2WCPA

Crystal structure of mouse cadherin-23 ec1-2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structural Determinants of Cadherin-23 Function in Hearing and Deafness.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA02
4ZMVA 3K6DA 4AXWB 1WYJA 4AQEA 1Q1PA 2OMVB 4ZMWA 1O6SB 4ZMOA 2WHVA 4AQAA 3Q2LA 4ZMXA 2O72A 4NQQA 3K6FA 5JYLA 3LNIA 3QRBA 5JYMA 4ZMNA 3FF7A 4QD2E 2X2UA 4ZMPA 3LNDA 3UBFA 3LNHA 1L3WA 1ZXKA 2OMYB 2YSTA 1NCIA 4NUQA 5CO1A 4ZTEA 3FF8A 3LNFA 4AXWA 3Q2WA 3UBGA 3K5SA 4ZMYA 3K5RA 1ZVNA 2OMXB 3LNEA 4APXA 2V37A 3MVSA 4XXWA 1SUHA 4NUPA 2WCPA 3K6IA 4ZMTA 1WUZA 2QVIA 4OY9A 1EDHA 5KJ4A 4ZMLA 2YQGA 2A4EA 2WBXA 3PPEA 4ZMQA 4AQ8A 2OMTB 2OMUB 4XXWC 1NCJA 2A4CA 3UBHA 4AQEB 2OMZB 4ZMZA 4ZI8A 1NCHA 3LNGA 5DZVA 4AQAB 4AK1A 5CZRA 4ZT1A 4AQ8C 2EE0A 2WD0A 1NCGA 4APXB 3Q2VA 3Q2NA 4NUMA 2QVFB 1OP4A 1FF5A 2OMWB
chains in the Genus database with same CATH superfamily
1QRNB 2R0LH 3S3SA 1SVZA 3KLLA 3ZN6A 1DUYA 3MV01 1MHEB 4MD0A 5EA0L 3NFSH 5KSAC 1HDMB 5AW4B 5I1IL 3EZ8A 2M83A 4OVUA 3SDAD 3AGVA 2I85A 3JWOH 1IM9A 1ASQA 4OLVH 1M9SA 3DURB 4ZMXA 1GCYA 3TN0A 1DANT 2P9RA 3OKLA 4ELMB 3HG3A 1DJHA 3GMOB 3ZE1F 5DZJA 4OLWL 1IU1A 5JHLH 1Q9LB 3QYNA 2DQGH 4PJ8B 4DPBX 1CXFA 5ACMA 2ORBL 1BYPA 3BWUC 1OTTD 2A6IB 1HKLH 4NC1E 3ZRCC 2XV2A 2O6CA 4YUEH 4IKLA 2KBGA 1QNIA 1RPKA 3D2UD 4I88A 3GI9L 2Y72A 3BDBA 1GA2A 2I32A 2WINA 4YQXH 4I1NB 3SGEH 5HYJA 3F6JA 2GPZA 4AT6A 4JJ5A 3CFDA 1IAOB 1QI3A 2WKGA 4R96A 3TNNB 2X1OA 3CMGA 3QPQC 4ZXBD 4JRLA 5IQ9A 1YEFH 2W60A 5I71C 4BUGA 5D1XE 1J0HA 4XHJC 3VD7A 1RMFH 2WKLA 4HOZA 5K1VA 1FHNA 2D8KA 4G8AC 5ISZE 1A47A 2X41A 5J9PA 1MRFH 4P5TD 4AYFA 5I75C 1Q72H 5E8OA 3MNMA 4H88H 1AY1L 1SYSA 1F4XH 1B4JL 3ATAA 4OLUL 4BZ1L 1QYGL 1YRKA 2QQNH 3U0PB 3VI4A 4ZFZA 4ZMQA 5KBKA 1IV8A 3DXAA 1LXMA 5FXCH 3TT3H 2EEBA 1HILB 1HXYB 4S10A 1ZHBB 2A2QT 2OP4H 1MCQA 3WS3A 2OXHA 2BSTA 2JTDA 3N42B 1FYTA 4HJIA 2CDEA 1Q38A 2VUYA 2DTML 4KUZL 2OMXA 4IOFD 3QDJE 3ZRFC 4AH2B 3PV7A 3D85A 4U31A 3S6CA 4OLXH 1PSKL 2P49B 4FC3E 1ND0B 2W91A 4DQOH 4IOFC 4AQ8C 5CJ5A 2UXTA 4JPWH 1JRHH 3V95A 4OZ4A 4J3UA 5GGTH 5J06A 5JMOC 4XO8A 3D0LA 2AXJA 2IFGA 3BQVA 1NAML 3BSHA 3CTTA 4U1SB 1ZHLB 3ATFA 2J6EH 5AVZB 5LGYA 1NMCC 4S2SA 1WIPA 3EOTH 1FL3B 4P4KB 4ERSH 3DECA 3GJEA 4PJHA 2CM6A 4OF7A 1XMWA 3B9KB 3TVMB 4HQQL 4YFEA 3MLYH 4AG4L 1CFBA 3NT0A 3ZIYA 5CEXB 4Z7QF 3RU8L 5C0AA 4CMHB 1DSWA 1BEYL 3MFFA 3MRGB 4GKNA 4Z7NB 1XXFC 2EVFA 1TFPA 5JMRA 4KKBC 4JPVL 5ACLA 2PWHA 1EZSA 1AHWA 1ZE3C 2LTQC 4U0RB 5JW4N 3MNDA 1GRWA 2IFFH 2VM3A 4BH8B 5E9DD 3ZKXB 2PPEA 1SXSA 2D3VA 4N5ED 5BRZD 4DP5X 1MHPL 1AAJA 1FFTB 4JDTL 3S4SB 1YUHB 1A1OB 1NOFA 4P0DA 5IW1A 2BSCA 5KVEH 1ZA6B 5CJXA 4B96A 2COQA 5CEZH 4M4RA 1LWHA 5JQIB 4YWGH 4PJ5D 3VCLB 4DESA 1KJ2B 2Q86A 3GBEA 4PTTA 2IPUG 2A99A 1ZCRA 2DQFA 5DHVH 2VRQA 4CC1A 4KJYA 2NOYA 2MOQA 5TDNB 2AI0L 1WSST 3E1F1 4YGAB 2EINB 4LOEA 5D4IA 3TBSB 1HHJA 3LN5A 3BKYL 4PJBA 1G6VK 3UG5A 3MBXL 3RGVC 3VW3H 2UX6A 4GXVL 5F3FA 3MRDB 1I3RA 4ZFOB 1H0DB 2VUOA 1XGTA 2X4QA 4FFYH 2O61A 1SLXA 3BPOC 3FQWB 2QVIA 3Q5OA 4P5RA 2V7HA 5FM4A 1UT9A 1HCFX 3HBZA 5F96H 2JKRM 4NN5B 5DC0A 1A0QH 1YNLL 1AFVL 2N0KA 4RMSA 4PB0L 3UJTH 3AB0C 1ZT4B 1A5FH 1A7RL 4FNLL 4BKSC 1Y6NR 3O9WA 4JFHD 1C1EL 5IWLC 1W91A 4GSRA 4WFEE 1AD9A 4DK5A 4XN5A 2CXKA 1M71A 2AJYH 4HISA 1FH5H 4IMLA 4MFHA 4UT9L 5IHBA 1FAIL 1J5DA 4UOW1 4XO9A 1F41A 4G7VL 3L5WB 2EYRA 1NDMB 3ZIMA 3VWKA 4PS4L 3UYPA 3BAEL 4QXUL 2ZCKL 2VITA 4PV1C 1HH9A 5HI4D 3DMMB 4X4YB 2CGYA 1LEKB 2YD5A 4IOIA 3T0EA 3EADA 3F7YB 4NZUL 2X3AA 3EG9B 4CSTA 4OZFA 3ZTDC 3CSTA 3KJ6H 2CAKA 2WZPA 3UADA 2Y7QB 3OXRB 4AW4A 4HOWA 2HUEA 2RA1A 1AO7D 1J48A 1UZ6F 4YXKH 1JFQL 4OZGB 2WTRA 2OMTA 2OMUA 5K9OA 2CH8A 5IJCC 1M6OA 2VB5A 5DD1L 1F4WL 1R24A 1RI8A 2AQPA 3UIYA 3N5AA 4L4TA 3PABB 5HHVH 1G0XA 4Y9BA 1TYEB 1ZS2A 4Q58C 4P48A 1HNGA 1XD0A 3ULUH 3BKCH 4V1DA 3AROA 5MEPA 3VGFA 4P9HL 5TPWL 1ZJAA 3ESUF 5GPRA 3U7WH 4A7QA 4UINL 1RSFA 4KRPB 4Y8AA 2VOTA 3FQ1A 3MXVH 1I9JL 1SOSA 3RUGA 5C0ND 5J4MA 3KDPB 1GW6A 4FTDA 1KULA 3MV11 1IARB 4IYKA 3GMNB 4AYGA 5C0NC 3O3EA 2IANE 3PXLA 5SX5K 2EO1A 1NCBH 4K2UL 2WUBL 1UA6L 4C4BA 1O7VA 5C6PB 1N9PA 3T71A 3AMKA 1MCOL 4JQXC 3VSQA 1AD0A 5DFWH 2DQCL 1T7ZA 1K2DB 1KDIA 1KGCE 4PJAE 1D7CA 1NGZB 1YNTA 1HHHA 1M05B 4HKXB 3W5MA 1N6VA 4U7MA 4XTRD 4O51B 2D31B 4PV8B 4OKVA 3EO0B 5D2NC 2GYSA 4MA3A 3IWUA 4UYQA 1PZ3A 5C08D 1Y1DA 1U3HC 3K72A 4P06A 3F00A 4NKOB 4Z7VA 5F70A 3QK0A 2IO5A 1D6VL 4R3SB 2NY2C 4X4ME 3UPRA 4WK2B 3SIKA 1E3FA 5HYSG 4RNRA 5T1KA 3OAZH 3ATDA 1INQB 2BRRL 1AXSB 1F3JA 1P84J 1IVLA 1XZWA 1F86A 1PL3A 2WGXA 4MX7A 2HRGA 4Y4KC 1OM9A 4ADJA 3MR9B 2ALWA 1CDIA 3DV6B 3F2LA 1MFCL 5JR1H 5KSBA 4NIYE 2FTAA 1KG0B 3EOYG 1S8DB 1KJ2H 2ZSVB 5HHMD 1I8MA 1YEDA 2PPDA 4PJDE 3VXRA 3UO1H 1S5IL 2WYTA 3E8VA 2Z92B 1QTYT 3BYTA 3TH2T 12E8L 1NBVL 4ZAKB 5AW2B 3QDJB 1CE1L 4LEOB 4Y16A 2QVKA 3VD9A 3TCLB 1D5BB 3U2SB 2BSBA 3L3OB 4XZUB 1UWXK 5IBLD 2Q20A 2IMMA 4GRWE 3UAEA 4JM2B 2E4FA 2B5IB 1U91A 3VFTA 1YY9D 1FF5A 3LB6D 4M02A 3DUSA 1WIOA 4UOZA 1IAIH 5DMGC 3KBPA 2MCPH 2J25A 1K5NA 3BGMA 4XC3H 1T3FB 1URLA 3IDXL 4NQEA 2ADIB 2F8XC 4P3CL 4LSRH 2V0AA 2X1QA 2XX1A 5MHSE 1PFOA 1T66D 3QXVA 3VWJB 4PJ9C 5AKTA 1JZ5A 4QHLA 1E27B 2AV1B 1T66C 2C1OB 1C16B 5B39A 1HNYA 1ANUA 3QVAA 1OARL 2IPUK 2PCYA 2GC4C 1Q0XL 3BISA 4ZFGL 3K2MC 3NSFA 4FL4B 4LSQL 4WJKB 1YJDC 3IJSB 4O9HH 4O2CA 3KYMA 2CUIA 3L7EA 4Z3GA 1R3JB 1B4LA 1N5AB 1YMMD 3CXDH 4L37A 1NM9A 2WIIA 3OQRA 5E8EA 1VLXA 5FYJH 2HVBA 5CO1A 4CBZA 5KVGH 5T1DH 2CDFA 1JZIA 4WWPA 1WWWX 5I6KA 4DZBA 4AL8H 3HHRB 5D7LB 4DK6A 1V55B 5IFJB 3MRMA 4RDQG 1FFOA 1RZ7L 2K1MA 1IB5A 1NWPA 4HEPG 4Y88A 5KUKA 3OM3B 3X3FH 1JWSA 5TH2B 3ZQXA 3CFKB 3IDJB 1PZUB 2YA1A 4XNAA 4KTYA 4JFTA 3IRCA 3SQOL 1YYML 4D7BA 4E42B 5E0QA 3SDDC 1F11B 2AAVA 1RZKL 1A9EA 5E24E 3PP4H 4ICWA 4XCFL 4N9OB 5F7AA 4IBWA 1UH4A 1J05A 3MV7D 3QJTB 3AU1B 5FUCE 3IU4H 2KKQA 1UASA 2Y3AA 2EIBA 1CGVA 4GRLC 25C8L 2WXLA 4N8UA 1TU2B 3P77B 4HMEA 2WTOA 4LVNC 4TUJA 5CSBA 3MLUH 1BOYA 1DVFA 2DLIA 2QV2A 5DRXA 15C8L 1WQVT 3UAJC 3U1QA 2DBJA 3SPIA 5DQDH 4OB5H 3FB5A 1UKQA 2DWDB 5I5MA 2XWZA 3U30C 5T3ZL 2HT2D 4UQ3A 2G60L 2EC8A 1L9NA 2AQNA 3CZGA 4V2BA 2H47C 4PRID 2YKLL 4KUCD 4URTB 5GGRB 5HBBA 3RWDA 1OVZA 4PW9A 4RZCB 2FHBA 3LCYA 4NT6B 3WIFA 4KJWD 4E9LA 3HI1B 2DL2A 2IDSA 4KDVA 3I9GH 3H56A 4UMGA 3GIZL 1UEMA 1YN7A 1Z6JT 4XMPL 2QADD 1CTNA 1BD2B 1DQIA 5EEVA 3OWRA 1TPXC 2J1ZA 4FKEA 3G5ZB 5DR5H 5LXGH 3K2UH 3RUGF 3VQ2C 1XIWA 3MREB 4UTBH 4JFUA 2Q6WA 4X5PA 4LF3B 2OXGB 3GEWB 2HJKA 3EBHA 1ZHKA 4R4ND 4B53A 3QAQA 3FUIA 3GBLA 3SJVE 4NO2B 2BNRA 3CE1A 4JN2B 5HYIA 2OZ4L 4KVCL 5D7JD 4NXSA 3RJOA 4QTIL 3IAGC 1VB9A 4G8GA 2X7LB 4UM9D 5CU5A 3GI8L 1WC7A 3D87B 2EC9T 1LM8V 2J3SA 2IXQA 3NQKA 2BFVH 3L4ZA 4PJGA 1P7QA 4X6EA 4XNUH 5F1OB 5TK2A 4Y5XA 2WSKA 4HGWA 2YK1H 4NN6B 3BZ5A 1WTGT 4P5MA 4K7PH 3TJEH 2W9EL 1CFQB 2VABB 4Q6IC 1CLYH 1YNTF 4QRQA 1L3WA 1UCBL 5EEXA 2OFQA 2ILLA 5AUMB 4HFUL 4R5VA 3D30A 1YHPA 1G94A 3MJ9A 1T7WA 4MMXB 4A55A 3LKQA 3D48R 3UTSB 4QT5A 3FULA 5M94B 4NKQB 4G7RB 3DX0A 3MV8D 4OTXH 5EZOL 2DICA 5BOZG 3OR6A 4IS6A 5E4OA 3EH1A 4Z7VF 5DO2D 5BO0D 5FM5M 2LAGB 3N1MC 2FWOB 3BPCB 3LNEA 3C09B 2VRKA 2FT7A 5C0RH 3MVSA 3SCMB 3EYUL 1DN0A 2NTFB 1F4YL 1OLZA 4XNMB 3S36L 3N9GH 4GI9A 1N67A 3WEXB 2AXWA 5H94B 4WCYL 3H2PA 2X09A 4FQXD 1SGKA 4JN1L 1VFBA 43C9B 5DHYA 4DF9A 5GRWA 5EBMB 1DEEA 2X4UA 3BZFB 3QFJE 2IGFL 4Y5YA 5KG9A 3KPLB 4KKAD 4UT7L 1IILE 3EJZD 4AMXA 1RU9L 4KKAC 4S0TD 5D93C 1IKNC 1PX4A 4M6OH 4H0HB 5GIRA 2DWTA 3HBQA 2XIDA 4YHLH 1TZ8A 4NUJA 4HKJA 2CGRH 5GRUH 1EIBA 4OCYH 4X0KA 4Y0GA 3NFPA 4XCCH 2A9MH 3KYAA 1DJGA 3WUZA 2V5TA 1X4YA 3AJ7A 4BA8A 4L0ZA 1UD2A 3NFNA 5EUKA 3RZCC 2R23B 2YD2A 3GHEL 3T6ZA 4IQHA 4A1RA 4EIUA 3PV6A 5A3IC 1M6UA 5CZVH 4XO4A 2AITA 3CBRA 3MLVL 4MRBA 3WIAA 3ZUNC 5ID0A 5AVUB 2BVQA 1HXKA 3APFA 4NQCB 4PJDB 3CHPA 5DUMH 5G5DA 4ORGB 1TKWA 3BT0A 4LLWA 3L1EA 2HJLB 3VRLF 4N8CL 2HT3C 2GJZA 3V0IA 2G5BA 3ULAB 3RLSA 5KTEH 2X4SA 2QQLH 2AQSA 3CLFL 3ISYA 2Q7YB 4CA4A 2VM4A 1MIMH 1JIBA 3UO8B 2B20A 3MRFA 2FQDA 1RUKH 2DEXX 3RWGA 4AC2A 1ZANL 3T3MF 2W81C 1CZ8H 4K94C 1Z32X 1TQWA 1XMEB 5D7HA 2MPAH 3P4OB 2H2PD 3B2XA 1IBHA 2DRUA 4J3TA 2V5YA 3MBEA 2D7TL 4IK6A 4XR8C 2WJ7A 4RFNB 3TH4T 3BP5A 3T3PB 1I75A 5BS0B 3TBTA 3C9NB 4W93A 1AZNA 4NO5A 1DVQA 1KCVH 2QSCL 3BUIA 5E94A 3ZDXE 4F15B 3RPBA 2LV4A 5CINH 2ARJA 3CQPA 4AZ8B 2AXFB 4M7LH 3CZNA 3WFBH 5EIIA 3BEVA 5BRZE 3UTZB 3MN8A 3O2VL 3VXTB 2NUTA 2FB4L 3QO1A 4ZPTB 3DTXA 1IKOP 2ICWA 4LSUH 1HWHB 2I07B 2XKNA 4BGDA 3ML8A 3RYMA 2B4CH 4PJ5E 5B38B 4JG9A 5AKSA 3ARDA 4JR9L 4PG9B 3ZDZF 4HZ1A 3F6IA 2CBPA 2UWEA 2VR6A 3GINA 4Z77B 3KYOB 3C6SA 3CFBB 4CC4A 5GGQL 3FQ4A 4QRPB 2V2WB 2BIIA 1PIGA 3INUL 5JW5B 2FYYA 1EAQA 2BOBA 3PHAA 4S11A 5EEUA 2DD8H 2PCPA 4APQB 2CK0H 3L7FB 3IXAA 4Z95H 5FK9B 4B0MM 2XRAH 3MLSL 4XPGH 3L81A 3AADB 1WIUA 4IIQA 4JM0A 2LU7A 1I8UA 3ZDWA 4XMLH 1R5WA 3REVA 1FUNA 4PG2C 2YEZB 4TM9A 3W9EA 3FL7A 3IYLW 4CW1A 1XCWA 3C60B 1QMUA 4P2RE 3DJ9A 4CILA 4U1GB 2I60H 4G6JH 3REWA 3OMAB 1IJNA 4JKMA 3UYOD 2ADJB 3MX0A 4OCRH 3UOAB 5IF0B 3MA9H 2WYZA 1UA3A 5C0JB 2Y07L 1KPVA 2VLJD 3BIAX 1UHVA 2ZOLB 5D4QA 3FQUA 3JV4B 3R8QA 5C1MB 4QY8A 2DZEA 4MBOA 4R26H 1G9NH 1QFWM 3HC3L 4PJGF 4MAUH 5ENWB 4PCSA 1HSBB 4Q9CA 2ESVB 2ZT9C 5BV7C 1UADC 5CCJA 5BPPA 3U7YL 5L4MA 5F6IB 1HOCB 1J8SA 1NGPL 1FC2D 1FWXA 2VMFA 3QUXD 4O2FB 4KZDH 3DBXA 1JNHB 2G4GA 3TF4A 2YAQA 4B7LA 4XP6L 3ETBJ 5D2LF 2WLLB 4PR5B 3BVDB 4YDLC 1O6SB 3NZUA 5A1AA 4M6NH 1KGUA 2I69A 2Q2LA 3QR2A 1E9OB 4Y9CA 2VYRE 3EO1A 3QJZA 4MMYB 2APWA 3KLQA 4N8PA 1OP5K 3FU9A 1Y6MR 4TUKH 4B50A 5EF3A 1K3IA 4X6DE 1GKOA 1JUFB 4OCNC 4ZW5A 5HDWA 1XTLA 3LXAA 3ARRA 3Q7JA 3AREC 2Y22A 5EF0A 1N19A 4AM0Q 3U36B 3VFGH 4LBEA 3N50A 2QLYA 4R2GD 4ZDHA 2B1AH 2FHCA 2IAMD 3NACH 2GBAA 1EZLA 2CLRA 3HG1D 3K91A 2OJEA 1HN1A 4H2AA 5L4IA 5I0VA 5JUEH 1NCIA 2X70B 2E7LA 4WO0A 4U1IB 1BIIB 1FZOA 3SDAB 5E5UB 3OJDB 5K9QI 4ZUTA 4H13C 3FQYA 3VB8A 1DLFL 4HPOL 1BQLL 3DROB 3O2DH 3CFCH 3Q2WA 1SXBA 4CN1A 3CN1A 4Z7UA 2DMHA 4NBXB 1T4KB 4PV9B 3MI6A 1TQCC 4UQ9A 1P7KB 4HKBA 1AGDA 4MD4A 2AXGB 4YDVB 3M46A 4UAHA 1WCBB 4JDVB 4XXWA 3N1QC 4J12A 4K3EL 2Y7MA 5D7IA 4ZYKA 2RR3A 3WXWL 1PQZB 1BREA 1CIDA 1E0OB 2YS4A 1NLBL 2A9NH 3D2UB 4FTVA 1OTUD 4G3YL 2ZKYA 3ZXAC 1HC1A 1T83C 2YGOA 5TQ2H 5CN3A 5HD8C 2I7SA 4HUWA 3CXHK 4FQIL 3G6JB 1FNEA 1OTUC 5L8JB 1XGYL 1QRNA 2E75C 3GSNA 4MS8C 4ZXBB 1A14H 1DBJL 1FVDA 2KLRA 5D2NE 4Y4FD 5K9JH 4WSKA 1WA0X 4J39A 2J8HA 2GTZB 5CNHA 3U25A 3UBXI 2CR0A 2JKNA 4WEBL 5F7NC 4MCZB 2AJXH 4XNYL 1S7VB 3LKPA 1T22B 1CC3A 1WF5A 3DURA 3EH5B 4M7ZC 5FW7A 3ETSA 1X5HA 3M88A 3S37X 2FZ3A 2PP7A 3FN0L 5IB5A 1HE8A 1MLBA 4OM1L 4B9PA 3ARFD 3GMOA 5BVPH 4HP5A 4P5TB 4M7LT 4E9VA 2F19L 3GUTB 5EWIL 5F9DC 5DMYA 2XWBB 4D9RD 3VXSE 5D55A 2IWGA 5J6SA 2ZWNA 5CUSL 2A6IA 5GGUB 4A38A 1H3VA 4AWJC 4N6QA 4JKPL 1YECH 1KBGL 1YEHH 5DJCB 2F08A 2EDTA 3LV3A 1LEGB 2NY0C 2GK0A 2BVPB 1JGUL 4EDXB 4ODTH 1MHCA 3S34L 2X6BA 1MJ8H 3X3GH 4OFPA 3ZT7A 1CL7L 4HF5H 4ILDA 4WF7A 4K55A 1X4ZA 4P3WA 2VR7A 2FL5A 4P23C 2YMXH 3GZKA 3T2NL 1IZKA 2NXYD 5K5YA 5DJAA 4F7MB 4OCMC 3IFOA 4I89A 1IE5A 4XPFH 4KKNA 5AKVA 2H45A 5SV4A 4AJ0A 3VRIB 1TJGH 2H7WA 3K81A 1MCKA 2ZXCA 3H4HA 1JXFA 1XWVA 5JA8B 5DHMC 1SJHB 2XWTB 5SWZD 2VMCA 3PY9A 1RXLA 4U3CA 3TJHD 1YMHB 5AG9A 3P2BA 4HUUB 3AMLA 3ZHDA 3LZFH 1MPAL 3CZKA 4JFDE 5LCVA 4JG1L 3IDGA 1J1PH 4X8XA 2EAEA 5EEZA 2UWEF 2ITDA 5B8CB 1CIUA 1CK0H 5DQJB 3VU2A 1CLZH 3DOIA 2PWEA 4O00A 4YH6A 3JQOB 3ZJAA 1KB9J 2LTQB 3QQ9D 2OV0A 4LRNL 3SOTA 4AXWA 2XJKA 2YRPA 3KLAA 2P5ED 1EAJA 5C2UB 4YHML 4FMVA 4NQVB 1YMME 3UAAA 1SMAA 2F53A 3W81A 5E9DB 1ZXQA 3O6LH 5DFVC 1XH1A 4MBRA 3BMWA 2PR4H 3PE9A 2EE3A 4QHMB 2FATL 2C3HA 4U1SA 4C4KT 1Z5YD 4I3SL 5IP4A 3TV3L 4X7TB 4JY5H 3NABH 4QNPF 2JMRA 2W07A 1ZVSB 5GISL 3RPIB 1BXAA 1DVYA 3T2OA 4HA1A 4ZUSA 3WN5B 1AANA 3BLKA 3BPLC 5ILTH 1RIHH 4HKZA 4O4YL 3T4AC 3LQAL 4A7VA 4PQXA 3RIAF 5EZIL 2X4NB 3FT4B 4R0LA 1MG2C 4X9YA 3P9LA 3VD3A 3N0PB 3MV7E 4HS3A 3GUFA 1G7HA 1RURL 2UXVA 1AZRA 2PUQT 1MWAA 4MNQD 5J1TC 1L6XA 2YQ2A 1XSJA 4TVPD 3MRHA 1I7UA 4WJG3 1OAXL 3GK8H 2H2SC 4AITA 4BH8A 3AB0B 2UY7B 3WKNA 2XY1A 4KX9A 3T0VA 2H3NA 4H0LC 4ZPVA 3SDCD 4QJ3B 3FU3A 2GJ6E 2IH8A 1V3KA 2JB5L 3NCCB 3P3RA 5EZLB 1G9HA 4MZ3A 4W4OA 3U0WL 1ZA6A 3AXLA 5B22A 5AYUH 4OLYL 4XI5D 2EE6A 3U9PH 3H7BB 1YEGH 5FGSA 4XI5C 2VDML 4ZOBA 4D9QD 4A7SA 2XBDA 1SN0A 1HQRA 1XH3A 3D25B 4DAGH 3TP4A 4P99A 1S7QA 3HNVL 1UWYA 3LRGA 5E8DL 3AQDA 4WU7B 2R0LL 1PDKB 2ICEB 3MJ7B 1VZHA 2ITEA 3MRDA 5EDXA 4ZFOA 1H0DA 1QI5A 4PWGA 4WNSA 2OL3A 2OA9A 4Z7OE 1H8LA 1DDHB 1I1YA 3NFSL 3GM0A 5CGYD 3B9AA 2CLZB 2SODB 1RCYA 2J88H 4JPKH 3LDBC 4JANB 3JWOL 4OLVL 3U4EB 4MAYD 2VLKB 4DP1X 3GTTA 4F7PB 1AO7B 1SJEB 5D7IF 4JPIB 3QI9D 4Y2OB 1ZXKA 2K70A 5JHLL 4AVJA 3V5KA 4QEGA 4XO5A 3QAZC 1JXDA 3STLB 2XTJD 2DQGL 2PWDA 2JV6A 2ZYSA 2UZPA 1HKLL 2DQDH 5C07D 4M5TA 3WTTA 1R6VA 4YUEL 5IJVA 1UATA 1JV5A 5BUGA 1OTSC 3CVDA 3F05A 4QTHB 4YQXL 1WUNT 5HHOB 1E67A 3II2A 3L5WA 4M00A 1X44A 3GSVB 5DJ2B 4UQAA 2R39A 2GEEA 3FQTA 1X5JA 1YEFL 1Z66A 3MV8E 1NPUA 1TZGH 2IGTA 2ICES 4HK3N 4RMVA 1GC1C 4J23A 1RMFL 4F58H 5GZOD 1YDPA 2EUZA 1K4DA 5L88H 2YQGA 1KV3A 3D18B 1JWUB 3QRFM 2VMEA 4AIZA 1D9KC 1ZV9A 3BCFA 1XAUA 3FUDA 1GYUA 4M5YH 4OJAA 2WAHA 1MRFL 1SDDA 1Q72L 1CBJA 2YUZA 3B7YA 1I9IH 4H88L 3KPNB 1F4XL 1EEYB 4G7SB 3QP3A 3PABA 2QQNL 2AJ3A 3OBAA 3R06B 3ZVVA 4GSQA 3UGUA 2Y5QA 1ASPA 3U6XA 5FO8B 3C6LD 3TT3L 2UXFA 4UDUA 3ARSA 3HBGA 1WITA 2OP4L 4HU2A 2ZWZA 1SOKA 2DKUA 3KPSD 4XXDB 5FKPB 5B3JE 2PO6D 4G6MH 5C08B 4NP4H 4N24A 4IIZA 1G43A 2CRIA 3HOGA 3JUZA 2ZE0A 1O0VA 2PO6C 1QI4A 4KNSA 2F74B 2DM4A 4OLXL 4DQOL 4Q4EA 3KGSA 4G82A 2FGWH 1U95B 4RESB 4JPWL 1JRHL 5GGTL 4C47A 1AGFB 4I18C 2DIAA 2HMIC 4PSPA 5ESAB 5GHWH 1F6AB 2GIMA 4TTDD 2J6EL 4U3SA 3JTTB 4XX5A 3AG2B 3EOTL 5HHMB 2F58H 1KT2B 1XF3B 4ERSL 5MEOA 2E9IA 1YCSA 4WGKA 2NT0A 4IHBA 2ZKWA 3X1GA 3FHAA 5F0LB 3ULUF 4PCTA 3MLYL 1NGZA 4LLQB 5IB3B 5DWUH 1BM3H 2CD0A 2FWUA 3IFPB 5H8DA 3WNIA 4NIKB 5D1XA 3EO0A 1LGVA 3ESOA 2ICCA 2XKUA 1AG0A 2BIQA 3APNA 3F7RA 5ISZA 2YPVH 4NQSA 2OW6A 3L4CA 1OT2A 4BRJA 1TCRB 1MVUA 1EJOH 3RNQA 4PJXB 1AVAA 3TO4A 1INQA 2SEBB 2IFFL 3F7VA 1W6LA 1XGUB 3OR7B 3GBMH 4L2YA 3MR9A 1U9KA 2XHNA 4MRCA 3DV6A 2NY5C 4U1LA 4AJYV 4HV8B 3HR5B 3MRBA 4FQHA 1CBVH 1KNOB 5KVEL 1BQHA 2IPKA 4UQBA 3OXSB 5DJDA 3OHXA 5CEZL 3HPJA 4YWGL 1TQBB 1MDAA 1DVUA 1BXUA 1DFBH 1HT6A 4X8GA 4JMXA 4BA0A 1BQKA 1EH9A 3V7MA 2MCG1 4RBPH 3QDJA 3CPUA 4DP8X 2WCPA 3BIKB 3V2AR 2BW5A 3TCLA 3U2SA 1YMMB 4KJQD 4XMUA 3WCYA 1FG9C 3FB6A 4OH2A 1BIHA 3KPTA 2DJ4A 4RAVA 5CSZA 3VW3L 4KJQC 1R3LB 5I1JH 3KGUA 4JO1H 4FFYL 2ZIDA 1DANU 3K0YA 1BJMA 2HRLA 2Y7LA 3WHXA 2V17H 3QUHA 2KC0A 5F72S 4FXLA 2K9FB 4TN9A 1WFUA 1ES0A 5F96L 4LVHC 3ASOB 2CJTA 1A0QL 3UJTL 4PRBB 2XPGB 3IDIB 1A5FL 1G9MH 1JGVH 2GITB 2C1OA 3SE9H 1C16A 1KGJA 2P1YA 3GBDA 5JXED 2WQ8A 2YD1A 2AK4E 1U8NB 1XCTB 1UXWA 1EHLH 1T2XA 2FJFB 3MV7B 2AJYL 2EILB 5F7MC 1EBAA 5JIPA 5E5LA 1XSKA 4TSAH 3IJSA 1NFKA 1FH5L 4GG6B 2TSAA 1NGYA 1R3JA 4KMQA 4IRZH 1N5AA 4Q0XH 4Q52A 2BSRB 5ECJE 4A6YB 1QSVA 1MNUH 5F9OH 1T89A 4MNHA 1HX0A 5H4ZA 2MTPA 3U30B 1G7MB 1U8MA 4LLAA 1RK0A 5I23A 1URIA 3W11C 3LN4A 1XB6A 4LGRB 2FSEA 4UTCA 1TZIA 2UUDK 4NNXA 4PRIB 1AYOA 5HHNB 3KJ6L 4RQQB 1WBZA 4LCVA 3F8UB 5TH2A 2HCZX 4HUMB 2X4TA 4YXKL 1JZ3A 5EDSA 3W57A 3H8NA 1G5GA 4V2CB 4LBAA 3IJYB 5FUOH 1N8ZB 5DDHA 3BGFC 2B7DT 4N0FA 4N68A 4D0CB 4HJ0D 5HHVL 2RJMA 3OKKA 3PWLA 5FX3A 2IH3B 2QADB 2J2ZA 3BW9B 2FH8A 1HS6A 3GTVA 3QJQB 3ULUL 1FLRH 3BKCL 1TU2A 1KOAA 3OD3A 4OJCA 1I8LA 4B7IA 2JJTC 4KK5D 2KZ1B 5FB8A 1RJYB 1MI5E 3U7WL 3WO4C 2J1KA 4NAQA 4KK5C 1E4XH 4KXCA 4KPHH 4U6YA 3VXQB 3MXVL 3E0GA 4Y1AE 5D7JB 1A4CA 2DWDA 3DGGA 1MJJB 4ABWA 1T6BX 4C54A 4UM9B 5DC4B 4KVNH 3DX7B 1MJ7H 1X7SA 3E2HC 4LCWE 3HG1E 3MO1A 5BW7C 2IALB 5EUOB 2PTTA 1GGUA 3FB7A 3QWRA 4KU1A 1NCBL 1KXVC 3SKOB 4GW4A 4NM4H 4NRZA 1C8QA 4NHUA 4YSRA 3K4DA 2AQ1A 4I13B 5J1SC 4PJIE 4NQDE 3E9TA 2QKIC 2ZUQB 3EYFB 4FYRA 3D7PA 2YBRB 5C3LD 1N2RB 3MV8B 4HWBH 5IB4A 3TTSA 3S48A 2RAMA 1P1ZA 1CS6A 3BAJA 4FEMA 5D70H 4LDCA 5DWPA 2HSIA 2FSDA 1SMDA 2ROXA 1ZSHA 2WXHA 4CU8A 3TFKD 3P1VA 2FVNA 5DJXB 5F21B 3CZSA 1EHKB 1EFXA 2VSCA 3TFKC 4JN2A 4X4KA 2YQ3A 1NIEA 2MCAA 1TZOA 1E28A 1U8JB 3ET9F 1J88A 3UEQA 4FULA 4HCRA 1XB8A 3S7GA 4FQXB 2CLVA 1KGIA 2EIZA 5DVKA 5I6OA 3T8XA 4YNYB 4HDIA 2MQGA 3BKJH 4WO4A 5D1ZA 5JR1L 5I0YA 4EUPA 3UGEA 3C5JB 1KJ2L 1KY7A 2ZYIA 5J11C 1XSIA 3FMGH 2NDGA 4MMXA 3UO1L 3DOHA 3BH9A 2E7DA 4U1KA 3L13A 4FX5A 3GMRA 4IGBA 2WLIB 2ENJA 2CKBB 4O58H 5KVFH 1MQKH 4BK5A 1U8QA 3FUHA 1HYSC 4ZFOL 4ZK8A 3DVNB 3VDCA 2IANA 4XP4H 3BPCA 2F54D 2E5EA 1M2VB 4E41E 3CDGA 4ABQA 2NTFA 5LB1A 4FYQA 1A7PH 1IAIL 4FG0A 5I6MA 4JQVC 3KWWB 2MCPL 1JGLH 4XC3L 4XNMA 5K1NA 2OQJB 5F6HI 3BN9C 2VDKB 4LSRL 3JUYA 4PJAA 1I8AA 4ONFH 4KK9C 5JTWA 1IC4H 2H32A 3CVHA 4D8PA 4YZFE 1CYWA 2L4OA 2DLEA 1LE9A 3PS6A 3INOA 2NUPA 4O9HL 3ABLB 4ZX5A 5LG6A 2AEOA 2PPAA 3QISA 4X4MA 4A6YH 3VXMD 5FO2A 3CXDL 3FF8A 3TC9A 2COVD 1MHHB 3DPBA 3HRZC 5FYJL 4KFZC 5KVGL 5T1DL 1NFDB 4XN2A 1L0QA 4NERA 4UWQB 4A39A 4AL8L 5IEHB 4WAFA 1RUQH 4L48A 2NY1C 4XP1H 3R0MA 5SWSB 3VFNB 1AP2B 5F3BA 1G1OA 3LIUA 2DOCA 3EJJX 4F2ME 4PJDA 3X3FL 4XVSH 4E9TA 5A16B 5IR1B 2E56A 3Q48A 4J2XA 2HJLA 2P45B 3T2QA 4ZMLA 3KJ4B 9CGTA 1OK8A 2A4EA 1Q4NX 2XA3A 4M03A 4FZ8H 3WG7B 1H8SA 2X9ZA 2HTKD 3H9YA 4WK0B 3PP4L 3DX1A 3VVVA 2Q7YA 5KOVC 1AGEB 1MH5B 3FN3A 3IU4L 3LRKA 4HFWB 4JQIH 1LTXA 4GLRH 1P6AB 2G75A 4C4UA 4GI6A 1SEBA 3BP7A 4P8QA 5DYFA 3UCQA 2X89D 2N56A 2GSGA 2C9VA 2F1AA 3MLUL 5J7CC 3FT2B 4I48B 4F2FA 4P07A 4Q6KA 1E9PA 3Q44A 5DQDL 4XMKH 4OB5L 5JZ7D 5FR3A 1RVFH 3FH5A 4P2QE 2F8VA 5B4MD 4F92B 3O3BA 4WTXA 4W9GC 2R2CA 3V5HA 3GM8A 4HBQA 2X44D 1FVCB 4P04A 4TVPE 4MD5A 2WMPB 4MJ5A 3I9GL 1CR9H 2CDGB 2YPKB 4M61A 4WQOA 3QYMA 2O5ZH 4X80H 1EZVX 1HWWA 2FJHB 4FNTA 3GJFB 2WWMC 5ALBH 2CKNA 4ZPTA 4WW1A 3F6LA 1UACH 1CFVH 4L8CB 1AKJA 1EJ6A 4EN2A 5AW1B 3L3DA 5DR5L 4HETA 4LAJH 4MXQD 4YSTA 3K2UL 2VLJB 1VRSA 5LXGL 4UTBL 4BWTA 5F9AC 4MXQC 3LPFA 3RG1C 3RA7H 1GJWA 5FO9A 5I1CH 3CFBA 1M57B 1L3NA 1N59B 3H55A 3N04A 2BVYA 3OX8B 4QOKD 1N6UA 1JXKA 4WUKH 2P8MB 3X13B 1HI6B 4M9PA 5EC1B 3QUXB 2BFVL 3FO9B 5GS1C 3L7FA 4LDLB 4XNUL 4IMKC 1L5GA 1FSKB 2YK1L 2YSTA 2Z31C 3EYSH 4WI2A 1JZHA 5DA4A 2Q3ZA 2Q10A 1JN6A 2VQ1A 2XI9A 4K7PL 3FTXA 5DJ6A 3TJEL 4BKLA 3BQUA 5KVMC 5CGBA 1CLYL 2YEZA 2XG4B 3TOPA 4C56E 1FCCA 2O30A 2CKBH 4LNVA 3HUJB 3MQIA 4GT0A 1ETJA 4OTXL 1PW3A 4U49A 3EBIA 4P57A 3P11H 5C0JA 4DO4A 4R2GB 2DWYA 4ZTOH 4M56A 2ZOLA 4KWUA 2IAMB 5IEKB 1QA9B 5TDOB 2JQMA 1LMIA 2WV3A 6CGTA 3ZLQC 5CR1A 3IJHB 5C0RL 2DQEH 3NIDB 4L0YA 4R83A 1ZLEA 2VDKH 1N12A 3N9GL 2AGJH 3KDMA 5FS5A 5ADOH 1GZQB 1JNHA 2J8UE 1IT9H 2XNAA 1D2PA 3TCXA 1JZ2A 1TQCB 3AM8A 1M2OA 4PR5A 2HB0A 4FFTA 5AOMA 1O6TA 4OUUB 1IEBA 3X12B 2JK5B 5D6DC 3UDWC 4MMYA 4ZW3A 4I9WD 1GGCH 2JQAA 4X98B 3UJJH 5C92A 1V8HA 3A5VA 3OB0H 1BAFH 4M6OL 4K94H 2YA0A 3SJVA 1CQYA 4YHLL 1NGWA 4NKMB 3VRJA 1MLCA 2CGRL 4O02B 5GRUL 3KWVA 3U36A 4OCYL 4XCCL 2A9ML 3QO0A 4OJFH 5CEYB 3RJDA 1WJ3A 3P2TA 5A7BA 1N3NA 5KSAA 2I9TB 1BZ9A 2FWSA 4Y4FB 1NC2D 4F27A 5ICXA 3QUKA 1IC0A 4PJAF 4YPJA 4QRUB 1KBWA 4DKTA 5CZVL 1OF2B 2HFGH 4B6ZA 1UD6A 1M7IB 3CDCA 4W1TA 1LO4H 2C3XA 3OKMB 3DROA 3KNBA 3ARFB 5DUML 3QUYC 1FORH 3IBEA 3RDTD 5F0MB 3GXUB 1T4KA 3RILA 5AZ2H 3RDTC 2OMVB 3FQRB 3JZYA 2BP8A 2YRBA 2QPDB 2EXWC 3RWHB 4J8RA 1CFNA 5KTEL 2QQLL 2WP3O 1GS6X 3K4AA 3KYNB 1PQZA 1MCWM 2YSSB 3D2UA 5ICUA 1MIML 1TJHH 5C8JA 2H26B 3GSQB 3O3AB 4NENB 5D5MB 4CJ0A 1NGXB 1XL4A 1RUKL 1YPZE 5CN2A 3W0WE 2IAAC 1FNGA 3IDYC 4P9HC 1CZ8L 1RFDH 2MPAL 3LH8A 1CXKA 4UDTA 3T65B 2Z8WC 1COBA 1NUGA 3P02A 4WNQB 1YVLA 4M8VA 4PJDF 3QFJA 2GTZA 1YEEH 2JXMB 3FT9A 4JY6B 4UBDD 1OB1B 2NXYB 4H8WC 1YA5A 1KIUB 3BH8A 2B3RA 3ECBB 5E5MB 3HMXH 1S7VA 1VESA 5E00B 3D9AH 4M93C 3QIUD 3GLDA 2OS7A 1KCVL 4DKFH 3HN5A 1U8HB 4L1SA 5C0BE 4TLTA 1TQUA 1XH0A 1WWAX 1R34A 5CINL 3DV4A 1DJYA 4YE4H 5DJ0A 3GJFH 3K6NA 3CN0A 4U1NA 3FUKA 4M7LL 3WFBL 4YAQA 3BN3B 5SWZB 3NSDA 5I1LA 5DZNA 5AVYB 1GIGL 4L9LC 1G7QB 4KKRA 5I0WA 4LSUL 2YEVB 1WHPA 1ZSDB 1AS6A 3C5SB 2OI9B 4Z5RB 2F15A 1RUAH 2B4CL 5KANG 4F2MB 4I85A 1IEHA 1E9QA 2EC9U 1XEUA 4KZCA 1WGOA 4AQ8A 3APMA 3DX8B 4JRFA 3NRFA 2P5EB 2ZNWA 1NCDH 1NCJA 2BDNH 3FFCD 4F7MA 2J21A 5L6YH 4P2YA 3GSUB 3JWNG 2DD8L 2OMZB 3QUZD 4KKCD 3GSRA 5TE4H 3MNVA 2CK0L 5KYYB 4Z95L 1VSCA 2XRAL 4LOUD 5ESQB 1SHSA 3VRIA 2EDBA 4KKCC 1TVBB 1IJ9A 4XPGL 1CL7I 2ZICA 4R5XA 4E9XA 3GXDA 4LOUC 5EOTA 2HX8A 1XR8A 4XMLL 2ENSA 1MSPA 4XMWA 3V0FA 1U2YA 4OJYA 2Q2EB 5I76B 5ESVA 1BMGA 2EECA 1S7RB 2CO7B 5IQNA 2HP4A 3T2PA 2I60L 2V7NA 4G6JL 3V6OC 2VAAB 1UQSA 3W5NA 4JDZB 4OCRL 4JFFE 2IQAA 4QAMB 2P5WD 3MA9L 2VN6A 2AEIT 2GK2A 1OLLA 2WXMA 3BVTA 4PLKD 4R26L 1G9NL 4MAUL 1XDTT 1HQ4B 4MNQB 3KL3A 4NLAA 1OAJA 3ZKNC 2VAJA 4N87A 1KWKA 2MNJB 2E9GA 4PLKC 1HJCA 2NX5E 3HS0B 3QNXB 4K3DH 2WSPA 3GMQB 4RH4A 4UV7H 3L1GA 4KZDL 5BRZA 1AZBA 1R75A 2UZXA 3SDCB 3T6XA 5LBGA 3IF1B 4UAOB 1FV1B 4M6NL 5FW6A 5A2KH 2QQKH 1L0PA 1ZVSA 4PJ5A 4DZ8B 5LHDA 4TUKL 1MCDA 5FYJU 2VM9A 1C5CH 3DRQB 1HE7A 5JIHA 5IOPA 4WFFD 4O02H 1KCSH 1PLAA 2CWRA 3RGVA 1USZA 3O3UN 3SE8H 4WW2C 3VFGL 4MJ2A 3QS3A 2EDMA 4ABVA 1A3RH 2B1AL 4PFEA 4YDIH 3NACL 1BA9A 5JUEL 1FO0B 1FNFA 4NFBA 5DMKB 1HIMH 5HVGB 1ZAGA 3B2UC 2E0PA 1HL4A 1AMYA 4PRHD 4UV4H 1EHXA 2VMJA 1WFIA 1UM5H 1J9TA 3CSYA 2A9AA 4MAYB 5E4EC 4RA3A 1TOXA 5ITFB 4JGUA 3NZ8A 3QNFA 3O2DL 3CFCL 4P2RA 2R15A 2ARJQ 4Z3HA 2NR6D 1LILA 5BZDB 2J6WA 2RMNA 2ZWYA 5IWLA 3QI9B 5EZLA 2D73A 2LLLA 3HE7C 3NCJH 1RZKC 2BNQE 2XTJB 4AGLA 3PL6D 2XOTA 2EP6A 3H7BA 1USQA 2WNKA 5C07B 3CK0H 3HZMA 4QPEA 5B3NA 3QH3A 4AIOA 2YMTA 2A9NL 3AWEA 3CC5A 5TQ2L 1DSFH 1DQJB 4BSWB 1NC4D 1BXVA 1M1SA 3FO2B 3P4NA 4WU7A 5AL8A 2ICEA 2NRDA 3RL1A 3RQ3A 2YQBA 1A14L 2BIPA 5K9JL 2QTEA 4C59B 2WBJC 4PS8A 4IBQA 5DD5H 3RX7A 2AJXL 1KFAH 1SQMA 4GBXD 1S7TA 2ITCA 4Y19E 4HLEA 3L48A 3W9DA 1HYRC 4X6DA 1N26A 3EYOA 5BVPL 1SJEA 2VZOA 2HPOA 3L3JA 3WIIH 1RJCA 1AI1H 1L0YA 3T1FA 4YHIA 4IEFB 5I19H 1F02I 3FSVA 3QR1A 5TJWK 3RVVC 5JOFB 3L1FA 1BGXH 1OGAD 5EC2A 3IE9A 1GTFA 1OWWA 4MB1A 5GSVA 1YECL 3BVUA 3C6LB 3HZYA 3FZUD 4KBPA 4QXWA 4TL4A 4BCYA 3LYRA 2DJMA 1E4KA 4ODTL 2JE8A 4RIRB 2WYIA 4WI8A 3VM5A 3KPSB 3MYJA 1MJ8L 3X3GL 2PO6B 4D2NA 3EJTA 4HF5L 3WGVB 2QFRA 2ATPA 4LIQE 1UTDA 3GMMB 2WZ5A 1MDTA 1SY6A 4XMZA 3CFEA 2YMXL 2FCBA 2ICWI 3WMQA 3RX8A 5HDLA 3PXHA 5DZOA 1UXSA 4XAKD 4BQBA 4XPFL 4BFRA 4L8SB 4DUXA 1G7JB 3S96B 4N0UE 3SGEI 1CLCA 4JQXA 1TJGL 1TEFA 4LLYB 1QBLH 4BYHA 3AT8A 4RMTA 2QMKA 5EFIA 2AAAA 3TL5A 2DJSA 3R06A 2BSDA 5C9JA 2GUOB 5LDUA 1LVEA 3PGCA 4JHAH 5D2NA 3BDYH 3LZFL 5EBWA 5DI8B 1QTPA 2C34A 4GG8A 2BSSA 1J1PL 4HJUA 3CXHJ 3VTMA 3V79C 1CK0L 1U3HA 3DIFB 1CLZL 4NUGH 3S88H 1E6JH 4GKLA 4JG5A 1XT5A 3Q8AA 1DJIA 2MRYA 4TVPH 4XPHH 2O6EA 3NJMA 1MAJA 5DVPA 4Y4KA 2R2EB 4M3KB 3KXFE 1TZHB 4M9OA 3UCRA 4KTDH 4ZSOB 2JQZA 2ISDA 3VXSA 2QPFA 1OF0A 2X6UA 1AGFA 3O6LL 4L8DA 4QWWC 5DEGA 5DVOA 1KEGH 1UD5A 2PR4L 2Z34A 4YSDA 3UZVA 3GZQA 2WBXA 3D39E 2NNAA 3KVPA 2R1XB 3QT2A 4GXFA 4FXTA 1Z0MA 5DD6A 3WN6A 3JTTA 5EZPA 4XB3A 4GUCA 4JY5L 3NABL 4L2LA 4PJEE 5F7YC 4CGUB 1SXNA 2OK0H 1MFAH 4FFWC 5E4AA 3W39A 4I1RA 4ZZKA 3OG6B 4AVHA 1TT6A 1S9YB 4KMTH 2PCFA 5IB3A 1JRHI 1MW1A 5ILTL 1FGNH 1RIHL 4JB9H 1CXLA 3X14B 2XA8H 1P4LB 5BZZA 1FZKA 1RHHB 1FO0H 3GSWA 5E1HB 4P59H 4E5XG 4QYOA 5F89A 5F97E 1RIVH 2BINA 1JTOA 1M1XA 2B0SH 5GGVH 3TWCH 4NSKB 5B21A 3DJZA 1IM3A 3D3VD 1A65A 1YC8A 1UT1A 2GJJA 3O41A 1F0LA 1NLDH 2SEBA 4DVRH 3GK8L 1CE6B 2K0RA 3V6BR 3WU1A 1QVOA 4PJ9A 5DRZA 1H9DA 4HV8A 1XGRA 1QFOA 4JFDA 5AYUL 1EVTC 5JORB 3U9PL 1FN4A 1NEZG 1YEGL 4ZMWA 3VXNB 3PWNB 2RFXA 3L6FB 5BNXD 3L4YA 3RPKA 2H6UA 2BXYA 1YEJH 5GZND 3FCSB 5EZJA 3BIKA 3LPGA 4DAGL 4NNYB 1I7RB 4ODUB 1YMMA 1TJIH 3V0JA 4LT7A 3QCTH 4KFMA 3G5XB 3IMUA 2CA3A 3OF6D 2QFPA 1Y18A 3GKWH 3MYZA 3SE4C 5C0FA 2V2TB 3MRJA 2AV7B 5E1AB 4P5KA 4WRLA 2JKIS 4FN0A 4W9JC 2J88L 2FX9H 4JPKL 1KGYE 3LAFA 5IROC 4L05A 1PZCA 2H8PB 5TGBB 3TONA 4BFKA 1J8KA 4HCIA 1B90A 4NXKA 3U1PA 4ZS7H 3T8MA 2LR4A 4XNZC 3SDDA 4QOKE 5E9NA 4GAYB 3U0TB 2C5DC 3UYRH 2W65B 3ZDYE 1UUSA 1NIDA 2C3GA 2L8AA 3TF7C 4YSPA 1B6DA 1UZ8A 4N90D 4CJ1A 2PYED 3NN8A 1L0XA 4ADIA 2XXMB 1U8NA 2JLLA 2G2RB 4MJHA 4S1RH 4XNQA 5JO5B 3MV7A 2DQDL 4GRLA 2HPTA 2MWCA 3IT8D 3SPVA 3WTUA 4CMMA 3CN4A 3VDBA 1O7SA 3UAJA 5G4OA 1OM3H 2PW2A 3ROOB 4QRRD 5HI5C 1H3XA 4N4YB 3DOSB 4N2LA 1T1ZB 4OF3A 4RGND 1TZGL 1WPCA 2XX0A 2GJ6A 4X6DF 3SPHA 4B9GA 4LLDB 1B0IA 4F58L 5L88L 4ZODA 5EU5B 4FXKC 5HHNA 3GRWH 4XGZA 2GSIB 4QHUA 4XCYB 4M5YL 3TBCA 7PCYA 3QQ4A 1JV2B 1I9IL 5IHHA 4ZI8A 4QCIB 4HK0B 3UJIH 5I6XC 3FQ2A 4URKA 4GO6B 1E2WA 3BW9A 4GUPA 1ZS8A 3BPNB 3MUY1 4AQ1C 3C75A 1LK3H 5FKAA 3TBWB 4AI7A 4F33A 2FO1A 3RNKB 1QSFD 3V9CA 4I9WE 3T4YB 1JPGB 2XDHA 5HYSA 1Q94A 4PWFA 3VXPB 4E0RA 5L4FA 5FA4B 4G6ML 4NP4L 5AAPA 4NBYB 3P4MA 3WEAA 3DETC 3A4EA 1FJ1B 2BLFA 1KLUB 2FGWL 1OALA 1LQSR 3ES6A 3ZO9A 3QA3B 2B08A 5LXVA 2O6PA 5KYUA 4Q6IA 4Z0XB 1DE4A 3DHUA 4ES9A 4UQ2A 1T1WA 5GHWL 4ODXB 5HPOA 2Q76A 3PQYE 2O4EA 2WNWA 5IIEA 2X88A 2F58L 1WD8A 2J1XA 1PVHA 5JPMB 2ZCHH 3PJSA 2NCEA 3PYCA 1FIGH 3F85A 4PTUA 4U33A 4ZUUB 2Y2YA 3EHBC 3EYFA 1JVOA 3TA3D 3CVIH 4Z76B 2Y2WA 2M26A 2FQFA 1BM3L 4IKJA 4IRSC 4KZ0A 5DWUL 4H25B 1JOIA 1KXTB 2L7JA 5C7XH 3Q06A 4NRYA 3TXAA 2TAAA 3POCA 3Q1SH 4JO2H 1XF5B 2R29H 5SWQB 3MXWH 4WUUD 5IW3A 4Z7WB 3WTVA 1OD7A 3VFPA 5I8CB 2YPVL 1XHHA 3WLBA 3UTTE 2F54B 1QSEE 4Z7QE 2XJLA 3K8MA 5F9JA 4RSVA 1EJOL 5FCUH 3MHZA 1F58H 4G6FD 5ANMB 1WAAE 2F7IA 3QJHA 5E6RB 3KBEA 3TCTA 3GBML 4FQXA 1OAYH 2GI7A 2PXYC 3O8XD 3ZU8A 3HLAA 1CBVL 4YFDB 2W9LA 1E42A 1TO5A 1IKNA 4MQXC 5KYXA 4G9DB 5EH1A 1ZWIB 3D4YA 3RAJH 5CD3A 1DFBL 4I3RH 4XNBA 5KJ7E 1AXTH 2DEWX 2WLIA 1HINH 3THMH 3QWOB 4FXGC 3ZZLA 3UPCA 1U41A 3VXMB 3RZCA 2NY4D 2MSPA 3STZB 2F8IA 4PJXF 1NBYA 1QZNA 1ZLUH 4HEPA 1FNSH 5I1JL 2YD8A 1WRFA 2H41A 4JO1L 1H9VA 3PWVA 3X11B 2QSVA 1TF4A 4PBVC 2V17L 5TQ0H 5DK0A 4FHKA 4UYPA 1H6TA 1W15A 4G6KH 4GFTB 1J8HD 1JNLH 2H6PA 4H1LA 3CSGA 4EXKA 1G9ML 3EJYD 1JGVL 3FFCE 3SE9L 1ZA3B 2WLJA 3BMVA 5DVMA 2W5PA 3KS0J 1RHFA 1U93A 1IAII 1TTAA 1EHLL 2FBRA 2XY2A 1HHIB 4PGEA 3WOVA 4LKXB 5T1MB 4A2LA 3EBAA 4TSAL 2OJ1A 4PIBA 2FJGA 5B7MA 1I53A 3E6HA 2WLHA 1ZJBA 4IRZL 4OIFA 4Q0XL 2HKAA 1ZV2A 3O4LE 1FH2A 3V6OE 3Q6FA 5B3SB 1MNUL 1SF5A 5F9OL 1N10A 5J12C 4GSDH 2MOVA 1UB6B 2Y7NA 1RUPH 5I18H 1G84A 4A7GA 1JTPA 1AQHA 4JFQB 2P5WE 1ZOXA 4EN3C 2V2XB 5E6ZA 1GTNA 4M48H 5JIDA 4OZIB 4IOSA 2O5XH 4UOJA 1AACA 5LBSH 2A7BA 5E7BA 5FUOL 3L9YA 1PKOA 2YJQA 4JRXE 1GH7A 1UWFA 3VX0A 3BUDA 3ZHLA 1BQUA 3I50H 4ODHH 1KB3A 3BWZA 2B3IA 4BDVB 1X9LA 3GMPA 3T1WA 4BFGA 4ZNEE 3LZNA 1FLRL 3NGBB 4EQ3A 3HC4H 2BJMH 1KEMH 1RULH 2VZUA 3L3KB 4HIJB 3QG6A 1XSOA 3RVXD 3N1PC 2O5NA 3Q8FA 4YLCA 1DQMH 2ZXEB 4KUCF 1E4XL 4MMZC 4KPHL 3RVXC 3EYVB 4QOKB 2XLLA 5D7EA 3ZDYB 1Y0LA 2BCMA 4KVNL 1EX0A 2R0KH 4JGMA 1MJ7L 3BP4A 2AK4A 3QJOA 4NDMB 4UZSA 3W1ZA 5K39B 3EFDH 4G1EA 4A2HA 4PG2A 4AEIH 3MJWA 2YXVA 4FA8A 4NM4L 8FABB 4TLSA 3R18A 1ZHNA 3CUPB 1NFAA 1WZKA 3H2WA 3LQZB 1N18A 3PIQB 3W56A 3FQXA 5DSCA 3NDZE 3NSJA 4UT6A 5IG7B 2OMYA 1U3JA 4B9KC 1R9FA 4K9EH 2G3XA 2EIJB 1XH2A 3LQAC 4HWBL 4XX1E 4F24A 3V5DB 2C7FA 5D70L 4EAEA 1LYQA 3ESMA 2ZUWA 3DRTB 2WXRA 3B5GA 4PI2A 1ET7A 3RVWD 2QR0A 5EUOF 3X13A 2A83B 3CBKB 2OSLA 5E7FA 1P4IH 2QELA 3SY0B 5IUCA 3FO9A 1ZLVK 5DK2A 1PBYA 2ERJB 1L9SA 2ZOKB 5HGHA 2B59B 5CIPB 5T3ZE 2NY6B 3K1DA 3BWSA 4FLOA 5INDA 3RTQD 1YY8A 1ZVYA 3BKJL 1CDUA 4LE8A 4L4VD 3GS0A 2UYLB 3B2VH 1CGXA 1HEHC 4G8FB 1TITA 3FMGL 1A6AB 3GRGA 3HJEA 3AREA 3EGDB 1MI5A 5DMIH 3I6SA 4B3VA 4O58L 5LAPA 5KVFL 1MQKL 4NOBA 4L5FE 3Q2CA 4R97B 4Y1AA 4B9ZA 2IH1A 4N2NA 5CP3A 1B6UA 3S5LG 4X5XB 4DEPC 4LCWA 3HG1A 3II1A 4FYTA 1IEAA 1IBFA 32C2A 4GKOA 4XP4L 4J6IA 1NC2B 1T20A 3IJHA 4XVJH 1PYWB 3QS2A 1A7PL 4U6XB 4WHTB 5I74B 1JGLL 2XU9A 4HC1A 3JWOC 4GYBA 5C09D 4PJIA 4NQDA 5CD5D 4HUKB 1FZMB 4Z78B 5AB2A 3RDTB 2E6QA 4OKDA 5CD5C 4ONFL 3KPRE 1JE6A 4HW6A 4Y2DB 4OUUA 1IC4L 3H4FA 3CLEH 1AQDA 5KYWA 4ZZFA 4XAKE 3WNNA 4CNIA 1FZJB 1U2CA 1EGJH 4X98A 4JHUA 4LCCC 3QEQE 1T83A 1R4XA 5HYQB 5MI0B 4RDQF 4G8IA 2EYSA 3MLTA 4Y7OC 1U3NA 3D1MC 4K7FB 3T0WA 4A6YL 4LEXH 4G1MB 4K5LA 4IHOB 5FDWB 1CD0A 4F93B 4OV5B 4WJ5A 2YZ1A 3OLDA 3LIZH 5HDRA 2M1KA 1Q9OB 2F7QA 1RUQL 1TTFA 4L1BA 2HN7B 4NWUH 4XP1L 4ETYA 4BFIA 1H5BB 1M7IA 3QIUB 5IMOB 2NYKA 1HL5A 1JTTA 5TDPA 2O5YH 2O6FA 4XVSL 2X05A 1EMTH 4LDOB 2J5WA 4D7PA 2D0GA 2EXTA 1A4KA 4ZTPH 4FI6A 2EXYD 2JKJA 5I9QC 2OMVA 3HPLB 3IAPA 1IGMH 4FLQA 4MNGE 4FZ8L 4FG6D 4DK3A 3RWHA 2KT6A 1MCSA 5HVWA 1C5DB 1CGTA 3VXOB 4BH7B 2W80C 3GSQA 5C0EB 4JQIL 4E41A 1OWRM 5E2UH 1NGXA 3ELQA 5CILH 5I17A 1NFDF 2E9JA 2AEPH 2YEQA 1XCQB 3ARBD 1MY7A 3GXTA 3KM1A 4PYHA 3SSGA 4P23A 3IKCB 4KJPD 3O6FD 5IKCA 1Z9OA 3VVWA 2PF6A 3CPLA 1Q0YH 3BD3A 4W70A 4XMKL 3U46B 4JY6A 4C83B 1BQRA 3QDGE 4TOYH 1BLIA 3ECBA 1WK0A 4HXAH 1RVFL 4N2AA 5E2JA 3RE0A 3SE3A 5E00A 3N43B 1VJSA 2GBUA 4CSPA 3J7HA 3QUZB 3UG4A 4XWOD 5A2CA 2FLBT 3OKNA 4PRPE 3OVUB 3KGRA 4UIMB 4XWOC 3TASA 5JPNC 1CR9L 1H6UA 2O5ZL 4X80L 3ZL1A 2XN0A 1SN5A 3WE6B 2LABA 2V5MA 4FCHA 1L9TA 5ALBL 2IBGA 4OD2A 3H9HA 5LWYH 1UACL 5MENB 1CFVL 5DCCA 2RACA 3LNIA 3MRNA 1TDQA 4K4KA 2P5WB 1O6VA 2XKSA 2PWFA 2J5LC 4F2MA 4N22A 4P3DA 3A24A 2E7LC 5IW6B 3RA7L 3LEYH 2X1WL 4KO9A 1G6RB 3MRQA 4MA1B 5I1CL 3MROB 1RV6X 4WUKL 3NK3A 4UUJB 4ZO6A 3ATEA 3BAKA 3DJRA 3JV0A 2NY3C 3GF8A 3MRKA 5DZLA 2YD0A 3GSUA 3NZHH 5DHEA 5CIPH 3FONB 4QMEA 1ADQH 2X0UA 3DTDA 5F93C 4Q4IA 4LQ1A 1DQKA 1MCFA 1YQVH 3EYSL 5E8PB 3S4SG 3SODB 1I8IA 4AUUA 1R3HB 2YD9A 5FWQA 3VMOA 5HI3D 1BFSA 3T4AA 2VERA 1JGEB 2CKBL 2EEAA 3HE6C 5C71A 1I1AB 1PG7H 3CC1A 3WUWG 5GGSB 2VAAA 4LVOB 4LPCA 3NQIA 4GEIA 4N90E 1WO2A 2PYEE 2VL5A 2YFNA 3P11L 1MFMA 4ZTOL 1S7WB 1HAUA 3O3DB 4KRLB 4P2QA 4DOHE 1PAZA 1GS7A 4L1HA 5FFGA 2DQEL 1KJ3H 1S5HA 4PRHB 3D34A 3ARZA 2VDKL 5E4EB 3HS0A 4HLJA 1WDAA 3QC5X 2AGJL 1BZEA 4XNDA 4FMFA 5ADOL 3OZLA 2CIIA 4AQEB 1SOXA 1IT9L 1S7SA 4MDIA 4WSGA 3IF1A 2WOBA 1W8OA 3F7LA 1T0NA 4XBGB 4PJ8C 1E4WH 3V4VB 1B0GA 1M7DB 1MCLA 3PL6B 4ANWA 2CALA 4DZ8A 2JKXA 2Z7UA 1GGCL 3LEXB 3UJJL 3K74B 3L9RB 1BAFL 3LRSA 4IK7A 4K94L 2YAOA 1A25A 2B1HH 5IESH 1HHKA 4YC2B 3R1GH 5CMAB 4G11A 4ZFQA 1NC4B 1IRAY 1I1CA 1I31A 3FOLB 4LSSH 3NIDF 4OJFL 1MKFA 5JW4M 3KE0A 2YMOA 4H8WH 1OPOA 5IVXE 2EDQA 1NCCH 2X38A 1D5ZB 2F5BH 4YGVB 1LL1A 4P46D 5F1NB 2BOCB 4EI5D 2W94A 1I9EA 4Y4HD 2N7BA 3O4OB 5DUBB 3VJ6A 4GBXB 2BNUB 2HFGL 2R1WA 1QO3A 1LO4L 4LARH 4C56A 2PW1A 3DIDA 1E8XA 2VWEC 2Z93B 1FORL 4HAKA 5AZ2L 3V6ZA 2GW5A 3CHQA 3PWUA 4ICXA 1DP0A 4Y1SA 4ZUWA 3VI3E 5HVHB 1PY9A 3CSFA 1OGAB 3L3IB 2GAZA 3NJXA 3OAYH 1YAZA 4XCEB 3BSZA 1A1NA 2D9CA 3VRLE 1DBKH 1TJHL 4M7KH 5IHZA 4OGQC 3ULUC 1DQJA 4MJID 1XF4A 4IU2A 4IBYA 2R7EA 1G7IB 1UUNA 3F58H 1RFDL 2JCCB 1SBSH 3ILQD 2HUHA 3DYMA 2P24B 2J8UA 4H4NA 5D9SA 1T0PB 3ME0B 3RY5A 1YEEL 4HWNA 3T3ME 1RZPA 5HGAB 4NB7A 3LKOB 4BZ2H 1D9KA 3HMXL 5I1AB 1VACB 3D9AL 4DKFL 3H1ZA 1AJ7H 1GMIA 3AWGA 3ZKMD 2A74C 1T1YB 5DRNB 1NOLA 4P4KC 4YE4L 3FCTB 3WEMA 4PRAB 1BX2B 2F7PA 3B9KC 3TVMC 4BWUA 4YIQB 4M8QB 4XBPB 3KL0A 5HJ3B 3QEHB 1HOEA 3S97C 3LSOB 5E99H 4CMHC 1VEPA 4JO4H 2OTUA 5LNDA 4KDWA 3EKCA 3UGXA 5DF0A 1RUAL 2PO6A 4PGZA 2L04A 1G6RH 1JI2A 3GMMA 4U0RC 4TS6A 2QMJA 4YZFF 1KF9B 2RGSA 4ZQKB 3Q1EA 1NCDL 3ZKXC 4I18A 2BDNL 4LGSB 3N44B 5ICYA 5KZCD 5L6YL 3OZ9H 3S96A 5TE4L 3NIFE 4WZ9A 2G5RA 4FGMA 1GYVA 4YPGB 2EZ0D 1DDTA 1YPZA 4MGXA 3W0WA 1T5XB 3B9VA 2ZAHA 2EZ0C 4QHKJ 3K71A 3I75A 3ABMB 2B8OT 4D0DB 1J8HE 3HRPA 3FCUB 3UEZA 1B0RB 2KL6A 4LPXA 4O2EA 4BJLA 1QAWA 1WP6A 1F8TH 3WDJA 1BPLB 1DBAH 5C0CD 1K8DA 5I5JA 1U8PB 3GWJA 1OW0C 3I6GB 2QZQA 2FO4A 4HX1B 1ZT7A 4NN7C 3ARXA 5HY9B 5C0BA 4KXDA 3QIBD 4U3HA 1XEDA 5I8KH 2O6DA 2R2EA 3B6SB 3C2AH 1OGPA 3D3VB 3T0BA 3QIBC 4NN5C 1IGJB 3QIWD 4K3DL 3OAZK 4UV7L 1LO0H 1TYJA 5F7DA 4X7DC 1U8LA 3L2MA 2PPCA 3MJ8A 3MNWA 3V4VH 4AGPA 1X6LA 3S3PA 1KENH 4LU5H 2F5AH 1XF1A 3LNHA 3TYGH 1VKXA 2QQKL 1XGQB 2QHRH 2FLRT 4DVBB 1K4CA 4LPTA 3HHSB 4PRDA 1C5CL 1OQOA 5D2LE 3EFFA 3UP1A 3L5HA 1FFNA 4O02L 1HZKA 3N41B 5EU6D 2BSEA 1KCSL 1CICD 3CDYA 3AITA 2KZBA 3LD8B 3D4CA 3LKSB 3SE8L 1XCXA 2R1YB 3WY2A 3DMMD 4ENZA 1CICC 5DYOA 2P43B 1A3RL 4YDIL 3RX9A 4XH2B 3DMMC 3OLEA 4LGPB 2F1BA 5A2LH 2KDGA 1HIML 4AL8C 4ENED 4DP2X 5IB1B 1IMHC 4OFYA 5LQBH 4UV4L 1HVXA 3RWCA 1U58B 2BERA 3QNZA 5LGJA 3H9SD 3QEGH 3HKZA 1RK1B 4KKZA 5CKAA 2H0FA 4L5FH 4S1DD 2BY0A 4UM8B 3K6SA 3LZOA 4LLVB 4NO3A 2I25N 3NCJL 4NPYB 5JXEA 2G2NA 3ATBA 4JFFA 1N5YH 2PYEB 2P26A 2FBOJ 1MW3A 2UZIH 3CK0L 1FL5A 1UURA 1W72B 2P8PA 3L6FA 4PN6A 1HEZA 2YC1B 1DSFL 1OAQL 3N1FC 3NCYP 4BFEA 2DH3A 2OZ4H 3EYQC 2KI6A 2NX5A 5J13B 1GJIA 3JWNH 1GOHA 4KRPC 4QRRB 4UTAH 4WU5B 4HSQA 3BT2H 4HIHB 4RGNB 2WP3T 4XMVA 2W0FB 5DD5L 1KFAL 2HX9A 2NY7H 3AQYA 2MTAA 3FT3A 2BC4A 1SLWA 3Q2NA 4JL1A 4LQFH 5ABDE 5DZPA 3A67H 2BVOB 4YHPA 3MJ6A 3WIIL 4IRJD 1AI1L 2ZD0A 3QZWA 5BUPA 5CAYB 4YHNB 1BLNB 3AQZA 4HHAB 4U6HB 3TM6A 5I19L 3OJVC 3S2CA 5FYKD 1BGXL 2NDFA 4TVUA 2QGBA 2XQYG 5EPMA 5JLZB 4Q9BA 5I66A 4AZUA 1QSFB 2JJTA 1UWEH 1KYAA 1Z5LB 2QDVA 2VXQH 3GDCA 1LD9A 3V8CA 4GQPH 3KCWA 2AERT 1H3TA 3DOSA 1S9WB 1VZIA 1CTMA 4F8QA 4JG0H 1P2CB 2C9AA 5BW7A 2A73A 3CZFB 4D8OA 1WA2X 2BNQA 3FPYA 5EU5A 3V4PB 5KS9B 5KYNA 4OD3H 3VI3B 1KXVA 4XCYA 5AB1A 2E86A 3IK2A 1LDPH 3A6BH 4HYTB 2P80D 1PPIA 2UX7A 3AG4B 5BO1H 1ZGLB 2EDEA 1QBLL 2JIXD 1ZTMA 4HUXB 5F7BA 5LBSA 2QKIA 3O45B 5C09E 1VFAA 1O9VA 4DNLA 4PVBA 3MV9D 3VXUD 3SOBH 4ZAKC 3TA3B 3OMZA 3QNYB 4E5XB 4IU3B 2YPLE 1Z9SA 4JHAL 3BDYL 3TBWA 2I24N 3WJMA 2VR8A 2QDWA 1B0WA 4JM2D 4KGJA 3L3OC 2J57A 3T4YA 1JPGA 4JM2C 3FO1A 4WUUB 2B5IC 3DJSA 1RPQA 2FLMA 4NUGL 3S88L 1E6JL 4Y19A 1VFUA 4J4PD 1CT8A 3NJFA 4P4RB 4TVPL 4N6RA 4XPHL 1EBPA 1SXAA 1ONQB 3KL5A 4YFLI 4ES8A 2P46B 5BVJB 3N55A 5EU3B 4G6FB 1AGCB 4KTDL 5J6GB 1W0WB 1MREH 2NYYC 5H2BB 1EDQA 1QFHA 5DJ8B 1YPZF 3QA3A 2N1KA 1KEGL 3VWJC 3ULVH 4G42A 3O8XB 1JERA 1LJMA 4ODXA 2A4CA 2D7NA 4JFED 5LAXA 4HOXA 5CBAB 5L2JA 4OGAC 4F7CA 4I5BB 5K9KA 3UBXA 2OK0L 3ZE2B 2APFA 1MFAL 3CHXA 3PWPD 4H5SB 5IB2B 4FL4C 5I1DA 2DYRB 2VJ0A 4KMTL 4Z76A 1BVOA 4D0BA 1S78C 2VN5A 3IETB 4H25A 3ROLB 4AM0A 1FGNL 1G1YA 1T0OA 4JB9L 4R7DB 2XA8L 3IWVA 4QNPE 1SFDA 4HWZA 1MRDH 2ITFA 1KTJA 2CJUH 2NY4B 1FO0L 4P59L 1CU4H 5I8CA 4B5ZA 1IGCH 3EFOB 1SYVA 1RIVL 4N0UA 2B0SL 4JQVA 5GGVL 3NIFB 3OKEB 4G80A 3TWCL 1E5ZA 3N40F 5E8NA 4PP2A 3US0A 4CADB 2RQEA 5ACZB 4DVRL 1NLDL 4LDEB 3B8SA 3MRIB 1J8HB 1JXJA 2MPVA 3FS9A 1CDCA 3C5ZD 2Y1AA 3EOAB 2P28B 3BRFA 1AH1A 1MFBH 3C5ZC 5DU7A 1JAEA 4WI5A 1ZWIA 4FNSA 1NCUA 1W72H 2EIEA 2G0KA 3PNWB 4L3EE 2BVTA 4NZFA 3GMLB 1YEJL 1JNNH 1IIIA 4BWWA 4E9WA 3ECQA 3KXFA 3GS7A 3I3DA 2DTSA 1C9SA 1TJIL 3HRZA 5EU4B 1A1MB 3IN2A 3UZEC 2Z7YA 2QGDA 4NBZB 3QCTL 3VM7A 4EKXA 3D39A 1OSYA 3X11A 3GKWL 1MY5A 4PJEA 2MFNA 2OMWA 2FX9L 3QR0A 1X7QA 2DM2A 5H37H 4TQ8A 5BRQA 4Q9RH 2I7OA 4PJCB 4ZS7L 2XVLA 5I0DA 4JZNA 1LLAA 4J3XA 4JDEB 2ZG1A 4JJOA 1RQ5A 3UYRL 2JLPA 1KPRA 4BZ1A 3PUCA 5AENA 1ZA3A 3J2PA 4PVMA 3LVTA 5H35B 1C12B 3GNMH 4S1RL 5KVEE 4LKCA 4FLSA 4X7EC 1IM9D 5CEZE 1QWHA 3IDUA 4RFEB 5CLTA 3V52H 2VDLB 2FT8A 5CKGA 1J5HA 2X89A 2CM5A 5BQ7B 1MQ8A 2OYKA 4FQ1H 1HESA 5B38G 4NWTH 1CMOA 2AC0A 2V5SA 3PRZA 1OM3L 3HN8A 4Y9GA 4U1MB 2HLAB 5JHDB 4YDNA 4PGDB 3FTWA 3DUUA 4JVWA 3V4PH 2HRHA 3QXTA 4LSPH 2V2XA 1NAMA 3QUMB 1JWMA 4PLNC 4NN6C 3GRWL 3HJ0A 3P9MB 4NYLA 5HYJD 4ESKA 1ORQA 5FYLD 3GSOA 4NKDB 4ELME 4FDWA 2GI0A 3BP6B 5E6SB 4APXB 4MMXC 4HJSA 3UJIL 4JUTA 3T0XA 1LO5A 2XQYK 2D7QA 4QHNB 4TKWA 3AS2A 1LK3L 3P73A 1S9VB 1N4XH 5DHDA 4QKTA 1TVHA 2AZAA 4OZFG 4QTFA 4GH7B 3SQBB 1GPOH 5BQDA 4CGTA 3C09C 3L5XH 1S7UB 1JPSH 4FG2A 4K3JH 5AOIA 3WNMA 3SCMC 3VG9C 2HLFD 1G9NC 3KPPA 4FJZA 1EPFA 4QOKA 2J4WH 3QUGA 3DXAD 5CP7B 1KC5H 2Y5TA 2IDQA 5MEQA 4POUB 5GS1A 4YEFA 4JFOB 1JI1A 2HVKB 4IMKA 5I2IB 2Z31A 4BFJA 2DQUH 3WJLC 4EIBA 4ZX4A 3FQNA 2DBLH 4NDMA 4KI5D 1B88A 1FYTD 3RTQB 3V6FA 3S3CB 3CCHB 4HJGB 3WTYA 1DBMH 2QJDA 4RSYA 3I84A 4L4VB 3QULA 2UZYA 2VWEE 4XNXH 1E4XI 2LOEA 3D85D 3B5HA 2ZCHL 1FIGL 1NFIB 2BWQA 5TFSH 3CVIL 3B1TA 2UY6B 2GIXA 3O81A 5C7XL 3M1BB 1OGTA 3WTXA 3FRUB 4PP1D 3TPKA 3WJJC 3UPAA 1D5IH 3DO7A 3Q1SL 5FLVA 1KTLA 1ETZA 2R29L 4JO2L 4MSWB 4PP1C 4R90H 1LQBC 1WWBX 2W1NA 3KEHA 1B9ZA 2ZWLT 3D06A 5AG8A 2KHAA 3F3HA 3ULUE 3MCYA 3OKDB 4JFYA 2IC2A 5F1KC 1P9MC 35C8H 5T5NG 3HNTH 1TXKA 5DUPH 5FCUL 3GSXA 1F58L 2AQQA 1LE5A 4R5TA 2AKRA 5C09B 5C0AD 3OGCA 3JT2A 2WWKO 5A2JH 1LEIB 1Q8MA 1OAYL 1Y07A 2TSBA 4YO0A 1B3JA 4MKTA 5D6DA 4U1JA 3UDWA 1V3JA 4R4BB 3UTOA 4N20A 2EJ1A 3BWAB 1WFTA 3RAJL 1VENA 4RAUA 5F3HB 1A6AA 1A9BB 5EN3A 1JK9A 3WE1A 4UT9A 1LP9E 3QZMA 4UNTA 3WMSA 4I3RL 1SMOA 4JZOB 4Z7WF 1AXTL 3UROR 1HINL 2ATKB 2WQRA 5F0PB 3THML 4EZLA 2R9HD 4KKLD 4QRSB 4A04A 1D6EA 3AUWB 2CIKA 2K45A 3UBHA 2R9HC 1QSZA 2A9CA 3MTRA 1ERNA 4KKLC 4L3CB 4M29A 4TNVF 4X5XA 5T3XD 2CCLA 3ISWA 1KIPB 3MRRB 4Z7NE 4OZHB 4RFNC 1FNSL 4BXSV 1NC2A 4FQQB 2Z3FA 4GJTB 4DETA 4F7TA 1MZYA 5KBNC 1JPFB 3PQYA 4OIIH 5TQ0L 2XWJB 3QUYA 1BOGB 2EDWA 3KWTA 5I0XA 5FHAH 5ICZA 4G6KL 4HIIB 4DKEH 3SPJA 4F15C 3RDTA 1JNLL 4E36A 2VR9A 3O11A 2P7TA 3BRGC 4LFHG 4H26A 3RWIA 2XG5A 1PZBA 2QL1A 3LRHA 3DWTA 3G5YB 1U8CB 2JWYA 1I1RA 1AHMA 4PGCB 1QUNA 3GTNA 4ISVA 5D6CB 1DJZA 1U8IA 2VDLH 4I2XB 4LB8A 3UTTA 5HYQA 5IY5B 1QSEA 3M45A 2CCVA 1A6TA 3BC9A 1PLGH 1U3ZA 5EN2B 3KPOA 4XBMA 3DARA 1KCBA 3ARBB 2RCSH 4G1MA 1UC6A 1WAAA 2X0VA 4NOFA 4QJ4B 3O9WD 5FDWA 3MGOB 3JTSA 1UGKA 3DX2A 3L3GB 3O6FB 4N2FA 2WBKA 4GSDL 4MB5A 5I18L 1RUPL 5DJYB 1X7TA 4NQQA 1XTMA 3GGWB 1N7MH 1TQVA 3KPMA 3QUMH 4Z23A 3DVFA 4APQC 5D7KE 1H5BA 5GJSH 1SJMA 2OMBA 4LNRB 2X87A 4M48L 2KPWA 3WY3A 1HNFA 1KIRB 2O5XL 4QXTB 5LBSL 3VWKD 2ZP0T 5ADPH 3T0ED 3C60C 2HJFB 4M6AA 3DC0A 3I6KB 4OAWB 4U1GC 1C5DA 4L9LA 3RVUC 3TZVB 4CVZA 1Q1JH 3I50L 4ODHL 3VXOA 3M86A 1R3KA 2Z9TA 5E0FA 5HPMA 3G08A 4ODWB 3TNMA 1RZGB 2WZPD 1DQQA 5HGBA 3H6JA 1JPST 2CO6B 3D12B 1I82A 4EZJA 3MCKB 3HC4L 2BJML 1KEML 2IIJA 3LXBA 4XHQA 1RULL 4FQ2H 4X5LA 4ZW8A 3N91A 1FG2B 2X3BA 5C0IA 1DQML 4L4TD 3QJFA 5EU6E 4JHZA 2LAAA 1E6OH 5F6IC 1CXIA 5FYJE 3FFCA 5KVGE 1IO4C 3MOAH 1ILUA 3FAWA 2R0KL 4QAWA 4GLRI 1D2OA 3QUZA 5KN5B 4BZ2A 2DQIH 4JLRB 4PJ7E 4V1DD 3GS4A 3SYAA 5IMLA 5C0GB 1P5VB 1VIWA 4UIMA 4AEIL 3EFDL 5KBDA 3IN0A 4OZGE 3R7RA 2EDFA 2D4FA 3VE0B 4BZYA 2J56A 2WUCH 1QLFA 3H9SE 2ZCZA 3O4LA 3V6OA 1PS3A 3S5LB 1W8EA 3KCPB 3ZHFA 4K9EL 5AZUA 3U7AA 1JF1A 4GW1B 4ALAH 4NPJA 2P5WA 1NUFA 2XN9D 2OCCB 5EOCH 2YO3A 2DWEA 2Z35B 1TETH 3ZDYF 1J9QA 4X5WB 4X2UA 3RWFB 2VQUA 3BE1H 1BFOB 5IW6A 1J0ZA 3SDAC 1HZHL 2KQMA 3MROA 3V9FA 4ZX6A 1R47A 4J3SA 1AKPA 5L7XH 4JRXA 5C0DB 1E8WA 1P4IL 3FONA 2UVFA 5DS1A 5C6TH 4R7NB 1P69B 3DX9B 4FKHA 4UU9B 3BHBA 3F5WA 1CFSA 3FTGB 2RB8A 5E9AA 3PAUA 4ZNEA 1OTTC 2ADFH 3B2VL 3M8OH 1VADA 4I9XA 1KIQB 2EDYA 3P3TA 3Q3GB 2EDHA 2JTYA 1J9RA 4MYPA 4AIEA 1Q1PA 2GT9B 4KC3B 2G5UA 3CDZB 5DMIL 4AQZA 4WDIB 4WW2A 5IBUG 4CVXA 3F65A 3UZQB 3PPSA 1CQKA 4RVBA 2Q5BA 4AV0A 4FNQA 4LHUA 1S7WA 4AEEA 4ZXBC 5FYKE 4OGZA 1ZT1B 3L3HA 2E8ZA 4AUYA 1RP8A 3H0TA 3AZUA 1EXUA 3L2NA 4P46B 4OF0A 4MCNA 3VXRD 4XVJL 1KJVA 4BCZA 2CHNA 4EI5B 3TIDA 4Y4HB 4DGIH 4LFHD 1CYXA 1G7PB 5E6UB 3C2SA 4HK3J 1KZQA 5J1AB 1I3VA 4Y16D 3CQQA 4P5TC 2OSXA 5I8EB 1ZGLM 1IL1A 1QHQA 3BSGA 3HE7A 4YHOH 1EUTA 4TUOB 4Z3FA 4KROD 3ABGA 2FIKB 4NHCH 4I0PB 3CN3A 3CLEL 4EJ1C 3BLPX 3MNZA 3IDNA 1TTUA 3MRLA 4JE0A 1EGJL 2WO2B 4JBSA 3ZE0B 3QZLA 4G43B 1R3IH 2Y1VA 1UVQA 3Q05A 4MDJB 3NEXA 3RFZB 3WFEH 3ELAT 4MJIB 2ETWA 3B56A 1UJTA 2Z4QA 2XZAH 3OAUH 4LEXL 2GB2A 4UB0H 3TIEA 3NOIA 4HS6B 3LMJH 3ARWA 2G9KA 2ZONA 2HTLD 2DYPA 3HVDA 2AJSH 2YLKA 2WBJA 2VN7A 3LIZL 4UF7C 3LOWA 4WHYH 3NIGB 3TYFB 2DLFH 4QI3A 4EMZA 2ZSWB 1PKQE 1ECYA 4NWUL 1NANI 3Q9PA 2HG5B 2A74B 3ZYIA 4BELD 2X4PB 1WBYB 2J8OA 2O5YL 1EMTL 1LP9B 2D7MA 4PSRA 4ZTPL 4EVNB 7TAAA 2HKHH 1CF1A 3KW8A 3BEWA 1IGML 2LW3A 3MLWH 1KYOJ 3NSXA 3ZPDA 3TO2A 4D9LH 5BXFA 1H15B 1WAAF 2DIJA 3PDOA 1THAA 4GKSA 5KWYC 5B8CC 5E2UL 3V4UH 5CILL 1SHXA 3OKOB 1MCNA 3LZRA 1CGYA 1YC7A 2AEPL 43CAB 4QJ5B 4QRBA 4L3FA 4PJFB 3WEBA 1TLKA 3L1OH 1UEYA 3B7UX 3FC8A 2X9WA 2OZ4A 4U4IA 1MNNA 2P3YA 2A6JB 2QTVA 1U92B 4A2EA 4AV4A 3VNZA 1Q0YL 4BIKA 3KPRA 6FABH 4PY8I 4WI0B 4TOYL 4FQPA 4HXAL 1ETB1 4JKNA 5D7LE 3TEZA 4N5EC 5KZCB 3IGKA 3P0VH 1CGSH 1UKSA 3CU7A 4YR6A 4RMWA 3WXVH 3QEQA 4DP4X 2P42B 3F12B 1T1YA 5DRNA 2Z8RA 2ZUUA 1DVFD 3EXJA 5F7FA 1R5IB 4AQAA 3WUWB 1MEXH 4AV5A 2DAVA 5FF6B 4X7SH 2GFBB 1J1OH 1A3QA 4M8QA 2BP0A 2VW6A 2FEEL 3WN5C 1MOEA 1RJZA 4M1DH 4XVUD 2X2UA 3PDDA 3L5JA 5LWYL 2XWCA 4Z8FH 1DLHB 3VMPA 4AEHH 3HEIB 5AYTA 3IJEB 2V9QA 5C0CB 5J6HB 2GC7C 2JI1A 1BJ1J 4OQ1A 8PAZA 4NN7B 3US1A 5D7SH 4FFVD 3GXIA 2HG0A 2FHFA 5F9WB 1QEWA 1WICA 1T1XB 3QIBB 5IQ7H 3LEYL 1ZLWH 4HLZG 4PYGA 2F0CA 2I9LB 3QRGH 4QO1A 3QIWB 4MNGA 5EIIG 3NZHL 3ZZQA 1L6ZA 3EJSA 3QQ3A 3SKMB 1ADQL 1Q0EA 3FSOA 4DTGH 3IDMB 5IK3B 1LK2A 1YQVL 4XVOA 3QYCA 1HAWA 4OQTH 4X7CC 3BZ4A