1ZLWH

Fab 2g12 + man8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 2G12, light chain
total genus 39
structure length 224
sequence length 224
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zlwH01
1M05A 3TT3L 4MJ6B 4OFVA 1RZFL 5CSZA 3D39A 4KJWD 5HHXL 3RWCB 5DT1L 4LLQA 4OQTA 1II4E 3VFTB 5GJTH 2P47B 3CDGA 3CGTA 3SBWC 5ADPH 5HJ3A 3MJ9H 2E8YA 4IM8A 4M62H 1MFAL 5DUML 4IJ3C 4JPVH 2WP3O 2UYLB 3O3AA 2ZUSA 4LSRH 5I1HH 4UDUB 4WUUD 3C9NA 2R1YB 2P8LA 4YC2C 4U49A 4OCRL 3DUUB 2VXTL 1FN4A 2J8OA 5ANME 2GCYB 1CICB 1XGQA 3ZTJH 6FABH 2FIKB 3S37H 3ARYA 1TQCC 4ODWA 2OTUB 4M5ZL 4ZQKA 1A6AB 1WF5A 4P5TC 4XMLH 4JHWH 4D9QE 3FCTA 3RKPA 2NLJA 1MHHB 4LSPH 4CNIB 4NPYA 4G8GE 5T1KD 1U3JA 1RIUL 5IFJA 4S0SD 3FT4A 3IKKA 1KT2B 5E99L 2IALA 4K23L 5C3LD 3EOTH 2HLFD 1ZHNA 2LVCA 4XPTH 4UV4H 5JXEC 3LHPL 3FQTB 3HZKB 4QOKB 3EFFB 1QVOB 5B22A 4NQXA 4HZLA 3MV7E 4RFEA 4QWWD 3O3EB 5AYQA 3EJJX 3JV5A 4X4ME 5ALCH 1MF2H 2HFFA 1DQDH 1PBYA 5DD0L 2AS5M 5CGYD 2O5XH 4NM8L 1TCMA 4P23C 5BXFA 4UTAH 5GS3A 5B21A 2F19H 2YD3A 2HWZL 3MLZH 4IS6A 3BESR 3FAXA 2B4CC 1JF1B 1AI1H 2VZSA 3BKJH 1RZJC 3AUVA 4MD5A 1NDMB 2VDLL 1X4YA 2CO6B 4QRQA 1U2HA 1WFTA 4N8PA 3VMPA 1G7HA 1DUYA 1UXSA 3S88L 5DMIH 1U92B 4V1DA 1QFWM 4UBDD 2UY7A 4WWKC 4WO4B 4V2CB 4H1LB 2PYEE 4YR6B 1ZHLB 3CSYB 2XYCA 3HI1B 4KPHH 1SYVB 1TNMA 1CU4L 2Y36H 1IT9L 1W0YT 1J8HE 5TDOA 2DM4A 3TBWB 4KTYA 1RULH 4F7PA 1QNZH 4OGXL 5JQ6L 2AJVH 3BP4A 5F7KC 4HKBA 5GGSY 5IBUB 3QDGD 5DJDB 1IGYB 1ZS8B 4XRCB 1RI8A 1AXIB 3SO3B 1I1AB 4S1QH 4CN1A 1FC2D 5HSFA 2CIKA 2X1QA 3SE4C 3SGEH 2NY6D 3NCBB 3O2VH 3B6SA 3UTQB 4JPKH 1QACA 4U7SA 3ARXA 5EO9B 1E4WH 1LO2L 4RMQA 4Z7VE 3T0AA 1QFWL 3CFJA 1UJ3C 2V9QA 3GJEA 5EU5A 4MMXC 1BD2D 1A1OB 3A67L 1AGDA 4HIEA 3VFWB 1FL6A 3GO1L 2NYYC 3CIQA 4K2UH 4P4KA 3B83A 3SE9L 4DKDC 2NY6B 4OZIF 4JKMA 3MRIA 1YN7A 3GSVA 3VFSB 4PRPB 2XKNA 1KELL 1WT5C 4MHHG 4M3KB 1A7RL 3S8WA 3U0TA 3KYMA 4CAGA 2BVPA 4G42B 5HYJD 1OARH 4GS7C 5HD8C 3H7LA 4PRIE 1A6UH 5FYJL 3VXSA 1P4IH 3ZE0E 2EIDA 1A7RH 1WGOA 1KIPB 3VGAB 1YEEL 1XGTA 4U1IA 1CF8L 1HH9B 2ZG2A 2D7NA 4YJZL 4TVPD 4MJ2A 2XI9A 4YFLI 2X4NB 3QHTC 4KJYB 1CGTA 4ZAKC 3LN5A 5DJ8A 3O9WC 4P3WA 3FQXB 5C7XH 2J5LB 4K94H 1GPOL 3CX2A 1LD9A 2CQVA 4X6DA 4HPOH 5IFAH 2YA0A 5IFHH 5D1XA 3P4OA 5JO5A 5I8CB 2P7TA 5D7LA 4JM2A 3BW9A 1HDMB 1CD8A 2JJTA 3MRCA 4P2RD 3NPSC 2Y6SD 5JLZA 5F7EH 3FO2B 5EU6E 1KB5B 5GSVA 1A3RL 1JF6A 2ADGB 3IB4A 3HFML 1OGAD 4MA3B 4WI3A 4NCC2 2HH0H 3AMLA 3N1GC 3QIUB 5KVFH 4U1NB 2JB5L 5L2JB 1VFOA 1A3RH 2HLFC 5BMFH 2BNRE 2RJMA 3D85B 2DQUL 3VA6A 1YNTA 3WNMA 3DVGB 2FBOJ 4KKNA 3WXVL 2OBGA 5E1AB 4R7DB 4K8RD 1SY6L 3LKNB 3OAZH 1Q9LB 3TBSB 2W9DH 4XNMB 4RMRA 4R8WH 3MRLA 1ZLUH 1RZGB 1T0NB 3E8UL 1C5CL 1OL0A 5CD3A 1BX2B 1C1EL 3HKFA 2GITA 5J06A 3G04B 4ZS6C 3GKWH 2WBJB 4U1HA 2HKHL 4M5YH 4Y5YB 1IAIH 4M8QA 1KN2L 1ZVYA 4KAQL 4P4KC 2IMMA 4K7PL 2ZG3A 3QA3B 1IQWH 1OCWL 2D03L 1HI6A 5DJXB 1G9NC 5DURD 1G7IB 4OJFL 2BRRH 1V7NH 2EO9A 3TNMB 1D9KD 4XAWH 5I1AB 5SWZB 1ZVSA 2HVJA 2LV4A 2WINB 2DQGH 1KCRL 5C08D 3ZLQC 1G9EA 3DRTA 3C6LD 3F7YA 3SJVB 2H41A 3KLHC 2J3SA 3DTXA 4KV5E 1W72A 2DYPD 3HUJB 1WTLA 4UINH 4ETQA 4KU1A 4HXAL 4J3VA 4K7FA 4F9LC 4CMHB 1ADQH 3TCLA 3ZYZA 1JNLH 1MCDA 5I1HL 2Y07H 3BWUC 4FFWD 3BKML 2EYTB 1FZJB 3BRFA 1LEKA 1R3HB 4OLVL 3SE3C 1GGIL 1M7XA 3CH1B 3T0DA 1XF4A 3MUGA 3LD8C 4LLYB 2IFGA 4TSAH 3VXOA 3D85D 3KG5A 4PGDA 4LAJH 2C3VA 4QNPE 5D70L 1XIWB 4XB7A 4XCYA 4HSQA 5IEHB 3SCMA 4FQXB 5BV7C 2AV7A 2DQJL 2EH7H 2HT4C 3RVXC 2Q7NA 4LF3A 1MJ8H 1CCZA 4QXWA 3LKRA 2WP3T 3FO2A 3IRPX 4YBLC 3PXHA 5GSVB 5L2KE 3KPMA 5GRZA 4BK5A 4DUVA 2RFXB 2QQKL 1NC4D 1IC5H 3FT2B 5KSVA 5K93A 3ULUF 3NZHH 1V3KA 4PJCE 5FDWB 1UT9A 2ORBH 3RWEB 5CEZL 3EO9L 5E6IB 4XVUC 3DX6B 1A6AA 1PJ9A 5ID0B 3DYOA 3HLAB 4IMLB 5E2VL 2Q1EA 5HHNA 4DTGH 3O3BA 4K55A 4KRPD 3S4SG 1MI5E 1TTUA 1AFVH 1RZKL 3PDOB 4S0TD 3G6JE 2CD0A 5T1LA 3VXMB 5JORA 4MJ5B 2CRMA 5F3BB 3QJFA 1R0AL 2ITDB 2PF6A 3H9SD 4K3EH 1S5IL 5SX5H 5IVXA 1VFAB 2W9LA 2A6IB 3F12A 1S7QA 4Q9RH 3ZT6A 2ATPB 5SX4I 4JQVC 2NY4D 4YHLH 1K4DB 4HUNB 4NNXB 2APXA 1BQHB 3ARPA 3DI2B 3WD5H 5MENB 5IOPB 1NCWL 3EYSL 4MB4A 3CFDB 5D7IA 4DW2H 1FVEB 5HBBA 4R0LA 2ARJA 4YNYB 3MZGB 1CGUA 1PZ5A 1WAAE 5I0DA 2KQMA 5EOTA 4OZFB 4CVWA 4F7TA 3NFNA 3RGVB 3C8KB 1I8KB 1XIWC 3HE6A 5IV2A 1TZIB 1CGSH 2HT4D 1BGXL 4PJ9A 1H0DA 3UTTE 3QUKB 1Q0YH 2WINA 1I1YA 2FGWL 4H8WH 5FKAB 5DMYA 1DLFH 2Z91B 3I6KB 2VKWA 2VXUH 4PY7A 1HCFX 3Q1SL 3P9LA 4AT6B 3EOYG 3OKDA 4OGYH 1ZTXH 3DVFA 4X5WA 3OF6A 1UJ3A 5DJ0A 3FQUB 5KZCD 4OB5H 3B8YA 1CD9B 1JPTH 4ZDHA 1R3IL 2OL3B 3ZHDA 4ONHB 3VXPB 4PJ7A 1G0DA 4M6NL 5A2KH 3T2OA 2YEZB 2ENYA 5F1SA 1SBBA 5F7EL 1AO7A 3LPGA 2X4UB 1KJ3H 1JMXA 1CG9A 4JO4L 1KCRH 1ZGLB 1J11A 2V5SA 3HR6A 4LP5A 1KJ2B 3OXRA 4X4MA 1S5HA 5JW3H 2Q3AA 4O2FA 1MNUH 3BD3A 4X98B 4JDZA 2R15A 1JHLH 4ZOEA 2P5WD 2HJFB 1U8KB 4MDIB 3NPSB 5DO2C 4MSWB 2AXGB 2GJZA 3UZQA 5EU3A 1U6AH 2IBZX 4QCIA 4WUUA 5E6ZA 4J12A 3V5DB 3UBXI 2G60L 1GZQB 5BS0D 2GJ6A 4UB0H 1KGCE 3R1GL 2QHRH 4I4WB 3RZWA 5GHWH 3AAZA 1G6RH 1PD6A 1J1PL 2BSTA 4FTVA 1DDHA 1SM3H 1BBJB 5MENE 1D5IH 3MBED 4RFOL 3T0WA 3WL9B 2A83A 1JHTB 1GJIA 4O58L 3TYGH 4AYFA 4ZFOL 3VXMA 5F71A 2GK2A 1TVHA 4L8SA 2Q7YB 4O4YH 3KPSE 2ZCKH 3LN9A 3DVNA 2X1XR 4J6RH 1S9YA 3W5NA 4K2UL 3MRJB 2X44D 2P7TB 1UJTA 3BH9B 2OYPA 1JUFA 5JXAL 5BMFL 5C70A 1LDPH 1UM5H 3LRSA 4PJFE 4CRPA 4AEIH 3OKOB 4NJ9L 1D6EB 1N7ML 5I1IH 5I75B 2UV3A 3L7FA 2OQJB 5IK3A 1RMFL 1UZ8A 1NAKH 5IB4B 2W0KA 4I9WD 2EECA 1HSAB 2XACC 3JV6B 4YQXH 5KN5B 3K80A 4FQ1H 3IF1A 5J0BA 1V05A 4TSCH 3GHBL 4K71C 1TZGL 1AGEB 4D9QD 1B88A 2OCFD 4PB9H 4K3DL 3ARUA 5MI0C 4M7KL 2C9AA 5E8NB 1AE6L 1B0RA 1R24B 4EDXB 3MRNB 2XN9A 1GCFA 3TV3H 3VW3H 3L5XL 2JJTC 5B3JE 1AD0A 1YPZB 3LD8B 4PJHB 3MRGA 5F9WC 1OAQH 1NMAH 3LN4A 4QF1A 1HKFA 4JKKA 3MV7D 1IGFH 4YDKH 2KQNA 3WFEL 3DBXB 4HEPG 4XNUH 3OKMB 43C9B 4YUEH 3H9YA 4L8DB 4NO2A 4QHKJ 3FB7B 2WZPD 2BFVL 4ZAKB 3STBA 5I19L 3IFPB 1DEDA 5IMOA 4ZO8A 3GKZA 1F5WA 5KSUA 1LGVA 4GKSB 3HC0A 3O6KH 4NNYB 1A1MB 4JDZB 1KJ2H 4W6YB 4BQCA 1BOYA 3U4EB 3AREB 4MJIE 2DJUA 2ZKHH 3TM6A 3QEGH 1ZANL 3TBWA 1NKRA 4KMTH 5JW4R 4GFTB 3ARZA 2HP4A 5L7XL 2JIXA 1JTPA 2PYED 5D1ZA 2IAMA 3OKKA 3OWEA 1OSZA 1J8HD 4U3CA 5I1KL 1MWAB 1URLA 2GT9B 4QXGL 5FOBA 4C83B 3QDGE 3BJLA 1N4XH 2A83B 2E9WA 3RL1B 1AQKH 3HNSL 4OUOA 2DM7A 3D3VA 5TFSH 5KVEH 3H3PH 4BSWA 3F6IA 1AE6H 5IROA 4OFYA 4NRXA 1T1YB 4LHUA 4NN6B 3TYFB 3VWKA 1BD2E 3B5GA 4FP8H 2J2ZA 3QI9C 3HAEA 1EO8H 3V0WH 1F2QA 4WI6A 1JPSL 2HKHH 4G42A 5BW7A 4JFDB 2GSGA 4U1GB 3GRWA 1CLOL 2D7PA 1MCWM 1UADC 3SGJC 4POZD 5J12C 2VXSL 4QHNA 2BNQE 3OAYH 1XCTA 4GG8B 3VXQA 4WU5B 1DL7H 2EC8A 3B9DA 3KLDA 1A14L 4IRSC 4GRWE 2HWZH 3QP3A 3UPAA 4LCWA 3TO4B 5FYJU 4X8JA 3B43A 2CKBB 1M6OA 4TVPE 5E2TH 2FWOB 1CGVA 4OZIE 1FGVH 3T65A 1NFIA 4RZCA 4Z95H 4PRDA 5D1XB 1FBIL 2CIKB 1U2CA 4NSKA 4KFZC 5T3XL 2AJSH 4U33A 2E8ZA 3HMXA 1DUZA 5CINH 2X42A 3IJHB 4YHPA 4WI5A 3G5YA 4XPTL 1A7QL 5AYUH 1JGEB 1K4CB 4MCZA 5D8JH 3VGBA 2XTLA 1AR1C 1BZQK 3O11B 2RAMA 4X6CB 1Q0XL 1ZLWK 2OTWB 2MWCA 4EBQL 4JFXB 4G6AD 1CLYH 2FYYB 2R0WL 4FQHB 4L8DA 4ZNEA 1GL4B 5ISZA 3WJJC 4KK8C 4ZOAA 1EERB 1OPGL 1CGWA 3B3IA 3IU3B 3FB8A 4X0KB 3CSPA 1ACZA 1HXMA 1XR8B 2RB8A 4M4PA 2FLBT 2XKNB 3PWVB 5EU6D 5I8OH 4DZ8A 4MD5B 4K7PX 2IG2H 4RISH 1F3DJ 4NKDA 3P2TA 3EO0B 3F58H 3V5HA 5HVHB 3PQYB 3WIHA 3ARWA 1WISA 4F3FB 4N9OB 3CXDH 5GHWL 3INUL 2ERJB 3QYCA 2Q87A 1QKZH 2VRAA 1KC5H 4HULB 3TH4T 3WEXB 2SEBB 4UIKL 3V52L 3VFGH 1R3IH 1A6VL 3LKQB 4PIRF 1JIBA 5IWLA 1MOEA 5F3HA 4F7PB 5DJ0B 3SKOB 3BP4B 1WBXB 5DJDA 3Q48A 2IPKA 2W07A 1OQOA 4R2GB 1JPGA 4X7EC 1QHPA 1K6QL 1LO0L 1QA9A 5D2NC 5F6IB 1DQLH 3BKCL 2VLJE 1R3JA 3MRQA 4XNZB 1U3YA 3BXNA 1EV2E 1ORQB 5IMLB 4DKEL 5K59F 3GMLB 3C5ZC 4KXZI 1DE4A 4R97B 5I17A 3DX7A 3D48R 5D7IF 1E4XI 4MA8L 1UVQA 2VZTA 3QIWD 3ZZ1A 5FGCB 4RSVA 5I8KL 1BZ7A 1FH5L 1W8OA 5BVPL 3QXVA 4KK8D 4XMPH 4CVZB 4FRWA 1CDUA 5KSAA 4YK4B 4RFNB 2MCPH 1QSEA 1MFCH 5KANI 1UC6A 3CD4A 2AXFB 3DSNA 5D7JA 1PVHA 5C08E 4MA7H 2FBJH 4UT7L 1ZMYA 3EW3B 1KXQE 4WJ5A 3E6FB 5L88L 5J56B 3NCYS 1YUHA 4NP4L 1GC1L 1CXLA 1G7PA 5DD5H 3KPPB 1NPUA 1A4KB 3QUYC 1NAMA 2E6QA 1AFVL 2ILLA 2YHGA 1BVZA 3TA3B 4PREB 4D0BB 4U1KA 3ZHLA 2AJVL 3B5TA 2I60L 3P73B 4UU9B 2K3TA 2FO4B 3TO2B 4JHAH 1S3KH 1BLNA 5E8EB 2I5YL 5IUSA 4D9LL 2CSPA 3HZVA 4OLXL 2DAVA 2LU3A 4Y5YA 2X4PA 3D69A 3RA7H 2PNDA 5ISZB 3EYQD 5E0QA 1NCDL 2QQLH 5IHLB 2I25N 3DV6B 5C8JA 5FV1L 3KDMA 4O2EB 5DHVB 5AWNL 4N0FA 3L1OL 1NJ9A 5ICXA 1TJHL 3ZKXC 5I15H 1FZKA 3PWVA 4Z0BL 2O93L 5L2KD 4GBXC 4QRQB 4G80A 1MLBA 2EC9U 5IQ9A 4KMLB 3DX8B 3UDWA 5DGQA 1U58A 3K4AA 1WBZA 1FNFA 2FJGB 5TDPB 1S5IH 4I2XB 4P4RA 2ED7A 4DAGH 4KJQC 4YFLF 4OCXL 1HQRA 4MQXC 4YR6A 4DEPC 2CKNA 3MLTA 3RVWC 4G43B 1NQBA 1IKFL 4WVRA 4DWHA 4H25B 4ODWB 3UO1H 3MROA 1OY3B 3I50L 5HYJA 3DGGA 1YEKH 2XQBL 5C0FB 4UILH 5B38B 3V0AC 5HHPB 5TGBA 1QRNE 1U8PB 3IDMA 3S37L 5TH2B 1OAYL 1ZSDA 5IMKB 2G2RB 3UROR 5CJXA 3QIUD 1YEFH 1FNGA 3GSXA 3LOWA 2GW5A 3IDJB 3B9KA 5TDNA 1JN6B 1PYWB 4YHYB 1KUMA 2P8MB 3GJEB 5DFWH 2XIDA 2R29L 2NY6C 2R0LH 4HS3B 4JQIL 3HR5A 4CW1A 2ZSVB 4YHOL 5K9KB 4NN5C 2FJFA 3VG0L 1OW0A 4YHNA 4P3DA 15C8L 5I1DB 2AJXL 4C4KT 4ODXA 5I74B 1AHWB 4AT6A 5HHXH 2VLKB 1IE5A 3UTTD 5KW9H 5D7JB 2A9NH 2B1HL 4S1RH 3T04D 5I8KH 3O9WB 1J0KA 3CU7A 5I8EB 4NZUL 1ADQL 1J05A 1I9RL 2OS7A 3WFCH 5B8CC 2EKSB 3QUYA 4LCCC 2VE6B 1B6DA 2OLDA 3VWKC 3H9HB 1JHLL 2E9BA 1INQB 1FDLL 3J8F7 5HYIA 2E7CA 5EORL 4BZ2L 3UDWC 2VXTH 2VITB 5EZIH 3U6RA 3EYUL 5SWQB 1A9EA 3P4NA 1XF5B 1N3NB 2MPAL 4TSCL 4PJGF 1YNKL 4U1JA 4JZOA 3DJ9A 5IOPA 2Z35B 3PGCA 3QUZA 5FO7B 3NACH 3FRUB 1S7WB 1U91B 4PJCF 2W60B 5M95B 3WIHH 2IAMC 4KKCD 5B8CA 1U3HD 4WGVB 3DHJA 2P5WE 4KAQH 1U8NA 3DVIA 1KXVC 5GGQH 4HFWB 1HXYB 1I3VA 1CR9L 4Z95L 1XZ0B 1VESA 1GGBH 3HPJB 5EC1A 3SDXA 3MCKA 5C9JB 1F02I 5DJ2B 2V5TA 1KGCD 4QHKI 2GEEA 5FGSA 5H35A 3QEUA 2K9UA 4WUKL 4U2ZA 4GAYA 4AZ8A 1IZJA 3HZKA 3U7YH 4BH7B 5MEND 3OXSB 1OQXA 5CLWA 3K46A 1N6UA 2UWEB 2XY2A 3OKLA 5I71B 1CFVH 1WAAA 5B38A 5DFVC 3EHBD 5ENWB 5C6PB 5H8DA 3VXUB 1ODAA 2A77L 3H2WA 3EDKA 4HIHB 2PN5A 2ZCLL 3KPSD 4QNPF 5C07A 4JN2B 5HDQL 1FZOA 1G7MB 5E8DH 1P7QD 5C0CB 4FMFA 4EUPH 1WEJL 4OF0A 1I3GH 5IG7B 2YR3A 3S34L 2V7HB 1UG9A 2LTQC 1FVCA 1QHOA 5I30H 4FS0A 1A7PL 5HI4C 4CADB 2OR9H 4XTRD 4XWGL 1DUYB 3L5IA 4S1DD 4UMGA 4DOHB 5EN2A 4PTUB 3QQ9C 1MCHA 2BC4B 1Z0MA 4I9WE 32C2B 5LQBL 2WMPA 3VH8B 2GKIA 3CFKA 3O3DB 5EZOL 1E6JL 1RJYB 3GMRB 3H9SA 4RA0C 5I73C 4AL8L 4CMHC 1F42A 2MFNA 2X4OA 3U4BH 4JM2D 2CK0H 4FQ2L 2FB4H 3BUTA 4FFWC 3PWNB 4X6CE 4DZBB 4TVPH 4U1NA 5T5NF 5L2JA 3HNTL 1CT8A 1CFNA 1ZWIB 1UFUA 3LCYA 2P48B 4HC1H 5DVOA 4EOWH 5GZOD 5JHLH 1MIEL 3DIFB 4L1HA 5I76A 2DMBA 1KBGL 2GY5A 3LV3A 4HC1L 5HY9A 4EOWL 3V0VB 3VRIA 3O9WD 2FD6H 4QRUA 5IJVB 4PYHA 3X3GL 3PWPA 3MC0A 4UIMB 5KVMC 1P5VA 2I9LA 4NWTH 2AKRA 2J88H 5GGRY 4WI2A 3T2NL 5IESL 1BX2A 1CDGA 1N6QL 1TJIH 4MJID 5K9OA 5DWUL 1FE8H 5ILTH 3VXME 3QHZL 3MREA 2BMKA 2VQ1B 2IG2L 2P8LB 2OZ4H 5C2BL 1ZXQA 5CHNA 4K3DH 9CGTA 3SY0A 4KZDL 2VN7A 2B1AL 4FFYL 5JUEL 1D5MA 2CLVB 1YJDH 3F7VB 3RY6A 1U3HB 1F3DH 2CUHA 2V17L 4KQ4L 1QSEB 4QXTA 4BSWB 1NDGB 5GPRA 4KK5D 3ARFC 5DA0B 3MRPB 1NEZB 1MCNA 5LKNA 4GG6A 2BJML 3DROB 2DICA 1FYTE 2P1YA 4X9IA 5DK2B 5AYUL 5EBWB 5FHAH 4LU5L 4P5TA 5GRVK 3V6FA 4OKVB 1ZHKB 2EYRB 3UAJC 4HIXL 4TYUA 5BZDB 3ET9F 5CGTA 5AZ2L 1T1XA 1IL1A 1DTUA 1EMTL 1X44A 4OCYH 5IF0B 4HT1H 4KQ3H 2CH8A 1FGVL 1NFDB 2YS4A 1P9MA 4NO5A 2X70B 5AG9A 3T77A 4J8RB 4WIQA 1W0WA 5T5FL 2MOVA 1TPXC 1RZIB 2BNQD 4EN3A 4Z6AT 1S7XA 2F19L 3TVMD 3P3YA 4FNLL 3Q5OA 1EXUB 3OJDA 2FDBP 5EH1A 4GW4A 2X4OB 4FQ1L 1LK2A 4WO4A 3L3HA 3BKMH 4XCEA 3ZSTA 4CGTA 12E8L 4I77H 4S11A 1XGYH 4WI7A 2IFFL 1HINH 1X5KA 1U92A 4V1DB 4Y7MA 4ZO9A 1NEUA 3WNNA 1WZLA 1QR1A 4UI2A 1GVIA 3D3VB 3QO1A 4IHOB 2BK8A 1KV3A 4IRJD 1ROWA 1PEWA 5MEQB 4HPYH 3MOAL 3I2CL 4B41A 1FJ1B 2YPVH 2XG5A 4YHKL 4XX1G 1JGUH 4GBXA 1EVTC 3P0VL 3W9DB 3Q6FB 5IJVA 1V7NL 4H0IA 5CJOH 4F37F 3PWPB 6FABL 4BQ9A 5EU5B 1OGAA 5TQ2L 4UT6L 1PYWA 1S7RA 5KZCB 2ITDA 4OIIH 1IEHA 2IPTH 4F58L 1A6VH 2BXYA 1JGLL 1HOCB 1QSEE 4WHYH 4IRJB 1EA9C 1GSMA 3VI4E 4JPWH 4ISVB 3KPRB 1FNSL 3MA9H 4NT6B 2EYSB 4NNYA 2SEBA 5KG9B 2MSPA 5E95B 3BKYL 1CK0H 1GGCH 4PJXE 2ZKHL 1T04B 4AM0B 3PHQA 3PP3H 4PJIA 1BMGA 4X8JB 3GHEL 2ZSWA 1MFEL 1BF2A 5CIPB 3GGWB 5F7HA 1MHPH 5C0DB 3KYNA 4ZFFB 3HPLA 1RZFH 4X8XA 4E41B 3NPZB 3HE6B 3MCLL 3T4YB 4JANA 2YC1B 1B0WA 2VXQL 1LEKB 3O4OB 3HZMA 2IPUG 4JRWA 5DURB 2EXYD 3NGBB 1EEYA 1KG0B 4ODTH 1MEXH 4EEEA 3VXNA 3GSRA 1FZMB 2VLJD 1BREA 4XNXL 3I9GH 1R3LA 1D6VL 4UQ3B 3OGOE 5I30L 4U7KA 3TNNB 5L88H 5T3XH 3OR7A 3FT3B 2VH5H 4M1GL 3MFGB 5DQDH 3L7FB 3L7EA 4Y5VB 5L0QB 4ONFL 4DTGL 4EN3B 1K3ZA 4LSTH 5FECB 1NUDA 5ABDE 4XI5C 3BDBA 3ZYOA 3OXRB 2IQ9L 1F45A 4F57L 2F5BH 1BECA 1RK0A 2O61A 3EOAB 4Y8DC 3BPCB 3LIZL 1LE5B 3RA7L 1X5FA 5DJZA 1T1ZA 2ZJSL 3HC4L 2MHAA 3S5LA 2HN7B 4XP4H 3TVMB 3DSFL 4RIRA 3TT1L 3VD4A 3HNVH 3JTTB 4PRPE 4F2MB 4JGMA 3RL2A 1DANU 3EZJB 2P5WB 4PJEF 1XH3B 1DDHB 1MHPL 4P2QB 3VXRA 1G9MC 4I3RH 2E7MA 2J8UB 1IGTA 4NO3B 3W82A 4NO2B 3VFGL 2DQDH 2VZVA 5F9WB 1BAFH 2NR6D 2AJUH 2F54A 3R1GH 4NQXB 5B4MC 1UYWH 1G7HB 5IVXE 4AEEA 1JWMA 3NCJL 4NQVA 5BVPH 2GUOA 4PY8J 3C09B 2NXZB 1QRNA 1SBSH 2NY3C 4L4VA 2DDQH 2D0GA 2EDEA 3QNZA 4JKLA 3T3ME 1BOGA 1U9KA 4CMMB 4LCYB 1F4HA 4LVOB 2ITCA 2VDMH 4FQXC 3QISA 3EBAA 3UTSA 3SGEI 5F9OL 3RVVC 5B3JF 2CKBH 3E6HA 3S35X 5GS1C 2FSEA 3IETA 2W92A 1A7BA 3DV4B 2BVUA 4EI5B 1EBPA 1HHHB 1NL0L 1ZK9A 3GEWB 4Z18A 3TH3T 1P7QA 3TIDB 1MQKH 2OL3A 1JVKA 3RVUD 3OGCB 2ZCLH 3NMEA 3MYJA 4GAGH 4JFYA 1WK0A 5DRNB 1VENA 3SQOL 1QRND 2DJSA 3IDXL 4XP5L 5HHMB 1QOKA 5CP3A 4D0CB 1OAXH 4MNQB 4X4XA 4MXVE 2R1YA 3QI9B 3PQYD 4EN3C 2VR4A 2X4PB 4JO2H 1N8ZB 4IOIB 3H0TB 5TDOB 1AGDB 4D3CL 1MFAH 5KOVC 4NGHL 4KHXL 2PW2A 5FYKU 5HPOA 1I1AC 1VACB 5J1SC 4OSUH 3HG1D 1TLKA 1WZKA 1EH9A 3GSVB 2XTJC 1AY1H 5EPMA 5ITFB 1G7LA 3X3FH 5CJBA 3GRWL 2F5AH 1QLRB 1YEFL 5FCUH 2HKFL 1G9ML 3KYOB 4JFED 2AV7B 1R5VB 3QT2A 1X5XA 4WFFD 3IFLH 5LGKA 4S1SH 2NXZC 5KSAB 1LE5A 4ZTOL 3EO1B 1QLFB 3ZYJA 2EE3A 5KVDH 1CGXA 3RFZC 5SWQA 5JR1H 4JKPH 2OXHA 5I6XB 2F54D 5EOCJ 4I5BB 2BOBA 3QIWB 1NMCB 3FQRA 4QRPB 4M5YL 3GMOA 3BWAA 3KPPA 4PRIB 4GG6B 4M43L 2VDPL 3SDXE 3CZJA 4QHLA 4IMLA 1FSKC 4ZTPH 1VFBB 4W68A 4MJ4A 1NUGA 2YXFA 1WIUA 43CAB 3L6FB 3D2UA 5I1KH 1IRAY 1YY9C 1IILE 1J12A 1AC6A 3A6CH 2Z8VC 4K9EH 5DJ2A 1QPXA 3RY5A 4XZUA 1OAXL 1D5XA 2R2HA 1VFMA 1CDBA 1MCBA 4KROD 2VXSH 1WTGT 4J7RA 3BIBX 4LSDA 2OI9B 4DFHA 3U7WH 4PJHF 2GSGB 2A6KA 3VXTA 5EO0B 2VDNH 5FKPB 1FYHB 3FONA 1VB9A 1UM4L 5J3HC 3OB0K 3O8XB 4LLWA 2BP3A 1VKXB 5JOPD 2XNAA 1OP5K 3CH1A 4FQIL 4NWUL 4OFPA 5DI8A 1S9KC 3T0BA 2F53A 3M07A 4G6JL 3KJ4C 1OAYH 4D2NA 5JHLL 5DRNA 3ARTA 1QR1B 3EFFA 5F1IA 3SKMA 5IVOA 4E0RB 3QO1B 7CGTA 2H2SC 3FL7A 1MHEB 1G1YA 5ERWA 1NMAL 4OBRA 1UA6L 3GSNH 3DVGA 5T3ZL 2BNRA 4EIZC 3RI5K 3D0LA 4JREB 5CKAA 3JSSA 4YPGA 2RR3A 3ROLB 4FZ8H 2YEZA 3CFCL 2DQGL 4WEBH 3VWJD 4Q6IB 4GMSL 4ENED 3H8NA 1YQ2A 1AIFA 3QAZB 1T1WA 5FUOH 3O3BB 1EUUA 3D3VD 4KKBD 4WV1A 1N2RB 2A73B 1NAKL 2W38A 2Y6SC 3MRFA 3HI6H 4POZC 4X6EB 5I18L 5D7KD 2NY3D 4HV8A 2C1PB 3LS5H 3CDCA 3QDMB 1N7MH 4XHJC 2PETA 3G9AB 4KROC 1CDIA 1SYSA 2D4FA 1BWWA 3TA3C 1HKLH 1IMHC 2WLZA 2PXYC 3QEHB 3HTLX 1RUQH 4UNTA 3VXUA 2UZIH 4RRPA 1I1AA 4H26B 3WD5L 1A2YB 4ONGL 3CSBA 3RWHB 2DF3A 2GQHA 3H9HA 2OXGA 4LKXB 4FTVB 1F13A 3BZEA 3F7YB 3SJVA 3VW3L 3TZVD 2GTZA 4HEME 5J11B 4P2OB 3G5XB 5LXGH 1I7UA 5E7BA 1I7TA 2DL9A 3DYPA 1F3JA 5DD3L 5DEGA 1EDQA 5CUSH 3UXFA 3LKPB 1OAZH 1DBBH 1PX4A 4XVSL 3ULUH 5IHBA 4E41E 1I1AD 2DQTL 1KIUA 3VXMD 4LVEA 1JGDB 3CLFL 1HQ4A 4TN9A 3FQUA 3LRSB 1JNNH 2HLAB 2X09A 3CSGA 4JFQA 3NFSH 4LSPL 1A3LL 4ZXBA 3HLAA 1H3UA 1T20A 2BNQA 5A1AA 4BFEA 4P5TB 4K71B 5DUBB 3LSOA 2W9EH 4JFFE 5GGRA 1NC4B 3QWQB 2WANA 5C0FA 5IBLC 1ZT4B 1FYTD 1QQDB 2COQA 3MRGB 1MJJA 4ZUUA 3CXHJ 4OF6A 4NJAH 1S5HB 2JK5B 1AGBA 3OKEA 5DK0A 2AKRB 3VU2A 1EZVY 1OTTC 3FB7A 1FL5A 3RJDA 1HIML 3DRQA 1I85C 3O2DL 3REWA 2VISB 1QVOA 3RGVA 1L6ZA 1VPOH 4MJ5A 5F3BA 1QBML 5INCB 3GMNA 3MOAH 4EDWH 2P46B 3CXHK 4ALAH 3EZ8A 3QCVH 4O2EA 5DHVA 5B4MD 3S7GA 3OAUL 4JKWA 1FAIL 3WDJA 3DTXB 1LK3L 3E2HB 4OCYL 4NQCA 4HIJB 4IS6B 4NZJA 2VLJB 1E0OB 1I9EA 1X4ZA 2DQEL 4N5ED 2IAMB 3OKKB 4WW2C 4NQUA 1QBAA 1WITA 4PGBB 3U9UA 1AGCB 2GAZB 1TNNA 2AJ3B 2YKLL 4PD4K 5TQ0L 2DLGA 2X1OA 2XZAL 8CGTA 4ONHA 3VXPA 5BQ7A 4GSDH 3OKNA 1I8IB 1Y6NR 3EYQC 3ZDXE 3RAJL 1KCSL 1WV7T 2ZPKH 3MYJB 2DWDB 1P7HL 1S7RB 4XCYB 2YD9A 3MROB 4YXHH 3F6LA 4WHTA 1Y0LA 1NMCC 1T2QH 1UCTA 5IIEB 4YPJA 4N0YL 4TRPL 2FECI 4QKXB 5ECJE 4R8WL 2J5LC 4BELD 3VWKB 5JO5B 1JGVL 2CXKA 4Z7WB 3BO8B 1FHGA 4Q74A 1QLEL 3FT2A 5FB8A 1S78D 1IM3B 1QSED 3FOMA 4HBCH 2VSCA 4GJTB 5L8KB 5BO1L 4HGWA 4AG4L 1U8NB 1CBVL 1MFNA 5DD6B 3BMVA 4XP1L 5EPMB 4NZTL 1KTLB 1G7LB 1Z3GH 4XC3L 4KUZL 4XBEH 5HHQA 4X6CF 3HPLB 2OJEB 3GI9L 2XQBH 2H3NA 2YC1A 3U0PA 3D5OF 1T6VN 3ARFD 4G8EB 4FA8A 4D9LH 1LO3L 1XGPA 3WFDH 2XY1A 4DUWA 3TJHC 3QJFB 4W4OC 1C8PA 1C16B 5GGUA 1XF2B 4PR5A 1FP5A 5DRWB 5DQDL 5IB3B 5JPMB 1NANI 4C55A 1MJJB 1U8IB 3MMEB 2Z9TA 3RY6C 1DBKL 2VAJA 4M02A 4RZCB 2NX5B 4GKNB 4YO0B 1JNLL 3NIGF 2P4AB 4BUGA 1CZ8H 3V6FB 3CK0L 2NXYD 4OLXH 1F90L 3RWFB 2JIXD 4HF5H 1A7NL 1TVHB 1HH6A 3BPOC 2F8VA 1LD9B 1MJUL 3CVHA 4WHCA 1RD6A 1T89A 3LEXA 3RZCA 4PY7B 4IRZL 3MUJA 1U91A 3IU3A 3R8BB 1B3JA 3TIEA 1AQDA 1R24A 3DX9A 5D70H 2CK0L 4FQ2H 1DBAL 4JY4B 5DF0A 4RGOL 5GZND 4GW4B 3EO0A 3V5HB 1WWBX 2XT1B 5IVXF 2P45B 1HSAA 3JV6A 4CKVX 4YDKL 1DEEB 4PRPD 4J3TA 5I0ZA 5CEXA 1Q9OA 1L7TH 5D93B 4KVCH 1LO5A 3VD5A 2XA8H 2ENSA 1OSPH 4PPTA 2Y72A 5DJ6A 5FYLD 3MRNA 2R0KL 1QSZA 3GI8H 3B8SA 3FQWB 3IXAA 5EBLB 1WEJH 2RBLA 1NMBL 1YEIH 4L29A 2AV1B 4CMMA 5L9DH 2BERA 4XH2B 4LRIA 1OT1A 3ZL4H 5F9AC 1D5ZB 1LEIB 5INDB 1KTKE 1HHIB 2CLRA 5KS9F 4IOSD 1FYTB 1RUPH 4DFIA 4O5LL 2O5ZH 4POYA 1KTDB 4CADA 4YIQB 2NYYD 2AJSL 1HHJA 3WHE1 1OWRM 5DJZB 5DFVD 1QO3B 1MCCA 3ZL4L 4XP1H 4LFHD 4OLZL 5IHZB 3HMXL 1QBLL 2N7BA 3VDCA 3BFOA 1RK1A 3LZFL 1KN4H 3MJ7A 1JZ5A 4G8FB 2M1KA 3JTTA 1Q9WB 2OSLA 3MRBA 4FXGB 4MXWH 1NAMB 3GI8L 3UTZA 2E27H 4Z7OE 1Z9OA 3C5JA 1MAKA 2EC9T 4D0BA 2Q20A 3SBWA 4DOHE 1B4JL 3ARFB 5HYEA 4KDTA 2Q6WB 3PQYE 2OR8A 4NKOA 4MX7A 3DRTB 3IFNH 1QBLH 2Z31C 1OVZA 1IL1B 5DXWA 3BEWB 3ZE1F 1J87A 1VFAA 4TULL 3LV3B 5LGHH 3VDAA 3HG1E 2YD5A 4PRAA 5E4EC 2V9RA 3MXVH 5D1XD 4JO3H 2R4RH 2X05A 3SQOH 2IPTL 2UWEE 3CH8A 3CVIL 1N64L 3S37X 4CUCA 3PL6D 1S8DB 4TUJA 3MGAA 2QR0A 2VMFA 1XMWA 5DQJB 1VADA 4JFEE 1QFPA 4NRYB 2YPLA 1AQKL 3RGHA 5D71L 4WFFE 1M6OB 1ZLWH 4Q97A 5M7QA 4HS6B 4F33B 1AGFA 4P46A 2BSSA 2FECL 1FDLH 3FCTB 5CEYA 4OM1L 3SOBH 2F54E 1WWCA 3BD5A 2ERJC 1FFQA 5DWUH 5HI5D 4NFDA 4LARH 1EHLH 5C09A 3MOBL 4RGMC 3U0WL 3PDGA 4LCCB 1J0HA 5IG7A 2R69H 3O6KL 1KJVB 3QWRD 5C08B 4JGUA 2B2XL 4U1HB 4U1LA 3SEPA 4OZHB 2FCBA 1IGTB 4NWUH 3OKEB 2D0HA 5LCVH 1C5DB 4BFBD 2V5RA 4LLVB 4XPGL 3MSPA 3RBGA 1S7TB 4U3HA 1HI6B 2HFEB 1KJ2L 5DJXA 1PKQE 2XZCH 5DC4B 2KL6A 3DETD 4N68A 5F8QC 3I3DA 5FFLA 1NLDL 1W72B 3AU1B 2JELH 4GRLC 4DZBA 5MENA 1J9CT 4D94A 1CDCA 3V7MA 3A67H 1HZHH 3KVQA 3NIFE 1NCNA 3B2VL 5FA3B 5JOPE 3ELAT 4H1LA 1QFWH 4OFKA 3K1DA 3WKML 4M6AA 2EDOA 4M1CC 4OF8A 5F88A 1NGPH 1IKFH 3W81A 3FRPA 4HKBB 1OD7A 4ZTPL 4YC2B 1CFBA 3SPVB 4Z78B 4RWHA 5F93C 1EIBA 4M7KH 1Q94A 4Z7VF 3WLWD 2R9HD 4GAJH 4R96B 4WTXA 5FM5M 5DC0A 1MCRA 1XCTB 1RIUH 4GG8A 3LEYH 1DVFC 3OHXA 1RUQL 2NW2B 3T2PA 5D2NE 5IESH 4H5SB 4XVUD 1LK3H 2PTUA 4BSJA 4UAOB 4PRHE 2DI8A 3OG4B 4HGWB 3D3VE 1NGYA 3ECBB 4LNRA 4NJ9H 1JYXA 1CXFA 2NY2D 3QEHA 3OV6A 1ZGLA 5D7KE 2KBGA 5IMLA 4RMWA 1OLLA 3BDYH 1RUKH 2VLRB 2ZCHL 4F33A 1IAII 4LVNC 1ETZA 4FQCL 3P4LA 3RU8H 2VH5L 3PL6A 4JPWL 4ORGA 2H2PC 4PJBA 1J5OL 3ZYIA 1E28B 1KENH 5DJCB 2CIIA 1UM6H 4APQD 4F58H 2WIIA 4NJAL 2EDLA 1GGYA 1OP5H 3L3DB 3BVNB 3HFMH 4WW2B 3LKPA 3AB0C 2DM2A 5EFIA 1JE6A 3C5ZD 3H42H 2C26A 4OD2B 3RUGF 3ILPA 2XWBA 3OKMA 43C9A 4AIXA 1I1RA 5F6HJ 5D4QA 3OJMB 1EAPA 2NNAA 2FO4A 4GRWF 5I2IB 1TQCB 1TVDA 3SGKC 3UJIL 4E41D 3WNPA 4X7TA 4Z7UF 5J6HB 1MNUL 4NQVB 5EN2B 2EDBA 3NFNB 1QRNB 2BC4A 4KRPB 1EGJA 1MI5B 4LLUA 3WFCL 2R4RL 1GPOH 1F00I 3KHOA 3FT3A 3Q6GL 4H0GA 4HQQH 5ACZA 4LDLB 4GRWH 2VDQL 2VDRH 2AK4A 5CUSL 2QSVA 1FG2B 5TE6H 2DLIA 1O5DT 4RAVA 3AFLA 4HQQL 4QTIL 4X9BA 4M6NH 5ACLA 5CSBA 4C56A 4JFFD 2P5EA 4DGVL 3ULVF 4HWBH 3S36H 1U58B 4WI8A 3UJTL 3NABL 1JZ8A 3VGFA 2ZOKA 3K1KC 1A5FH 4QXUL 3EFDH 5HI4D 4JO1L 5DHYA 2G75A 2VLKE 3RVXD 4XPHL 2EXYC 1I7TB 4X4ZA 3EJYC 4RQQB 3GSWA 3GJFH 4OAWA 5JXEA 1V3LA 1Q0XH 2IAND 4P9HC 4PJBF 5J6GA 5LBSL 4Q9RL 1CICA 3VCLB 1G7QB 1JP5A 1KF9B 4YHYC 4Y19A 1YEKL 4JFPB 3MNVB 3U9UB 5ACMA 2Z31B 1J88A 5DUPH 2F53E 2M8XA 1BHGA 1T3FB 4MHHI 1PSKH 4LSUH 3DO7B 4KZDH 4BZ2H 1ITBB 25C8L 5MEPA 1VSCA 4LCIH 1GC1C 4BKLB 5AZEL 3RKDC 2EXWD 1H8SA 1FPTH 3MNWA 2XWTB 3P77A 1JPFB 4HH9A 2OI9C 3HNSH 3FQTA 3U2SB 2IJ0C 3QRGL 4KJQD 4ETQB 4LQFH 3V2AR 4KQ3L 3GI9H 5FYJE 3PGDA 1B4RA 5I6XC 1FNEB 3SDDC 3CUPB 2H6PA 1YY9D 1MELA 3OPZL 5L8JB 1Q8MA 3QUMA 1SEQL 3DOSA 4LHJB 1GIGL 1I7RA 4D0CA 1CFSA 4OLUL 3QJHA 4IRSB 1AP2A 1WBZB 4QTHB 5HGGS 1U8LB 5JPNA 4PJ9D 3JWOC 4IIQA 4X9FA 3HPJA 1YECH 1NBYB 3SDXB 5BVJB 4PY8I 1EHNA 4MCYB 3BQUA 2J4WL 1W0WB 2ADIA 3HNTH 3A6OA 4EZMA 4TPRL 1FNSH 5C0GB 1IZKA 3ULVD 4KI5C 3HAEB 3L3JB 1K85A 2V9TA 4JJ5B 1JRHL 2DBLL 4PGBA 4GT7A 1CZ8L 2BX5A 3MLSL 3ARBD 3GIVA 3VRIB 4Z7QF 3KYOA 4PP2A 1IC4L 4GKNA 4M9OA 1R5VA 5EUOA 4QHNB 3HI5H 3V5KA 3T8XB 4HC1A 1IC5L 5D2NA 1BAFL 4U1KB 2ZUQC 1A4JB 5MEOB 1WZ1L 1FFPB 3BSZL 5FOJA 4XAKD 1BP3B 4O00A 2DJ4A 1LO3H 4JO3L 2H8PA 2BRQA 3AY4A 5F9JB 1AGBB 3F12B 3CNKA 1IAIL 4LPUA 4LEXL 2B5IC 3IDUA 2A6DA 3B9EA 5DTFA 3IJHA 4OZFA 2VLKA 3VFSA 1KTLA 3F7PC 2NTFB 1K4CA 2HTLD 3SJVD 1DN2A 4TVPL 3CVIH 2FNBA 1MLBB 7FABH 3W0WE 2DTMH 3PXJA 1PZ5B 3DX7B 1GIGH 2R1XB 3BH8B 4P2RA 4GRMB 4WU7A 3RUGE 4ZMAT 1KB5L 5KSBF 1FO0A 3KS0J 5CLTA 4HK3N 2X9XA 4JFOB 5D1ZB 3QWOA 4LIQL 3O4LB 2L7UA 3IFNL 5JXED 4ONFH 3E3QE 2V2TB 3C60C 3EHBC 3KPLA 1MSPA 3I02B 1IFHL 2CO7B 1U8IA 1KCLA 4P2OC 2CMRL 3RGVD 3KPOA 2DLHA 3PP4L 3IDNB 1G7PB 1A4KA 4N9GB 4F80A 1IGYA 4O5LH 5FYLE 1MCEA 1S7WA 1TZGH 5JA8B 5IW1A 4JFDA 4HAGA 3QNYB 3BRDA 1CE1L 3QIWC 1RIVL 4MA8H 4XPHH 5DEFB 2VUYA 5FO8B 2GJZB 2O26U 4PLNC 3VGHA 4LPTA 5KVGL 4P3CL 2BNUB 1I75A 4WUKH 4X6BA 3BKCH 4YPGB 3PV6B 2IQAB 4F8TA 4DGVH 3MJ7B 3GBMH 1U8JB 3HAEH 1QFWI 1D7FA 4I4WA 1YNTB 5EZLA 4NZRL 5J12B 1J86A 4QXUH 4QHMB 1I3RB 3EOAA 5C86A 4HXBH 2YD6A 2EO1A 3TPUA 5DMJB 4H1LG 1CXEA 4JN2A 3T3PE 4CVZA 4Y1AA 2BSRA 1DUZB 3M8OL 2FD6L 1KLGA 4YX2L 1XF2A 5DRWA 4PRAB 4RMUA 2MHAB 4JFEB 1MIML 1CD0A 5EU4B 1JUFB 3UTTA 2D9QB 2CRZA 4MXQD 1L0QA 1FLTX 4YBLB 2VR9A 5ETUB 5KVGH 2VIRA 3WIFA 3O2WH 2VDML 4Y4KB 5CP3H 1FGNL 4F7CA 4YBHA 3F8UB 1FCCA 4AL8H 1HHGB 2IFFH 1NGXA 3CLFH 1T6WA 4LGRB 3LVEA 3TWCL 1SBSL 3FO9A 1Q72H 1HH6B 3O2VL 3O41B 1J8HA 1H8NA 2L4OA 4P99A 4KKAC 3SE4A 1FIGL 1KYOK 1AH1A 2VQTA 1U8QB 1B0RB 3UC0H 4KK5C 2XN9B 4K3GA 4RGOH 4URTB 4H8WL 2K1MA 1O7VA 4NC1E 5F96H 2NZ9D 4OUUB 1WBXA 3BT2H 1S7XB 4Z7OF 4OD3L 1DLHB 3SDYL 5IQ9B 2R2EB 2VABA 1VEOA 2EDKA 2ICES 2QV2A 5CBAB 3KPOB 3S5LG 1KIRA 3B9KC 3KXFA 4RMVA 5E5MB 6CGTA 1MAMH 3WJLA 3M17B 3HE6C 4R7DA 3QXTA 5HVGB 2VERN 4ODVL 2QQLL 1Z0NA 1CFVL 3QDJB 3IFPA 5MERA 4OCWH 4PJ8C 1HKLL 2H32H 3H0TA 4W6WB 4MMZC 3GBNH 1ZT1B 2UZXB 1UCBL 4MAYD 3FB6A 1T2JA 4UILL 3LS5L 3G04A 2PW1B 1MPAH 4HKZB 4XWOD 1JYWA 3RVVD 4N90E 1OP9A 4PJIE 5I74C 5IMKA 5TH2A 3SDDB 3MQIA 4KWUA 4J3OC 4JVWA 1T80A 2DQJH 2EH7L 4GAJL 3C5ZB 4QLRA 5F7LB 2C3GA 4Q9QL 4NKMB 1NDGA 2X9YA 4JAMA 1NFKA 2HTLC 5C3TA 5FM4A 4LCIL 2MMXA 2B2XH 4FZEL 3HR5B 1INEH 5D7LD 3WIHL 3RX5A 1RUML 4FQXD 1ZV5A 2P24B 2YPKA 3CLEH 5KTEL 4X6DE 5KVDL 1C7SA 1G1CA 5F9DC 1A2YA 4O02L 3RWHA 5FK9A 2EYSA 1KG0A 4LARL 4LKXA 1HCVA 3BZDA 4NYLA 4RMTA 4YBQC 4HXAH 4C83A 3K2MC 4S2SB 4YAQB 1NCDH 2NXYC 2BOCB 1RSFA 1BFOB 2R1WA 1CICD 5C0DA 2I5YH 5EIIA 4U1LB 1J7VR 4I3GA 5I8EA 3IT8D 4OV6F 5T1MB 1BZ9B 3UTTB 1C5BH 4ZO7A 3MTRA 3FZUC 2AI0L 1X5JA 3DUSA 4TSAL 4KJPD 4GH7B 1N6VA 1YECL 2O5XL 4PV8A 1C12A 3ARDB 1EXUA 2C1OB 3RRQA 4YHIB 4XVTL 3R0MA 1FZKB 3MJ9L 1NGXB 1D9KC 1KB5A 2ZPKL 5IW3A 3FTGA 4PRHD 2ADGA 2M26A 3CC5A 1P7QB 3TIDA 4LASL 1FL6B 5C9KA 3ZKXB 4HUXB 2V6HA 1G7JB 3BPCA 4O2CA 1I8MA 3QHFL 2CKBA 3V8CA 1T1ZB 3DX9B 5DMKA 4OI9A 3JTSA 3ZTNH 3KYKH 3ULSB 4R6UA 3GBML 3MV9D 4S10A 4UT9L 1ZKAA 1K8IB 1JGUL 3I3BA 3RPKA 1DBML 5C0EA 1CDHA 4OZFH 1SEBB 4Y4HA 5GIRA 3UCRA 4YDLB 4OJFH 4MJIA 1H5BB 5F1NB 2PXYB 4DKFH 3HE7D 2I27N 4HWBA 2F58H 2F53B 5CEZE 1CE1H 5J1AB 1AKJD 4L3EB 1NCBH 5C0AB 1CXHA 4DCQB 3VE0B 4NQCD 5I75C 3BP7B 1E4KA 4QRUB 1V3MA 2NPLX 5I1IL 3VG9B 4PJDB 3HRZA 3FMGL 3ARSA 1OB1B 2VDOH 4YGVA 3V52H 2XICA 5HGAA 2WUBH 1G7IA 4Y16D 4HXBL 1DBBL 4MNHB 1ZTXL 3WE6A 4APQA 2D7QA 4NHUA 1WBYB 4J3SA 3X3FL 2ICEA 4ZFFA 3QCUH 4HK0B 2Q86A 1ES0A 5IM7B 5DQ9B 3BGMB 2V2WA 4Q0XH 1KLFA 2HVJB 2O5YL 3B9KD 3D0VA 1IBGL 1OAKH 4JHBA 2CDEA 3WS6A 5C0CD 4HHAA 4LAQL 1JNJA 1JWUA 3KGRA 2DLFH 3IDIB 3C5SB 1FO0H 3VRLF 3CVHH 4L8SB 3LKQA 1CE6A 3AGVA 3LQZA 3I02A 3KPTA 1UJ3B 4KUCF 3MV9A 3BGFC 2VLKD 5IB2B 3Q6GH 3EYOA 1MFDH 2GTWA 4C57C 3BO8A 4U1JB 1TITA 1KEGH 4QRTB 3VXSB 1T0NA 5IB5A 2IANE 5CD3B 3P9WB 4PUBL 2H32A 3DMMD 4I0PD 4MA7L 1UZ8B 3PWJB 1QLRA 4BFIB 3ZMRA 2OJEA 1X3DA 2EIZA 1NH6A 3I3EA 4LLUB 3MJ6A 3MOQA 2GCYA 4ELKB 1CVRA 4JHZA 4LIQH 2NY7L 3BUYB 1S9VA 2F53D 3HMWL 2HVKA 4F7MB 3JBG7 1KTRL 3QPQC 1ED3A 2BVEA 3MRMB 4LSSH 1FG2A 4KY1L 5E6IA 3OSKA 3PL6C 1QEWB 3RVUC 5EBMB 5I8CA 1KTDA 1F58H 2HLAA 5I18H 5I1AA 4HIHA 3UPRA 3AXLB 4TNWK 4ZO6A 5MP6H 4GW1A 4YFDB 2R4SL 3SKNA 3RDTC 4JPIB 4M7LL 2C7UA 1C08B 3DYMA 1QQDA 1CK0L 1GGCL 3OTTA 4JFHE 5FYJD 1SJXA 3KPNA 4Y1AB 1YEEH 5MP6L 1PG7W 2HFTA 4G8IB 1AP2B 4QTHA 3RX7A 1A02N 4B7LA 1FVCB 4H88L 1RZJH 4CDHA 1AR2A 1NUNB 5CZXD 4HJ0C 3RTQA 4MXVF 2PCPB 3C6LB 1M7IA 4P46D 4JG1H 2VDNL 4PGCB 4MWFA 3FOLA 1KULA 1GGIH 5EFIB 3S88H 4LCYA 2Q8BL 3VH8A 4GS7B 4LBEA 5LVEA 4GKOA 2FGZA 5HGAB 1RUMH 2AQ2A 4O51B 2NNAB 1W8NA 3THML 2XPGB 1DSFL 4G6JH 1ZGLM 4I0PA 4M61A 3ULVE 1BQSA 3A0OA 2GK0A 3LRHA 3D6GA 5FKAA 3QG7H 2W0FB 2FIRT 2VKXA 1A4JA 4Z0BH 3S9DB 3WFBL 3G5VA 4WNQB 1HSBB 4XMKL 2VDPH 1RZIA 5HY9B 5FHBL 3LQAC 5AWNH 1DANT 3L9RA 1GHFL 1MCSA 4ZDHB 5K33A 3O8XC 5D6CB 4PLKC 4DN4H 2FZ3B 3HCVA 5K9JL 4OCWL 2AJ3A 3N9GH 4XAKE 5LG1A 1EO5A 5HGBB 3S3SA 2PUQT 4H0HB 4UIMA 1GYAA 1I9RH 3QDJA 2P8MA 5IW6A 3QRGH 4Y2DB 5JIHA 4HBCL 2DLEA 3WS6C 5DYOB 3OB0H 3SJVE 2PR4L 3TV3L 5IVZB 4N8VB 3PNWB 5KANG 3D9AH 3W0WD 3KXFE 2FBJL 3O6FD 4UT7H 4OSUL 4R97C 1H3WM 1OM3H 1K8DB 4RRPG 2QQNL 3QG6A 1TETL 3IXTB 1V3JA 4Y1AE 3NACL 5F72S 1WT5A 1P2CB 3GMQB 1UWEH 1YMMB 4K94C 4EXPX 1YNKH 1UB5B 3LQMA 1T1WB 4FXLA 1X5YA 3U0PB 3M45A 4AEIL 2H2SD 1J1XL 2DD8H 4DQOL 1NBVH 2AQ1A 3MV8E 2Y5TB 1PG7L 2CK2A 1OHQA 3MO1A 3TVMA 2XQYK 1FL3B 2Z0BA 1FORH 4XTRC 1FFNA 5E8OB 5AUMA 4E41A 2ZUVA 2DWEB 1F6LL 4QEGA 2CLZB 5KW9L 2J8UA 3MGOA 4I2XE 5DS8A 1B2WL 1ORSB 4U05A 4JO2L 5BRZE 4JQXA 3QFDB 1BJ1J 2QR0B 5DQJA 4X99B 1XZ0A 5GJTL 5IK3B 3BEVB 4PJEB 3NCFB 5JHDB 2GSIA 2ARWA 3PABA 4BM7A 5CJQL 3DUUA 5KSBB 5DUMH 5BQ7B 3RVTC 3QQ9D 2ZCHH 5K59E 1IVLA 3ALPA 4GAYB 4KTEL 3RDTD 4RMSA 4LKCA 2APBA 4FQJH 2Y06H 5DVMA 3UTSB 3ABZA 4AEFA 4BA8A 1H3PL 1MJ7H 4LQ1A 4JQXC 4ZFZA 4YEFA 2X4SB 2BOBB 4PJHA 5EIVA 4WWID 1F2XK 2NCMA 3TZVC 4ZFOB 5E2UH 5FB8B 3WFHA 4R0LB 2BSTB 1J0ZA 2ED9A 5GGVH 5DJYB 4P23A 4XMKH 2BNQB 4YDIH 5D8JL 5E2JA 3DRQB 5D6DC 3PJSB 3GM8A 43CAA 4X6CA 2WBJA 1E4JA 5LGJB 1TPXB 4LNVA 4CN4A 2FYYA 5H37G 5TF1L 1VEPA 2EKJA 4NT6A 1ND0A 2A73A 4G9FA 3KLAB 3MLRL 4HLZG 5GS0H 4QO1A 4OLEA 3TBYB 5INDA 3AREA 4PJDA 1I9IH 2EDHA 4U6XB 1JI1A 4QY8A 4OZGF 1C16A 3OKOA 4XH2A 1KPUB 1D5ZA 1LEIA 3A6BH 3C09C 4TTDD 3I6GB 4PJIF 5C0IB 4P9HL 4K3JL 3GBNL 3O2WL 1ZGLP 3X3GH 3C8DA 4H88H 3MLXH 3QULB 2IH3A 4GLRH 5I76B 1WWWX 3O6FA 1I85A 3E3QC 5EOCL 3GM0A 1G0XA 2Y5TA 4PFEA 4XX1E 3WN5A 2DB8A 1ZA3B 4U2YA 4RX4D 4O58H 3TYGL 4FN0A 3WIIL 4U0RC 2D31B 2PKDA 3ROOB 4YXLH 3KHQA 1KYOJ 1UXWB 5IBLD 4OIIL 4Y5VC 3U4BL 3EGSB 1KC5L 4N90D 1WZMA 3MREB 1CD1B 4JRXE 2NY7H 3FO9B 4KK6D 5JHDA 1T5WA 5B39A 3MRKB 5J4MA 4RAUA 2VZ1A 5TQ0H 4K9EL 5C1MB 2NMSA 1K5NB 4OZIA 3MODL 5FA4A 5DUBA 1DP0A 2WQ8A 3JUYA 5HHOA 2D7OA 1UEMA 1J1XH 1VACA 3QDMA 5D7LE 1RK0B 2O61B 3TVMC 5JW3L 2J4WH 1U8HB 5DJ6B 1NBZB 2AAVA 4TOYH 2YPLB 2IH1B 5GGVY 3I2CH 4N5UA 4GAFB 4RIRB 4TTDC 1TVBB 2G9HB 5HYSA 4NDMA 3SKNB 2P43B 2PYEB 3O2DH 4L9LB 2C1OA 4ZPTB 35C8H 4OF5A 1TQBC 5BV7B 3EO1A 4JPVL 3G5XA 3P30H 1U0QA 5E8PB 5BZDA 1F8TL 1MCPL 3GBLA 5IR1B 4YE4H 2AK4D 4JZJA 5D2LF 3MZTA 1H8OA 4PRBA 2R8SL 1FNEA 1RJZB 1EBAA 3WDHA 5J7CC 4HKJB 1MRDL 1T1YA 1UH3A 4OM0L 1NLBH 2ITCB 2W9DL 3MJ9A 5F89B 1MI5A 5AEAA 3D9AL 4DVRL 4NUGL 3BP6B 4TNVK 4YNYA 5HI3D 1R3KB 5AZEH 2GUOB 4KRNA 3CMGA 3IAQA 4H8WC 1WFOA 3T77B 1Q1JH 3ZDZF 3LZFH 3JWDH 4X7CC 4DUXA 4RDQF 1F8TH 1MCPH 2XXCB 2N56A 4MB3A 1YY8B 3QXUA 1QP1A 3X14A 4WTZG 4EVNA 5F7YC 4ODHL 3ALXA 4HIXH 2J8UF 3MX0A 4M9PA 1UKTA 4LVOC 2J8UE 4I2XA 4P4RB 3MV9E 4R4NC 1H3GA 2C1PA 3ZKMC 1Z9LA 4AEHH 4KQ4H 1JHKL 1XEDA 1JNHB 4I3SL 3GSQA 4PRHB 4F9PA 2A74B 1GOGA 4EIGB 2R56H 1WZ1H 3WNOA 2EZ0C 1A1MA 4LOUC 3EOBB 5CEZD 1MCFA 4NQCE 4MQ7B 1N0LA 1NUFA 1F4WH 4U4BA 4G8GA 1IC4H 2K7QA 2BY3A 2J88L 5HPMB 1SY6H 2EDXA 2PYFB 3MBXL 2ICWJ 5SV3A 3QR2A 1ONQA 3NFPA 1UCBH 5DQ9A 3KPRA 1HXYA 1HNFA 5D96C 3OZ9L 4E0RA 3P11L 4PJHE 3GMMA 3HMXH 4OCSL 4FG6C 1D5BA 3BP5A 5CP7A 2RQ8A 1EEUA 1EFXB 1FN4B 3UYRH 3WFBH 2DQHH 1JPSH 4LDOB 3PG2A 5C0CE 4XPAH 3X13A 3EAKA 1NSNH 3U9PH 5JDSA 4LHUB 1NCUA 4EJ1C 3HG1B 3RIFF 3L3OA 3X11A 2AJZA 3C5JB 3T09A 4NC1C 4KVNL 1I9JH 1MIEH 3OKNB 2R4SH 2GIYA 3WLBB 3CAFA 1RURH 3LSOB 3HZMB 1NMBH 2ADJB 1N4XL 4F15C 2AGJH 5D1QA 4Z7UA 3VFMB 2D7TL 4GOSA 1RK1B 1XCQB 4LEOB 3NCMA 5K9QI 1IAMA 4JY5H 4JG1L 2IQ9H 5E8PA 1N59A 1VGKA 2D7TH 5JW5B 1RY7B 4PRNA 1P1ZA 4DKEH 3AU1A 1JRHH 3WO3B 5HVFB 4NN7B 2EDFA 2HVKB 3KR3L 4LOUD 1PQZA 1WICA 4GMTH 1N0XH 1ZANH 32C2A 3VXUD 1BEYL 5ID1B 2PTVA 2YXMA 4LLDB 4M7ZC 4PRDB 3REWB 1IGIH 4FQIH 1INDL 3QRFM 3GJFA 4YFEA 4EVNB 2GI7A 1UM4H 1IQWL 4G8EA 4KRPC 4OCMC 3O11A 2DLFL 1BBDH 4MA1C 2IQAA 4N0UB 1A6ZB 3DNKA 4JLRA 4IIQC 3H3BC 3V6OE 5A16B 5J9PB 3MNZA 2X1PA 4HUWA 4LMQI 2P8PA 5JPMA 3ARRA 2I60H 2GYSA 4JFHD 5TGBB 2HG5A 2JB6A 4M1DH 2NW2A 3ESUF 4OD1H 4XWOC 3HRPA 1KSRA 1EEZB 3FO0H 5CEYB 2EIBA 1QRKA 1D5IL 4RFOH 4F7EA 3UJTH 1CWVA 3RWGA 3FFCA 3TO4D 5EZJA 2OP4L 1UQSB 4Q6IC 3QZWB 1FAKT 4NO3A 2A6IA 1RZKH 1MFBL 4OZ4B 1N2RA 1KCSH 3CFCH 4FZ8L 2V7NB 1QSFA 4LRIC 2FJFB 4P9ML 1G7QA 1AIFB 3VGEA 4M6MH 5EORH 1FV1B 2O5ZL 3PP4H 2DQEH 1U3HA 2V2TA 1B9ZA 1J1OL 4QXTB 3GMRA 1ACYL 3E6HB 3H9SB 3IETB 5C0IA 3VFRA 3QIUC 4Z76B 3L5WA 3L3IB 3REVA 3BPNC 5KS9A 1CICC 5E08H 1A6TB 2C7UB 2F5AL 5LCVL 4Y5YC 5DK2A 1S7VA 5I73B 1INQA 1I4FB 4NYLB 1DBMH 2XKUA 5BJTB 3G6JF 5I2IA 3LDBB 1TFHA 2DTML 3C9NB 1N5AB 1UM6L 1T03L 4WW1B 4Y89A 5HHVH 1MLCB 1G6RL 3ULUC 1TETH 3OKYA 5F7FA 2GJ6E 5TQ2H 3O4LE 4OI8A 2VL5B 5E24E 1T03H 2DIBA 5HDBE 2VUOA 2L7JA 1AO7B 3HS0A 4NZRH 5C0RL 2OK0L 1S7SA 2YA2A 1NANH 3L5HA 2Q76B 2Z4QA 5T5FH 1T7VA 5DVLA 3KXFD 4UBDC 4MNGB 4PJAA 4NUJA 1IKNC 2BVTA 4HW6A 1MY7A 3L95B 4ZS7H 1YMHB 4Y1AD 4C54A 1XGYL 3L3JA 1QO3A 3QUXC 2B1HH 3QWRA 4S1RL 5F9OH 2I9TB 1BD2A 5EOQH 2EDNA 5I1GL 2E7HA 2OTUA 2AEWA 4M6ML 2FX9L 2WIIB 2IADB 1FJ1A 2GHWB 2UWEA 1U8OA 1OAUH 4M6OH 4OQTL 3MV8D 3QEQB 5ESQB 3NCJH 4Z77B 4WDIA 1RIHL 5ENWA 1BVKA 4DGIH 3I50H 5ICXB 5H94A 2IANA 3FQRB 2LAAA 5EA0H 4G9DA 1JL8A 4D9RE 2QQNH 1WQVT 4K07A 4A6YA 1XGPB 1OGAB 2DIAA 4PGDB 4H20H 4JVPA 1L7IL 4DK3A 4FNLH 3RWGB 4AQOA 4WO4D 2C3VB 3EYFA 3GDBA 4RFNC 2FGWH 4Z7NF 1S9YB 4ELMA 3Q2CA 5HDBF 3P4NB 1Z9MA 5BRZD 1KB5H 3FB5B 4PG9B 4OV5A 5DRXA 5HYSG 1EAJA 1D5XB 1L0YA 4DZ8B 3MNWB 2B0SL 2R9HC 4PGZA 4WV1C 1WAAF 4DVBA 4ENEC 3GMPB 3GGWA 4PP1C 4CVUA 4WTWA 3KYNB 4J23A 3ULVH 3TBVB 5JQHC 4ZAKD 3S3PA 3RTQD 1J10A 2Y25A 3PIQA 4ORZC 5F6HI 3LMJH 3SPVA 3ARQA 3RZCB 2YUZA 4RNRB 4Y88A 2FR4B 4N0YH 2WV3A 2XA3A 2C3HA 3SDYH 1PG7X 3GSUB 5JPNB 4MQTB 3HI5L 4PD4J 4G9FB 2DYPA 3NN8B 4KTDL 4UQ2A 5IFHL 4JY5L 5I1EL 1PEZA 4N1HB 1W0VB 4NQSA 3MGOB 5DS8B 3RJQB 3ME0A 4LLMA 3C2AH 4GBXB 3SOBL 5IJKA 3MUGB 2Q8AL 2UZIL 1UYWL 5GXBB 3NAAL 5DSCA 1LO5B 3QEGL 4D8PA 2YRLA 2Q8BH 3GNML 3W39A 1KPVA 1UENA 1DCLA 5EOTB 4F7TB 4UDTA 1BBDL 4MNGA 4DN3L 2HFGH 3GSNB 3RIAF 4ETYA 2VN4A 3WIIH 4KJYA 2X5PA 4BKLA 1RUAL 3O45B 2Z91A 2AXFA 2EE2A 2YD8A 2C4FT 4IRJC 3KYMB 1RJYA 2GFBA 4ZUTB 1G84A 1ZA3A 1Q9KA 4LVHB 1YQVL 3TN0A 3MNVA 5D7JC 4BH8A 4LLQB 1KJMB 4ZFOA 3NCYP 4XPFH 3SE8H 1I7ZB 4JPIA 3T0VA 5FOBB 2EDQA 4AIZB 3U7YL 5CZVH 3Q3GB 4P57A 2X7LB 3HC3H 2JCCE 1X5IA 3TJHD 5DT1H 1T22A 1W2KT 3IAPA 4XXDA 3SE3A 3RTQB 3UJIH 4F37K 3QNXA 3F65A 4LCWE 3CCHA 2BXZA 3ZKSD 3AS3A 1FSKB 5DJAB 3RDTB 4X6DB 1HEZA 5IGXH 3EYOB 1FO0B 1H5BC 3PF2A 1FFRA 5HHOB 4JRXD 5DUPL 1XGQB 3ARFA 3C87A 3W11D 3ARBB 4H5SA 1F4YL 1BOGB 4I18A 4OZGB 4G80B 2H9GB 2XWJA 3OXSA 4MYWB 3R06A 1PFCA 2HRLA 2D0FA 3WNKA 3AM8C 1TXKA 4YDJA 1TZIA 2EE9A 3GKWL 3BHBA 4PJ9B 2VQ1A 3JXAA 3Q0HA 2CGRH 4HCRL 3DBXA 2G75B 5CJ8A 2OP4H 2NXZD 4TUOB 2UVFA 5CSZB 4YK4C 1KIRB 1NC4A 3KXFB 5E5MA 4HUWB 2LABA 2ZUYA 4PJDF 1G6RA 1IJ9A 2VDOL 4IMKA 2XA8L 4HKJA 3RKDD 4ONGH 3MLYL 3GIVB 2ICCA 3ZE1E 5C0JA 4PP2B 4KHXH 4LMQE 1OW0C 1I8LA 4XVJL 5AZ2H 1XGRA 2BCKB 3U46A 4P5MB 4Q2ZB 3PHOB 4PJ5A 3BIKB 4O9HH 3QB7C 2AK4E 3RZCD 2R56L 2YUVA 3SGJA 1NCBL 4I1NB 3U1SH 4I3SH 3R8QA 1NCTA 2E6PA 5DLML 1WBYA 4XI5D 3VFNA 5EULV 3ZKND 1U6AL 4QGTA 2RGSA 2CLRB 4GRLB 4YHNB 1CT8B 1ZWIA 5JZ7D 2V7NA 3WO4C 1EO8L 3ISWA 1YEGL 1V5JA 3HUJA 2NXYB 1JWUB 3BAEL 2A9MH 5EUKA 4FMKA 1U8HA 3OB8A 3V8OA 1J0IA 1QSVA 5C2BH 1AJ7H 1A3QA 4Y8AA 2Q8AH 4DVRH 5GS0D 5A3IC 3QHZH 3BH8A 4P2RB 4WU7B 3WCYA 5HYFA 1MHCA 3NOIA 4QHLB 2ZOKB 2QBWA 1I7ZA 2VQUA 1ZLVK 1P6FA 1EEYB 5D1ZC 1AXTL 3OGCA 2WWMD 1FIEA 4KKLC 3OR6B 5DR5H 3ARBC 1K2DB 1XIWA 3U30C 3QJHB 1AXSB 4KHTL 1NBQA 4MGXA 3S6CA 5IEHA 5C6WH 3SCMB 5IB5B 1A1OA 3MRDA 5IR1A 4P48A 3AS0A 2NZIA 3IGAB 4OGXH 3QH3A 4JZOB 5T1MA 1WIOA 1C5BL 3BEWA 1QPPA 1OGTA 5CHNB 4CBPA 2YK1L 2JCCA 3OJ2C 1UGNA 5HJ3B 3C08H 4M8VA 5I1LB 1ITCA 2AEIT 2CUMA 2VDKH 4L4TB 4MQXD 4NC0B 3DSFH 1N5YL 3T0EC 4UTBH 1EAPB 1DVFB 4XBPB 3L1OH 4L3EE 3SE9H 3T65B 1ERNA 2ZJSH 1HHKA 1VA9A 5C6TH 5HI5C 1AGFB 4P46B 2R39A 2XFXB 1OP3K 4YDJB 3MLVL 3QEUB 2DRUA 4OKVA 4R26L 5TE4H 4R2GD 1JGEA 4GKZA 4Z7UB 3VFMA 1NAML 5C07D 4O2CB 1I8MB 3IYLW 3KPRD 3KPNB 4HLZH 3FN9A 5FF6A 1LNUA 2NW3A 3KNBB 2A9ML 4R7NA 4Y5XA 4YXKH 5F7WC 4OD3H 4PR5B 2IADA 4C56B 3M1BA 4N0CD 4HG4J 1IGCH 2A6DB 1C5DA 2LAGB 3FO0L 3CX5K 3OG6B 3ZE0F 4U1MB 1IKNA 3UZVB 1NGWB 1PY9A 1RU9L 4PJGB 3HZVB 3NZ8B 3RIAK 4QGYA 5GJSH 5DEZA 4MA3A 3GZKA 5IV2B 3LY6A 3VXUE 3C60A 2BVQB 3RHWF 2BVOB 1KLUA 4MS8D 3QFJB 4ZS7L 3I6LE 1M71B 1L9MA 5LBSH 3TEUA 2LE9A 3QCVL 3BP6A 4L8SC 5DRZA 3WJLC 3NH7H 4PJAF 4FTVD 1SYSB 4KRLB 2BDNL 3DHMA 2O5YH 4JDVA 3TIEB 1MH5B 1I9IL 3TFKC 3ZTJG 2NQCA 4Z0XB 2JIXB 4OIAA 1N26A 2WWKO 1PSKL 1DQDL 1ES0B 5DD0H 5IM7A 4HDIB 4IBLT 1JFQH 3ZHKA 2NZ9C 2Z31D 1MWAL 4WI9A 4ZUVA 2CJUL 4YHPB 4NC2B 4YWGL 3RAJH 3AY4C 4YHIA 1A47A 3GSQB 3HHRB 3EJYD 4LVHC 4ZXBC 2HN7A 2FH6A 2W0LA 3FB6B 1N59B 1BFSA 4L29B 1Z9SA 1F3JB 4JGJA 1P1ZB 4ODTL 2DKMA 2G60H 5LQBH 4W4OA 3NN8A 3B9KB 5TDNB 3B6SB 3TYFA 4XMLL 2HRPL 3V6ZB 4D0DA 3M17A 1TMCB 5DFTA 4JO1H 3LB6C 3SDCB 4XB8A 4ALAL 1JNNL 4HWNA 2YN5A 1YDPA 3QDJE 2D03H 4KZEL 3E6FA 3RNKB 1YUHB 5DLMH 4KVCL 3GIZH 1L7TL 5EUOE 3QDGA 4HJGA 2P24A 1ZA6A 5ESAA 1QYGL 5LAXA 3MUZ1 1D5MB 1YQVH 3MRFB 4X6EA 1MFBH 1O7SA 3Q1SH 4Z7VB 4FQCH 4JJ5A 4WUUB 1T5XB 4JRYE 5DZNA 4JFPA 3EDFA 1S9XA 4NKMA 2QSTA 4ZUUB 2NW3B 4ZSOB 2APTA 1B2WH 3U7AA 3WUWB 2CIIB 4X5XB 3CFBA 4PJAE 4UNUA 2OSLB 3MRBB 2NY0C 3WHXB 4MNGE 4XNZC 4OT1H 1QFOA 3V5KB 5CJOL 5GRUH 1IGJA 3DMMC 4NN5B 4N0FB 1R6VA 2IH3B 3TJEL 2AI0H 5KAQF 3UPCA 1FVDA 4G6KL 1MJUH 5D1ZD 2GJ6D 4LSQL 3O4LD 4LRNL 4BSVB 4ELMF 3LKOA 1HILB 4GUPA 2OJZH 2P49B 3C2SA 3LEYL 4L9LC 4HPYL 3VJ6A 4PGJA 2GTZB 5E2WL 1RJLA 2ICWI 3QI9A 4P23D 4V1DE 4GLRI 5I8OL 3L95A 4DN4L 5FGRA 5GRYA 4R0LC 4YHLL 3KPMB 4GG6F 1U95A 3FQNA 3VRLE 1U8MA 1CDYA 3P0YH 1YJDC 3FFDA 4U31A 4PJFF 4R2GC 1KFAH 1BFTA 4OFIA 4RAVB 3CLEL 4LPXA 2FLRT 2HMIC 3ZKMD 1I7RB 4K8RC 1E27B 2ZUQB 1SMOA 1AO7D 2VXUL 2YOCA 4OTXL 2R2BB 3L3HB 4RGMB 4L4JA 4QHMA 4XCEB 1Z5LA 4F3FA 3GJFB 5LXGL 1T0PB 5FA4B 1DBJH 4I0PB 1FNGB 1P69B 3GSXB 5BRZB 1NLBL 1YNLH 5IHUH 5T3ZH 4DK6A 4K7FB 4NOBA 2OL3H 5EO1A 2MQ0A 2QHLA 3MNZB 5GGRB 4CN6A 1FC1A 2NY5H 4ELMB 4D9RD 3IJYA 3DXAB 3G5VB 4HJJH 2WAHA 1ULVA 5J6GB 2BY0A 4OZHA 1BJ1H 4N0CC 3HS0B 3LPFA 2AEPL 1F4AA 4NKIL 3GSWB 5F1OB 2HJKB 4GQPH 2ZUXA 4PGEB 4E42A 4ODXB 4JZJC 3QNYA 5SX4H 1AHWA 4OBSA 4JAMB 3ZDXF 3DI3B 2RHEA 2PXYA 2ICEB 3NVQA 1S7TA 4GXUN 1GC1H 1GRWA 2EXWC 3AXLA 5C0AE 1J8KA 2B20A 5JMOC 3NAAH 1MVFA 1DR9A 4AJ0A 1EGJL 2IF7A 3THMH 2R69L 5FEBA 5I66B 1YZZA 2VITA 1OWWA 5EZLB 3NA9H 3UAJD 4J2XA 5ITBL 3NZHL 1JCKA 1JPST 4BQ6A 3QIBA 4WEUD 3JV4A 5A2LH 3MRRA 5HHPA 2OM5A 4ZFGH 3WLBA 2PO6B 1U8PA 2DL2A 3O0RH 3CPLA 1UWGH 2A6JB 4JB9H 1FNLA 1W72H 4LBEB 1TTGA 2NY2B 3FKUS 3S36X 2VB5A 4JRYA 4NN7C 4QRTA 2E9JA 2YK1H 1G9NH 1S7QB 4JEGB 2EH8L 1N5AA 1KCUH 3MJ8B 2V5MA 1Y0LB 4AEHL 5I16A 4GO6B 5F44A 2GK0B 3IS0X 3IDNA 1KCVL 1G7JA 3MV9B 4N9GA 3ARGA 3UYOD 4MCYA 2CPCA 4L8BB 4PJEA 2X4RA 3MRHA 4HX1B 1CBVH 4PLJC 2AEPH 3K3QA 5F7MC 1ONQB 3NIFF 3ZE2E 1NFIB 1GXEA 3PHSA 4FFVD 5EBMA 4ZXBB 4LSQH 4M3JA 1AY1L 4BQ8A 2VWEC 5FYLL 1NEZG 3VFPA 1YMHA 4TRPH 2VLRA 1S9WA 5GRUL 5EB9A 2HTKD 2E5EA 2X6MA 4XXDB 1DQJB 2XRAL 1NCCH 2E27L 5C2UB 2P8PB 1H9VA 3TPKA 1P84K 3AROA 3MRPA 2XTJB 2DQFA 3HZYB 4L4TD 2CGRL 4PBWD 5TPWH 5BV7H 5E99H 5HHNB 1GHFH 2R2CA 4NM4L 2VDRL 4PRBB 1NFDF 5JNYB 4RGNC 5C0BB 3FFCB 4LCWD 4XCFH 5FKPA 3GIZL 5MERB 2I07A 2DM3A 5DJYA 3SGKA 4QRSA 1YEIL 3HUJE 4O51A 2ATKB 3BD4A 2NY1C 3WXWH 5A2FA 1NDMA 1LDPL 3GMNB 4MDJA 1OTSD 4NQDA 2X70A 2BVOA 3CVHB 4NUGH 3GHEH 3CFDA 3C5SA 5D7IB 3BZ4B 3LRGA 2D3VA 1U3ZA 2A9NL 5E8NA 4EDXA 1R5IB 3WIFB 3I6GA 2GJ6B 5GGSA 1P53A 3P30L 1XF1A 3JUZA 3SDDD 4PLJD 4Y4FC 2IPKB 1JPGB 4PJCA 3S35H 1ZS8A 4AIZA 1FZJA 3QPQD 4CDGC 4PBXA 5FYJH 2X1WL 1S7VB 4Y19E 3O6FB 3WL9A 3QFDA 2VE6A 2FR4A 4JVUA 3CXDL 2AP2A 4JCLA 2R29H 3GMLA 4WHYG 4NBZB 1KACB 2PYFA 5IMOB 4OUUA 4X6DF 1JK8A 2KH2B 1SJVA 3MRJA 3TC9A 2C3WA 4OGAD 1S8DA 4F8QA 2CUIA 1U8JA 4HPOL 2JJUA 1HYSC 4ZFGL 4HUKB 3MRIB 5DD6A 1BPVA 1KENL 1QZ1A 4X83A 3OJVC 5D1QC 4D8PB 4BZ1H 1DBKH 4XBGA 4JREC 3ULUL 4LCUA 1T66C 4EBQH 1KJ2A 3W2DL 5I17B 5MEPB 4P4KD 1YMMA 4HS8L 3P9MA 3L3OB 1AD9A 3MXWL 1AGEA 1XGTB 1CVSC 3X12A 4K3EL 5LAXB 2ZSWB 2DI7A 4P49A 1IFHH 4PS4L 5HVHC 4R90H 1MCKA 3C5ZA 3KAAA 4R4FL 4LSVH 1TCRA 2BSRB 1ZLUK 1PKQA 3SGDI 5I15L 4WDIB 1KLGB 1BVKB 1WSST 3UMTA 1RULL 2GAZA 2HA1A 4FXGA 1I8LC 3L5WB 4WO4C 4E9LA 5KS9B 3QXAA 3SDAA 1SVZA 1A6TA 1F4XH 4PTTB 4CNIA 4HF5L 2VDLH 2YPKB 3PHOA 4IEFB 4PRNB 4QYOA 1RZ8A 3OZ9H 3UYPA 1AI1L 3BKJL 1F4XL 3T0EA 1FVDB 1FZMA 1RV6X 1L4IA 5GGTA 3L3KA 1BLNB 2Z8WC 3DURA 5E8EA 3VD7A 5I9QC 1A7OH 4NHCL 5E70A 2XZCL 3AS1A 2ADIB 3C8KA 4QOKE 4H20L 5JLZB 5CAYB 3TGXA 4LGPB 1RVFH 1NCWH 1OF2A 2YBRA 3EYSH 3C8HA 5IJKC 4MXQC 1WFNA 1RU9H 1AKJB 4L3ED 5CJXC 1OB1A 4YGVB 3MACH 4P2QE 5JQ6H 1CR9H 3MLPA 3LHPH 5JIPA 1T4KA 3I6KA 5FA3A 4DGYL 2CLVA 2MNUA 3F7VA 3UC0L 1QEWA 1W72L 4LK4A 5FIEA 4PJDE 5ALCL 4XNXH 5GRVL 2W1NA 1RVFL 2G2RA 5C07E 3VFTA 3BX7C 1LHZA 2OZ4A 2NY0D 3VI3F 3KPRE 2HG5B 2JB6B 5CCKH 1T7XA 5KSBA 4Y0GA 4P0DA 5E2VH 3WKMH 5CBAA 2FJHA 4NWTL 3CJJA 5FM5O 3W0WA 4JQVA 2WK2A 1ZLSH 5I1JL 1HK6A 4EI6A 4J3XA 3EO9H 3UZEA 1CD1A 1IC1A 4FFZL 5HYJB 5KSAC 2X41A 4KGJA 3GRWH 3MCLH 4R96A 1OGTB 4L9DA 4TPRH 3VRJB 2H1PH 3FQWA 3IXAB 5EBLA 1W0VA 4NQSB 3CZFB 3VGDA 5T1KA 4GW5B 2GTWB 2YMXL 2N1KA 4KTEH 1A6PA 2XN9E 5F7DB 2I26N 5E00B 4OLVH 3M8OH 2VOTA 2VJXA 5DR5L 1KPVB 2APVA 3MBEB 3I6LD 3MGTB 1EUTA 4OCSH 3D39D 2F54B 5AAMA 3G6AB 1IAOA 3N06B 4FTVE 1MFCL 2VWEE 1HIMH 2ZSVA 2E9IA 5M94B 2N7AA 3WEXA 3AAZB 5EZOH 2D2OA 2PR4H 4HIEB 5C92A 3H7BA 1QYGH 1R5WA 5FM8A 3X12B 5F8RC 1Q72L 3WDIA 2OL3L 3R4DA 4JQIH 3SY0B 3PV7A 4OZHF 4U6XA 1AQDB 3P0VH 3VXRE 1A1NB 1FORL 4P3CH 5HHOE 3VGAC 1FAIH 4RCAA 3WYRA 3U0TB 4RBPK 3T4AB 2FHFA 2R23A 2P44B 4S2SA 1PG7H 2LU7A 2OMBA 1IM3A 5F89A 1LEGB 4UOW1 3X11B 4C4KO 2V5YA 3V6ZA 4D0DB 4JG0L 4W81A 5CKGA 2YRPA 3BDXA 5D7JD 3VXOB 1M4KA 3NZ8A 4YQXL 5CCKL 3N0PB 4FQHA 3WKNA 1CGYA 2BRRL 2H3NB 3MCG1 3UO1L 2JB5H 5H2BB 3DETC 3VDBA 4PP1D 4UQ2B 3LQZB 2BNUA 1G9MH 4X6BB 4MZ3A 1KIQA 3V7AG 3CFIC 4POUB 5EC2B 5KN5A 4N8VA 1VDGA 1OF2B 1Z6JT 5ID1A 3QDJD 5IKCB 2HT3C 4XCNB 1IBGH 1OAKL 5IGXL 5IBTH 4LPWA 1PQZB 2ED8A 3KPSB 2ICWA 3TJEH 2LTQB 3B9VA 3ARDC 2H26A 4HS6A 3JTSB 1OT2A 2BSSB 1HHKB 4NCC1 2AXHA 5I1CH 2AABL 3EOBA 4HLJA 4YH6A 1IGJB 4NFCA 4YIQA 4OD1L 4JRYD 2YD4A 4KGLA 4WU5A 2DIJA 3UTQA 3P73A 3LN4B 4QF1B 2FEDC 5CS7A 4NDMB 1VHPA 3T3PF 1Y18B 2FJHB 3S4SA 4NBYB 4LL9A 1YEHL 4UB0L 4LEXH 1YPZF 5CWSA 4G8FA 5IQ7L 1U3HC 2F58L 1JZ6A 4KV5F 4Y4FB 3VE0A 1CYGA 4Y16C 3U46B 2YWZA 1E6OH 5DK0B 5E6ID 2CLZA 1Y6MR 4PJ5