2WCPA

Crystal structure of mouse cadherin-23 ec1-2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Cadherin-23 Function in Hearing and Deafness.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords CADHERIN-23
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA02
4NUQA 4APXB 1NCGA 4AQ8C 3LNHA 4ZMQA 5JYMA 4ZT1A 4ZMYA 1NCJA 4ZMNA 4AQAB 4ZMPA 2A4CA 3Q2NA 4AQEA 4ZMLA 2OMVB 3K6IA 4OY9A 3LNEA 2OMZB 5CO1A 5CZRA 2A4EA 2YQGA 3LNIA 2V37A 3UBFA 2WHVA 2WD0A 4AXWB 4ZI8A 2EE0A 2WBXA 3Q2WA 3FF7A 2YSTA 2OMTB 1O6SB 3K5RA 1ZVNA 2WCPA 3PPEA 5JYLA 1NCIA 2QVFB 4ZMOA 1EDHA 4AXWA 3UBGA 2OMYB 4ZMZA 4AQ8A 3K5SA 4NQQA 2OMWB 3Q2VA 2X2UA 3LNGA 4NUPA 1WYJA 1ZXKA 3Q2LA 4QD2E 4AQEB 1Q1PA 3K6FA 4AQAA 4APXA 2OMXB 3K6DA 1FF5A 4ZMXA 3FF8A 4ZMTA 4XXWC 1WUZA 4XXWA 4AK1A 3LNDA 2O72A 2OMUB 1L3WA 4NUMA 3UBHA 1SUHA 4ZTEA 2QVIA 1OP4A 4ZMWA 5KJ4A 1NCHA 3QRBA 3LNFA 4ZMVA 5DZVA 3MVSA
chains in the Genus database with same CATH superfamily
4A2GA 4LAQH 1NCAH 2EYTB 4QHLB 2FUTA 1BFVH 5CLYA 4QRTB 1EBAA 1H0DB 4ANXA 1E0OB 1E8WA 2ZG2A 1H15A 4H0GA 3UTTE 2YEZB 2DQEH 4RA0C 4DZ8B 4GIPD 4QHMA 3L2NA 3N0AA 3QXDA 3UBXA 3TVMB 2ZTBA 3AS2A 1IKOP 2OMWA 1A7QL 2O93L 2WUCL 4JREC 4JVUA 4ZO9A 2VWEC 2ILLA 1GYWA 1KLGB 3QFJB 3MLVL 4KY2A 4HSCX 4U49A 3MCKA 3L5WB 3PJLA 4OD3L 2DQUL 1YY9D 1E5CA 2FZ3B 4TQPA 4GW4A 3GXIA 5LNDA 3KPPA 1B3IA 2VYRE 3MLPA 1FZKB 2IQ9H 3TYGH 1SOQA 1R3IH 4JANA 4GRLB 3IMRA 1BX2A 3O6LH 3NIDB 4PGEA 1RHHB 5MEQB 3O2DL 4IOSD 3QDMA 4PTUB 3OB0K 3OKEB 4X8JA 3RUGE 4LCWA 3ROLA 3QB7C 4WNQB 4WW1A 1TF4A 3L3DB 4JRFA 2WLMA 4DP2X 1S3KH 3X1NA 5T1JA 2NQ3A 2NY1B 4GQPH 2YD8A 5B1CA 1R3LA 2DQDL 5BZXA 1XGUA 3GJFB 3VXUB 4BE6A 1EEYB 3D8MA 1U8JB 3IAGC 1ZVHA 4EI6B 3MOQA 2JIXD 1MRDL 4TLTA 4XVUC 1XF5B 3IDIB 3BPNC 4AEIH 1UJ3A 3IRZA 3JWOL 3ZL4H 4AYGA 1I8MB 1OGSA 1YDPB 3CZGA 1CN4A 4QXVA 4MAZA 1UH2A 2OBGA 1E3ZA 3VXRE 5IBUG 2ZKHH 4ZUSA 3FCSB 3RIFF 1CR9H 1H8OA 1KPUA 2GTWA 3I02B 1UYWL 3KEHA 4L5FL 4OUOA 4TVPD 5I15H 2MKLC 2YAOA 5KSAB 1VDGA 2WW8A 4XXDA 4X80H 4YUEH 4FQXB 3V6ZA 5DFTA 4G9FB 3PYCA 2XBDA 3JVGA 2ZNXA 1LO0H 5ICZB 2SEBA 1FO0L 2WANA 5E99H 1S5HA 5E00A 3ULSB 1A4KB 2VDPH 2LABA 2Y06H 2R9HC 2EC8A 4D0CB 1I85C 4PRHA 1NBZB 1PBYA 3VFVA 2GITB 1WFTA 1MCWW 4W9LC 4X7DC 1I9JH 1BZ7A 2AEWA 1P7QD 1WCBB 5A6MA 2ZYHA 4U6YA 1CGSH 2O5ZH 4FZ8L 3JYCA 4H4NA 5LG6A 1B9KA 2JF1A 3D34A 4NZFA 3U9PL 4KO9A 4E9LA 1GW0A 5ISZE 1G9EA 2PW2B 2QV2A 4HKBB 3EO9H 4GNKB 4GXVH 4MDIB 3IXTB 3LZNA 3U46B 3TESA 1U8QB 3CFCH 3T2NL 4Q4EA 1NEPA 1JGDB 1M6OB 2G75B 2DQJL 5ICZA 4CKVX 3VDBA 5EZIL 1MCPL 4ZQKA 3D39A 1PD0A 2XZQH 3KDMA 4R2GD 1DLFL 1KN4L 3WNOA 3ALXA 3L3JB 5CD5D 3QZWB 2DQGH 3TEWA 3BMWA 3ZR6A 5A16A 1K8IA 4LEXL 4LP5A 5CO1A 2Y69B 3ATEA 3SOBH 2JJSC 5CGYC 5F1NB 3LEYH 4GT0A 3WS6C 4PLJD 2PWHA 1HDMB 1IZKA 1JZ3A 3DGGB 5D7IF 2P5EE 3IJSA 4BH8B 1MWOA 2VN6A 5CM1A 1KYUA 1KZQA 3MNVB 3QZWA 4GB9A 1MHPH 2CO6B 2Z1PA 5A2BA 5MEND 5IFJB 1IFGA 2BVQB 3FRPB 4JO4H 1YJDH 2FD6H 2H5UA 4RMSA 2D4FA 3QEQA 4Y2DC 3UTZB 2QV4A 3QNFA 4KKLD 2DDQL 3D3VD 3HBPA 3K6OA 4NM4L 1FL6A 2JLLA 4RH4A 2HFEB 2XQBH 4UTBH 4NJ9H 1UENA 3GMOA 3MV9E 2FATL 3HUJE 3BXNB 4AKOA 5BRQA 1ORSB 4PLKD 3WIFA 3B5HA 3QR2A 4JG5A 3CZSA 2JKRM 4FQQB 3EOYG 3RHWF 1JPFB 2DV6A 5IF0B 1TJIH 5JZ7C 3ULUC 1KJ2H 4AW4A 1MDTA 3FPYA 4ZRGA 4XVTH 5I74C 2QVFB 1A47A 5EN2B 1CFMA 3MRRB 5EF3A 3CX5J 1WA1X 3WFHB 5LGKA 4YDJB 4YHPA 2X4QA 2MMXA 4RNRA 3OB8A 3RAJH 3P4OB 5LNEA 1QNZH 1FZJB 4A66A 3EO1B 4XWGH 1N4XH 4X4YB 1I75A 4HHWA 5HYEA 2DWDA 4TV3A 4HIHB 1JZFA 1TVHB 2VR8A 2ADGA 3MODL 2R8SH 1A1OB 4G82A 3O4LA 3FUIA 1RIVH 1HX0A 3BWAB 3K6FA 4DN3L 4K7PL 1H3VA 1N0XL 4TVPE 3RZCC 1JK9A 4ZW6A 5GZOA 1DBKL 2JB6B 1DL7L 2B16A 1AIZA 2IPTH 2NOYA 3QHZL 4LLWB 4DCQA 3RRQA 3AS1A 4LOUD 4WI3A 4PI2A 1CL7H 1KBVA 1LL1A 5IQ9A 3O6ML 4PR5B 2G0LA 1CJYA 3KGUA 4KQ3L 4ADIA 4EXPX 3CN4A 4Q6IA 5EU4B 5KW9H 4H0HB 3TO2A 3A23A 2V3EA 5E03A 5E8PB 2XN0A 1NGPH 5DHXB 4F80A 2BOCB 4NQEA 1QATA 3BSZL 4F2MA 5CEZH 2EDBA 2WWMD 4K3EL 3E6FB 3IJSB 3UJIL 5T3ZD 1BYNA 4A2HA 1KFGA 1ID2A 2VITB 2VDNH 1TXKA 4IU2B 4TUJA 1JXGA 3QWNA 3GXUB 1RJLA 3CX5K 1CDJA 3N44F 2GSGB 4UM8B 1KIUA 4M7LH 4DGVH 2ZOKA 2E7LC 4MBOA 3H9SE 2J6WA 2MWCA 3IU4L 1R0AL 3KDMB 5DHVH 2WXFA 4IHOA 4BFJA 2EH7H 4CVZA 2UZPA 3CMGA 1D5ZB 2B14A 3CK0L 2VM9A 1CFTB 1QKZH 3LDBC 4U1HA 35C8H 2AXFB 4HH8A 4NQEB 3DBXB 1BQHA 4WHDA 2VQ1A 4AG4H 4Z77B 4PJXE 2WBXA 4AGMA 1WZ1H 3ARTA 4XP5H 3L3GA 2COQA 3ZTCC 3MO1A 4CL7A 2IFFH 5EF1A 2APSA 1QLEL 3CFTA 4R97C 3II1A 5F7EH 1FPTH 5DK3A 3VFVB 2BVEA 2XIBA 5BZDA 2GJJA 3HNSH 3MRJB 1DBKH 2IADB 4Y9EA 1G7JA 1XSKA 4PRIB 1NUGA 1YNKL 1KGJA 1NBYB 1A4KA 3HFFA 2H9GB 1RUQH 2X89A 2FK9A 4ZOBA 3UO1L 2DKMA 5CD3B 1ZIBA 3FTSA 1AR1C 3DROB 3UAJC 3ZLQC 5HY9B 2HLFC 2W0PA 4L1TA 3S4SG 3X3FH 4TTDD 2HUHA 2FIRT 3HKZA 3QUYA 3RY4A 1MXDA 1AC0A 2YXVA 2CO4A 3KCPB 3HAEH 2NSQA 2QSCH 3CZJA 5D7JB 5ITBL 4IIZA 1JI1A 1LP9E 2Y23A 4BZ2H 4OGYH 4YSEA 3D0VB 4C83A 3MLZL 3IEAA 5EOQL 4JHZA 4ELKA 5FLVA 3TVMD 4MAYA 1I7TB 5K39A 1S7SA 1A14H 2J6EL 2IPKA 3INOA 1Y18A 3FB8B 3C6SB 4MYWB 1M56B 1MJJA 1H19A 4FFYL 5LKNA 2X28A 3L08A 2YK1H 1UC6A 4B50A 4P3DA 3VWKC 5T1DL 1RURH 1EZVY 2CBMA 1YUKB 3NIGF 3WIIL 1BZ9A 4F24A 5BW7A 1YUHA 2D73A 2O6FA 2VO8A 1K3ZA 4MJ6B 1X44A 4L4VE 5EC1A 4RMUA 3GT6A 3VXMB 1BIIA 1IM3D 3D12B 2ZKWA 3FYEB 2P28B 3IF1B 3ZN6A 3KR3L 5JXEA 1RZFH 3GTTA 3SYPA 3AQDA 2QVMA 4MJ4A 5C0NC 5IFJA 1F58L 3STBA 2R7EA 3QI9C 4GBXC 3K72B 4CNIA 1QSFE 1MHCB 1P2CA 5LXVA 2Z31B 1NLBL 1NSNH 3KYNB 2X6CA 1MCLA 5A6IA 2P5EB 4R7VA 1HDMA 5D4IA 2HPTA 4E5XB 1G6VK 4RAVA 3CPLB 1QR4A 1V54B 3QUKB 3HNVL 1BPLB 1V5JA 3CHPA 4N8VG 3WY3A 3DUSA 2YAEA 4PGBB 5G2NA 4Q9RH 2G2NA 4Y4KB 1VFAA 1MVUA 1M71A 1T80A 3BO8B 3P73B 1OTUD 3IKCA 1UXLA 4UUJA 3RVTD 1DDTA 3VI3A 1OCCB 5MENE 1YEWA 3IGLA 4JO2H 4WUKH 3PWUB 4TYUA 4NJ9L 4JFWA 1AE6H 2R56L 5TTRA 5G4OA 3WTYA 1EO8H 4N85A 5HI5D 4HKBA 5J11C 2Z7UA 1NDGB 1OB1B 4Y8AA 5SX4I 3K8KA 3P3RA 3TO4B 1MFAH 5G4MA 1FHGA 2B59B 4WI0A 4X4ZA 4NJAH 3ZKNC 2V6HA 5KVGL 1J48A 3BE1H 3HJEA 5KBPA 4L8DB 5FYLH 5IROA 2MQ0A 2MEJB 3GPEA 3QNYA 4LLUA 4NYLA 4BZ1A 5JXAH 2IANA 1AFVH 4BJLA 4D7PA 1EHLH 4WEUD 1WWAX 3VXTB 2YQBA 4QOKA 4OGYL 5A6LA 4PJDA 1MNUH 3BKCL 5HHQA 1YNLH 3PGFH 1UKSA 1PGRB 4X7FC 3TCLA 2R2BA 1M2OA 1T22B 2GFBB 1GYVA 3DETC 2GT9A 1PDKB 4G9FA 1JPEA 2PCFB 4M6NL 5CP3A 1N6UA 3CFCL 3ZYZA 3KW8A 1XTLA 3GJFH 4PCSA 5FUZL 1JYNA 4XMLH 2GSGA 3BUDA 4NUPA 3DX8B 3RWJB 4ZPVA 3V9CA 2LLGA 5CP7A 4BZ1L 5KSBB 4KJQD 3RVWC 4FULA 5C6WH 4JHVA 4NQSA 2ICWJ 5ILTL 3BKJH 1FBIL 3TFKD 1IJNA 5FS5A 5HJBA 3L16A 3QG6B 2Q6WA 3NJNA 1OT1A 4NENA 2IH1A 4Z0BL 5EA0H 1U8IA 2A3TA 3V52H 5AW9B 4BFFA 1TEGA 3S35X 4IKNA 3ILQC 3LKQA 4G6AC 3JWNC 4XBGB 3LV3B 4G8IA 3KPSA 1UKQA 5DJDB 4AT6B 3S6CA 4OZHA 2VDRL 3FB5A 4URKA 1JK9B 4KI5F 3LSOB 3D2TA 3KS0H 2TAAA 4LSDA 4Q6IC 3M86A 4APXB 2BHFA 4XC3H 4PGEB 3MLUH 4UINH 5CJOL 1QR1B 2WVUA 3EYQD 4KDTC 4CSZA 5E1AB 2B2XL 4TN9A 3ZK0A 5L7XL 3FO9B 3X1EA 4JGUA 3V4PL 4NFBA 1KJ2L 3KPNB 4WUKL 5KSAC 5LQBL 3DYOA 3GSNB 1QRNA 2FBJL 3IM1A 4BK5C 5KSVA 2Y25A 5I8OH 3TNNA 4A2EA 3F7PC 4OTXL 2Z34A 2GIXA 3VM7A 1BF5A 3MNZA 5C0FA 3CXHJ 1Z3GH 3RJQB 2IDCA 1MCFA 4NGHL 4DK5A 2R23A 3FT4A 4P2QE 4B5EA 3MX0B 1AXTH 1IEAB 2IBZX 4ADJA 5DFVD 5EZLA 3TV8A 2C9UA 1TFHA 3B5GA 1E28B 3FRUA 3KBEA 4JO5A 3EGDA 1SLXA 4FFVD 3UX9B 3OR6A 1RZIB 2VL5B 3PHOB 3Q2WA 4B9IA 3M7OA 4N20A 2Z8SA 3DVIA 5CMAA 1JGUL 5D7KD 4LCYA 4OD2A 5T1LA 2Y5QA 3P54A 2QEJA 4HUWB 1AZCA 4MCNA 4WV1C 4LFHD 2BSRB 2OJEB 5JW4N 1HHHB 3WU1A 5F7BA 1QLEB 4NI3A 4U6HA 5EUOB 5EU3B 1I1FB 4EMZA 3ARVA 2DYSB 1QPKA 4P0DA 1G9HA 4CUCA 1LEGB 3UBGA 2AABL 3T4AC 4J3XA 4GQZA 4UB0L 1QYGL 5INDA 2CBTA 2DTMH 3IT8D 5IIEB 2FJFB 4NSKB 2NLJA 1P0SE 3DV6A 3MNDA 4RLDA 1PZAA 4BFRA 1HSBA 4I1PA 4IRJD 3FONB 5FKAB 1M6OA 4J2XA 3KGSA 3E2HB 4LASL 1DHKA 2FBJH 5I6OA 5J6HB 5FYKD 3IXTA 2XV6B 4LLYA 2CR6A 2K7PA 4B60A 3QIWB 4EKJA 1SZNA 3RNQA 3HS8A 2OJZL 4ODUA 4UIKL 2LTQC 1P1VA 3K6DA 2A6JB 3THMH 1CGSL 4FZ8H 4ANUA 2WIIB 3ATFA 3Q8EA 4UINL 4GUQA 1WD8A 3EBGA 4L1SA 5D2LF 3BRFA 3JTSB 4LB8A 1G43A 4GQ9L 4I0PD 2PO6C 4DZBB 3I6GA 2AXJA 2CNYA 2WQSA 3EJJX 1BBJB 1N8ZB 2H45A 3AB0B 1OVZA 4JR9L 3MVSA 1CFNB 1AVAA 3LKOA 1EZVX 4G7VH 3RNQB 3PJSA 3LIUA 1MW1A 2DL2A 2VWEE 3WJJA 4LLYB 2XXCB 4PJAA 4H20H 1JZJA 2ZWSA 4UQDA 1GJUA 3WTUA 1DUYB 4AEFA 2FQGA 2QQLL 4X6CB 3MLXH 2PCXA 4KGLA 1U8MA 2BP5M 1CVRA 2KPWA 2QADD 4OVVA 4D9LH 2F58L 4YPGB 4BXVA 3UAJA 3NABH 3CN0A 2KYIA 5FM5O 4ZG1A 5DQJA 2H4EA 3ZYIA 4F2FA 2EYSA 2Q86A 2WBKA 2XT1B 3SB3A 5EULV 1O5PA 3MRNB 3VWJC 3SZ6A 1W0WA 3FQWA 2WKGA 5HVGB 1D5IH 1MHHA 3DK0A 1KT2B 3A6BL 4J3OC 5IR1A 4N2GA 3EXLA 5AVUB 2D4DA 4W9EC 4HV8A 3O45B 5LCVH 2JKXA 4A7QA 1BDYA 4U31A 4OD2B 5IVXF 1I1AD 3FOMA 1KLUA 3OKYA 2OXGA 1JZ8A 4JFTA 3BJLA 4NQCB 2VL5A 1NCTA 3LEVH 1CF8L 1ZLSH 4ZOEA 3T08A 1C5DA 1KEMH 3SJVD 5D2NB 4JY6A 2F18A 2WVVA 4C55A 1CGWA 4J8QA 3E7JA 4M7ZC 4P5MB 3CLWA 3EGXB 3EOAB 3OKMA 1K2DA 2ZUQC 1J12A 1PCXA 1AP2B 4XBPA 3L48A 2L04A 4FHBD 2Z4QB 4B7LA 5DS2A 3LN4B 4JZOA 2J8UE 4MNQA 3V4VB 5I1EL 5LHDA 4OCRL 1YECH 3BIKB 4PTTB 2JI2A 2NDFA 4ZODA 1KYAA 4BDVB 3ULUE 3ULVL 5IJBC 2B0SH 3LZFH 4A7GF 1XGTA 1WIOA 1WFMA 2ENYA 2E6QA 4PRNB 4JQIH 5DD1H 2QHLA 4OV6F 1K8DB 1JCKA 2YEZA 4CU7A 1G6RL 1FGNH 3IVKA 3L4WA 1F8TL 2OR8A 2J43A 2YRBA 3NIFB 5BQDA 1ZLVH 1RHFA 3FQYA 2BK8A 3ULAB 3FFOA 2F54D 3CFBB 5A2FA 2ZWKA 3ZKMD 4AK1A 1ZHNB 2HXAA 4G80A 4P57A 4FAAB 4IOIB 1TJHH 4ZMWA 3S0PA 3NG5A 4JN1L 1MAMH 5DEJA 2EH8H 2NXZB 3QEUA 4J3OH 1T0NB 4JG0H 1KG0A 2NZ9D 5DI8B 5E4IA 2I60L 1DQJB 2A4ZA 3AG3B 2K8QA 2YJQA 2IGTA 4C56B 1ADQL 3OR7B 4M4PA 3IFOA 3D06A 5FYKH 5ADPH 3OX8A 3B2PA 4RGMC 3QORA 3HE6B 1F3RB 4G8FA 1SJMA 3ZO0A 3C08L 5LDSA 5KJRL 1TDQA 1FO0B 4I18C 5FO9A 2R27A 4ZO6A 3C5JA 5ABDE 1CPUA 1G4RA 4GRMB 3OF6D 4IIQB 1I9RH 3DSNB 4MZ3A 5EOTA 2PPAA 4BA0A 3MGTA 3DO7A 2A9ML 1AGCA 3BP6A 3KPRB 4GSQA 4ENED 1YY9C 2LVEA 4MXQC 2AJXH 2N7AA 1YVLA 1N2RB 2ZUSA 2DKSA 3IJYB 3QHFH 1SOKA 3V0EA 4F5CE 3F58H 1JF5A 5F70A 2HSIA 2HUEA 5HHNB 3A6CL 3AGVA 3MV11 2G3MA 4NI6A 4NYLB 2Q2EB 4P2OD 4QXTA 1PW3A 3QIBB 2NY3C 3GSRB 4XAWH 2YR3A 3KPMA 1ZWIA 5E8OA 2FSEA 2B39A 3RVVD 1GIGH 2YZ8A 3L5HA 1AMXA 1UH4A 2DBLH 4HX1A 4OD1H 1VADA 5DRNB 3WE6B 1SN2A 3TO4A 4A1RA 4JKNA 4U1IA 5CWSB 2Z8WC 3MLTA 3H2WA 5CJXA 3D30A 4MD5B 3HW7A 3CQPA 3MLUL 3C6LD 5JYLA 2VLLA 2R1WB 4U1NB 2XIDA 4UNVA 2EDDA 1AHKA 2JI1A 2PN5A 4L0PB 4PRPA 2VW6A 5E5RB 2UYLB 1KJ2B 3ML9A 3CH1A 2V8LA 3NCWA 2IDSA 5GRUH 3WE1A 4DP1X 5LNGA 1F97A 5FX3A 2F5AH 1J11A 4ORZC 2ITEA 3QULB 2VZ3A 2VMEA 3CPLA 1P9MC 3QUKA 4G43A 4EN3B 4L1DA 4E5XA 2VXVL 2ZKXA 3KWXA 5AL8A 5L9DH 1L9NA 3S37L 3IPEA 4GMTL 5E9DD 3FU0A 1KC5L 5EZJB 3VGDA 3OJMB 5LBSH 4NQVA 2EIZA 1IBGH 2CBOA 4KROD 4ZD3H 4YHKL 1NFIB 1OGAB 2OJZH 2QMKA 2R9HD 5DHDA 1MFMA 2HA1A 5I8KL 4HJJH 2AJUH 3LPOA 2BRQA 4NKIH 2GG1A 3S4SA 3ZO9A 2H26A 2PO6A 2WMPB 1F13A 4TPRH 2VDMB 4CC4C 2YMXL 2APXA 4HPYH 5FGSA 3ZHDA 3SQBA 1AGDA 3OC5A 1BV8A 4JG9A 4YFLF 3MOBH 1UGNA 1AZRA 3QH3B 3MBEB 1OAQL 5GGTH 2DI7A 3X17A 2BDNL 5CXPA 4DN3H 3PP4H 3AS0A 2G60H 4Y5VB 1IVLA 2W65B 3SEPA 1NEZG 1T7YA 3BZDA 1NANH 2J8HA 1GOGA 4WV1A 43CAB 4ANWA 2LLNA 1A1MB 1OWWA 1FNGA 3PXLA 3DO4A 1PSKH 1PYWB 3KWVA 3D50A 4OF0A 1K3IA 3JUZA 5ICXA 1NKRA 2OMZB 5CGYD 2JIXB 3OBAA 4ZAKA 3W38A 3H42L 3IK2A 3TA3A 3ABZA 2NTSP 1MIEH 1A6UH 1E27B 3U4EA 4HUVA 1OAYL 2MRYA 2C7UB 3IFPA 3SGJA 3BE1L 4E41E 3ZTNH 5I2IA 2C9QA 2JCWA 4IGBB 1DVXA 4Q0XL 1T1ZA 1G7JB 4WUUB 5HBBA 2IANE 3NN8A 3GLAA 4JREB 2NY2B 5FM5M 1MI5D 4Y2DD 3F05A 3RB7A 5IVXA 1XB8A 3DDFA 5FDWA 4A2FA 2ETWA 3E9TA 2R29H 1A4JB 4LDOB 2ZUTA 3SBWA 4KZ0A 2P5WB 3TT3H 4R8WL 3EJYC 5HDBF 1BA9A 3KPLA 4AZ8A 5KS9F 3VVWA 4LPWA 1D9KB 4ZXBA 2YD4A 2J12B 3ULUD 4E5XG 4KKZA 1FDLL 1OLLA 4JO1H 1ZLWK 1T03H 4L9DA 1NMBL 4AV5A 4NOFA 1YCSA 3MJ6A 3RPIB 5KEZA 2WXRA 2R2CA 4FNQA 4F2ME 1EXHA 1CD0A 4JMNA 4OSUH 4BQ9A 3MV9D 1HS6A 1C5BL 2HJLB 1OGAA 3CQQA 1GS7A 5AOLA 2N59A 5D1XA 1AS7A 1KGWA 5E08H 4FMKA 1GSKA 3KXFA 4MNHB 1OAJA 1H3GA 2P48B 2IEPA 3N1GC 4GIOA 1S7RB 4DESA 2RQ8A 2WXIA 3DSNA 2V5MA 5EOTB 5I1JL 3MCLH 4PS7A 4JY5L 3QAZC 1QHPA 1DVSA 1SYVA 3FQTB 5L0QC 3EFDL 4ZMAT 5IB5A 2YWZA 4OGZA 4LCWD 3GSOB 4NDMB 4S1DC 3V4PA 1LO3H 2PYEE 4JDZB 1UXSB 4AQ1C 1JS4A 2OSXA 4H1LG 5FUOH 2BOBA 4YE4L 5D7IA 1X5KA 3MJ8A 3BVNB 4DT2A 2ZUQB 1JUFA 1BAFL 1TMCB 5JW3L 4L8CB 3AY4C 3EYFA 4X6FA 3VRLF 5JR1L 1A14L 3MDJA 3T1WA 4K3DL 2QBWA 1KBBA 3QUXA 1ZHNA 3V2AR 3O4LB 3PDOB 4AL8L 3KL5A 2YA1A 2PWFA 2WXQA 3ECVA 1I7ZB 2VN5A 1BFOB 4AITA 3BC9A 1NINA 3HNTL 4L37B 3ZGIA 5J57B 1CI5A 1CVSC 3P9MA 3B37A 5DLML 1V7MH 1TUPA 4DW2L 4FYRA 4LIQH 1NC2A 2F7PA 4ERSH 2WLYA 1TZGH 2X2HA 2IIJA 3NA9L 1EFQA 1KTJA 4GYBA 3NJXA 3US1A 2Z91A 3QG7L 1QUNA 2A4EA 3EYUH 3SKNB 2C34A 3MRBB 4LVEA 1E4XL 4JQXC 4FQPA 5ID0B 1LDPL 1AZBA 2NT1A 3H9HA 3H9SD 4CSTA 2VSMB 2YWYA 5JHMA 4MMXA 4IBZA 3SYCA 2H8PA 4F93B 4JJ5A 2FJSA 2B4CC 3MBXL 3EOAA 5FECA 4YPJA 1M2VA 1OQOA 4NKDA 3DTDA 4L3FA 3TEYA 2VXTH 4K94L 3PUUA 3NRPA 4ONFH 4PMFA 2IAND 3V5KB 1VA9A 2OMTB 3O3UN 5KYXB 3WY1A 1DQTA 2VLKE 4R9HA 2J1WA 3W9DA 4FQ2L 1JNHA 1N0LB 2K3TA 3JV6A 1GA2A 1M6UA 2HLFD 4YBQD 2BSED 3SY0B 1HXMA 5HVWA 1S7QB 1R47A 4N8VA 2AEQL 2A6IA 3R0MA 3FQTA 1QSFA 2X6AA 1PG7X 1Z2KA 1A0QH 3GMLA 4HBCH 5SWSE 3ZRCC 2DD8L 2MPVA 3QR1A 5GJTL 3BAEL 3BKJL 3GXTA 5A16B 5MHSE 4UV7H 4LBEB 3BPCB 3JWDL 3LHPH 1INQA 2ZONA 3N0PB 9PCYA 1T4WA 3KXFB 2XZCL 5K5YA 5AW3B 4EN3D 1U93B 5F1IB 1OWRM 1KSRA 2HX7A 2B9AA 1UURA 1PD1A 1MEXL 1AFVL 1TIUA 3MRMB 4HWEL 3ZTJH 1K8DA 1JRHI 5AB9A 1IGFL 1U8NA 1I3RA 3VWKD 2VLKB 4XPAL 2IBBA 5J6SA 3QEQD 4Z0XB 1INEL 4PYHA 1Z66A 3OKLB 3WUZA 4C58B 2P24A 2ZWZA 3C6LB 3LZRA 2HLAB 3EOBB 3ARFA 4D0BA 3HBQA 5BV7B 1L9MA 2QLYA 12E8L 5CNHA 2VABA 3OG6B 2R8SL 4FXGC 3VQ1C 4MXWL 3DVGB 4MCYA 1S5HB 5E00B 1VFOA 1RSFA 5IVXB 2UY6A 5KSUB 5KS9B 2XX1A 5JHDA 1SN5A 3GHPA 2QGEA 4TNWK 4K5MA 4L4VD 4XBEH 5FO2A 4Q74A 5I2IB 3NACL 4YGAB 1TETH 2CDGA 4D9QD 3GS4A 2X88A 4X9IA 5AKSA 2BO0A 4HGWA 4ZUVB 4H5SB 1EMTL 1JTTA 1OTUC 4YHYC 4K5OA 3FC8A 3HB3D 1A9EB 1X9RA 3HE6C 3L54A 4A6YH 4Y5XC 4MCMA 4IBQA 1GH7A 2K6WA 5HYJA 2NTFA 3NESA 2NT0A 1OGPA 2FH6A 4P2RB 2OMVA 4CMMA 1CS6A 2Z92B 4GFXA 1OSYA 1TKWA 1JN6A 2KZBA 3TYGL 3VXUA 3BEVB 1XGYH 1FRGH 3O9WC 4HJ1A 4YHMH 3S36H 4H5SA 2NXZC 3D3VB 4F5CA 5EU3A 3U2JA 2BNQA 4I48A 4CMHC 2EH7L 4R0LA 1IIIA 1HHHA 4Y5VC 4NN5B 3VMNA 1WAAE 4LL9A 4G8EA 4XRCA 2HH0H 4BSVB 2DJSA 1NBVL 4HUWA 3RGVB 3S5LA 5CF3A 2R4SL 4RFNB 2WK2A 3L9RA 4XMKH 5J89A 4YDIH 1CBVL 4ONOA 4QRSB 3LKRB 3QEHB 1P7QA 5J13C 1IKFL 2WBJB 1NC4B 1AR2A 1MJUL 1NWPA 3BZEB 2X44D 1JGEB 2HJFA 4YAQB 4JFSA 2Z7ZA 4FA8A 3QARA 4O51A 4XP1H 5EB9A 2X3AA 3GNMH 2OMWB 4MNGA 3N44B 1E6JH 2DWXA 2KLSA 3OQ3B 3G6DH 4PJ5D 5TH2B 3WIHL 5IBTH 5J6HA 5LUMA 4KTGA 4AM0Q 1PIFA 5DVPA 5SV4A 1MCJA 1MWAH 1CLVA 3NEOA 4G42B 5JIMA 5KSVB 3D1MC 4DUWA 2RACA 1KPVA 1FYTE 4XN2A 4IQHA 4WTXA 3MV8A 1S9YB 3Q9PA 3NUKA 2IWFA 2XN9A 3T0EC 4AQ1A 2D3LA 5FK9A 5KUMA 5F9WC 1P7KA 3MREB 1QQDA 4TUOB 5J3HD 3P3UA 4DAGH 4IBWA 4IBLT 1RJYB 4KK8D 3X12A 2EDKA 3QXTA 1XGPA 4ODTL 3MROB 4FXKC 4POZD 4GO6B 1XF2B 3SBQA 5KYXA 5ICYA 4FTVB 3QUXC 3V5KA 1S7WB 4QXTB 2LU7A 3LKQB 3W2DH 2BS9A 5F8RC 4MA7H 4ZTOL 1M2VB 1WFJA 4NKDB 5CIPH 5DA0B 4TNVK 1YPZE 1GL4B 1J8SA 2QZQA 2DPKA 4G8GE 4FTDA 4H25B 5DTFA 3GRBA 1E4KC 3HZVB 1A6TB 3DJ9A 5ISZD 5C0CD 2GBAA 1FN4A 4NQUA 2OX5B 1LO5A 4ELDA 2YPLD 2R23B 4Y19D 3AXLB 3DHJA 2YGPA 5KW9L 2QKIC 3GO1L 1FO0A 3I9IA 2DY2A 3MUZ1 3LKNA 4G8FB 1GOFA 1E6JL 3MYJA 1DQVA 2CK0L 5DZPA 3WNPA 1UB5B 1RZGB 2A9CA 1JZDC 3UTOA 1T22A 3IGFA 3K2MC 3NCJL 1QRNB 2FTAA 4QCIA 4I8DA 2KZ1B 2F2HA 1XZ0B 2DJUA 1E5BA 3KPNA 4F92B 1QTYT 4FYQA 4O4YH 4M1DL 2KPNA 1I7ZA 4B53A 4KKPA 5CZXC 2QGCA 1TQUA 2RR3A 2GHZA 4PPTA 5DD3H 1OPOA 3LZPA 3I84A 3VI3F 5IEKB 3BUYB 2RMNA 5EUKB 4MQ7A 4ZPTA 4PV8A 2YGVA 4RAUB 5MHSD 1GGIH 1T0OA 2Z7YA 3S3PA 5HYJE 2CLVB 2V17L 2GJZB 2LFGA 1KC5H 1S9YA 5I71B 3MJ9L 5DK0B 3VFUB 3G6JE 3PF2A 1DSFH 4YFLI 1JMZA 1ODAA 5IV2B 2O6EA 3Q6GL 4GRWB 2OL3H 3AACA 1UB5A 2HVJB 4G7VL 1OXYA 2G9KA 2MCPL 3RYMA 5IB5B 1NOAA 3D09A 4B5ZA 4W9DC 1G9MH 5T5NF 2R2EA 4ERSL 3GLDA 4Y1AD 4GOSA 1J1PH 1IAIM 3AADB 2QQLH 4JFDD 2EO7A 4O51B 4DW2H 5C9JB 1QFWH 2XY2A 4NQXB 4DKDC 2DAVA 1U3HC 3U30B 4UI2A 3HRZA 2OLDA 3MRIA 4JFVA 5CSZB 4LEBA 5IMKB 4KO7A 4QTIL 4B6ZA 2WAQA 4MA8H 4I0PC 4OZIE 3IMBA 4O9HL 2YAFA 4YQXH 5HHVH 2FB4L 3CSGA 3HIZA 3OLDA 5KJ4A 1BMGA 4FFZH 4GXFA 3G5YB 2FRGP 5DZVA 3ZDWA 4DEPB 3ZZ1A 3VXMA 4JUSA 4NO3A 1JHTB 2J25A 1J8HA 1YYML 4S10A 2EC9T 1YEIL 4QXWA 4ZZFA 3QCTL 1GSMA 4X99B 1E9QB 4LSSH 3CZEA 3I75B 4AYEC 4CGTA 1JN6B 4X8GA 1F02I 1KIPB 4ZNEE 5EZIH 4FCHA 3T65A 2P80A 1GGIL 2V5RA 3DIFB 4WFED 4WFHD 1IEHA 1HZHL 1F45A 1NOFA 4LAQL 5DS8A 5GIRA 3BP4B 4H8WL 1A6VH 3CZKA 2A74A 3FBQA 4FG4A 5CFAA 1PZBA 4RGOH 2OCCB 3RWDA 1BXVA 3LXUX 5TH2A 3LRSB 1KIRB 5BOZG 4BCXA 1JZ5A 2V7HA 4UUJB 1U8HA 3CIQA 3HC0A 1G7IA 2AVGA 3A67H 5TDPA 2HJKB 1WCQA 2WD0A 2ZXAA 1NMBH 3GEWB 5B4MC 5KVMC 1MOEA 1AQKH 3DXAB 4UQ3A 1X7QB 4W6XB 5LBGA 3TF4A 4MD0B 8FABA 1T6VN 3W56A 5JHDB 4RRPG 1F8TH 2XXMB 5B3JE 4F15C 1IGTB 1RIHH 4RA3A 2W65A 1T2XA 1NEZA 5J8OA 1KCSL 3NCYS 2R51A 5JIHA 4BSJA 3FFDA 3NP3A 2YKLL 3OM3B 2DM2A 4ONGH 5E2TL 12E8H 3L7FB 3P2TA 3ARDB 2J56A 5GJSH 1KY6A 2E6JA 4MD0A 1WTLA 3G5ZA 2D7TL 4IW4C 4OCYL 2J1XA 3GSXA 5DHYB 3RDTD 4AC2A 1H5BB 3U36B 5LO7A 4FJ6A 4OLZL 4DO4A 4WWKD 5AYQA 4AMKL 4PB9L 3LQAL 4BKTC 2VLKA 4JLRA 2VAJA 1DTUA 3EG9B 4YHIB 5I1KL 3VI4B 1KCRL 4HIXL 4J3SA 4U3HA 2J8OA 3E38A 3EDDA 4NJAL 2VDML 3WD5L 5IMMB 5HSFA 2NLJB 3DV6B 2UX7A 4R2GC 4YDKH 5IBTL 4LF3B 1SY6L 3NJIA 5IEHB 3HI5L 4KI1A 2XVKA 2IALB 3MKGA 5D4HA 1J0IA 2QL1A 4IKKA 1MCIA 5I5IA 4PJEA 5JIIA 2VJ0A 2ZCHL 4PLJC 5J6GB 1LTXA 2FGWL 4MA3B 2BNQE 1R6VA 4ZMXA 5KN5B 4Y5XB 3OAZH 1TG8A 4YSUA 1D5XB 5C2BL 7PCYA 1KENH 5I30H 5HI4D 2E7DA 4DQOH 2ZF8A 5TK4A 1UD4A 5FUCE 3CFDA 1BQ5A 1YEJL 3TIEA 1WZAA 2E8YA 2BM3A 4AQ1B 2AAVA 2EIEA 2QTVA 4KQ3H 3AABA 2ZOTA 3MLSL 4M7JL 4ZTPH 4E9QA 4H88H 1NANI 1NCGA 1S7TB 2X4PA 3V6OC 4AQ8C 4PI0A 4GJTB 5HTSA 3HI1A 4G42A 5DQDH 1KV7A 2VR4A 1KGUA 4XCFL 5J1AA 1RMFH 2ODIA 4Y19E 2D0GA 1ZWIB 4I2XB 4MS8C 4PLKC 3DURA 5I6XB 1BLNA 3FMGL 3X14A 1S46A 2IBGA 3HMXA 4K5LA 1U8NB 3A4EA 3GMNB 5KVFL 1UWEL 4N6RB 1UD3A 1PKQB 3GDBA 3PNWA 4FZEL 3FU7A 1ZT7B 3GSVB 3OLIA 3R1GL 3ME0B 1CC3A 3BD3A 3RZCA 1KJVB 4PHXA 1AANA 2YRLA 1UUSA 2ZSWA 2GI7A 4HFUL 4R5VA 4L37A 4AKQA 3SDXE 4F7KA 1CGYA 1SXNA 2PLTA 5TD4A 4FE9A 3OJDB 4G2AA 4I3GA 4NNPH 4RSYA 4JFOB 2EUZA 1TQWA 3Q3GA 4DGIH 1DE4B 4PJFF 3PDOA 5D2LE 4LEOA 1P5VB 2ICEA 2VITA 4IU2A 2OA9A 5IF0A 3POCA 5KJ7E 2VDLB 4K8RC 4OZGE 2XVGA 2EXWC 2W5PA 2ZXBA 1N0LA 2PR4H 1H6UA 3EYFB 3HHRB 1TZIA 4RGNE 3D3VA 4M61B 4PG9A 2EXYD 2AK1H 3ULVF 2X4NB 4HUUB 2AF2A 2CGYA 2OTUA 5FYJU 1UFUA 2WCPA 4LO9A 2RB8A 5F7AA 3PQYD 4JN2A 2JJVA 3FH8A 5DT1H 2NXYB 4FNUA 2ATAA 4MMXB 3CH8A 1EJOH 1MJ7L 3UJJH 3KAAA 4EIGB 2FO8A 5ID0A 4ZX3A 1CB4A 1JNLL 1WITA 4UTCA 5JOFB 1B2WL 3WIHA 3GUTB 1TVHA 5B22A 4AJVA 1F42A 4I77H 2C5DC 1NGZB 4RBPH 5FM4A 3V0FA 5C0IA 5TGBA 3IVKB 4KTDL 3TV3H 1WYJA 2ADFL 3KH4A 1G9NC 5IK3A 1J88A 2O30A 1X5AA 2W81C 1XBRA 2A0LD 1FBIH 4APQB 2AV1A 2JKSA 4R4BA 3ULVH 3BEWB 5JW3H 3WGUB 2P47B 2RHEA 1HC1A 2X2IA 2KMWA 5FYKL 4AQAA 4DP0X 1USZA 5ADPL 1XF2A 3D4ZA 1W80A 4JM2C 4J5VA 3K74B 3B8YA 1UEYA 4YHZL 2LAGB 2FWOB 4P46D 4XOAA 3CPUA 1IGCL 3N41B 5HXMA 1SMOA 2P8MA 4W9HC 4HHGA 4M1DH 2DLGA 4A67A 4WENB 3FMGH 5E2VH 5FDWB 1HHKB 3H0TA 1UVQA 3CSYA 3LKSA 4HWZB 1HQ4A 2DLIA 4FFYH 4XCCH 1FC2D 3NJLA 1TTFA 3MUJA 3IDXH 1UZ8B 2Y72A 1SDDA 4TSCH 1AGFA 1KJ3H 4MD4B 4RIRB 1NC2D 4L4JA 2AAAA 5FFGA 2R83A 1AR1D 4HBQA 3VXSB 1Z9PA 1SY6A 3LN5B 3VI3B 1KLFB 2CM6A 9CGTA 4N2HA 5IQOA 5D1ZC 4FP8H 1JV2A 2EVGA 1BZEA 4XH2B 1A1MA 3HBZA 1JL8A 4HJJL 2AJZB 2F54A 3E1ZA 2PPCA 1OP3H 4XN9A 3EJSA 3Q5YA 3TVMC 4CU8A 3F6LA 5B3NA 5HHOD 5DLMH 3WTTA 1G5AA 1CE1H 1OF2B 1VPOH 2O5YH 1CGUA 4N5ED 3KPQA 2CKNA 1XGUB 3GJFA 3MBWB 1D9KA 2NXYC 1NGPL 4PHZA 1CZ8L 5H94B 4HAKA 3LQAC 4JR9H 4AV0A 1F56A 1J8HE 1E8YA 3ET9F 3ZE1E 3QPKA 2D9CA 2JV6A 3M1CA 1H3PL 2Q5BA 1G4MA 2BSEA 4I3SL 2XTLA 4LSTL 1N59A 1BZ7B 2X9YA 2X38A 5C0BD 4Z7NB 3FB6B 3UYRH 5MEQA 3A6BH 4P06A 2KZWA 3O41A 4PRHB 1QHQA 5JHLA 5LBSL 3NN8B 4U1GB 4CC1A 1Y18B 1NCNA 3FB8A 4IGBA 2NR6C 4XNZB 5J06A 2WNWA 4MAYB 2PP8A 3O4LE 2SEBB 3Q0HA 1HL4A 3UTPE 4FNLL 1UWXH 4G43B 4EN3A 5I9QC 2VR6A 5E70A 5A7EA 1ICTA 4PU2A 1PCSA 4MWFA 1K85A 1WICA 2V7NB 3WFBH 5I74B 4B9ZA 2X3CA 3QJTB 1PLCA 4XI5D 2Y2TA 2PMZA 1M53A 4V11A 4M1GL 2WUCH 3NAAL 4ZUSB 2IAAC 3EJTA 2VN3A 3L4CA 4S1DD 4HCRA 4GPVA 1WH0A 1SF5A 3QA3B 4N3TA 1FFTB 1IE4A 1HE8A 1ESOA 1XGRA 1OARL 1JI2A 2LT9A 4GKOA 4U33A 5EBWA 5EHFA 3SGDI 3HC2A 2F7QA 1K4DA 4FRWA 1GXEA 2BINA 4Q6KA 5IKCB 3IMWA 2AQSA 5LB1A 1HHJA 1I7RB 8CGTA 1AGDB 2IJ0C 25C8L 3T2NH 3U79A 4NWUL 1R3LB 2ZUXA 2DF3A 4WU5A 1R3JB 4JDZA 3ZKND 2C3VA 3C5XA 4FJZA 5DFAA 1X5FA 2DMKA 5AWNH 2FL5A 4DKFL 3V6OA 5T1LB 2D7MA 3EXJA 4OB5H 3UTSB 2FX8L 2GUOB 2XRAH 3FT9A 3LQAH 3WKQA 2YA0A 1F0LA 1TCRB 2C9SA 2RD0A 4OLZH 1EHXA 2ISDA 4IKIA 1VZHA 3KR3H 3ENEA 2J6EH 2YPKB 4H44C 2YXFA 3H9SB 3MRKB 2OK0L 5T8IA 4NQEE 1G6RH 1MFBH 5BOJA 4PJXA 1QSFB 4JZJA 5C0FB 1AKJD 2RFXB 4TUJB 1Z0MA 1KB5L 1FVCA 4H8VA 5BRZA 1BYPA 3VXQB 1MW0A 3BWUC 2MOVA 2NY6B 2J21A 4PWGA 1ZK5A 4RMWA 1DJGA 2Q76A 2XZZA 4HT1H 4XP9H 2FATH 2HLEB 4XB8A 1M57B 1KNOA 5BUAA 2JCCE 2AITA 4HS8H 4KRPC 1XAUA 4YDIL 3HI5H 3D51A 5HVHB 1OAYH 2W60B 1MWAB 5AZUA 3P77B 5DRXA 4G7SB 2DOCA 2YEVB 3OB0H 3KNBB 4FLSA 4MZRA 4OIBA 5DUMH 2DB8A 4PJEF 2Q8AL 4N1EA 4RETB 3Q6GH 1RZKL 5HHOE 3ILQD 4G6AD 1AD0B 1J0JA 1J1OH 2JQZA 2DS4A 5DWPA 4AQOA 5E8NB 4YBQC 5C0RH 2ZZUT 2RH0A 3RU8L 4FKEA 4H88L 1HWHB 3WN5A 1BVLB 2XETA 2BPBA 3W5NA 5GGUA 1T7WA 4W4NA 4GUPA 4ZAKD 2PTVA 4K7PX 3H3PH 4ZS6C 2WCSA 5KSBF 1ETJA 4X9HA 5C0BE 4BM7A 4FXTA 1JV5A 4QJ4B 5DURB 2CE6A 2UZIH 3HG1A 2Z93B 3JTTB 5ACZB 4MXVE 1ZEAH 2DQJH 3LZQA 3HR5A 2NY3B 3IB4A 3FW6A 3IN0A 5EIIA 1DQLL 4AGLA 2YPVH 3DVNB 3GMRA 3KHQA 1NIBA 3QQNA 1KBWA 3WEOA 1WBYB 3F7RA 3AROA 2XN9D 3AAZA 3DHMA 2NY7L 2WYTA 3HE6A 1QSEA 2V2TB 3EGSB 4RRPM 15C8H 3W81A 3C8HA 2XXGA 1F6AB 4OF5A 4OZGA 3LX9A 2BCKB 3RFZC 5EOCH 3GMQB 4UT9L 4F7MA 4YL4A 4ZS7H 3WS3A 1EHLL 5CGBA 3LEVL 4KKAD 5D9SB 1CF1A 1FZMB 4E2OA 1PAMA 1CDIA 4NQDE 1AACA 4NQCA 3VXTA 3HPLA 4TS6A 2Z9TA 5HGDA 4XCEA 5KBMA 1SVZA 1L0PA 1NCCL 4KK6C 2HX8A 4NPYA 2GTZB 5E24E 3JWOH 3VFOA 4BUHA 2R15A 5CR8A 3B2UD 3SE6A 5DVNA 3IMVA 3KW7A 4WI0B 3ZYOA 3A67L 4RESB 4GLRH 1OIOA 4M8UA 4YO0B 2GSMB 5I19L 1UYWH 4UMSA 4N8CL 3DIVA 3GF8A 2XTJC 1KTKE 4MNHA 1DEEA 3MPCA 1P4LB 3R18A 2G3XA 3W39A 1JG9A 2WXNA 3RNKB 1WFNA 3WEMA 5EH1A 1T2QH 4PRNA 1XXFC 1MHEB 4RDQF 4EIUA 4RAHA 3TGXA 1JPST 5CN2A 3ZGHA 3FT2B 1F3DJ 4IRJC 1LQSR 4H20L 4FMFA 4NO0D 4P04A 1RUML 1UEMA 1CICA 4G6KL 5DJ8B 3REWA 4KK5C 1EBPA 2JKIS 4IKLA 4HS6A 4RAVB 4P2QB 4HXBL 1XF3A 4Z7WB 4DOHE 5MP6L 3IE9A 4MX7B 4OD1L 2BP0B 1NFDF 1R19A 3ZDZE 6FABL 5D2NA 1ML0A 2BHUA 2GTZA 1URIA 3RIAK 4JO3H 1NJ9B 4N0CC 4FADA 5E2UL 1B4JH 5CGMA 2PO6D 1TMQA 1KBGH 1X4ZA 1ONQA 1NIFA 2ED7A 5KYWB 3FO1A 2ZPKH 3IFPB 2B15A 1RU9H 2D3JA 2OTWA 3GBDA 4JY4B 1UCBL 1NCWH 4FEMA 5J9PA 1XSOA 4N2KA 1S9VB 3NCFB 3EGSA 4B3VA 3G6AB 5D6DC 1IM9A 3K71A 5JNYB 4PJBB 3PWLA 3C5JB 3IBOA 3DX6B 3KHOA 3DVNA 3FT3B 1SN0A 5IFHH 5L4IA 2A1WH 3CLEL 1Z9OA 4HIEB 1BM3H 1JFHA 1KENL 3ZE1F 2KQMA 2EILB 4I5BA 5CKGA 4UNUA 3N2JA 1K4CA 1RLWA 3T0ED 5J12B 4XBEL 4KPHH 3NJFA 1T1WA 4OCRH 3G04B 3VWJD 1MCCA 5A2IH 4KX7A 2BSRA 1TU2A 1FGNL 5D5MB 2H3NB 1UWGL 3O0RL 4KJYA 5DD1L 3ZX1A 3VO0A 4XNQB 1AHWB 3NVQA 5DD5L 5DUBB 4IU3A 4PJBE 4Q2ZB 4EPSA 4X7TA 1HZHH 2OW7A 2IFFL 2ITDA 3VXUE 1XR9A 3N50A 2B4CL 3CVHH 3PHQA 2Y07L 1JNNH 1ZY9A 3FCBA 2YK1L 3UAAA 3GSNH 2W60A 4Z76A 3NFNB 4HF5L 2L7QA 4PBVC 4ZUTA 4NQDA 2UZXA 5FAAA 5IT2L 1A64A 1E40A 3H3BC 3QIWA 1J9TA 3HHSA 1G9NL 2WLIB 3KYKH 3T0WA 2OZNA 2PKDA 4DPBX 3Q44A 3VFGL 3LXBA 3NDYE 1FLTX 3IDNB 3QC6X 3ERXA 2M8XA 3LN4A 3V4VA 1SMAA 1X5LA 3DJZA 4AEHH 2DZEA 1CFQB 3WFBL 1OAKH 3WN6A 3HMXL 3CDZA 3UIYA 3RNKA 1QLRB 5C0CE 3OJ2C 2E9JA 4KY1H 2JJUA 2VZ1A 3S3CB 3WXWH 3PHQB 4JY6B 1IAIL 3VU2A 5IHUL 4YXLH 3TA4D 4AGQA 4OZHF 4H8HA 4GAYB 4HKXA 1R33A 2G9HB 5T1KA 3U0TB 4HCRL 1IB5A 3OKDB 3OLGA 4GW5B 1YNLL 3X1GA 1OSEA 1U3HA 5JHDD 1I1AA 4U6VH 4YLCA 2YN5A 3T4AB 2F53A 2Q7NA 3G6DL 3HN8A 3QIBA 2YO3A 4UV4H 3TWCL 4YX2L 4GAAA 4LEEA 1KCVH 3RWIB 3ZKMC 3ZMRA 4J8RB 1A4AA 2MTPA 3F7VA 4XMUA 4X4KA 2CUIA 2XUWA 4G9FE 1FZMA 3AG2B 1PX8A 1Y1UA 5LBSA 4JBSA 1ASQA 2NZ9C 1LEKA 1DJXA 3PABB 5ABZA 2PABA 1X9LA 2MOQA 4A7SA 4C4BA 3T6XA 2AANA 4B9KC 3CFMA 15C8L 5I1GL 5LXGL 5KSBA 2VXTL 3ILPA 1OP5H 2NUTA 3K5SA 2JQMA 1MVYA 3O9WB 1TZGL 2X7LB 4LXFA 2BX5A 1BXAA 1ZMYA 1A7NL 1OAZL 2D0HA 4V1DA 1WGOA 5C08E 2XV3A 1OAUH 5K9OA 1VGKB 4J3BA 5E9AA 5GISL 1NPJA 3WFCH 4DKEH 3FTZA 3AQXA 3RILA 1SBBA 1UZ6F 3FH7A 1EV2E 2FX9H 1SQMA 2HCZX 2WJ5A 3HS0A 4JAMB 4TVPL 3HG1B 1AD9B 3OR7A 3L7EA 4RNRB 3OVUB 1Z7JA 4S1RL 5HPMA 3NZHH 5I1KH 3FT0A 2VUKA 1K72A 1NEUA 4O5LL 2ENPA 4HMEA 4TXVB 5CILL 1CG9A 1ZLVK 5E1AA 3NT0A 3IDXL 4W9JC 3U9UB 2VXQH 1ORSA 1AHWA 3WIFB 3DPBA 5C3LD 1PKOA 4AL8C 2XA8L 4EQ2A 2DQIL 4W9ZA 3KG5A 2Y7MA 1UOKA 1ES0B 4X5PA 3A3YB 5DEGA 5MEOA 3W9EB 1AOZA 1J9SA 3S96B 1OB1A 1ECYA 3QI9A 4GBXA 4DAGL 3RFZB 4QUOA 3ARSA 3ARBC 5HHPA 1NLBH 3RTLA 2HWZH 2XN2A 5DMKA 3GB7A 1XEDA 3APDA 1JPSH 2Y1AA 4KAQH 5TDOB 5HYQA 1O9VA 1PKQE 4PRIE 3VFWB 3BVTA 1QEWA 5AAPA 2HB0A 5JW4M 3OWRA 2QMJA 1WTGT 3BIKA 4PTTA 1ZANH 5DD3L 2CALA 4PJXB 3LAFA 4M9PA 2A9NL 4PJBA 1VEPA 2Y7OA 3KVQA 4NN6C 4OGAD 3EKCA 1L9RA 2WNGA 4YQXL 3JXAA 1TJIL 5K1NA 3MFGB 2EE0A 5F7YC 1H5BC 2ZJSH 5J9PB 5I1LA 3LPWA 4JG0L 5GHWL 2JELH 1PQZA 2VUOA 5D96C 3C75A 5KYNA 3J07A 3D69B 5D7LE 5DZAA 5JIKA 4BKLB 2WKOF 2EDHA 5FA3B 1S9KC 3EGDB 4KQ4L 3CSYB 3O6FD 3GJEB 1HIML 4JKMA 1IC7H 1RXLA 4F37F 5GS3A 4HLZG 1N67A 4PP1D 1HHJB 3TWYA 1RLBA 3WMQA 5IKCA 1IVTA 2NYYC 4LCVA 1IRAY 1M05B 1CURA 4JS7A 5ESQA 3BMVA 1BXUA 2EEBA 2GJ6E 2YARA 5FYJL 3QSKB 2W9LA 5EWIL 2ZXGA 4NC1E 5AD0B 3BGMB 4UU9B 4LHUD 3MLRH 4HC1H 5DZLA 1ZXKA 5CFHA 2PTTA 2W1NA 3II2A 5E8EB 3QUYB 3ABLB 5AOMA 5EBGA 5J5EA 2ZCLL 3HS0C 5FGCB 1U91B 5DJZB 5E9DA 4WWID 1WV7T 3Q1SH 5HY9A 5SX5K 5L88H 1J9CT 2BZDA 3NSXA 2ESVA 4MCZA 1VSCA 4P46A 3QUML 4NKOB 1E9OA 4Z3IA 2WBJD 2Z31A 3KM1A 1XF5A 5HI4C 4DEPC 4WW2B 1MCNA 5H4YA 3ZDYE 3VXUD 1UM5L 4JGMA 4K4KA 5KSBE 1SM3H 5FDYA 3KNBA 3B9KA 4XN7A 1VGEL 2FUQA 3OHXB 4LKXA 1DBMH 1PLGH 2XOTA 1QVOB 2ZP8A 3GXFA 3NTCL 2IXQB 2A77H 5JQHC 1YJDC 3GTVA 2FT7A 1PMYA 5IESL 1H6EA 1TQCB 3SDDB 4A7TA 2EUXA 1PY9A 1GVIA 4OM1L 3T5WA 4KY1L 5GJTH 2YMXH 4HPYL 2G2RA 3WEXA 1YMHB 5EO1A 1HJCA 3QQ9D 5FKAA 5CBEA 4GRLA 1HESA 3GIVA 1FLRH 3K81A 3VG0H 5MERA 4H1LA 1MEXH 4HWEH 1SUJA 1I9IL 4D0DA 1PJ9A 2JCCF 4WFFE 2JJSA 3NK4A 1FG2A 4J23A 1AIFB 2A83B 4GXUM 1E4XH 1A3RL 1LO2L 4XX5A 4XMXA 4OGQC 5FW8A 6FABH 3PWVA 4N6RA 3OMZA 1HI6B 4KTDH 3TV3L 4G9DB 3ZZSA 4K07A 4K8RD 2VNCA 5T33L 3UPRB 2WLLB 3RU8H 4Z78B 3JT2A 3MV8D 3P30L 3V8OA 3QE5A 2ALWA 4XMPH 3AITA 3GJFK 4DPRA 3OR6B 4PRPE 1ZRUA 4ODTH 1Z5LB 4ABWA 4NAQA 4FQIH 1YYLL 2EC9U 2YLHA 4AI7A 1JHKL 1J5IA 3FRUB 3B6SA 2JB6A 5C0BA 3H3PL 5A2LH 2BVUA 2WLLA 1I3GL 1QLRA 1ZLWH 3VFPB 1TETL 2JQAA 5IJKC 3FZUD 1RJCA 4R3SB 4BYHA 4Z7VE 3SOTA 1DQLH 3VRJA 1YSOA 2DQHH 1ZTXL 3PWVB 4WIQA 5A43C 1G1OA 3O3AB 4Q6YA 2O4EA 1SVCP 4LSPH 1M71B 3BO8A 3MV9A 4H26B 2FT8A 3K2IA 3X11B 4L5FE 4DVRL 3DUSB 1OGAD 2DTML 4JDVB 4QI3A 2H0FA 3TH4T 1BVKA 2B1AL 2BSSA 5SWZA 2B20A 3UAEA 3ZYJA 1Z1WA 5ISZA 3BAWA 1JVKA 4RCAA 4N9OB 5DJ0A 3WEAA 1QSZA 4CNIB 5FHBH 1OE2A 2MHAA 3V5HB 3NJVA 1XR9B 2AQNA 1UD5A 5PAZA 1IBDA 4LSVL 4HZLA 4WKZB 5D1ZA 5EEVA 1N59B 3L9EA 5KWYC 3WYRA 4NC0B 3JVFC 5D4JA 2TRHA 3EO9L 2BIQA 3CVIH 4GXVL 2X10A 4HG4K 1CBVH 2LGNA 1BM7A 3AXHA 4LSRH 2IH3A 2OTUB 2IH1B 3W1ZA 1KN4H 3ARGD 5BS0D 5FEBA 3L5XL 1WT5A 4OGXH 5IW1B 4FNPA 5LN8A 1AXIB 4X6BA 1VERA 2IOIA 1E6OH 3BWAA 2DWEA 3ESNA 2N1KA 4MA8L 2DMHA 2OP4H 4AE0A 4QRBA 5F44A 1JV2B 3K4ZA 3X2QB 1X5IA 4P2OB 4YK4B 1FFPA 1JPTL 3NMEA 3K71B 4NWUH 1TZHA 2WB1A 5I73B 1HXYB 4K5NA 2MKWA 4JM4L 4XPTL 1ZLUK 2FO1A 3C12A 2VM4A 4BFKA 2I9LA 5L8KB 3D5OF 4UU9A 5GRVL 3WS6A 1OAUL 4PJBF 3RZCB 1QBBA 3B7RL 4K3HA 4MASA 3QYNA 1ANUA 4ELMB 4PJDB 1IU1A 4EN3C 1EMTH 2YGQA 3DNKA 5KAQF 1UZ8A 2CGRH 3GMPA 4F8LA 4JGJA 1RU9L 3D52A 4CN1A 2YGNA 1PIGA 2PW2A 5DF0A 3DIFA 5BVJA 2WQRA 1MPAL 4N5EC 4MBRA 1LLAA 4H40A 1Q38A 2PPFA 1W9XA 3GM8A 2ATKB 3O4OC 4FQQA 1PZSA 5FHAL 5LAXB 2WTRA 2NZIA 3C2SA 4CW1A 5J1AB 3GMOB 3N40P 1UTDA 3D6GA 1T21A 1RZ8A 4H2AA 4D0CA 5BVJB 4UAHA 4RX4D 4L29B 1VAHA 1JWMA 5DO2D 2ZX7A 4U1HB 4TQIA 4FFTA 3SYAA 5H4ZA 2EDRA 4NN7B 2HYMA 3ABGA 4ZDHB 3B8SA 3VXMD 1YEHL 2JVUA 2VGLM 1CUOA 1T20B 1R9FA 2JH2A 3O2WH 1ADQH 3QUMH 4ODWA 2ICES 2EADA 4TUKH 2EE9A 4XXDB 5F88B 2Q10A 1P7HL 2R69H 4UOW0 3FS9A 4NQQA 5AB0A 2P3YA 4QYOA 1CGXA 2APBA 1I8KB 5IOPB 4GG6A 4X98A 2OAAA 5DMJB 3MOAH 1YDPA 1OT2A 4HEMA 5CUSH 1Q72H 2EDMA 4W93A 3GI9H 3BD4A 3IDIA 1J0KA 3HE6D 4ZQKB 3BUTA 2Y6TE 3IF1A 3VI4A 1GJIA 3KXFE 4PJGF 5HHPB 1LP9A 4QXUH 1PFCA 2AK4D 2WINB 5HGDB 1DEDA 3EG9A 4YHIA 3T6VA 2WSKA 3S96A 1ID5I 3WUWG 5EF0A 1T21B 3CHRA 1MXGA 3G9AB 1AOHA 4LLWA 1RK0A 2NXZD 2NY2C 3SDDC 1BQUA 3HUJA 3VUAA 3LNFA 2NY0C 2CAKA 1UWYA 3G5ZB 1R24A 5K93A 3B7SA 4GLRI 1NLDH 4I85A 3KYKL 3IU3B 5LCVA 2ARJA 1AAJA 1E2VA 3QCTH 4TKWA 4EUPG 4J7RA 3M8OL 3Q3GB 1BMZA 5EC2A 1WC7B 1FIGL 2Y3AA 1P9MA 5E1HB 3BOVA 5I9QB 4JNXA 3OLEA 4LOFA 4KJPD 4M93C 2PXYC 4FLOA 4HJ0D 4RMBA 8FABB 1ETA1 1UXWA 4UQ3B 4O02H 4JAMA 3TFBA 1L6XA 2HJKA 2VLRB 1N5YH 4JRXD 5D7JA 2VH5H 3MV9B 2YC1A 4H26A 1CDUA 4WJKB 4P23D 3DOHA 1NL0L 3LKNB 1PKQA 4OJAA 4PJHE 5KTEL 1EHKB 2OJ1A 1KCVL 1OF0A 3RURA 1B0IA 2F5AL 4ANVA 1X7TA 4YSPA 5CD3A 1M9WA 2R0WL 3LNIA 1CICD 3HC3L 5ALBL 3RVXD 2A9DA 5AUMA 1HILA 1HNYA 1AQKL 4K7FA 1BF8A 2LAAA 3HI1B 4P5SA 3SDAC 2W9DL 4GKNB 3TOPA 3MRJA 3C5SB 5TK2A 5E4EC 5E6UB 4J6IA 1EEYA 3Q8CA 2UUDH 4NIKB 3FCTB 4Z7QE 3O6FB 5T3ZH 3SGEH 2BVPB 5IB1A 1G7QA 4POYA 5HPOA 4E0RB 3ISRA 4HGKC 4JE4B 5J3HC 3BP5A 2F74A 5DJAB 2FR4A 3QCVH 1XGPB 3PDDA 1U2CA 4XWGL 3LZOA 5D7LA 2V17H 2V9QA 4KKQA 2G9HA 2V2XA 4R5TA 2EEAA 4LEOB 1MF2L 3PIQA 5DYFA 2G4EA 3DDGA 4JFOA 5FYJE 4MRCA 1E3FA 3QIUA 5CILH 2GJRA 3BI9X 3VD7A 3EH1A 4WTZA 3MN8A 1BVOA 3IPFA 3QHFL 2ODHA 1D3CA 3SGJC 1DLFH 1KJMA 1KJVA 1M1SA 1QBLH 4GQQA 2XKNA 3DHPA 4N0UB 3E6FA 1R5IB 1YMME 5JPMA 4HCGA 1XAKA 5FKPB 2FECI 1UD6A 3DSFH 3UBXB 2DI8A 3VG9B 1HCZA 4QHMB 3GRWA 4P59H 3VFPA 3DURB 4Q6IB 4C4UA 2VDKL 3UDWA 2DQIH 4U6TA 1I7UA 1YC8A 4PR5A 4LLVB 4OF8A 1A5FH 4KKAC 4G3YH 4K2UH 4BXSV 1T7ZA 1IGIL 4UOQA 5AOZA 4NPJA 5F9OL 3P30H 3GI8L 2ZUYA 3LKRA 4L5FH 5JA8B 3PNRB 4X9BA 5A40E 1DFXA 3VYPA 4RZCA 1YAZA 1IGTA 1UG9A 5MP6H 1G7LA 3WLBA 2A5UA 3WO4C 1PU0A 5KYYB 4ZFZA 2LVCA 3KD4A 3HE7A 5IBLC 4AEEA 3I3BA 5ESAA 5GSVA 5ACLA 4N2FA 2EDNA 5B38G 4X4YA 5I6KA 4L8SA 4A55A 5AVYB 5DFWH 1YO4A 4QCIB 4I5BB 3C60B 5AAWC 4HJGA 5IREA 3JT0A 2HT2C 5F7MC 2GK2A 4IRZA 2H0EA 4WSJA 5CBAA 4PGDA 1OCRB 4EI6A 1A7BA 3PWLB 1B88A 1JGLL 4PLOB 2QFPA 3RUGB 4ADGA 5C71A 3O41B 5JW4Q 1A9EA 4PRDA 3I50H 4N1CA 2PWDA 1W6WA 4NAMA 1OP3K 2J71A 3GZPA 2FCBA 1OTSC 3AY4A 4PRAB 4XB3A 2FBOJ 1ZHKB 1O6TA 2IQAB 1Q94B 2ENQA 4PJ6A 2I9TB 2IXQA 4UDTB 2PP9A 1Y07A 4DOHB 1U3HD 4NZUH 2CA3A 1TVDA 1GYAA 3RY5A 1MFVA 2F19H 4OLVL 4YHKH 2ED6A 5JO5B 1TTRA 3QHZH 1DN0B 3QIBD 5EEZA 1OTTD 3HJ0A 5GGVH 4RISL 1I1YB 1JYVA 2UZYA 2VLJE 4XTRC 2FLMA 4WI9A 3QZWG 4HA1A 4DNLA 3ETBJ 1E9OB 4POUB 2BCMA 3PL6C 2XA3A 2F54B 7TAAA 3MUHL 2WLJA 4P2QA 3VXRA 4OF6A 5FYKU 4N5UA 3DXAA 3AMLA 3ZVVA 4DH2A 3V0DA 4DK6A 3A4FA 5JXEC 5CJOH 3P1VA 5IY5B 4P3CL 5HYIA 5AZ2H 1KLFA 3CLFL 1AKJA 4AK2A 1FJ1B 3P9LB 2ZXCA 5E5MA 1GOHA 3QXVA 2WWKO 2XFXA 3OAUL 1B4TA 3U46A 1M4KA 4KRMB 4Q97A 2XTSA 2J2ZA 5HDBE 5GIRB 1H0DA 4NCDA 3U1SH 1CE6B 4P5KA 5FV1L 3QZNA 4IDLA 3QJUB 1QFWI 1QPXA 3WXVH 2WJ7A 4N86A 5HGAA 4OH2A 3MA7B 5EO9B 3UYPA 4RAUA 1GCFA 4X99A 1NAMH 3L1OH 2NSXA 3SJVB 4OJCA 1RPKA 1Q4NX 3MXWH 2X9XA 3P69A 4NXKA 3WKMH 1ZV5A 4F9LC 3SBWC 1WGVA 4BWWA 5JR1H 5I8OL 1SJHA 4PJ8C 5E7BA 5SX5H 1XZ0A 3B9AA 1Q8MA 2ZD0A 4XPHH 1FAIL 4BSVA 3HE7C 2ADIA 5F9WB 3LRKA 5JQ6H 1HKLH 3DTXB 2AEOA 2EEFA 4W4OA 1MG2C 4JPIB 5IK3B 1DCEA 3O8XC 3WCYA 3GWJA 4WWKC 3SDCA 1D7DA 4ONHB 3BLKA 4FQXD 3RVUC 1VACB 5FIEA 2ICCA 3M88A 2J5WA 1ZE3H 3ZE2B 2VH5L 1SRDA 3FFCB 5BO0D 2Z91B 4QKTA 1A6TA 4MMZA 3ZJAA 1KUMA 1AGBA 1V05A 4GAJL 4HJUA 2IH9A 3BAJA 2HT3D 5ECGA 3N91A 1FE8H 1A6ZB 3DV4A 4L8BA 4ISVA 3KYAA 1MF2H 1VF5C 2H41A 1Y7VA 4XNYH 4WO4C 1TZIB 4TOYL 3ESMA 2H6UA 3CQFA 4PRBB 25C8H 4PREA 2F8OA 4PV8B 1XV8A 4KOBA 4PRHE 3D2UB 1D2OA 1VKXB 3IJ8A 4BZYA 4XMLL 1P5VA 3ULVD 5EBMA 1QYGH 5DMGD 5J1SC 1TNMA 3ZQ9A 1JZEA 3QWOB 4NNPL 5DJ6B 2V2WA 1JERA 1KNOB 4LU5H 3FHQA 4L05A 1IIKA 3U2SA 4BFBD 4D0BB 4B27A 1UA3A 5I18L 1WE5A 5JHLL 3S37X 1OE1A 1NFKA 1A7RL 3V4PB 1T89A 3W0WA 5D1XC 1BG9A 1NMAL 3MFFA 3QDGA 3QT2A 2QPSA 3FB7A 5J11B 2CCWA 3LRGA 5C0AA 5FUZH 2YIHA 1DUZA 4LSRL 1U8PB 2A73B 2IAMA 3LOWA 4UQ2A 1W16A 5B1KA 4ECNA 1MRDH 4PVLA 3SODB 1U93A 2BNRE 4DFIA 4NBXB 4DP6X 1LWRA 4TLUA 3UTPD 2AW2A 3VFRB 4M6OH 5GGRY 4NHUA 4N2MA 4MS6A 1IAMA 2D31B 1TCRA 4DTGH 3BAYA 2W91A 1AYRA 3UTSA 2UY7B 3TWCH 5BRZD 2R0WH 4PJ7E 4PJFE 5JLZA 4JFYA 4KJYB 2DM4A 4OR1A 2F53B 3VH8G 3RGVA 1FQ9C 2AK4B 2FHBA 5B39B 3SCMD 1CD1B 1ZEAL 2HTKC 4M7ZB 4RFOH 4TL4A 1QZNA 1ZV2A 2Y1YA 3SDXF 4OTXH 4Z95L 3W9DB 4NRYB 2FX7H 4NUQA 3LS5H 4TSBL 3QNZA 2R1YB 1RJYA 3IRCA 1NFAA 1UT1A 3HZYB 1XSIA 4GSDH 4KMLB 1MI5B 2WSDA 1Q90A 2EXYC 4Y2DB 3DX9B 4JQIA 3V0WL 1E8XA 5I1IH 5L7XH 4LF3A 1BQLL 4AW7A 2IV8A 3SYOA 4ETQA 4KKCC 2Y4SA 3G7TA 3C5SA 3K2KA 4YDKL 3UH8A 4I18A 3VYNA 4Z3EA 2UZIL 4Q56A 2R39A 1D5BB 2VJ8A 3HA0A 3QS3A 1BQKA 2VDOB 1J05A 2WWOA 3QUGA 2DD8H 3FL7A 1SNRA 5F96L 1JE6A 2FEEI 3SD2A 3JZYA 3T0EA 4Y16D 5FWQA 3CHOA 4D94A 3EBIA 4GEJA 4ZAKB 3GBNH 4M8QB 5AKVA 1J0HA 2Q1EA 4X4XB 5DUJA 3DMMA 1B4LA 3TZVD 2CQVA 4JFFA 1NFDE 3ZDZF 1RURL 4FNRA 2VDPB 3ECBA 4AOFA 1IQDB 5IMOA 2VR3A 4LQFL 1ZS8A 3KYMA 3RDTB 2ZX8A 1DJWA 3HOGA 1QSED 2KLRA 2YSSA 5DUBA 1I9IH 1WBZB 5FCUL 3D48R 2W88A 5C07D 1AS8A 4EUPH 4WUUD 2VLRE 3MHZA 1OP9A 2CPUA 2XKSA 3EZJB 4KXZI 4Y2OB 3QDJE 3D9AH 1HL8A 4KOCA 1T1WB 1DSYA 4A04A 3IJHA 4NKMB 2HKFH 4DUXA 4Y4HB 2AC0A 4PUBL 5TFSH 1GC1H 1Y1DA 3PQYA 4HKZA 3ULVE 4UIKH 4KROB 1A1NB 5DDHA 3P4NA 5DC2A 3MRPB 3FDWA 3MV7A 4HK0B 3BQVA 1FI8C 4U0RB 3ZZLA 1F3JA 1XIWA 2DWYA 2Q7AA 2FYVA 2QR0A 3GYRA 4YNYA 4YZFE 4L8SC 1S7VB 3HBGA 4PS3A 3GSWB 3LQZB 4PCKA 1ZK9A 4A39A 3PFQA 2XLLA 1PLBA 5BS0B 3VW3H 3X1FA 4AG4L 2Q2LA 4UB0H 1GGBH 4JRYB 3ZDYF 4A2MA 4WRLA 1F3JB 1FZOB 1XIWB 3VFOB 5CU9A 2OZ4A 1NM4A 2YKKA 4WWPA 2NMSA 2XWEA 4IBVA 4K3DH 4OJDH 3AREB 2O6CA 2D7QA 4HKZB 3OMNB 1AYOA 3IS1X 2SODB 3DX7B 4QWWD 2AEPL 3LKSB 3MRCB 4HWZA 4MAUL 5IM7B 2LOEA 4KHXH 4EZKA 3BWZA 3NJGA 3UG4A 3VD1A 5TE4H 5KZCB 3GBEA 2E75C 3QC5X 1K5WA 1FSKB 4JPSA 3RWGB 1BD2B 1UM6L 4FXKA 4KK9D 1JHLH 3PU7A 3HRZB 2P49B 2WTPA 5KTEH 4N90D 4K9EH 5DYOB 1A4JA 4AJYV 5DJ8A 4HJEA 4A68A 3T8XA 4G1EB 3WDHA 3CN2A 3QORC 3HI6H 3TPUB 1JHKH 5CN3A 3QQ9C 2CLRA 5EIIB 3H54A 1R5WB 5EEUA 4V1DD 2QHRL 4DP5X 5FO8B 3OL2A 5B1JC 1YPZA 2AHIA 2ATPB 4X0NA 4H8PA 3PWPD 5BV7H 3VH8B 3FAXA 5E99L 4HD9A 1R75A 5GGUB 5IHHA 5CZKA 4K15A 1CGVA 4KVNH 2GC4C 1D7BA 2YQ2A 3WUWB 3D3VE 1REIA 4BGLA 3WJMA 5LGJA 3O6KH 1T0MB 3BFWA 1WPCA 2H2SD 3UBXI 4WEBH 4HH9B 4WFFD 1IBHA 4Y9FA 4LL1A 3RTQB 1E4HA 4NPYB 4LSQH 1T5KA 2XIIA 4WV1B 3H2PA 43CAA 1PLGL 4MB1A 2VDQL 1MIMH 3I6KB 1SXAA 1MWAA 4NZDA 2CH8A 3IDMA 5D9SA 2OMTA 5ERWA 3H6AA 5F6HJ 4E41A 3P4MB 4OM1H 2X87A 3SCMB 3V4UH 2BOBB 3IKKA 5D7IB 2E7CA 2J55A 3V55A 5H35A 1F6AA 3VFSA 1CD1A 5CEXB 1QNIA 5BRZB 5IUCA 1AO7B 3ESUF 2EXSA 4JFHD 4ANKA 4RSVA 2VC2B 4BFIB 4PGCA 3UEQA 3F83A 4XO4A 4MJIE 1XCTA 1T0MA 1DJSA 4FP8L 4M6NH 4OCXL 5D5MF 3UO8B 3F00A 3MRFA 1JF1B 3VE0B 2V3DA 3STLA 4U2YA 1FN4B 2EIZB 4O00A 5IVXE 2CKBA 3DXAE 3HTLX 3U83A 1DSWA 3FQ1A 1CIUA 2V9UA 5TPWL 4MZIA 2Y1VA 5GSRB 5JW5B 3MNWB 5MENA 1UH3A 1FNAA 2FD6L 1UM4L 4PJFA 3VU1A 2DIAA 1AI1L 1DFBH 1OGAE 2A6KB 2CRYA 4BFOA 3Q5OA 2AJ3B 4YDLC 3VFNB 5D70L 1E2ZA 3MOBL 3MA9L 3QUZB 3ROOA 4P2AA 1B9ZA 4A7VA 1DBBH 4WK0B 4ZXBB 4DUVA 3JBG7 4TUUA 2Z6FA 4XXWA 4OV5A 2LFEA 1MCOL 1ZT4B 4JM0A 3ELQA 1HAUA 2AS5M 3FSAA 5KBLA 1RZJL 4KXDA 1H6FA 3S48A 3PV7A 4X6DB 1LNUB 1RIHL 1QI5A 4U1IB 4XVUD 5F3BB 3BSZA 2B4CH 3CVHL 3TN0B 3RX7A 4OLUL 4XVJL 2WXGA 3INUL 4TQEH 2P8LB 3LIZA 1ZHLA 5L6YL 5FB8A 1GKOA 2WVTA 4NLAA 3F6JA 2EEDA 2XZAH 4JCWA 3RBGA 1FRGL 5C09D 4YHML 2A4CA 2AJ3A 5I1DA 4XNUL 3UPRA 4KNQA 3A47A 4FG6D 5I5MA 2IALA 4U3SB 5D7JD 2HRGA 4N90E 1SYVB 4L3ED 4OY9A 4AYSA 5BS0E 5GSRA 3EJZD 3MBEC 4P4KD 4UILL 5JW5A 3O8XB 4K23L 1GZPB 2BERA 3NH7H 4YNYB 2X12A 3MUUA 4KPHL 2ZOWA 1ZGLM 1VB9A 2DN7A 4OCNC 4XX1G 3REVA 4D0DB 1VHPA 3DRQB 2DLEA 4GAGH 3WO3B 1USQA 2DQFB 3QQDB 5A1AA 4X8XA 1ZHBA 4Y9GA 3GRWL 4JPWH 4PJGE 5C07E 3QJSB 1OO2A 2IAMC 3U7YH 2OMNA 3PWPE 1GC1L 3RGHA 1ZVSB 2HRHA 4LP4A 4PY8J 2XSKA 5CKAA 1R3JA 3Q9QA 4XRCB 2WSPA 5T5NG 2N1TE 4U1JA 5DHYA 1GIGL 4R0LB 4I48B 1IC4H 3Q06A 3IDMB 2NY6D 3S35L 1UACH 2X0VA 3I6KA 4NN5C 3TCXA 3VDAA 1UKTA 1X5GA 4OZFG 1E8ZA 5JIQA 4GRLD 4N2IA 4G6KH 2H6PA 5JHDE 3VW3L 4HF5H 4CC4A 1UT2A 5CD5C 1U95A 5CHNA 3MCLL 4DWHA 1DR9A 3VTTA 5EBLA 2IGFH 4N25A 3IBEA 2RA1A 5IHZA 4QRAA 3FJTA 2BMKB 1A7NH 1CE6A 1OAZH 2YFOA 1BOYA 3HB3B 4H0IA 6TAAA 4JFHE 2Y6SD 4R4ND 3N85H 5ENWA 1SDYA 2BY1A 3ES6B 1EJFA 4TVPH 3SE4A 3IWUA 3GIZL 3TEZA 1JCVA 1IAIH 2W9EL 5IIEA 3K3QA 1A3LL 1KIPA 2VW7A 4QOKE 5AVXB 4D3CL 3HLAB 3TPUA 2CSPA 5DVKA 1FHNA 5EDXA 1KPRB 3I75A 5FGCE 5I6NA 5DQ9A 5EFIA 5CP3H 1DO5A 1AP2A 4ODBD 1HH6A 1SUHA 2EIBA 4IMKC 3F12B 3MLRL 2CIIB 2PP7A 4GSRA 1MLCA 3EF4A 1GTFA 3GC3A 1FVEB 2XDHA 1IQWH 3FOLB 3O2DH 1HYSC 4LNVA 3UTTA 2BNRB 3EHBC 2VTFA 4QRFA 2H26B 3L3KA 3DI3B 3DX7A 3E9UA 3N42B 1F00I 2OI9B 4PJ9A 5B7FA 1H3WM 4NT6B 5JIDA 1FNEB 1SXZA 1HVXA 2CK0H 4KJPC 5E0QA 5GRZA 2DQFA 3Q13A 4ZMPA 2AJZA 4WHTA 5CIPB 5TGBB 3S8FB 4U1MB 4BWTA 3G3LA 4CGUB 5KBDA 1IGIH 5BMFH 1WZKA 3OZ9H 2FX9L 5IOKA 4FYTA 1MCEA 5C86A 2VDMH 4PJIF 3LD8C 4DKEL 1RUPH 3FULA 2AQTA 2YLKA 4MGXA 4KWUA 1DUZB 2BWQA 2CRZA 4JK0D 3NTCH 1V10A 1BJ8A 1NMCB 1AY1H 2CMRL 3FB7B 4YBLC 4BFIA 3T0DA 2YOAA 5CLXA 3W0WB 3VFSB 3WTWA 1UB6B 1B2YA 2OSLA 1Z9SB 4HPOL 5FFOA 5K33A 3NIGE 1JPGA 5F7LB 1QACA 3H0TB 1TQCC 3ARGA 2C3GA 2WWKT 4H8UA 5EUKA 4UV4L 4P4RA 5IMLB 3LKOB 4YSQA 3N9GL 3HMXH 5C9JA 1DE4A 3ULUF 2WWMC 4OV5B 3DPBB 5DRNA 3WE6A 3ZDYB 2YSSB 1JWUB 3APMA 4N8CH 2J8UA 3BVDB 4YSCA 5JTWA 5F9OH 5AW4B 2LV4A 2VZTA 4HCRH 4JKLA 4KKBD 3VXRD 3L45A 5CCJA 1Q0EA 4AKPA 1IAKA 4MNQD 1TJGL 2P52A 4ODXA 2H6OA 4GINA 5AW8B 4OIIH 2XXFA 4YC2C 3T71A 3SPCA 2OXHB 5F7DB 5E2JA 2NW3A 1P5UC 2AVFA 2WAHA 3E8UL 3TT1L 3VJ6B 3PNWB 3U25A 4OD3H 1JVLA 4U3CA 4N26A 1MDAA 1XH3B 3BPNB 5FKPA 5BO1H 1MSPA 2HRPH 3Q43A 4C4KO 1VGKA 3L3OB 4GRMA 1GW6A 3BVXA 3FONA 4YFDB 2I5YH 2BVOA 2VR5A 2BLFA 2E3VA 5B1JA 1AZVA 4HJIA 2ADJB 3FSVA 3TP4A 4JN2B 4Y9CA 4FXKB 4X6EB 2X3BA 4YLQT 1D2PA 1OEZW 2R2BB 3CZUB 1E7UA 5DK2A 4PBWD 3P4MA 4J3TA 3HZYA 4O02L 2WB7A 3VWJB 4U6HB 2RALA 4FXGA 4TSAL 4QOKD 1ITBB 3EH4B 2A9AA 1SJXA 5D7LB 2JK5A 3TT3L 1WFIA 2DYPA 3THML 3U9WA 2EICA 1L9OA 1JSYA 1OSZA 1OZUA 1C08A 2DDQH 1WP6A 4PH8A 3GBMH 2D2OA 2D7NA 1QHOA 2ZX6A 1E3XA 4ZOAA 5FK9B 4MSWB 3WJMB 4CVUA 5L6YH 5C3IA 1AKPA 4W81A 1OANA 1KBKA 1EO7A 1QBLL 1J5CA 1R5VA 1S7RA 2WXKA 5LLIC 1UOWA 4P5KB 2HAZA 4K3JH 1JZHA 4M3KB 3LNEA 2FH8A 3TN0C 2GAZB 2DJMA 1N3NA 1SVBA 1LK3L 4YDNA 1ZLUH 4LKCB 3VRLE 3MUY1 3ZXAC 3RWEB 3FTYA 2YQGA 1JXKA 3CLFH 3I3EA 1WEJH 4LHQB 2E7MA 1OTSD 3TBSA 1J8KA 4LL4A 3VM5A 1JGEA 2HJFB 3ISYA 1J18A 4LVNC 4WDIB 3Q48A 3WL9B 3ARRA 4G72B 4UQAA 2XKUA 2O6DA 4PY7A 1DQMH 3VD2A 3I6LD 2JTYA 2VDPL 4D9LL 4LRNH 1MRCH 5K59E 2B5IC 1OAKL 3FFDB 4HG4J 1NGQH 1OTTC 5T1KD 3L5IA 1NEZB 2WP3O 3H7BA 4X9GA 5DJXB 2J7LA 4R83A 4N0YL 4L0YA 4F9PC 2LE9A 4HSAC 3K5RA 3ECBB 1YN6B 1IC5H 4IKJA 1MN4A 3MV8E 1GHFL 3GZOA 5EC1B 1QRND 2AXGB 2FYYA 2H3NA 4WTQA 2ROYA 1PZ2A 4P9HL 4PRPD 2OZ4L 3B2XA 5A2CA 5E8DH 5BXFB 1BREA 4KITB 1FO0H 2XJKA 3L3HA 3B2VL 5AOJA 3RQ3A 4CADA 2AJYH 4ZUWB 4JZJC 1AJ7H 2JIXA 5CEYA 3VB8A 4MDRA 4G1MA 2W94A 3DX1A 3VI4F 4G3YL 2BNUB 4L1LA 1EXGA 1Z9NA 2FNBA 1AC6A 1RZKH 2CD0A 3FTUA 3J8F7 1S7SB 3IGAB 1X5HA 3OZKA 4EZLA 4U05A 3ZQXA 4ZUWA 1ASPA 2GB2A 1T2JA 5HDWA 3DX6A 2GSIA 1U8MB 3T0XA 3O2VL 1CI3M 3LKPA 3EW3B 4F8OA 2AXGA 3HRZC 4EBQH 1ZPLA 4NO3B 1CU4H 3EADA 1HK6A 2DL9A 4OQ1A 1T20A 4R84A 2E9BA 3KGRA 2J73A 4HKJB 5ADOL 4GI8A 4WI8A 1T5XB 2B7DT 5KS9A 1CK0L 2OMBA 4XO3A 4NHCL 4K3GA 3TBTB 3GSQA 4B9YA 1SFHA 4Y4HC 2FQEA 3OPZH 3RIAF 5KVDE 4QGYA 4MFHA 3EJUA 4NQVB 4FYSA 3LNHA 2G5BA 2HLAA 3EOBA 1S9XA 2ZOLB 1YY8B 4MX7A 4G83A 1J1OL 1JXFA 2XRAL 3SE8H 4ODUB 4FQXC 3RVUD 1OLZA 3AB0C 2JI3A 1U8PA 1DVFD 3BAIA 5JHBA 1A25A 1BQHB 2LLLA 4ZUUB 3GMPB 2VRAA 4AYMC 1FYHB 1TYRA 3F7YB 4NFCA 5AENA 3FT2A 1NGYB 4KMTH 1SLUA 3TFKC 3UG5A 4R6UA 1ERNA 2HH0L 2IGFL 4IBSA 4JFXA 4LSVH 5EDSA 1ACCA 1MRFH 4G71B 5B3JF 3HG0A 5HD8C 3O3DB 2D2CC 3IFNH 3ESVF 5EO0B 4UM9D 4LVHB 1E9QA 1C12B 5D55A 5E94B 4ZX5A 4QO1A 3PPSA 4WO4D 5CWSA 1X5ZA 2H0PA 1W8EA 3MMEB 5TDNA 2P5EA 4M1GH 3RWFA 3OAWA 1A6WH 2FSDA 3SZKC 1VKXA 1VCBC 1N5YL 1VADB 4XPHL 4F2MB 3R0NA 5F7WC 2FSE