CFCL 4JRYB 1A7BA 1E6JL 5E1AB 2VKXA 3RPKA 3VRLF 5JIKA 3K0WA 3RL1B 1S7WB 2ZSVA 1T4KB 1DL7L 3PWPA 4NKDB 4C56B 4OCNC 4GG6F 1RULH 4J3UA 4J3XA 5D1XB 2FBJH 1ZSDA 5CGTA 2P7TA 4G42B 4JN2A 2MFNA 4BFEA 1D5MA 5C9JB 2FJHB 3FT2B 2VDKL 5DHYB 4RAHA 4WNQB 4HKXB 3RPIB 3SDXF 1I9EA 1U41A 5CLTA 4Z7VE 2BY3A 2X4RA 2RQ8A 5D2NE 3ARBC 3KLAB 2WSKA 1U91A 1IC7H 1NUNB 1JPST 3WHXA 1CWVA 1JRHI 3RVVD 3CSPA 2V5MA 4XAKE 1S9XA 4PJBF 4P4KD 1BM3H 1CDIA 4LCCB 2EDKA 2YPLD 4NC1C 3TN0B 1MFCL 5D7LE 4H8WL 2YD8A 4HWBH 4C55A 5CINH 5FA3A 4ZAKA 3NFNA 4D0BA 2YN5A 4LARH 2Z8VC 4ODUB 1QSFA 5HHQA 2P1YA 3DXAB 1N64H 4IRZH 1QSVA 3T4YA 1MCWW 2V5SA 4HFUL 5J06A 4XCYB 4YHLL 1NMBH 3HZMA 3RI5K 2DYPD 4JFFE 5AD0A 5GS0C 3IDIB 2APFA 1XGRB 4X7FC 4PRHD 3VFMB 4N0UE 1R3IL 5E5RB 2BNQB 1ADQA 4OJFH 1U58A 2IAND 4DN3L 2WMPA 3GSWA 3IFLL 1LP9A 1OSZA 3O6FC 1A14L 1YUHA 3DX9B 4P59H 3BESR 2B1AL 1M7DB 2EEAA 1SEBB 3IDMB 4PRNB 1XCTB 1MWAL 4HXBL 5FGSA 2PTTA 3IXAB 3QI9D 2SEBB 1JWUA 4UOW1 1MF2L 1U3HB 1S9VA 3I75A 1OAXH 3ZKMD 1DVFD 5KG9A 1S8DA 5JDJA 1WBXB 1Q9OA 1MCWM 5EU7C 1A21A 2C3HA 2R0LH 2XWBB 1WFTA 3CVIL 3QEUA 4XC1H 1KNOB 2J8OA 2BX5A 5HYJA 3MLVL 1KCVH 1QRNA 5T1LA 4XZUB 4PJDF 1D9KD 1P4BH 1KN2H 3UCRA 1FL6A 4NN5B 1ORQB 2Y1VA 4TTGA 4PY7B 4EOWH 4M7ZB 3T0VA 4LK4A 5HDLA 4JLRA 4I3RL 4OCYL 3E2HB 4FFZL 4M93C 5DUBA 1MQ8A 1IILE 5E8DL 5C0AB 5F1IB 1T7WA 3EOAA 1L7TL 2C9AA 2EKSB 3VXUB 4TVPE 1NSNH 4RMRA 1BMGA 4IBLT 1AXTL 4WO4C 4ONGL 2Q76B 4QF1A 4KRMB 3TPUB 4F7CB 2IALB 3RU8H 4MNGA 3OHXB 3ZTNL 1VACB 3HE7C 1QYGH 5JA8B 4FXGB 1RULL 2FBJL 5MP6H 3SGEH 5CIPA 1UM4H 4GOSA 1D3CA 3QIWB 5GS0H 3PQYD 5CD3A 2CDGA 3PL6B 4LCWD 3WFHA 5F3BB 1MHCB 5EG6C 4PJGB 2GHWB 4BFIB 4XNMA 3K2MC 1IARB 2X4UB 1I9JH 5GJSH 3UTSA 4HD9A 4YZFE 4NWTH 1IC7L 1JPFA 1F90H 3LRSA 1FG9C 2N1KA 4P9HL 3IFOA 4AT6B 1BM3L 1CLCA 1T03H 5GS0D 3X13B 3G6JF 3ZKXC 4NT6B 4WTZG 3IDJB 3KPLA 4P5MB 5CINL 3WJLC 5GS1C 4R7DA 2IQAB 1S7RB 5C08A 2W59A 3FB8B 4NO5B 4XH2A 2AABL 2CLRA 4YFEA 1ONQB 5D7KE 5DHVB 4IRZL 3C6LA 3X11B 3QUKA 4PUBH 4R2GC 1AJ7H 1DUZB 4PJAA 4R3SA 3U6RB 3HAEA 3H7BB 5DJDB 2NW2A 2BC4B 3RAJL 4NQSB 2VLKB 2IWGA 1LE9B 1HNGA 2R0KH 3D0LA 4OJFL 5BXFA 3GHEH 5AYQA 1MCPL 2VQ1B 2LAAA 4Q9QL 3T77B 1JPTH 3CVHH 1RUAH 4GG8B 3U0WH 3RWCB 4P59L 4Q2ZB 1QSZA 4JPKH 2BFVH 4H1LA 1F97A 2HFGH 1MWAB 1HHJB 2XG4A 5CHNA 3BPNC 1FFNB 3B9KB 3SDXB 1RVFH 4P5KA 1A6AB 3PJSB 4NP4L 5A40E 4I2XA 4HG4K 4Z95L 2WP3O 1FG2B 4EQ3A 3V6OE 4B0MM 2XV6B 1EAPA 3QQ3A 2X41A 4D8PA 2P45B 2W0KA 1CGTA 2R0LL 4ORGB 2Y9RT 1A8JH 3MV11 2PYED 1C5DA 4YHML 4Y5YA 1KCVL 4WV1C 1E4KC 2F53E 4JFEE 4AG4L 4WO4D 4QRPD 1KN2L 4P5TA 1CICD 4N5ED 3JV6B 3VXRE 3LHPH 1YEEL 2FYYB 5AAWA 4J23A 4XPFL 5K9OB 3T2QA 2BNRD 4MNHB 3HE7D 1DBKL 5I9QB 4L3AA 2DWEA 3STLB 2XT1B 4JB9H 2Z91A 5TE7H 3MR9A 4U4BA 3RUGB 3LDBC 2L7UA 3NCYP 3QG7L 3P2TA 1YC7A 3KPMB 4RSVA 4LVHB 1GSMA 1DQJA 4M9PA 4X5LA 2VUOA 3NIFE 3RU8L 5C0IA 4HJ0C 4KWUA 4KMLB 5JO5B 1QYGL 2HT4C 1FVDA 2CUMA 5FA4B 4P4KB 2C3VA 5MP6L 4F7PB 2YPLB 4OGAC 3SE3C 3F62A 5GS0L 2LVCA 5F7LB 3X3FH 4S1DC 4XPBL 5MEND 5E7FA 3QPXL 3U7AA 1KGCE 4M43L 1LGVA 2NY0C 4HPYH 1I9JL 3LPGA 5GJSL 1DE4B 4J1UA 1SMAA 2CDEA 5D5MF 1CDGA 1WT5A 3DO3A 4NWTL 5FUCC 4KUZH 2PXYA 5I74B 2ED9A 2NLJB 4GXVH 4ZUSB 3VFSB 2DYPB 1M05B 4PRHB 1T03L 1M7IA 2PO6C 2W92A 1OY3B 1XF3B 3GSNL 1P5VA 2AJUH 2Z35A 4NNXB 5DWUH 1ZAGA 1F4AA 1X5JA 2B4CC 1F4HA 1IGYB 2IANB 5C8JB 4KK5D 5E6YA 3KPOB 4FQIH 2BXYA 1LDSA 3EYSH 5DQJB 3W9DB 1PG7H 4ZUVB 3S5LG 3ALPA 3N1PC 2ICCA 3KPQA 1A02N 3V6BR 4ODHL 4XP4H 1CXKA 3RTQC 3VXMA 2H2PC 5CJ5A 3NACL 1AJ7L 3NIDE 1IAIM 3QI9B 3RKPA 4NQDE 1DBJH 3TNNB 5J11B 5SWSA 1CGWA 1UFUA 2R0KL 3FOMA 5MERB 4GMTH 4U1SB 3GHEL 2PF6A 3PDOA 1DVFB 2VLJD 3VJ6B 4LU5H 1ZKAA 4Z7WF 3O3DA 4K3HA 1J8HE 1JPTL 1KUMA 1RUAL 3U0WL 5KN5A 1T0NB 1KN4H 4JPKL 5TDNA 2BFVL 2HTKC 2HFGL 1B0RB 4ELME 3VFTB 1D9KB 3IU4H 4I0PA 2HG5A 2ZUSA 5ANME 1RVFL 1UA6L 3OKNA 2GAZB 4OM1L 1IAMA 3PABA 5IF0B 4O4YH 3ZSSA 2A83B 2Y23A 5IHLB 2K7QA 3QA3A 2E7LC 1T66D 1RJZA 5EU5A 4OF3A 2JJTA 3BPLC 3GMPA 3KYNA 1MFBH 1MEXH 5FO7B 5CEXA 1HKLH 2B0SH 5CEZE 5CSZB 5C0CD 4HLZH 5ID1B 3UTTA 4HJ0D 3E1F1 2IJ0C 4NRZA 1KJVA 3GMQB 2MNUA 2HT4D 2H8PB 5EUKB 1CGUA 2IG2H 4OGAD 3PQYB 4KJWC 1ERNA 2J2ZA 4LCWB 1FIGH 1JTPA 3J7HA 5GGVY 3O4LE 3WO4C 1UB6A 2B4CH 3PNWA 5T3ZE 2G75B 5DD0H 1SMOA 1RZ8A 3V5KA 4G6MH 1G7JA 3ELAT 4G80A 3TBYB 2J8UF 5CZVH 1HHIB 3WN5B 5JHDD 4PJ7E 1PAMA 5HBBA 1NFDF 4AM0A 4CVZA 1KTLA 2PO6D 3X3FL 2YA2A 4S2SA 5HGAA 3MV7D 4Y1AD 3HRZA 3MRMB 2I24N 3QP3A 4HIHA 2QSCH 3VRIA 4Y2DB 4HPYL 4E42A 4JY6B 5IMOA 4QRRE 1M71B 5T1KD 5D1QA 3BRGC 1D5BB 4XXCA 5FGBA 4JHBA 3FONA 2ATKA 5DJXA 3RTQD 1A7PH 2VXQL 4GXVL 5LBSH 3K7UA 4HK3N 3WDIA 1V3KA 4K7FB 3WS6C 4C54A 1FO0H 5EDXA 3F12B 5MEOA 2AJUL 3VRJA 5JNYB 5BZDA 4IMKC 1AGFB 5TE6L 4PV9B 5DWUL 3LKPB 1KC5L 4I9WE 3QDHA 2IF7A 4X9HA 1YEKH 2HT2C 4FQIL 1DEEB 3G5XA 1YDPB 1DBMH 3ZDZE 1N59A 1T1WA 2HTKD 4LHUG 4XP4L 3QRGH 2GITB 3DX6A 4R26L 1G6RH 2WV3A 1UGNA 5TF0A 4QTIH 3CX5J 5B38B 4F7MA 5C0BD 5KZCD 2YC1A 4LGRB 5JOFB 4LSRH 5EUOE 1DBJL 3RDTC 4P23C 1HHGB 5F1KC 3KAAA 4O2EB 4JFHE 4LL9A 5IIEB 5D7JC 1K85A 5I1DB 3UTQA 1I8MA 1SHMA 4X6FB 5ACMA 4PGDA 4LU5L 3O0RL 1BGXH 1AKJA 1QFWL 4M93B 2PYEB 2BSSA 1OGAE 1KN4L 1UVQA 2LU7A 2WIIB 3MRFB 4Y4HA 3SBWA 1L0XA 3VWKA 3GMNB 5EO9B 3SPVA 2ENSA 5I73C 2FGWH 5JDSB 4NSKA 3P4MA 4WO4B 2D4FA 5INDA 4QRPB 1S7VA 4U1MB 4LLMA 4GKNA 1OAUH 4GH7B 4L5FL 1CICB 4X6CA 4TSBH 15C8H 4KAQL 5MHSD 3ILQC 1BVKA 1CFNB 5CJQL 1BPVA 5CJXC 1U8MB 4M02A 3HE7B 4LRIA 4PPTA 1LEKA 1X9QA 4O4YL 1EHXA 2DBLH 5DJAB 2BXZA 5D5MB 1HIML 4DWHA 3W39A 3WNPA 3T2OA 4MD4B 1E4XL 2OBGA 3KXFA 1ZGLA 2WWKO 1MFBL 4RMSA 1MEXL 1OLLA 1HKLL 3SGKC 1FV1B 2B0SL 3WUWA 4CN1A 4N1EA 4GRMA 2GEEA 4CW1B 4I5BA 4OCMC 5JLZA 4MHHI 3UTPE 2XZQH 3HZKA 1XF1A 3E6HB 2HJLB 1S7SA 3PV7A 1AFVH 1T1YA 2V17H 4YO0A 4R97B 1OF2B 4AIZB 5K59E 1CD1B 2A6DB 5KSAA 4NRXA 3WIHA 3MFFA 1QLFA 3S3JA 1UENA 2HWZL 2XN9A 5MENB 4K7PH 3NFPB 2KQMA 1FIGL 3CX2A 2FX9H 5GS1B 1UYWH 2P5EE 2DQCL 2B4CL 4S1SL 3SGEI 2QADC 1U6AH 1AP2B 4PJIE 2UZIH 4G6ML 4XP9L 2FHFA 4RCAA 5B3NA 1XMWA 4QOKE 5GGRY 4Z7WB 5CZVL 4GW1A 3FKUS 3LV3A 3DYMA 1NGYB 1M6OA 5IFJA 4N8VB 3CUPB 3O6ML 1B0GB 5T1DH 5F8RC 4XCEB 3DRTA 2YPVH 3KPSD 3MGAA 1X4YA 3N1FC 4R8WH 4WIQA 5FOBB 4NGHH 4JJ5A 4ZMAT 3Q3GB 3U0PB 2CUHA 1WC7A 5IM7A 1RK0B 2DDQL 1AO7D 2HT2D 2QSCL 5EO1A 1H0DB 1VFBA 4XVJH 1PQZA 3H6JA 2K3TA 1NMCC 1T2JA 3BH9A 4MXWL 1IGIH 1ZLSH 1Q0XH 3KYOB 4Q58C 3DLQR 5JQHC 2F54E 3BPNB 5CGMA 4Y2OA 1DBBH 4W6WB 4YXHH 1GC1L 1RZKH 1IKNC 3BE1H 4NYLB 4JR9H 1MAJA 3RDTD 4P23D 1GIGL 2VIRB 5IHUL 2R4SH 3QBTB 5D7JD 2VLJB 1GGUA 3IDXH 4APQA 3QH3A 2H2SD 3MGTB 3VXSD 3O6LH 4NN6C 3MJ9H 3RGVC 3O3UN 4RISH 4WV1B 3WMSA 4ONHB 5I30H 1RHHB 2DI8A 2CO6B 1WUNT 3HC0B 4OIBA 4DCQB 2DICA 4QTIL 1CFSA 5E95B 2FJFA 1TQBB 1P2CB 4LSRL 2FRGP 4DQOL 4O2CB 3ILQD 3QG6A 1JYVA 1KCSH 5EWIL 3VXOB 3V5HA 4F3FB 1YZZA 3A6CH 5HDBE 3D6GA 1BZQK 4KMTL 3FT4B 1UWGH 5E5MB 5GGUB 3TYFB