1RZFH

Crystal structure of human anti-hiv-1 gp120-reactive antibody e51
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
218
Chain Sequence
b'VQLVQSGAEVNKPGSSVKVSCQASGATLNSHAFSWVRQAPGQGLEWMAGIIPIFGSSHYAQKFRGRVTISADESTRTVYLHLRGLRSDDTAVYYCASNSIAGGYYYDMDVWGQGTTVTVSSASTKGPSVFPLAPTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab E51 light chain
molecule tags Immune system
source organism Homo sapiens
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
total genus 50
structure length 218
sequence length 234
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzfH01
1F4WL 2ZCLH 4GLRH 4X6CF 1L6XA 1W0VA 4APQD 2VABA 5D1ZB 5JA9A 5H94A 2G5BB 3DVGB 4L29B 3QQ4B 4AEFA 4F15C 2GW5A 1IAMA 2YPKA 1TNNA 4U1SA 4XCYB 2J7LA 2HKFH 4LCCC 1I3RB 3L95A 2NY2D 2G5RA 4OLVH 4U7MA 5FGRA 1QYGH 4MA7H 2AEPH 4KKAD 1BZQK 4Q0XL 4JY4A 4MCZA 4FQXD 4PJXB 4S2SB 1RMFH 5KSAC 3MRQA 3MQIA 2BY3A 1BBJA 1UA6H 4NCC2 5F97E 5L2KD 1DVFC 3SGJA 1N59A 2LVEA 3PG2A 3KPSD 2VL5B 4NRZB 4MNGB 1XGPA 3VFWA 3GSUB 2IH3A 2W9DL 1JWSA 4JHBA 2L7JA 4LSRL 4PBWD 5DQDL 3OKEB 5I1LA 3E1F1 4N8PA 1E6OL 4JFFB 3H9SB 2A6JA 3S35H 5J7CC 3PP3H 3F7RA 4N1HB 2P8MA 3MV7A 4OBRA 4PJ5A 3M07A 3MV9D 4PLJD 5EBWB 3ZHDA 4ZO7A 2EC9T 3IDYC 4V2CB 1F3DJ 1CXEA 3OWEA 2D03L 4HWEH 1IQDB 3W9DB 5HHNB 1NMAH 3BXNB 3HZYB 2UY6A 3LQAL 1NMCC 5EORL 2C3VB 2YA1A 1H15A 4ISVB 4QYOB 4PJXF 3QXWA 4RZCB 4XBEL 5D7LB 5CGMA 4NFCA 4RAHA 5TE6L 2EDQA 1JZ5A 2V5MA 3GMOB 5I15L 2VN4A 3CFDB 1INEL 3ARXA 2E7LC 1F02I 4TQEL 3GGWA 5SWQA 4D8PA 3D2UD 4JPIB 1FNLA 1PG7X 1EAJA 5GS0D 4OV5B 2FR4A 1JNLL 4AL8H 1K4DA 4L4TB 3B6SB 2KBGA 5C08D 1S7TA 2OR9L 4JRXA 4I13B 4U7SA 4LCUA 4WHYH 4Y4KD 4L4VA 4MQ7A 4JZNA 3GSVB 1NSNH 3ARBA 3HN3A 5B39G 1TPXB 5T1DH 2LQRA 2YBRB 1C7TA 5MEPB 3RUGA 5JXAH 4HPOL 1KENH 4OLWL 1FJ1B 3AMLA 2A6KB 1F4YL 4G9DB 2VQ1A 4C83B 1W2KT 4JN2A 3QI9D 4X9FA 5A2KH 3MUY1 5LJYH 3QIUD 5ADOL 4MNHA 2GEEA 3IJSA 4WNQB 1AE6L 4L4VD 3QXTA 3ROOB 6FABH 2DQGH 5T3ZD 3FCTA 4OTXH 4Y5XA 2VQUA 4Y4FA 3UROR 1RQ5A 2VZUA 1GGBH 5IHUH 1E4XI 5C70A 4LKXA 4FABH 5HPOA 4J6RH 3V6FB 3SDDD 3SE9H 1IARB 1KTLB 4JREC 1ZLSH 3LS4H 1MIML 4OLXH 5EU4B 3U2SA 5C9KA 1LMKA 2BVQA 2EEAA 4ZUVA 4H1LB 4M6NH 5IB5B 4UIKL 1FORL 1N8ZB 4UT6L 5FDYA 4YQXL 3FFDB 1YN7A 5HYJB 4OFKA 1HQRA 2APFA 1HQ4A 3UXFA 1KEGH 1F2XK 5D7IB 1AO7D 4OV6F 1NCDH 4BSVB 3GIZH 4O5LH 1X5GA 1I3RA 2ZOKA 3ZKMD 3S88H 3QUZA 1PEWA 4PJ9D 5JQ6L 4W70A 1R5WB 5I1DB 1XGRA 4JB9H 3PWVA 5B3NA 5BVJB 3KJ6H 3VWJC 4YGVB 5TQ2H 3WFZA 1TJIH 1XGUB 5CMAA 5F6IC 1YDPA 2O5YH 4P46D 3QEQB 5J9PA 3RNKB 1EPFA 3W11D 2ZUWA 2YRLA 2XFXA 5HYJE 2YOCA 3BPCB 1F6AB 5TH2B 3S7GA 2VWEC 4KTEL 5ESVA 2V5YA 1NCDL 4HFUH 2WBJB 2X4OB 4Z0BH 1M7IB 2F53A 4PR5B 1HHGB 3BT2L 2B1HH 3RIFK 3HS0A 5F7YC 3S36H 2DQDL 1QVOB 5JDSA 3WL9B 1Z9LA 3WJJA 4EDWL 1VGEH 4TOYL 1TZGL 5IGXH 6FABL 5IKCB 4NM4L 4Y19E 2FX9L 3PWLB 3U1SL 3QEQE 1C16B 4GW1A 1LNUA 2C9AA 3RUGB 5MEPA 4H26B 1SVCP 3H7BA 3AREC 2ZPKH 4FN0A 3W0WD 3RRQA 5D8JL 3ARFD 4WI8A 2Y7QB 3MROA 3NIDE 3OKLA 5I8OL 2EDTA 2VSDA 4J7RA 4N0UB 4WWKC 4PJBE 3QUXC 2NX5D 3TNNB 2FGZA 4PJEA 4JY5L 4FFYL 4PJFA 3MNVA 4N0YL 2E6PA 4P2QB 3WKML 1FZMB 2KL6A 2MQCA 1UZ8B 1WCBA 2E7CA 3G04B 5CHNB 1AD0A 2YPVH 4AQ1B 1KT2A 1CICC 4LFHD 4NWUH 1MCJA 2EC9U 5SWZB 1NBZA 3WIIL 3IGAB 4LLYB 3QPQD 4AEIL 2IGFL 4KJYB 4JFHE 1ZT1B 4HIHB 2MQ0A 3JV4A 3C5ZA 1DQQB 5C1MB 4GG6B 2XACC 1UQSB 5I75B 1ONQA 4KI5C 1MLBA 1KPRB 4NZDA 5BMFL 1MEXH 1Z3GL 1ZKAA 4D9RE 3FQTB 4MQ7B 1CDGA 3C2AL 1A7RL 4HWBA 1U58A 2VZVA 4GAJH 3ZTNH 2VC2L 1MWAH 1N3NB 1MWAA 3VXOA 1UB6B 5JNYA 2G75A 3SKJH 4EDXA 4Z95H 1G6RL 4LASL 4Y19A 4AMKH 3CFBB 4I3GA 2F54A 5DI8B 4D0CA 4FTVB 4Z78A 3MV11 3U7WH 5MHSD 5EZLB 4OGXH 4C83A 3KLHC 1QPPA 4MNGE 1HYSD 4F33A 3CH8A 1EMTH 3EUUA 5FUZL 4U6XA 2IF7A 2ZOKB 4GG6E 4KJPD 5HHOB 3RWCB 1YMME 3L3KA 1L9MA 3BE1H 3WDHA 5C0BB 4AH2B 1RIHL 3RQ3A 3VFMB 3TV3H 2CRZA 4WHDA 5ACLA 1OD7A 4MAYB 2J8OA 4GAGL 3QZWG 3HC0A 1ZOXA 5IFJB 5DJZA 4K55A 3SCMC 2AEQH 2FSEA 5DRNA 4M3KB 4S10A 3OKOB 4M4RA 3HS0B 3TIEB 3JTTA 4TNVF 5IVXB 4LHQB 1XFPA 2AEPL 1Z5LA 4MA7L 1DVFB 3GMLB 3WXWH 2C1OA 5GS0H 4GAGH 1NGXB 2GI7A 1R5IB 5T3ZH 4GKNB 5D1XB 4RAUA 3K4DA 4HF5L 5FFLA 1EV2E 4D0BB 4LDLB 3UTSB 1JN6B 1Y18B 4XGZA 3CFIC 3KPLB 5I16B 1IAIH 1ZGLB 3U46B 1C7SA 3UPRA 4PV9B 1J8KA 1YYML 4JRYA 4KJWD 5CJ8A 3QO0A 1HSBB 1SYSB 3F7QA 2BOBB 4JFFE 4GRMA 5DRXB 3VD5A 2ITDA 3ZKMC 4M1DL 3MPCA 4X6DB 3ULUC 3QYCA 4NJAH 3HNTL 4XBGA 4XNQB 5KSAA 3TBWA 4NQDB 4RAVB 5E56A 5ITFA 4C58B 3O45A 3FOLB 4W4OC 5DJDB 1CCZA 3U7YL 5JOFB 3AC0A 3RDTB 1MCOL 4OF6A 2Y36H 2VLRE 3WFDL 2NR6C 3H42L 4RWYH 1QFUL 8FABA 3RTQA 3QXAB 4C54A 3WFHA 1LE9B 4S1RH 1UM6L 5E6IB 1FDLH 4F7PA 2X4QA 1JHTB 1YY9C 4KGLA 3EDDA 1JGVL 1UWEL 5DC9B 4IDJL 3P4MA 3ARTA 3WDIA 4AEHH 3VFUB 2FJFA 3PGFL 4KRPD 5FYKH 2PF6A 3BGAA 5GGSB 4FFYH 1IC5L 2OMBA 3B3IA 3CLFH 4U1JB 4PV8B 1S7WB 1JWSB 2LAGB 4TRPL 1ADQH 2XYCA 5CLWA 5TQ0L 4HJGA 2R0KL 1FL6B 2C26A 4YHKH 3LEXB 3MREA 1D5ZA 1MI5B 2RFXB 4S1DD 4HJ0C 4GW5A 3TN0A 3L3JA 1OLZA 3DX8B 2FX7L 4GMTL 4WFEE 5BQ7A 2R2BA 3Q2CA 4NM8L 1QEWA 3VXQA 4ZUSB 4FQHB 2FH6A 5TDOA 4EJ1C 2I24N 4QKXB 4XZUA 5TQ0H 2BNRB 5EIIA 4N0FA 4WWKA 1JTTA 1IC1A 5DDHB 2YA0A 5ANME 2CKBL 3BGFB 3BZDA 5AD0A 5B3JE 1DDHB 1OQXA 4V1DE 3MFGB 4JFEA 4F8QA 3VMNA 2P46B 5ID1A 4P9ML 3MGAA 5JIKA 2PTVA 4XC3H 3T4YA 5HHME 2DQFB 1C12B 4AIZB 2IAND 1HXYA 2DTSA 2YMXH 2HKHH 4Z0XA 3ULSB 3VD4A 3LHPH 4WU5A 3P0GB 4V1DA 2XWBB 2ZUYA 2Q86A 2QQKH 1RK0A 5DYOA 2BVPA 2I26N 1FORH 4UT6H 4UIKH 2V2WB 4HFWA 3W39B 3BKYH 3B2VH 2Z31C 1AXTH 5SWZD 2I5YH 2JJTA 2JIXB 3X11B 3HZVB 1VPOH 2YK1H 3SKOA 4PJ8C 3KYMB 1YECL 1TTFA 3CSYB 5EO9B 5I6XC 1AFVL 2I9LA 5GIRB 1G7PA 3QUML 4DN3L 4OTXL 5JORB 4IRJA 2Q8AH 2XKSA 4RGNB 4WUUD 1PG7L 2R8SL 1OTTD 4RQQA 3GKWH 1O5DT 1NUDA 1MREL 3MOAH 5FYLD 4Y16D 3LKRA 1CF8H 4OQTH 5T1LA 5E6IC 3ZTJH 2IPUK 1FDLL 4DZ8A 3MV7E 4NUJB 3T8XA 5LWYH 2O61B 3TZVD 3IF1B 2GT9B 4XP6H 2B2XH 4QXUH 3CDGA 2R9HD 1T0NA 5K9JL 3CU7A 4MD5A 3MV7D 1S9XB 5IOPB 1A3RL 3R0NA 5E4EC 4OD3H 2X4SB 1QOKA 4NQCA 1D6VL 3UBXB 4ZFOB 1T7ZA 5IB1B 1ED3B 3IVKB 1RZIB 3ES6A 1S7SA 3ZL4L 3A6OA 2EYSA 5B3JF 3S34H 5DLMH 1FL6A 3RGVD 2YC1A 3WFEL 5I1JH 1TJHL 5FV2A 1WICA 4XBPB 1FNAA 1J05A 1GHFH 1HH6B 3IFNL 4DGIH 1ORSB 5E0QA 3W2DL 3AGVA 5CZVH 3RDTA 2BERA 2ADGA 1K8IA 2X05A 1GIGH 3QEQD 5TF0A 3TCLA 3ARBD 4BYHA 1RUMH 4N0RA 4XX1E 5GGUA 1OAQH 2YA2A 1U3HA 5IR1B 2BSTB 5FA3A 2I25N 1LGVA 2F9BT 5C0CB 4YGVA 2A9NL 3S5LB 1JHTA 5EUOA 3MV8B 1UWXH 4TSCL 1I9JL 4PJCA 1IM3B 4LEOB 5ETUB 5I2IB 1UENA 2DLHA 3CD4A 2WWMD 3MA7A 2NW3B 4X6BA 3QUMA 1HZHH 3Q6FA 1I1YA 4U1JA 5E2TL 3NH7H 4P2RD 1PKOA 2AEIT 1RU9L 1YMHA 4K94C 4R4FH 1MWAL 2EIBA 1JV5B 5IBUB 2VLJB 1OM3L 5HYEA 1CICA 3QXVA 3HUJA 5I1AA 1FAIL 3PABA 1BOGA 2IPTH 1QTYT 4G6KL 3QG6A 1L7IL 4MB5A 2AXGB 4PJ7A 1F4XH 3RWGA 4OZIF 3HLAA 5C9JA 4Z7VA 4XCYA 4M7KL 1K5NB 3L3HB 1L0XA 5E2TH 4R6UA 3IXAA 1EMTL 1JWMB 3C5SB 3GJFH 3GKWL 4N0FB 3SJVB 3D6GA 5E2VL 4I0KA 4ALAL 4ZFZB 5HI3D 3IDYB 4WO4A 3TO2B 2VLJE 4RFOL 3SO3B 2XI9A 5ITBL 1PKQA 2DDQH 4OFPA 5I8CB 1DSFL 5AYQA 3CXHK 3MLXH 4FZEL 2VLKE 2XXMB 2OSLB 3MCLL 5IHLB 5D7JC 4H25A 3MO1B 5C09A 1U8LA 2YWYA 3WSQL 4R90L 4ZUUB 2NQCA 4GG6A 4JQIL 4QTIH 4CL7A 4Z7QF 3CDCA 4XPAH 1NLDL 5DJXA 1XGPB 3P11H 4N9OB 1GL4B 1BD2A 5C08B 1A5FH 2YKLH 4PGCA 5IB4A 4AT6B 3R8QA 5JNYB 3WIIH 3D0LB 2IFGA 4LCWD 2ZUQB 2YD1A 4JDVB 3GSQB 2Z4QA 2VZTA 4Z0BL 2H26B 2KQNA 1IILE 4OI8A 3KYMA 4TUOA 2B8OT 2YZ8A 1FYTD 3R1GL 4PRHD 4XMLH 3WLBA 5IEHA 4H0GA 1QLRB 3MUGA 3GSNB 5EU7C 4GXUM 4BUHA 4JZOB 5IIEA 1TDQA 3DTXA 4UNTA 5FOJA 3QI9A 5SV3A 1S9WA 4LCCB 5DFTA 3WHXB 1AXIB 1EO5A 2NLJB 2NXYD 5GHWL 3U1SH 3MJ7B 5H8DA 3S88L 2B2XL 4XP9L 3CDGB 1N2RB 1AIFA 1JBJA 2HLFD 4PJEE 5I1CL 2PO6D 5IF0B 3MACL 4JY5H 3QIUA 4G8IB 3MRJA 4NNXB 1KIQA 2IH1B 3CZFB 4C4KO 2NX5A 3H9YA 4ZYKB 1OSZB 3BD3A 5HYSG 2IALA 1JK8A 4TPRH 1ZANL 5JZ7D 1NC4A 3LN5A 3G6JE 3RKPA 4BQBA 5J13C 4DAGL 4OUUB 4M6MH 4WUKL 4NZTH 3HZMB 2NXYC 3FFCA 3SGKA 4YPGB 1IM9A 2GJZB 3V0WL 5C0RL 3TVMD 2R0LH 1UXSB 3DI2B 3SDDA 4U6YB 5DJ8B 4HS3A 1ZLUK 5HTSA 1K5NA 4M7LT 3O2DL 2BSRA 3RU8H 4QTHA 4MX7A 4O5LL 4MAUL 1I9RL 4X4ME 3ORJA 3CMOH 5TF1H 5AZEH 5DVKA 5HGBB 1S7UA 5D7SH 4KY1H 3TBYA 3MYJB 5CEYB 3TYFB 4MVBD 3KLAA 3UEZA 4CADA 5JR1H 3L3GA 4WFGE 1IQWH 2UY7A 3TA3A 2VUYA 5IFHH 5C0FA 2YPKB 3VXUD 4P46A 2AERT 4LKXB 5F9WB 3GHEH 4OLXL 4YXLL 1ZXQA 3V6FA 3QIWB 1MIEH 1V7NL 1S8DA 3GSWB 1DN2A 4R26L 4FNLH 1NAML 2OMNA 3CMOL 1S9YA 2V17L 4ZS6D 3VFRA 3EDJA 1N64L 3PJSB 1KEGL 1LE9A 5L2KA 4UDTA 3IFLH 1Q9KA 4N8VB 1R3KB 1OTUC 2Z8WC 3FRUA 2ESVB 1GPOL 2DTMH 4RBPK 5I9QB 4WW2A 5J8OA 4YPJA 4OLZL 5DJ0A 1TXKA 3FO2B 3MRGB 1UM5H 2R1YB 1HXMA 1QFWI 5DSCA 2IAMA 4UZGA 3OXRB 3I50H 2MOVA 1BD2D 1WZLA 5FECA 3W0WA 3VWKB 3P77B 1UH4A 1YQ2A 4XP4L 4A6YB 1FO0H 1NCNA 1P6FA 5SX4H 3SGDI 4EXKA 3RVTC 3BKJL 1CXIA 2PW1B 4M9OA 4L9LB 4I2XA 3EYOA 4K8RD 2AJ3A 3CJJA 2RBLA 3MJ7A 3SDCB 5GQBA 4L8DB 3GMPA 3SOBL 1BIIA 4LQFH 4MJ5B 3MRHA 5IWLC 4LCYA 4OT1H 1T89C 4XP9H 5F7UA 2GAZA 5SX5H 3BGMA 4OM1H 5FO9A 1KB9J 3DX6A 1INDL 2J8UE 4F15B 1ZVSB 3X12B 4HWNA 2Q3ZA 3HZYA 4OAWA 4DK6A 1A9BA 3TV3L 3V4UH 1CDHA 3HI5L 2IWGA 3VFPB 4XCEB 5D7LA 3FN0L 3RVVD 3BSZH 3CPLA 5E94B 3QXDA 4M00A 3QQ3A 5EFIB 3WN5B 3QEHB 1JMXA 4EOWH 2VAAB 3T77A 4NC2B 3BZEA 3O3EB 1I1AA 3BDYH 2EKSA 1RZKC 5IJKC 4OF5A 4X5XB 5FA4A 1ZS8A 3TM6A 4GW4B 3U7WL 1A3QA 3MRCA 4PP1C 3AY4C 3SKNA 1JTPA 2FYYB 4U05A 5F1IA 2XRAL 1YEFL 3QFDA 9CGTA 4M48H 4JO1H 4ETQB 5EO1B 4OGYL 1GAFL 4YBLC 1IM9D 1OAYL 1ORQA 4HBQA 5FHBL 1ZHLB 3UZQA 3QO1B 4AK1A 1MHEB 4IM8A 1JF1B 4K8RL 3QUXB 1FNHA 1EEYA 3QUKB 2EXWD 3EDKA 5DO2D 3Q0HA 4Y7MA 4Q6IC 2VLME 2A74A 3QWOA 3QAZC 4LLWB 4YDKL 4WFHD 4PGEB 3Q48A 3MRKA 3VFTA 1MWAB 5HHOE 2DDQL 2AK1L 5GSVB 1MCEA 2PXYD 2ATKA 2EE2A 5DURD 1XF5A 2HTKC 2PTTA 2J8UF 4NPYA 3W5NA 1NUNB 3HRZB 2VO5A 4XCNB 2BVQB 2ZG3A 3VWKC 1T22A 3AU1B 4M8QA 3U9PL 4MSWB 3OL2A 5HYSA 4LLMB 5BV7B 3TT1H 3RX7A 2R69L 3FFDA 3ZE1F 3T3ME 3O81A 1QHPA 1NEUA 3BHBA 1BEYL 4DWHA 4RGNC 4AJ0A 4MNQB 3HMXL 1I1RA 3DXAE 1U8NB 2BK8A 4NQEE 3GUTA 1DLFL 1P53A 4YNYB 2VC2H 1AR2A 3V4UL 4HK0A 3W11C 3U0PA 5TQ2L 4ZXBA 1S7XA 2QL1A 3C6LA 4UT9L 5EH1A 5KG9B 3V6OE 5GS1C 2GYSA 3BSZL 3QDGD 1WBZA 1WTGT 1ZWIA 3DURB 4R3SB 4G6JL 5F72S 3L1OH 4UTBH 3MLYL 1H3VA 1JPSH 1TQBB 2X4PB 3L3DB 4KKCC 5FYLE 4XPFL 3KPLA 5I16A 1ZGLA 2P8LA 4X0KA 3SE4A 2DIJA 3HG1E 2DLFH 4XVJL 2YSSB 4YHML 2PO6C 4PY7B 1RULL 2M8XA 4G5ZH 1P84J 4ZSOA 4MJ5A 1JNHB 3ARYA 2FX9H 3TBWB 4HUKB 2L7UA 5DMJB 4TNWF 1NEZG 3P4NA 3RWGB 3FQWA 2FBOJ 1LEKB 2E7BA 4PGBA 1A7QH 1QSVA 1N0XL 5DMKA 4GMSH 4Q9QL 2NNAB 2V17H 2FNBA 4NCDA 1EXUB 3LV3A 25C8L 1YNLH 3G6JA 4ZPTB 3RWFB 3T0VA 4F9LA 4LDOB 5DHYB 3EJYD 1NAKL 5D1ZC 3RVXC 2HWZL 4JG1H 4I5BB 1PKQB 2WIIB 1DTUA 4BH7A 3GHEL 2OR8A 5ENWA 1OP5H 4EI5C 3NA9H 3F7VB 4HFUL 35C8L 1A9EA 1F4YH 4TVSa 4MD4B 4NN6B 4PG2C 3H2WA 1UQSA 4PJIA 2CLRA 3K80A 3CLFL 4JFPA 1KLGA 1VHPA 3CGTA 2PXYB 4FG6D 2O5YL 3FHQA 5JLZA 5IMMA 5GGQL 3KJ6L 5FM8A 4PJFF 1DN0B 3KHQA 1UKQA 4J4PC 1ZV5A 3BVNB 3VXUB 3SE3A 3MFFA 4X9HA 5E1AB 3SDXE 1MFAH 5K59E 3G5VA 3UJIL 3BP6A 2ZP0T 3BQUB 2DN7A 4LSVH 2HAZA 4DN4L 5GS0C 3QUKA 3LS5L 3MRFA 1VB9A 2XKUA 3MNWA 5F9OL 2R2BB 4M6ML 3U4AA 3L3KB 3CDYA 3E2HC 3A6CH 2YRZA 3E2HB 3MRMB 3HI1A 3QH3B 5D72L 1MCOH 1E6JH 1NPUA 4AH2A 1NGPH 1I7ZB 2QHLA 2R0LL 3GI9L 1MCDA 4PRHA 3PP4H 2EIZB 4HIEA 1TVHB 1N6QH 3SQBA 3D25B 3QA3B 3BZ4A 3H0TB 3EKCA 4TTDC 3V5DA 2XG4A 5E7BA 3MR9B 5HVWA 4HXBL 1O7SA 1L4IA 4ODXA 4U1KB 3X13B 2QSCL 4YUEL 2GJ6E 4KUZH 4ODSH 1CIDA 4KH2A 5FKAA 3WDJA 5GS2H 1P5VA 5DRZA 5CEXB 5KVFL 2BSSB 1BQHA 4CVZA 1QFPA 1MFNA 4JFXB 5DQDH 5IBTL 2WLZA 2XWBA 3JBG7 5DZNA 4QEGA 1CL7H 5K9OA 2HG5B 2FJHA 2OR7A 4X99B 2R0ZH 5F1NA 2KQMA 1ZEAH 2VITA 3AREB 3EW3B 2A6DA 4DQOH 4OF7A 1JWUB 2P43B 2DYPA 4Z8FL 2JTDA 3DPBA 4G6FB 1AQKH 2C3XA 3JVGC 1OTTC 5FYLL 3T2NH 3M17A 1PQZA 1FFOB 1YY8A 5FYKL 1HNFA 3BP5A 5E2UL 5CFHA 4YJZL 1A5FL 2YKLL 3F12A 4P5TD 2QQNL 4YDKH 4XP1H 4G8FB 4ZG1A 1NLDH 2AGJH 1YEDB 1F2QA 1QSFA 4AM0A 4LBEA 4H20L 4E0RB 3O4LB 3TT3L 4OIBA 3DYOA 2JCCB 4D8PB 1KFAL 1E4JA 4M1CD 2Y23A 5F7NC 2O26U 2AJXH 2DJ4A 3AS1A 1FRGL 1XF4A 2EDKA 4CMMB 2ZUUA 4B7IA 1CE6A 2E9IA 4MDIB 3I85A 3V52L 4KHTL 3RKDD 3U0WH 2DQUL 2PXYA 4FQ2H 4HGWB 1ITBB 1LO3L 5GRJL 4C59B 1BQLL 4WGVB 1NFDE 1UYWL 3RPKA 4KKCD 1GZPA 5INDA 1H0DB 4OFYA 4RRPG 5F93C 1AGBB 1YN7B 2DM2A 1XEDA 5EPMB 5IM7A 2XWJA 4QOKE 5M7QA 3OAUL 2IPKA 1IEBB 1UACL 2X1XR 5IMKB 3DXAD 3FO2A 3MRGA 4JLRA 1FAIH 2E6QA 4PJHF 1CI5A 3B9KB 2P24B 3JWNC 2AJZB 1B3JA 2A77H 2GFBB 3ILQC 1KEMH 3NACL 1J8HE 3X3GL 5MP6L 3ULUE 4LRNH 1KB5H 3O9WB 1I8MB 2Z92A 1T0MB 1IKFL 2X2YA 4XPTL 4BH7B 3IFOB 3NCJL 1Z6JT 4Q2ZA 3ROLA 3UJJL 1AO7B 3V5DB 4QHNB 3RL2B 3SDCC 4LKCB 4NQEB 5TE7L 3PWJA 3D0VA 1PSKH 3D69B 1DANT 1RZJH 2XQYK 1FYHB 4DFHA 2CDEB 2DICA 2Z31A 4FXGA 1HZHL 2AJYL 1QO3B 1I3UA 3BPOB 3NTCH 5IMMB 5E8NA 4NT6B 5EIIB 2B20A 4OAWB 1MH5B 3BO8B 3LEVL 4OCRH 1FVCA 4PJAB 5E2WH 3NFPA 3T0ED 2NW2B 1P7QB 1G9MH 4CU6A 3HCVB 2VLMD 5L2JA 4DVBB 4FHBD 1YY9D 5GISH 5IVXF 5LGJB 4JFQB 5CEZL 1IEHA 1AGDB 2EKSB 3C6LD 3GB7A 3ARFA 3QNZA 4XNMB 1RUML 3FB6A 1WFOA 3IKCB 4EIZC 4LIQL 5I66A 3LQZA 3HC4H 4Z95L 4YHYB 5C6PB 4X98B 1I7RA 2VLKB 2NR6D 3EOAB 2JF1A 4O02L 5BO1L 2M2DA 3WEXB 5BV7H 3ILPB 5F3BB 3G04A 4QWWC 1B2WL 3VJ6B 4E5XA 2ADJB 1FCGA 4RMRA 3IGAA 1CE1H 2GJJA 4HCRH 4HJ0D 3N85L 1U9KA 4M7ZB 3BAEH 4FMKA 3MCKB 1NFIB 1SHMA 3I3EA 4L3CA 2I9LB 4I9WD 1ZSDB 1CK0L 2J8HA 5DEFB 2AAVA 5DHVB 3MBXL 4NQXB 2Q8BH 2W91A 3OB0H 1PG7H 1UWXK 1VFBB 4QRRB 3OR6A 4JFOA 3I2CH 2ZZUT 3BH9A 4QWWD 4MA3B 4CVXB 1J8HA 1MCIA 2AXFA 3EYQC 2YD7A 5HHQB 2DQEH 4KUCF 4XXCC 2DD8L 1WTLA 1CFVL 3ZHKA 4Z7NE 2N1KA 3FQRB 5DWUL 1AGFB 1MHPL 4TNWK 3LSOA 3HRZA 2EDDA 1E0OB 2LABA 3I75A 5I1KL 3JXAA 3I3DA 5IJVB 1J1PL 2ZSVA 5L9DH 1KCSH 3CCHB 4OZHB 1XGQB 1XAUA 1NFDA 4JPVL 3U4BH 1EHNA 4U1NA 3GJFK 4PTTA 4LFHG 3BIKA 3BKCH 3F8UB 3DI3B 1HH6A 1WFUA 3RJDA 1K6QH 2QHRL 2VDQH 1A6AA 2Z8SA 2DQGL 4YFEA 1AIFB 4GAYA 4OIAA 4HIXH 3VD9A 2AJUH 2X9YA 2V7NA 3GO1H 4MDIA 2J6EH 4KC3B 1HHHA 3O3DB 4MS8D 3SBWC 5D7JB 4HIIA 3UBXG 5D96C 3IDUA 3JVGA 2DBJA 4PRPE 5J3HD 1EVUA 3ARVA 1WZ1L 4JFEE 2BHYA 5I1IL 5HY9B 1FNSH 4WWID 4RGMB 3HPJA 1OSPL 5IHZA 4X9BA 2F8OA 1P69B 1T2XA 3HE7A 3CVIH 5TDPB 1F6FB 2XNAB 2VE6B 1FPTH 3RFZC 4X0KB 1JNLH 1ADQA 1I8MA 4GRLD 2NY2B 3DUSA 5D93B 2MPAL 4JZJA 1I8IA 4JGUA 3ZYIA 3UTZB 1N0LA 5FDWB 4TN9A 3TYFA 3QNYB 4PJGA 4L8SA 4HZLA 2X4NA 4PS4L 5GXBB 1R3LA 3W0WE 2EYRA 2F8VA 3PE9A 3QNXB 3NN8B 1P2CA 2CGRH 5JOFA 1YJDH 3GSOA 3RA7H 5C86A 1ULVA 1UCBH 1QRNA 2WK2A 4P0DA 5DHVA 3GJFB 3WO4C 4R2GB 3TZVA 2VN7A 2ESVE 3O4LE 5HHMB 2ITCA 2NY3B 3VGHA 2Q76A 1DEEA 1YEJL 2ICWB 1MJ8H 4UT7L 5HXMA 4A2MA 2HFEB 3MLWH 3SN6N 4W6WB 4QY8B 4FQQB 3SDAC 1EJOH 1KELH 2H45A 4X4ZA 5E6ID 2A6IA 4G3YH 2N56A 1D5XA 2G2RB 4NZRH 3AS0A 3NAAL 5DJXB 2VLKD 3MRLA 1A1OA 4JHAH 2AQ1A 5CSBA 1OTSD 1YEGH 3SDXA 1H5BC 2J6EA 3LOWA 4A6YA 4YK4C 1PX3A 4MZ3A 5KSAB 5FUCC 5JHDB 3HNTH 3DUUA 5GGTA 3MFFB 4I2XB 2KKQA 2ZOLA 2WANA 1MQ8A 2BFVL 2FZ3A 3MBEC 3OJMB 3RTQC 2HFFA 1DJSA 2WWMC 1HEZB 4KTDH 4HUVB 3VWJD 5DD3H 4HWBH 2AKRA 3GSNH 2W07A 4U3CA 1DUYB 3BMWA 4YC2B 4HIIB 2YWZA 4IOIB 3HC3L 5D1QB 3MLXL 5K59F 4NC0B 3DHJA 4NKMA 5ITBH 5CJ5A 3F58H 3V5HB 1PSKL 1RZJL 2VR9A 4EUPG 4R90H 5ICZB 1OF2A 5L2KE 3EYUL 1FL3A 1WBXA 3DMMB 1KTLA 4DGIL 4DFIA 1J0JA 1EDQA 2LE9A 1ITCA 3MLTA 4R8WL 2HVJB 2E9JA 2GTWA 4JM2A 4LSRH 1D5BB 1QRNE 5F9JB 5I9QC 2Z35A 4BZ2L 2BY0A 1GZQA 5F1SA 3DVFA 1XIWB 4LDEB 5F3HB 4OUUA 1KIUA 3OHXB 4JANA 3T08A 4UV4H 2GJZA 3RZCA 4GBXA 1F13A 4Z7UF 1RIHH 4IIQB 4AY0A 1IT9L 4OLUL 1YQVL 3MV8E 2HRPL 4YXKH 4ONHB 1F90L 3R0MA 3WJJC 4F7MB 3O3DA 1A6TB 1YNTB 4JM2D 1S3KL 4UQ2B 1G6RB 3SQOL 4A6YL 2QQLH 1S5HA 4XXCA 4Z7WE 1FNGA 3TFKD 5AG8A 5GZOD 3F65A 1AXSA 3RTQD 4U1IA 3LQAC 5JXED 3QWOB 1RJZB 5DTFA 4DN3H 1ZVHA 3E3QE 3PHOB 3QHFL 3V0VB 2YD8A 2R1WB 4OQ1A 3QG7L 5D7KE 5KAQG 1GJIA 3P3YA 3QDME 3MMEA 5I8EB 3WS6A 4E42B 5L0QB 1O7VA 5DEZA 4MD5B 3TPKA 4NWTL 1D5XB 3MRBA 1XF4B 4Q58C 4W4NA 5F8RC 4CMMA 1N5AA 4LLQA 2Q7YA 4PJBF 4F58L 3O3AA 3MLUH 2FEDD 3AVEA 2WUBH 1P7KA 4ZPVA 2CJUL 4K3EH 2QQKL 3VCLA 3WKMH 3QEUA 2F15A 4YR6A 1LNUB 1S7SB 4M62L 5E2UH 4J12A 1GZPB 4XNYH 1HI6B 5LAXA 1MRDH 1I8LC 1DQLL 2HP4A 5I1JL 1U3HD 3GNML 3CX5J 4JGJA 2K7PA 3K1DA 1JGDB 2AGJL 2UUDH 5IT2L 1MFDL 4KUCD 3OKLB 3SJVE 1OY3B 3W2DH 3CIQA 4IRSA 1A1NB 1D6EA 1MFBH 2QJDA 4O2FB 1FO0L 4J3TA 4WEMB 1RIVL 3RVXD 1Y6MR 1UH2A 4KHXH 4OF0A 5AUMB 3ZSTA 3NFNA 4WJ5B 5D2LF 3TZVB 1U8JA 2CGRL 5KSUB 4PGDA 3GUTB 2F74A 2Z93B 2WINA 4XAWH 3GMQB 1H15B 4QYOA 2HA1A 3T3MF 1TTUA 1LD9A 4OQTL 2R0ZL 1IEAA 1KJ2B 4MMZC 5EWIH 5HVGB 1I4FB 5ELIA 4J3OC 3RZWA 4ODUB 1RZFH 5FYJE 1HCFX 1ZWIB 1EHLH 3PWPE 5J12B 4RMTA 3OR7B 3TYGL 2IJ0C 2PCPB 1BIHA 4WW2F 5D4QA 2ESVD 4UILH 5DJ2A 3I6GA 2OI9B 5D1XD 4JM2B 5DQ9A 3MA9L 2WP3O 1U8MA 3VXRA 3GI9H 4NKOA 2F5AH 1YN6A 3S37X 4PBXA 2JLLA 3BKYL 1TETH 3G5XB 2B1AH 1A7NH 2GTZB 1WZ1H 1UB5B 1SBSL 2AV7B 1JTOA 1T1WA 1VPOL 4QRQA 4XI5D 3VRJB 4H8WH 4N90D 5ISZD 5C3LD 2IANB 1CLZL 1AGDA 1XT5A 1TVBA 1ETZB 5IW3A 3MGTB 3RAJH 5JQ6H 3CSBA 4DKEH 3SKNB 5DJAA 3TN0D 4GKSA 3ZYJA 1XCTA 4YDIL 5HGAA 3VW3L 5C0GB 2BOBA 5DMKB 4N0CC 4NHUB 4MAYA 3HE7D 5D7LE 2AI0H 2OJZH 2V9QA 1XCQA 43CAB 3UX9B 3KLSA 2PR4L 1JYXA 2ORBH 3IJYB 4TSBL 5C0JB 1E4WH 4XCFH 5L9DL 5HYJD 4K9EC 1PY4A 3TGXA 5DO2C 4E42A 3QUXA 5EU3B 4YFLI 1ZLSL 2B4CL 3GJEB 3QUYD 2QLVB 4L3CB 2IQAA 5HJ3A 3SE9L 3MYZA 2Y72A 1CD9B 3TIDB 1FYTA 3U83A 5IB2A 1UEMA 2F8XC 3KPRE 1MPAL 2X09A 5D7IF 3KPNB 5KN5B 4MA3A 1FGNH 3MACH 2B5IB 4JDVA 3QT2A 1TENA 2GUOA 1FNEA 5FO7A 1F11B 1BLNB 4IMLB 5B38A 4X6CA 4G9DA 2W59A 2AXJA 5IVZA 5KSAD 4D9QE 1FZKB 3EAKA 4ETYA 5KVEL 5B39B 2R4RL 3WKNA 1C5BL 5HDOA 3SJVA 1IGYB 3EYQD 3PGFH 1KG0A 3WXWL 3D18A 4B41A 3QI9B 3TH4T 1U8KA 1RULH 3WUWG 1YEIH 1MCBA 5ITFB 1Q0YL 5JW4N 5KSVA 4QRSA 2BVYA 3NABH 2ILLA 5EOCH 1S78D 5E7FA 1XGTB 4XPAL 3LKNA 1I85C 1Z9SA 3DWTA 2APXA 3HC4L 1N5AB 1U8OA 2PYEB 4P5KB 1MJ7L 2DQTH 5I19L 1OPGL 4LL9A 3QEUB 3RWJA 4Z5RB 1KPVA 4WENB 1MCLA 2O5XL 1FG2B 2CIIA 1KIRB 3LD8B 3TN0C 3IS1X 4PRHE 3LAFA 1XR8A 3MUJA 1OP3K 5HGDA 3ETBF 4I3SL 4JN1H 5CZXD 5E8PA 4XVUC 1KCVH 2AQ3A 1NCCL 4JY6A 1CGWA 1RI8A 2AJVH 3MUHL 4MYWB 3BRGC 4CGTA 4Z0XB 5DQJB 1UJTA 3VXSE 2VLLA 4U6VL 2I9TA 3OKNB 3VXME 4K9EL 1JZ8A 1E27B 5KSBF 2Q8BL 4G6MH 2VZ1A 2H1PH 2R29H 4HXAL 2HJFA 1IFHL 4LHUD 3H9SA 5E9DE 5GGTL 1AJ7H 4U0RC 2WLYA 3O41B 5CSGA 3GI8L 4NO0B 4WTXA 3NZHL 4KXZH 4G8GB 3JUYA 1WF5A 1X4YA 4BQCA 4JDZB 2HN7B 4QHUA 3DO7B 3V6OC 2IPTL 3FQWB 1BF8A 2BXZA 1MFEL 2IBBA 2VDRH 2X89A 3M8OH 3O4OB 1NCAL 5C8JA 4KI1A 5I6XB 1B2WH 2VZ3A 5J11C 2H6PB 3SGKC 4S1SH 1EXUA 1D3CA 5EZJA 1NJ9A 4LSQL 5HVHC 5L2KB 3QEGH 4I5BA 1FSKC 3ZE1E 4YPGA 3GGWB 2O61A 4WFGD 5AZ2H 3RX5A 2VLRA 1EAPB 3F7YA 2Q87A 3UPCA 2D0FA 4XVSH 5K93A 4BK4A 3H3PH 4HS3B 5I17A 5J89A 2A6IB 3SGJC 2DLTA 1Y6KR 1ES0B 3UTOA 1AI1H 5C6WH 3ULVH 4K8RH 2I07B 3C09B 1LK3H 2ARWA 4FTVD 3VFWB 5HGBA 4JDTH 4GXUN 1ED3A 3IVKA 1DBAH 1A4JA 4RDQF 3CFCH 4LVHB 2J88L 1KXVC 5DD0L 2YC1B 3HG1A 4XPGH 4LMQE 1V7MH 3G6JF 1BIIB 5C0NC 2E7MA 4YHLL 5C7XH 5LVEA 4Y16A 4QHNA 1ERNA 4QRTA 3ZKXB 5JW5B 5C0AD 4G9FD 3FB8A 4MVBC 5DS8B 1QR1B 2F53E 4X4MA 5CUSH 5HI5D 2FIKB 5DMGC 4TTDD 5FYLH 5MHSE 1IC7H 3TA3C 3BP7B 1JE6A 3QPXL 3HPLA 1DQTA 4EQ2A 2KPNA 3SE8L 4P46C 5HHXH 4KK9D 5HHMD 3T65B 5FGBC 3FN9A 4DTGL 1QSEB 2B7DT 2F58L 3QEHA 4RA0C 2P5WA 2ESVA 3ARED 2WQ8A 3HI5H 4BSWA 3T77B 5D1XA 3BZEB 1TQCB 4JQXA 4LLUB 1ROWA 4PB9L 4Z7VE 2WBJC 2CLZA 5EOQL 2FHCA 3UTSA 4JPIA 4ODHL 5DRZB 4KXZI 3U46A 2ZG2A 1YJDL 4OZFB 4ODSL 1IJ9A 1RAMA 2EYSB 2Q8AL 4KHTH 1A1MB 4KROC 1EX0A 4IBLT 4ZOAA 2CO6B 2VIRA 3BWAA 4RGND 3L9RA 4OB5L 4WDIA 4JM4H 3AREA 5CJOH 4M61B 1LHZA 3VMOA 1BJ8A 5GSRB 3O8XA 3QQ4A 4ONOA 3OAYK 3QPQC 3CXDL 2A6KA 5AWNL 2ICEA 4G6AD 1J5OH 1E6JL 4Z7VB 3LHPL 1X5YA 1NC2D 4X6FA 2OL3B 1VKXB 4JRYE 1N64H 2F54E 5IWLA 4LAJH 4I48A 3EYVB 1GVIA 1Q72L 4P2RA 2GCYA 2FECL 3PHSA 4WO4B 3WIFA 1VFBA 1N4XH 2ZJSH 4G7YL 2DF3A 3GZKA 2J5LB 3BW9B 5HGGS 2GSIA 4P9HL 3U9UA 3MOBL 4F7CB 2OZ4L 2VLJD 4IJ3C 1JN6A 1Y18A 5MENA 2X9XA 1NBYB 1FNSL 1G0DA 1RURH 5D2NB 2NMSA 3B5TA 3OKNA 4KKAC 2DLEA 1OT2A 4OZIE 3C8HA 5IK3A 1EHLL 1YNLL 4PYGA 3DV6B 3IXTB 4HW6A 4YDJA 3HB3C 1OARH 4G80B 2G75B 4G7YH 2A0LC 3PL6D 1NAKH 3VRLE 1IRAY 1XGQA 3MXVL 4JPVH 3KXFB 3U4BL 1MAKA 4KK5C 4L4VE 2ZNXA 4PJ5B 3MUZ1 3VFNB 3L95B 4PRNA 4BZ1L 4HKBB 3UTPE 4M5YL 3OAZK 4F37F 5IG7B 3O2DH 4XRCA 5TPWL 1DQJB 1QZ1A 2FATH 1R3HA 4XAWL 4NDMA 1NGQL 5HPMB 1RD6A 1SY6A 3P0YL 4R7NA 1II4E 1AKJA 5FF6A 5C2BH 2WBKA 2BCKB 1KJ3L 2FDBP 1CVSC 1KC5L 3MRRB 5E70A 1T3FA 4MXVF 3KXFE 1ZAGA 4LP4A 4PJ8D 4ENED 4KI5E 3UJIH 1J12A 3D0VB 4P23D 3OXSB 1K4DB 4L4TA 1MVUA 4Y5VB 2ENYA 3PV6A 3FQTA 1CDIA 1X5XA 3BP4B 4DKDC 3ZDZF 5ADOH 2W0FB 3OB0K 5F6HI 4QXTA 5I1CH 4FXLA 1U6AL 3OKDA 5T3XH 3HUJF 1CDBA 4G9FB 2NW2A 2EICA 4D2NA 4QHKI 5I73B 4CBPA 3HNSL 4OFVA 3BDXA 1YPZF 1DLHA 35C8H 5DMYA 3ARWA 4QRTB 1I7UB 4HZAA 2LV4A 2FR4B 3QG7H 4KKNA 2R23B 4N9GA 5HI4D 4HUWA 2R1XB 1JNNH 1C1EH 3X11A 4DW2H 4F9PC 3LQZB 1BJ1H 1SJEB 4M3JA 1A6UH 4X7SL 4U2ZA 1Q0XH 5A2LH 2JE8A 4FZ8H 2IBZY 5GIRA 2EDXA 1D5MA 1MLCA 4X6DA 3MYJA 1R24B 5I15H 1VEPA 3SKMB 4HUMB 1K85A 4U3HA 3TA3B 1NBZB 4LNVA 4NQCD 4XVSL 1T04B 4UU9A 4UV4L 4DEPB 5IF0A 1JRHH 4Q9RH 3MX0A 5GRVL 2JIXD 4HLZG 3F6LA 3FB7A 3JTTB 5L6YL 1W72B 3A6BH 4ZS6C 3C08H 1QBBA 4CU8A 1YEEH 3UC0H 5T33L 5JIHA 1A1OB 4R97B 4MCYA 4GG8A 3UJJH 3QDJA 3I3BA 1DSFH 1F8TH 1UWGL 4Z77B 2XIDA 5BS0D 5FIEA 2RGSA 3W39A 3RHWK 3G5VB 3VGBA 4HX1B 2Y06L 2E6JA 1RFDL 3P4NB 3P30H 5T5FH 4U31A 4XGZB 5EC1B 4KROB 4LVEA 1NEZB 1SEBA 4FQLL 4P3DB 1I85A 3BE1L 2HTKD 3MNZA 3CH1B 4JCMA 1FV1B 5B8CA 2Q6WA 5T1MB 2FBJH 3VD7A 4G6ML 5D6DC 3RUGE 2VDML 4OSUL 5IJVA 3I6KA 4FTVE 5DD1H 2IQ9L 2M1KA 2P42B 2XG5A 4RMQA 4U1NB 1AJ7L 4PLJC 4GW5B 3KLHD 3QFJD 3P73B 4YHOH 1M7DB 1HKLH 4PRID 3VXQB 1GYAA 4F9LC 1M71A 3T09A 1KTRL 1GGIH 5F7FA 4ODTH 3QUMB 4LVOB 2EDNA 2X4SA 1RZ8A 2HKFL 3PL6A 1NCWL 1U41A 3X17A 1DZBA 3GBNL 4KRPC 3WNMA 4CVWA 1A7OH 3QJFB 4OLVL 5E8OB 2ID5A 3TT3H 5BVPH 2VXQL 4YZFE 4ORGA 3QCUL 4P48A 3DBXA 1UJ3B 3SKUD 5IQ7H 2IGFH 2AXGA 1Q0XL 3P77A 3G6DH 1MCRA 2X4UA 1JNNL 1OAZL 2EE3A 3SDAA 4X9IA 1HHIA 5L88H 1K2DB 1RJCA 4FP8L 5JW4Q 1JNJA 2CUMA 1G7JB 5D8JH 2UZIL 1KJ3H 1JHKH 1QSFB 1EGJL 1TZIB 3BPLB 1FFQA 5GGVY 4AM0B 2Y9RT 4U0RB 4KRMB 3TESA 1IAKB 4MJID 2XZAH 4OIIH 1JVKA 4IS6B 2F53B 2FLBT 4YC2C 3JWDC 4ODWB 1Q9WA 3C5ZB 1QBML 5IV2B 3VH8G 4F2MB 2VKXA 3PNWA 1P4BL 4LIQE 3X14B 1U92B 5E8EA 5MERB 4QCIA 1G7LB 3BQUC 4NQDE 3HFMH 1A6WL 1LEIA 2VLJA 1KUMA 4NO5B 4D3CH 2Q76B 5E6IA 2J2ZA 3B9AA 4WI4A 1QQDA 1BOGB 2FRGP 1I1AB 4KMTL 3FL7A 4G42B 2DQCL 3IF1A 2E27L 3F7PC 5D2NE 2VLRB 3F7YB 5F7EL 1ZHKB 1H3GA 4WHCA 1T5XA 5FKPA 1J87A 3EGSB 4MXQD 4X4XB 4XI5C 2C3HA 4PJ7E 3ZYZA 2GY5A 4YXLH 3DARA 4MNGA 2QR0A 5DEGB 2EO1A 3PWUB 2DQTL 3PWPB 4P2YA 5I19H 5A43C 4L3EE 2C7UB 4X80L 4PJ5E 3D39D 3IFOA 3HMWL 1QA9A 4KMLB 1C08A 3VWJA 1I9IL 2YPLD 3GSRB 2EE6A 3SKOB 3M1BB 2VR5A 4GXVH 1QBAA 4OZ4B 1ZA6B 5IB3A 1FBIH 1QR1A 3BDBA 4DKFH 5I30L 5DWUH 3STLB 4YLQT 2OCFD 4GBXC 1TETL 4K23L 3BZFB 4MCYB 5EN2A 1UZ6F 4XP4H 1X6NA 2RQ8A 5DQ9B 3RWIA 2HJKA 4JJHA 4OFDA 5C09E 3TVMB 3MRQB 5KVDH 4UI2A 4BFBD 2MPAH 3SDXF 4HS8H 3VDAA 4LSSH 1BVZA 4TPRL 3TA3D 4U33A 5JOPD 1FQ9C 3CFDA 4GMTH 2A9MH 3DHMA 2VL5A 5J12C 3IB4A 3RWCA 5HHPA 5DD5L 3FQUA 2A73A 2GK0A 1BM3H 1I1YB 2MQ3A 4BQ6A 3SDYH 1J0KA 2DBLH 4X4YB 2GFBA 3I2CL 4HGMA 1H3WM 3HMXA 2FEEL 2X4TB 4F57H 4LCUB 3AFLA 3WS6C 4GQ9H 4LLVB 1GGTA 3JWDL 3RL1B 2E8ZA 12E8L 5GS1A 1Z0NA 4WIQA 2Q86B 5I73C 4OLWH 3U0TA 1KB5B 2R39A 4NO2B 1QACA 5DFVD 2NXYB 1BZ9A 5KVGH 5HGHB 4AYFA 3JUZA 1U8NA 3I02B 5IT2H 1RZ7H 3F62A 1JCKA 2CDGB 2ZCKL 2D7OA 5JO5B 8FABB 5EOQH 3D85B 3QDGB 3L7EB 4OM0H 5JXEC 2HMID 1QHOA 3LN4A 1LEIB 3UJTH 3D9AH 3ZYOA 1V7ML 4CVXA 4HDIB 5I8CA 2VR4A 4YBQD 5TGBA 5AWNH 1L0YA 3OB8A 1ZMYA 5CEZH 3CLEH 3MMEB 4XNUL 4ODBD 1FNEB 5GISL 4BFGA 4XNMA 4XNZC 4RWYL 2J4WH 1T83A 1AQDA 2Q1EA 3QIWC 2YN5A 4UNVA 15C8H 5LXGH 1TQCC 3ALXA 2YEZB 3W0WB 1IGMH 1P7KB 1TTGA 1G7QA 4M7LH 3OG6B 1G7IA 4XX1G 2OQJA 3WFHB 1CYGA 5ESQB 4Q74A 3UDWC 4NQDA 3D3VB 3HUJB 4HS6A 2BMKB 5I1AB 2HFGH 2FHFA 1IAII 3EO9H 1TZHA 3K1KC 3O0RH 4XNXH 1KGCD 5B38G 3DSFL 2CQVA 4LHUG 4AIXA 4JKLA 5I75C 3WHE1 3ZE0E 4PLNC 1T7VA 5C0DA 1S3KH 3NVQA 5GZND 1HNGA 1F90H 1DFBL 3OSKA 3LKNB 1KV3A 3SJVD 5KAQF 1OTUD 3C5SA 1I7ZA 1IGTA 2HTLC 5CP7A 2X1OA 1B0GA 3DVNB 5FYJU 4JPWL 4WTZA 4OFYD 2A77L 4PJBA 3QQ9C 3RWIB 5I0ZA 3WO3B 5HYIA 3QEGL 4GQPH 5FHAL 5L7XH 3VGGA 3VFVB 1RUPH 4NP4H 1MRCL 3S3JA 3DSFH 3G5YB 3RHWF 1QFWL 5HYQB 3NBNA 1NDMA 3DMMC 1WK0A 5F7KC 3STZA 3NH7L 5JDSB 5CINL 3WUWB 4BELD 3C08L 4X6BB 4WCYL 3RWHA 1JRHL 4Q9RL 3RUGF 3C2SA 1U8MB 3VXRB 4Q0XH 1LK3L 1N6UA 4OZHA 4YEEA 5HD8D 4OI9A 1AI1L 1FC1A 3DJ9A 4ETQA 3NCYS 1EERB 4Y8AA 3FQNB 4I0PA 4WI5A 5E2WL 1JPGA 2IG2H 4OGYH 3RIAK 1IGCL 4MJ6B 4WEBL 2CSPA 1X7QB 1CD1A 1NLBH 5DGRA 3SBWA 4CAGA 5CD3A 1TVBB 4UUJA 3DMMD 3JWOH 1JPST 5DJ6A 3BYYA 5C2UB 1BMGA 2J8UB 3PHQA 4HK3N 3ZLQC 4G7VL 4S1SL 5E2VH 4K7FB 4ZFGH 4OCLC 2QQNH 3DX7B 2DQHH 5GRUL 5FCSH 4M1GH 3NCJH 3EHBC 4EOWL 3T0EC 1MELA 4P2OC 3WN5A 3LCYA 5DLML 4U1MB 2Q3AA 3S35X 3ZE0F 5DMIH 4FQQA 1EJOL 3O3EA 5GZNC 3N1PC 4ZAKB 2W60B 2VDOL 3QUYC 1NCBL 3CFJB 2VXTH 4HMCA 4UT7H 1ZS8B 1FIGL 2IQAB 1MLBB 2ED8A 3SDCD 4NN7B 4K94L 1A7BA 4AENB 2E7LA 3FT4B 4HV8B 2NY3C 1ACYL 2VDNL 1BFVH 4EN3A 3HE7C 3D2UB 4YK4B 1KC5H 5T1LB 1CFSB 4JFFA 2C3GA 1T21A 4JO3L 5HBBA 1J18A 2LTQC 3T8XB 4B5EA 1BVLA 5I8OH 4CDGC 2NY0D 1LE5B 5KANI 4I77L 1G7PB 3F5WA 3WUZA 1UCBL 3RI5K 1F4HA 3HZKA 3CH1A 2PXYC 3RA7L 3I50L 3G9VA 5LGHL 4YO0A 3S96A 2IADA 3CFKA 1A6VL 3GRWH 3HRPA 3BP7A 1VGEL 2NY3D 1HILB 1DUZB 3EYFB 3SE3C 3BN9D 3LKPB 4S2SA 5D6CB 5CJQL 1G7HB 4KRLB 5LQBL 1TPXC 3MA7B 1IC4L 4HKJB 4M9PA 3O3BA 5DF0A 3MLTB 4NKDB 1P4IL 5INCB 3P9MB 1ZVSA 1YMHB 3MOBH 1WAAA 3VFRB 4OD3L 1VFAA 5I1LB 3KPQA 2BVOA 4Z6AT 3FQNA 1A1MA 4I0PB 4P5MA 1EEZA 2JCCF 3VRIB 5CGTA 1OGAD 5CS7A 2W9EL 3VXNA 1MF2L 1U95B 2CO7B 2VXSL 2HRLA 4PJEF 5JXEA 4ZFFB 1F00I 3EHBD 1C5DB 4JLRB 4JAMA 1H5BB 4D0BA 4IDLA 4WFFE 1EUTA 3REVB 3AY4A 3DX9A 2P48B 5CEZD 3QR2A 5FK9A 4HC1H 4XMKH 3FFCE 1J1PH 3HKFA 4PY8I 4APQA 5BRZE 4NYLB 1B9ZA 1K2DA 3MBEA 3QUMH 2OTUA 3CVHL 3ECBB 3VFOA 5IFJA 3EFDL 4DAGH 3TBYB 3MRNB 2R0KH 5B21A 4KWUA 2WSKA 4OZIB 5DUML 4J6RL 4ZUTB 1EO8H 1A02N 4N5EC 4W6YB 3UPAA 2EYTA 4PGZA 3V0WH 5IFAL 3BWUC 4LAQH 1LDSA 3QCVL 4XVTL 2H9GA 1DBJH 3U9UB 2PNDA 4QF1A 1A0QL 2VDKH 5JUEL 4PJIB 4RFEA 4M6OH 4ODHH 1DQDH 4FQXA 4L4VB 5IMOA 4CN1A 3FONB 2F5BL 4RX4D 3VW3H 3TBTB 43C9B 2FO4A 1P4LB 3D0LA 4P23A 4H1LA 2F58H 2X4QB 2VERN 3WE6A 4PRAA 2DQJH 1TFHA 4JM2C 1DBMH 2V6HA 3BFOA 5C9JB 3R06B 2P7TA 3VH8A 1R3IH 3ZDXF 5GHWH 2FJFB 1RIUL 1YNTA 4XVUD 5IEHB 4MNHB 3OAYH 1UVQA 1LO5B 5CAYB 1NGWA 4JQXC 2FJGA 2QKIB 3GBNH 5F3BA 3HG1D 4MSWA 2UV3A 1PVHA 4H88L 2KZ1B 4YHLH 1IKNC 4OKDA 4Y5XB 4AT6A 3L5HA 4G7VH 1N4XL 3QRFM 3QEQA 5J9PB 4XPGL 3JTSA 1R0AH 4NM8H 4FG6C 5F9DC 5EULV 1VSCA 3L3JB 4X8XA 4OGAD 5ESVB 3H9HB 3RJQB 3RGVA 3TNMB 1PD6A 2BC4B 4WUUB 2XTJD 1CU4L 4NWTH 5FKAB 3NFSL 2V2TA 2ICCA 3DX6B 5JIIA 3OX8B 4LLWA 5EORH 3GIVB 1TJGL 1PEZA 4L9LC 2MFNA 4I0CC 4HPYL 4NQED 3LD8C 2HG5A 4LOUC 1IAIM 2NY6B 4I9WE 4AEHL 5ID0B 4JRXD 3FOMB 1MFDH 2Y06H 4WCYH 3MRFB 3HE7B 3QDJD 2BP3A 3FO9B 4ELMB 3TWCL 5I76A 4RGOH 1PQZB 4XCCL 4JRYD 2F19H 3B9KD 3HUJE 5JZ7C 4M4PA 3MBXH 3BEVA 3LPFA 3VXSD 3QA3A 1IBGL 1E6OH 5DYOB 1UC6A 3EJZC 5F7WC 3BPCA 2W0KA 4YDLB 4HKJA 4KI5D 2G5BA 3AXLA 4ZTOL 3TEUA 3QO1A 4PG9B 1G9MC 1M7IA 2QTEA 3KDMB 4PR5A 3QHZH 5EU6A 4RGOL 4XCCH 1WVZA 4GH7B 2E5EA 4EUPA 3L3IA 4YHYC 4QRUA 4DZBB 1YUHB 2BNRA 1OM3H 4MX7B 2VYRE 1PGRB 4HXAH 2JJWA 3FT3A 4GAJL 3SPVA 1CGYA 4HGWA 4KK6C 4RQQB 3UC0L 1DDHA 3VRIA 2E7HA 3KPRA 1MRFL 3ARSA 5DD0H 4TSCH 5T5NF 1CXHA 1HOCB 3P0VH 4NKQB 4Z78B 5JMOC 4XTRD 1CR9H 3B6SA 3NCEB 4E9LA 4I3RL 3PDOA 4MAYC 5J4MA 4OI7A 3HAEH 5FUOL 5IBUG 3BUYB 2XQBL 1CGSL 3L7FA 4WU7A 4JZNB 1BREA 3GMNA 3KWWB 1XR9A 3DV6A 1QRND 1H3TA 2QQQA 3G6AB 4PREA 5CILH 5BZWB 2OQJB 5A2IH 5C0AA 4LF3B 4ZSOB 4LGRB 4H20H 4UIMA 2HVKA 3BI9X 4GRLC 3B8YA 3D9AL 3H3BC 4Z7UB 3PGDB 1F45A 5JHDE 2O5ZH 3IFNH 4XAKD 3GJEA 1B4RA 2XPGA 5I8KL 4WNQA 3TCLB 2K3TA 3B9KC 3ROOA 2VJXA 4WI7A 4K7PH 2NZ9C 1Q9LB 3G9AB 3GBML 4PJIF 1IQDA 3OX8A 1YMMA 3BH8B 1FG2A 3RI5F 4FFWD 3EJJX 3BMVA 1S7XB 1OAYH 2XFXB 2UWEB 1P7QA 1AGCB 1MREH 1ZA3B 4KUZL 4Z7UE 5EIVA 3OAUH 2X7LA 1QSFD 2QSCH 1EA9C 1YPZE 3MRCB 1T20A 5CGYC 2W0FA 3MRPA 2VAJA 2VNCA 2J5LC 3RVWD 5ICYB 1KCVL 4MQSB 1N5YL 1MCWW 5JHLH 3ULUD 2R8SH 4KPHH 3VXPA 3ZE2F 1S7VB 2ATPA 4NN6C 3WXVL 1T1YB 5EG6C 4C57C 4P2OA 3WN5C 2DKSA 2AI0L 2OJZL 4MZ2A 4KY1L 4LSVL 4DN4H 4JJ5A 3LS5H 4P99A 4FXKA 4PTUB 1IGIH 4PP1D 1MJ7H 4IIQC 5CD3B 1U8PA 1YPZB 4HC1L 3D69A 4XMKL 1R5WA 3I84A 5D2LB 1Q94A 2HKHL 4I4WA 4I18A 4NGHL 5EOTB 5HHNA 1KB9K 4UV7H 4ZO6A 1Z9MA 2YPLA 2F5BH 4KVCH 1OARL 1FNGB 1U92A 4PJ9B 1CN4A 3KS0J 4L3ED 1NMBL 5JW3L 3RTQB 4YIQA 3UDWA 5I1IH 1FSKB 3DRTB 3DVGA 5D6DA 4BK5A 1T5WA 5KVGL 3H9SE 4U1SB 1J1OH 4I1NB 5CZKA 5DR5L 1L9NA 1SJHB 4L3EB 5D2LE 3QNZB 4M5YH 4UILL 2Y5EA 3S5LG 4GJTB 5C09D 5KS9A 1AHWC 5DUBB 5EO0A 4WW2C 5IBTH 5IKCA 2F5AL 1FE8L 1T89A 3DVIA 3ZTJG 2HT2D 4JY4B 4MCZB 1LDPL 2OP4H 3CX5K 1WQVT 5C07B 3QWQB 1H0DA 1LO4L 1ZLUH 1HI6A 5LAXB 1ZHLA 2ERJC 4Z77A 2BXYA 4J4PA 5GSVA 3ARGB 1MPAH 4YHKL 3F6IA 2YN3A 3V4VL 4DUWA 4JE4B 4DCQA 5HYJA 4V2BA 5K9KB 1G7MB 5EBMA 5F7HA 1QBMH 1T1XA 1RV6X 1CLCA 5EU6B 3GSQA 4X6DE 5LGHH 3ZKXC 1FFOA 1OAXL 4LQ1A 4RRPA 5DC0A 2FIRT 2V7NB 4P3WA 1FV1A 3ZKSD 3H7LA 5DEFA 3DECA 1A21A 3IDJB 3CFKB 4XCFL 2NXZC 1CZ8H 4LARH 4ZAKC 3QQ9D 1KACB 2IPUG 4NHCH 4HPOH 3GNMH 1W72H 4YDVA 3T0DA 4ERSH 2DLFL 4BH8B 3UBXI 1YEHL 3NIDF 4J3SA 2L4OA 4J3WA 4U1GC 1Z2KA 3ARQA 4JCLA 4P2QD 1KCSL 1LVEA 5CBAA 4Z9KB 3GRWL 4PJHA 1IL1A 1VFOA 3U0PB 2VQTA 3B5GA 5J06A 1QD0A 5KTEH 1HK6A 5BVPL 1RUKL 5ESAA 2B39A 4Z7UA 4ZOBA 1F5WA 2OS7A 3V0AC 4Z7VF 1CIUA 2E27H 3FB8B 2EYRB 1DLFH 4AEEA 2P8PA 2AK4B 2FH8A 2VUOA 4KKBC 5IEKB 2P8LB 5ALCH 3OGCA 4ONGL 4ZXBB 2IQ9H 4KKBD 4GRMB 5DRXA 5BXFB 1WWWX 2VDMH 4R0LA 4K7PL 3FAWA 1YYMH 4XNQA 5EU6D 2C1PA 2NY0C 3U79A 1YEDA 3DSNA 1M1SA 2CDFB 4YBHA 3RKDC 4YAQA 5KVMC 3WS3B 4IS6A 1VGKB 4JVPA 1U3HC 4OF3A 5ID1B 5MEOA 3HPJB 4N5UA 4DKAA 3NMEA 3NZHH 5MENB 5C07D 4Y88A 4P46B 3FB5A 3N50A 2AJYH 5IVXA 5CKGA 1S8DB 2H2PD 3QFJB 1VADA 5CINH 5HJ3B 3L5XH 3WO4B 5IUSA 3J7HA 5BS0E 4L8CB 3O8XC 3BISA 2VSCA 4OD2B 3RNQB 4PRPD 2A2QT 2Z8RA 2FO4B 2GIYA 4HJJH 2Z0BA 3VXOB 4KZEH 4QOKA 2CLVB 2AJVL 3LKSB 3CK0H 3HHRB 4J3XA 2WUCH 4M43H 5EPMA 4JN2B 5EBMB 1M6OB 5F7MC 2RB8A 4P4KB 3N1QC 4N0UA 4B50A 5E00A 1T5XB 2I27N 2YUZA 3VU2A 4MDJA 3OZ9L 2QSQA 1QFHA 3QO0B 1XCTB 4ZOEA 2YPLB 5GGTH 2X40A 5FECB 2A0LD 4RISH 1X4XA 3FZUD 2NY1C 4J4PD 1CL7I 2H1PL 3QIBA 1WWCA 5DVOA 1TQBC 1OWRM 5CP7B 2Y4SA 3CK0L 3PWPA 1DN0A 2WM0A 4RBPH 4ZODA 2XOTA 1JZ7A 5D5MB 3ULUH 4FQIL 4HQQL 1QFWH 2ADFL 2LU3A 3IDGB 4NP4L 3VFVA 2CLRB 3FN3A 4FZ8L 5DK2B 5JPMA 2GITB 5FM5O 3HB3D 4JHAL 1FL3B 1WBXB 5HYQA 3MLZH 4HUUB 3M8OL 5D70H 2DWEA 3NCCB 5LKNA 3A67L 2BSSA 3TO4B 4Y4HB 1REIA 1OP9A 2V2XB 3HTLX 4OSUH 3RIAF 3S3SA 3TIEA 2NCMA 3KHOA 1A9BB 5T3XL 2W9DH 2NTSP 2UWEE 4ORZC 4WFHE 3KPMA 4LNRA 4MXVE 5E1AA 4P2QE 5ISZA 1BX2B 4LPVA 4P57B 4W6XB 5CP3A 3C60B 1JWUA 4N68A 3Q6GH 3FOMA 1FFPB 4G6AC 2OL3H 4Y4FD 1KXTB 5JUEH 3W81A 3BP5B 3BPOC 4CVZB 2X4TA 1DBJL 3RIFF 2VZSA 3O11A 1SYSA 1D5MB 1MLCB 4DQOL 5DK3A 4PRBB 5FDWA 2CKNA 2HT2C 3NCMA 4NO2A 4P4RA 4HIJA 1CDJA 1T04A 4KQ4H 5FYJD 5HGHA 1QSED 1MQKL 1FO0A 3WFCH 4NQTA 4X8JB 2CD0A 4NRYB 2P47B 1X44A 1U8LB 2W60A 1FAKT 5F88A 4QO1A 1X5AA 4S1QL 2ED7A 1RK1B 1IMHC 2X1WL 3O2WH 4BUGA 1L7TH 5IGXL 4KDTC 1WFNA 3EOTL 4DZ8B 5HVHB 1NGXA 5TGBB 3IYLW 5CIPH 2ZUVA 1EAPA 1OW0A 2H2SD 2BVTA 4JB9L 2IBZX 4P3DA 2XNAA 3LVEA 4EKXA 1KCRL 4Z7QE 4MDJB 2HMIC 3TPUB 3T0BA 4U1LA 12E8H 2IH3B 2I07A 3WLBB 5K9JH 2ZCHL 2YEZA 2Y07L 2FECI 2XZQL 4FFVC 4ZD3L 4OZFG 5K9QG 3AM8C 4PRDA 3DXAB 1BZ7A 2V2WA 5I71C 2YS4A 2DI8A 4LSDA 4TNVK 3BUTA 1OTSC 3IDMB 2XT1B 3EYFA 3IDXL 4UOW0 1CXKA 3ULVF 4JDZA 3DUHA 4LKCA 1MUJB 4NQEA 4F33B 3QIWD 1M05A 1XZ0A 3K81A 3QFJA 5DFWH 3CVHB 4WY7H 4L8CA 3TO4C 4PJGE 3SGDH 4R7DB 5FGCB 2JK5B 3VFTB 2FATL 4KV5F 4NKOB 2F54B 4WUKH 5DI8A 4D0CB 4EBQH 4POYA 4GBXD 2XTJE 4JO3H 4YHZH 4WV1A 1S9VA 2HWZH 3V5HA 1OAUH 1RIVH 3E8UH 5IMKA 5CD5C 4EN3D 2OL3L 5B8CC 3R8BB 1F3JB 3PP3K 5J1TC 1NDMB 4LHUB 3N9GH 1BVKA 3LB6C 3H42H 4DGVL 5KSBA 5IMLA 3D39E 3CX2A 3QJHB 4NQCB 4OCMC 2X1PA 2XZCL 1D5BA 3VDBA 1WITA 3VXPB 2P5WD 3MODL 3S37L 4CDHA 3OAZH 5JXAL 5I1HH 5A3ID 1KENL 5F21B 5D1XC 5EU7E 3C87A 1KJVA 2EXYD 4OLYH 5EU5B 2V5RA 4L4TD 2ENSA 1RSFA 5LCVH 4LRIC 4QRPB 5ACZB 1AH1A 4OZGE 1JHLL 3IKCA 4M93B 2P44B 5I66B 3GSOB 1RHFA 3CU1A 3CZFA 4CMHB 1L7TL 2J88H 3LRHA 3GMLA 4GO6B 4RFEB 3PQYE 3DX7A 2CJUH 5E8OA 4Z76B 1INEH 4RZCA 4U1IB 5HDLA 4JM2F 5ERWB 2H2SC 1R5VB 2VXQH 4LEOA 4QHKJ 4X6CE 3WNNA 5GS0L 4K2UL 4OZHF 1QQDB 4JFDD 5KN5A 3TT1L 4KRNA 3Q5OA 5C0RH 4PRAB 1BAFL 5D9SB 2B4CC 4H25B 5FO7B 4RWHA 3QWRD 3CFJA 1SM3H 1ETZA 3H3KA 4UQ3B 4FZEH 1J88A 4QTIL 5DJYB 5KANG 3MRBB 4WW1B 1C5CL 1KTKE 4HJJL 4YHPB 3BRDA 4HKZA 3FT4A 4HV8A 3WYRA 4AENA 4JFFD 1CWVA 4X7CC 1FLTX 3QULA 1BWWA 3T3PF 3LKQB 4GKZB 3GM8A 4D9LL 1NKOA 1JGEB 1U8HA 1KN2H 3KXFA 1EGJA 1C08B 4NNPL 4DCQB 5K9KA 5MEQA 1MJJB 2QADC 3BQUA 2NPLX 3THMH 1L7IH 3S97C 2W0PA 4HEPG 3CSYA 4XRCB 4LCWE 1HHJB 2NY5H 5IESL 4M7KH 3PWVB 4FQJH 2FD6L 5I1DA 4P2RB 1FLRL 3IDJA 3TF7C 4NNYA 5IQ9A 5FB8B 1FZJB 5E5RB 1X5LA 3PJSA 3TJHD 2ZUTA 4NNPH 3QHFH 3KJ4C 3IFPB 1XH3B 1HH9B 4L4JA 3QQ3B 4NUJA 1F6AA 5EFIA 5GJTL 2MNUA 1EK3A 2GQHA 5FUZH 2ADFH 1CGXA 3GKZA 2NY7H 4MJ2A 3QFJE 5KOMC 1YEEL 5HHPB 5T33H 1WT5A 3TCXA 4GAYB 5I2IA 2XRAH 4E41D 3U2SB 2P5EB 3QISA 5FXCH 1KULA 3KYNB 3RVWC 3P11L 1JPTL 2ZUSA 4ZYKA 1D9KD 2X4RA 1T03H 4GSDL 4EIGB 1OAQL 5K9OB 2FCBA 3G5ZB 1Q9OB 2HJFB 3BGFC 2AABL 2D4DA 3B9EA 5AD0B 1EEZB 1U91B 4Y4KC 5KJRH 4FQLH 3RY4A 5A2JH 2MCG1 4HH8A 4Z7WA 1RZGA 4KV5E 3LDBB 4OCSL 1T1WB 4QRQB 1UCTA 4G8GE 1A6AB 3P30L 3NABL 4KDTA 5EOCL 5AUMA 4JAMB 1HYSC 3IRPX 1KPUA 3HAEA 3M17B 1U8OB 2PYEA 4BKLA 1H8SA 4OM1L 7FABL 3ZSSA 3Q3GA 5IEKA 4L8BB 4JZOA 1RZ7L 1JMZA 1FZMA 1BFSA 1FNFA 3MGOA 1LP9A 1YEGL 2H6PA 2D31A 3MBEB 1K3ZA 1S9WB 4LCCA 3D25A 4M5ZL 2W1NA 1AD0B 3C6SB 5FOBB 4TYUA 3WFEH 2C1PB 3EDFA 1T6VN 2NY0B 5E4EB 1I4FA 1F58L 1A7PL 4PJCB 1RPQA 1RZKH 5IHZB 1ZLVK 4Y5YA 2WV3A 1MVUB 4Y5VA 3I9GL 1DFBH 3O4OC 1YNKH 2EIDA 1ONQB 1IFHH 3NOIA 4DJMA 1T4KB 3BJ91 4NQDD 3RL1A 1BBDL 1GOGA 1E27A 2H3NB 2QSTA 4GQ9L 1WZMA 4F57L 1I8IB 1W8NA 2OBGA 1LK2A 3V8OA 2BMKA 2GSGA 1WIPA 1CF8L 4RIRA 3MV01 4EDXB 5T3XE 3D85D 3LRSB 3FRUB 4Y4HD 2FLRT 1IGFH 5BJTA 3EYSL 2YZ1A 2E8YA 2P8MB 3MV7B 1CFBA 3S6CA 5GRZA 1Q8MA 1FZKA 3EJYC 5E00B 3O6KH 5H35A 4TVPD 1RIUH 1EFQA 1YECH 4LEXH 3FN0H 5DS8A 1DR9A 1FBIL 1SEQL 3UJTL 4G43B 3NFNB 1UM5L 4PJXE 5IQ9B 4FQ1L 1Q9LA 4K23H 1X5HA 5C0EA 5EZJB 5KBNC 2ORBL 5EC2A 3IJYA 1KT2B 1VEMA 1F3RB 1MCWM 1WWAX 5CWSB 4NZUL 2HFTA 3GMOA 1UXWA 4OT1L 4K7PY 1YZZA 1JZ4A 5EU3A 2VXSH 4IHOA 5DRNB 4M6OL 4FNLL 4MNQD 4HUUA 1OAXH 1Y0LA 3HI6L 2Z31B 3KGRA 4FXGB 4GG8B 4M8QB 4UBDC 2BOCB 5JHLL 1PZ5A 4YX2H 5AAWA 4HMEA 1MFCH 3CUPA 4HBCH 1R3KA 1XIWA 2BDNL 4JG1L 2MJWA 1MSPA 1HIMH 2DM7A 3PUCA 4M03A 3L3OB 4Q6IB 3N9GL 5EBGA 4L5FH 5LBSH 1JF6A 5LGJA 5F7EH 3NA9L 3D39B 2FEEI 3FO1B 3FQXB 5L2JB 3B4NA 4HUVA 5LQBH 1OVZA 4UUJB 2D7MA 1N0XH 1VFMA 4MB3A 3FO9A 4ELMA 3PXHA 4G8GD 4JRYB 1SYVA 2GHWB 4PV9A 2MCPL 4IOIA 1YYLH 4I18B 1WISA 3BXNA 3PQYD 2ZCHH 5FUCE 3ARDD 3RDTC 3L5JA 4FQCH 4TVPL 4Q9CA 2BDNH 1W0VB 1D9KA 4KDVA 3GK8L 2PW2B 2W9LA 2IANE 3IJHB 5F44A 2VDLH 4RNRB 1J1OL 2R2HA 2QV2A 1R3JB 1QSFE 5T1KA 3AXLB 4LCWA 3BGMB 4Y5XC 4QRRE 1AD9A 3L5IA 4DKFL 5I30H 1MOEA 1N26A 2ICES 5E1HB 3L3DA 1JI1A 3OKYA 4RA3A 5IHBA 3MOQA 3ALPA 5H2BA 4U49A 4LMQI 1CBVL 3QXAA 1SY6L 2CIIB 1LWRA 1S7RA 4PRPA 1QKZL 3VFGH 4RIRB 2V5TA 4LGSB 1S9KC 3HE6B 2XA8H 4LLDA 3BH9B 1AGEA 4S1RL 1MCNA 3T4AB 4NJ9L 5GGVH 1CG9B 1CR9L 5JHDD 3OQ3B 4JR9L 4ZDHA 4Y2OA 3RGHA 4F58H 4LEXL 3IU4H 3O6KL 4U0QB 5CUSL 4RGMC 1R6VA 3FRPG 1A7OL 4EUPH 4M1GL 1UZ6E 1DQJA 5BV7L 2DQHL 4ZFGL 3NTCL 5BW7A 2ADJA 4NQSA 4WV1C 4PRIA 1N7MH 2OSLA 5CWSA 3UTTB 3QHZL 1G6VK 1CS6A 4ODUA 2EH8L 3MRHB 3DROA 3IRZA 4OJFL 1KTDA 1OLLA 1F6LL 1YA5A 1JFQH 5DT1H 3QZWB 3ZKND 2NY5L 2XKNA 4IMKC 5IESH 3LH2H 1WIOA 1J86A 3OMZA 1PYWB 3HE6D 5IB4B 1EFXA 3EDEA 2FBJL 3PGCB 1CFNA 2J3SA 4KK8C 4G5ZL 5CMAB 3BEWB 2AK1H 2UZIH 3LQMA 5AEAA 1UFUA 4KZEL 3VMPA 1PAMA 3DNKA 3L6FB 4JFYA 1A6ZA 5C09B 1W0WA 2PYEE 4WW2B 3D39A 3FQXA 1OT1A 4PB0H 4R4BB 5TE7H 1JGUH 1AGFA 4U2YA 2L0DA 3TJHC 4Y4HC 2FGWL 4JHZA 1KLUB 4HUNB 1CD8A 3L1OL 4UTBL 3RZCC 2VLLB 2WINB 1F42A 3F12B 3ULVL 3ARDB 2RFXA 1IAOB 4XWOC 4MQTB 1WAAE 2NTFA 5DURB 3BPLC 5IBLD 4L8SB 4RX4A 4LCIH 2R2HB 3WSQH 5GSRA 4H26A 2ADIB 1NL0L 5BS0B 3X13A 3BJLA 5EUOE 1JYNA 5DJCA 4Y2DB 4YAQB 1U8PB 4ODVH 3ULUL 4V1DD 5EO9A 3M45A 4X6FB 4LSTH 1NCTA 4A2LA 3WLWD 5IMOB 4PJ9A 4F3FA 4UTAH 1RUPL 5GRJH 2V7HA 1X5FA 4LCIL 4QXGL 3B9DA 1JPFB 5ANMB 2AV7A 4MB4A 2Y5TA 43CAA 1AGBA 1KN4L 3LKRB 3DRTA 5KTEL 2NZ9D 3EOYG 4ZTOH 3CFEA 4G3YL 2K1MA 3O2VH 4X7DC 3F7VA 1U0QA 4O51A 5JA8B 4XNUH 4M43L 4NRXA 1OD9A 4RDQG 4XHJD 3T2QA 2WZPD 2R23A 1INDH 4N9GB 3P4LA 1LILA 1U8IB 4IJ3B 3C60C 3GSVA 4S1DC 5FYJH 4NC1C 1OCWL 1MAML 1J10A 3NZ8B 2YPVL 4IRSC 1UADC 3CC5B 3IETA 1NFDF 4P9HC 4ONGH 4P59L 4OM0L 3U0TB 3ABZA 1KN2L 3O6FD 2BHUA 4IRJD 4HS6B 3D3VA 1A3LH 4GKZA 2X6MA 1TJHH 1QPXA 1E4XL 1HQ4B 3UYOD 3ZDXE 5DFVC 5T3XD 4LLAA 5CP3H 4CUCA 5BCAA 3EFFB 5FCUL 1S7QA 5HDBE 4KU1A 1C5CH 2BSED 5DRWA 1EO7A 3PF2A 5L6YH 1OGTB 4S0SD 3U36A 2Y6SC 3LV3B 3D87B 3W9DA 1FP5A 5CLTA 4NM4H 5KS9F 4ZS7H 3T0XA 1CU4H 5LWYL 5D72H 1NFKA 4ZMAT 2P45B 1GSMA 4R2GD 3QRGL 5JQHC 5HGDB 3V9FA 1T3FB 3T1WA 4L8DA 2AXHA 4MJIE 1OAKH 3UCRA 4OLYL 5TDNA 1GPOH 1LO0H 4YHIA 4RFNB 4BA8A 1XGTA 5J56B 3OXSA 4LLUA 1UVQB 5I18L 5CBAB 2Y25A 2UWEF 4JFED 4RMSA 1QLFB 5BZDA 2X4RB 2P1YA 4PJGF 5L0QC 5F6IB 3I6LD 5HYSB 1Q9KB 4N8VA 2Z35B 3MXWL 2PR4H 5BOZG 5EDXA 1I3VA 1CTNA 4QHUB 2NY4C 3DO7A 3K8LA 5EUKA 1MJ8L 1ND0B 4Y5VC 2HJLB 1DQDL 1V3JA 1IKNA 2DWDB 4LSPH 3TBVB 5JPNB 3RWDB 2CDEA 1V8HA 1T7YA 4O9HH 5F1IB 1AO7E 3Q3GB 2I9TB 1Y6NR 5E6ZA 2C3WA 3VG9B 3PL6B 4Y8DC 3LY6A 5BXFA 3VXMD 3MV8A 1ZGLP 4NKMB 1G9NL 2JB5H 4M7JL 5B4MD 5C2BL 1ZHBB 4WY7L 3PHOA 3E6FB 1A4KB 4TVPE 1B0RA 4JFYB 2EDHA 4OF8A 1DCLA 1U3YA 2EC8A 3KYAA 2BRQA 2EDOA 4JY6B 1L0QA 1VGKA 3GDBA 4I0PD 2DD8H 4ZQKB 5DQJA 4TTGA 1A14L 4KVNL 4HWUA 4LPYA 1CE6B 5FKPB 1Q1JL 2XWTB 2NY6D 1G9NH 2JB5L 5DVLA 3SE4C 3WIHA 1NC2B 4F7EB 2NY6C 4H1LG 5IK3B 1MF2H 4K3HA 4X99A 5F3HA 3ELAT 1T66C 4HBCL 1BZ7B 5A2FA 3MLYH 4KJWC 1JGDA 1BWMA 1SJVA 3DX8A 1F4AA 1GOHA 1NEZA 3AS2A 1V7NH 4QHLB 1I7TA 4PJFB 1RURL 2DLGA 4WJ5A 3QUZC 1EUUA 3FTGB 3B3IB 1UZ8A 2P5WE 2R56L 1GC1C 4ONFH 4QHMB 1A22B 2XZZA 1P1ZB 5DUPH 1RHHB 5D1ZA 1DL7L 3HG1B 3EOTH 3GMMA 2GK2A 4WFED 3MRRA 2PYED 4NSKB 1ZT7B 2FHBA 2HH0H 5C07E 1BEYH 4Y1AB 5D5MF 2Q7YB 3GHBH 1CGSH 1IZKA 1CQKA 5DJ2B 2H2PC 4O2CB 1MI5E 2C3VA 3LEVH 4ISVA 4OCRL 1H3PL 3J8F7 3EO1B 2OXGA 1E4XH 1G0YR 1JHKL 5I74C 1RJYB 4N0CD 32C2A 5E99L 2NX5E 4NJAL 2IPKB 4Y4KB 4PB9H 1MCFA 1A1NA 1D6EB 5T5NG 1MFBL 5ADPH 3LN9A 4JJ5B 1UG9A 1PKQE 4YWGL 4PB0L 4OLEA 3GB7B 3OTTA 1H5BA 1KCKA 3MNWB 3WCYA 3LIZH 4IEFB 5JPNA 1UKSA 3B9VA 5C3TA 3I9GH 1SVZA 2DMBA 5AYUH 3SE8H 4X7TA 1JZ2A 1BJMA 4IRJB 4NHUA 3X3GH 1FLRH 4V1DB 2OTUB 1VENA 5M95B 4CNIA 4HULB 5CHNA 1LP9E 1IKFH 2A1WH 1AC0A 5TFSL 2XA3A 4BZ2H 2CMRH 2MKLC 4K9EH 1UA6L 3G08B 4QT5A 3MLZL 5D70L 3VXRD 1RZ8B 3JWOL 4R96A 5F9AC 4M1DH 5EO0B 5CILL 1OGAB 1DVFA 1QG3A 1S7VA 4JDTL 1U8QB 4WUUE 2BY2A 3QJFA 5E9DA 4PJIE 3S36X 3HR5A 4WRLA 3TIDA 1BD2E 2X42A 4L1HA 2OTPA 5DK0A 2IFFL 3EBAA 1XF1A 3SKJL 3EOBA 2BX5A 5J6GA 4FXKB 1BZ9B 2BVEA 1KGCE 1NMCB 4U6YA 5DJ8A 5D2LA 1UXSA 3PWPD 4HK3J 3REVA 4Y2DD 4Z7OF 5D2NA 2G9HB 5DD3L 2X9WA 2AJXL 2QR0B 1KCLA 5D7IE 1JGUL 3P4OA 3ZKNC 3DGCR 1GRWA 2PN5A 2ZSWB 4G80A 5GJTH 2IFFH 4CJ1A 1X4ZA 4NN5C 4LSQH 1INQA 4NWUL 5EUOB 4E0RA 2BNRD 2CR3A 1J11A 4I18C 4LLYA 3QDHA 1MRCH 5HHVL 3ZT7A 4QRSB 3SOBH 1JI2A 2GAZB 3FO0H 3QUZB 2DYPD 4M6AA 3B83A 5IOPA 1SJXA 4PP2A 5D1ZD 4QLRA 2IAMD 2FWOA 4JEGB 4XMPL 2CKBB 5T1LD 4JFOB 4Y4FB 4C4KT 3EO1A 3EO9L 1SMOA 2D7QA 5HI3C 4JFZH 1MCSA 1H3UA 4DGVH 2BFVH 3ARBC 1NCCH 1L6ZA 2W65B 2WIMA 3VD3A 3TH3T 4U6VH 2ADGB 1QNZL 4NKIL 3KVQA 1C12A 3FTGA 4RGNE 4ZAKD 5IW1B 2AJSH 2FO1A 3AROA 3L3HA 4LU5H 4XB7A 1D5IL 3OKDB 1BOYA 4PLOB 4L9LA 2V9TA 3TH2T 4N0UE 5GJSH 3ARDA 3AB0C 4X9GA 4YDVB 3NIFE 5CBEB 4NO3A 3T0AA 5KSVB 5DTFB 3GMMB 1R3IL 5DA4A 5ICXA 1ZT7A 4HG4K 3R4DA 4FQHA 4M02A 5J0BA 1EEYB 4IRZL 4P5KA 1JHLH 1UM4L 2BNUB 4O9HL 1KIPB 3BZFA 3LEYL 5E8EB 3N06B 5MERA 3DIFA 2XZQH 1TVHA 3VCLB 4DK3A 3B5HA 4Y0GA 1MCCA 1I75A 5TH2A 3DV4B 3T3PE 4X6EA 1CFSA 4LAQL 1CT8A 3OKKA 4OD1L 3MV9E 1TCMA 4K3GA 2JB6A 2ED9A 4HAGA 4X83A 3FB6B 4GRWF 1EJ6A 5T1MA 5C0BD 3N1MC 3JWDH 4JFXA 3D1MC 4Y19D 3VXTB 3EO0B 4YFDB 4TOYH 3RVUC 4JZJC 5C0IA 2WMPA 4LPXA 4KROD 2ZSVB 2OM5A 1EFXD 3DYPA 2N4IA 1ORQB 1LD9B 3DLQR 3BHBB 1CD0A 1NFDB 1LO4H 2XWJB 3IT8D 1QP1A 2CRMA 2ZOLB 1YC7A 1JF1A 5KS9E 4CVUA 2FX7H 2FZ3B 3RWEB 4P3CH 3G08A 5F70A 4KZDL 2HT3D 1RZKL 3HI6H 1SEBB 4P5TA 1KF9B 3U82B 4N1CA 4JPKL 4OZ4A 3TZVC 4NC1E 5I8KH 1NMBH 4L1DA 1YEKL 3P9MA 4XZUB 4NNYB 2RCSL 5K33A 5C08A 4MAYD 4TSBH 4IDJH 4FFWC 3T65A 4WWKB 2YRPA 1GH7A 4E41E 1J8HB 2D7NA 4QY8A