1ZLWH

Fab 2g12 + man8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH01
3FOMB 1JJUA 1YNTB 1RUPH 2RIKA 5DWUH 4OJFL 1HXYA 3TCLB 1G7HA 4N0FA 1EDQA 3HC0B 4FQXC 5L6YL 3RVUD 2X44D 4S1RH 4UILH 4P2YA 4PJ5E 3UTSA 2XKUA 5DJ8A 3F8UB 2DI8A 5DTFB 5ADOH 3D3VA 1AD9B 3QEGH 3AB0B 1LE9B 1DSFL 2BXYA 1LVEA 2OQJB 5AAMA 3FJTA 3TIDB 5J9PB 3MCLL 4KRLB 4MXQD 5GGRA 3OKMB 5AZ2L 4PRBB 5IR1B 3VWJA 4C55A 5GSRB 2HRPH 1X5GA 4HKJB 4D3CL 4Z77A 5JPMA 4HAFA 3BT2L 1S7WB 4JKLA 5IB4B 2B5IB 2HJKB 4NRXA 3PV7A 3DHJA 4QHMA 4RNRB 1SY6H 1SYVA 2Y36L 2GKIA 1TQBC 3RZCB 3BKYH 3MQIA 3QEUA 3MV7E 5HDBF 4Z7NE 1MJ7H 2JIXA 2DLTA 4G6JL 4LEXL 4MZ3A 4PIRF 2VDQL 4P23A 3WL9A 4Y4HC 3LCYA 4ZXBA 1FYTB 4I2XA 4D0BA 1LO5B 2X1PA 4HQQH 3ZKNC 3DURA 4TRPL 4P46B 1OD7A 3QFJD 3QG7L 4M1GL 4KQ3L 5E2UH 5F7DA 5C6PB 5F7FA 1Q9KA 3RGVA 4KHTH 1YEHH 2P5EA 5SWZB 5IB5A 4WY7H 4JG1L 1T4KA 2IMNA 4ZUTA 3C9NA 2KKQA 3CSGA 5EN2A 1TJHH 1EVTC 2LFGA 4FQCH 3PL6B 3QJFB 1WWBX 5BO1L 3MRMA 5J57B 5CCKL 2VAJA 1CF8L 1M05B 4RGNC 2PTVA 2BY0A 3PHQB 2D7QA 3TJEL 4Q58C 1NCAL 3S35H 4Z7UA 4LSTH 4RMQA 2X4TA 5JIPA 3WDIA 5EU4B 1F4YH 3ARTA 1R3IH 3CZJA 4D0CB 4K3DH 3K1KC 3WFHB 5I1DB 4KJWC 1SM3H 3L3OB 3MGTA 3KYOB 1IM9A 4UAOB 1JE6A 2Z8RA 1MREL 1VPOL 3CDCA 4KGJA 1JBJA 1T1WB 3VW3L 3U7YL 3ECBA 5HHOD 1ZTXH 3ZYJA 2ICWA 1EHLH 4HS6A 4U0RB 5JA8B 3OB0H 2J8OA 3OX8B 1S7SB 3ET9F 1AIFA 3NCMA 4P9MH 4RRPA 3EYUL 4NNYA 1QBAA 3OAZH 5ISZE 3GHEH 3CFJA 3FZUD 2Q6WB 3BZDA 3QDHA 1T89C 2MOVA 4ZTPH 4UIKL 3X3FL 1W8NA 1JCKA 1JNJA 1T7WA 5JR1L 4TQEL 1U8HB 3F7VB 4U1JB 3P2TA 1A22B 5DC4B 4NWUL 4IRSA 4EXKA 1CGYA 3SKUD 5IJKC 5HGBB 1P9MA 1AKJB 2HKHL 3WNOA 1ZHLA 3WJLC 2R2CA 2X4QB 3OKKB 3PE9A 4JN2B 4PV8A 1QA9A 1FZMA 3VFRA 4K3EL 1JFQL 2J6EL 2K3TA 4HIXL 1EIBA 1IGYB 4MSWB 1WUNT 3KGRA 1HOCA 3RVWC 4YWGL 1IKFH 3JWDL 3BKMH 1G6RA 4IDJH 5DFWH 4LLWA 3QQ3B 5F7UA 1BZ9B 4NP4H 4Y1AE 2DQTH 3FO9B 1AP2A 3ULVF 1H3WM 5HDOA 3RVXD 2BX5A 1A2YB 3QUYB 4NDMB 4W70A 1XGTB 2ZUWA 1MWAB 5EZJA 5DJ0A 1G1CA 4WTXA 3RI5K 2WMPA 3MV8E 2I9LB 3T3PF 3IFOA 4G8EA 3W9EA 3QDGB 2ICCA 32C2B 3O3BB 3UXFA 4NZUH 1B4JH 3SJVD 2OM5A 4Q2ZB 2ADIA 2ENYA 2KH2B 3ARGB 3MBEB 1QRKA 1YEIL 4YE4L 2VLJD 1WISA 3K0WA 5FO8B 2VXUH 3OF6A 4PGCB 4LCYA 4NZRH 1ZHBA 4IJ3C 4FG6C 4TSBH 2JJVA 4AM0A 1FH5H 1YA5A 3GMPA 2VL4A 4KH2A 2FL5A 5C0BA 4PGJA 1SMAA 3QQ9C 5I1GH 2LV4A 4KK5C 5C07D 2VQTA 1BQLH 4UB0H 4ZUSA 1A7OH 5EFIA 1R5VA 4ZUVB 3F12B 1I3GH 3ZSSA 2YBRA 1D9KB 5AYUH 4NRYB 4OZIF 4BM7A 3HCVB 2YR3A 3P77A 1MRFL 3LN5B 2R0ZL 3FO0H 2CGRL 5C2BH 1OAKL 4FZEH 5IJVA 5I16B 1B4RA 1J0KA 4G6FB 3ZKSD 2NX5A 3RX7A 4ZAKB 4YFEA 5EIIA 4HXBH 1C16A 1NC4B 2CKBH 4JAMA 4LKCB 4M7JL 5H35B 5IK3A 5TE4H 3AGVA 4XGZB 2AP2A 3FQRA 3TFKD 3VD7A 4H0GA 3EHBC 4XPAL 3BPCA 4KK5D 5L2JB 1FNEB 1IL1B 3UTSE 1IAIH 3WIIH 1CK0H 3IDMB 3ZT5A 4YHIA 3U0TA 5DD5L 1FFNA 2XA8L 1CL7H 5DHVB 4Q9RH 1FAIH 1N64H 2DAVA 3ALWA 1DR9A 5EWIH 2VLRB 5GQBA 1FORL 1EJOH 5HY9B 3MNWA 5IHUH 3BW9B 5F7LB 3GGWB 2D9CA 3LEYL 1QSFD 1SJHA 4G6AC 4JFXB 4Q0XH 1A1OA 2UWEF 3BDYH 1QFWH 3S37X 3T2PA 3SDCD 4HIHA 3TYGL 2PETA 4HC1H 4JVWA 3MLXL 1HIML 1TXKA 3DUHA 3EHBD 5FYLE 4RMVA 1R0AH 1CICD 5CMAA 5JW5B 2EC9U 5FGRA 4M4RA 2PO6A 4GSDH 5MI0C 4NNPH 3E8UL 4LL9A 1SVZA 5JDSB 5SX5K 3T8XA 1MNUH 2E9JA 4YXKL 3RWIB 4G6AD 4K8RD 3UTTE 3BI9X 1C8PA 3WHXA 4LSSH 4JM2A 2XNAB 1FO0H 3SQBA 3B9DA 15C8H 4GJTB 4ODHH 1CT8B 2VNCA 5MHSE 4I2XE 1WAAA 4U1HB 5CZVL 1YECH 1NGPL 1BD2E 2HFEB 3O2VH 2AXFA 2BVQB 3KS0H 3QUXA 1T6VN 3TA3C 1ES0B 1T7VA 1P7HL 2V2TB 4RZCA 3MZGB 1BMGA 4MA7H 4FXGB 5D7LB 4GLRH 3RL1A 1VFUA 3H9SD 4LSRL 4PJAF 4JPIA 1P5VA 1CFBA 4QWWD 3QDJA 2P5EE 3I2CH 3BKJL 4P99A 2AK4B 5JQ6H 2XG4A 1P4IH 3BH8A 4HFWA 4R3SA 1J11A 1F58L 4MNGB 1T2XA 4S1QL 1FZKA 3CZFB 1FAKT 3QUML 4PY7B 5EORL 5SV4A 1AR2A 1BVKB 3UJTH 4XPHL 3SHSA 4GUPA 3VGGA 2VN4A 4Z7UE 1U3HC 3KJ4C 4M48H 2IAMB 5FA4A 4KGLA 1OW0A 1UM4H 3MFFA 4KRPB 5FCUL 3E6FB 2HG5A 2YRPA 5GZOC 4RIRB 1CFQB 3RRQA 3FFCD 5DQJB 1B0GB 4L8SB 3B3IB 3NZ8A 1LO3H 2NY5C 1MVUA 4Y4FC 5TF1L 4QRPD 1OCWL 1K3ZA 3WD5L 2UZXB 4GW1A 4LFHG 5DZOA 5DJ6A 1TZIA 2JB6B 5C0DB 3FQTB 5CILL 1U2CA 1U3HD 1V7MH 2AJVH 3W0WD 2EDLA 1ND0A 4EI6A 4J4PA 3ZKMD 1MCPH 5DJ2B 1FL3A 3P9WB 4GRLA 5HI5C 4M93B 1EO8L 3VG0H 4CADA 1PZ5A 1AQKH 1MRCL 3AMLA 3DGGB 1WIUA 4RISH 2W92A 4Y8AA 3FT4A 2IEPA 5HHPA 4G6KL 4JFDA 4NFCA 5ITBH 3DVNB 2BNRB 3HRPA 4AG4L 1CDJA 5DHYB 1B9ZA 1CXKA 3F6IA 5FGBA 3QUZB 1CD1A 5HHME 1IAMA 2W65B 4JQVA 1XAUA 5CEZD 2FHBA 3DSFL 4OF0A 3U0PB 4J6RL 3P11H 3QQNA 3LKRB 4GRWH 3MV9D 2YEZA 4S1SL 3RUGE 1N2RB 1OP9A 1QQDA 4OBSA 3T3ME 5C09B 5EU5B 3O81A 4F7TA 3B9EA 3V8OA 4MD5B 1S9VA 5FYJU 1I4FA 1WVZA 1JRHI 2EIEA 1PYWA 4OV6F 2DKMA 4NT6B 3O3EA 2W9EL 3SDXF 2WV3A 2Y07L 3KXFD 4LASH 3P73B 4OCNC 5DQ9B 5EUKB 3NFSH 1OY3B 4D8PB 4G9DB 3N50A 3CH1B 4PP1D 4L8DB 4PJBA 4YDKL 1HSAA 4U2YA 3L95B 5JXEC 4R7NA 2DWEA 3C60A 3ULVL 3PGFL 2GTWA 1BX2B 4I3RH 3ARFC 1JGEA 2DN7A 2CJUH 1DFBH 3HZKA 1BWMA 3OR7B 3KYMB 4JFED 4XPGH 2J8UB 5I1IL 3WNKA 1T80A 2NY0D 1XF4B 1F42A 1RURL 3IKKA 5HYSG 3BN9C 3D25A 4XI5D 1HYSD 1CR9L 5DRZA 3BP6B 4AY0A 3UZVB 3TEUA 4LQFL 5C0BE 4HWEH 5T33L 3ZE1E 1VESA 3MJ9L 25C8H 1Z6JT 1GOFA 3S5LA 5C1MB 4G3YL 4YBQD 1KEML 2B1HH 4JRXD 4XPBH 5D1QC 2A1WH 4L8CA 2C3HA 3H42L 2QR0B 1QOKA 1RU9H 1BAFL 4WCYL 3BZFB 1DEEB 3LHPL 1Q9OB 4UTBL 1TMCB 2AJXH 5HBBA 3QNZA 5C0CB 3O9WD 4M7LT 4QNPE 2J7LA 2V9TA 4PJ7F 3VXQA 1MHEA 1G9NL 4XBGA 5I2IB 2IFFH 2V7NB 2DMCA 4OZFB 4X7TB 3L5XH 3TO4D 3CMOH 5EOQH 4G8FA 3WO4B 3NCYP 1RK0B 5H8DA 3RUGB 1OP5K 3IKCB 1HHGA 3K1DA 1K4DA 1J0YA 1XGYL 5B4MD 5MERA 2OL3B 5HYQB 5J89A 5D1QD 3O6FA 4Y5YA 4D9QD 2QHLA 4N5ED 1JK8A 3BN3B 4QHNA 1U58A 2WBJC 3D39D 3VXNB 1A6TB 1MFAH 1KCVH 4R9HA 3KS0J 4PBVC 2HFFB 4UOW1 2YD4A 4JO1L 4HF5L 3V5HA 2C3WA 3OB8A 5D1ZD 3EYSL 4XMLL 4MD0A 1RJCA 5FXCH 4H1LH 1S5HB 3BZEA 1F90H 1NCCH 4RBPH 4ELKB 4PJIB 3ARPA 3QP3A 1MHHA 4U7MA 2WBJD 4OFVA 3QJHB 4XMPH 3ZDXF 2D3VA 4WHTA 3FQNB 3IJYB 4PRPD 2H3NA 2VR9A 5LCVH 2FR4A 4OFDA 2XTJB 3GMRB 3VXPB 4ZO9A 5DS8A 4X80H 3NPZB 3O2WH 4NQVB 1KB5A 2VXSH 2ZUQC 2NY5H 3HNVL 3PP4L 4QOKB 4Z6AT 4BZ2H 2FYYA 1FNGA 4ZPTB 4C59B 4EXPX 3L5IA 4AEIL 4PTTB 1IC5H 5CEZH 4E41A 1WAAE 3ULUD 1TTUA 1F3JB 4FQLL 4WIQA 4LP4A 4OCYH 2ZOKA 4YDLB 4AMKH 1I7ZA 1T2JA 3KPTA 1XGUA 3KPSE 3MLZL 3UYRL 1EEYB 3BDXA 3BKCH 1CN4A 4NUJA 3HTLX 4AL8L 4Q6IA 1JPSH 3QDJE 4BH7A 1G1YA 3QG6B 3FKUS 1UENA 2Q8BL 3OKOB 3WXVL 4M1DH 4JPVH 2PXYC 1WC7B 1A3RH 4LCWD 4HH9B 2ZUTA 5FO7A 4NZTL 5D7IE 3UPRA 3UBXA 3SKOA 2A73B 2F53B 3PWPB 4L8BA 2V9QA 2YKLL 5E99H 5GZND 3CFBB 3U4AA 3I9GH 4GKZB 4RCAA 2OI9B 3WHE0 3R8BB 2Y23A 3OJVC 3QEQB 1EV2E 1X9QA 3G6JB 35C8L 1AKJD 2CDEB 4Z8FH 5ANMA 2NXZC 3IDXL 4I0PA 3BESR 4K94L 1GGIL 4OD3H 3QULB 3VRIB 5E4EC 4U6HB 1EFXA 3L1OL 5SWSD 5EO9B 2H45A 4ZSOA 1R24B 1GIGL 3RL2B 2ZUXA 2AEQH 2PYEB 5E94A 4J3XA 2NTFA 2P48B 3GSUA 5D1XB 5IB1B 2ZKHH 1HKLH 1QFHA 4N0CD 4G9FA 1MFEH 1KT2A 3U9PL 1QYGL 5ID0A 5HSFA 5TGBB 3EIFA 3VFUA 3NPSB 4JFDE 5FA3A 4FNLH 5ABDE 5KSUB 3GK8H 4WI8A 2NMSA 1OQOA 4CVWA 4CU8A 3ZL4H 1QLRA 5CKAA 4WUKH 5DUPH 1ZA6A 2DQIL 2B8OT 1KJMA 2H6PB 4NO0A 1KJ2B 4R97B 5FYJH 3LKOB 1NH6A 3Q5YA 1E28A 1W72L 1EBPA 5T1KD 4HKXB 1HWGB 3QCTH 3MREB 2WBWB 5CBAB 4DTGH 1XIWD 1XCTA 1KFAL 1EGJL 4K7PX 4LRNL 1IAKB 2MKLC 3JWDC 3MRNA 4OJFH 4DVRL 1VEOA 2BP3A 5L6YH 2BJML 4X6BA 3JUZA 3OJDB 5B8CA 3O45A 2FJGA 2R2EB 2N7BA 4QTHA 1SY6A 1S78D 2FJHA 3NTCH 1QSEB 2L7JA 4PGEB 3IDNA 3MCLH 2VLKB 1HI6A 1J8HB 5JPNA 4PJGA 1HEZA 5AZ2H 2DQCL 1KJVA 4DWHA 3LKNA 1BBJA 3ARYA 5BS0A 5GHWL 2OLDA 4QRRB 3DO7A 1F6FB 4B7IA 3QAZC 1JPGB 4D3CH 3NAAL 5EZLA 1VEPA 3G08A 3RDTA 3BT2H 1BGXH 4P2RD 4P5TA 3VD5A 1YY9C 5L2KD 4EDXB 2AXJA 3VXUE 5B38B 5DJCA 1Q0XL 5CHNA 4NCDA 3SO5A 5D93B 1IGTA 4HV8B 3IGAA 4OLVL 1MCBA 1M7IB 2Z4QB 3IFPA 3UMTA 1ZT4A 4KXZH 1HQ4B 3EYVB 4G6JH 4LEXH 1H0DB 2VXQL 5EO1A 1SMOA 4HX1A 4OZHB 3GMOB 5IBLC 4UQ3B 3TNMA 2CLRA 4R7DA 2F54A 5IG7B 1QFUL 3CFKB 4MLIA 4M5YL 2CUMA 3FRPA 3S36L 4TRPH 1OTTD 3AS2A 1HHJB 3JVGC 1RZ8B 2F9BT 1HKFA 2P8MA 1QRNB 2A9ML 3EDJA 3QG7H 4M1GH 4JANB 4KQ3H 4EQ3A 5F9AC 1AGCA 1T20A 1HNFA 4I9WE 3QRFM 2IC2A 5FM4A 4WU5B 4JG1H 4WO4D 1ITBB 2IH3A 1IEAA 2IG2L 2H41A 2DYPB 2JJWA 1LDPH 3QFDA 1NAKL 5BO1H 1OPGL 2IQAB 5FM5M 5CCKH 1GZQB 3QBTB 4LDLB 1KN2L 1U9KA 3PDOA 1V05A 1CF8H 3L3GA 3FB8B 4H5SB 1LO0L 1D5BB 3TJHC 3MOAL 5F72S 5JMRA 2AJZB 3TJEH 1NCAH 1XF5B 3AROA 3HPJA 3EW3B 5C0AA 4PG2C 4B5EA 4FTVE 3ULUF 3L7EB 1LP9E 3U6RB 3B9KB 5IMOB 3JXAA 2Q87A 4MCZB 4U3HA 4QCIB 4BFIA 3T08A 3DROA 4NC1C 4NN6C 1MREH 5C0GA 1VPOH 3HG1D 1NQBA 3VW3H 1A6AB 3U7YH 3IJHA 5EUOF 3DUUA 4RQQB 1CD9B 2EDKA 4G80A 1G7QA 3B8SA 3ALPA 3SOBL 2OMNA 1U3YA 5DURD 3L7FB 1BECA 3ZMRA 4ZQKB 2DTML 1LO2L 1MY7A 3EYUH 2FEEI 2APTA 4LAQH 3A6CL 4XNZC 2PR4L 4UIKH 1HQRB 3X3FH 1J9CT 4CKVX 4FQXA 1WBZB 5JR1H 4TQEH 4CAGA 3U30B 2EDEA 1NAMB 1Z3GL 2DOCA 1NC2B 4NWUH 2BRQA 4OTXL 3QIWB 2HKHH 3GSRA 4WW2B 5CD5D 3KG5A 2HWZL 2Z91B 1KPUA 1S9WA 1J12A 4OLXH 1EHXA 2NPLX 4K3EH 1JFQH 2J6EH 4HIXH 1P4LA 5HPMA 1I8MA 1XT5A 2VZVA 3DX7A 3PGCA 1OF2B 5IVZA 4YWGH 3SDAB 1DQJB 4CMMB 1U91B 3JWDH 4LEOB 3RA7L 2FLBT 4HBCL 4PJEA 4K7PY 4ZSOE 1F3DH 1LEIB 4E9LA 5I1JL 1OAXH 2WBKA 5EC1A 3ZO0A 3MYJA 4U1IB 4JJ5A 1J8KA 5IVNA 2LTQC 2FH6A 4KMTL 4NQDB 2NLJB 2BSTA 1I9JH 3O4LA 1KLUA 2BNQA 1FZJB 1ZHNB 5FUCE 2UZYB 2VZOA 3PV6B 1AGFA 1ZA3A 2ZP0T 2I07B 3FQXB 1YEIH 4YE4H 1I1FA 4Y4HA 1L7IL 2CKBA 3VG9B 5EOTB 2NYYD 4ERSL 1F4HA 5DEGB 3SGDH 1EXUA 3H2WA 3WKML 3IJSA 3EKCA 4KJPC 3T4AB 2NY1D 1A9EB 5DRNA 5IB3A 3UAJC 1DANU 5F1KC 3RX5A 2XTLA 2GI7A 3WN5C 3S35X 3PXJA 5JOPD 2VITA 3MRKB 4OAWA 1FE8L 4O2CB 3PQYB 3NIFF 1MRFH 3EOAB 3RWHA 3VFOB 2R0ZH 1XGPA 2CGRH 4HC1A 3WKNA 1TPXC 2RAMA 3ZKXC 1PQZA 4YGVB 3DUSB 4MAYB 5E9DB 4OLUL 2XOTA 3GSXA 5DA4A 2IPKA 4M7JH 3CH8A 4GAFB 5IOPB 2G9HA 5T1MA 2ZPKL 4QXGL 4XRCA 3NH7L 4XPAH 5JW4M 4BSWB 2FGZA 3HS0B 5D2NC 5DD5H 5ETUB 3RGHA 3KPLB 2XA8H 1EMTH 1OVZA 4J3UA 1FZOB 2X7LA 3P0GB 3ULVC 1FORH 1N4XL 3MRLB 3T0VA 4X9GA 3LEYH 3QIBB 3T0ED 1FO0A 4XP1L 4XX1G 5MEQB 1AGBB 5C0IA 3TYGH 5EULV 1NL0L 4GS7C 3TV3L 1YYLL 2ZOLB 1SJEA 3MLXH 5C3TA 4J3VA 1AD0A 1HIMH 1CGVA 5BS0E 3WE6B 5KS9B 1S7VA 2DMBA 4TVSa 1T1ZB 3EUUA 1NLBL 5I8KL 3RX8A 3E8UH 2ZCKL 2E6JA 5KSAC 1T89A 5KVGH 4MMZC 5EBWA 4LSVL 4YXKH 4X7SL 5FAAA 4RFEA 4LHUG 5HYJD 1EH9A 4OZ4A 3T0WA 43CAB 1PY4A 5IJKA 1I7RB 4JO2L 3WJLA 1RIHL 2C1PA 4LHUD 2IBBA 1Z0NA 1YDPB 4PJCA 1K5NA 5ESQA 1G9NC 3FOLB 5CZVH 5J3HD 3MLVL 3S88L 1NGPH 4TNVF 2X9YA 5FCSH 3HR5A 1UFUA 3LEXA 1DUYB 1RSFA 2NY2C 4PREB 4IMLB 1WWAX 4S1DD 3EO1A 1U8KB 1UM5L 3PWJA 2PKDA 2D7TL 1YEDA 2AABL 1YMHA 1HZHL 2H26B 3BKJH 4OIBA 4OUUB 4IOIB 4YHPB 3TBYB 1JWSA 1KLGA 3L3IA 1R3JA 2WZPD 2AQ3A 1UGNA 3C6LC 5A43C 1QSVA 1F58H 2X4PA 3VJ6A 5BOPA 4S1QH 4U6XA 1P7KA 1TVHB 3GMNB 1CXIA 5D7JB 5HHVH 1DTUA 1LO4L 5EORH 4FQQA 5C07A 5DRXA 1DJSA 4XPHH 3PIQB 2AKRA 4M8QB 4TVPL 4NCC1 5F3BA 5CIPB 1IC7L 2YUZA 5E6YA 5C0AE 4HXAL 3T2NL 3JTTB 4X6DA 1HH9A 1RUAL 2EZ0C 3AU1A 2XQYK 3V5DA 5FCUH 1G0XA 5GGSA 3MLTA 5D5MB 2NY3C 1J05A 5KSBA 4XC1L 1ZGLA 3U9UA 5JHDA 4MDIB 3SDDD 3TNNB 3ZZ1A 2VAAB 5TF1H 5ACZA 1OCWH 4KK8D 2CDFB 3WD5H 2ED8A 3WEXB 3PWUB 5BRZE 2G5BA 5CILH 4P4RA 2W0LA 5IF0B 4URTB 4W6XB 4YLQT 5EU3A 4P57A 4HGWA 1EO8H 2BHZA 3CFEA 1MRCH 3G5VB 3VFVB 2NY3D 1UC6A 2MHAB 3D18A 1SEBB 4GXUN 4G6KH 3W11D 1C7SA 4MYWB 4PP2A 4AG4H 2EC8A 4Z7VA 5IHZB 1W0WB 2DLIA 2RR3A 5GS2D 2OK0L 3B2UD 3DSFH 4MJID 4J6RH 4QHUA 2LVEA 4LMQI 3DHMA 5L0QB 4P5MB 1G7LB 2G60L 3AREB 2WP3T 4BA8A 1CDCA 4PRIB 3TO2A 5C0JB 1A14L 4U31A 3OXSB 5E5MB 5A3IC 5DGRA 4PJEE 2WWMC 4YBHA 5I73B 5KVFL 4K94C 5DD1H 5DSCB 3WUWA 2W9EH 3NFPB 4NM8L 2Y07H 2CDGB 1INDL 1R5WB 1P1ZA 3VXMB 5ACMA 3HB3C 1NBYA 2FGWL 2IALA 5F1NA 2D0FA 4WEBL 4YDKH 5F70A 1K2DA 3O4LE 2BOBB 3ULVH 2BNQE 2JB5L 1MWAL 3PGFH 4X5XB 3UTPE 3HLAA 4F58L 3QO1B 3QWOA 2WWMD 4PRDB 3M1BA 1IT9L 3O3UN 3TIEB 3Q1SL 4EN3D 5I1IH 1OARL 1VCAA 2B7DT 1CE6A 3P4NA 2ARJB 3DXAA 3TA3A 5F93C 1CR9H 2AJ3B 4Y4KC 4LQFH 5T33H 1QUNA 3GKWL 4JZOA 5F21B 4MHHG 3CSYB 2OTPA 3MJ9H 3MROB 3KPRB 3LSOB 2YA2A 3IDIB 4G3YH 1KEMH 1XR8A 4P2OD 3ARDC 4JREB 4M61A 3H42H 4E0RA 1BAFH 1FNHA 4G7VL 3FB6A 3QI9C 5F89A 2DM3A 3LHPH 3O3AB 4UTBH 5DDHB 5E8NB 3T04D 5D9SB 1KULA 4GG6B 1AO7D 2EKJA 4RGNE 1G9NH 1I1YA 3ZYOA 3RZWA 4JVPA 3D6GA 1UQSB 1L6XA 1KPVB 3W39A 5I8EA 2J5LB 2VABB 1U3HA 3C5ZD 3P9MA 4H1LA 4X6CA 1OTSD 1XGYH 3W0WA 3KPOB 2FX7L 5CGYC 5IHLB 2BSSA 4AK1A 2I24N 3OKYA 3QDMA 2DRUA 3X12B 1OGTA 5F9OL 4YO0A 1F4AA 1Q72L 1D5ZA 1IQDB 1U0QA 1MFDL 4Y4FA 5KN5A 3OR6A 4K3GA 3V6ZA 1XF3B 1IFHL 4PB0L 4JO1H 2YPLA 4HF5H 3VCLA 1U92A 1UXSA 3T4YB 4V1DB 3EYSH 4XMLH 4PJIF 1DBAL 3U7WL 2WP3O 3F6LA 3GI9L 3L3JA 1T0PB 3MGOA 2CPCA 4F8QA 4NN5C 4M02A 3T0AA 4I18B 4WI3A 3V7MA 2UUDK 4PR5A 3NIGE 4OM0H 4LHQB 3HC3L 1KPRB 4H8WL 3HNVH 3PP4H 4PJCE 1YY8A 1YZZA 4O2FA 4AEIH 3DX8B 5E7FA 4FQLH 4ISVA 4LVNB 4MLSA 1PBYA 4NN7C 4PTUA 1HHKB 2H2PD 4OCSL 4ORZC 1I3RA 1OGAB 4OFYA 2OMBA 3RWFB 3MLZH 3UYRH 1JYXA 4S2SB 4AL8H 4EDWH 4JRWA 3TZVC 2Q8BH 3WXVH 1D5IL 2JLLA 3NN8B 3HFML 3CUPB 3OAUH 2W0FB 2CUIA 3O8XB 1TCRA 3B83A 5EU7C 5JXEA 4HD9A 5J56B 1JPST 5HYSA 4NZTH 1KENL 4LPWA 4MNQD 2XIDA 5E2WL 5DF0A 4KVNL 4UTAL 3A0OA 3ARFA 4WUUB 3MRHA 2YKLH 1HH6A 2YMXL 3GJFH 4F2MA 3BOVA 3G6JF 2GTZA 1V3KA 1DN0A 35C8H 4X6DE 1L9MA 2HT4C 3IDXH 3BDBA 4LLMB 3L3KB 1GVIA 4K94H 3ARWA 1Q94B 4O2EB 1GGIH 2W9LA 5KSBE 4KK6D 1TTFA 3L1OH 4PJ8C 5JHDE 2BHYA 5INCB 1GIGH 1DEDA 2V2WB 4DFHA 1SYSA 3QNYB 4F15C 1GSMA 3P4MB 5D1QA 1RZGB 1TZHA 1YN7B 2M26A 2P8PA 3TBSB 3GSVB 5J0BA 4OFIA 4MS8C 1GJIA 3Q6GL 3NCFB 2HT4D 4LSUL 3H6JA 4MA1C 3U9PH 1QYGH 4Z5RB 1X5IA 1GAFL 3IRZA 1MRDL 5HGAA 2PW1B 1BJ1H 1WBXA 1NBZB 4N90E 4KTDL 3EGSB 5HGDB 4HZAA 3RBSA 3SKMB 2FECL 3T77A 5E00B 3WBDA 4UV7L 3BH9B 5IW1B 4XCNB 3NACL 5E56A 4YR6A 3RFZC 2GCYA 3LN4B 2DQIH 2WBJA 3OKLA 1OAZL 4NHUA 4OD2B 4WDIA 1NGWA 2OJEA 2YC1B 5E70A 1BJ8A 1DBJL 1W72H 2ESVB 3BWAB 2CSPA 4FA8A 1Z9MA 2R1WB 1T21A 2Z31B 2A74A 1BVLB 3CFCL 1HXYB 3V0WL 1KFAH 1DLHA 4I8DA 4LRNH 1V8HA 2QJDA 3GRWL 4FQPA 4YC2C 3VXSA 3MJ8A 2FLRT 4TNVK 5EG6C 5M95B 3P30L 3SCMD 2E27L 1R6VA 4QRSA 1T1YB 2BJMH 3IDYB 3D3VB 5CUSL 1J7VR 1RUQL 1U8PB 3SPVA 3SE3C 1MCWW 3HZVB 4GXUM 3RNKB 1MLBB 3OTTA 1QD0A 3LIZL 5GS3A 3VGDA 5E6ID 4ONOA 4BK5A 4O58L 2HVJA 4Y16D 1BQHB 3DXAE 4Q74A 4OQTL 2NNAA 2DQCH 2F74A 2NR6C 2QQKL 3HPLB 4H88L 5FDWA 2P5WD 3PDGA 5GHWH 4R90L 4GRMB 2QADD 5T3ZD 3NAAH 1MI5A 1ROWA 1FNSH 1KIQA 5I71C 1LD9A 1CFTA 5F3HB 2PXYA 5FYKD 1Q0XH 4A6YB 1R5IB 4OLVH 3TPKA 1FFOA 3BP4B 4CBPA 2H2SC 1T2QL 2NR6D 5HGGS 1JTOA 3TBVA 1F6AB 3HMXL 4IS6A 2VXQH 3VXRD 3ZE2E 3WFCL 5DJYB 4X6CE 3MMEB 1VACB 5E0QA 3LQZB 4APQD 4AEEA 4HUWB 1EPFA 1IEBB 4HS3B 3QDME 4M5YH 1NGZA 3SE8L 2FH8A 3S36H 4AYFA 2WW8A 4LLVB 1EUTA 5DJAB 2DLEA 2GK0B 3C87A 3MRFA 4YIQB 4MA3A 2A9MH 3MRBA 3SKJL 3V6OC 1OP3K 4CGTA 2P4AB 3DYPA 3BRFA 4IBLT 4XAKD 7CGTA 3QIUB 2YPLE 3BMWA 1JNNL 3AB0C 2IG2H 1NCBL 1NAKH 5E95B 4GMSL 1OPGH 3LEVL 1KN2H 4Y2DB 3V6FA 5F7EL 1VFAA 4QO1A 1LO0H 4WTZG 3JV4A 3MOAH 1FSKB 1HCVA 1F45A 4G43B 4GKSA 5D7KE 2R56L 5JTWA 4GT7A 2B2XL 5FKAA 5C2UB 1N3NA 4AH2A 2E9IA 4XPFL 1YNKL 1R3KA 1YMMD 4QT5A 2EDYA 2ICWB 5DA0B 1JGUL 5E1AB 4ENEC 2XZZA 1BBDL 1F00I 5E8DL 3RZCC 5F7NC 4L4VA 3SOBH 3OV6A 4P2CG 2XWJB 3HAEG 3TH3T 2J6EA 2X89D 2VIRA 4HULB 3NCJL 5JQHC 2DTMH 1LO2H 1QTYT 5I17B 4ELMA 4JFFB 4YNYA 5I66B 2PR4H 1B0RA 1IJ9A 1O0VA 5J6HB 4TTGA 1A1NA 3U83A 5C08B 4NBXB 4P46C 3F5WB 4ORGB 1Z3GH 3IAGC 4TUOA 4D0DB 4KKCC 4OTXH 5BVPL 1JGVL 1FZMB 2D4FA 4LVOB 3TN0B 4WW2F 3VFRB 3GB7A 1IILE 3OZ9L 5L2KA 2R2HA 5E6ZA 5HVHB 1M6OA 5CJ8A 4HMDA 1BJ1J 4AQOA 4YAQB 1VKXA 5JOFA 3LPFA 3PL6C 5BQ7A 1GH7A 1XR9B 3VMNA 1JHKL 3WLBA 3RA7H 1MCOL 2FSEB 4HBCH 2YD9A 4PJHF 5I1JH 1PDKA 2E7CA 3K8LA 3ARBB 5FYJE 4L4TB 1AXIB 4ZPVB 4G6ML 4P5KA 4XVJL 4KMTH 5HDQL 3C6SB 4UINL 3TCXA 5AG9A 4PJ5D 4UAOC 2Q20A 3RVVD 1I85C 4MQSB 1UVQA 2XPGB 1NANH 2AV7A 4LCYB 3DSNA 4L3EA 3UROR 3WDHA 5JW4R 1L7IH 4U0RC 4PJFA 2QTEA 3MXVL 3W5NA 4JFYA 1JPTH 4ERSH 3D0LB 4JO3L 3WKMH 4L3AA 2Y6SC 4JPKL 5EU6A 3JVGA 5HYEA 2FEDD 3NOIA 2J1KA 1T22A 4JFPB 5K93A 5GGVL 1IM3B 1FRGL 2YSSB 4CDHA 2IADA 4FQJL 5B39B 5DT1L 5L7XL 3WLWD 1FE8H 5CJBA 5EBLB 2NX5B 1BIIB 2IPUK 3IFNL 2ORBL 3C08L 3VGEA 4UUJA 3VXSE 4AIXA 4JJHA 4OLUH 3EJYD 3MV7D 5H2BB 1QBBA 4DZ8A 4HUVA 4LLDB 5BW7C 2ZPKH 4QXGH 3H9YA 3NH7H 3JV0A 1JMXA 4PG2A 2GK2A 4R26L 2VDRL 3MNWB 1ORQA 1SBBA 1JPFA 2Z92A 4MCYB 4D9RE 1AJ7L 3QUYC 4XNXL 3UYPA 2I5YL 3QXDB 2FIKB 1I7UA 4XP1H 4M1CD 3S8WA 4NRZB 3O6LL 1GGYA 3TV3H 2B1AL 1YYLH 5KS9F 3SY0A 1DVFC 1CFNA 4LSDA 5EBMA 3ARGC 3U46B 3MBEC 1ZV5A 2VISA 1RI8A 1NLBH 3VI4E 3RP1A 5I8KH 1WCBB 1MI5E 4UBDC 5CBEA 2XKNA 2ZCKH 5FUZL 5SX4H 1VSCA 1YN6A 1RHFA 4ZTOL 4KPHL 3VD4A 4LSVH 3SN6N 3HAEH 1RJLB 1XH3B 1AR1C 4WWKB 5ICZA 1XGRA 3VFGL 3NCCB 3O2DL 1NBVL 1DVFD 4PJ9D 4PGDB 1ZHKA 3IU3B 4JO2H 3T09A 1NEZG 4EI5D 1RIHH 1I7TA 1Y0LA 1D9KC 3S96A 1TJIL 1INEL 3QUMA 4EEEA 4DCQA 1UH2A 4DKFL 3UJIL 4PJDA 1YC7A 3S88H 3MRDB 3BVNA 4L3CB 4UNTA 2X4SB 1NBQA 3T65A 4K7FB 1UM5H 2R1YB 4XZUA 3BPLC 2D7TH 2AABH 3ZDZF 3QWQB 5IV2A 1EFQA 5ISZD 1HZHH 1GGUA 1CLOL 1KTLA 3BYTA 1WZMA 1CZ8L 1FLTX 1QKZL 5E8OA 3S4SA 2XY1A 1LO4H 5ADPL 3H7BA 4JFZL 5JLZA 5IFJA 3V4UH 4ODVL 4TVPH 5IQ7L 2PN5A 1UB5A 4EQ2A 3OJ2C 2VRAA 5DUML 4Z7OE 5A2IH 3LMJL 1IC7H 3I6KB 4HXAH 3T2NH 1OD9A 1RUAH 2F8OA 5D5MF 4LKXA 4KXZI 4FQHA 4KI1A 4X99B 1S5IL 4HUUA 1A6VL 2NW3B 5CKGA 1JV5A 5D6CB 4XC1H 4NQXA 4H8WC 4Y1AD 3RWEB 4EVNA 5JUEL 1KTDB 1L0YA 3WN5A 1FHGA 1ND0B 4EI6B 3TVMD 4PYHA 4L4VE 3TT1L 3OKEA 1DQDH 3MV8D 3FFDA 1F11B 1CXEA 1I8IA 3C09B 4RFOL 3MC0A 1PKOA 3FTGA 1BF2A 3DX6A 4NQCA 1HSBB 4V2BA 3QDAA 2CQVA 3FT3A 1A4JB 1U3JA 5ID1A 2HN7B 3FO1A 2IANB 1LNUA 3MRGB 4Y88A 4CVXA 2Y72A 3WCYA 3BXNA 3FB5A 1V5JA 4L4JA 5D2NA 2OK0H 4WW1A 1DUZA 1S3KL 4WFHE 2YRLA 2A0LC 4M6OH 3FQWB 2W0PA 4V2CB 3CLEL 4G8IB 3RAJL 1CFSB 1QQDB 1F6LL 1NAML 2JELL 2G60H 1YUHA 3HI1B 3QB7C 2H32B 4HWZA 1DBBL 4HLJA 1MCQA 1A14H 3BGMA 1RHHA 1I4FB 4P2QB 1PYWB 3G5ZB 5HJ3A 5I19L 2WQRA 4E5XA 4MNHB 5AWNH 2X6MA 1MCHA 4WFFE 1WK0A 1ITCA 5J1AB 1AQDB 5KVFH 2QSTA 4NM8H 4K55A 2IAMC 1ZSDA 2GJ6A 4PJBB 1INDH 1HSAB 4KRMB 3GZKA 5KSAA 1H5BC 4KRPC 3MJ9A 2FGWH 4JY4B 1FVDB 3CC5A 4WEBH 1FBIL 3D85A 3EZJB 2UUDH 4TNWF 1FVCA 3UTSD 4RAHA 4L8SC 1MWAH 3B5GA 4K71B 4F58H 4L3EE 4MJ6B 3C5JA 1S7RA 5DRZB 3LB6D 1J0IA 4OZIA 3CCHB 4F33B 5IGXL 3MUGA 4MDJA 1ED3A 5EU6E 4M93C 1EZVX 2CD0A 3VWJD 1DQML 3VFPB 5FYLD 3GKWH 3X11B 4P3CL 1WF5A 2CRIA 4L8CB 1ZK9A 5CWSA 1AGDA 3QUZC 3MRIB 5IBTL 4Z7NF 1CGXA 2EDJA 3C6LA 4G7VH 4U6YB 1NLDL 2DQHL 4XWOC 3UTTD 3EOBA 4XBGB 5DMGD 1C1EL 4DFIA 1MUJB 3A6BL 5I1HL 4IHOB 1S7TB 4HFUL 4P4KB 1K85A 2JIXD 4JFOA 4ZD3L 4C56B 1E4XL 5TDOA 1T66D 4LCCB 4MB5A 4P23D 5FF6B 2EH7L 2EYSA 5HI4C 4ZXBD 4PJXB 3D0VB 5T3XE 5MHSD 2BCKA 2CR3A 3O3DA 2FX7H 1BD2D 1DQQA 4NWTL 3I6LE 3H0TA 2GT9A 4WWID 4PRHB 5H37G 5F9OH 1FV1A 4NC1E 1Q72H 4X98A 4Y19E 1ONQB 1MFDH 43C9A 3KPPA 1CQKA 1FG2A 1P7QA 3RGVD 3SGDI 2P5ED 1IFHH 4PB0H 1EO5A 4MJ5B 1OAQL 5HI4D 3HE6C 3LKSA 2EICA 5HDBE 3CSBA 2C7UB 4LIQE 4EUPG 1DBAH 4GBXB 5BXFB 3KNBB 3QPQC 3U7WH 1N59A 1VFBB 3GI9H 2DKSA 4YXLL 3PNWA 3STLA 2R9HC 2WQ8A 3ARRA 5LG1A 2WINB 1MCKA 3K74B 4XC3L 1KB5B 4O9HL 3ZHLA 2XN9B 2GSGB 4BSVB 2CIIB 5FO9B 1A21A 1K4CB 4MB3A 2ZSVA 3HC3H 4H8WH 4E41B 1D5XA 1T0NA 3HE6D 4IOSD 4NZDA 3MRCA 3WIFA 4PJAA 1IM9D 5TE7L 4PJDE 5F97E 3GJFA 2DKUA 5AD0A 4OCSH 4YEEA 5FOBB 4Q6IB 3MJ6A 4RRPG 4GXVH 4KROD 3IDJA 2FJFB 1IQWL 1P5UA 2NY7H 3WO4C 1OTUC 3WNMA 3WV0A 3VD9A 1D5IH 1CLYL 2DWDA 1X4XA 2E6QA 2H9GA 3HFMH 4GQ9L 4XHJC 2FO4A 4JRYB 4WHCA 3AS0A 3U1SL 1VGKA 1KENH 2YS4A 1EEUA 4XBPB 2XZCL 5HHMD 3FMGL 5E2WH 4OZFG 2DQEL 3EFFB 4IRSD 4KVNH 3FL7A 4F37F 1CBVL 4UTAH 2YMXH 3CVIL 4JLRB 4M62H 5ANMB 5DZNA 2R0LH 5IM7B 1E27B 1PKQA 3C5SB 2ZG2A 4Y19B 4HJ0D 4NBYB 4JKKA 4JZJB 2V6HA 4OGAC 1TJGL 2HH0L 1GHFL 3BEVB 4R2GD 1ZKAA 4MVBD 4UIMB 4UMGA 2AV1A 4Y4KA 3WS3A 4XTRC 2GSIA 4LPCA 4S11A 1OSPL 2XTJC 1MH5A 3ARDA 4JHWL 3ARVA 3UDWC 2QSVA 2V7HA 3QI9A 1W72A 3VFUB 3B5HA 3Q6GH 1BF8A 3WIHL 2DJ4A 4NQCE 3GSOA 3PJSB 5F9DC 4PY8I 5FA3B 1GAFH 1L0XA 4FFVD 1FFPA 2O5ZL 3KR3L 8FABB 1EGJA 1MRDH 1YJDH 1MHCB 3KDMA 4YDLC 3LZFL 1CXLA 4XVTH 5IBUG 3OF6D 4KTDH 5D2NE 4CDGC 3N1FC 4UV7H 5IROC 4M7ZB 5I75B 2A9NL 4NO0B 1EZVY 3NACH 3ULVE 3P4OA 4YHOL 3PWLA 5MENB 5C0BD 1OAZH 3BPNB 4K3JL 4MWFB 1DBJH 3BO8B 3T3PE 2LE9A 1RK1B 1T03H 5E03A 4HWUA 1H3PL 4KJYB 4NPYA 2EIZA 2EXWD 3HZYA 4FXKA 5H37H 4RGMB 3V0WH 2KQNA 3CFCH 3BUTA 1RZFL 1MJUL 3CDFA 3GRWH 2GJ6E 2BVPB 2X41A 3HZMB 1KNOB 5J12B 3MODL 3L3HA 1MQKL 3O6ML 2JCCB 3P30H 1NGQH 5F6HJ 3MXWL 2E27H 2CO6B 3SKNA 1N26A 5CUSH 1RUQH 4F3FB 3E3QC 4EUPH 1K8IA 2R23B 1K9TA 1MFBL 2QBWA 3BEWB 2BNUA 1ZS8A 2EDNA 3IDNB 3LIZH 4HIJA 4OD1H 4MQ7A 4DKEL 3OPZL 5D1XC 2XRAL 4OZIE 2SEBA 3I3DA 4ZDHB 1MLCA 1BBJB 4MQTB 4CW1A 4G8GB 4QRUA 4JG0L 2PCPB 5IB2B 3DWTA 4OQTH 4F9PC 3DVGB 4H88H 2QQKH 3MR9B 4EBQL 4G7YL 2XY2A 4R90H 5TF0A 5H94A 4NO2B 2OXHA 2PO6D 4ZOCA 4QYOB 3G6AB 2MFNA 4ZG1A 3BQUB 1QLEL 4ZO8A 1F3RB 5DQDL 4HIIA 3FCTA 3IFPB 1PG7L 4FHBD 4YHKL 1CTNA 3OQ3B 4IRJB 1U42A 1NUDA 2FX8L 3RWGA 4LSQH 3RTQB 4HPOL 4JM2D 3I84A 1T2QH 2ICES 3UTZA 1BVZA 2P8LB 3BZ4A 2G75B 3HMXH 3DV6B 3QEHA 2CLRB 3TNMB 2MNUA 2F54B 4R4NC 5INDB 1UEMA 5DMKB 2FRGP 4LGSB 3EDEA 3KPMA 2Y9RT 2P8MB 4OZFH 3QUXD 3SE8H 2YD2A 5T1LB 2VDNL 3IXAB 3IF1A 1QSZA 1T20B 3KPSD 1NCDL 5DK2B 4PJ8A 3SKJH 2HTLD 1W0VA 1GZPB 3I75A 3IYLW 4KZEL 3QDJD 4BH8A 1G6RH 3J8F7 4KKLC 3KYNA 5EB9A 3QH3A 2YPVL 1JNNH 1MCIA 1ZOXA 3PDOB 1NCBH 3L5WB 2JK5B 4GMSH 4KAQL 3LEVH 3ALXA 5F7EH 1F4WL 4FFWC 4RA3A 2P24B 1T7YA 4N1CA 3HE7B 4NKOA 2HMID 5IMKB 3MO1B 4KJQD 4GW5B 1YPZA 1XZ0B 4XNQA 3VH8B 2PTTA 1FC1A 1CDYA 2P44B 2R56H 5I74B 5KW9L 3KJ6L 4LDOB 3G5XA 5I1EL 2B2XH 5CZXD 1A3QA 4I5BB 2R2BA 4HT1L 5C0GB 4OV5A 5GGUA 2EDOA 4XPFH 1YNKH 3FRUA 2X4UB 4PJAE 4FQ2L 2VDOL 4JCLA 3ILQC 5F9WB 5DMIH 4CNIB 2P45B 4AT6B 1IAOA 3VFNB 1JGUH 5D93C 2DM2A 2BVUA 1BBDH 5E8DH 4RMSA 4XNYL 4Z0BH 3ULSB 1MPAL 2ILLA 1I1AC 4J4PD 3DVFA 3NCJH 1MCCA 3FO2B 2APVA 4GRLD 1KCRH 5B38G 1NFDB 5BZWA 2AJUL 2X40A 3V5KB 4DW2L 2ARJQ 2UWEB 5L8JB 1KCLA 1ZGLP 4JFDD 1TZGL 3DNKA 1QHOA 3DYMA 3SE3A 2GAZB 3VDBA 5GGQL 5BVPH 4NQEE 5J1SC 4JM4L 2BSRA 1JGVH 2YZ1A 3ILPA 4QTIH 3Q5TA 5HPMB 3OZ9H 3T3MF 1I1AD 5TDPB 1PKQE 2Z35B 1UACH 4NQSB 1P4BL 5IVZB 3KWWA 3QHZH 3RU8L 1LDSA 2ZSWA 3D9AL 3IDGB 5KZCD 1ERNA 1CIDA 2MCG1 3X14A 4U1MA 5TDNA 1G0YR 4YHYB 1M7DB 1ZEAL 1JNHA 2DQFB 4WFEE 1MCOH 1UJ3B 1MQ8A 4X9BA 1S7QA 3NFNA 4U1NB 3ROLA 4JFQB 2ITDA 4A2MA 2VLLA 3BIKB 3D69B 3K46A 3IXTA 1XGQA 3FQUB 3QFJB 4YQXL 5GS0D 1C08B 5AZEL 3B9KC 3ARQA 4G6MH 4HJGA 3VE0B 4XVJH 4PGBB 5C0EB 1I1RA 5F1IB 5HDQH 3VD3A 3C60D 3TBTB 5IVXB 2B0SL 2C4XA 1I1FB 4JN1L 4M6AA 2JJTC 5EC2A 2ZG1A 2CKBB 4OCMC 3ZT6A 1ZLWK 1QO3B 3PHOA 4MD4B 2AQ2A 3MXVH 5DFVC 4I3GA 3ZTJH 4Z7QF 2HA1A 3EYFA 3FOMA 1INQB 3ESUF 4JO3H 5D70L 4LDEB 2D31A 1ZT1A 1A47A 1C12B 4O4YL 3HN3A 4JPKH 1LQSR 1M71B 3S5LG 3TCLA 3CPLB 3V6OA 3HC0A 4HHAB 5GGVH 1FRGH 2Q3AA 4HKZB 3U30C 1X5KA 4FZ8L 4FQJH 1JGLL 5DT1H 4JKWA 4R4BA 3VXUD 4QNPF 5DTFA 1AD9A 3QIWC 3IFNH 5DFVD 5DC0A 1FP5A 2ORBH 4POUB 5CINL 4XVSL 2C3VA 2OQJA 5IHBA 3C08H 5HHOB 4KUCD 3UTQA 3WSQL 2IGFL 4KKNA 3TIDA 1OLLA 4OKVA 4UZGA 5J9PA 5JORB 1CE1L 2BFVL 4C4KO 3OKMA 4IEFB 3SDAC 4PRBA 1ACZA 2FB4L 3VGAC 4RDQG 2X4OB 5GSRA 4MHHI 2BOCB 4R26H 2VDRH 3RJQB 3O6FD 4HKJA 2EDTA 3AMKA 1FO0B 1AJ7H 4XCYB 1ACYL 4XVUC 1S7WA 5IB4A 2Z0BA 5D72L 2HJKA 3DI3B 4XNXH 2KUTA 2I5YH 1SJEB 2AJSL 1AD0B 4RNRA 2WUBL 3C8KB 5GS1B 4YHNB 2F8VA 4I9WD 4F37K 3RZCA 4XXDB 1JF5A 4J1UB 1Q9LB 1A0QL 3VGBA 3W9DB 4RSVA 1FYTA 1S9XB 5FUZH 3VG9C 4JM2F 4KY1L 2Q7YB 4ZTOH 4KPHH 4RFEB 3ES6B 1L0QA 1OT2A 1VHPA 3HR6A 4IOFC 4HMEA 5EU7E 1K8DB 4P46A 1HHIB 2Z9TA 3VFGH 2UVFA 5ILTL 3O2DH 1NBVH 1PJ9A 4TULL 3DV4B 5ESQB 2VE6B 3LKQA 4A6YL 2Z93B 4KK9D 3SDXB 1TJIH 3SJVB 3K4DA 4X4XB 8CGTA 2MCPL 4DKFH 2UZIL 4XT1C 5C9JB 3UJIH 4N0YL 3EO1B 3PL6A 3QJFA 4PJ5A 2WSKA 4MAYC 2VLJB 4U3XA 1M05A 3WUZA 4MQXC 2ZUSA 3PHQA 3QO0B 4DUXA 1JWSB 5LVEA 3L6FB 2X70B 4GAGH 4HK0A 5A16B 4X6FB 5EU4A 1CLOH 2X4PB 4CU6A 1CZ8H 1ETZB 1JRHL 3DIFB 4D0CA 4DOHB 1QPXA 3UBXG 5I1DA 5C07B 5BJTA 3KYOA 1QKZH 5TH2B 1UEYA 3QIBC 1RUKL 1I85A 1T1WA 5ADPH 4JFZH 2XQBH 4ODVH 5IQ7H 5DUMH 3LMJH 1QACA 5GXBB 3OX8A 1D5MB 2W59A 1S7SA 4KFZC 4NYLA 1AXTL 3OJMB 5AAWA 4WU7B 1BZQK 1E6OL 4I0PD 4X0KB 2VL5B 1S5IH 1A6VH 5IMMB 1MFCL 2HLFC 3MLUL 2Q6WA 5FUCC 3U2SB 4GRWB 4K23H 1EFXD 1C5DA 2NXYD 4PJ7B 2F5AL 3MLRL 2BY1A 2G5BB 5JUEH 2A6JB 1U8HA 1FCGA 4U1JA 2FWOB 2CLZB 5DEZA 3TT1H 2XZQL 5EU3B 1QSFB 2OS7A 5HGBA 2HT3C 1ZLVH 4MJ4A 4RFOH 5LAXB 3SDCB 2DQDL 2HLAB 4UT7L 3TH2T 4G9FD 2X4QA 4I0KA 4JN2A 2E7BA 4R6UA 1CI5A 3SBWC 4M5ZL 1IGYA 2YD3A 4MSWA 5DUBA 1CICB 5TPWL 5BW7A 1D6VL 2P42B 5SWQA 1BZ9A 5EA0L 4KUZL 5IWLC 1S3KH 3FO9A 5J13B 1L6ZA 1A2YA 3QUYA 3CLEH 4NDMA 4TSCL 3TO2B 5GGTL 3RAJH 1XGTA 2O61B 1MWAA 1NAMH 2JELH 3MRJA 4H20L 5DI8A 5E2VL 2I9LA 3MBXL 3QDGA 1UA6L 4F8TA 2NW2B 32C2A 3O3BA 4PPTA 1CYGA 3RNQB 5D7JC 1C5CL 1DVFA 4Q2ZA 4QRTB 2QQQA 3HNTL 1ZGLM 3ARGA 2ZJSH 3MBEA 3FT2B 4PJBF 1LK2B 1NKRA 2OSLA 5FO8A 1MIEL 4PGCA 4AEHL 3BUYB 2P1YA 1WZLA 5HGHA 1FBIH 3H9SB 1XFPA 4DGYL 4LLQB 1S7XB 1Q0YL 2R0WL 5ISZA 4ZUVA 3F12A 1D9KA 4NRYA 1UZ6E 1NSNL 3HCVA 2WWKO 5KAQF 4ETQB 5IGXH 3IB4A 5I16A 3H3PL 4WRLA 1H3UA 3Q5OA 2EE2A 1DQMH 5DHXB 4YFDB 1UG9A 1NC4A 4LKCA 4LF3B 5BS0D 5H35A 4P3CH 3V6OE 3EO9L 1WTLA 5ICYB 4M61B 4E0RB 1RMFL 3FB6B 5L2JA 1FNEA 3RDTD 4KUCF 3EOYG 4P5TD 5A2KH 5CJ5A 3FFCB 3QNXB 2KPNA 5IBTH 5DHVA 3GM8A 2R29L 1NLDH 2DQHH 2VLRA 4QRPB 5L0QC 5HY9A 3BW9A 1C1EH 3GGWA 4NGHL 3AREC 3BGFB 4Y1AA 2L4OA 4JFXA 3A6BH 1G7MB 1JWMB 5EZOL 1U3HB 5I1HH 3KJ4B 3GBML 4HFUH 3W0WB 4ZD3H 1E4XH 2VDML 4BQCA 3FRPG 3ISWA 2CH8A 4HEME 1I8KB 2NY6D 1Y18A 5JW5A 1B90A 2HTKD 4F7EA 4NWTH 4YO0B 5F9JB 5MP6L 5DJXB 5JDSA 1A6ZB 4WENB 5CP7B 3RPIA 3RWIA 3UPAA 3VCLB 4RMRA 5JZ7D 5HD8C 3MV9B 1G7JB 2NZ9C 5J1TC 1BJMA 2UY7A 1OAQH 2XNAA 1U8LA 5K33A 1P84K 1X6NA 1R3HA 1P2CB 5C0ND 3KLDA 1N5AB 2YA1A 3WNLA 4JGJA 1FYTE 1CT8A 2Y7QB 5C0RL 3K4ZA 3RIAK 1OB1B 3CFDB 4U1HA 4YXLH 4BFBD 5C70A 2HFEA 2ICEA 2BVQA 4BZYA 3BFOA 1ES0A 4XC3H 1MCNA 4O9HH 2V2TA 3KXFB 3U36B 5D4QA 2DTSA 3NGBB 3MZTA 5C0AD 2EEBA 2FDBP 4EIGB 3CJJA 4FXGA 1QPPA 5D7LA 1YY8B 3MRPB 2I9TB 5JDJA 4WVRA 4ZO6A 5SWZE 3GO1L 4JREC 3K3QA 4KVCL 4RMTA 2MWCA 3GSWA 3TM6A 3SQOL 5TE7H 1CDGA 3IT8D 4M9PA 4TVPE 4MNGA 2K7QA 3CZFA 2EDBA 1GL4B 4OCRH 4JFEB 1G7IA 5BRZD 4PY7A 3EJZD 2YPKB 1BVKA 4M03A 2NY0B 1IQWH 2V5SA 4O02L 4X7FC 5LWYL 2IAMA 4ZUUB 5L88L 4Q97A 4FFYL 4RMUA 3GIVB 1CLYH 4GW4B 1H5BA 3E6FA 4GQ9H 4FQXD 1CDUA 3MOBL 3RKPA 4RIRA 1CFQA 1KYOJ 3U1SH 4JRXB 5MEOB 4PD4K 5DQJA 2XZCH 1B0GA 4L8SA 3FMGH 3N85L 3B3IA 2DQEH 1CBVH 4YHZL 1U95B 5SX4I 3CVIH 3KPNB 4O00A 3X13A 5J06A 2P49B 2QKIB 3FQTA 4ZFOB 3O9WB 4LHJB 1ZE3C 4WEUD 3UTTA 4LNRA 1FDLL 4E42A 5DJ2A 1J0HA 3TO4B 1TJGH 2HH0H 1GHFH 3RY4A 5CIPH 5DD6B 2XWBB 1S7UA 3STBA 5D1QB 3SDYL 4I18C 3DVNA 2BNRA 1OSPH 2P8PB 5DHYA 2Z8WC 3QUZA 4U1LB 2ZG3A 4JHWH 2W65A 1BD2A 3GIZL 4N8CL 4PV9B 3D39B 3U0PA 1T83C 5GSVB 2CXKA 3LKRA 4IDLA 3WIHH 3O4LD 5HGAB 2BNQD 2WLZA 4RAUA 1N2RA 3OAYK 6FABL 3UTPD 2O5ZH 3KR3H 2HJLB 5ESAB 2W91A 3GRWA 5C09A 3LZFH 3VRJB 5IW6B 5D1ZB 4R0LB 3T77B 4KI5C 4MD5A 4Y4HD 5GJSH 1YEJL 3OSKA 3D2UD 3JBG7 4YR6B 2GCYB 3LH2L 4GMTL 2HVKA 1A6WL 1G6VK 2WBJB 4PUBL 4NT6A 2HJFB 2A9NH 3ZKND 4BKLB 1J88A 4WDIB 5EUKA 5DQ9A 4PRPB 5IIEB 2CK0L 4YHOH 1RIVL 1IEHA 4EUPA 5LQBL 3BIBX 4D8PA 4G9DA 4K3JH 1MFNA 3CH1A 1JP5A 4L8DA 3O8XC 3L95A 3QDGE 3DYOA 3QQ4A 5F44A 4FABL 1CDBA 4Y5VB 4LBEB 4UT6L 1H3PH 2QSCL 4LCIL 1BX2A 4F7MA 3HE6A 1MY5A 2CMRL 1RZFH 1MJUH 1J1PL 3FONA 4WHDA 4R8WL 4OQTA 3KYMA 1QR1B 3PWNB 2WM0A 2JCCF 2J8UA 4M00A 2YOCA 3MODH 2Y1VA 1AHWB 1XF4A 1MQKH 4RGND 3O6MH 3MXWH 2OP4H 3C2AL 2NY4C 3I6GB 5EUOB 5IP4A 3BP6A 5E8EA 1UYWL 5HYFA 3AM8C 5K59E 3SE4C 1MFBH 3R0MA 4LCWB 2X1XR 2GUOB 4PJGF 4KJWD 4DKEH 2HVJB 3OPZH 1AXSB 2XRAH 4MA8L 3CK0L 3RQ3A 2QR0A 5TQ0L 3BZFA 4GG8B 2F74B 3HMXA 3BGAA 5K9KB 1DEEA 4CU7A 1GC1L 1Q9OA 4F80A 3DX9B 4X6EB 4JG0H 5LXGL 5C0CA 4NNXB 1T5XB 2NY4D 4ODSL 4ACPA 4JDZA 4EBQH 4UU9B 4G7YH 5I2IA 2V7NA 1BP3B 1UCBL 4OZFA 4X7TA 1RK0A 3RUGA 3IKCA 2EH8L 3FAXA 4U05A 1QLEH 4ZOAA 3VDAA 3QA3B 4JDTL 5DQDH 5FGCB 5SWSB 1PG7H 4YHKH 4JQIL 5T5NF 2F8XC 3TYFB 2VLRE 2FEEL 1BOYA 2FX8H 5CSBA 4M7KL 3TBVB 5K9OB 4HPOH 1ZLSL 1K3IA 3E2HC 3BISA 3VXNA 5C7XL 1A6TA 1A5FL 1NGYB 4Z76B 4POYA 3N0PB 4ONHB 2HFFA 1G9ML 2Z31C 1KIRB 2ADJA 4QY8B 1KF9B 4MA3B 2GQHA 4ONFL 1FQ9C 3KYKL 1ULVA 3RVWD 2VDNH 1S5HA 2VDLL 4L9LB 3QYCA 4PJIA 4ELKA 4FS0A 1NCDH 4LGRB 4FMKA 3IDYC 1PEWA 3IJYA 2AI0L 3F58L 3DECA 4KZEH 3GMRA 3VXPA 1LGVA 4K7PL 1JWUB 2VXTL 2YPVH 3UDWA 1JZ2A 1MVFA 4X8JB 2ED7A 1NGXB 4QOKA 4ZPTA 1PZUB 2O5YL 3GDBA 2GJZB 4KAQH 5T1KB 5I1KL 4PTTA 5FECB 2AEPH 1F4WH 4GKSB 2VSDA 3O4OC 1XIWB 2IQ9L 2R15A 1MOEA 4JVUA 5KW9H 3GMQB 3WFEL 3KJ6H 3BRDA 1EEYA 4QHLB 4XNUL 1R3KB 5D7LE 1Z9LA 5I1EH 4QT5B 5KSVB 4FG6D 5CEXB 5IROA 4HT1H 3QG6A 3QRGL 5A2FA 2AK4E 2VDOH 1RZJL 3OKOA 4NQTA 4JPWL 1WC7A 5JHDD 3QQ9D 3LV3B 1M1SA 3LS4L 2VQ1B 4HH9A 4IIQB 5JW3L 4MNGE 3SGEI 3RWJB 2CR6A 2GYSA 1JTTA 1PAMA 5LBSL 2A73A 2F53A 1CVRA 1MPAH 4ELMB 3CFBA 3UP1A 4GKZA 4M6NL 1NFDF 3QEQA 4CN4A 4NO3B 3G6JA 2AJUH 3PP3H 4DW2H 5DRWA 2VDPL 2QLVB 4C83A 1TZGH 1MAJA 3QULA 2X4NB 3VRIA 4ODBD 5ERWA 4N8VG 3GB7B 4U6HA 4P2RB 4N90D 5L2KB 2R2HB 5GGQH 1T0MB 3S98A 5EO9A 4WJ5A 1R24A 1UWXH 3RL2A 2YZ8A 1VKXB 5JIHA 2PYEA 5JOFB 4POZC 1UJTA 3GM0A 5T3XL 3QIUC 4LVHB 5GPRA 5D1XA 1JI2A 1P4BH 5IB1A 3RU8H 4PJEF 2D4DA 1U8NA 3D9AH 4NKMB 3ZSTA 5F1SA 2YN3A 4EKXA 4PRNB 4F9LC 3QAZB 4Y2DC 1ZEAH 5TGBA 3WUWG 4F9PA 5EPMB 2LQRA 5CGMA 2G2RA 3S6CA 1FSKC 4MXVF 5AUMA 2M2DA 2BNRE 2X42A 3ZDYE 1A3LH 1E4WL 3LDBB 3VXOA 1OQXA 4YQXH 5AZEH 2HP4A 2R69L 4LIQL 2VC2L 5IVXF 1FNLA 2X1WL 3MCG1 3KPSA 2OX5A 1X5HA 2B0SH 2H6PA 4JN1H 5IESL 3LKOA 4WO4B 3THML 4PJFB 4I4WB 5C09E 3GUTB 1LWRA 4M43L 5CGTA 2X5PA 4HKXA 3MREA 5CBAA 5E8PB 1PX4A 1HWHB 1IGML 2KQMA 5JIIA 1UXWB 4XB8A 1KB9J 2OBGA 1LE5B 5D7IA 1T22B 3DXAD 4O4YH 3TA3D 5TE6L 3K2MC 1S8DA 4WI7A 5IQ9A 4ZOEA 4Z9KB 3OJDA 3EOTL 1VADB 1FIEA 3K81A 2R2EA 1T1XB 3HG1B 4LVOC 3LKPA 3TN0C 3KLAB 1CGUA 1X7QA 5CINH 4XVSH 3Q6FB 3BD4A 4QRQB 5HVHC 3WSQH 1F13A 2J8UE 2IGFH 4PGEA 4AJ0A 2VLKA 4H1LG 5DURB 5GGRY 1J8HA 1V3MA 4EOWH 1CE1H 2BFVH 3W82A 3AVEA 4NKDB 2FB4H 1GOGA 5GRXG 3FN0L 4LFHD 4UQ2B 3U4BL 3UC0L 1O7SA 4QRRA 5EO0B 3BJLA 1JPGA 3QDMD 1ACYH 3UO1L 2YRZA 5GZOD 2YXMA 3TBWB 5I76A 3ARBC 4EDXA 1CGTA 3O2DA 5D72H 2RFXB 2VWEC 5B38A 2AJSH 3FN9A 2FZ3B 3GMLB 4Y4FD 5E2TL 2WUBH 4HV8A 1KJ3L 2XZAL 5FB8B 3K8KA 4YDVB 2Z4QA 1M7IA 3OKDB 2VISB 3LAFA 5C0CE 4JDVB 1HQ4A 2YPLD 4OFPA 12E8L 3EYVA 4NC2B 5EBGA 1G84A 2PYFB 1I1AA 1YN6B 1H0DA 1VFOA 3TPUB 5I9QB 1OSZA 5GIRB 5HI5D 3C8DA 4LGPB 4OZHA 4KY1H 4UQ3A 5ICZB 3NIGF 1CD8A 4RWHA 1KSRA 1IGJB 5IG7A 3CFKA 1KIUA 2YD6A 1HHJA 3RWDB 1RZ8A 5D7KD 4PJCF 2OZ4L 5ILTH 1QRNA 1G0DA 4DK6A 4TULH 2EIBA 3VU2A 4A6YH 2I27N 1F97A 4HUMB 1DN2A 3EZ8A 1QBML 2MCPH 2QQNL 2UZIH 2DYPA 4N0YH 2IBZX 4WI6A 4OF6A 1GZQA 5D96B 1J1XL 4OFYD 4PJIE 3PXHA 4LSTL 4H5SA 3B6SB 1D5BA 5I18L 3MRRB 4O51B 4OLZH 3LRGA 1NJ9A 4H25B 2XTJE 1XF5A 2I60L 2NY1B 2DQUL 3L7EA 1JRHH 1HXMB 2HAZA 3PWVB 3U6RA 4RAVB 4NFBA 3B9KA 5IMOA 4QOKE 5I30L 4MCZA 1KV3A 4QCIA 5JXED 3I02B 2Q86B 1RUKH 1DQTA 2ICWI 4X6DF 3GFUA 2DBJA 4BQ9A 2JJTA 3ARFD 1EHLL 3G9AB 4P59L 1A6AA 4RQQA 2X10A 3C8HA 4OCLC 3VXUA 4Z95L 1IC4L 1WFUA 5KSBF 2CXGA 4HUUB 5ALBL 3GKZA 4WNQB 1AXTH 1CG9B 4N1HB 1E6OH 4NQXB 4GRWF 5I0ZA 3BN9D 2EO9A 1MFCH 5C92A 4OGYH 1NMCB 1FN4B 4KKBC 1HQRA 4WHYG 5I6XB 4NJ9L 2F5AH 3MLRH 4ZUWB 2OCFD 1WBZA 4WWKC 1NAMA 1I8IB 1NC2A 2F53E 3PWPE 5LKNA 5FYJD 3T0EB 1I8LC 4OI7A 3QIWA 3VWKC 4KV5E 2DQDH 4UT7H 1U8IA 4AIZA 3QEQE 4Y0GA 2Z91A 3G6JE 4Z7VF 3CDYA 4NBZB 3FO1B 5F7KC 4CVXB 4LCUB 5TPWH 1LHZA 2IFGA 3SDAA 1DQJA 2ATKA 3GI8L 5GRVK 1D6VH 3E3QE 1U91A 4LEOA 4CMMA 5JIKA 3BE1L 5DD0H 5EA0H 5F7HA 4KUZH 1LEIA 4AENA 2PYEE 1PX3A 2XFXB 4TSCH 5GGTH 3VWKD 3KPQB 3N1PC 3EYQC 4H20H 1T04B 2BVEA 3DGCR 5E2VH 3AXLB 5HYJB 3MBXH 4YH6A 4NQDA 1UA6H 2NLJA 4NCC2 4LHUB 1HCFX 4FTVA 2MQ3A 1P53A 1C5CH 3KLSA 1PFCA 2ZCHL 1LP9A 1FZJA 2B39A 1ZHNA 3HNTH 2J12B 3PV6A 4CJ1A 3MA7A 2I07A 3FQXA 1CLZL 4OZGB 3VXSD 2Q1EA 1MIEH 5EOTA 3BSZL 3G5YB 1EHAA 2EDRA 3B5TA 3BP7A 4AEHH 5DEGA 1H15B 5GRYA 4DGYH 1A9EA 1A8JH 4UB0L 3QUKB 2KBGA 5FFLA 2VR5A 1Q0YH 2R0WH 5DK0B 4D9RD 5IW3A 2C1OB 1A7QL 1A4KB 5CFHA 3OB0K 4HGMA 4CJ0A 5SV3A 3PGDB 5I8OL 3CAFA 1NSNH 2NY2B 4O2CA 3PQYA 4DUVA 3BP5B 3EOAA 3VFOA 1EAJA 3C09C 2E7HA 3OAZK 4LAJH 5TE4L 4P0DA 4YGVA 4YK4C 4LSPL 3VXTB 4MAYA 5E9DA 1E4KC 1QNZL 2V2XB 4WEMB 2ENSA 3VMOA 1CK0L 3EO9H 5IOPA 1IBGL 2AAVA 3IETB 1RMFH 1MI5D 3Q0HA 4BSWA 4NSKB 5ETUA 3OG4B 3KPLA 2PXYD 3L3DB 3SDDB 4Q0XL 2R29H 3LQMA 1FZOA 3VA6A 3MRLA 1QSEE 3CVHB 4X6CF 4FQ1L 4NGHH 3RY6C 3QIBA 5EZOH 5MEQA 2VLKE 1JHTB 4U3CA 3GBMH 1AGBA 1J8HE 2ZOLA 3MNZB 3OXRB 2VDMH 3L5HA 3HC4L 3WE6A 5KS9A 4QRRE 2RCSL 2NXZD 2NY3B 1T1ZA 2PW2B 1FV1B 4X98B 5MP6H 2JTDA 5JW4N 5FK9B 4KTEL 3G04A 2XXMB 1YEKL 1R3LA 1D7FA 3V8CA 1XF2B 5D2LB 4MJIB 1RJYB 1Z0MA 2D7NA 1F4XL 2R8SL 4BQ8A 2VJXA 43CAA 1GC1C 2E8ZA 1I7RA 5DJZB 4WHYH 5CD3A 2DIAA 5KG9B 3OGOE 4XH2B 1YDPA 1RPQA 4OZHE 1YEFL 4QEGA 3JTSB 5C0RH 3FOLA 3SBWA 2HYMA 3P0VL 2KZWA 5IUSA 5AG8A 4AEFA 4PREA 2AXGA 1ZT7B 4IMLA 3NBNA 4QHKI 3LS5L 1U8KA 1QRNE 3MRCB 4CN1A 5IWLA 2GJJA 3IVKB 3GO1H 4ZFGL 4LRIC 1CGWA 2W60B 4IOIA 4KVCH 4OUUA 4YHPA 3TBYA 3SQOH 3V0AC 4ZNEA 4D94A 3O0RL 4DVBB 5EZIL 3QCUL 2XI9A 1TVHA 1G9MC 4L4VD 4OF3A 5D7JA 3LPWA 3MCKB 4EN3B 2VERN 4P4KC 1DSFH 2EE9A 4LCCC 1DE4B 3PIQA 2OTUA 4M8QA 4O02H 5CIPA 5LWYH 3RJDA 1ZWIA 2EDXA 5L88H 4FFYH 4Z7WB 5HVWA 1Z5LB 2WIIB 4DAGL 2DIJA 2ICWJ 1U93A 3MOBH 5DEFB 5D5MA 4P2OB 2UVEA 3O41A 3BRGC 1N6UA 5T1DL 1ZXQA 1KELL 4MDIA 4YHZH 4WFHD 2VAAA 2CDFA 3WIHA 3WEXA 3I50L 2KDGA 2VTFA 3PWUA 4KQ4L 4NIKB 3CIQA 1J18A 2JE8A 1AO7B 3ARZA 5IF0A 1FYHB 3WS3B 2Y36H 4ESKA 4KDTC 1FDLH 4RISL 4J3SA 3QXUA 4GBXC 3C5ZB 1FJ1B 4KKAC 3VFVA 4WFFD 2MHAA 4YZFE 2VDQH 3SDYH 1SEBA 4X5WB 1RZJC 1JIBA 2V7HB 5E5UB 3WDJA 3E1F1 1YY9D 1W0WA 4LPYA 5JHLL 3GIZH 4N8CH 1D6EA 4JY6A 4L29B 3DBXB 1P84J 4NJAL 1FG9C 4XCFL 5HHQB 4HLZG 2E9WA 2DQJL 5T5FL 2EXYC 4P5MA 1G7LA 4XHQA 4UDUB 2Z8SA 4XNMB 3AREA 1VDGA 4PRIA 1EX0A 4L5FL 5C0JA 3VGFA 2OTWA 6FABH 5I1AB 3R06B 3OXSA 5E5MA 4IM8A 4L3ED 4R96B 5IFHL 1JTPA 1YEJH 3QXAB 5IBLD 3LH2H 4GMTH 4CL7A 3PWLB 1A6WH 4QXUL 4PUBH 5DSCA 5CJQL 3NFPA 2HT2C 5EU6D 2CDGA 1R5WA 2CK0H 3LQAL 3VXMA 1RIVH 5LQBH 1V7NL 5HTSA 3SGJC 4NQDE 4NPYB 4FABH 2MSPA 4K8RL 2BOBA 4OKDA 4UT6H 2V17L 4LCIH 4X5XA 1NUNB 1FIGL 1NDGB 2H32H 4WV1B 5EIVA 3GBNL 3QO1A 2CMRH 3T1FB 4PRDA 1J1PH 3MNVA 3EDDA 4J8RB 4R8WH 5CP3H 5KOMC 3TP4A 2GIYA 4JY5L 2EIDA 2HT2D 3H3KA 3KHOA 4JZJC 3TJHD 1NCTA 2P7TB 3C2AH 2ARJA 5BRZA 1N6QL 2AJ3A 4PD4J 1UYWH 4HIJB 2KZ1B 1T6WA 5T3XD 3CSYA 3MROA 4U1KB 2ATPB 3KPRA 3I6LD 3IDIA 3LSOA 3MUY1 4CW1B 3JV5A 1CDHA 4MA8H 4MNQB 2IPTL 2OR8A 3PQYE 5TQ0H 4CVZB 5FEBA 5KANI 3O3AA 4S0SD 4OLYL 1WSST 5DDHA 5E8NA 5LXGH 5D9SA 1NPUA 5D7SL 5E9DE 4GG6A 4ODSH 1WEJL 5DXWA 1RZKL 1UCBH 1UQSA 3G6DL 1KPVA 3FCTB 1XCQB 2EH8H 1WIOA 3KPOA 2DLHA 4JDTH 4Q9BA 3ABZA 2WNGA 4JQIH 4M7ZC 4HAGA 1EEQA 4Q7DA 5JNYB 3AFLA 1RJZB 4M7KH 3X12A 2UYLB 3BPNC 5FUOL 1ZLSH 2DF3A 3V7AE 2JKXA 1IQDA 2F58L 2H8PB 5C7XH 3HRZB 4MX7B 1A5FH 5SX5H 2AXHA 4PLOB 4PJHB 4XXCC 3FN3A 4NO5A 3WFDL 1XF3A 3VFMB 4U1SB 4OFKA 1G9MH 5KS9E 1HDMB 4X4YB 4RGMC 1T5WB 3T4YA 4V1DA 3HI6L 3VFWA 2ADGB 4ONFH 3KYKH 1QVOB 5J12C 2FO1A 2VDLH 3I75B 4F15B 5CEYB 2XWTB 5A1AA 2BMKA 4ALAL 3QH3B 3GNML 4I18A 3F58H 2B4CL 1RZ7L 1X4ZA 3D2UA 4K7PH 4N0UB 2QHRL 2W0KA 4PLJC 2VXTH 2MTPA 1CS6A 2VB5A 3S4SG 1KPRA 5CEZL 1T83A 3VRLE 5I8CB 2A6IB 1Z9SA 1WZKA 2O5YH 3REVB 3V4PL 2HFTA 5I1KH 1YPZB 4AMKL 4QHKJ 4X8XA 1EO7A 3AAZA 1BOGB 2IQ9H 1A1MB 1BM3L 2R2BB 4HLZH 2V5YA 5GGUB 3RWFA 3WFEH 1OAKH 4XNUH 3E6HA 3FRUB 3OKNB 4YHLL 4S2SA 3W2DL 3SCMB 2VKWA 3BQUC 3QRGH 4KJPD 1KIPB 1RZJH 3MRQB 3SO3B 4JPWH 4ZNEE 2BERA 3NN8A 3UAJD 3UBXI 3OGCB 3CUPA 4IRJC 2W0FA 3O8XA 3LS4H 5JW3H 3RTQC 3O11A 5E6IB 4ELMF 1TVBB 5C6TL 5LBSH 4MB4A 3MUHL 3HI5L 3RVTC 3ARXA 4WUUA 2XA3A 5DO2C 4M6NH 3JV6A 4Y16B 3WHE1 4NQCD 3STZB 3QPXL 5LGJB 2P5WB 3KLHC 4ODWB 1LEKB 3GSQB 2VDPH 4LLMA 3L3KA 2QADB 1Q94A 4O2EA 5BZDB 5D5ME 3PABB 4HZLB 2C4FU 5INCA 2FHFA 3AM8A 1G7PA 3BX7C 1BHGA 4YPJA 3SE4A 2V2WA 3F7YB 3QNYA 3ULVD 5CSZA 2ZSWB 5T3XH 3P4MA 1RZGA 1YN7A 4BFGA 4U1MB 5GRJL 1Y6KR 3TBSA 1NDMB 1PG7X 1BQSA 4RBPK 3VXRB 1GOHA 4Z5RA 3AS1A 1NUGA 4ZFOL 3HE7C 4APQB 4JHAL 2PW1A 4DEPB 2GJ6D 5I74C 3PHSA 1A7NL 1E4WH 1NBZA 3EGSA 1DZBA 5HGDA 5KSAD 1E0OB 3M17B 1FGNL 5E00A 4LIQH 2VC2H 3BH9A 5IW1A 3D85D 4XCNA 4DK3A 5EC2B 3CNKA 3LN4A 4I1NB 3M45A 4JZNB 5F9WC 1FL5B 4PJFF 4OD2A 4PRIE 1JGDB 1U36A 4LSRH 3TC9A 4D2NA 5IESH 1NFIB 3PHOB 3THMH 5DD3L 5FHAL 2E3VA 2ESVA 3EYFB 4M43H 1KUMA 1BFSA 5D6DC 1UZ8B 3BWAA 4S0TD 1J0JA 2D31B 2ADFL 1J5OL 1ZT1B 3HUJB 2R1WA 3E0GA 4TUKL 2Z31A 5MEPB 1IGMH 1X5AA 1JN6B 1BVLA 4MXQC 5JO5B 1CVSC 2NY2D 3QUMH 5TE6H 3LPGA 3VXME 1U8OB 1JZ3A 4F7PB 3QHTC 4WFGE 3JSSA 3MGAA 4R4BB 1T1YA 1U8PA 3EOTH 4PG9A 1LEGB 3HZVA 1YMMB 3RNKA 1WWWX 1SJVA 2C3VB 1MLBA 4MAUL 3NTCL 3UTQB 3GMMB 3C6LD 2AS5M 4OKVB 5IEHA 3S9DB 4LPTA 4NKQB 4I77L 3ULUL 4YDJB 1X5XA 1BQHA 3H3BC 1H8NA 3HAEB 1UB6B 4YHYC 5B3JE 3FN0H 2VZ1A 3HPLA 4Y5XB 1UJ3C 3U4BH 2AQ1A 3UC0H 1FL6B 5CSGA 1BGXL 1S9KC 2EZ0D 4GRMA 5HPOA 3KPRE 3L9RB 1QBLL 3UO1H 5F3HA 4W81A 1OP5H 4X83A 3LRSB 2A6KB 5E2TH 3BYYA 4W68A 4A6YA 1R5IA 1KJ3H 1P7QD 2XZAH 4UDTA 3BP4A 2P47B 3H7LA 4GG6E 4BELD 1JF1B 1BFOB 2ZUYA 4N8VA 12E8H 2QL1A 1F6AA 4FN0A 3DMMC 3CLFL 4S1SH 5DJYA 4HUXB 3MMEA 1VACA 1HHHA 2AGJL 3LQZA 1KLFA 4MZ2A 2R1XB 1UH4A 1IEBA 4HUWA 4HS3A 3NIDE 3NCBB 4LLVA 2CIKA 3UJJL 5DJAA 4EZMA 2GK0A 4ODUA 2OZ4H 3LKQB 2Z8VC 4YIQA 1CWVA 2Q76B 2Y5EA 2XXCB 4PJDF 3MLWL 2EYTA 2YWYA 3EO0B 1LDPL 4XWGL 3DMMD 3QIUA 4QLRA 4PJ5B 1QBMH 2OJZL 2QQNH 5E24E 4UNUA 4V1DE 1KTKE 1X5FA 4F9LA 1EERB 1J1XH 1GGTA 4Y2DA 1UADC 3BJ91 1TITA 5EH1A 5A3ID 4HK0B 1B3JA 2IH1B 5I18H 4G43A 1RZIB 4JHBA 2Y5TA 3FZUC 3TWCL 2I60H 2DQUH 1RURH 1QEWB 3HB3D 5BJTB 5GRUL 3MJ7B 2A83B 5TFSL 5I30H 4UV4L 1WLHA 4KMQA 3QZWG 4NQED 3DO3A 4NOFA 4LVEA 5E1AA 4LARL 4P59H 4DGIL 5BVJB 1YQVL 4NYLB 5GS1C 2X09A 2BRRL 3ROOA 4N9GB 4Z95H 1IC4H 4KI5E 1OGAE 1MCEA 2XWJA 3FHQA 4WCYH 4YEFA 5ALBH 1T3FB 2Q8AL 3MV7B 4LAQL 1C5DB 5I17A 1EEZB 4JFFA 4Y4KD 1BZ7B 5I66A 5IEKB 4WFED 2D7PA 5J6HA 4NJ9H 5FKPA 4GAYB 5C08A 4HDIA 2GFBA 2X4RA 3RVXC 5GGTA 3IU4L 3F5WA 4ORGA 3ARDD 5EOCL 5M94B 1KN4L 4D0DA 4X4ZA 4G42B 5DYOB 3F7PC 4OLXL 3MLSL 4WUUE 1H8OA 3GJEB 3QI9D 3TN0A 5DUBB 4BJLA 2O5XL 2MKWA 3RWCB 4UOW0 4YAQA 2YN5A 4ZO7A 5BV7B 5ICXB 5SWQB 1L9NA 4PS4L 3FAWA 1XR9A 2EECA 3P9LA 3GI8H 1OAXL 1U8QB 3BE1H 2FSEA 5CGYD 2WIMA 3MRJB 5DI8B 5F6IC 4NQUA 2R39A 3ARBA 4TOYL 2FBOJ 1I9JL 5F71A 1JUFB 4L4TA 2M1KA 2GY7B 4ZPVA 4OB5L 2VQUA 1DVFB 4LPVA 3VGHA 4PJ9B 1I3UA 3C6SA 1ZVSB 5ITFB 4QF1B 4EI5B 5E1HB 3DRTB 4XAWL 5B21A 2ZCHH 2DL2A 2OSLB 5FGSA 1NEZB 1CCZA 2XPGA 2N1KA 4OZGF 5HGHB 1CLZH 4P3DB 3BSZH 1IAII 3D0LA 4H0HB 1TENA 4CMHB 1CL7I 4U1GB 3TFKC 1WFNA 4HEPG 4U6VL 4CRPA 1KCKA 5CS7A 3VFSB 5ISZB 2X9WA 4DZBA 4JFHE 3U0WL 4I48B 3R8QA 4JFPA 4PRAB 4JEGB 1IM3A 4I13B 1N0LA 2YSSA 5DZLA 1QFWI 1U8JB 2ESVE 4X5LA 1A7QH 5B39A 5I8OH 5EBLA 4LLUB 4YBLC 1BIIA 2D03L 3GHBL 2WUCL 1XMWA 3IAQA 3SDCC 1K6QL 1U8MA 4GKOA 5GJTL 4LLYB 3BPLB 2CRZA 4LSPH 1QNZH 5H2BA 1CICC 4Z0XA 1I75A 1MF2L 4LLDA 3RY5A 1IBGH 3D3VE 1EMTL 3LQAC 5ENWB 1V3LA 4RFNB 3TZVD 3CX5K 4OLWL 4Y1AB 4MCYA 4OIIL 5J13C 4K8RC 3TVMB 3HA0A 4FQ1H 2A6DA 3QXDA 2FIKA 1QHPA 4NRZA 3MV8B 1DL7L 4HS8L 1Y18B 4F7EB 1CDIA 1WBYA 3HC4H 4O5LL 2RCSH 3U46A 5KVGL 4GLRI 4ODXB 3RPIB 1WCBA 1MIML 3KHQA 1A9BB 4KTEH 4XMKL 1IGIL 1X3DA 5D2LF 1YEKH 1EHNA 1S9YB 4PJ8D 3Q48A 4MJ2A 4ZFFB 1RJLA 1XH3A 4WGVB 2EYRB 4WWKA 2YUXA 1FVEB 1U8LB 4QWWC 4YUEL 1F4XH 1R3HB 2R8SH 1U2HA 4PGDA 3IU3A 2X05A 1I8LA 4FP8L 4F7CB 2DDQL 3VFTB 3VWKA 4MS8D 5DVKA 2ICEB 4H26B 3GSNB 3EYOB 1YEFH 1RZKC 3P0VH 2GITA 3MRDA 2BY3A 4L3CA 2OR9L 1IZJA 2X4SA 3MUJA 3LS5H 4K7FA 4MMXC 4X4MA 2R1YA 3U48A 1EGJH 1G7HB 1IARB 3MLYL 4N0FB 3GSWB 1FPTL 3UX9B 4DVRH 1WQVT 1N6VA 2EEDA 4ZFGH 3UTSB 5DJ8B 1G7IB 4JCMA 5HHVL 3O0RH 5EZIH 3QCUH 3BGFC 3MJGX 3U79A 1WICA 3P3YA 3ZKMC 1KGCE 1H5BB 5GGRB 4Z7WF 4FXLA 3I6KA 3VWJB 3R0NA 2VKXA 1UM6L 5GGSY 4DAGH 4X99A 2B4CC 3OHXA 2V5RA 2NW3A 2D7MA 3ZLQC 5D6CA 4Z77B 5JPMB 4AQ1B 3NZHL 5T1DH 1Q8MA 1IGCL 3X13B 1KELH 2ERJC 4NRXB 3RWEA 1KTDA 4QHMB 3KVQA 2YD8A 1AI1L 1SYVB 1ZANL 3T2QA 3I50H 4OI9A 3UTTB 5J11B 4LNRB 4E42B 4KQ4H 3QEUB 3LRHA 1H3GA 1F11A 2JIXB 1S7UB 4P23B 3WL9B 4JFFE 1HSBA 4ZXBB 1E4KA 4I2XB 2BVTA 4D0BB 5C08E 5B3NA 1BD2B 2LABA 1A4JA 3DURB 3DVIA 2HN7A 2IANA 3NGBC 3MRGA 5HDLA 5JHLH 1QFUH 1LK3L 3T1WA 4PP1C 3FQWA 3S34L 4NJAH 4XCFH 4RAUB 5F7DB 2DQJH