1ZLWH

Fab 2g12 + man8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 2G12, light chain
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH01
3CC5A 1OTUD 3U4EB 4LSUH 2QJDA 1F5WA 4FABH 3GSOB 5TQ2L 4BFIB 5J6GB 2H9GA 5FDWB 2I9TA 2Y4SA 4HKJA 3QI9A 2UVEA 5KSAC 2FJFB 4JFDB 4IOFD 2FGWL 3WD5L 4KY1H 1V7MH 2IH3B 1BJ1H 4FZ8L 2FATL 1ZTXH 3RWHA 3ZE2F 5HVHC 4UIMA 5DMGD 3TA3B 1KENL 4XGZA 1BZ7B 3FZUC 3O2DA 4G43B 2XV6B 5CIPB 3HS0B 3U36A 3VFVA 5FKAA 3RGVA 1KCRL 2H2SD 2IAND 5AWNH 4HIHA 2W0FB 3BT2H 4XC1L 4XNXH 1X5ZA 1HHJB 3O3DB 3UTSD 4HKXB 1NQBA 1R3IH 3F7VB 3IJSB 1XF5A 3V2AR 3QI9C 2A38A 1KIPB 5FYJD 1AC0A 5IKCB 1A7BA 5J12B 3RA7H 4QGTA 2ICWB 1GH7A 4ZTPH 1WEJL 1L6XA 3GJEA 5KSBA 4MWFA 3K0WA 3QIBD 2GK0A 5FUZH 2B1HL 5FM5O 4HS6B 4J1UA 5A2JH 1Y0LB 4AT6A 4PB9L 4RQQA 3G6JE 3LH2L 3RGVC 4LSPL 1N6VA 3CU7A 1NKRA 5BRZE 5GGTA 1CXKA 4OZIE 3JUYA 5D1XB 3FCTA 4XCFH 1MCWM 4N1CA 5EU6A 5A2KH 2OQJB 1TETH 4QRSB 5IFJB 2VLJD 1EHXA 1G7QB 3HZMA 3VXPB 4LGPB 3MJ9A 2CK0L 5CWSA 4APQB 4MB3A 5DHYB 1H15B 1T0NB 1JNLL 4LGSB 1TQCC 1SYVA 4RFEB 4EDXB 4MYWB 4GMTL 1NBYB 2EDLA 1PKQE 4PRPE 2WBKA 4YHNA 3RL2B 4K7PH 4U0RC 5B8CB 4Y4HA 3B83A 1UEYA 3I3DA 4LHUG 5DEFB 1XAUA 4N8VB 4XP9H 3U9PL 2HJKA 2R23B 1FZJA 5IV2B 2OCFD 4LNVA 2DWDB 2AQ2A 5I9QC 4KHXH 3E0GA 1IJ9A 3DO3A 3RDTA 4HUXB 4CJ1A 4DAGH 4ZUWA 3AB0B 2Z91A 5E2VH 3RVUD 3EYFB 1YJDC 4MLSA 4YBQD 3RWFA 2X4SA 5C0JA 4PG9B 1CI5A 1L7TH 2H32B 2VR4A 1ZHKA 2GY5A 3NFNA 2F53E 3E3QC 1YEJL 2AJUH 3HPLB 4UU9A 1AE6H 4CU7A 3MREB 2J5LB 3RVXD 4Z8FL 4LCCA 3WMSA 1JF6A 4Y4HC 1EGJA 1OQXA 2IC2A 4WI3A 2P4AB 5DUML 3L5WA 4HT1H 1EXUB 4I48B 4ODXA 3GFUA 5GISH 3IXTB 1FFOA 4M93B 4WI8A 3S7GA 4ESKA 1VACB 3RDTC 5HHOA 1ND0B 1A7QL 1ZV5A 5EG6C 3DYMA 1Z3GH 1VGEL 4KQ4H 5JOFB 5HJ3A 3DX7B 3ZE2E 2GTZA 4OUUB 1E4KA 5F9DC 3QQ4B 4J7RA 1HQRA 1U8JA 3RZCD 1M7DB 3TV3L 2Z93B 3OWEA 1CFTB 3K80A 5T3XL 5TFSL 2A83B 2FL5A 4F7PB 3VXSE 1IM3A 3CH1B 2ZNWA 3KJ6H 1UZ8B 4ZFGL 2IADB 4LCCC 3VXRE 1TCRA 4NJAH 2CLRA 3MRMB 3WNNA 2BCKA 3GIVA 3CH8A 2IALA 4Z0BL 2VE6B 3MUGB 1DJSA 1I9JH 4DFHA 2ICCA 2XWJB 4M1DH 1XR8B 5I15L 1AD0A 2XZQL 4XNUL 3RWDB 1JYVA 2CO6B 5D5MB 3ARBA 1AJ7H 5L7XL 1BVKA 2ADGA 4X4XA 32C2B 2X7LA 5FXCH 4JZJA 5ERWA 1VADA 1E4KC 5BZWB 2E3VA 2EDXA 1QFWL 3T3PF 4C54A 43CAA 5GJSL 5KVDL 2D0FA 3LRGA 2IPKA 5CJXA 5E08L 4ORGB 4S1QH 2IPUG 5J13B 4R97C 5DZLA 4FQ2H 5DD5H 5DZNA 3FO0H 4O5LH 4Y8AA 4F3FA 2J3SA 3MGAA 5E2WH 5E8OB 2ICEB 1QBMH 3HB3C 3HRPA 5JNYB 2I9LB 5BQ7B 1BGXH 1ORSB 4MX7A 2R8SH 4GG8B 4AZ8A 3HRZA 1NSNL 5I8KL 2P7TB 1SEBA 4TUOA 1ITCA 4JGUA 1ZLWH 1LILA 3CFCH 5D7LD 3ARBC 4OZGB 1BFSA 1EEZB 3GSQB 2R1XA 1BZQK 4JZJC 2IF7A 4W4OA 1XGPA 2L0DA 3VWKD 1YPZF 1D6VL 3GMRA 3O6FD 4D3CH 2FH6A 3VD4A 1YEHL 4GMSL 3TT1L 2UZIL 4PJAA 5CJXC 2V7NB 1XCTA 1UVQA 2AQ3A 5F89A 5HYJE 4JY6B 4PJIF 3RPKA 3NN8B 3MV8B 3O9WB 4YEEA 2R56L 2A9MH 2EDJA 1J88A 3IDJA 5GPRA 2MPAH 3I02B 4QHUB 3KDMA 2YKLH 4LPXA 3B8YA 3G5ZA 3G6AB 2G75A 4BKLA 1HYRC 1U91A 4GUPA 3W81A 4U2ZA 4W4OC 2BNQE 2F54D 1SEQL 4Y2DD 3JV0A 5C0BD 5GRWA 4XBPA 3RAJH 2X41A 2DKSA 3AMLA 3CFJB 1R3JB 2YBRB 4NUGL 3AROA 2VDKL 4NNYB 3GSNA 4M61A 4DVRH 1RFDL 5J11C 5ADPL 1R24B 2A9NL 2G9HB 1M1SA 2XN9E 4AEIH 2CMRH 4YPGB 1LEIB 3QRGH 4EEEA 1GGIL 2AXGB 5L6YH 3BKJH 5E9DD 3OKNB 1A6ZB 4QRPB 2QADC 1MJ7H 1UXWB 4JHAL 4RNRB 4JANA 4UI2A 1URLA 3GSUA 2GI7A 1MFEH 5KW9L 1MCPH 1JGEB 4YNYB 3RX7A 3BEVA 3BPLB 1O5DT 2BDNH 3OKKB 4F7EB 5DHXB 5GGQH 3DSFH 3MLYL 3QZWB 3VWJA 5C9JA 3U30C 2GW5A 5IEHB 4Z7VE 5ESVA 1L0YA 1EAPA 2R0KH 2YPVL 3JV6A 5DK2A 3DETC 4LSTH 3V95A 3SEPA 1OAXH 4NHUB 3O45B 3D2UD 1N2RB 3KYMA 3M45A 5HGHA 3KPRA 3INUH 3QQNA 3V5DB 3HNSH 4XXCA 5EWIL 4KKBD 4JN2A 3TIDB 3VFPB 1DEEA 1U93A 2HTLD 2AV7A 4GAJL 4M7LH 5F1NB 3NCYP 4X83A 4HBCL 3KPNB 5DDHB 1EJOH 5DD1H 3HE7B 1JN6A 4ZDHB 1YJDH 3QDGB 4AIXA 1ACYH 1YPZE 4M62H 4L4VD 5K59F 5EU7C 4L8DB 3FT2B 2X4OA 3ES6A 1MUJB 5IB1B 4XXCC 3U48A 1CE6B 1DQTA 4PJIE 1MLBA 1JFQL 4KRPB 1UEMA 4YJZL 3HG1D 1R5WB 3X12B 1AR1C 1EMTL 4PD4J 5D1ZB 1N5YH 3QUXB 2AJYL 1WIPA 4MB4A 5FHBH 4MAYD 3ARZA 4P2OB 5E6YA 1BM3L 4JPWL 4PP1C 4HXBL 1JNHA 5KAQG 4BFGA 1QRKA 4L3CB 5IMKB 4I3GA 4ZFFB 2EXWC 3W39B 1X5HA 1Z9OA 3A6OA 3BKCH 1JF1B 1S7QB 2ZSWA 1EGJH 1SYSB 2W07A 1IQDB 1WWCA 4ZS6D 4XNZC 5FCUH 2P48B 3H3BC 3NCEB 1FQ9C 3WHE0 2VTFA 1TENA 4P49A 2FIRT 4F2MB 3STLA 4P3DB 1VSCA 2PYEA 1D5ZB 2PXYA 4Y2OA 1CGTA 5C7XH 1VKXA 5HHQA 1KB5H 4LCIH 1J86A 4FQXB 5C09E 3FFCA 5T1KB 4NUJB 3QA3A 2VDPH 3SKUD 3EIFA 4D9RE 5D6DA 4NKDB 1ZS8A 4MQ7B 4ELMA 3CJJA 5F9OH 3W0WA 3QT2A 4G9DA 4NKQB 4WDIA 2VZOA 4JE4B 2R29H 4YGVA 4GXUN 2QR0B 1K5NB 2UUDK 3K8LA 4UOJA 1WBXB 4S1DC 3ZHLA 4AENA 4A2LA 3BD3A 5F6HI 3GK8L 2X1WL 4RGNE 5LJYH 2JIXB 2YK1L 4MA8L 2PXYC 3EYVA 2JE8A 4Q0XL 3VFWB 1S9WA 5CEXA 1FNSL 3IXAB 3L6FA 3HUJA 5D6DC 3WEXB 4Z77A 4V1DB 1YNTB 1JPTH 4HWEL 3RL1B 1HKLH 3P30L 2JELH 4UB0H 2RGSA 1HEZB 4MDIB 4LHJB 2EC8A 4G8GB 5CJOH 5A16B 3DO7B 3P0GB 1Y6KR 5GZOD 3MNWA 4KROD 3CFEA 4JM4H 1XGYH 5CHNA 1D9KB 3L7EB 3PWPE 4XXDA 4NBZB 4JR9H 4DZ8B 2BVYA 3K2UL 5K59E 2ORBL 2PCPB 4CJ0A 5ICZB 2QQLL 1S7TA 2YXMA 3MACL 2F5BH 8FABB 5J1AB 1OL0A 3EJJX 4F33A 5C0NC 3VFNB 3QCVH 3BRFA 1N26A 3NABL 1K6QL 3T3MF 5FK9A 5CD3B 4OKVA 1W2KT 5D71L 5E8DL 1LE9A 1FGNL 4PJ5D 4BSVA 4X4YA 1I9IH 3WLWC 5CP7B 3O11A 3QIWA 2ERJC 5KS9A 5L9DL 3BMVA 5BXFB 1J8HA 1YA5A 4ZNEE 3EHBC 3JXAA 2VABB 4POZD 2XFXB 4M5ZH 3VA2C 1AIFB 3FB5A 5MEOA 2EEDA 3PQYB 2P5WE 2F74B 3S36X 5IB2B 3NIDF 4LRIA 1OLZA 2P1YA 4Y16D 4M8QB 2VDLL 4NZRH 1HSAA 1AGDA 2IFFH 4PJEE 1T89A 2G60H 2BOBA 1MFCL 3GSNH 3TM6A 4TPRL 4FQPA 3MV9D 1KJMB 1OGAA 3E6FA 3MJGX 4WUKH 4QHMA 4QRTA 4TYUA 5D7JA 3ZL4H 4FQQB 3KPPA 4OAWA 1KIQB 5D2LF 3OKDB 4NO0A 3EOTL 3VGGA 4H1LH 4I2XE 3ESVF 5D70H 1JHTB 5B21A 4C58B 3EYQD 4HZLA 3QUKB 4TSCH 5EOCJ 2UWEF 3G6JB 1UM5H 1R0AH 1X5FA 2ARJA 1ADQL 1IGTB 4YFLF 3TC9A 4X7SL 2R2BA 5BRZB 5I1LA 5JIPA 2NW2B 3S88L 3KXFE 5C6WH 4OZIB 1T89C 4PYHA 1DANT 4UINL 2NY6B 3QEGH 3ULUD 5EZIH 3U9UA 1QRND 3GMLA 5D7JC 1U8PB 4EUPG 4MVBD 5M94B 2QTEA 2VITB 4C83B 5IEKB 3VXUD 2VL5B 3FB8B 3ZYZA 5F70A 4L8CB 2V2TA 1E4WH 1CIUA 2ITDA 4LHUB 4PRPB 3L3DA 3IFPB 3P9WB 1YMHB 5DS8B 3UBXG 1Z6JT 2MHAA 3QUZD 4WVRA 2FSEB 3ULVF 3BYYA 5HY9B 4IDJH 1I1FA 3B9EA 3FO9B 3QPQD 2LU3A 3ARRA 2DQIH 3QQ3B 1OAUL 5JHDE 4Q6YA 2X89A 3FQNB 3C5JB 1OAZL 1IM9A 4E41A 1G6RL 2WQ8A 1NMCB 1QR4A 4R8WH 4OCRL 5F7DB 2DI8A 1KJ3H 2NY4B 4P2CG 5KBNC 2HT2C 3L5XL 3QNYA 4OB5H 1U3HD 1KPRA 5I17B 2F53B 3IFLL 4WY7L 1A6TB 3NFPA 3AVEA 1UQSB 4ZUVA 5IR1B 4HGWB 1N3NA 5IHZB 1HYSD 2X4TB 1J0HA 3QG6B 2VERN 2D2OA 4HLZH 3T3ME 4NQEA 5J1TC 2YXFA 1JV5B 3ARDD 3PDOA 5DF0A 4GLRH 1UJ3B 4GRMB 4BZ1L 5IQ9B 4DEPB 1JJUA 1MAML 3AREA 3OGCB 2VXUH 2DLTA 5DGQA 3QPXH 1CG9A 5HYSG 3GSVB 3DX6B 5C0AD 2VLRA 5ICXA 4DQOL 5DD6B 5IW6A 5JDJA 3FO2B 2Q6WA 3TO2A 4RFNC 4XPAL 3LKPB 3MBEB 3KJ4B 3VXSB 35C8L 4XBEL 2PW1B 3OF6D 5F88B 1DBAH 3NIDE 4MSWB 3BUYA 3D9AH 2HT3D 4PPTA 1P2CA 1G7HA 2CPCA 2ATKB 2B20A 3NAAH 3MROB 5F7LB 4WEBH 1KYOK 2YPKB 1P7HL 4YQXH 4I9WE 3AREC 1J8KA 3DV6A 2DQGL 2Y5TA 3HZKB 1RVFL 2NY2C 5T5NF 5LGHL 2LV4A 1MIML 2J4WH 4KTEL 5TQ0L 1INEH 2RHEA 5L88H 4PUBL 5DQ9B 1XGUB 1BIHA 2UWEE 3RVTC 5INCB 3QFDB 3KLHD 1IEHA 1P9MA 3OSKA 5I8EB 2FHCA 5T3ZE 3DVFA 2Y7QA 1U6AH 4X6DF 1YMMA 1F8TH 4PRHB 1QLRA 3NCFB 3QHZH 3QWRA 1JZ3A 5GRVK 1WFNA 3Q6GL 1WF5A 5K9QG 1QG3A 3F62A 3QAZB 4TUJB 4WWKA 1NAKH 2DQUH 4HFWA 1KEGL 4ZOAA 3BZ4A 4FZEH 3C2SA 4MD4A 4IRJB 3S36L 2JB6A 1B4RA 2E7CA 2GYSA 4NQDD 1U92B 2Q20A 5BV7L 4NQCA 4PJFF 1MCIA 3MRHB 1P9MC 2XA8H 3EGSB 2AABH 3MCG1 3TT3L 2XPGA 3WIFA 3ULVE 4NZTH 4OLXL 5F3BA 5HYJB 4KV5F 3QDJB 2XOTA 4ZOBA 4Y5VB 3K4AA 5JW3L 3L3GA 2ICWJ 5C0IA 4JRYA 4OLZL 2NY0C 1MCNA 5DRZA 1NGXA 5HI3C 4P5TA 4L8SB 2CD0A 5L2JA 4LVHB 1ZKAA 4WWKC 4L8BA 3LRSB 3UTQB 3C8DA 4JFPA 4OGYH 5FO9B 4TSAH 4MCYB 5T1LB 4DTGL 1YEFH 1RIVH 3QXDA 2O93L 3VD3A 1WUNT 4TVPH 5LXGL 4PTUA 2LVCA 5FYLL 4XTRD 2R4RH 5E70A 2DTML 2EEAA 5TE6H 5JW5B 5GRVL 4TOYH 2N56A 2NY3C 1E28A 3MRQA 5EZLB 2XN9B 3CSPA 3TZVD 4AL8H 3N1GC 4ZS7L 5GIRB 2VQ1B 2DICA 4P2QA 1PYWA 3PL6A 4NQVB 1BFTA 3DYPA 4QWWC 4P5TC 5AD0A 4R96B 3TCLB 5DK0B 1CDGA 1U0QA 1B6DA 3LEVL 3VXTB 2ZWLT 2OSLA 5I6XB 2VISA 4NO2A 5EFIB 1FGVL 5EIIB 2EC9U 4WHTB 1RV6X 4I0PB 1WAAF 1A4KA 3IRPX 1S78D 2EE2A 1O0VA 1Z0NA 3BESR 5F7UA 1E6OL 3GI8L 4Z7VB 1EZVX 1U95A 1BLNA 5TPWL 1BZ9A 1I9RL 5EC1A 3PL6C 1CD1B 3I3BA 5T5NG 3GBNH 2F19L 4HDIB 5SWZE 1E0OB 2HJLA 4Z76B 1A7PL 4QOKA 4DKFL 3I75B 1FIGL 3TNNA 2UY7A 5D7IA 4OZFH 5ADOL 1MREH 1GAFH 2EDYA 1FO0L 3HHRB 5IFAH 4X6DE 4GJTB 4ZUSB 3RWEA 1OCWH 2BC4A 1FAKT 3AU1A 3DECA 1A6VL 4NO3B 1RPQA 4IIQA 1RZIB 1OAQH 1I3RA 3QG7L 1AO7E 5HYQA 3DBXA 3L95A 1BEYL 3HR5A 2YD2A 1ZOXA 2XKUA 4KK5C 2FR4A 1HH6A 3HC4H 3P4OB 4PJFE 3EOBB 3F7RA 4NKOA 4HH9B 4M7ZC 4PJIB 1OB1A 4KV5E 1AGEB 3HAEA 3Q1SH 1IQWH 1RIHH 5DMYA 1EEQA 1KJ2L 2HRLA 5KOMC 5DUBB 4IIQC 5DR5L 2QQNH 3BRGC 1OF2A 2BOCA 5T3XE 2PO6B 5C3TA 4QTIL 1Q9LB 4XP1H 2C1OB 4NQUA 3NCYS 2HRPL 1D6EA 5CILH 3O8XB 3LHPH 4UTAH 1HHIA 3P73A 3DXAD 1JGUH 1X7QA 5JXEA 4E0RA 1TZGL 4P4RA 4LLYB 4KI5D 4G7YH 1G9ML 4NSKA 4OCYH 4XAKD 4OBSA 1BFOA 1HQ4B 1NCAL 3SKNA 4JFOA 3LEXA 4Z9KB 5E6IC 2E27L 5DJ8A 1Q0YH 2IH1B 3TO4B 2NY1B 3MQIA 3MA7A 3P0YH 5E4EC 4NFCA 3EZJB 4IHOB 3TNMB 5C09B 2CIKB 1NBQA 4PRID 3GHEL 1FORL 5F6HJ 4PJ8D 5F3HA 1FZKB 1WAAE 4GRLA 5KG9A 2CKBL 5JXEC 1T80A 5AZ2L 5JXAL 3TJEL 3T77A 2XKNA 3VGEA 4ZAKA 5TJWK 2EDDA 3TN0B 2FBJH 1PSKH 5C0CE 5EOQL 1ZAGA 5FA4B 1JGDB 4RGNB 5I1IL 1ED3B 4AH2A 1B0GB 4GAYB 1AXSB 2X4UA 4GAGL 2IFGA 4DCQA 3MRPA 1X5XA 5I0ZA 5I76A 1K85A 1U36A 1MI5A 3MGTA 2SEBB 3QEQE 4EN3A 1MELA 5C0DA 4K9EL 2IAMA 3FFDB 3AS3A 2HT4D 1RK1B 4HHAA 4F8TA 3D39D 4GRLC 4ODHL 2G5RA 4P4KD 1DUZB 5GSRB 1PVHA 1EZVY 2KL6A 1RU9L 3WO4B 1DFBH 2HTKC 3ZKMC 1BAFL 2WINB 1EK3A 3DROB 2WAHA 3MOQA 3O6LH 3EDKA 4LVOB 2VXVH 3IDXH 2H8PA 4XCEA 1EFXA 1IAIH 4GRWH 2D03H 3C08H 4JFDD 2MQCA 4IRZL 5HYEA 3B2VH 4I1NB 2VDMH 1MLCA 1NGWA 2CDEB 5JZ7D 3QSKB 3JVGA 1T1YA 4EN3C 3RVVC 3TA3D 4L3EE 4GBXA 2IAMC 1LP9A 3GJFB 2FECL 4FQLL 2XG5A 4PLJC 1BQHB 4A6YB 1PX4A 2IG2H 1M6OA 2V5SA 1FL5A 4O2EA 3PIQA 3THML 3KPTA 1CD0A 4YAQB 4FQCL 4PLOB 2P44B 5CJ8A 3MNZA 3MXWH 3MYJB 4JKPL 1DCLA 1RZJL 1VGKA 4YHKH 3GMQA 5MEPB 4U7SA 1QKZH 2J6EA 3NPSB 4HAFA 3L7FA 1GGCH 2X1QA 3JVGC 3NIFF 3UPRA 1DBJH 2H1PH 3MJ7B 5J06A 1RMFH 4GBXC 5FOJA 4TSBL 5GZNC 3IAGC 2ZCKL 3D0VB 3H8NA 2PUQT 4PJEB 3F5WA 4AM0B 4L29B 1HHHA 4XZUB 2EYTB 3MLRH 4EBQH 1CICC 3MRGB 1U8OA 3MRDB 1CGSL 5D1XD 1A64A 4I77H 3BZFB 3FTGB 2DQCL 4I2XB 4V2CB 4PD4K 4OLWL 3G5XB 5I75B 1F4WL 5LAXA 4D8PA 1VFBA 4APQD 1TVHA 3U79A 3O0RL 4H26B 4MQSB 3WS3B 2OK0H 4H5SA 3V7MA 2GUOA 1PLGH 3LKRB 5ILTH 3ARGB 3MCKB 3MRNB 4PJGA 5TQ2H 3KXFB 1DDHA 2GTWB 1IT9L 4EUPB 1QQDB 2BSSA 4MNHB 2H6PB 3OR6A 2WBJB 4MA7H 5I1AB 3CMGA 4OD2A 2FGWH 5DHVA 3WD5H 3WNLA 4P46A 4FQHA 4FZ8H 4FHBD 3DVGB 3B2UC 4S1RH 2H3NA 1UWXK 1KENH 2DD8L 4NDMA 3WFDH 1FL3B 2MJWA 1HINL 1IAIM 3QIUB 3WFZA 5DSCB 5HI5D 4JO4L 3SJVE 1BPVA 1KCRH 3IS0X 4Z7WA 3QB7C 3QFJA 3UJIL 2P8PA 4UDUA 2L7UA 1KCUL 1XH3B 4XC1H 3HI6H 1OSPL 4HUVA 3MV7A 4GKZB 4ODVL 3BZEB 7FABL 1GL4B 5AYQA 3GSWB 4QRQB 3ZDYF 4P5MA 4P46C 3VXMA 1O7SA 1AHWA 4QHLA 3B9KB 1WEJH 4TUKL 1RJYB 4PG2A 1QNZL 1T83A 4Y5XA 1NCTA 5I1DB 2B1HH 1TITA 2X1OA 3OHXA 3CFBA 4PB9H 3H3PL 3LH2H 3S9DB 5E8PA 1J0IA 4LSPH 3V4VL 4OLUL 2HKFL 2EDEA 3UROR 1UA6L 3C6LB 2A6DB 2BVTA 3LKOA 1AY1L 3BWUC 1RUKH 4TULL 4HUUB 5HYSB 1AC6A 2GJZA 4U05A 3S3JA 3KPQA 1WVZA 4GW1A 5FB8B 2QQKL 4P9ML 1WZLA 2CRIA 3UC0L 1AHWC 4JLRB 1C5DB 2CK0H 3V0VA 4AMKL 3N85L 3R06B 4CUCA 3B3IB 1PEWA 3MPCA 4PG2C 4HMCA 4KGLA 5D1QB 1T83C 4Y5XC 5IJKA 3B5GA 3MRKB 4GMTH 1I8LA 4J3SA 1BF2A 1T7VA 2GCYA 2JJWA 3EJZD 3BXNB 4L4JA 2ADIB 4MNQA 4KJQD 1CL7L 5IB3B 4MMXC 1V3LA 2WIIA 4U1JB 2BVPB 2CR6A 3KPMB 1CLOL 4PJ9B 4CW1B 3GMMA 4Z78B 1PJ9A 1QFHA 2MQ0A 4UOW1 4EIGB 4NNPL 3VI3F 43C9A 2DWEA 1SVCP 4NM4L 3VE0A 2ZG1A 1PBYA 1YEJH 1TNMA 5IJKC 5F8QC 4Z8FH 2EXYC 5F9JA 4OIBA 4XPBL 5DUMH 4KKLD 1T5WB 2D9QB 3RWGB 3TBTA 2H45A 2X1XR 4BQ8A 5FYKH 2E7HA 5ITFA 2NW3B 3MV01 1E27A 4AEFA 1C1EL 1AQDB 3O9WD 2G5BA 1AGFA 2OL3A 3FQTA 4WW2B 5DXWA 3TV3H 5ALBL 1A4JA 1IGIL 3BW9B 4Q58C 2D7OA 5TFSH 5CKAA 1ZLUK 4ZFGH 2CLVA 3P9MA 5EB9A 2VAAB 2XWTB 3H7BB 1MCRA 5HI4D 3NZHL 3P40A 2GJ6A 4TTDD 4JB9L 5ESQA 1B0WA 4LPWA 2VLLB 5I15H 1XIWA 3FQUA 1F4YL 5D9SB 3ZDYE 4CN6A 6CGTA 1HILA 3CDGA 3HMWL 5L7XH 1A6UL 1IGYA 2YZ8A 4EDWH 2AXHA 1H3GA 3U0TB 1NCDL 1A6AB 1DQQB 2LU7A 3I2CL 4X8JB 1QA9B 5DFTA 1F3DH 3SGEH 4UNVA 1QFWH 3T0XA 1EJ6A 5GJSH 2E7MA 5E1AB 3S37H 4E5XA 3QWOB 1JK8B 4GQ9L 4QRPD 1LO2L 1HCVA 2VDQL 2FX7L 5E08H 4ELMF 4WI6A 4RMSA 3DWTA 1HI6A 5D96B 4GSDL 3QH3B 5EH1A 2DS4A 4PGDA 5B3NA 1INDL 1NSNH 5I8KH 1XIWC 1G7LA 2IANA 5IMOB 3C5ZA 4IOIB 1OTUC 5KSUA 3ULSB 4FQIL 5IROA 5MI0B 4NRXB 2Q87A 3U7AA 2OTUB 2X4NB 4U0QB 4CMMA 1GSMA 4JRXA 2R2HA 5EOCL 3VXOB 4UUJA 1YEHH 2EYRA 4GMSH 3TT1H 4X6FB 4S0SD 5FV1L 2UZIH 3SN6N 5C70A 4JFFB 1SMOA 2A6KB 5DMGC 4X9FA 4YWGH 2BY1A 1RIUH 3QUML 3O3BB 2Q3AA 3I3EA 5DRXA 3UBXI 3NPZB 3ZT5A 1KGCE 2R56H 2HN7A 5GRZA 3TFKD 4LQFH 3ZYJA 3SPVA 2HLAA 3C5ZC 3PP4L 1MWAB 3WNPA 3VI3E 3M17A 5IROC 5SWZB 1OAYL 1SEQH 5FUCE 3QRFM 1C5CL 3HE7D 4XNQB 1NFDA 5CCKL 2VLJA 3IFOB 1LHZA 1U8NB 2NX5A 2CDFB 3QDGD 5C0RL 4YHZH 1KF9B 2GQHA 2DIAA 5KVFH 3ZE1F 2VDKH 5F93C 1KT2B 1RFDH 3QIBC 5AZEL 3W9DA 3EZ8A 4X6DB 4JQXA 2A9NH 2R0ZL 5HPMA 1R3LA 3JTTA 2NY7H 3Q2CA 1KN2L 1R3KA 2ZUWA 1FC1A 5DJYB 1GGIH 1AO7B 4MA3A 1MCLA 3AXLB 3VXQB 1HWGB 3AS0A 5TH2A 3T2NH 4EI5B 1WCBA 4JHAH 5E99L 5EIQA 3T1FB 5IT2L 3NCCB 4LSDA 2XZAL 4HS3B 5KW9H 4NQXA 1JRHL 5I1EL 3SDYH 5E8NA 2XTJB 1KG0B 5H2BA 2OP4H 3MLUL 3FMGL 1AGBA 4RAUB 3DX8A 4NT6A 5C07A 1A1MB 3OJDA 3HI5L 4R2GB 1SVZA 5B39B 1TPXC 1HXYA 2YPVH 4H20L 2YD6A 1ZXQA 1FFNB 2XZCH 3ARPA 4D0BA 5IK3A 1BWMA 3OXSB 2O5YL 2PYEE 1CCZA 1TTUA 2CLZA 3IJYA 2I07B 3E6HA 4ALAH 1R5IB 1N64L 2NMSA 5L8JB 2XYCA 4RGOL 3RVUC 5T1KD 1F90L 4ELME 3F6IA 1NDGA 4RFOH 4HF5L 4YBQC 1RUML 4OV5A 3OAUL 4CMHB 1E4XI 5EWIH 3RZCA 4OCNC 4HUMB 2P5EA 4ENED 1UCBL 1CYGA 1V8HA 4PJXF 3BEWB 5GS1A 3DTXA 3EYUL 4GAJH 3RVXC 5CBAA 3PGCA 4N0FB 3MRIA 4HUKB 1UADC 4PIRF 4HD9A 2YA0A 4LNRB 3AAZB 3LQZA 1MQ8A 4F7TA 4PJBF 4JZOB 2VDOL 2JIXD 3HN3A 3WS6C 1JF5A 1MHPL 3H9SE 4I3SL 1YN7B 4HMEA 1HNGA 3VGFA 2YD5A 1RJLB 1G7JB 3GBLA 3RZCC 1L7IL 4KK9D 4V1DD 5A2IH 1JFQH 3MZGB 1ZGLB 2DQEL 2YC1B 5F96L 3UTPE 1KCSL 2XA3A 5GS1C 5I18L 4ODWA 1EMTH 3WIHL 2AJYH 3GUTB 1BM3H 2NXYC 1HHGB 3VFUA 4P57A 5HVHB 1D9KD 5EUOA 1KTLB 3QEQB 1U2CA 5HHPB 3RGHA 1TFHA 3LKQA 4PJ7F 4U2YA 3MODL 5D7LA 3BH8B 1JWUA 4QRUB 2XZZA 4U3XA 2AAVA 5FOBA 3ZE1E 2EH7H 2VZSA 1N4XL 3CC5B 3VWKA 1S7XA 4M7JL 3WKML 3NIGF 2FD6L 3X3GH 2DMCA 3VU2A 5IP4A 1JMXA 5BOPA 4ETQA 1C7SA 5T5FH 3EOYG 5KS9E 2Z35B 3RWHB 3RIAK 4IEFB 4UIMB 2OL3H 1UXSA 4XGZB 5I1GL 5FYLE 3LS4L 2YZ1A 1RK0A 3UCRA 1IAKB 2F9BT 5EO9A 5FKAB 3SOBL 2HFFB 3RGVB 4BH8A 4L1DA 2X1PA 5L8KB 1HDMA 3VWKC 5C0BA 2C4FT 4KFZC 2RBLA 3O6FC 5HHVL 2YS4A 2EE9A 4Q9QL 2P8LA 3OZ9L 5MEQA 4Y0GA 2AEQH 5ID1A 1XF5B 4JKLA 3SE9H 4MA8H 4S2SB 4L9LA 4Q0XH 3BPOB 1T5XA 1T22A 4PLKD 3V8CA 1FNSH 5K9JL 4JY4B 3D3VA 4ERSH 4MWFB 1ZHLA 2QLVB 2GK0B 3UYRL 2WWKT 5A2LH 5H8DA 1KJVA 3G5VA 4U0RB 4HWEH 4AT6B 3P30H 5FECA 5AAMA 1QD0A 1T0MB 1EV2E 1NANH 4PJXE 2UY6A 1KLGB 2VH5H 2AS5M 2VZUA 5BRZD 1K4CA 1JYXA 5IVXF 4OIIH 3TBSA 4NGHH 3FCTB 4DZBA 4OM0L 4K3DL 5EU6B 2VZTA 3IF1B 2NY6D 4WNQA 5ACZB 3K4ZA 3HZMB 4L9LC 1U8HB 3K2UH 2ORBH 1WBZA 2CXGA 2QQLH 1XGRB 3MACH 5L2KE 3AMKA 4Y5YB 5E0QA 4CBPA 1NCBL 5BV7C 1NGPL 3QHTC 1FFRA 2EECA 4YHNB 3PF2A 5FYJH 3J7HA 1UB6A 2UUDH 4LHUD 4PRPD 1CGVA 3D2UA 1RZ7L 3NABH 1K6QH 3B4NA 1H3PH 2HJKB 3DUSA 5D71H 1FGNH 2OJEA 3OV6A 4Y89A 1ZLSL 5F44A 3ROOA 5L9DH 3FB7B 2IBZX 3OKEA 3QEHA 4WW1A 2X4SB 5C0JB 3RNKA 2QSQA 3OKYA 1ZHKB 4PJ7E 3DHJA 2OLDA 5IB5A 4HC1A 3VCLA 3BHBA 3SJVB 4Z7OF 2A0LC 3B9AA 2F53D 4RAHA 1TQBB 4XVJH 4ZPVA 2VDLH 4OUOA 4POYA 2FWOB 4L4VA 1BIIB 4X7FC 5EPMA 3V5HA 1MFCH 3NIGE 2APFA 3UDWA 4TPRH 1BFVL 2R0LL 3B6SB 3V52L 1FFOB 1CLYL 5DQDL 5T33L 1YYML 1WZ1L 3EW3B 4PRDA 3MNVA 1A9EB 3EOTH 1DEDA 3HG1A 2HTLC 2GTZB 3QXUA 1U8JB 3NMEA 5CINL 3IU4L 3IDNA 1NAMB 4MAYA 2M26A 4BSJA 1E4JA 1CDUA 1ZWIA 3HC0A 4X7SH 3MBED 1FO0A 3VXSD 5I16B 2CLRB 3HTLX 3GIVB 3VXRD 4K7PY 3Q6FA 4XHQA 5F71A 2DM4A 4UINH 3UDWC 1XF4A 1QYGH 1S5IL 1CXHA 4HK3N 1S5HA 5EZOL 5A2FA 3K46A 3ARBB 1BVKB 2V7HA 1L4IA 3MLVH 1NGYA 2ADGB 4X4XB 5IQ7L 1I8KA 2X7LB 4HG4J 2FO4B 4ZSOE 43CAB 3MLXL 4MAYC 2HLFC 5DTFB 4U6YA 2WM0A 3ARTA 5DJZA 1MHCA 4D9LL 5IVXE 1ZVSA 4X6EA 4MX7B 1MFDL 1OAUH 2JK5A 1SEBB 5DUPH 4GT7A 4MZ2A 4PV9B 3BOVA 1G6RH 4RA0C 3G08B 4Q6IA 4OCRH 4ZS6C 3VGAC 4NOBA 2X4PA 3ZKND 3K1DA 3L5XH 1H5BA 2R1XB 4UNUA 1YYLL 3IFLH 2YEZA 2AK1L 1XGPB 3O6KL 1BBDL 2I26N 5SV3A 1H8SA 5C6TL 1N0XL 5CLWA 4IRJD 1ZVHA 4HUNB 4PJAB 5IF0A 3MRLB 3TIEA 4JY5L 1XCTB 4GXVL 5EU4A 3BPNC 4D9QE 2D31A 4BZ1H 2QHRL 1FE8L 5C0GA 3P0VL 1MAMH 1TJGL 4FTVE 5HYJD 4X9GA 1V7NL 3IDJB 5FGSA 2ZOLA 4Q6IC 3KDMB 4DQOH 3G5ZB 2DJSA 1HOCA 2G75B 5MHSE 1H5BC 4BKLB 1U91B 4GUPB 3FO1A 3U46A 1JWMB 4Z7OE 3P77A 4XPAH 5ITBL 4XBEH 2X10A 3OKOA 4XBPB 2BNQD 4X7EC 1NKOA 3L3JA 5FGRA 5IESL 4YHOL 2FJHA 4MJIE 5T1LD 2RIKA 4XI5D 1G9MC 5H37G 3TJHD 4M6ML 1I1YA 3ZDZF 4XPHL 4M61B 3U30B 2CGRL 1GC1L 1A2YB 2IBZY 3CZFA 2DQGH 1NC4B 2EZ0D 1RVFH 5LGHH 5GXBB 2XN9D 2FEEI 4P2QE 4URTB 1MIMH 3U0WL 4KTEH 4H8WL 4PUBH 5GZOC 4OV6F 4PJ5A 4KROC 4QY8B 4F58L 2BXZA 2VXQL 4JANB 4WCYL 2JCCA 1IZKA 3GSUB 4N0CD 5CSGA 2HA1A 1WTLA 2AXJA 1UENA 1KPUA 3VWJB 5C9JB 4I0PD 1IAOA 3I84A 4JGMA 1W72A 2DJ4A 5ESVB 2E6QA 3LAFA 3JV6B 5FUOL 2YPLE 3Q6GH 5DK2B 1D7FA 4OI8A 2AKRA 4QHNB 2J8UF 5EOTA 4NN5C 1ZHBA 4K9EC 2Z4QB 3OBAA 3S36H 3FONA 3RU8L 5CSBA 4K8RD 2Z31A 1ZANH 1T1XA 4X9IA 5HGHB 5DFWH 1X4XA 1QHOA 3KPRB 5BV7H 4QOKE 1K8DB 1I7ZA 4FRWA 4NPYB 1BQLH 4OLXH 1NBVL 4POZC 4XCYB 1DEEB 1U93B 15C8H 5DLML 2GAZA 4OLZH 2LTQB 4WGWB 1B9ZA 5AEAA 2R1WA 3GZKA 5JDSA 1HE7A 4GG6F 4JFEA 1IEAA 2NPLX 4N1HB 1QRNA 2YUXA 4DTGH 1GOGA 2Z31C 4G80B 2Z9TA 3VXUA 5LXGH 5AG9A 3LV3B 3T2PA 2DTMH 1CXIA 1D3CA 3EYQC 4QYOA 4XNZB 4GXUM 3O3AB 1MLBB 1YEGH 1NGZA 1JZ8A 2EH8L 5JLZA 2O5XL 4ZS7H 1J1PL 2NTFB 2A73B 3QUZA 1I8MA 3V5KA 3HAEG 1CT8B 5ID0A 2JB5H 1RZJC 3F12A 4JFZH 1IGCL 1CVSC 3CCHA 3TPUA 1VA9A 3ULUC 2H26A 3PWVA 5F7WC 3N1MC 3LEVH 1N8ZA 5E5MB 5KANG 4MVBC 3BWAB 4X4ZA 1FGVH 2C3XA 5D93C 1U3HA 1P1ZA 3QNXA 2QEJA 5DEGA 3ZDZE 2ZSWB 3OQ3B 1E6OH 5FM5M 3GI8H 2E9WA 1RAMA 1LK2A 4U1HB 2ZUTA 1MCOH 1W0WB 4AEHH 4MB5A 4FXKB 1I9RH 3QUZC 4I0KA 2X5PA 4LKXB 1U8IA 3ARDA 3FB6A 4KKNA 2PYEB 3Q48A 2PXYB 3MRCA 5BVJB 1VKXB 3ILPA 3U7WH 2F19H 2NY1D 4WJ5B 3QPQC 1CGWA 3QA3B 3WBDA 5C09D 4DKFH 1FIGH 1ZS8B 4ELMB 3WDIA 2BVOB 3BI9X 3RY4A 4D9RD 4EOWL 4P48A 4G9DB 3CMOL 4M6NL 1FLTX 1U3HC 3MJ8B 5A1AA 2AJXL 1FO0H 4HKBA 3HC3L 5CEYA 3OF6A 3PWUA 4G8IB 2QSCL 2PYFB 1JPGB 2ZOKA 4P9HC 5DVKA 4AENB 1XT5A 3V0WL 2V2XB 2J8UE 3ARDC 5IVNA 1ZT1B 1KEML 4RGND 5C08E 3F6LA 4M43L 3S34L 1FZOA 3VRLF 1S9WB 1M4KA 1XF3A 4CRPA 2AV1A 3PWNA 5EC2A 5LGJA 2E9IA 3GMPA 5EBGA 3CLFL 3WFEL 4PJDF 4KI5F 1A7NL 2HT3C 5DR5H 3MNWB 3CFEB 4NKMA 4PRNB 1LO5A 3R0MA 3IDMA 5BOZG 3T0EE 1S3KL 5B4MD 4QTIH 4XXDB 2HRPH 3KPSE 3PWPD 2RR3A 3EFDL 2EDFA 1OTSD 4JEGB 5GRJL 1AFVL 1S7TB 1QFUL 2XRAL 5GS0D 4QXGL 3BDXA 1CGUA 3T65A 1K8IB 2DQHL 4NQSB 5KJRL 1OY3B 1LP9E 1G9MH 4P59L 5DA4A 4WEMB 4E9LA 5FK9B 3VA6A 4G8FA 4OKVB 3BISA 2E27H 5DC0A 3KLHC 1HXMA 5F9WB 4OF5A 1C08A 3UYPA 5ABDE 2W9LA 3O2VL 4BSVB 4X4YB 4HULB 3QIWB 3FQWA 4LKCA 5KSVB 5TDPA 5KS9B 1J8HB 1T04B 1DQJA 4NP4L 3GHEH 1FORH 2JKXA 3LPFA 4OLYL 1CQKA 2GITB 2CKBH 3PHQB 5AZ2H 5JXAH 3QDHA 4NN6C 4RX4D 2P5WD 2NXZB 1KXQE 4JM2F 3VFTA 1AGDB 1A0QL 1T20A 4RDQF 2I27N 5EOQH 1M05B 2OZ4L 3HLAA 5I1IH 1OGAB 3E6FB 4JCMA 5D7JB 4R7DB 3TCXA 4GAGH 4FFZL 5IW1A 3KPPB 3TZVA 4NO0B 4BH7A 3L3KA 4P3WA 4K9EH 2HYMA 2NZ9D 4HZLB 4WO4A 1HHKA 1B90A 2PR4L 3GBML 5D8JL 4ODHH 1DL7L 4LCWE 4AG4L 1XFPA 4LVEA 5ISZE 1RU9H 2VSDA 4UBDC 3IDIA 2R2BB 3BP5A 2BJML 1BAFH 4UT9L 4KKCD 3ARGD 5ETUA 4JG0L 4J3TA 4JFYB 3KXFD 1W72H 3FOMA 3LSOB 4XTRC 3X11B 2ESVA 2WBJD 1N6QL 3CIQA 4GLRI 4NIKB 1A6WL 1F42A 4IRZH 3VRLE 3TZVC 4JHWH 4X9BA 4WV1A 4Y19E 3CVHB 4PGBA 5IWLC 4S10A 2V2TB 2ITDB 2IPUK 2P45B 3L3DB 1W0VA 4WO4C 2ID5A 12E8L 4FQLH 3QIUD 4Z7UF 4Q2ZA 1DQLL 4M4RA 1H8NA 2A77L 4Z7WE 4RBPH 2MHAB 3ORJA 3ZKXC 1IAMA 4R0LA 2XNAB 2PW2A 4PJDE 4KI5E 4ONFH 4LOUC 5J57B 4FQCH 1I1FB 5EA0L 3SGKA 2X4RB 4JREB 2R15A 3B9VA 1MCSA 3JWDL 4JKPH 1S78C 3BDYL 1RZJH 5JHDD 5IBUG 4MXVF 3GMNA 3QNYB 4PJ7B 4KPHL 3S5LB 4WV1C 1KPRB 3B9KD 3NFPB 3R8BB 4W70A 2W91A 3BSZL 1II4E 4ZUVB 4Y4FA 1KJ2B 4TSBH 4U6XA 5AYUL 5C9KA 2ZCKH 3WUWA 1FV1B 3FN3A 3D18A 4OF7A 1RHHA 4R0LC 3PDOB 5AUMA 4OGZA 1BF8A 4XWOD 2N7AA 3C6LD 4LFHG 3SGKC 4UIKL 1DP0A 3AFLA 3N1QC 5DI8A 3E2HB 4Z6AT 3KNBA 1T4KA 2FYYA 1CG9B 2DQCH 4QHKI 2R2EB 2VLRB 1NUDA 5ICXB 2MMXA 5F7KC 4PGCA 2Q6WB 1MCDA 1X9QA 5HHME 3WNOA 1AR2A 5CZVL 3O0RH 5D1QD 4YHLL 4Y4FC 3FAXA 3W11D 1IFHL 3C60B 3PGFL 1P2CB 2V9TA 5HGDA 1G7HB 3RIAF 4MNQE 1X6NA 1IT9H 1FPTL 2B0SH 5GS3A 2B5IC 3MRFB 1MHEA 4X5WB 2OI9C 4FA8A 4I9WD 3DVNA 2BVEA 3MO1A 1D5MA 3C87A 4M6OL 4PJ9D 2DD8H 4QXTA 5H94A 4ZSOB 1HINH 4JO4H 4GFTB 1I7TA 1P7KA 1UC6A 5HHNA 5ICYA 1A8JH 4MS8D 5E2TL 1NUFA 3UJIH 4PRIA 4XBGA 1KCUH 5TE7L 3LEYH 4PJ8A 1OSPH 5IVXB 4ODVH 7FABH 1QSEA 1ZA3A 2Y7QB 3N9GL 4Y1AE 2IQAB 5T3ZD 3DJ9A 1QSZA 1QLRB 5TE4L 4JPKL 2NY0B 5EO1B 4HJGB 2HG5A 4TUKH 5EULV 5C1MB 1FZMB 1QNZH 2C3VA 4WWKB 3U1SL 4RWYL 3OL2A 3BZ4B 3CFKB 1CFBA 3HPJB 1QLEL 1CFNB 3OAYK 3H3PH 4QTHB 4Z7UE 1IE5A 5M7QA 4XP5L 3V4VH 4OLUH 3SDCB 4K2UL 2B2XL 1JBJA 1PFCA 1L9MA 1B0RB 3WIFB 3RPIA 5F3BB 4PJ8C 1F4XH 4Y4KA 3ULVD 4FTVB 5HDOA 4P4KA 4I3RH 2QQKH 3L3GB 4P9MH 1C16B 5FGCE 3QDMA 3UC0H 5DRZB 4MXVE 1NGXB 4P5TB 4NYLB 5L2JB 3SDAD 1BVLB 1FCGA 1NCNA 4OD3L 4WUUE 3U4EA 4LAJH 1VDGA 3EDDA 3MTRA 4J2XA 4JFPB 5J6GA 1P5UA 2VDRL 3NFSL 1EERB 4EVNA 4MJIB 2FJFA 4HMDA 4OGAC 1CL7H 2IH3A 5JA8B 3DPBA 4GKOA 1WWBX 2ED9A 3LKSB 3TA3A 1DTUA 4WHYG 1MRFL 5MP6L 4UT6L 4Y4KC 3MRQB 1CLOH 2HT4C 2V17L 3HE6A 4J12A 3MA9L 2W9EL 4HWBA 4P4KC 1FVCB 1PQZB 4QXWA 4P2QB 4NNPH 1PYWB 5GRXG 3PL6B 5C8JB 1JGLL 1UM6L 2VC2H 3QJHA 5AD0B 2ARWA 4NM4H 1G1CA 2CO7B 1G9NL 3O3DA 4X7CC 4YUEL 1JVKA 1BD2A 3C5SA 5J8OA 4JRXE 1XZ0A 3ILQD 1QSFA 2OSLB 1FHGA 3MBXH 3QUYA 4KK6D 4NO2B 4XPBH 5IHBA 1KIPA 3HCVB 4ZOCA 3H9HB 5IKCA 4RISL 4WTWA 1A4KB 4DUWA 5JZ7C 1SY6L 3TA3C 3ABZA 2W0PA 2MOVA 2BRRL 2FJGA 3HE6C 3MCLL 5BVPL 2VQUA 1K9TA 1U95B 2YPLB 1Y0LA 1BLNB 2R0WL 1BZ9B 5EC1B 1EUTA 2XG4A 3RUGA 1CXLA 1MAJA 5ALBH 5FIEA 5BMFL 1G0YR 1T2QL 1FNEB 4H0IA 1Z9SA 4QOKB 5SWZD 3TNNB 2NX5E 3SKMA 3QUYC 3NZHH 4QRSA 1MFAL 4M7ZB 5SWSA 5GHWL 3TF7C 5IFJA 3MOAL 5D7IB 3MFGB 5D2NE 5DHYA 1F4YH 1JL8A 4LPUA 2X42A 3HMWH 1A6UH 4IIQB 3RL2A 1I3RB 3L95B 3ARFB 5EBMB 4N8VA 1AO7D 1LEGB 2K7QA 1I9EA 2DWDA 4X99B 3LN5A 3OKMA 4GQ9H 4EI5D 1LO2H 3MFFA 2VDQH 2FX7H 2ZUSA 3SE4A 4HUXA 1XGTA 1HH6B 1WIOA 2ZUXA 1R3HB 4HG4K 4NKOB 3NOIA 3E1F1 4YHIA 4LP4A 5A40E 2A6IA 4X5XB 2V5RA 5FDYA 3VFMB 3HAEB 5C07E 1INDH 4MJ5B 4KJYB 4G6AD 1AXIB 2HVJB 5DQJB 2VWEE 4R2GD 1ZLUH 3O81A 1NFIB 5F9AC 1LE5A 3O4LA 4RZCB 5T3XD 3FQRA 1EXUA 1D6EB 3BO8B 3IXTA 5DYOA 4XCNA 1HHIB 2DL9A 1DE4A 4ACPA 3AB0C 3N50A 2EC9T 3GJFK 1X7QB 4E0RB 4P4RB 3QUMH 4YLQT 1M71A 4LRNL 4OUUA 5HI5C 2P5EE 2VLKE 2Z93A 2Z92A 4DGIL 4JFOB 3LEXB 1G7IB 3RY6C 4J3XA 4F7PA 3PP4H 1MIEL 4KJPD 5DMKA 5JR1L 1G0DA 1UZ8A 2C1PB 4NWTL 2IADA 1CFVL 4PGZA 4Z5RA 5E2JA 3MA7B 4X4MA 2HMID 4BFEA 1OAYH 3MV8E 1YY8A 4J6RL 1MFNA 1IGJB 5C6PB 5CCKH 2XWJA 1IAII 3T0VA 4EJ1C 5C0RH 2CDGB 2BSRA 5FHAL 4BJLA 4GRLB 1DN0A 1TTFA 5LCVL 2XKNB 5IJVB 3CXDL 1CFQB 5F97E 4ZAKB 1HCFX 1ERNA 5BZWA 1KN2H 1KELL 2R2CA 2CRZA 4F7CB 4ZODA 5EORL 2J8UB 3WFHB 4AH2B 5C0CD 2ADFL 3T2QA 3ZT6A 2PKDA 2X4UB 4ORGA 4DCQB 3MRPB 4OM1L 5E99H 5I76B 5IT2H 2XZAH 1MI5B 3MGTB 3JBG7 1JRHH 2J2ZA 4MXQD 2EYSB 5EUOE 4A6YL 1ORSA 4EN3B 5I1EH 5C0DB 2ED8A 4GG8A 1KSRA 3QEQD 1Q0XL 4DKEL 4DW2H 4HHAB 3DMMB 3FMGH 4HW6A 4NRZA 1UCTA 3HI5H 4WHCA 3ME0A 5DEZA 3VMNA 4XHJD 1MVFA 3EJZC 2C4XA 1EFXB 3DLQR 2DYPA 3T0EB 3U83A 2O5YH 3UTTA 4YFLI 2DLIA 3KPSB 3OG4B 4KI1A 2LAAA 1N64H 2DM7A 1JI1A 1FL6B 1NGWB 4RGOH 1F90H 3O9WA 3ROLA 1JZ7A 4HF5H 1RUMH 3OAUH 3G6DL 4J3OC 3MMEB 1LP9B 3UAJD 3I02A 4QHUA 4L3ED 1FIEA 1M7XA 1UCBH 2DTSA 1M6OB 3EYUH 1FL5B 3RGVD 4O2EB 3PIQB 1EEYA 1G6VK 5CS7A 4KKLC 3PP3H 3CFJA 1P84J 1N7MH 1R3JA 4LLWB 2VDOH 3CVIL 4JKMA 4NCDA 1VGKB 4NNYA 1MJ8L 1MHPH 4I3SH 3D3VE 2G9HA 3PWJA 2MCG1 3L7FB 1P6AB 3O9WC 5IVOA 1CF8L 4X9HA 1WITA 2BNUA 2AXGA 1DUYA 1UT9A 2R9HC 1U58B 3IB4A 1A6ZA 1TZHB 5HDQL 3F5WB 2DQEH 4TQEL 2FB4H 3KYNB 4N0UE 1KCSH 1ZVYA 4QRPA 5I18H 2Q8BH 4FMFA 4Q7DA 3WIHH 1EX0A 2BZDA 1T7ZA 1JGEA 4YNYA 5HI4C 4TTDC 1U8OB 3GKWL 3HZVB 1MAKA 5CIPH 3OKKA 4YFDB 1GOHA 3OG6B 3C9NA 5EU6D 3QZWA 3BGAA 5E6ZA 4EI6A 3MODH 3TH3T 1VFBB 4MQTB 4ODTL 5J7CC 5ISZB 2EDHA 1N4XH 4H5SB 2GUOB 2HFGL 4HX1B 4NHUA 1F3JA 1T03L 4M7JH 4PJGB 3WKMH 2I25N 4LLMA 2FD6H 3O45A 3JSSA 1DDHB 2HVKB 2BSSB 1K3IA 5TF0A 3MLWL 2J88L 5DHVB 4P46B 3KYKL 4R4BB 1I3GL 4KUZL 4FQHB 4Q97A 1FNHA 1QBBA 4Y19B 3TIDA 4DKAA 1ZHNB 4QRRA 1U8QA 1Q9KA 1RZKL 3SOBH 4K55A 2E8ZA 2W1NA 4N8CL 4BFBD 4Z7WB 1CDBA 3SJVD 3QFJB 1KXTB 5KANI 4DN4L 1MF2L 2P8PB 4UDUB 1HZHL 4ZDHA 5HHVH 4Q9QH 3I6LE 2VXSL 3MV7B 4HUVB 1CZ8L 1OAKL 5J6HA 1JPFA 2DKUA 3K3QA 4L8DA 5ALCL 1UM4L 3FT2A 5IBUB 4RMVA 4P5MB 2XXMB 1T7XA 1MPAL 3VXMB 4DK6A 3QBTB 4F9LA 4QHLB 5K9JH 4FFVD 1PEZA 2YD8A 1LO0L 3QULA 3TFKC 3UYRH 1R5WA 3ZYIA 3WIIL 3DURA 2OR9H 1FAIH 4PREB 5E8PB 1K2DA 5IBLD 3T2OA 1T21B 3W9EB 3HE7C 4QNPF 1CS6A 2EDTA 4F8QA 3RJQB 4HEPG 4OF6A 1J0ZA 3S98A 2H32H 4OM0H 4K3DH 3NCJH 4NHCL 2GJZB 5IMKA 2HAZA 4ZFFA 3HB3D 3KPQB 4GW1B 4M9PA 2O61B 3L1OL 5GRUL 4G8GE 1JF1A 1W8NA 4F9LC 2NQCA 3V0VB 5F6IB 2WWMC 1SYSA 3ARBD 3MUJA 4J3WA 3LVEA 1TJIL 1NCBH 1NGPH 3L3HA 4DOHE 4RAVB 5T3ZL 4U49A 1RZ7H 2W59A 2GCYB 4JM2B 4G8EB 3V79C 3ALPA 4MNQB 1J05B 3VH8B 3QCUL 4U6HB 2X2YA 5T1KA 1F2XK 1RUQL 2WIIB 3RWIB 1ZLSH 3VGBA 1QP1A 4WI7A 3GRWL 3Q3GA 1MSPA 5FO7B 1C12A 1G7MA 1QR1A 3VFSB 43C9B 2BNRA 2DWEB 3VE0B 5E00A 2QSVA 3ULVL 3PE9A 1FN4A 1RZGA 1YEIL 5F9JB 5I8CA 3SGEI 1J0JA 1QFWI 3TBTB 4KKAD 4UTBH 3VFWA 2R0LH 5EU5A 3V52H 1ZEAL 4ZTPL 3PQYE 4Y1AB 4NCC1 4ZFZA 1CLYH 5DQDH 5ITFB 5T33H 1YYMH 3LQAL 4V1DA 3RX5A 5I8OL 1E27B 3H6JA 4ENEC 2AJSL 5IUSA 2V2WB 3F7YA 3TLRA 4MDIA 2VZVA 4JHBA 5CINH 1YUHA 4M1GH 1A4JB 5GQBA 1U41A 1GZQA 5IMLB 2BVUA 2CIIA 4Z7UB 3GI9H 2DLFL 3P9MB 4YDKL 1I7UA 1KNOA 5SX4H 5FV2A 5DVNA 4DZ8A 4XPFL 4NC2B 5I66B 5FFLA 3S3SA 5ICZA 2UYLA 1S5IH 3PXJA 1UWEL 1XIWB 1MRDL 3FQUB 5FGCB 1KCVL 5J1AA 3I6KB 1HILB 3UZQA 3CDGB 1CBVH 4KK9C 4RSVA 1IGYB 4HIXH 5IMMB 5IQ7H 4WUUB 1NC4D 5EZJA 1J12A 4UV7L 2ICES 1CD8A 1GPOL 3MLXH 3NZ8B 2JCCE 1FFQA 5HHXL 2LAGB 4P2YA 3REVA 4D9LH 3RBSA 1CWVA 5BXFA 4QNPE 1MWAL 4PGDB 3L9RA 5HGBA 1L7TL 4NZDA 1MFDH 2XFXA 4HV8A 5HVWA 3VWJD 1AIFA 2AJUL 1CDJA 1G7LB 4N5ED 4NQTA 3C5ZB 2FHFA 5KSUB 4HIJB 5CGMA 1ETZB 1CN4A 1YYLH 2AK1H 4MA1B 2P24A 3SDDD 3SKJH 1QPXA 3O6KH 1BBDH 4CMMB 4JRXB 4M48L 5CJBA 4UUJB 2EYRB 1KJMA 1N0XH 1X5KA 3M1BB 3L3OB 2DM3A 4P23D 4NM8L 4MJ6A 1LNUA 1R5VB 4FQQA 4GXVH 1JP5A 3OKDA 4KQ4L 2QHRH 1BJMA 1FE8H 3P0VH 5DRXB 1TJGH 2CRMA 2FX9L 3QUKA 1PDKA 3B5HA 5IG7B 1KGCD 2OMNA 2HLAB 1EEUA 1EDQA 1KOAA 3M17B 1MFBL 2NW2A 4JFEE 5GJTL 1GZPA 4U1SA 4OZIA 1C5BH 1VFMA 3EDFA 3EO1B 4W6YB 5JOPE 1KB5A 1I9JL 4PP1D 5IESH 2IJ0C 1UH4A 2NX5B 1EVUA 3O6MH 4BUGA 4PLKC 4M6MH 3MUZ1 3BKML 2VITA 4I13B 1VCAA 2EXWD 5DJDA 2VL5A 4XPHH 5D2NB 3G9VA 2CGRH 3FB8A 1GC1H 2OZ4A 3W9DB 3LB6D 4L8CA 5HPMB 5IIEA 1VERA 1WWWX 1TPXB 3TBWB 1PKQA 4PRPA 5D7SL 2LQRA 2LVEA 1QFOA 5DS8A 1UG9A 5GGUB 3U0WH 4JZNA 4XP6L 4OLEA 5MERA 4H8WH 1WCBB 4S1QL 4KQ3L 4Z7VF 4F58H 5DURB 2VXQH 3FO0L 4WCYH 5E2WL 3T0AA 1I1AA 1QBML 4NQXB 3FO9A 1BGXL 2NY6C 5E8NB 3EO0B 1JTOA 2Z8SA 5H2BB 3CFCL 3C5JA 3FQNA 4N9GB 2AQ1A 4JKKA 1AGBB 1AI1L 3L5IA 3DX8B 4NT6B 4PJHA 5C07B 3OJDB 1NDMA 4JQIL 1LQSR 4UV4L 1HXYB 3HKFA 1UQSA 5FUOH 4HGWA 1NUGA 4OZ4A 4IDLA 2AJ3B 5IHZA 2X4TA 3UPCA 4S1DD 3IJYB 1XF1A 2YN3A 3RU8H 3ZMRA 3E6HB 4PRHE 2GK2A 2PYED 5LBSL 2PXYD 4QCIB 1UJ3A 4GRMA 3WJLA 1I1AC 1VFAA 4K7FB 2N7BA 2DJUA 3OX8A 4CVWA 3U6RA 3CD4A 5JPNA 1NMCC 3DX6A 2P5EB 2VLKB 5DLMH 3IDYB 1Q8MA 5CBAB 3MBEA 3PGCB 1HIML 2Y07L 2PW1A 1QHPA 4P99A 1I7RA 2OX5A 4MSWA 3VXRA 1T7WA 2NXYB 2BX5A 3LQZB 3QDJE 4F7TB 2ATKA 2WV3A 4PJCA 3MROA 1GIGL 1PAMA 4WGVB 2YPKA 4DVRL 1UJ3C 3KWWA 1XMWA 3WJLC 4OZHF 4DEPC 3H9SD 3IKKA 5KAQF 4OBRA 1QOKA 1FYTA 3BKJL 1CDCA 4KRLB 1DR9A 2EH8H 4JAMB 4FN0A 5DQ9A 4BQBA 4ODWB 1XGUA 3UTPD 3MBEC 4CU6A 3WFBL 4X6CF 1Y18A 2WUCH 4EXKA 1IGCH 4LBEB 5CGTA 1ULVA 3O2DL 3IVKA 1T2JA 1NH6A 1WSST 4KK8D 5I8EA 2DQDL 3VFUB 2BXYA 4NCC2 5GGQL 5GS2D 5D72H 5EUOB 3VFRA 1AGCA 3BP6B 4YXHL 3ZKQD 3LKQB 5DRNA 5KVGL 4H1LA 3FQXB 4KRNA 1JWUB 5FOBB 4YHML 1DBKL 2BRQA 5I1HL 3CAFA 3VWKB 4TUJA 3VDAA 1RZ8A 5GGRY 4FFWD 1KPVA 1G0XA 1NANI 1U92A 1IARB 3INUL 3MRHA 2ZSVA 3EGSA 1CE1L 4G5ZL 1MRCL 1NCWL 3DGGB 3HNSL 1UXSB 3QIWD 1U8KA 5T1MB 4NN7B 4Y5VA 2VR5A 5FAAA 1RK0B 4EOWH 5FYLD 5GGTL 4M8VA 3CMOH 1KACB 3ZKNC 4M6NH 4IMLB 4M7LL 4NZUL 4OI7A 2YD9A 5B38A 1X44A 4L8SA 4R3SA 4KDVA 3HC3H 5F1IB 4MJ4A 3QAZC 5MENA 3LRSA 1CTOA 3CLEH 5C0BB 2QSCH 2BNQA 1YJDL 3T4AB 5FO9A 2NXZD 4MCYA 1ACYL 4M62L 4HIEA 3MJ9L 5T1LA 5MEQB 5HSFA 3RP1A 5ID1B 4JO1L 3V0WH 4CKVX 2EIBA 1NPUA 1KEMH 4CNIB 4M43H 1QO3A 5IFHL 5JW5A 3BP4B 3GHBL 3D3VB 3ZLQC 5EZLA 1ZHLB 2XN9A 1VEPA 2D4DA 4NO0D 4Y5VC 5BS0E 3F8UB 5IVZA 3TGXA 2UVFA 2VQ1A 5HTSA 1KJVB 3G5VB 1C7TA 4H25B 4B7IA 5FECB 4NQVA 1N5YL 5F7MC 1NMAL 4L8SC 2ITCB 4N0UB 5FHBL 5LGKA 4IRSD 3BPCA 3CLFH 3SDXF 4IS6A 2DF3A 2YUZA 1A7NH 1K4CB 3VXTA 4JO3L 4XI5C 1LGVA 1JUFB 4DZBB 3TJHC 5FKPB 1S3KH 3KR3L 5EIIA 4MAUL 3OXRA 4WNQB 2ESVE 4P5KA 2WBWB 1RJZB 3BKCL 1H3TA 3VI4F 3EFDH 3UTOA 4OFVA 5CEZE 1AFVH 4OFPA 1QFUH 2XRAH 2EZ0C 4OZHE 4QXGH 5L2KD 2DQHH 5KJRH 3DI2B 4BZYA 4ZFOA 3RTQB 5K9KB 1CD1A 2AEWA 2I60L 3KYOA 3DUSB 4N0CC 2XXCB 4HDIA 2EE3A 4Z76A 5F21B 3A67H 4O4YL 4X6CE 3WN5B 4H88H 4P2RA 3I75A 1GHFH 2F58L 3T0DA 5I6XC 2YOCA 1EHLL 1NAML 3P4MB 4PJEF 3X13A 2AEPH 3OKEB 4OQTA 4NP4H 5D6CA 1WT5A 4WW1B 1KULA 2R29L 3RNKB 3NTCL 3I85A 5ANMA 4OLYH 4ZUSA 5IB5B 3NH7H 3BX7C 2AXFB 3BHBB 4UQ2B 1SM3L 4NO3A 1RZIA 2RB8A 3OPZL 3DVIA 1F6LL 1UGNA 3W2DL 4XRCA 5FGBA 1T1WB 5HBBA 5EPMB 4K8RC 4ZTOL 3G04B 1YN6B 1CIDA 1YPZA 3BKYL 4KC3B 4NNXB 4HSQA 3KHOA 3V5HB 3ZTNH 3WUWG 3LKNB 2A6JB 2OZ4H 3MRRB 4X7TA 2EDWA 4DUVA 3NA4A 4YIQB 4FFZH 4D0CA 4KXZH 1G9NC 3HG1B 4UB0L 1AGEA 1WT5C 2CRYA 2PR4H 2WP3O 3GBMH 5D8JH 4MAYB 1DL7H 2X09A 1JMZA 4LEXL 4AG4H 4U1LA 1U3YA 3HC0B 1XGYL 2BJMH 1KC5L 3CU1A 1S8DB 5FGBC 3UEZA 2D4FA 3S4SA 3C60D 3Q6FB 4JG0H 2BMKA 4Z18A 5C0FA 3CSYB 1MJUL 2E6PA 4RIRA 4AIOA 1S5HB 1U42A 1N6QH 3IAQA 4QEGA 3VGAB 2V7HB 1A6WH 3IKCB 1X5GA 1YEDA 1S7UA 1F13A 4LP5A 4OQ1A 2YMXL 2V9RA 1UACL 3IETA 3GEWB 5D4QA 5K33A 3SO3B 4DOHB 1GGYA 12E8H 1DQLH 3QXVA 2IH1A 1IL1A 4YO0A 3T0BA 4RMTA 2FHBA 3OMZA 5DJZB 3SDXE 5BJTB 4GW5A 4EZMA 5A3ID 1U8MA 5EA0H 1DQDL 1WICA 1ZVSB 4X6EB 5KVMC 1SJVA 5DO2D 1QSEE 2JK5B 2WANA 4LMQI 5IB4A 5DRWB 5CZXD 1J5OL 1G7PA 1S7VA 3VI4E 4XCCL 4KPHH 4QF1A 2YEZB 1ODAA 4U33A 1V3JA 1P84K 2YA1A 2G60L 3BSZH 3GSNL 5AYUH 3IGAB 4GAYA 2FZ3B 2NY1C 2YWYA 4I8DA 4XX1G 3TIEB 4LSVL 3SDCD 1ORQA 1H9VA 2D31B 2SEBA 1JTPA 2GT9A 3NGBB 4UIKH 4D9QD 2OS7A 3FFDA 4KTDL 1RK1A 4FTVD 3QDME 1H0DA 4UDTA 1UM5L 5LG1A 1HOCB 3WKNA 4M7KL 2WINA 4QWWD 3FO1B 4P5TD 2EDBA 3P77B 1REIA 4YDIL 5CZVH 2DQFA 3WHXB 5MHSD 4YHLH 3U0PB 3E8UH 2PTTB 3L3IB 1J11A 3L3JB 4B5EA 4HXAL 3PWPA 3VFOA 1NCCH 4MJID 1I1YB 1FPTH 1PY9A 3LDBB 4OZFA 2CDEA 3VDBA 3ZE0F 1MHHA 3BN9D 3CFDB 3GIZH 4M6OH 3RZWA 2APWA 3GJFA 4WFEE 1I1RA 4YDLC 1OD9A 4AK1A 1BQHA 4A6YA 1OARL 1I85A 4P2QD 1VFUA 4KWUA 4LVOC 2JCCB 5E2TH 1BD2E 4IDJL 4YAQA 5B4MC 3C8KB 1QSFE 3C8HA 5TE7H 3MRBA 1ZMYA 1KPUB 3MYJA 5I71B 3BZDA 4WW2F 4ZNEA 5GS0C 5MEPA 1IAOB 1FBIL 3N9GH 3GSRB 1ZSDA 2NNAA 3X17A 5KTEH 4JPKH 4RX4A 2P5WA 3LCYA 2IPTL 4F15C 1MCCA 1I8IA 3U1SH 2AKRB 5DD3H 4ISVA 2YPLD 5EOTB 1I85C 1Q9WB 1ZHBB 4AM0A 4L29A 4R7NB 4FNLL 3FONB 1QLEH 4XZUA 2EYTA 2Z31B 3GO1L 4JFXB 1T1XB 5E7FA 4XP5H 1TNNA 2R4SL 2B2XH 4K2UH 3RWCA 5I2IB 3DUUB 1I7ZB 1V05A 2ATPB 1B3JA 4QOKD 5SWSE 3FTGA 4I2XA 5CBEA 4LLVB 5E1HB 1KB9J 3G5XA 1WJ3A 1B88A 3LY6A 4PY8I 3VXNB 2GAZB 4LF3A 3WS3A 2YR3A 3MRNA 4F57L 4OD3H 3D6GA 3IDUA 3X3FL 5JDSB 4R26L 5ELIA 4JFEB 1IEAB 1RUPL 2VXTL 3WSQH 3CXHJ 3GM8A 3NAAL 1QRNB 3VDCA 2GTWA 3ARFD 1RURL 2VNCA 4OF3A 1QQDA 4MNHA 1H3XA 3UMTA 5I1AA 4N8VG 2YSSB 1OLLA 2NTSP 5EBWA 4WI4A 4B50A 2ZNXA 2FIKA 4ONHB 2NR6D 3PABB 4I4WA 1QEWA 3DVGA 4QGYA 2Q8AL 4D0DA 5HGAA 3P11L 2NZ9C 4QYOB 1MRFH 4X7DC 5MP6H 4UT6H 2UV3A 4K8RH 2V17H 5I75C 4M4PA 1INEL 3QIUA 3MA9H 4PR5B 3TEUA 4CL7A 5JLZB 2W9EH 5L88L 1NC2B 2Y1VA 3WE6B 1I8MB 3V5KB 4OFKA 1JGLH 1UM6H 4NKIL 3EYSL 4KKCC 3TPUB 3UPAA 1XH3A 1Q9OA 3MOBL 1G9NH 3O4LE 4OQTH 4YUEH 2H26B 1DSFL 3PWVB 2X9XA 5DK3A 1N8ZB 4O51B 3BZEA 3NCMA 4GS7B 5DWUL 2JJUA 3I9GH 5JHDA 1ONQA 2ZCLL 3EFFA 4PTTB 2WMPA 1P1ZB 5E94A 4U6TA 5DEGB 1SY6H 5I73C 1RJYA 2AEIT 1JHKL 2BRRH 5I1DA 1I75A 3ZE0E 3MCLH 1LK2B 3QIUC 5BVPH 1NEUA 5C0EA 2R0WH 3B8SA 1XF2A 4LAQL 1CTNA 1FH5L 1U8IB 4U1IA 3FB6B 3ZDXF 1X5AA 3SQOL 2WUBL 2Q86A 2XA8L 4X4ME 3ILPB 2AABL 3C6LA 4LL9A 5BMFH 1T2QH 4KVNL 3V6FB 4HKZB 4QLRA 4G9FA 3C6SA 5FB8A 5GHWH 3BIBX 2BP3A 3PGDB 4JLRA 1C5DA 3VRJA 3B9KC 3B3IA 4MNGE 1AP2A 5D1QA 3MUY1 4IJ3C 3MRKA 4RGMB 4TSAL 2ZOKB 2BFVH 1YEFL 2GSIB 4HJJL 4ZAKD 4DGVL 2ADIA 3LQMA 3C6LC 2YUWA 4U1JA 1XF3B 2HFTA 5C08D 4QT5B 2AK4E 4PJ9A 4G42B 1EBAA 4CW1A 5TDOA 1LO4L 3BJLA 4EN3D 5D2LA 4XPTL 3PWNB 2HP4A 5EC2B 3D69B 3GMPB 1FDLL 3DMMD 2YRLA 3U4AA 2X70B 5D1QC 3IJHB 5HD8D 2UWEA 3W11C 4AYFA 1ZGLP 1U2HA 4NKMB 1IC5L 4ZNCD 4YBHA 2XT1B 1T5WA 1Q94B 2HWZL 4LVNB 4N0RA 3UTTE 1EFXD 3T0ED 4XT1C 3WLBB 4YHPA 3KPSD 2AJVL 2C3HA 2NW3A 1DBML 4PJ9C 2VDNL 4OFYA 1IC7L 1AQDA 1T66C 4LRNH 4RMUA 4XP4L 3H42L 5JMOC 2ZCHH 3JTSB 3BW9A 4DGIH 5JW4Q 1JWSB 4FQ1L 4JFFE 1BREA 5CSZA 1HXMB 2HFEA 2RCSH 3RWJB 3GNML 5JR1H 1OD7A 4RMWA 4NWTH 1GVIA 5GGVL 1EIBA 5C86A 2VAAA 4LKCB 1FVDA 5TDPB 4J6RH 1DQJB 4LSQL 1KBGL 5IHLB 2CQVA 2VLLA 4WFHE 2W0KA 1QBLL 4LLQA 3SDAA 2Q7YB 4OF8A 4ZPTA 3U0TA 4HJ0D 1MNUL 1A6AA 4F7MB 5L0QB 3CXDH 2VRAA 4FXGA 1QA9A 1YECH 3VFTB 4O2FA 1T20B 4LCYB 4U3HA 1WBYA 1KELH 5GS0H 2BY0A 2FECI 1OTTC 1TZIB 3D85B 3QWOA 2LU4A 3CVHL 5EORH 1GGBL 2ADFH 3ZHDA 4M1CD 3HC4L 3ZDXE 4OM1H 5F7EL 5ESAB 2XQYG 3GJFH 3ULVC 3TZVB 2OTWA 3S96A 4A6YH 1EO5A 3IRZA 1TMCB 4WO4B 3QZWG 4DKEH 4HH8A 5IMOA 5FA3A 3SDAC 5BCAA 5JORA 2I24N 3F58L 2DLGA 3IDIB 3BP5B 4LCWD 3BJ91 5ISZD 1OSZB 4GKSB 3LQAC 5J56B 2XTJE 3VXOA 4NC1E 2X4QA 4ZUUA 1K4DA 3LHPL 4X6FA 1A7OH 1S7WB 3QO0A 2ESVB 1LD9A 4P46D 2EE6A 5E6IA 3OKLB 4G7YL 1FJ1A 4OZHB 4MD0B 4O9HL 4PGBB 2YN5A 3NA9H 4Y19D 4QRRE 4L9DA 4LSRL 3LN4A 5F7YC 5GGSB 4Q2ZB 1A02N 4LQ1A 3PHSA 3P0YL 3SCMB 5KSBF 4YHYC 4R0LB 1CDIA 5SWQA 5SWZA 3ILQC 2PW2B 3GKZA 4MQXD 4KK6C 4X6CB 3QXAA 3RFZC 2VOTA 3MR9A 2CDFA 3EJYD 2VZ1A 1B2WL 1AQKH 4HGKC 4G3YL 3GMNB 1YEKL 2EKSB 1P4LB 2FO1A 1HNFA 3OR7A 2B1AH 4LK4A 4WFGE 4EUPH 1CF8H 5DJYA 4Y4FB 1AO7A 4BSWB 3AXLA 4TVSa 3VXQA 4V2BA 5EU3A 5HDQH 3C09C 3D18B 4TQEH 5DFVD 5F1KC 1MY7A 5BS0B 3BD4A 4K71B 5IOPA 1J0YA 1EO8H 2B5IB 2L7JA 3WFCL 4LFHD 4Q9BA 4ZXBD 4PJFA 5E5UB 1KIRA 1YDPB 4OT1H 5DI8B 1KG0A 3KNBB 3IU3A 3JUZA 1VESA 2FYYB 1IGMH 3MGOB 1FVEB 2F8OA 4U4BA 1A7RH 2YUVA 4HPYL 1FFPA 4L4TA 4RAUA 2ZUQB 4M5YH 1L6ZA 1A1MA 3QJFA 4HUWA 1PG7X 4PGCB 1OP3K 5B39A 4ODTH 4LEOA 3DX9A 4FG6D 5GSVA 4OCSL 5HHMD 4JKWA 2HFGH 4P3CH 1T03H 3OXSA 5HGDB 5I1KL 4EI5C 4G6KL 4JM2D 2APXA 2A74B 1R5IA 3A6BL 3MLWH 2CJUL 4MNQD 4EXPX 2J88H 2VDML 1MHEB 3KYKH 2K1MA 4KUZH 1ZA6A 5FEBA 3DVNB 1KV3A 1D5MB 1T1ZB 4HLJA 5H94B 3BEWA 2BNRE 4G6AC 4DN3H 3D25B 1I7TB 1JPST 4JG1L 5CGYC 3KLSA 5H35A 4R2GC 1RZKH 3DGCR 4N8CH 2B39A 2GY7B 5DJXA 4XC3H 2YD7A 4DGYL 4Z95L 4DN4H 1A1OA 4AY0A 1MF2H 1UH3A 3SDXB 4LNRA 1HZHH 4PJ8B 2NLJB 4JZOA 1SBSL 4J8RB 4YDVA 4F37K 1CZ8H 2XQBL 5ALCH 1QSEB 3SKOB 1CL7I 4ZMAT 1GGCL 1WAAA 1MPAH 4Y1AD 5JW4N 3NACL 5DJ6A 2HG5B 1DQML 4NBYB 7CGTA 5TF1L 1A5FL 1ZGLA 1CICA 25C8L 2YC1A 3VG9C 5C0CA 3PUCA 2X40A 5JPMB 3WIIH 4AEEA 5DGRA 4MCZB 4CVXA 4Z7QF 3LPWA 4LIQL 4YDJA 4O58L 5KSBE 5CP3A 1RZFH 4WTZA 1D5BA 1Q72L 3RPIB 1NBZA 4I77L 1KTLA 3QEQA 4Y4KB 5HHPA 4R4ND 4P4KB 3TYGL 5GRUH 1SQ2N 4QRUA 3QDMB 1Z2KA 1MVUB 2BVQA 2OK0L 1PLGL 5ILTL 2Z8VC 1TJIH 3PXHA 4HWNA 4WUUD 3FKUS 5EU6E 5T3ZH 5I19H 4EVNB 4HIIB 4MA7L 3ARWA 4K3EH 1BBJA 3MUHL 1MEXH 3QCUH 1FSKB 3E3QE 4MXQC 4S1SL 4S1RL 2Z35A 1RUQH 3WFDL 3KGRA 4M9OA 4L3EA 3GRWH 3HE6B 4ETYA 2WZPD 1IAKA 4PJAF 2XICA 1UKTA 2HFFA 3QJHB 3FT3B 3C5ZD 3M8OL 4XHJC 3ULVH 5J0BA 3LMJL 4PJCF 3HI6L 4QXUL 1BD2B 1N5AB 3C5SB 1XZ0B 2FATH 3CK0L 1YEIH 1QLFB 1QSFB 5TGBB 3QUYB 4JRXD 2UZXB 1Q38A 3CNKA 4C56A 4S2SA 3GGWA 3UBXB 1JIBA 1HN1A 1ZEAH 3ESUF 4JY4A 3MLZL 2FJGB 3LQAH 3UAJC 4YK4C 5I8OH 2AJSH 4LSSL 2OXHA 1AD9B 1T0MA 3BQUB 3PJSA 5I74C 3RUGB 4I0CC 4POUB 4OKDA 1KLGA 4PY8J 4OCXL 1N59B 4LDEB 3RJDA 3TBYB 5HHOE 3KYAA 3QWQB 1MJJA 1BWWA 1RUKL 3S35X 4C4KO 2DLFH 4YDKH 3SKMB 3IF1A 5ACZA 5SWSB 2ADJA 2NX5D 4XPFH 5JQ6L 5JOEA 1U8HA 1JZ2A 2P49B 3BPOC 4LLDA 5GGRA 1XGRA 2YRPA 1UFUA 1UWEH 1MRDH 1QVOA 4Y5YA 3BIKB 1KCVH 3NCBB 1NCUA 1XGQB 1QTYT 2ZPKL 4UILL 1WC7A 4UV7H 3STZA 1G1YA 1PG7L 3BGFB 1QBAA 3MRJA 1GPOH 2M2DA 2XWBA 3WL9B 1AKJA 3LN5B 3OKMB 3MFFB 4Z7QE 5HHXH 5DURD 1XGTB 2MSPA 4BM7A 4MHHG 1JNLH 4M3JA 3FB7A 2NZIA 4OLVL 4YHIB 1MWAH 4G6JL 3EO9L 4C57C 2A6IB 2BK8A 4JFQB 3ARUA 1NJ9A 3KPLA 4PJHE 5E5RB 4Y5YC 1CDYA 3SJVA 5C07D 3U9PH 4ZQKA 4KMLB 3I6GA 1W8OA 2HH0L 4X0KA 1PZ5A 2FWOA 1BIIA 1LE5B 3O4LB 3FQRB 3PV6B 4GW4B 4M48H 3B6SA 1EPFA 5FYKL 5DYOB 3LS5L 3HI1A 4XCNB 1DE4B 3H9ZA 4NM8H 1A9EA 1SJEA 1JRHI 1M71B 4LARL 4NC0B 2BSTA 2FX9H 2P5ED 2Z92B 1NAMA 2VLKD 4PJAE 5DA0B 3QHFL 4PRBA 5DMKB 3WHE1 2VLME 1TQBC 4Z5RB 5I16A 1MFBH 3BVNB 5GJTH 4I5BA 4PJCE 1YY8B 1A7QH 2NXYD 5SX5K 2WLYA 1IEBA 5D7KE 1VGEH 3MV8D 3DIFB 1RQ5A 2BSRB 1SBBA 5JUEL 3BKMH 3K1KC 4Z0XA 1DN0B 4FFVC 1LMKA 4EDWL 2N1KA 4WWID 1EHAA 5T3XH 4AIZB 1FYTE 4MNGB 2FO4A 2DBLL 5D7SH 2OBGA 2KZWA 4MJ2A 2C7UA 4JN1L 2DMKA 4XVTL 5IBLC 3S37L 5DTFA 1SJHA 4Z0BH 3P4NA 3V6ZA 1W0YT 2YD3A 4XP6H 3REWB 1IC4L 2XZQH 4XNUH 4KQ3H 1S7RA 3V6OA 1VFOA 2AK4B 4N90E 2W0LA 2A2QT 1CQYA 1EFQA 4PV9A 1O7VA 1N6UA 3MSPA 4DWHA 3G08A 4HCRL 1AI1H 3EKCA 5KVDH 4H1LG 4NRZB 3LRHA 3HR6A 1Z5LA 4XNMA 2OJZL 4JQIH 3IT8D 4UV4H 2BSED 2J6EL 3MLTB 2DYPB 2DDQL 3UTTB 3MRLA 4YWGL 5LBSH 3V6OC 1RIUL 2XIDA 3WDHA 3ROLB 1NMBL 4N9OB 3UTSA 5JW4R 4LQFL 4YXLL 4WI2A 5DJCB 4OCLC 5DJ0B 4LPTA 2H41A 1D6VH 4IOFC 5EU7E 5B3JF 1XCQA 4YBLB 5CP3H 3KPRE 3HUJF 5B38G 1D5IL 1JWMA 5MENE 1HIMH 1TLKA 1EHNA 2Y07H 1EEYB 3FHQA 3X14A 2R1YB 4JDVB 1U8LA 3QIBA 1KB9K 3A6CL 4BUHA 4KKAC 5CD5D 4YHZL 2ICWI 5KVFL 2W60A 5DMIL 1GIGH 4KDTA 2H2SC 3S35L 3BN3B 5KOVC 1A2YA 2GSGA 3PWJB 2NY7L 3D3VD 1NC4A 1DVFB 3CXHK 2BNUB 1DUYB 4HS8L 1A9BB 1YC8A 2Q1EA 3T2NL 4QY8A 4U1KA 4NUGH 3WFBH 3BD5A 5ADPH 3SDYL 3EOAB 3O2DH 4C55A 4HLZG 3RHWK 2DQDH 2LFGA 2OP4L 4U6VL 3C9NB 4Q9RL 5CMAB 4KRPD 4KDTC 4YXHH 4EI6B 1WFUA 3DYOA 5KVGH 3T8XB 3SGDH 1P4BL 1P7QB 5D1ZD 3QUXD 3TBVA 4YHMH 5FM4A 2A0LD 1DBKH 3SDDA 5KS9F 4C4KT 5I1HH 4P2OD 4QHNA 1CR9L 2XZCL 1F3JB 4PY7A 4K07A 1ADQA 4LLMB 3RTQD 2Z4QA 3T3PE 4P23A 1DBBL 4ZO8A 3S97C 1QFWM 4ALAL 3U2SA 3MLYH 1GGTA 3RIFF 4YC2C 3BFOA 4P2RE 1K8DA 2E7BA 4CADA 1CE1H 1S9XA 1MRCH 4G5ZH 1NCWH 4NPYA 4RFOL 4U31A 3ISWA 4XCYA 5FO8B 3QQ9D 3VWJC 4GH7B 5C2UB 4JHZA 1JPSL 4N5EC 5K9OB 4QRRB 1U8QB 5ANME 5GGTH 3ZKSD 4NZUH 4E42B 1Q9KB 4OIAA 3BGMB 4HAGA 2CSPA 4U1GB 3WS6A 4PP2A 3UP1A 3FFCE 3SDDC 3VRIA 1ZGLM 1J7VR 3QP3A 4R4FL 1FG2A 2VL4A 4FQXD 1NEZA 1GOFA 1KLFA 1JTTA 1WGOA 1LDPL 2RFXB 1RI8A 4MXWL 3MJ9H 4UAOC 4P23C 3W0WE 5J6HB 1QZ1A 1JPFB 1A6PA 4JO1H 4KUCF 3I6LD 4G80A 5C71A 5LQBL 3LV3A 3G5YA 1A47A 1BOGA 2AERT 2ZUVA 5IFHH 3TVMB 3GHBH 4K23L 1G6RA 3O3AA 3QULB 4HBCH 4J4PD 4PBVC 2J7LA 3ARVA 2NTFA 2A73A 3HZYB 3KS0H 1CT8A 3DURB 2LTQC 2DQTL 1K2DB 1NMAH 2HLFD 5B3JE 4O00A 5ENWA 3KPOA 3RKDD 4UOW0 3HUJE 1T6WA 5FUCC 2QSTA 4JO3H 3ZTJH 3BMWA 5E5MA 3GMOB 3BWAA 4NRYB 3S4SG 3KR3H 4MAUH 4LU5L 1XR9A 2NYYD 3IS1X 3BIAX 3LB6C 1QPPA 2EH7L 4G8GD 3OGOE 2VIRB 5DJ2A 5KSAB 3L3HB 4K3JL 4R90L 4U1HA 1W0WA 4FXKA 4JPWH 3X3GL 2ZUYA 3RNQA 4HXBH 4LKXA 1KTRL 2I60H 5BVJA 2D9CA 2EIZA 1IILE 5T5FL 4WJ5A 1J1XL 4O4YH 4TVPE 2OL3L 2F58H 3D1MC 1DLHA 5SX4I 2BVOA 1EHLH 3Q3GB 1NAMH 1ITBB 1C12B 1F11A 3O6FA 2H9GB 2Y72A 1G7MB 3MJ8A 4ZD3L 1QR1B 2I9TB 3NTCH 2BNRB 4WU5A 4H0HB 4HKJB 3H0TA 1KTDA 3QI9B 5E00B 1MOEA 1SM3H 4G8IA 4XMPL 3P4LA 2PYFA 1JPGA 1FN4B 3OPZH 1IVLA 1RZGB 2AEQL 4JDZA 1J8HE 3O41A 3MLSL 5I8CB 2V2XA 3W2DH 4XVSL 3SE9L 4ZTOH 3ELAT 4HWZA 1ZT1A 3BKYH 1BX2A 3O4OC 3H9SA 5EU5B 3U36B 4JVPA 3VFVB 1EH9A 4ERSL 1LK3L 1JE6A 4X5LA 4ZFZB 2IBGA 4NWUL 2F54A 3PQYD 4Y2DA 1YQ2A 4HIHB 3VG0L 2L4OA 4XNYL