1HXMA

Crystal structure of a human vgamma9/vdelta2 t cell receptor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
AIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCACDTLGMGGEYTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GAMMA-DELTA T-CELL RECEPTOR
publication title Structure of a human gammadelta T-cell antigen receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 206
sequence length 206
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxmA01
3E6HB 4G9DB 4PJCB 5IBLC 3MRLA 2OR9H 1YNKH 2FL5B 5F1NB 1HIMH 4OCYL 2R4SL 4Z7VE 3LEYL 4QXUH 3QH3A 3T4YB 3HPJA 4GLRH 1KTKE 4GBXA 1S7WA 3MYZA 4KU1A 1CT8B 1HQRB 5JMRA 4UQ2A 3OAZK 4K2UL 2VLMD 1CU4L 5IESH 4E41B 5I1GH 3D3VE 4D94A 1Y18A 1Z9SA 2KDGA 4EBQL 1PQZB 5GRZA 2X89D 3N50A 5D2NE 1A3LL 5IG7B 4D9QD 1IGMH 4AENB 2NY5L 3BZFA 2W1NA 3LS5L 2A6IA 4JDTL 5C0IB 4Q9RH 3TT3H 5F7MC 4O02H 2GSGA 4HIIB 4FFWC 1VEOA 2CUIA 1W8OA 4DQOH 3MJ7B 4XC1H 2VLJE 1TMCB 3O6MH 5IFJB 3OHXA 4ORGB 4RDQG 3FT3A 5JQ6H 3S4SB 1MLBB 4MA7L 5ICXA 1LDSA 2EICA 5EWIL 3MLWH 4G80A 3OX8B 3MGAA 3FCTB 4FQCH 2IFFL 5C2BH 5SWZD 5MHSD 3CXHJ 4GKZB 3RTQC 2X1XR 3LN9A 1I85A 3W39A 3WNMA 4KK8D 2HJLA 4RFNB 3SO3B 1T0NB 5I18H 1JV5A 4PRHD 4ODVL 5SX4H 3O2VH 1I3GL 5FGBC 4I18A 3S6CA 1G7JA 1GZQA 1CFSA 3WSQL 3EYVB 3PV7A 1ZVSB 5ALBL 2GK0B 1MI5E 4XNUL 4PJIF 3RBSA 5BV7C 1KJ2H 4QLRA 2IC2A 1AE6L 5BO1L 1L0QA 3JWOH 4HGWA 2HN7B 1F3RB 4X98B 5F70A 3VG9B 1AO7B 4MD0B 1OM3L 3HN3A 4NRYA 4LCCB 3B9KB 3ULVF 4WJ5A 1YQVL 3DMMA 3G9AB 4XPAH 3BQUA 3QJHA 3VWJA 3MV9B 3U46A 3MRFA 2I07B 4LSUH 4OFDA 4YDIH 2DIBA 1YPZB 1A4KB 2Y72A 4EOWL 5DJ0B 3MREA 4NP4H 4NQSB 4OF5A 2AXGA 4X80H 4QXTA 3MUJA 4CVZB 3DXAE 2XOTA 3H3PL 3TV3L 2WP3T 2Q87A 2XYCA 1KYOJ 1G7IB 1CBVL 1ZOXA 1MCNA 5IKCB 4MXVF 2OR9L 3IAGC 5FGCB 1CGVA 5TH2B 1I1AA 2I5YL 2VDPH 3QWRA 1S9YA 5IBTH 4EN3B 1ADQH 4YDKH 5T1KA 4TPRL 2BNUB 5GRJH 3WYRA 1OTSC 1JNHA 4WWKD 4QTIL 5DMIH 2QQKH 1BVLA 3H6JA 4YXLH 1RZ8A 5IESL 1MCQA 2DD8H 2FR4A 3LS4H 3WS6A 2NY3B 3H42H 3GZKA 2C3VB 1E6OH 3MJ9H 4HWZA 5EPMA 5GRUH 3K80A 4HH9B 3PF2A 3BXNB 1IGML 5JW5A 3LKRB 3WDIA 3T0AA 2V2XB 2YZ8A 5AYQA 3IAPA 3VFWA 2N7BA 1JF1B 2IBZY 3EJYC 4O02L 2Q76B 1LQSR 2YPLB 2NX5E 1AJ7H 4AG4H 4DQOL 3WFDH 2D9CA 4XC1L 1HYSC 3O6ML 3ZDZF 1NEZA 5KG9B 4JM2D 2E6QA 5EH1A 3W0WB 1KN4H 3NN8B 3D39E 1QR1B 4NN6C 1QBAA 4ZNEA 2BOCB 1AQDA 4IIQA 2AS5M 2JF1A 3G5YA 4NO3B 4UMGA 3W11C 4MAYC 3O2VL 3GSOB 2XQBH 3DYOA 3QFJE 3OWEA 1JI2A 1AH1A 4XH2A 3BPLB 1CXEA 3EJJX 4Q2ZA 1UFUA 3WUWG 3RAJH 3QA3B 4ODXB 4ZUTB 4PRDB 5A16B 1EJOH 1KJ2L 2CJUL 5F3HB 1S9WA 5JPMA 4JGMA 3SDXE 8CGTA 3ARGC 2H32H 2NZ9C 3JWOL 1Y6MR 1A6TB 1Q9WA 1QQDB 3UX9B 1MQ8A 4X7TA 1T83C 2VABA 3TN0B 3OKOA 1V3KA 3WCYA 1D5BA 2NY4D 3UZQA 2MPAH 3I6LD 5EB9A 2AJ3A 3G08B 3NIFF 4XPAL 2JCCE 2VLME 1BQUA 2J88L 2I26N 1SJHA 4I8DA 2AEWA 3N1FC 1CFNA 2JJTA 4LSUL 1FNHA 2E7LC 4YDIL 3T2PA 3QIUD 5MEQB 1GOHA 1FL5A 4FQJH 2WP3O 3MRDB 4NP4L 5AZ2L 4D9QE 4X80L 3RWFA 4XZUB 3DV6B 1G9MH 4QRPB 1LP9B 5KANI 3MRPB 4JCMA 3PDOA 3A67H 1JGEB 4N5ED 4K8RD 3ECBA 3RWHA 5GS1B 3KYNB 2R8SH 1L7TH 2GJZA 4WGVB 4NQCD 4F15B 2VDPL 5IBTL 4XCCL 1ADQL 1I7RA 3MXWH 4YDKL 1A14H 1XEDA 1YYMH 5GRJL 1PLGH 2H8PB 3SDDD 5EOCL 5SWZE 2P44B 4TVPH 5MHSE 5AWNH 5DMIL 2QQKL 3L3KA 5EDXA 4YXLL 2DD8L 2VL5A 4PTUB 2DM3A 4OGAD 4PRHE 3ZKSD 1ZT1A 4P46B 3H42L 4UU9A 3ILPB 4HPYH 3MJ9L 1JWSA 4IRJA 3PP3H 1CE6A 5F6IC 4MDIB 4GXUN 3OAYK 2IADB 3IJHB 3O2WH 1NUNB 1RFDL 3QO0B 2YA0A 1ZT7A 3GHBH 4UIMA 3CDCA 2VR5A 4WUUD 3BP6A 2VTFA 2AI0H 1AJ7L 1KCSL 1QSEB 4AG4L 32C2B 2AXFB 3JTTA 4DAGL 3IFPB 3BKJL 1FQ9C 1KN4L 3DV4B 3G6AA 3PABA 4JLRB 4NIKB 1VEMA 1ZS8A 3KDMA 5HVWA 3D1MC 1KT2B 1NGZB 2VXUH 5DHVA 2P8PB 4NYLA 2PW2B 4HS6A 2WBJA 3ARTA 1MREH 3FOLA 5LGHL 5HYJD 3UTTB 5FOJA 5D6CA 3O9WC 4X9HA 3ARYA 3X3FL 5HGAB 2XQBL 5GPRA 3HNVL 1A9EB 4Q97A 3NFSL 2RR3A 4G42A 4UNVA 4IM8A 3IDJB 4YHIB 4OQTL 1I4FB 3VFNB 4OQ1A 2HFFA 3RAJL 3PWPD 2ZCLH 2BXZA 1HXMA 1EJOL 1XR9B 2OSLA 3TBYA 1BBDH 3TYGH 2GJ6E 4OCWH 1EEUA 3HI5H 4PRPB 4OLYL 3BQUC 2C9AA 4ZUWA 5KS9B 2ARJQ 4G8FA 1CXLA 2D0FA 1MCKA 3HE6A 1CG9B 3NMEA 5EC2A 5TE6L 2MPAL 3VGAB 3GMPA 2GTZB 3KPQA 1TTUA 1DLHB 1XF5A 4JFED 5A3IC 1KTLA 4DCQA 5HY9A 4GRWF 1AR1C 2IPUG 5TJWK 4Z78B 3GM0A 1HNFA 3QEHB 3QCVL 3O4LA 4FQJL 4KKAC 4HAGA 4F57H 4OZFA 3KXFE 3CZFA 4PP2A 5GS2D 1HHKB 1UB6B 1I3RA 4XXDB 3QXAB 2GTWA 1J1XH 1G9ML 1X5YA 2N56A 4LPTA 3A67L 3C60B 2BY0A 5A2JH 4KK5D 2OJEB 1D6VH 2DLFL 3G6JE 3T4AB 4P5MA 1NKRA 3RL2A 3ULVC 2ZUVA 1SBSH 1JK8B 5ITBH 3BFOA 2D7OA 3JTSB 4LQFH 5BW7A 4QOKD 1TQCB 1A14L 1X7QA 3OMZA 4FNLL 1YYML 2IPTL 3WS6C 1LO5A 1W0WA 4X5LA 4P57A 5DJDA 1MCRA 4TVPL 5AWNL 4Z7VF 3HC3H 5F96H 3N85H 2F53D 3TO2B 1UKQA 1VACA 3ALPA 5GRYA 4XAKD 1IZKA 4HPYL 1R24B 2X9WA 4IRSB 1K3ZA 5IROC 1XGYH 2OQJA 3DETC 4X4MA 3L7FB 4GAFB 2OR8A 3O3AB 5T5NG 3O2WL 4F7PA 2Z35B 2AK4A 1FVCA 3L5WB 4TTGA 4PV8A 5KVFL 2NXYD 1WZKA 4CMMB 2GSIB 1D7FA 2AI0L 4K3GA 1YY8A 4OD1H 3ULVH 1S8DA 2VDOL 2LU4A 3GNMH 5EO1B 5C08A 4W6YB 2Z4QA 1M7IB 4APQA 2GFBA 4BJLA 2W60A 1I7ZA 3PHSA 1IBGH 3FJTA 4C83B 2ENYA 4K7FA 2BVPB 4C4KT 3CLEH 4QHMA 3BAEH 1MREL 1AXTH 5F7YC 3EDDA 3FQRA 4DN4H 1J10A 4JPWH 4YEFA 4Z7VA 1JFQH 3ARBB 3TT1H 1RZFH 3BH8B 4HF5H 5C2UB 4JG0H 2MJWA 2ZCLL 4HWEH 4G8EA 4YR6A 1G7HA 3D3VA 1BBDL 4OCWL 2VIRA 3HI5L 5D2NA 4W6WB 5LGJB 3ZKND 3WKMH 4NQCE 3IDMB 5ESVA 1MCEA 4YDLB 4MVBC 2EYRA 4R4NC 5E7FA 4BELD 3S37H 5DRWB 3WEXB 2PNDA 1XGQB 4EUPG 4LSTH 5H2BA 2Y5TA 5E4EC 4HJGA 4LCUA 4LCWB 2VLJA 1CFBA 5FYKH 3QQ4A 2GCYA 4WI2A 1BZ9B 1WQVT 2J2ZA 2DN7A 2SEBA 3ILQC 3P3YA 4F57L 4S0SD 2NMSA 1RHFA 4V2BA 1J1XL 3DX9A 5DJXA 2H9GA 1Q9KB 4IBLT 2J7LA 2EIEA 3VFRA 2G2RB 3VJ6A 4XVTH 4WUUE 2FX7H 5GGSA 1D6VL 5F9JB 1RJZB 4W4OA 3WJLA 1SYSA 3IETB 2ZG1A 4LHJB 4FZ8H 4LQFL 4YHNA 3WNKA 1MI5A 5C6PB 3ULSA 3R0MA 1OD7A 2DQUH 4KTDL 2R56H 3TIEB 4K23H 1M05B 3WKNA 2NY2B 5F7FA 3HC3L 2X6MA 1NSNH 4XMPH 4MLIA 5K9OA 3N85L 4PJBB 3L5JA 3SGDI 5HYJE 1U8HB 5EUKB 1AXSA 1EO8L 1RZJC 4Y8DC 1AD9B 2DQTH 4DN3L 1P9MC 1EGJA 1R6VA 1XGYL 4L3CB 3CVHB 5LBSL 1BD2D 3RKPA 3DPBA 5KSUA 4XRCB 4CADA 1Q0XL 1VFOA 2AJYL 4BKLB 3PWPE 4HMCA 1OQXA 2DI7A 1CLYH 1YY9C 3SKOA 2DM2A 1QFWI 3ULVL 1F00I 4KI5D 2OTPA 4C4KO 1XGRB 3DXAA 3BWAA 4WIQA 5D1QD 2JJUA 5C0AD 3EBAA 2OL3A 1IBGL 3T08A 1LMKA 1QSVA 2RB8A 4M00A 4KZEL 3BHBB 4JFEE 3BAEL 2ID5A 4DN4L 5IB4A 1TIUA 1RZJH 4JPWL 3AMKA 5J11B 1VADA 4NO0B 4PRNB 4D8PA 1DUZA 3TT1L 4W68A 1RZFL 4HF5L 5CJOH 15C8H 3ES6A 1MHHA 1PKOA 3WL9B 4DKFL 2D2OA 4JG0L 3LKOB 5GGVH 4GRLD 4HWEL 3TC9A 4YBHA 1V7MH 2W92A 2BFVL 2BVQA 5DJCA 4Y5VA 4ZMAT 3WIHA 4M4RA 5F21B 5DHVH 4R2GD 1FNGB 2IFGA 1OAUL 2AQ2A 4V1DB 2EDTA 4YAQB 4X7DC 4KQ4H 3OL2A 3ET9F 3SDXF 4QOKE 4ONGH 3MGOB 5GZNC 1CN4A 5ENWA 4X0KA 1OSPH 2E9IA 1ND0B 3I6KB 1CDIA 2NX5A 4U1GC 5E56A 3GMOA 3QUXB 4Z6AT 2HWZH 1U8JA 2EH8H 2F53E 5IW6B 5FYKL 3NCBB 1NFDE 3EOBB 5F1KC 8FABB 3RY4A 3MV01 2VZ1A 4XAKE 2JCCF 3D39A 4N8VG 4DW2H 3PQYB 3MRQB 5DJZB 5TF0A 5HDLA 2VZTA 4WEUD 4LK4A 3CDGB 5E24E 3LAFA 4QTHA 4I0KA 2NLJB 4D0BB 2ZJSL 1CL7I 5I1AA 1PBYA 2NY0D 2F5AH 2NY7L 1XCTB 3DX8B 3QIBA 3QFJA 4KHXH 5F7EH 4KKLD 3W9EB 5E5UB 1G7QA 3MNWB 4JFFD 5E8PA 4Q9CA 1W0VA 1WC7A 2R56L 4I5BB 3E3QE 4OZFH 3SDXA 5DA4A 4N0CC 1NSNL 4HUKB 4XMPL 3KPSD 4CMHB 3Q3GB 4GH7B 1EHLH 3T2OA 1C08A 2W9DH 4WTZA 3IKCA 4AIOA 4EDXB 2JCCA 3PV6B 3BKCL 1HE7A 1UJ3A 4F9PA 4LHUA 4YHOL 3IGAA 4L1HA 3HE7B 2GQHA 1MAML 3IDIB 3ROOB 5C0JA 1NCDL 4P23B 4FFYL 1CD1B 2DYPD 3LQAC 5I76B 4Q0XH 3X11B 1FNLA 3IDGB 4S1DD 3SJVD 1EFXD 2BHYA 2XICA 4LRIC 3WLWC 2IPKA 1TZHA 5CP3A 5K59E 3LD8C 1UWXH 2VISA 4MSWA 4JRYD 1FN4A 5D70H 4YFLI 5KJRL 1JGUH 1F8TH 4XBPA 1EERB 3IJSB 5FOBB 2EDDA 4G9FB 4XPTH 5ISZD 4NCC2 3H0TA 4S2SA 4X4YB 2CUHA 2X4UA 15C8L 3MV7B 4KROC 5D2NC 5SWZA 4PGBA 5HYFA 1JCKA 2DWDB 1B0WA 4YFDB 5C0DB 5L8KB 2J8UB 1V7ML 4JDZB 4PRHA 1QACA 3BEVB 1UT9A 4ZG1A 1YEEH 3BN9C 3FB7B 3QQ9D 1HSAB 3LKNA 5F6HI 2W9EH 1XF1A 3LQAH 5KSBF 1ZGLM 3BZEB 1P7QB 2PTTB 4CW1A 4KQ4L 1MH5B 4EDWH 4JZJA 1QNZL 4ONGL 2HLFD 1NCCL 2DWEB 3TBSA 1OSPL 5H37G 5IV2B 1E28B 4XCNB 1JZ4A 3IF1B 3PHOB 2I60H 3UZEA 4YHYC 2X10A 3JXAA 3RTQB 2EXYD 4KVCL 4OV6F 3UYRL 3M8OH 3WFZA 3NACH 4C56D 4DW2L 3U2SB 4XP9H 3GMLA 3ARSA 2EIDA 5F7HA 4IMKA 2AXJA 4W4OC 3ABZA 1O7VA 2ARJA 4XNQB 3GUTB 3PP4H 4OKVA 2E9WA 3VI4E 2PXYD 3KYAA 5FAAA 4HS3B 2OZ4A 4KI5E 4NWUH 4IS6A 3H9HA 4KHXL 5JUEH 5D1XD 4GW4B 4KRPC 1A3RH 4NWTH 2HP4A 5IMKA 2APBA 5C0AE 2HJKB 4NGHL 4JM2F 1N5YH 5KW9H 5EA0H 1JZ2A 4KZDL 2GJ6A 2UY7A 3DWTA 5EFIB 3UBXA 4B53A 4XXCA 1PG7L 3P2TA 1FDLH 1EHLL 2LU7A 1DLFH 1AQKH 4PGDB 4HUMB 4Y4FD 5CP7A 5IJKC 4WWKA 4K94C 4UB0L 2O61A 4FXLA 2P7TA 1ZSDB 2XTJB 1KXTB 3U83A 2O26U 5I15H 2V7NB 4KWUA 2X40A 4U7SA 1IGIH 5IMLA 5IVXE 3KXFA 3RVVC 3GSWB 1K4DB 4IOIB 4Q0XL 1T1WA 1N64H 1URLA 2HRPL 2WMPA 1EGJH 3NFPB 1KC5H 3STBA 1E0OB 2HRLA 4LLVA 4MB5A 1D9KD 2CR3A 4GLRI 2ZPKH 3G6JA 3OKMA 2P5WB 4L5FH 4FQIH 4LOUC 2XWJB 4QKXB 5D70L 5EBLB 1JGUL 1F8TL 2WINA 4JM2A 4I4WB 5AG9A 5IMOB 4XPTL 1W8NA 3L6FB 3VGHA 1N6QH 2G75A 2C1OA 3S3SA 4MCYB 1G9NC 2DL9A 3AAZB 3HZKB 4Y5VC 2ADIA 3NCYS 1ZA3B 1NBVH 2XXCB 3ZKMD 1M71A 2OL3H 4L9DA 2EH7H 1SQ2N 2H32B 1FBIH 3E6FA 2A9MH 3BT2H 5IWLA 4OZHB 1OQOA 1KELH 4EDWL 3OKNB 3QDGD 4JFFE 1AC0A 5BQ7B 4NN6B 4DFIA 3WE6B 5GZOC 5D9SA 4WV1A 1FJ1A 2I60L 4U2YA 3ARED 3LZFH 3KPSE 2QSCH 4YH6A 4HIXH 4ZUSA 5JHDD 1OHQA 4OGYH 4MAYB 2DM7A 2ZCKH 4HK0B 4YK4C 4H1LA 3NACL 1QLFA 4PJHF 4XP9L 3WIHH 2ENSA 4HKXB 4XVUD 4O51A 1R3JB 2PN5A 2DLGA 1K4CB 3QIBC 1VPOH 1EJ6A 1ES0A 3QAZC 3WD5L 3FQTA 3PP4L 3MRIB 3QIUA 3T0VA 3L3OB 4HWBH 4LPXA 4HFWA 3W9DB 5BVJB 5DD1H 3ARGB 4WFHD 5B38B 3TA3C 4LIQE 2NR6D 4KMTH 2OTWB 5FEBA 2XTLA 4NWTL 1KIQB 2ZG2A 3SJVE 4OZIF 3QUZD 1EMTL 1N5YL 2A0LD 3CJJA 5ILTH 4JRYE 5FO9A 2P43B 4L4TD 1G7MB 1UZ6F 2VN7A 5E9DB 4NQCA 5AG8A 2F9BT 7FABH 1YNLH 1UJ3C 1QFPA 4F9PC 5ISZE 2FCBA 2CKNA 1AQKL 3IXTB 4JG1L 3F62A 5J13C 3V5HB 1JPFB 1I8LA 5FB8B 1ODAA 2DOCA 3B3IB 3SDDA 1BJ8A 3MRLB 4JFPB 4OCSH 4QRRD 3DECA 5TDOA 2P8MB 3QYCA 2PTVA 3GI9H 3UXFA 3UO1L 1JE6A 5I15L 3QH3B 4FABL 2VR4A 4QHUA 4GBXB 3HFMH 5FO8B 1DANT 1IGIL 3KAAA 4MXWL 4G8GB 4UQ2B 1F4YH 3OKDA 4JQIL 2NTFA 3JV6A 2EKSA 1U3HC 1UJTA 2AEQH 4L4JA 5IOPA 1NGYA 5FYLD 1D5IH 1XAUA 2P48B 1KC5L 1Y18B 4PB9H 4WY7H 4WUUA 5JXED 3QUYD 2ZPKL 3WNPA 4QHNA 4FQIL 5DFVD 1LE5A 1YC8A 2G60L 3BZFB 4OB5H 2IMMA 1O0VA 3KYMA 1EO7A 1WEJH 4JRXD 5EORL 2A6IB 3B8SA 1N6QL 4KK8C 4C56E 4S1SH 5F6IB 4NBZB 2GSGB 4HZAA 3VFOA 4ELME 3NIGE 3STLA 3W81A 3OHXB 2VITA 3FT3B 3P0VL 5HYJA 5ICXB 2OL3L 5JZ7D 4JZJC 5ABDE 4ODWB 5JTWA 5TF1H 2HT4D 4G80B 4KKCD 4PV9A 1TITA 5TGBA 1NDMB 2A9ML 4N9GB 1KELL 3W39B 3PWPA 3DI3B 5BZWA 1JV5B 3EZ8A 2Y23A 3NABL 4TNVK 3MYJA 5GGRA 2XG4A 4I18B 5FV2A 1F2QA 2G9HA 4LSVH 5I1LA 3LZFL 4M7ZC 1G7JB 1GZQB 1CFSB 4PG2A 5H8DA 4OGYL 3K3QA 1KPUA 3WIHL 1KV3A 1H15A 2BCKA 3JV5A 1NFDF 4HGWB 1NGXA 4YC2C 5DHYA 4JGUA 4JFEA 2G5RA 4LP5A 4M5ZL 4Y1AB 2O5ZH 2ZNWA 3T09A 5IB3A 2AKRA 4WJ5B 4M6ML 3DMMB 3BQUB 3QJHB 3VWJB 1BEYH 4XXCC 3MRFB 4AYFA 2RBLA 3OBAA 1Q9OB 3MREB 3TZVC 1EHXA 5ILTL 1MRCH 3CK0L 4DZBB 4ZODA 2FRGP 3VXTA 4QXTB 2XKNA 4K7PL 1YNLL 1MFBH 1FH5H 2B2XL 4OZGE 4YO0B 4QOKA 3S4SG 3N9GH 4J1UA 5L88H 1BF8A 2OZ4H 4A2MA 1VB9A 2VDRH 1I3VA 3VXRB 1I1AB 4XTRD 3GI9L 1RU9H 2F53A 3ARRA 1S9YB 1NFDA 4PY8I 1J05A 5F93C 4BFIA 2X70A 3VDCA 5FGSA 4PS4L 1F4YL 4DUVA 1JNHB 1A6UL 5IMMB 2X4NA 5IW1A 3QDGE 1RZ8B 2FR4B 2AEQL 5KANG 3C8HA 1D5IL 1SHMA 4YLQT 2BNQD 4PB9L 3KNBA 1OGAB 3ALWA 3U4EA 5EPMB 4HWZB 3THMH 4ZFOL 4K3DL 5LJYH 4OB5L 5JHDE 4U6XA 5BS0E 1WEJL 4LQ1A 1F6AA 3VFWB 3LN5B 4S1SL 1FNSH 4JKMA 1U36A 2DM4A 1F42A 5DD3H 3D85D 2Z31D 3C5ZD 1NEZB 1GXEA 4ZFZB 5IWLC 3ZE0E 3ZTNH 3FO9A 3ZDXE 3T2NH 2F15A 1B0GA 5TF1L 1C7SA 1AQDB 4ZOCA 2R0ZH 2BVOA 4R3SA 4IIQB 3S8WA 1JPSH 4LPUA 3GKWL 1J87A 4OCNC 2R1WA 3KLDA 4ALAH 2JB5H 5J89A 2NY4C 3OPZH 4P5TD 5EBGA 3K4AA 3BSZH 1A1NB 4LSVL 4YNYA 3CSGA 3MOBH 1HN1A 3I85A 4XH2B 4Q2ZB 4JQXA 2XWTB 2E7MA 3RJDA 2YD9A 3GMRB 3BRDA 3OKKA 5DDHA 1K6QH 1S9WB 4JFZL 5DQ9A 3OGCA 4YPJA 3BPNC 4DOHB 1NCWL 2NY6D 1Q72H 5DQJA 1Q9WB 2MOVA 2GT9B 4X7TB 1Q94A 2O5ZL 2VABB 2A1WH 1D5BB 5IQ9A 4JEGB 4N5EC 1A6VL 4K8RC 2AJ3B 3S34L 3SPVA 5ETUA 4PRID 1P4BH 2DLHA 2B5IB 4J4PD 4Y2DA 1CFNB 2PUQT 1E4KC 3VI4F 2H2PD 5FYLE 3SO5A 4H1LH 5C0RH 3VW3L 1I8LC 1MRCL 5E4EB 5DEFA 1J1OH 4N1HB 3BPOC 2VDLH 3RWFB 3VGBA 1NUFA 4WDIA 3VH8A 3IDXL 1RSFA 4JRXE 1CWVA 1FH5L 1VGEH 3S35L 5C0CD 3PDOB 4OGAC 2Z93A 4HUWA 3N9GL 4XCFH 1AGFA 3RL1B 5L88L 2OZ4L 3RWHB 1A7NH 3MJ8B 5F1SA 5HGHA 2VDRL 2GJZB 5ALCH 2A9NH 1RU9L 5HD8D 3DVNA 2CRIA 3MRJB 1I7RB 2ED9A 2NNAB 4K8RH 5LKNA 3LEVL 3B2VL 2MMXA 1OY3B 4NNYA 5D7SH 3WFEL 3FMGL 3L3KB 1RIHH 2VL5B 4GUPA 2ZCHH 3QDJD 4JHWH 1U91A 1ZT1B 5IVXF 3SE4A 4XBEH 4UU9B 1JWSB 4PFEA 4IRJB 1CGSH 1CE6B 1XF3A 1PGRB 2IAMD 5JW3L 2UY6A 4MQSB 1OL0A 1X6LA 5D1QA 3VRJA 5DUMH 1CFVH 1UQSA 5C0AA 1ZT7B 1FNSL 4UIMB 4E5XA 5HPMA 3QEGH 4RQQA 4YJZL 1GIGH 1MFDL 5J9PA 2FHBA 3BP6B 4KJYA 5DD3L 4PYHA 4ODHL 5GGTA 5SV4A 3JTTB 1RIUH 4XP5H 1JMZA 4G8IA 3LQZA 1LO4L 3MFGB 5GGQL 3G6AB 3GMQB 3PABB 4LBEA 3MMEA 5EZLA 3P40A 3T2NL 2J5LC 1ZS8B 3C6LC 2QLVB 5DHVB 1SY6A 2XY1A 1EV2E 2R0ZL 3WV0A 4NYLB 3BKML 2B20A 4HS6B 3U0WH 4PG2C 1TZGH 4GRLA 5D6CB 4BZ2H 2P42B 3BSZL 5K9KA 4IMLA 3HHRB 3MOBL 1P7KA 4G42B 3VXOA 5IVXA 1FCCA 5KAQG 2LFGA 4LPWA 2FHCA 1T7VA 1MIML 1NH6A 1QKZL 3KJ4C 3X17A 1HXMB 2OSLB 1K6QL 3TBYB 1J11A 4GOSA 1Q72L 2IMNA 4KJPD 4ZUWB 4G8FB 4AT6A 4G6AC 3HE6B 1LK2B 4WEBH 3T0ED 5JW4N 3GFUA 3PDDA 4KK5C 4P3CL 3KPQB 4UINL 1XF5B 5DGRA 1P4BL 4QNPE 4FQHA 1BQLH 1QSFD 2KH2B 4DCQB 2JJSA 3P0GB 2BNQE 5C0RL 3O4LB 3CFCH 1SMOA 4PD4K 5F71A 1KF9B 4OZFB 4U1GB 1J1OL 3ISWA 3L9RA 3CZFB 2VDLL 4PP2B 1I3RB 1I8IB 4M43L 2GTWB 1SM3H 1DQMH 4JFFA 4XCFL 1IC5H 2C26A 3NPZB 4P9HH 5AD0A 1J0KA 3RPIB 2V9QA 2YD2A 5GS2H 3KPSA 2A9NL 1PSKH 3V7MA 3QDMD 3L5IA 1EA9C 1YA5A 2NXYC 1X7QB 4L8SC 4P0DA 4K8RL 3WMSA 1W0WB 3EDEA 2EEAA 5DJDB 1VFAA 2AEIT 1HINH 3SCMD 4JHWL 2Z8VC 1VACB 5HHNA 4XBEL 3Q1SH 1CGSL 5DD5L 3FB5A 5J6GA 2FIKA 4H8WC 4GO6B 2DYPA 2FEDD 1S5IH 1LEGA 4RWYL 4F7PB 2AK4B 1FVCB 4H0GA 4WU5A 5DUML 1RUKH 1EFXA 3MRRA 3SJVA 4Y19D 4F9LA 3GIVB 3QEGL 1GIGL 1YY8B 4UOW0 1RIUL 4PREA 4AH2A 4LSQH 3KPOA 3MLYL 5GJTL 4APQB 4Z7WF 4NPYA 2IPUK 1R5IA 5ISZA 1J0ZA 2GFBB 3NIGF 1OB1A 1I7ZB 2W60B 5TPWH 2FNBA 4F8QA 3MRBA 1IGYA 2GK2A 1NCBL 1TVHA 4K7FB 4NC0B 5E6YA 2VXQH 1G0DA 1RHHA 2YD7A 4QHMB 3EFDH 1GOFA 3FQRB 4L1DA 4LVEA 4N8CH 1FFNA 4N1CA 3MV11 4Z7VB 1GC1C 3GO1L 5DJ2B 1Q0YH 3QG7H 1WTGT 4WRLA 2MNUA 2MKLC 5I66A 2BSSA 5C0CE 4OFVA 2EE3A 4G8EB 4YR6B 2YA2A 4U6TA 3WXVL 1G7HB 3D3VB 5BMFH 5IQ7H 5J0BA 3IDNA 5I1KH 1YNTA 2FGWL 2VIRB 4KROB 3I9GH 3C6SA 5D2NB 3OXRA 1CDCA 1JF5A 5IHZB 1LP9E 2FLBT 3RY5A 5ESVB 4B7IA 2APVA 4EEEA 5FYKU 4TSCH 5IEHA 4OLZH 2YD3A 4WEBL 1V05A 1H8OA 3NZ8A 1ZWIA 2XI9A 4GW5A 1GGUA 2ZZUT 3HUJE 5H2BB 2VNCA 3I3EA 4HJGB 2DQEH 4LCUB 5E6ZA 4XX1E 4NZRL 4ELMA 5ECJE 3FT4A 4HHAB 2VLJB 3FOMA 4NM4H 1MWAB 3QQ4B 3QDJE 5IHUH 2SEBB 1XCQA 4PR5A 2MQCA 1X44A 2PXYA 5TDNA 5BVPH 4YHYB 2MFNA 3J8F7 4NQXB 5D1XA 2FSEA 3DX9B 3VA6A 1SM3L 5DJXB 2H9GB 1EVUA 1ZLWH 1B6DA 1IC4H 1G84A 1GHFH 3VJ6B 4P9HL 5GGSB 1I8MA 1X5KA 4QYOA 2IEPA 5IB5A 3BX7C 3GBLA 2V5YA 2VLKB 4AEEA 1M7XA 1SYSB 4OZGF 1PSKL 4LLQA 3B6SA 1BX2A 1D3CA 4YHNB 1MI5B 3ULSB 4XPFH 5K93A 3QEQA 4Y4FA 1QSEE 3OZ9H 1T22A 1LDPH 3SE4C 2AJXH 4XNMA 4HWUA 4LASH 3GDBA 1OSZB 4KRPB 1SBBA 3TO4C 5K9OB 1HINL 3D25A 5F1IA 1AXSB 4MB3A 5D1QC 3KWWA 1NCAL 2VL4A 1ZGLB 3T0XA 1X5HA 4KGLA 3MOAL 1OAXH 1TVDA 1S5IL 2A74A 4KK6C 5KSUB 4CADB 4U1KA 3UTTE 1UVQA 4Z95H 3ESUF 5GSRA 3KLSA 1RUKL 1AGDA 4S1QL 1YMMD 3SKOB 2XNAB 1INEL 3VGEA 2F8OA 1U3YA 1D9KA 3HZYA 4CRPA 4Z5RA 1FGNL 1G1YA 4BFGA 1E4XH 1H3PH 1A5FH 4KY1L 3DXAB 3BWAB 4JAMB 4U7KA 3PL6D 3HG1D 2BK8A 4OZGA 2OL3B 3T0EE 3T8XA 4EXKA 4Z7UF 3AS0A 2EECA 5F88B 2VXQL 3KYOA 1AY1H 3ZE0F 3EFDL 2HYMA 5IB4B 3NGBB 1QSFE 3ZDXF 3IFOA 2K3TA 4JR9H 4HJJH 4F58H 1RJCA 2IAND 3QG7L 4D8PB 1DUZB 2CDFA 1J12A 5GGTH 3ES6B 1MHHB 2C4FU 1CI5A 4OKDA 5T1DH 2PO6D 5KSAA 2ED7A 1JPTH 5HGGS 3QDGA 2V17H 5BMFL 5IQ7L 2BVQB 2OX5A 2UUDK 5DJCB 5I1KL 4Y5VB 2DJSA 1JVKA 4F2MA 1UA6H 1SY6H 1SEBB 3VDAA 4ZOEA 4HSQA 4K9EH 3QDME 5D6DA 5JHDA 4MJ5A 2KKQA 1ZHBA 4TNVF 5BS0A 3CZJA 3AY4C 5ENWB 1RK0A 3RWEA 2D9QB 1XIWD 2DQEL 2NX5B 5CD3B 2E7HA 5F89A 2R2BA 3GMOB 4I3GA 3UTQB 4LDOB 1U8JB 1KCUH 4KKLC 4PJ9D 5IHUL 3D39B 1U6AH 1TFHA 1ZA6B 1NMCC 2YWYA 2YHGA 4BUGA 4PLNC 2GUOA 5BOZG 2FWOA 1HKLH 4K55A 4QTHB 3QUZA 4Y19E 3T3PF 5I1AB 1GHFL 4OLUH 3VFPB 5DD6A 3ZZ1A 5JOEA 5DZNA 1XF2A 4PBXA 4HT1H 3QIBB 3QFJB 3ULUD 2C3XA 3PG2A 4BK5A 3DVGA 1IL1A 3QAZB 4DWHA 3JV4A 3C5JA 5CEYA 4B41A 2CIKA 1G7QB 1CGTA 3OZ9L 1S7VA 1WC7B 5EO0A 3KS0J 2FEEI 1JZ8A 3SDXB 1GPOL 1T1ZA 3QJFB 4U1SB 3UYPA 4XB7A 4ZOBA 1JIBA 2KL6A 1C08B 4F8TA 2FJFA 4NSKB 5LCVH 4G5ZH 1KIRA 4ZUUA 2XPGB 4TOYH 4RNRB 3MLUH 4PIRF 2JCCB 1UJ3B 4Z95L 5DI8A 5J13B 3IU3A 3S9DB 3ZT6A 1PG7X 3QUYA 5C0JB 3RX8A 1SJEB 4NZTL 5GGVY 1SEQH 1E4XL 1A5FL 5GJSL 3P4MB 4LP4A 4JRXA 2IPKB 1TZHB 2E5EA 2ZOKA 5IBLD 1FC2D 4MSWB 4QWWD 2RCSH 3QO1A 1AY1L 4LIQH 4GG6F 1FN4B 1T7YA 3D48R 3P4NA 4XBPB 4JR9L 5CBEB 1T20A 2XQYG 3TIDA 4F58L 3H0TB 4S2SB 2HLFC 4Z8FH 1B2WL 2YD8A 3MJ7A 3BI9X 1IC7L 4LCWE 4P9ML 4HG4J 3WN5A 5SWZB 2W0LA 4PGBB 1MLBA 1JPTL 4XWGL 2V17L 4PRHB 2CK2A 1BOGA 4CVWA 1UA6L 1FLTX 1SY6L 2C3WA 4LKCA 3LKNB 4GKZA 1MJ8L 3ME0A 3NA4A 4PG9A 3PGDA 4K9EL 4CW1B 3RIAF 1JRHH 3QPXL 4KRNA 4JZJB 2Y36H 4PJ8D 3TBSB 1OWRM 4HKBB 1L7IH 5EULV 1NQBA 1A7OL 2ZOLA 2WM0A 2AV1B 4Z0XA 5D1XC 1KCUL 2J3SA 1VCAA 4DK6A 4RISH 2GY7B 5BZDA 1U6AL 3GMLB 4HULB 5CS7A 4M7ZB 5HVHC 3F6LA 1AO7A 2FX8H 1L9MA 1HKLL 1ZLVK 2ARJB 3MLZL 2LAGB 5I74B 1YMME 4OLUL 3AS3A 3RVTD 4OKVB 4Y4FC 3VXSD 1HZHH 4HT1L 4IS6B 3AFLA 3BP4A 3H9HB 3NH7H 3N06B 1OLZA 3SDAC 3O11A 1MJ7L 3HG1E 2YMXL 2DQHH 5HHPA 3WNLA 2IH3A 4CVZA 3UBXB 1A7QL 1I1CA 4YBLC 2OK0H 1QFOA 3SKNA 1HH9A 2IANE 3H8NA 2VQ1A 3ZHLA 5LCVL 4TOYL 2ADJA 5CP7B 3MLUL 1D9KC 1LD9A 1QUNA 2E7BA 5TH2A 5I71B 1UG9A 4WWKB 4RFEA 2AQ1A 2BMKB 4UDTA 4EN3A 1OARH 2O61B 2P7TB 4FQLH 3ZKQD 3MLXH 4ERSH 1IGCH 1RK1A 2BNQA 1CK0H 5IMLB 3EYUL 4EI5C 4LSRH 1IT9H 2EZ0D 3MRKA 4ODTL 1EZVX 4YXKH 1T1WB 3SGKA 3UZVB 5CLWA 1H3TA 3ZKMC 5SWQA 1U8IA 2YD5A 3DIFA 3FFDB 2QADD 3OR7A 4HH9A 4OV5A 1PYWA 1EUTA 3G6JB 3OKMB 4LIQL 2Z31A 3C5ZA 2WINB 4JM2B 4S10A 1JF1A 5CGYC 4HS8L 4RA3A 3QUML 1FPTH 2G75B 2C1OB 5D72H 1A4JA 1CDUA 3DX6A 2ADIB 1MAKA 4TN9A 3AREC 4RMTA 3BZDA 1L6ZA 5D6DC 1T03L 4IRZH 2X9XA 1KLFA 1M71B 3QI9D 4FXGA 3CFIC 5FHBL 5I9QC 1FNFA 4P5TA 2AJZA 2BVUA 4HJ0D 5F7DA 5T3ZD 4M7LT 1MCCA 4HXAH 2ADFH 5HYSA 2VLRD 3VI3E 1TXKA 1TLKA 5EUOE 4HUVA 1H3XA 5D9SB 1HYSD 4WV1B 3KR3L 5C7XH 3B83A 5D5MF 2M8XA 2NR6C 1YN7A 4WI7A 3TWCH 4PJDF 4ZUSB 3G9VA 4RISL 1CE1L 3HUJF 3QUZC 4H1LB 5F3HA 2A0LC 2IQAB 1QQDA 3BMWA 4O51B 4NKQB 1QP1A 4Z76A 4J4PA 3TN0A 5GGSY 5TE4L 1U8NA 3FQTB 3R06A 4LCIH 2CRZA 3REVA 3QIUB 3C8KA 1WWAX 3MNVA 4HFWB 5T33H 3G08A 1WIOA 1HZHL 2JJWA 1F11A 3AU1A 3NH7L 3F58L 3BIKA 2JELH 2DICA 4FRWA 3QHFL 3R4DA 5C0GA 5C0CA 4AMKH 1UM5H 5JO5A 3CC5A 2F8VA 3O3DB 3GRWL 3QCTH 2HVKA 3RGHA 2BRRL 5FO9B 3QULA 2OK0L 2L7JA 3DV6A 4LVNC 4QRPA 1LP9A 3C09C 4I77H 4NQCB 1OP5K 2VO5A 3EDKA 3EFFA 1INQA 2H6PA 5JXEC 3BPOB 3SDDB 3HUJA 1G0XA 1QVOA 2A38A 5DFVC 4JM4H 5KSVB 2V5MA 3OJVC 5TDOB 3FQUB 3F7VA 2CH8A 4JO4L 4FQLL 4LEOB 5I1HH 3QDJA 2WLYA 3MLXL 2VAAA 4ERSL 1IGCL 3O4OC 3D9AH 3QXVA 4QHUB 4F80A 3B2UC 3MNZA 4HAFA 1DVFD 4K7PX 4LSRL 4PTTB 3OKDB 2IAMA 4AIXA 4O2CB 1T04A 2J8UE 3BISA 4YXKL 2NTFB 3BDBA 3JV6B 2EKSB 3ARXA 4HX1B 2ZNXA 4XCEA 4ZO9A 1BBJA 3GSNL 5IOPB 1NGYB 4QHKI 4JFDD 4QEGA 5JZ7C 2WNGA 5KN5A 1MCLA 4WUUB 4DKEH 1E4WH 5F97E 1DN2A 2HT4C 2HKFL 4J3TA 3UBXI 3KYMB 5FYLH 4Y16D 1K2DA 2ZUWA 5D72L 2F8XC 1Z0MA 1QSEA 4N90D 5JIIA 2P5ED 2DQCH 1EDQA 5A1AA 3VFOB 1U58A 4PJ7E 2VN4A 3DV4A 2YD6A 2VITB 4IRZL 4QXGH 4JLRA 3U79A 5HYJB 4FQ1H 3VXSE 4PV9B 5GRXG 5TGBB 3C2SA 3AXLA 3V52H 2W91A 3UTTA 4HQQH 3PWPB 4LCYA 2J5LB 5BZWB 5J1SC 3MYJB 5CIPA 5GGRB 5C7XL 4TUOA 2G9HB 2Q7YB 2VXTH 1N3NA 3TWCL 1S9XA 3C5SA 5HDOA 4FN0A 4RMWA 3T1FA 1QHPA 2C3GA 1KPUB 3T0EA 1JNJA 4X6CE 3UJTL 1H15B 2BCKB 1JPST 1XGPA 4TULL 1NGXB 3GBNH 4JFEB 1JTOA 3O9WD 1QSFA 3LPGA 4EI6A 1I1YA 4LCIL 1X5JA 1G6RA 4LAJH 1ZANL 4C59B 1DTUA 2AKRB 2R29H 4MXQD 5B21A 4E41D 1DBAH 5T5NF 3A6BL 3GMMA 4XP4H 4Z78A 4PPTA 1F3JA 1BGXH 4DGVH 4AMKL 2L0DA 1F5WA 3QCTL 2X1QA 3BGAA 3QXAA 4XPGH 3VXTB 4I77L 2XKNB 4P2CG 2RAMA 1UM4L 1ZGLP 3QDMA 2I9TA 1T5XA 1P6FA 1F02I 4QOKB 1H5BA 3T4AA 4J1UB 2J1KA 5JOPD 1L6XA 4MHHI 4PJFF 1CR9H 3AB0C 4JM4L 5EG6C 4JHZA 3JTSA 2F53B 4GMSH 1KJVB 4KDTA 3SCMA 5I1HL 1NFDB 2EDBA 1J05B 3SGKC 3KGRA 3LDBC 4RGOH 4BFIB 5T3ZE 1WCQA 4HFUH 1ETZA 4RZCA 1VA9A 2Y07H 2ZG3A 4JO3H 3S35X 2VLRE 1KNOA 3C5ZC 3TLRA 2X4NB 3RHWF 1MY5A 5IW1B 3REWA 2ICWJ 4NQDD 4MJ6A 1GGBL 2NXYB 4Y19A 5EIIA 5GHWL 1JF6A 3KNBB 1E4WL 4DKEL 4KAQL 3U4EB 3VWKD 1CGYA 3MUGA 4LFHG 5EU6D 3HPLB 3L5HA 1OAYH 3O3AA 4NT6A 4OZHE 3L5WA 4ONFL 4U6XB 1QLRA 1WBYB 5IFAL 3BYTA 5FYLL 2ERJC 1EEYA 3EUUA 2K7QA 4P5TC 2EE2A 2FX9H 4CAGA 1HSBB 2DI8A 4QXGL 4QRQA 4I0PD 4C83A 3FO9B 1B0GB 5EZIL 2V6HA 4NQTA 4X4ZA 5E08H 3V52L 2BVOB 2NY6C 2EDFA 3AS1A 2FJGA 1BJ1J 1E27B 1X5IA 3T1WA 5L8LB 5ACMA 2VXTL 4K71C 4XMLH 4O2FB 1GL4B 3K4ZA 1FZOB 1GH7A 2BC4B 3V7AE 3OKKB 5DDHB 1BHGA 4YHLL 1B0RA 1ZTXH 5LGJA 1I9IH 5DQ9B 5DRZA 3OGCB 5E9DE 5TE7H 1MELA 2AABH 3GBNL 5DQJB 3RVWD 1UWEL 4CNIB 2HT3C 1Z9OA 1B6UA 4G6JL 4Q58C 1Q94B 1XGQA 5IHLB 5IQ9B 2R29L 3CLFH 3KPTA 4LCWA 1DBAL 5ETUB 1DBKH 3SBWA 1WK0A 3GJFA 4XP4L 3BDYH 1BGXL 4OSUH 4JFDE 4ZXBD 4G8GE 4L4VD 5DEFB 4XPGL 1IM9D 5DWUH 4MVBD 4M8QA 1F90L 1MAJA 3KPPA 4WDIB 5DJ6A 3VH8B 2EIZA 1NEZG 4OFPA 2F58H 4OI8A 2Z93B 4HUWB 2YBRB 1AGFB 2MSPA 5CEXA 1CFQA 3MLPA 3IETA 1CR9L 1H0DA 4BFBD 1JN6A 2IAMC 2EDKA 4GMSL 5MI0C 3ILQD 3RUGF 3DVNB 3AM8A 1G0YR 4Q9QH 3IKKA 4RGOL 3HS0A 1M05A 5CWSA 5F9DC 1FFOA 4HFUL 2E7CA 3W5NA 5CUSH 4ZQKA 3U30C 4JO3L 1ZMYA 4NNYB 1BD2B 3D18B 4FG6D 1N26A 3KHQA 2VXSH 3IB4A 3O3BA 1DZBA 1S7RA 4PRAB 3FN3A 1YMMA 1U91B 4UILH 2PKDA 5GGUA 1XF3B 1ZHNA 4I3RH 4U0QB 2P47B 3OKLB 4CJ0A 5D1QB 4L9LA 4GKNB 1TETH 3P9LA 1Q8MA 1UQSB 4X7SH 3QXUA 5C0AB 3PL6A 3HG1A 2EO9A 2NXZC 5HPMB 5J9PB 4OGXL 4KJYB 3C87A 1IKNA 2ORBH 1PAMA 1IM3A 4BQ9A 1NC2D 3K2UH 3SDYL 2R1YA 4FFZH 4G8IB 3LQZB 1NJ9A 4WW1B 1CGXA 3FN0L 5K9QG 4LBEB 1OTTD 3MMEB 5D8JH 3QQ3B 1RY7B 2AVGA 3U0TA 3IU4H 1GGTA 5E08L 1S7QA 4Y1AE 2O5YH 4KJPC 2KBGA 2QL1A 3OF6D 1YY9D 5SX5K 4GRLB 5I30H 4M93C 2Q6WA 3DRTB 3ULUF 3T0EC 5K9KB 4IMLB 2VSCA 1QRND 4R2GB 3VI3F 1B9ZA 3WL9A 5IVXB 1P7KB 4XMLL 5EUOF 3VXOB 3NTCH 4HEME 4KGJA 4ZS7H 5CMAA 4J3WA 5GSVA 3K4DA 2DQIH 1GGYA 4KRLB 1FZKB 1X5ZA 4YEEA 5JOPE 1ZTXL 1FNGA 1KCVL 3VMOA 5TE7L 4YAQA 2AABL 4R0LA 4P4RB 5I16A 2X4QA 5JNYB 3KPNA 4WCYH 4WENB 4PJIE 5FUCE 1ND0A 1WV7T 5ERWB 5CIPH 3SKMB 3VXRE 4IDJH 3BDYL 4FQHB 1RZKC 4NQDE 5MEPA 2V9TA 2NY0B 5EU6E 3EO0A 3L9RB 4K3JH 5DWUL 3FTGA 1V3MA 1Z5LA 3MCLH 4UUJB 3TGXA 3VXPA 1X5FA 1T66D 1U8LA 1T1YA 3HNTL 1G6RH 1OGAE 5HHVH 4KDTC 5EUOA 3SCMC 1TCMA 1MCOL 1IGFH 4JFFB 5HVFB 5F72S 1NMCB 1VFUA 5D1ZD 5FO7A 2W9LA 5AD0B 1TDQA 4WU7A 3KPSB 1OF2A 2FEDC 4Z18A 4U2ZA 4LU5H 2E3VA 4OLWH 2OLDA 3V6ZA 4RGNC 3RBGA 3RDTD 3SQOL 2YXFA 4EIGB 1MUJB 4KTEH 4D9LH 5HYIA 3Q3GA 3ZE1F 1C7TA 1RZKH 4ZFFA 1T5WA 2AGJL 1BMGA 2X41A 3ZT7A 3NCJH 1QFWH 1D5XB 4UILL 5HHNB 1TPXC 2DQJH 3HAEB 3E1F1 35C8H 3FB5B 5DVNA 2FIKB 2B4CC 2DYPB 3O6FC 4D9RD 3K8KA 2P49B 1S7UB 4WU5B 1EFQA 1EFXB 3MRRB 4X7SL 3SJVB 3ROOA 5B3JE 5EC1A 3FO1A 3OAUL 3VFVB 2ORBL 4JRYB 5TQ0H 3BZ4B 4PREB 1ZLUK 3K2UL 3IDGA 4AH2B 3KPOB 4FFZL 4WO4C 2K9UA 5L2JA 4NPYB 5ISZB 1R5IB 2FDBP 2PR4H 1N7ML 1KFAL 5SV3A 3S3JA 1OB1B 3KS0H 3MRBB 1IGYB 4PJ7F 4CU8A 1TVHB 3IU4L 3U48A 4OZFG 3CX2A 5C09D 4NQUA 3L3DA 3CMOH 1FFNB 5I30L 4X4YA 4X5WA 4L4VE 2BY3A 1NBZA 3MRHA 2B4CH 5DUPH 4MD4A 4LDEB 1IEAA 3PWUA 5I66B 5C0DA 4ZS7L 2XZZA 3WLWD 2J8UA 3FN9A 2BSSB 3CMGA 2B39A 3WS3A 2R4RL 1C5CL 2DQIL 4PJ8A 4M6NH 1YEKH 3IDNB 3VU2A 4MAUL 1FCGA 3C6SB 3OXRB 1OT2A 2YUVA 5M94B 1P7QA 5F9AC 4NKIH 2BHUA 2DWEA 1JZ5A 4X6CF 5IEHB 2Q1EA 4WCYL 4PJEE 3BGMB 4C56B 4XCNA 1ZWIB 1DQDH 3PHOA 4YUEL 4GW5B 4JFHD 1W72A 3RTQA 1AGCB 1CL7H 2UYLA 3FT4B 4IDJL 4PJ7A 4PGJA 3FOMB 2AJVH 5FGBA 3ROLA 3HR5A 1JNNH 5I6XC 5I8EA 1XCQB 5K33A 4PR5B 1P6AB 3BGFB 2PXYB 5TDNB 3VXSA 3GSXA 4TNWF 1Q1JH 4K3JL 2Y4SA 3MCLL 4PJ5D 4RGMC 3NIFE 1V3JA 5D1XB 2FSEB 1FO0A 1G6RL 2JB6A 3FO2A 5HHVL 4EVNA 1JZ3A 4PGZA 1IGFL 2GJJA 1UEYA 4W81A 1QFUH 1I8MB 4QYOB 4X99A 4XHJD 1VHPA 5HVHB 1N2RB 5IB5B 3DOSA 4Y4KC 4XP1L 3GJFH 4LLQB 3B6SB 1BX2B 2HJKA 4DUWA 1EEZA 4Y4FB 4BSJA 5EFIA 1T22B 1KTRL 1SVZA 4X6CA 2Q20A 4YX2L 5D96B 1MHEA 4S1RH 4XNMB 2EEDA 5F7KC 4GKSA 1A6PA 5J12C 3MBED 5F1IB 4RMRA 5F44A 1QFWL 3NCJL 3KWWB 3PL6C 1QRNE 3MODH 3BD5A 1IKNC 1QSZA 2A74B 4U1KB 1ZSDA 3OB0H 1UVQB 5GSRB 1AGDB 2LTQB 2W0FA 4BQ8A 3JWDC 4WHTA 4OBSA 4GMTH 1GYAA 1D9KB 3HZYB 4Z5RB 1ORQA 1EAPB 4DFHA 1CCZA 2HG5B 2PO6C 4K3HA 3SE9H 5CSGA 3SHSA 2PR4L 1GOGA 3V95A 1YEHH 4OZGB 3T8XB 3CX5K 5JLZA 3PWVA 1KLGA 3KYOB 4X6DE 3UPRB 5CEZD 3L6FA 1QPXA 3CMOL 3FL7A 2ICWA 3IFOB 1PEZA 4UOW1 3UMTA 5J4MA 1J86A 3HZKA 3RVVD 5JHLH 4OLXL 1U8PA 4M1GH 2CDFB 3R0NA 1XIWC 1PKQE 4LARH 1CDBA 2VLRA 1KB9J 5KSAB 4UQ3A 3QDGB 5J1TC 3BP7A 4HLZH 4PJ9C 4N5UA 4FP8H 4F2MB 2H32A 1WSST 3AREB 4OZHA 4NKIL 5B3NA 1PZ5A 3V0WH 5JHDB 4MJ5B 1D5ZA 2C1PB 2VE6A 3OGOE 4U0RC 3TJHC 3WDJA 1RK0B 3BO8A 1J1PL 5HHMD 1CL7L 2ADGA 2R2BB 3TPKA 3LV3A 3B43A 3TVMD 4HK0A 4GXVH 3ULUC 1Z9LA 2AJVL 1EUUA 1PD6A 2FD6H 1YEIH 1JRHI 3LB6D 1MIEL 5I1CL 4TTDC 1Q1JL 1K4CA 4D9RE 2FWOB 3IRZA 1UXSA 3HMXA 2YRLA 3MRIA 3QUZB 4NJ9H 4CJ1A 3K1DA 5FKAA 4F7TB 4GRWE 2DL2A 3ARGA 1QFUL 3BDXA 3BE1H 5DD6B 5B38A 3RWIA 1XF2B 1QBMH 1T6WA 2ATPB 4L4TB 2DJ4A 4LMQE 1KIQA 3NCFB 4YHZL 1IL1B 1A21A 3JV4B 3C5JB 3HCVA 4JY6A 4HIHA 5CEYB 2CIKB 3RA7H 2DIJA 1M7DA 4MJ2A 5EO0B 1OLLA 4S1RL 4I3SH 5E9DA 3EOAB 5C09E 3ULUH 2WIIB 4QGYA 1BWWA 1T1ZB 1E6JH 1MFCL 2FJFB 3CNKA 4ZSOE 4P4KD 3TA3D 1KIRB 1EIBA 43C9B 5DTFA 1DVFA 4ZUUB 4JFPA 4PLJD 4LVNB 4QWWC 2P8MA 3C09B 4PY7A 4DGIL 4RAVA 1KENH 5DI8B 3KG5A 2WQ8A 1YJDH 2WK2A 4HKJA 2HFGH 4BH8A 3IU3B 4JFDA 5FO8A 1BP3B 3RZCD 2W0KA 4G8GA 1MSPA 4X9GA 3QUYB 2A6JA 2HLAA 1EO5A 1FL3A 1MLCA 1KG0A 5AZEL 2F74A 4JRXB 4X6FA 4MWFA 3VGDA 1YEHL 1NGPH 2ZOKB 1DQLL 3CVHL 4FS0A 3K1KC 3QO1B 4DTGH 3MACH 3P4NB 3PQYD 3DURA 2IWGA 3GSVA 4Z0BH 3IFLH 3EYSL 1T20B 3TIDB 4JGJA 1LE9A 4DVRH 2EYTA 4GKOA 4PJ8C 5JHLL 4M1GL 3HI6H 4PJ5E 1U3HD 3GK8H 3WN5B 3U7WL 3VG0H 1CF8H 1VEPA 1W0YT 4QRUA 5DS8B 4WHYH 4ODWA 4ZFGH 3J7HA 1CYGA 2EDEA 4FP8L 4F7EA 1BOGB 2LAAA 4AZ8A 3K0WA 3WO4C 4LKCB 1NMAH 1NDMA 2EDLA 1KLUB 2VB5A 4N9GA 1FORH 4PG9B 3OV6A 3PGDB 3V0WL 1F3DH 3VFUA 1WWCA 1R3LA 3BN3B 5ITFA 1T0MA 2VLKE 3RVTC 4PJAE 4YDVA 3ZL4L 5CINH 2X9YA 3KPMA 4WTZG 3V0VA 2ZOLB 4J8RA 1WZMA 2W59A 2YD4A 4Z0XB 4GXVL 3O9WA 1CLCA 2FD6L 1YEIL 1IGJA 4LHUG 4C55A 5BZDB 3RPKA 3Q5TA 4QF1B 4HMDA 4JPKH 4OT1L 2IQ9H 4UBDD 4Y1AA 1LO2L 4W70A 3GEWB 2IBZX 4OGZA 3EGSA 1D6EA 2CGRL 1EHAA 2DAVA 4F37F 4R4BA 1QBML 1W72H 4POUB 1OGTA 4M3KB 3BP4B 3M1BA 5E2UH 4X7CC 1S3KL 1Q9OA 3O11B 2XQYK 5E7BA 1F58H 4DZBA 5HHPB 4X7FC 2CQVA 2IH3B 4M1DH 2EZ0C 5CEZE 5BV7H 1FO0H 1E6JL 2E6JA 3SKNB 1R3KA 4YO0A 1HH9B 2ZUXA 4F7CA 2VQ1B 1JHLH 4PJIA 2XACC 3I02A 1FYTD 2QADC 2ADJB 1YNKL 1HIML 1LD9B 5JXAH 3VXRA 4RFEB 2RGSA 4QXUL 1KENL 4UDTB 1N59B 1YJDL 1KTDB 4NQDA 3TZVD 3GHEH 3BJ91 3DUSA 3M07A 2BNQB 1RK1B 1REIA 2MCPH 1KJ3H 3VWKA 5IMMA 5EU6A 2YR3A 3Q2CA 4JFYA 3AB0B 3MRKB 1IILE 5I1GL 5B3JF 1U92B 3LN4A 4MQXD 2X4SA 1OGAA 5E5RB 3LCYA 3QI9C 5SWQB 3K81A 1U8IB 3DIFB 3OR7B 2PETA 4OV5B 5CILH 3QP3A 2EKJA 1PYWB 3D85B 5HHME 4HJ0C 3TP4A 2Z31B 3C5ZB 1ZT4A 2BSRA 3MACL 1QPPA 3P11H 4MDJA 4D0DA 4Z0BL 3IFLL 1G9EA 3EZJB 3LN5A 4FQQB 3TT3L 4Q9RL 3CUPA 1CICC 1PEWA 2VSDA 4DVRL 4LSDA 5IROA 1A4JB 2CKBA 1FZJA 2OTUA 3HI6L 3DX6B 1IARB 3GK8L 2CR6A 4ZFZA 5JQ6L 3VG0L 5DMJB 1MNUH 2FZ3A 3MLWL 4FXGB 1N4XH 4ZFGL 4MNGE 4FQCL 4P5TB 2AJZB 4ETQA 5C86A 4JPVH 5C2BL 4OFYD 5FM4A 2A83A 5F7DB 5HYSB 5J56B 5EU4A 3UBXG 1QTYT 5I18L 4LLDA 1OP5H 1X5LA 2GY5A 5L0QC 4KDWA 4P59H 1A8JH 4HUVB 4AM0A 1A1NA 1KPRA 5T3ZH 4LL9A 4AY0A 4GW1B 2NY6B 3TBTA 2XWTA 1YN7B 4PJEF 1I8KA 3GMRA 1DEEA 4JPKL 2IQ9L 4QGTA 4K71B 2GT9A 1U8MA 1ZHKA 3MBXH 4Z76B 2Q86B 1U8NB 3R06B 5LAXB 3REVB 2OJZH 2ZSVA 3C8KB 4L4VA 2QSVA 3MNVB 1HHJA 4JVWA 1R3IH 1W72L 1F11B 2M2DA 3AU1B 4ESKA 4P2OC 1IM9A 3DARA 3WFHA 3BIKB 5C0GB 1BJ1H 3DYPA 4R4FH 5C0CB 2R23B 2Y7QA 3CC5B 3EOYG 1F58L 5JO5B 3TPUA 1TCRA 2HVKB 3UPCA 3MLTB 1DVFC 1J0YA 3QULB 1JHTA 3B5GA 4IJ3B 4M1DL 4BZYA 2FGZA 5BV7L 1FO0L 3HMXH 1FFPB 3I84A 1CTNA 4QRTB 4YHMH 3RL1A 3V8CA 3EFFB 4PJEA 1INQB 2H6PB 1WZ1H 3MJ8A 4YGVB 5JXAL 1QBBA 3HUJB 3ZE2F 1QVOB 2PCPA 2VYRE 5LVEA 3TJEH 3MRJA 3F7VB 5E2JA 3GHEL 2NNAA 5JR1H 3QDJB 2VAAB 4L3AA 4Y16C 1DQJA 3JZ7A 1DL7H 4OJFH 1LO3H 3MNZB 2IF7A 5KAQF 1U9KA 2VZOA 2IAMB 1WBZA 1T04B 5MI0B 3LS4L 2OMBA 1BOYA 4XCEB 1BBJB 2P45B 5HDQH 2CIIA 1E6OL 5GRUL 3R8QA 5KN5B 4H1LG 5CILL 4ELKA 3U30B 5FHAH 1EZVY 3P11L 2E8ZA 1NC2A 4HBCH 4PGEA 1P9MA 3BWUC 4HMEA 4X6DF 1K2DB 4I13B 1DSFH 2YXMA 3DNKA 1CQYA 3WFDL 3SGJC 3WNOA 3MRNA 3WNNA 1U58B 5IB1A 4MS8D 5EOQH 3GMQA 3LQMA 4PP1D 4Z9KB 4BA8A 4GRMA 1N4XL 3FKUS 3RIFK 1F4XH 4JPVL 2R69H 3PWJB 6FABH 1QRNA 3AXLB 1RUAH 1MCIA 1WWBX 2DMCA 4LCYB 1CGUA 3U6RA 2KZ1B 5CIPB 4TUOB 4MXQC 1NGQH 4U1LB 1N3NB 2I9LA 2XG5A 5HHOD 1S9XB 5KSBE 3C5SB 3O3EB 3VRLE 3C6LD 3BMVA 4J7RA 3T1FB 4PB0H 4C58B 4FZEH 3T0EB 1XGPB 5EBWA 4X6DA 1GGIH 2RHEA 5CFHA 4QHKJ 1NGWB 2N7AA 1QSFB 3RZWA 3CPLA 4EI6B 1KIPA 1LK2A 1I1YB 1G6RB 4WW2F 5ICZB 5JMOC 2HTKC 1R3IL 4RMVA 1PKQA 1NCUA 2UVEA 1UH3A 3GMMB 5KS9F 4ACPA 1HILB 1F3JB 4R4FL 3UTSD 3BD3A 1A1MA 5D1ZA 3BIAX 4LLUB 5FUCC 2FH6A 1I8IA 2DB8A 4KUZH 3NA9H 5DC0A 3RI5K 3SO3C 3D2UD 4NDMB 4U6HA 4G6AD 3HMXL 3QDMB 2I9TB 2B1AH 5B22A 1T5XB 4YHML 4WTXA 2FYYA 4M61B 1UENA 3RPIA 1MF2H 4RMSA 1H5BB 2R8SL 3RNQA 3RDTA 1L7TL 2EDNA 4CU6A 3VWKC 3I3DA 2PYED 5JW4M 1A02N 2X4PA 2OR7A 3TJEL 4K3EH 3NFNA 3MXWL 3IS1X 1RQ5A 3SCMB 4JKWA 1PLGL 1DL7L 4OJFL 4HIJA 1LO3L 3VG9C 1O7SA 3OG6B 3WFBH 2F5BH 4ODSH 1ETZB 4RZCB 3QRGH 4WW2A 3B9KC 1KNOB 3PP3K 3REWB 1CFTA 2JIXD 5HDQL 4MJ6B 5EIIB 4Y19B 4I0PC 4I48B 1IQDA 5FUOH 3MUGB 4NT6B 3V4VH 1QLRB 3UTZA 3GHBL 3B5TA 3GIVA 2ZWLT 1EEYB 3G6DH 4RBPH 3F7RA 4XNXH 2H26A 1A6ZB 5KBNC 1EAJA 4HBQA 3V0AC 4AIZA 4HC1A 5C09A 5EOQL 2WV3A 4JCLA 4NCC1 4PJFB 4QRQB 3VWJD 4JKLA 3I6LE 4ZSOA 5D7JD 2VXUL 5FF6A 4Q6IA 1HI6B 3OTTA 4M3JA 3RVWC 4XPHH 4LRIA 2FJGB 1IQWH 5IM7A 5DJ2A 4I0CC 2AERT 4KVNH 1BQSA 2VAJA 2CKBH 3LHPH 3WJJC 3C08H 1BM3H 3UC0H 1OT1A 1NGQL 3DJ9A 2NY3C 3U4BH 3QBTB 1ED3A 4PJAF 1XMWA 1FIGH 1LEKA 3TYGL 1BIHA 1AIFA 3L3HA 1HCVA 4FZEL 4ZXBC 1B0RB 5IHZA 3QWRD 1NL0H 1NFIA 5DRZB 4Y8AA 3FRUA 2LQRA 4EUPB 2R0LH 5T1KD 3I75A 5SWSD 5T1MA 1RUQH 4ISVA 3STZA 4MB4A 1DP0A 1TZIA 3MRMA 4PJXE 4JJHA 5I2IA 4PJHE 5LXGH 4HHAA 4JFXA 1EXUA 2IG2H 4PJ5A 4OF7A 1MWAA 3GJFB 4U05A 1JYVA 2BXYA 1P7HL 4KMQA 3EYOA 4FQ2H 3T04D 1YYLH 5M95B 3K8MA 4KUZL 3NA9L 4NQXA 1UH2A 2BRQA 5B8CA 4M8QB 3KPPB 4FG6C 3VFSA 5DJ6B 2GHWB 2EIZB 2DRUA 3SE3A 1FRGH 2B1AL 4OZIE 1WITA 1F4AA 1EH9A 5CEXB 2VLKA 1CFQB 4PJAA 3QHTC 3VD9A 2Y6SD 1SBSL 1H0DB 5ESAA 3ELAT 1JN6B 2V7HA 1OAQH 5ITBL 4LSPH 1UZ6E 1U8KA 4K3EL 3MBEA 5J3HD 3QNZB 2ZUQB 4OD2B 4CDGC 4BFEA 3HS0B 1P1ZA 5CWSB 3WFBL 4ODSL 1FFOB 4OM1H 1GAFH 1OSZA 2WANA 4ZQKB 5F96L 4R26H 5IP4A 1PX4A 1G7LB 3MRCA 3O3BB 5CJBA 1S7RB 5D2LE 1ZGLA 1WLHA 3K46A 1YMMB 4LVHC 1OTTC 4U1NA 3DBXB 5FUOL 5GGUB 4YIQB 4NM8H 2RFXA 4OAWB 4CUCA 1BZ7A 4Y7MA 5E2VH 2CUMA 5HHOE 1IEHA 5J12B 1ZHNB 3F8UB 4PJBF 1RVFH 4L9LB 4I2XE 3P9LB 2XNAA 3G6DL 1OCWH 3PL6B 4QY8A 1K8IA 3HG1B 5I0DA 1JZ6A 4XNXL 5IJKA 3WLBA 1T4KB 4OD1L 4LGRB 3FAWA 2MKWA 3GNML 2WWKT 3TO4D 4OCRH 1IM3B 1V8HA 2CRMA 2R1YB 4JAMA 5KOVC 1NAMA 5GS1C 4MNQD 1NJ9B 3H7LA 5F1OB 1JUFB 1LNUA 1FL6A 4MD5A 2IANB 4ZS6D 3F7QA 2D7MA 5DVKA 5AAMA 5F88A 4F15C 2YKLH 3CLEL 1WCBA 4KK6D 3U0TB 1AXTL 1S7QB 2FHFA 5IFHH 2PO6B 1IQWL 2C5DC 3HI1A 3UTSE 1JFQL 1T89C 2J4WH 5T1LD 3VH8G 1I9JH 4KVNL 2Q6WB 5HI3D 2CKBL 3LHPL 1U93B 3C08L 1BM3L 4MA8H 4DVBB 2UZIH 1ZK9A 5CMAB 3RWDA 1FIGL 5E5MA 5GSVB 1I3UA 3KPRD 3PJSA 3AVEA 1SEBA 2X7LA 4JY5H 1NL0L 3WKML 1XIWB 2PYEE 2VH5H 4R0LB 2R0LL 3NZHH 1OP3H 5I16B 3TVMA 1KJMA 2XFXA 1RUQL 1T66C 3S37L 1NMBH 2X4QB 4DUXA 4CBPA 3KPNB 4UT9H 4HWBA 4JANB 4PJ9B 4LSTL 1IAIM 5D1ZC 2LVEA 4YXHH 5CBAA 5CD3A 2BDNH 3RWGA 3UTQA 2IG2L 3KPLB 1BREA 5MEPB 2FBOJ 4FQ2L 1ZA6A 4U0RB 5J06A 1UACH 2EDRA 4MNGA 2CK0H 3RDTC 3EO0B 4GAYA 3QT2A 3FTGB 4YE4H 1MJUH 1Z5LB 3VXPB 1U8LB 3E0GA 2PTUA 1FRGL 1T1YB 4XVTL 3VFPA 2FX7L 3HR6A 3PWNB 5EUOB 2I27N 1HCFX 5FO7B 4DEPC 4R96B 4U1MB 1IEBB 2O93L 4WU7B 1NKOA 2BZDA 2ICCA 2DMBA 2MTPA 4WW2C 4FZ8L 1OF2B 3HNSH 2DQUL 1U2CA 3BH9A 2WBJD 4K23L 5J8OA 4P4KA 3TA3A 4DK3A 3BESR 3V6ZB 3F7PC 3VXMD 1GAFL 4KV5E 1C12B 4MNHA 3VXQA 3QJFA 4U1SA 4LHQB 4ZFFB 3VGAC 1WVZA 1T5WB 4NSKA 2DQTL 2A6KA 3RZCA 1A7PH 2XPGA 4RNRA 5DC9B 4JFOB 3U7AA 4P3WA 4XNZC 5E2VL 2WWKO 2QJDA 4F3FA 3FB8A 1RVFL 3H2WA 4IHOA 3DTXB 1CLYL 2FO4B 5CJQH 4O00A 4HLJA 2X89A 5EC1B 1SJEA 3FO1B 3O6KH 1K3IA 4YGAB 1HEZB 3GSQA 1WAAE 4LPVA 1T2JA 4OCRL 4ONOA 3HE6D 4Q6IC 1CD0A 3P4MA 5DJ8A 5SWSE 2XN9D 5B4MD 2Q8AH 1RZIA 1MPAH 5L2JB 5I1JH 1FYHB 2YS4A 3EO1A 4N0RA 4GRWH 5JDSA 4OIIH 1PW3A 2YKLL 1J7VR 4WVRA 3ARFD 1U3HA 1M4KA 1RZJL 5CBEA 1TQCC 1IAIH 4POZC 5CJXA 4NUGH 5FUZH 3L3DB 4OTXH 4BZ1H 1I9JL 1RULH 5DZOA 3KHOA 1MCDA 3QHZH 4X5WB 4H5SA 4JREC 1NBZB 4GG8B 4C54A 5CJOL 3MRHB 3WIFA 4MD4B 2QSTA 1JJUA 4HC1H 4MA8L 5GGVL 3H9SD 1IEAB 1YEGH 3PWUB 4G7VH 1HH6A 2UZIL 4IRSC 4ZTPH 3WS3B 2X4OB 1Q38A 4CVXA 5J1AA 4R8WH 3RGVD 1NBYA 4PJ8B 4JY5L 5ADPH 3SN6N 3VRLF 1FSKC 3AS2A 3TBVA 2FJHB 2ZUUA 1J0JA 4UT9L 3QWOA 4HKBA 2X4RA 2Y1VA 4YXHL 3WO4B 1T2QH 2FBJH 1V5JA 1W72B 2BDNL 4XHJC 2AV1A 2HWZL 2EH8L 2UYLB 5B8CC 4PJ7B 4HGKC 1ROWA 3ROLB 3SE3C 1NLBH 3HR5B 3MOQA 2YN5A 1UACL 2W0PA 4BUHA 1JI1A 5I8EB 2Y9RT 1BD2E 1GJIA 3VXSB 3GSXB 4YE4L 1WICA 1CDYA 3B5HA 3ARBC 3RQ3A 2EDJA 2FH8A 1FO0B 5BV7B 3RVXD 2JB6B 3DHMA 3FO2B 3MBEC 4LNRA 5E95B 4EVNB 2F5AL 5C08D 3GSRA 4UV7H 5HI5D 4X99B 1ZV5A 1F13A 2HT2D 1B4JH 5F7EL 4P2QD 1MWAH 4MNQE 4J3SA 4NC1C 3HNSL 5KSBA 5IBUB 3V8OA 3PXJA 4HCRA 5KVMC 1EEZB 5FA4A 5TQ2H 1NAKH 1F97A 1CXIA 1UADC 4X6CB 1MHEB 5L6YH 4GKSB 2W9DL 3TZVA 4XT1C 5IIEA 5F3BA 3MFFA 5ELIA 5HXMA 2N4IA 4ZAKD 5CJ8A 3SDAD 2OCFD 2BMKA 2R9HC 4Y5YA 2VZUA 2W0FB 5CJQL 1MFEH 4WHTB 3KPRE 2R0WH 4YHKH 2QADB 3MTRA 3O6KL 1ORQB 2GKIA 5ICYB 1UWXK 1AI1H 2HJFB 4JO2H 3DRQA 5I1JL 3DGGA 3NCMA 3FFDA 2ICEB 2Z91A 3ARQA 4Z7QE 5LQBH 5JLZB 3PWVB 3X12B 4GQ9H 3G04A 1KLGB 1IAIL 2QEJA 4NUGL 2ICWB 2R0KH 1ZEAH 5EIQA 4BH7A 4Y0GA 5H94A 1RULL 4P3DA 3QI9B 4EI5D 1EPFA 4Q7DA 3UJJH 1U8PB 2GW5A 4OFYA 1XGUA 4K94H 1YEGL 4RWHA 5CEZH 3AMLA 2VLRB 1NAMH 1AGBA 2FECL 2VZSA 4UQ3B 5FM5M 3TVMC 4DGYH 5F7NC 3RIFF 3BP7B 4R8WL 1YEEL 2D0GA 3LB6C 2NY5C 2W9EL 4YBQD 5ADPL 1N5AB 3FONA 3LQAL 4Y4HD 1N6UA 5CGYD 3CDYA 1PZ5B 1RIVH 2EDHA 5DUBA 3Q6FB 2P1YA 1D5ZB 2VE6B 3VXME 4OCYH 3BO8B 3VCLB 2R4SH 1YEDB 1S9KC 3LEYH 4RMQA 4MJID 1AFVH 3M8OL 3CSPA 2ADGB 4AEIH 1JP5A 3LV3B 1YQ2A 4PJXF 5L0QB 1G9NH 1NLBL 5DVMA 2M1KA 2HH0H 5E4IA 1UKSA 2IQAA 1CU4H 5E94A 3FQNA 4EXPX 3OAZH 4FA8A 3L7EA 4WI4A 4EBQH 1CQKA 1UXSB 12E8H 2FEEL 3CXHK 1T80A 5FKAB 2E8YA 1GZPA 4NWUL 4P4KC 2YC1A 3RWIB 3LS5H 4N8PA 4OFIA 1B4JL 5JUEL 4PLJC 2DKSA 4ZDHB 1WT5C 1A3RL 2B0SH 1MWAL 2XN9E 4MCZA 4ZTOH 4ETYA 2APXA 3O3DA 2GAZA 3HCVB 3O41B 4JY6B 4HIHB 5IR1A 2RIKA 3HTLX 5KW9L 3EKCA 5EA0L 1BPVA 4LVOC 3S5LB 1M7DB 4MQTB 4Y5XA 5TQ2L 3RZCC 1NAKL 1CLOH 3RI5F 2J12B 3FT2A 1E4KA 3D0VA 1FDLL 4OCLC 4F7MA 5L6YL 1DLFL 2X1OA 2OM5A 1N0XH 2IFFH 4MMZC 3O0RH 3BW9B 1FVEA 3F7YB 3QUXC 2DQDH 5DTFB 4PJXA 1DVFB 4DKDC 1T1XA 4NN7C 4PJHA 3QPQC 5KSVA 3H9SE 4P5KB 4PY7B 5D2LF 4KC3B 3FQUA 1I3GH 4RAVB 3D87B 4LEOA 4R97C 2MHAA 1MHCA 4HKJB 1MFEL 4BH8B 4CVUA 4JFDB 2R0WL 3BKYH 5ALBH 2W07A 4YHKL 4PTTA 1BIIA 3T0DA 4XNUH 1F2XK 4O2CA 2XT1B 5FK9A 2MCG1 2A6JB 2HLAB 1FL3B 4HK3N 4OF8A 1N64L 1MLCB 1CD8A 2RQ8A 4HX1A 4TYUA 2XZAH 1AE6H 1KG0B 4N0UE 5CJXC 1IJ9A 1EGJL 5BO1H 2F74B 4X6FB 5DURD 4MWFB 2KQNA 4OZIA 5LQBL 4L5FL 1OM3H 1KYOK 3CAFA 4GQ9L 4M7LH 1YQVH 3DURB 3GSVB 4HK3J 1H3VA 4NQED 3B2UD 2P24B 1LE9B 2D03H 4Z7WE 2EYTB 2YPKA 4CMHC 4K94L 2G5BB 5CEZL 1NBVL 3OR6B 2L4OA 5AUMB 4QRUB 5I17A 2ILLA 3FQXA 2LABA 2VDQH 4TSBH 5D2LA 1AKJD 2EH7L 4F7EB 3L3JA 4LPYA 1FBIL 3AGVA 3H3PH 4P2QE 3BT2L 1NEUA 3HE7C 1RIVL 5FYJD 4KPHH 4UBDC 1U8QA 4J3XA 5HHOA 3RX5A 3VFUB 1JPGA 1R3LB 5E8NA 2VC2H 3C6LA 4I2XA 4P23C 5ITFB 5HI4C 1T0MB 2I5YH 1E4JA 4YDVB 4G3YH 2Q7YA 3KPMB 2B8OT 2QSCL 3V0VB 1AFVL 4HIXL 1AP2A 2BP3A 4J8RB 4AEIL 2AAVA 2ZCKL 3VRIB 4TPRH 3O9WB 1G9NL 3OKEA 3MJGX 2ICWI 1IGJB 2PF6A 2HH0L 4QTIH 1DBMH 2Y06H 3GIZH 4LHUD 5GRVK 5IF0A 1Z3GH 1VPOL 3CU1A 2CLRB 5GRVL 12E8L 3LEXA 3UTSA 4HWBL 3EGSB 3TBWA 2E9BA 1DQQA 1D6EB 1HXYA 5DD1L 1YZZA 4U1HA 4UIKH 5INDB 2XRAH 3EJZD 4KMTL 4R4BB 1CVRA 3SKUD 1A7BA 1DANU 2B0SL 1OGTB 3D2UA 3O81A 3M1BB 1R5WA 4OUUA 4ZTOL 4LRNH 5HYEA 3B9VA 1M1SA 3P4OA 1CGWA 5HHQA 3JWOC 4NBYB 1CLOL 1RZGA 1I1FB 1RV6X 4LLMA 2PYEA 7FABL 2YD1A 3D0LB 4Y5YC 4QCIB 1AHWA 1NBQA 1HQ4A 3G5VA 1R3KB 1N0XL 4K07A 4KV5F 4UI2A 1A1OA 3O0RL 4GFTB 4F7CB 4MQXC 2XA3A 2X4TA 4PJIB 1S9VB 2DQDL 1T21B 3I02B 5HGBA 4OCSL 1NDGA 2VZ3A 1T7ZA 1KJVA 4HCRH 2JIXA 4NQDB 4X9FA 4LAQH 5C0FA 3HFML 3BKYL 3DUSB 5FCUH 3VWKB 5EU6B 4JFYB 4M4PA 2CJUH 1WJ3A 2XZAL 4L8SA 3ZYZA 3LN4B 3JSSA 3QZWA 4WY7L 2X4SB 1WAAF 1SYVA 3HPLA 4MQ7A 4MJIE 4M7LL 1ZT4B 2BSRB 1WBYA 4MDJB 4D0DB 2AEPH 3UDWC 3CUPB 4I0PB 2J88H 2D03L 2RJMA 4L3ED 5D7JA 3CVIH 4UTAH 2EC9U 2CKBB 1FZJB 2OTUB 4L8BA 4Z7UE 1HSBA 3KYKH 3U36A 4ZYKA 2R2CA 4G6MH 5C70A 5AZ2H 2FZ3B 2OXHA 2VDQL 2VRAA 3I50H 4TSBL 3QNXA 3ZT5A 4WFHE 5JW4R 4RFOH 4ETQB 2DBLH 2A83B 5IB2A 3DLQR 3MCKA 2XTJC 5EU4B 1DE4A 2YK1H 4KPHL 4KJQD 2GJ6D 1E27A 3DROA 2VC2L 4LLDB 4BYHA 1F6LL 2DLTA 4L4TE 4AM0B 1KPRB 4G3YL 1X3DA 4XCCH 5GIRA 1WAAA 4O2FA 4W4NA 3TBTB 3QDAA 1FZOA 2BC4A 4Z7OE 5SWSA 1DBBH 1I8KB 1TTFA 5EOCH 4L8DA 4WGWB 3RX7A 5E6ID 1DEEB 1DBML 2Y06L 3GIZL 4QRRE 1IE5A 1Z3GL 4CNIA 1U8MB 1ZHKB 1QYGH 4MX7A 3KXFD 1AD0B 4ZXBB 2ZSVB 4L4VB 4UIKL 1HHJB 2JK5A 2XRAL 1RFDH 4Y5XC 5E8OA 1BEYL 4JKKA 1IM9B 4JZOA 5EOTB 3WFHB 3OAYH 4LRNL 1HOCA 5L2KD 1KCSH 1YEJH 4DAGH 2Y7QB 3TPUB 3GI8H 3T3PE 2PYFA 3BKJH 1TCRB 3T65A 2HT3D 2ARWA 2EEBA 2Q3ZA 1JHTB 1MFBL 3VFGH 4JN2A 5F9OH 2Q7NA 1KB5A 2E27H 4NQEE 2YBRA 3OJDA 3T77A 1MCFA 4PJEB 1J5OH 1FG9C 5LGHH 1HYRC 2ITDB 5DYOA 5DJAA 4CDHA 1MRDH 2PCPB 1LO0H 5CLTA 1G6VK 3V6OE 2HMID 5HYSG 3X3FH 4HCRL 2CO6B 5GXBB 3HNVH 4LAQL 3NFSH 1DQJB 4OQTH 5FCUL 1I1RA 4LLWB 1BD2A 1G9MC 3D5OF 3D18A 1I7TA 5DK0A 1NCTA 3HB3D 3F5WA 1WBZB 2DDQH 5FYJE 4OBRA 4GAGH 4PRAA 5DT1H 4MS8C 4OLYH 4PP1C 4H25A 3ZMRA 2CIIB 5MEND 3IXAA 4WUKH 3THML 4ELKB 4JDVA 3QEUA 3TO4A 1NC2B 3OKLA 5TE6H 5DFTA 4Z7QF 4GKNA 2AEPL 4PGEB 4MNQA 3NVQA 3AC0A 4LVHB 1QO3B 3QB7C 3CVIL 1FHGA 4UTAL 1UB5A 2AP2A 3MRNB 2GIYA 3KYKL 3QCVH 3L3IA 5EN2A 4LLAA 3DVFA 3V6FB 3ZTNL 5IB1B 4G6ML 4WW1A 1J9CT 2QHLA 3IRPX 4IDLA 4GG6E 5T1LA 1MFNA 3I50L 4XAWH 2V2TB 4GRMB 2D31A 5C0EA 3MLRH 1L0XA 4NOFA 3QQ3A 4RFOL 2Y25A 2DBLL 1QRNB 2YN3A 1JPSL 1MRFH 2YK1L 4X5XA 4GBXC 2DLFH 2NXZD 4ALAL 2JB5L 1PY9A 3DRTA 3OPZL 3GJEA 1KXVC 2H45A 4NOBA 3KPRA 3OSKA 3IVKA 4XGZA 3U6RB 1QLEH 4RRPA 3IDYC 5CCKH 3DO7A 5JIKA 2I9LB 4FNLH 2IPTH 3VXUD 4M48H 4EIZC 1DBBL 4XX1G 2H41A 1DR9A 3NBNA 3IJYA 1CTOA 1FZKA 2WBKA 1RAMA 4UDUA 4FXKA 3BVNB 3Q5YA 4LF3A 4D3CH 1B4RA 5B39A 2APFA 4P4RA 5EBWB 4X6DB 43CAA 1QYGL 5JNYA 2A1WL 3PNWA 2VDMH 3CPLB 1KIPB 3VGFA 5D7KD 1UEMA 5ERWA 3SKMA 3V5DA 3AROA 1J8HD 2HA1A 2WW8A 1INDH 1JTPA 4G6FD 4JPIA 5KVFH 3I2CH 1PKQB 1X4YA 4A6YA 5KVDH 4WI3A 4N0FA 2D7QA 4R7NB 3AY4A 1AHWC 1YEJL 2VDOH 1A1MB 2V5SA 3GI8L 4XHQA 4KKBD 5D1ZB 4AQ1B 1BQHA 1I85C 1K5NA 2ED8A 4UUJA 3ARDD 3VFGL 3MRGB 4U6HB 5F9OL 1VGEL 3O3UN 2E27L 4I18C 5A2LH 2GI7A 4L3EE 1FZMA 2FYYB 1ZHLA 1J5OL 1A7NL 3RNQB 3RDTB 3VXMA 1FG2A 4U33A 4PYGA 5ALCL 1MRDL 1LO0L 1H9VA 1Y6NR 3O45B 2X4PB 3V6BR 1MCWM 3NFNB 3FQWA 4NO5A 1WWWX 4NKDB 4DEPB 1MUJA 4HIJB 3WUZA 4OCXH 5D7SL 3ZTJH 3DUHA 3OQ3B 4HGMA 4WW2B 1NANH 1RIHL 2DDQL 5CSZB 4E9LA 1MQKH 4GAGL 2ZCHL 2M26A 5DT1L 1D5XA 1CFTB 3DMMC 3B8YA 1DFBH 2A6DA 3VWJC 3HAEA 4UNTA 4WUKL 4GRWB 1IQDB 5D7JC 1VENA 3DX7A 3S97C 2HFTA 1RI8A 1S7UA 2XN9A 1CFVL 4O4YH 4HW6A 3UTZB 3M45A 4NRXA 2QSQA 4RGND 3TCLA 4NHCH 3VFVA 2H26B 4JRYA 4TQEH 4XP5L 3BZ4A 3F12A 4XNZB 3ARFA 4AIZB 4ODBD 2NY1D 5C09B 4JHBA 4XAWL 5E99H 4KFZC 3MLRL 3S3PA 4ZSOB 2VERN 5ADOH 3QUKB 1I1AC 4PRIE 3O6FD 4EQ2A 5FF6B 2VUOA 2P4AB 4Q6IB 3U0WL 1VERA 3PGCA 1TZGL 1MRFL 3H9SA 3B9EA 5L2KE 2FB4H 1XR8A 1U95B 4FTVD 4BZ2L 5IM7B 1C5DB 3LD8B 2IJ0C 1TJGH 3RGVA 4XBGA 5DF0A 4H8WH 1QLEL 2ZSWB 5CCKL 1GGCH 4WO4D 4KTDH 4M48L 1ED3B 4LGSB 4N0UA 3UP1A 1LEKB 4JREB 5ID0A 1AIFB 3L3HB 4D3CL 1NFIB 1EO8H 2OBGA 1FP5A 3FRUB 2F54D 4G43A 2BY2A 1UKTA 4DN3H 5D5ME 1FV1A 3I75B 5T1MB 2VDML 1RJYA 3BGMA 4ISVB 4PJDE 5LBSH 2DQFA 3N1QC 3STZB 4C56A 1TZIB 1Q0XH 4Z7WA 2AJYH 2CLVB 4P2YA 3MRMB 5I2IB 1AGCA 1INDL 1FSKB 1K9TA 4J3VA 3I2CL 4JFXB 4XPBH 1EXUB 3SDCD 2Y6SC 4PJ5B 1BQLL 1GC1H 5KVDL 2V2WA 3RU8H 4OI9A 1U3ZA 2COQA 5J3HC 3CFCL