2WCPA

Crystal structure of mouse cadherin-23 ec1-2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CADHERIN-23
publication title Structural Determinants of Cadherin-23 Function in Hearing and Deafness.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA02
3K6DA 5DZVA 4ZT1A 4AQAA 3MVSA 4APXA 3Q2WA 3UBGA 4AQAB 4APXB 3FF7A 3LNEA 1WYJA 4ZI8A 2X2UA 4AXWA 4XXWA 4NUQA 4AK1A 2QVFB 4NUPA 4AXWB 2YQGA 1ZXKA 4ZTEA 4NQQA 3LNDA 1WUZA 4ZMVA 2A4EA 5CO1A 1Q1PA 4ZMPA 5CZRA 2OMVB 4ZMLA 1SUHA 2OMYB 3LNGA 3QRBA 4QD2E 4ZMNA 1O6SB 3K6FA 2WBXA 1ZVNA 4AQEA 3LNHA 1FF5A 5JYMA 4XXWC 2OMZB 2YSTA 4AQEB 2WHVA 1OP4A 3LNFA 1EDHA 3UBHA 4AQ8A 2EE0A 1L3WA 1NCIA 2OMUB 2WCPA 4ZMQA 1NCHA 4ZMXA 2QVIA 2OMXB 2WD0A 4ZMWA 2OMTB 4NUMA 2A4CA 5KJ4A 1NCJA 5JYLA 3UBFA 2O72A 3FF8A 4OY9A 3Q2NA 3PPEA 2V37A 4ZMZA 3Q2VA 1NCGA 4ZMYA 4ZMOA 4AQ8C 3K5SA 3Q2LA 2OMWB 3K6IA 3LNIA 3K5RA 4ZMTA
chains in the Genus database with same CATH superfamily
3ERXA 1NWPA 1I9JL 3B9KD 1YYMH 3AWGA 3MLXH 4XB3A 3A6BL 4M1DH 3A4AA 4BFGA 1QLRB 4UQAA 1RUPL 4R4NC 5FM5M 2JLPA 5AVRB 3W2DL 4AXWA 2I07A 3WEOA 3WNMA 5CEZH 1V7NH 1U91B 1REIA 2Z7UA 4HG4J 3G6JF 5AAPA 4PGCA 2NY5C 4PJ8D 1N10A 3D8MA 4E68A 1GYWA 5EBGA 4Z7WA 5DK0B 3BP5B 1FZKA 3D50A 1BOYA 4JFEA 3DX8B 1MJJA 1MQKL 4UZSA 2IV8A 4OZHB 1QPPA 2CJSA 4BKSC 4Z3FA 1ODUA 3BUQA 5D70L 2GG1A 3SYOA 2MEJB 2OMYB 1JDDA 1A64A 5E8OA 5E5UB 1CU4L 2EE9A 4PGBA 5D1QC 2DJUA 3MGAA 3JWOH 3SQOL 2CQVA 5KANI 3MV9A 4HUXA 4GS7B 3SJVA 1X5AA 3L3OB 2VZOA 1MCOH 2IMNA 5DT1L 4GUPB 1R0AL 2DQEH 5E00B 1NBVH 2RTTA 4E9YA 3SY6A 4R7NB 5HI3D 2HLEB 3HG1D 3S9DB 4MGXA 3VMPA 5EG6C 5DS8B 5ADPL 3F8UB 3HJEA 3G6DH 1BM3H 1MLCB 3ETTA 4FNRA 4ZMQA 3PP4H 4LQFH 5AW3B 3QG7L 1W6LA 3ARFC 4DJMA 1GHFH 2HKHL 1IE5A 1G7LB 4KV5F 4NM8H 2IC2A 3JXAA 5AB0A 2OMTB 4PS4L 1GZPB 4WIQA 4JQXC 5DJ8B 4BUQA 1BZ9A 3FNKA 4WI3A 4FJZA 4LF3B 4OQTA 4JPWL 5GRVK 5GGTH 4HC1A 1H3PL 4WW2A 1ADQL 2F6AA 4QRQA 2EVJA 3HCVA 3NSCA 5IB5A 3NFNA 3JV0A 3UZEC 1FVEA 2V7HB 3IKCB 2ICWB 4IBTA 4LARL 1GH7A 3L5IA 4QPEA 5IESH 4FXKB 3O0LA 2DYPB 4Y2DB 1G9MC 3AXIA 4LOVA 2EEDA 1ZVSB 5DMJB 5A16B 3SDDB 5DDHA 4R4BB 2Z93A 4D2NA 3QWRA 1LMKA 2WZPA 1KJMA 1PD6A 4HKBB 4Q6IA 2VABA 3TVMC 3SOBL 1U3HD 5HY9B 1MCWM 1HH9A 3LKOA 4OJYA 4UM9D 5DURB 3QQ9C 4NJ9L 3QCUL 4NRXA 4PJ9C 4CMMB 1WFJA 3ZKND 1YQVH 2CDGB 5I73C 2OX5B 4ZS7H 1B4RA 5ILTH 1YEEL 3UBGA 2B14A 3OAZK 1M9WA 1LDPL 2NZ9D 1V55B 4PRDA 3SBRA 4Q8BA 2M8XA 2H0PA 1F0LA 1FJ1B 3TX4A 4DZ8A 4GPVA 3KE0A 3X3GL 1PPIA 5IJCC 3AT0A 1HKLL 4YHOH 5AW8B 1H3WM 2G4EA 2CK0H 5D1ZC 5J1SC 1JTTA 3V8OA 2ZCHH 5IB4A 2FEEI 5HHOD 3IMRA 5TF0A 3F7QA 4PJ5B 2N59A 2FJHB 2D7OA 2OMVB 4WHCA 1XR8B 4AGMA 3NSFA 1CWVA 2WIMA 4WTZA 1EK3A 5IQMA 4JKMA 1IGCH 4TRPL 4N2GA 3V79C 1KTLA 4BK4A 2BHYA 5AYQA 1RZIA 5JW4N 4I2XE 4G5AA 4IHOA 3SKNB 4YAQB 4XZ4A 2CGYA 1RZJC 3MBEB 3CVBA 1CVRA 2NCEA 1E5CA 1EERB 1X5HA 1YN6B 2IOMA 5EEXA 3MLZH 4LQ1A 5F96L 3V0WH 4JR9H 3TO4A 4JDEA 1ZEAL 3DRTB 3KXFB 3CZEA 1BQUA 1OK8A 3T3ME 3U30C 2X3BA 1MZYA 1Z2KA 4D3CL 3VDCA 4X80H 3NSXA 4JN2B 5DD3H 5K9KB 1G7IB 1JI1A 1Q1JL 3BO8A 3IF1A 3KS0H 3RUGA 4ZTOL 3NRFA 3U1QA 3FN0H 1JGUH 5BS0B 3VTMA 2FEEL 5EWIH 4X6CE 2A9NL 3L7EA 4YVUA 1CR9H 4LEXL 5DMKA 1ZLVH 1AKPA 4K9EH 1VCBC 4J1UA 1E4WH 1KPVB 1MCDA 1WCQA 4ONFL 4MAUH 5JW4M 3N1PC 3II2A 1CDJA 1JGVL 1S6NA 2G5BA 4C4UA 4JAMA 4PS7A 1L9OA 4M61A 1F4XL 1OV8A 5A2AA 4HK3N 2PYFA 1HHIA 1QLEB 4N0CC 43C9B 1DO5A 1YECH 1D7BA 2DLFH 4MNQB 1O7SA 5LGJB 2CHWA 4J3VA 2YS4A 5HPOA 2PCPA 4QAMB 3HMWL 3RX9A 3T0VA 4X42A 2XJKA 5LN8A 3UO8B 1CD1B 4OIIH 2VDKB 4LDEB 4WQOA 1JPFB 3TYGH 1D7CA 1FGVL 3L5JA 1JZGA 5KW9H 2HT2C 3NQKA 4LPTA 5C0RL 3IS0X 1HT6A 5DRXA 4JB9H 3SO3C 2QV4A 4BK5C 2W94A 4RAUA 3MLWH 1EXGA 2OJEB 3DI2B 4R2GD 4BUHA 5CP3H 2MOGA 3EJCA 4J4PC 3UBXA 4RISL 2BNUB 1KBBA 4JBSA 1XCXA 2VMJA 3KYKL 5HYSB 5JHLL 2XV0A 4YEFA 4TVUA 2FJGA 1F1DA 4GRMA 4JPKL 3BZEB 3MXVH 4G43B 3BUBA 2HH0H 1MVFA 4HJJL 3MC0A 3UO1L 4NNYB 1BEYH 2ZUWA 3SGKC 3QUML 3PWJA 1A4BA 5EU6E 3Q6GL 4WENB 5D1QE 1NCOA 4IOIA 5I66B 2JE8A 3QQNA 3BKJL 3EJPA 1FHNA 2MWCA 1GSMA 2FHFA 4FTVE 4XR8C 1N70A 2OTWA 1TCMA 4U7KA 3PDDA 2GITB 1IM9A 1UJTA 3RU8L 3DX9A 4IBZA 1WAAA 1ET7A 1Y7VA 5F97E 4Z7QB 4FRWA 3MACL 3GSNB 3EGSA 1SVBA 3O0RH 4POZC 1JNHA 2MCPL 3RVUD 4BQBA 5HYQA 2IDCA 4P2RB 2OXHB 3S35L 3F58L 1JGLL 3A23A 3IFNH 3OKEA 4K9EC 1OM3L 5JR1H 4GT7A 1XGPA 1YQ2A 2IXQA 1WC7A 5AB2A 3ILQD 2UZPA 2J1YA 2WKGA 1UXSB 4IRJB 3ZKMD 3BDBA 1EEQA 1OPGL 4FMFA 4KRPB 3GRBA 3EYFA 3B9EA 4GKZB 2GB2A 4XVJL 4I9WE 1M6UA 2OP4L 1FORL 3OZ9H 3SHSA 4GAGH 1NOAA 2VLJD 4RDQG 3ZT7A 1TVHA 3EYUH 3KPOA 2WXFA 1G5GA 1M7UA 5CEZE 2BVQA 2GJ6B 4J6RH 3LRKA 2BS8A 3K1KC 4UB0H 4YR6A 2H0JA 2IWGA 4PRAB 1VB9A 3G5XB 3LRMA 4FNQA 1X4YA 4P23A 4IIQB 4QCIB 5DGQA 4APQC 3L95B 1HESA 4B7LA 2FSDA 5AQ0A 4CSPA 1AO7E 2AI0H 5C6WH 3N85L 5FK9B 3GIZH 3HI1B 4G6AC 3CWGA 1UM4H 3FOLA 4G3YH 4WI6A 5C6TL 1QFOA 3M1OA 5B7MA 3VFVA 4PJHE 4PRHA 5FUOL 5K33A 5DTFA 1H3XA 1MFEL 4PRPD 5KYWA 3CBKB 2A4ZA 4I3SH 5FF6A 4ZAKB 3BVDB 5GJSH 1QVOB 2AEQL 2BPBA 1ZLVK 4XI5D 1YEGL 3VXMA 1OSPL 5C0AA 1OAZL 3MREA 4P2OD 2PTVA 5D5MB 3MGTA 3UJTL 3VX0A 3GSWB 2BCKA 3HI5L 3GSRA 1AG0A 1Q0YL 4QRTA 4G5ZL 2OR7A 3MGOA 3ZUCA 2FIKA 2LVEA 2J8UA 4DGIH 1DVFA 3W5MA 1BVNT 3SD2A 3ZYZA 2NY2C 1ORSA 2NZ1A 3CFUA 1QABA 4ZMZA 1RFDL 5JZ7D 5JQ6H 5EH1A 3FO1A 1HCYA 4FNSA 5FB8B 5I71C 3MNWB 1U92B 3KZ8A 4PQXA 4QRPA 5BZXA 4NZTH 4HHAA 3ARGC 5KS9B 2BRRH 1QFWH 1ZA6B 1I75A 1Z0NA 1J1XH 4HSCX 2ZP9A 3K80A 4UOJA 3F7LA 3BT2L 3BPOC 3QDJD 3UYPB 2AANA 3QIWD 3Q8BA 4OGXL 1BAFL 1SDYA 32C2B 1YCSA 1SM3L 1GYCA 1WS8A 3M45A 4G1MB 3T8VA 5DGRA 3TESA 3MA7A 4WGWB 5D6CB 3FUFA 1GY2A 3FO0L 3O4LB 5DZOA 1NCWH 2Z31B 4HCRL 3P4MA 1Q9WA 5J7CC 4ZFQA 1IBGH 5F8QC 5F9OL 2ODHA 2XQBL 3DOIA 3HG5A 4A7TA 1NEPA 2BP8A 4GIAA 4Q6IC 3TIDA 1CQKA 4XO5A 3BAXA 2XICA 3J07A 4OF6A 1IU1A 3FCGA 2YAQA 3K2MC 4R97B 4LBEA 3VNZA 4AL8C 3NACL 2VDPB 2ILLA 4RFNC 3M86A 3OHXB 2F54A 3LS4L 4Y16D 5TE4H 5ISZB 4L3AA 4KJPD 3QWQB 1ZTXH 1FNEB 1RUML 2ZZUT 3GKWL 1NMBL 4OU3A 2EXWC 4FQIH 1EXUA 2G9KA 4HWEL 3CVHA 1VERA 4N28A 2P5EB 3MRGA 4LCWE 1BZ8A 4O02L 1U8QA 2GSGA 2X4RA 1QZ1A 4PSRA 4F27A 1QEXA 2DQUH 2VQTA 3PWPD 4RMRA 3AGVA 1KGXA 3CIAA 3HZMB 5E9DB 1BP3B 1KLFA 4HF5L 1NCIA 4RGMC 4D94A 5F7AA 2DQJH 4EXPX 3ZTNL 1W72H 2E27L 2A83B 2FO4B 4OIFA 5DD0L 4F7EB 4QJ3B 3ZR5A 4JREC 2ZOKB 4FS0A 4R5VA 3TBWA 4JPQA 4D9LH 3HNSL 4P57B 4J28A 4XPAL 1QA9A 3GMQB 3SDYH 2X41A 3H2PA 5T1DL 2ZUUA 2CUAA 2AK1L 3ULVD 2ROXA 1AHWB 4LP5A 1P7QB 1HHGA 3L7FB 5GS2D 1D6VL 2DYRB 2YRBA 3EYOA 3RWFB 4H26B 1DLFH 3QZWB 2HLAB 4U6YB 4KOBA 5IQ7H 1S5IH 4ODTL 2EXSA 4BRJA 4HS6A 3C60A 1PLGH 3AS1A 2B0SL 3WIFA 5HBBA 1JVOA 2H7WA 3GMPB 4FOMA 4JZOA 3A6CL 4X8CA 4N90D 3VRLE 5EB9A 5J6HA 3HG3A 5I16B 5CGYC 1R33A 3ESNA 4JVWA 3A5VA 4LSSH 3U9UB 3IPEA 3ZT6A 2EQDA 3V4UH 2DWXA 4AVHA 4NO0A 3O6LL 2ESVD 4UT7H 5I8CB 2FEDC 3FONA 3IGLA 1U58B 5F1OB 2VLRB 4UOZA 1MVUA 4U1NA 1CF8L 3CSBA 4NYLA 4QHLB 3A67L 1AQMA 5IROC 2VKWA 1YY8B 1CZ8H 1RUQH 1U8JB 4JG1L 4PJAF 5EFIB 4GXFA 3WEBA 3VXSE 5DUML 1ZHKA 5INCA 1IX2A 3PWLA 5JPNA 1I7TB 3HHMA 4N0UB 4A39A 3GHEH 1E4HA 4G7RB 4F2MA 5DRNB 5IR1A 2XX0A 4J3BA 5JA9A 3FJTA 5IJVA 2QTEA 3UCRA 5IY5B 4OUOA 1SOXA 2FGWL 3T2NL 1UWXK 3TURA 2ZG3A 4Z76B 4B27A 2PXYA 2Z34A 4LL1A 5HHNA 4WI0B 4AE1A 4OFQA 3QJSB 4HPYH 5CU5A 3VSVA 4UU9A 3HLAA 1AS6A 3DBSA 1ESOA 3TBTA 4MJID 1H3UA 4NXKA 4OJDH 2K3TA 3BD5A 3NAAH 5C0JA 3DOSB 1WWBX 4N2HA 2WNWA 1ZVNA 4XN4A 3S96B 3HRPA 3GUFA 3K4AA 1BVKA 4JZNB 3V4PB 1TQCB 5DRWA 1VHPA 3GBML 4ONOA 5CHNA 4WDIA 4ISVB 4Z7QF 4KKCD 4KXAA 1NC4D 1FFPB 1NC2A 4MJ4A 4ADGA 5DFTA 2WB1A 4KQ3H 4DIXA 3MOAH 2NCMA 3QXVA 5DVKA 1A3ZA 1AQ8A 4QNPF 1KIRA 4M6NL 1O7VA 3BWUC 2HAZA 4GW5A 4OZIB 3QZBA 2ICWI 3RVXD 4I88A 2ZWKA 3ILDA 4PB0L 4Z7VB 3PP3H 2ZOOA 4K3JH 4DFHA 1SEBA 5SWZE 3L4TA 4RRPM 3OKNB 3V5HB 1U8LB 2R0LL 4AQOA 5A6LA 2VXQA 5T1LB 3WJMB 2AJZB 2N0KA 3HBZA 4OI9A 1CLZL 1A6UH 3L13A 3S4SA 3MRKA 4C47A 3P2BA 3L4XA 2GY7B 3K6OA 1RZ7H 4KKLD 1QI3A 5AVSB 1N5YL 4GSDL 2Y4SA 3KH4A 5FFGA 1NGXB 3UTOA 3D0LB 5FLUA 2P8MA 1DHKA 1E3ZA 5C3IA 3QXDB 3MCLH 4DVBB 3BN9D 1MWAB 5IVNA 2OLDA 2BWDA 4M29A 2ZQKA 4OF7A 3OKYA 4P23C 3SCMD 4GSUA 4MCYB 2G2RB 2BINA 2GAZB 3FQWB 4CC0A 1VCAA 3SGJA 5E2WL 4BSWA 2YRLA 2XXFA 3TN0D 1GS6X 5GGQH 2DWEB 1HILA 5E99L 3A4FA 3TV3H 4W9GC 4FQCL 3PGDA 5H37G 2W9DH 2IAMD 3L9EA 2JXMA 5IKCA 2CU9A 4NWTL 3MRJB 2ZXCA 4DN3H 4NP4H 4P2QA 4Q74A 5CLYA 5D2LB 4QJ4B 3OGCB 3H0TB 4XZUB 1DVFC 1MN4A 1UOVA 1GRWA 1QTPA 4JFQB 5C2BH 2E56A 2WQAA 4JUTA 3JVFC 5HGHA 5I1HH 4J3SA 2EH7L 5EDXA 4EZLA 2YKLH 2NR6D 3F12A 3N6YA 4RVBA 1W9XA 3VYNA 4N1EA 5IMOB 3AXLB 3D0VA 2NSXA 4YBLC 5E6UB 2Y2TA 4UTAA 5DI8A 3DVGA 1ZLSL 1HJCA 3BP4B 2RMNA 1FG2B 4UI2A 2YMXH 1L0PA 3NJHA 1C08B 3QNZB 1VZGA 3NVQA 4JRXD 2YWZA 1T1ZA 3UAJD 5AW0B 4F7CA 4HUUA 2J4WL 4KZ0A 3U2SA 3ZBMA 5B3JF 1IC4L 1RZKH 2YD6A 1IQWH 3VFMA 4OCRH 5A40E 1FH2A 4TL4A 1I8MA 3FTGB 4PHZA 4KK8C 4Y8DC 3VNYA 1OAJA 4L4VD 1MG3C 4L1HA 4RRPG 4XNMA 1P5VB 1CF1A 4NC1E 3WO4C 4PWJA 3VTAA 5J6GA 5DVLA 4I13B 4YHZH 1ZDSA 5IJKA 2EEBA 4F2EA 4HZ1A 2FH6A 2P5WD 5L4JA 3B7YA 3PP3K 5IMKB 4FG4A 2EIZB 2XVGA 4J23A 4ORGB 1OEZW 3VCLB 3CFKB 4ANVA 1FVDA 1OKEA 3ZRCC 1J8HA 4P06A 4F8LA 1MRFH 1ZTXE 4UQ9A 4RZCA 1INDL 4PJ7A 5ALBH 1MCNA 3E8UH 3Q48A 2QMJA 3L1EA 5D93B 2GTWA 1V7ML 1DDTA 5ABAA 1UA7A 1JXJA 2P44B 3A4EA 5BCAA 3EJTA 1SXZA 3AU1A 4XGZA 1S7TA 2A74A 4HUWA 5E2UH 3TEXA 3Q8AA 3HE6A 2YPVH 1DR9A 1N2RB 3CH8A 3CXDL 3Q44A 4X8JB 4Y4KD 1WFTA 5CINH 4WTXA 3W9EA 1LEIA 1UWYA 1X7SA 1KJVA 2Q2EB 1AYOA 3CHXA 4N8VA 5AW1B 1QLEL 4GKSB 2BRQA 4LSPL 1M6OB 1GIGL 2CGZA 2ZXEB 3DXAB 4ZUUA 3X17A 3L2NA 5MP6H 1U8KB 3EIFA 5T1MA 3GMOA 4AW7A 4MS6A 3C5ZD 5KSAA 1SYSA 2VDKL 2XV6B 2Y3AA 2IALA 4X99A 4OGYL 2NY6D 3GM0A 1KIUA 5DJ2B 1J1OL 2FWOB 3VD2A 3OMZA 4AC4A 5IT2L 3RY4A 3S3SA 3GSVA 3WLWD 2B08A 3C60C 4N2CA 4WUUB 3OR6B 1F4YL 4LLYA 2MMXA 5HHPB 1JE6A 3P0VL 4ZFOB 5H94A 4RGNC 3MV7E 1JDCA 2PWFA 3C6LB 2ZAIA 4IJTA 4KJYA 3ZE1E 3S37H 2XZAL 5J1AB 5B3SB 1N7ML 3PQYD 5T5FH 4XCFH 5GHWL 1ILUA 2G3XA 4ZX4A 7CGTA 4UQIM 2PO6D 4QUOA 5SWQA 4YHML 5FYJD 3DYPA 5A2CA 3UPRA 4MYWB 1WPCA 4PV9B 4U1KB 2GI0A 5E5RB 5TGBB 4WHTA 3UC2A 4JL2A 1ZJBA 2CO4A 3KL0A 4XH2A 3ZMEA 2D3JA 2NOYA 4Q52A 5C0BD 3GSNL 2Z4QB 1HSAB 1MCPH 1OTTD 4AW4A 4JHWL 4TNVF 1M1XA 1ZS8A 3WGVB 1HL5A 1GCFA 2YXVA 1CTMA 3EOAB 3ZYIA 3V5DA 1Y0LA 2AJ3B 4MXVE 1E4JA 2CRMA 2DQMA 4S2SA 2D4FA 2PXYC 2VT0A 3U9PH 5M95B 4JZJA 1T4WA 4WJKB 1M3IA 2DEXX 1UENA 4HJGB 2VXSL 1JWUA 2QADC 2VLMD 2ITCA 3LQAH 5F70A 5JDSA 3U6RA 1P4UA 4S0TD 2FB4L 4ODHL 5H37H 5ITFB 4WK0B 4F33A 5KSBA 4TVPD 2ZX6A 3D69B 4NAJA 3REVA 4F8TA 1U3YA 1UVQB 4U6XB 2O72A 1BEXA 3OX8A 4PD4K 3VSUA 3U4KA 5F9JB 2Q3ZA 1EO8H 4IGBD 5KYUB 5LN4A 4M7KL 4P5TD 3L1GA 4H5SB 5I2IB 1IKOP 4FNLL 1Q72H 3R7RA 2OK0H 1MFBL 4B5EA 3BPNC 3HRZA 4RFEA 4HQQH 8FABA 2WINA 4XCNB 3KHQA 4BFOA 3E6FA 5CCKH 3BAYA 2H1LM 4MRBA 1JD7A 4PM1A 4UUJB 4ZFFA 1XMEB 1MPAL 2CBMA 2PWEA 3MRCA 2GJZB 3I6GB 3MV01 4TQ8A 4WI2A 4XP1L 1T66D 3AU0A 1IL1A 1GCYA 1V5JA 4EEEA 4JFZL 4N2NA 1G7MB 5CD5D 4DW2H 4EN3A 1HS6A 1HC1A 2FD6L 5D7KD 1L5GB 1VRSA 2VNCA 5L88H 3WAJA 3INUH 5I76A 5I9QC 5D1XB 3G5VB 3ZLQC 4Y2OA 1FCCA 5FA4A 1GPOL 3KWTA 3K2IA 3EJJX 4K7PL 4DK6A 1VFMA 2KYIA 2IBBA 4GBXA 4QKTA 3D4CA 1EFXA 1R5IA 1CGXA 2EE3A 1U93B 4EI6A 1IJ9A 5EBWB 1WUZA 2COVD 3AS0A 5JW3L 2C9PA 4HWBL 3BKYH 1RKRA 1ZHBB 4XWOC 3FTZA 1QG3A 5D9SB 4MAYA 1Y18B 3IU3B 2DV6A 3FB5A 1UKSA 4OLYL 2J72A 2B59A 4M6AA 4Z3GA 3KPRB 1EZVX 1K4DB 1O6SA 1OT4A 1WH0A 3ARFB 1RPUA 3QEQE 1VSCA 4YSDA 1Z9LA 2Y69B 1EHNA 1KC5H 1ZSDA 3IFPB 4L3FA 4NZUL 1K2DB 4RIRA 4U4BA 3BUYA 4ZDHA 3SGJC 3QP3A 2CO7B 5C0FB 4DAGL 5G4MA 2CXKA 3ZE2B 3S88L 2ENQA 2XV3A 4OCYH 1MHCA 5I6XB 2COQA 1DANT 4LKCA 5DMIH 5DZ9A 3KLAA 5TDOB 2VAAB 1KXTA 1JHTB 2VDPL 1RJLB 3M17A 4LHUA 3B7UX 5DA4A 4HIJB 3KBHE 4DGYH 5IVXA 3BEVB 3GS4A 3TVMB 3P30L 4QGYA 1ADWA 1HAUA 2MJWA 4XAKE 1JGEA 4H8PA 4U3XA 2CGRH 2YA2A 1S9VA 4PJ9B 5K5YA 5C0CD 3CGTA 2ICCA 3LQMA 3SKOB 4QYOA 3MLPA 2QSCH 2D8KA 2R1XA 3GT6A 4F7TA 1JPTH 5ELIA 5E6IA 4TF4A 3DETD 1KDIA 2GFBB 2J71A 3HG0A 4H1LB 2E9JA 1PAZA 4PJFA 4HHWA 1EUTA 4WWKD 3VE0A 2ZYIA 5CSZB 1F4WH 3EOBA 1E2WA 3GO1H 2OJ1A 2IANA 2ZX9A 2VR6A 2V33A 1UZ8A 5HHMB 1A0QH 5C07E 3QJFA 3KLQA 5BPPA 4HK3J 2DD8H 4A2DA 3T4YA 3RFZB 1BGXH 4A6YB 3D39B 3BPCA 4KFMA 5LCVL 1YZZA 4K15A 4L4TA 4WEMB 5GGSA 4Y19D 5I1LB 1PZCA 5IJKC 2KH2B 4NENB 5H4YA 1A3QA 5E08L 4C83A 1EEYA 3RWGB 1LQSR 4RGNE 4CAGA 4DKDC 2WXPA 1HINL 2ZYHA 4CSZA 3RIFK 2R0KH 1EVTC 1IGJB 1MZZA 2XWCA 5CBEA 1E8XA 1UA3A 1X5KA 1JHKL 1JBJA 2WWKT 3T0EA 2ATPA 3D85A 1SJHB 4RX4A 5FYLD 2YFNA 1S7VB 5L2KD 4I48A 4WFFE 2WNGA 3MV11 5DJ6B 5TK2A 3SDXA 3NA9H 4TTDD 4FA7B 3LH2H 3LV3A 1S9WA 3OXRB 4G8AC 1P4BL 1YC8A 2D73A 4PJXB 2Z8VC 5D7LB 3HE6C 5DC0A 2GT9B 4XO8A 4F5CA 1BF5A 2ENSA 2XQ0A 3P4OB 1IGML 4IKNA 4S1QL 4MA3B 3FUIA 4WO4A 3GS7A 3N43F 3DGGB 3IDYC 1FN4A 2UXVA 4FFYA 2VH5L 2OMBA 4MX7A 4HJEA 1E90A 1T7ZA 2UZIH 3EZJB 5C97A 4QTFA 4U1IB 1U8OA 3KGTA 2AS5M 1GGIL 1A4KB 5FUZL 4DZBA 2GSMB 2C3GA 1J9CT 1G1CA 3KVQA 1RVFL 3CFMA 1IGFL 3H9SB 3AMLA 3C6SB 4OLVH 2GSIB 2D7TL 4Z77B 1KENH 1WT5C 2VO8A 4YDIH 3QULA 4I7ZC 5EU5A 2IFFL 2BSDA 1G6VK 1FNFA 2OMXA 4XC3H 4PCTA 5SWSB 2JI2A 4PRBB 1LP9B 4HFWB 3HJ0A 2WKOF 5F8RC 1P6AB 1TZIB 1MLBA 3MNVA 3V4PL 3SO3B 5E5LA 4M62L 3B5TA 4MD4A 1A2YA 3HNTH 1QOKA 3LEYL 3OF6D 5IOPB 1THAA 2X4TB 1EEZB 3ECVA 2C9UA 5EO9B 1QPXA 2OW7A 4NAQA 4QLWA 3NFPB 3WHXB 1ED3B 2G75A 5FCSH 1ZPUA 4DP1X 1D5ZA 3PJSB 1IKFL 4PJGA 5I5RA 1KMGA 1CTOA 2CK2A 1JCVA 4ELDA 2RFXB 2P8LB 4PI0A 5AYTA 2E6JA 2YD4A 4QT5B 4Y4FA 4ESKA 3OTTA 5JPMC 2YC1A 4N0YH 3HZYA 5ID1A 1ZMYA 2HSIA 4PJDA 5DUPH 1FZOA 5ENWA 3LKRB 3TPUA 3GRWH 5AYUL 3APMA 3NIFE 5F7LB 5CN1A 4I18B 4JZJC 4PJCF 3ARZA 2NY7H 3K1DA 4AH2A 1IC0A 1QSFD 4H7VA 1JF1B 5EEYA 2LVCA 3VXRD 1B4JL 3NSYA 15C8H 5BRZE 2KLTA 4M8UA 3OL2A 2HTKC 4ZNEA 4L8BA 4N0RA 1OAQH 5IW6A 1NL0L 1NANI 3QC5X 2H0FA 5EUOA 1TEFA 4AXWB 1MWAL 1DTUA 1ZS2A 4G7YL 3V52L 1BVOA 1EWHA 3N1QC 1KACB 4J3XA 3US0A 2DQGH 4PGCB 2AMUA 4R90L 1GOHA 3C08L 2Y5EA 3BP6A 4FQ2L 1OF2A 3HRZC 2M2DA 4JO3H 4Z7WB 1FZKB 5LUMA 2H6PA 3CFJA 4JFEB 4ETQA 4UBDD 3L1OL 2C4FU 4Z95L 2NY3C 2A9ML 1GA2A 2R0WH 3BGAA 4RETB 4UT6H 3IDXH 3BFOA 4LBAA 4KNQA 5FYKL 3VXOB 4QRBA 3CXHJ 2AEPL 4UMGA 1GAFH 1L9MA 4H0GA 4QXUH 5E8OB 2R59A 1NUDA 3QC6X 3OKLA 1E2VA 4PGBB 2W1NA 2AK4D 3L4CA 3WNPA 1FFRA 1RERA 3MV9B 4HUXB 3SJVB 4OB5L 4HBCH 2AW2A 5AD0A 2WLKA 3VI4E 5SX4I 2ZOLA 4TLKA 1LE9A 4HWZA 3RWHA 5L4MA 3S2CA 2IPTL 4NO2A 1D7FA 2ZUQB 2NY2B 4R26L 3HMXA 3IWVA 3O4OC 5AZEL 4E41D 1NPUA 3IE4A 2YA0A 2JF1A 4LSQL 1JXDA 5GRZA 4X6DA 1E6JH 3C6EA 4JO4L 5I71B 1DUYA 3NZHL 5TF1H 2PETA 4MAYC 3A47A 3DV6A 3Q05A 1D5XA 5DR5H 3ZE2F 1RUAH 2WLNA 3ZGIA 4GJTB 4OJAA 3BUIA 3L3DA 1J0ZA 4LSRL 4PB9H 2G4GA 4KOCA 4A7QA 2LAAA 2CR3A 3BPOB 3QJRB 2C4XA 4GEJA 2JTDA 2WQWA 2C1OA 1BZ9B 2CKBH 1MG2C 1MI5E 1SOKA 3HE7A 1RXLA 1BMZA 3TM6A 1T89A 4HJUA 3H3KA 4WW2B 2RCSL 3LIZH 4M7ZC 4QRQB 4NQDE 4V1DA 2BY1A 3HCVB 4Y4HD 3FOMA 5IB5B 2E6QA 3NFNB 3PAUA 1FVEB 1EO7A 5AUMA 1SLVA 2Q8AL 5IHZA 2HJFA 2NY4D 1ZK5A 4HIXL 4ZMOA 3SE8L 3BUTA 3HN8A 4J3OC 3S37X 4F3FA 5IFJA 5DDHB 4URKA 2Z93B 1KJMB 2V17L 4KH9A 1KTKE 2VABB 3H7BA 3ROLA 1XF1A 3QPQC 4LVHB 1HH9B 4RFNB 3U46A 4FP8H 4KUCF 6CGTA 1DJIA 2N56A 3B9VA 2GIXA 2FJUB 3GMLA 4NRXB 3VGHA 1VENA 2O5XH 4Q9QL 4EI5D 4M8VA 4M9OA 3L9YA 4CDGC 1OOWA 4FFZL 1K8DA 2FWLB 5E6IC 1WBZA 4LPYA 4PRDB 3AQYA 2AZUA 2D9CA 1CD8A 1EJ6A 3BLPX 1U3ZA 4LEOA 1IGYA 4DQAA 4DZ8B 3QFJA 1EHLH 1CGSH 2XKNA 5J0BA 4M8QA 4O4YH 4EBQL 5TJWK 2X89A 3HG1E 5I1IH 4RGMB 5I30L 2VDRH 1I82A 2NLJA 2VDOH 3NJJA 4K3DL 5JUEL 3UERA 4D8PA 1MAJA 4NHUA 5IB4B 2IQ9L 3PFUA 1I8LA 1DQLL 4DQOL 1KPUB 4JREB 1MCCA 2LHAA 1QUNA 1INEL 1D5MB 3ZKMC 1DFBL 5CWSA 3UG5A 4S1DC 1E8WA 3F6JA 1RLBA 1XGTA 2IDFA 4U1GC 1KT2A 2RJMA 3WUZA 1KTLB 2BW5A 3U4AA 1RZIB 2WVVA 5IWLC 4G9FD 1LLAA 4IHOB 4XX1G 1J0YA 2Q87A 4BWUA 4ZFOL 2BZCA 2FQDA 3HFFA 4NBXB 5E9AA 4YXHL 5A2JH 4XCCH 1A7OH 1J88A 1N6UA 1J87A 2PTTA 5AB1A 1KEGL 1ZD6A 2R39A 2R8SH 3T0EC 1IT9L 1B2WL 2PYEE 4JDEB 3TO4B 4AVIA 2DN7A 4N26A 2E8YA 4Y7MA 3WIHA 4L3EB 1OK0A 1N6VA 1OGAD 4XXDA 4NZRH 3BVXA 2X70A 2ZOUA 4KRMB 4P59L 4YX2H 1FYTD 3IPFA 1RJZA 1T5XA 3BO8B 3IF1B 4OCXH 3RUGB 4BINA 3QDMD 1WFUA 3L7EB 5DMKB 2X6MA 1BW8A 3CFTA 5KYXB 4J1UB 2XX1A 5CJQH 3GFUA 1UYWL 2V9QA 3FBQA 4XBEL 1I85A 3BSGA 2CPCA 3D06A 1UC6A 2Q10A 2G5BB 4JAMB 1T3FA 6FABL 3KBPA 1IUZA 4M61B 3NJIA 1A6TA 4WFHD 5IFHH 4BE6A 3WFCL 6PCYA 3NIDE 2PYFB 4EKJA 1HHIB 1WG3A 4HUKB 4AMKL 1WZAA 3EDDA 4LSVH 3B3BA 2PCPB 4G71B 3H1ZA 3K5SA 3QUXC 1CBJA 3NCWA 2HVKA 4LDCA 2EJ1A 1TOXA 3F2LA 1RH8A 3WJLC 3M07A 4IM8A 4LNVA 3TO2A 2VUKA 5HHOE 2BSRA 2JB6A 5EOCL 3V0FA 3ULVH 1IKNC 5GS2H 2EUZA 5DRXB 4OD3L 3UYOD 4RAUB 5HPMA 1NOLA 3MXWH 5F89A 1J5OH 1EV2E 2NNXA 3MCG1 3BAWA 1SNRA 2Z3FA 2FJGB 4GRMB 1E7UA 1JGIA 5H2BA 3E80A 1NGYA 1NQBA 3PWJB 4NQCE 4IOIB 1DBJL 4Y4FC 3RWDA 3UMTA 5D96B 4Z7OB 5HVFB 4WCYH 4KZEL 5BV7H 2OTWB 3CU1A 4P3CL 1IM9B 3DX9B 5LGYA 3X11A 4U2ZA 1WBYA 1DO6A 3EH4B 3RB5A 4XCYA 3F7VA 3EGSB 1JNHB 3BFWA 2WYZA 3B56A 3ZKQD 4ZMNA 5HYQB 3U7YH 5C86A 2HTLD 3EOTL 3OKEB 4W9ZA 1EVUA 4Z7UA 5TQ2L 3G5ZA 1NINA 1XGPB 1H6FA 2IXQB 1WC7B 2EXTA 3LN5A 5AVWB 2A6DA 2LU4A 2A0LD 1QX1A 2OA9A 3HN3A 3MU3A 3DMMD 4OM0H 4TNEA 5D6DA 5JMRA 3GNML 4IRZA 4Z7IA 2IADA 2PW1A 3EYFB 2UX6A 1DFXA 2APVA 1YN7A 1NOFA 5FC9A 3WMPA 1TVHB 3DDFA 1PIFA 2HUHA 1L6XA 3RTQD 3LKSB 3KPOB 3EO9L 4FJYA 4FG6D 2XTJC 3Q9QA 2X38A 2BVQB 2R56L 1MF2H 1D2PA 4J6IA 5I5JA 1ZA3A 2YD7A 4URTB 5K1VA 4YR6B 4NOBA 4P23B 5FKPA 4OM1L 4TQHA 3CHQA 4GKNA 4XPBL 4GY4A 3UBFA 1F97A 3UEZA 1ZANH 3FOLB 3U82B 3WFDH 4UT9L 4ES9A 1SFDA 1YNTF 4L1TA 3A4DA 4PRHB 3VFVB 5DTFB 4WK2B 4I3RL 5KYWB 2I25N 2ZX7A 3QJUB 1XSJA 2Y7QA 2Y9RT 1ZT4A 4JO2L 2UWEF 5C0AB 3MREB 4PJIF 2YGQA 3MGTB 1HU8A 2BCKB 1TJGL 3BVUA 3GSRB 4GQQA 1HNYA 4QRTB 2AF2A 3MGOB 4KMLB 4A67A 2AJXL 3KR3H 1L6ZA 2GHZA 1VF5C 2FIKB 4LIQH 2J8UB 4Q7DA 1HEZB 3IRPX 1YHPA 4K3HA 4RLDA 4YQXL 4CU7A 3LEVH 1ORSB 4LLUA 2XVBA 1CFTA 1CLYL 3FO1B 1ZK9A 2YQBA 3LH8A 4UILL 5GGVL 4XB7A 4O9HL 4QRPB 3ARYA 4WW2F 4HHAB 5CJ5A 2E9WA 3PWUA 2BOBA 2PPCA 1IC7H 4KXBA 4D9RE 1Q8MA 3LNEA 4DKEL 3WCYA 3D2UD 5IBTL 2V0AA 4ENED 4I0CC 3HE7C 5T3ZL 4BZ1L 3MA7B 1A14L 2I60L 5L8KB 4XPHH 2CA4A 4A2GA 5IP4A 1HNFA 4GUOA 4H8HA 4A6YL 2V5RA 2VLJE 1KTRL 3P4MB 1Q9WB 5FHBL 4HU2A 2AJSH 2GBAA 4QXTB 4Z18A 1EDYA 3X12A 2UV3A 3GJFA 1AQKH 2N1TE 3OLEA 2HMIC 2P5PA 2VXUH 2XN2A 2BP8B 1A6ZA 3TIDB 4IYKA 3CZUB 1RZJL 1Q4NX 4LBEB 3ARPA 4I4WB 5FGCE 1ODAA 2MPVA 1KELH 4U3SA 2UYLA 2F54B 5GRUH 1K72A 2FO8A 1S7UA 1ZDQA 1NUNB 3Q13A 4JG9A 3ZDZB 1TQTA 1JSYA 3ABKB 4NWUL 1R46A 4G7VH 4GSQA 4PRPE 4Z7NF 1TVBA 4KKCC 1EGJH 1EXUB 1TQBC 2G0KA 2LLLA 3CVHB 1F00I 1G4MA 4FFTA 3UCQA 4WV1A 2WHVA 3MRGB 2D7PA 5I1EH 2VUOA 4F8PA 4DN4H 2NUTA 4XVSH 5HDWA 5E24E 1U8QB 2GSGB 2X4RB 3CQQA 2ADYA 4GG6A 1QD0A 5C0ND 4LCCA 1XB6A 2D3NA 4AEEA 5AWNL 5CJOH 1KLFB 3BN3B 4S1SL 5D8JL 4C56D 1KWGA 3FMGH 4HW6A 1I1RA 2DIBA 2WWMD 1HYSC 4FYQA 3KEDA 4P2AA 4P48A 3VH8G 3D2TA 4QRRA 4FE9A 4FZ8H 5CZXD 3TBWB 2FBJL 1AH1A 4EDXA 4JO5A 3FUHA 3WFHA 1QA9B 5CJXA 1TJXA 1H9DA 3UTSA 1DN0A 1PFCA 3AQDA 4KDTA 3V0HA 1IFHL 3QDJE 1PG7W 1HHGB 2WV3A 3EYOB 4WU5A 2F0CA 4M48L 5CIPA 2EUXA 3WTTA 3MFFA 5DU7A 3ULUD 4UQDA 3N1MC 3UGEA 4HS6B 4X9HA 2C5DC 1NBZA 3C60B 3D07A 4IQHA 2DYPD 4Y2DD 3TJEL 1KULA 3K72A 1CTNA 2LTQC 3SDDD 3WIFB 3C9NA 3OHMB 5E1QA 3R06A 1NFDF 4JZOB 1J5IA 2CHNA 2ICWJ 4A68A 1PSKL 2BJMH 1CJYA 3BH9A 5J6HB 3QG6A 3JQOB 2GC7C 5DURD 1I3GL 2XSKA 3IJEA 4Y2LA 2F5BL 5GS3A 1G94A 3O3EA 4NO0B 1OAYL 1X5GA 2QBWA 3ZVVA 3IETA 4D0CA 3FONB 1I85C 1OTSD 3WY4A 1MVUB 4U1NB 5BUPA 1J9SA 1FIGL 2VN4A 2XWBA 1HI6A 2FWSA 2DQFA 3GMRA 3NCXA 4RMTA 3JVGA 5FOJA 1ZHKB 5INCB 4XB8A 3PWLB 5JPNB 2ZPKL 1UM5L 4F2MB 3DK2A 3PWPE 3QAZC 1DE4A 3TBSA 5IJVB 3MRQA 1AGFA 3BQUD 2OZ4A 1OIOA 3DRQB 1X7TA 1UUNA 2HRHA 2PXYB 5BUAA 1F02I 4H8QA 4JMNA 5HHNB 2QQKL 3KJ6L 3ELQA 4FF9A 3PREA 4PJ5D 1E7VA 2QADB 2XTJE 4HDIA 2R29A 3U4BL 2OBGA 4OTXH 4UU9B 3HLAB 1A3RH 1G84A 5E8PB 4LOUC 3TBTB 3OPZH 3NP4A 5C0JB 5TFSH 4F8QA 2RD0A 2XN9A 1BSIA 4EIZC 1EJ8A 1LEKA 3ULVE 3QJZA 4YSUA 1O9ZA 3PABB 2YAEA 4O2CA 5IHBA 1BVKB 1T20A 2JH2A 5DRWB 5KVDH 5L0QC 1WAAF 4W9EC 2W59A 5CHNB 3ZUNC 1BXXA 3QHZH 4WDIB 2Y5QA 4F8OA 4HXBH 2WY3B 4K5OA 4PMFA 2F1AA 1NC2B 1ROCA 3BPNB 3CVDA 1SDDA 3DJSA 3KXFD 3KPPA 4G8GD 4AV4A 2R0ZH 3OMAB 3WS3B 4G70B 4X9GA 4RFOL 5TH2A 1UJ3A 2B2XH 1U8MA 2DQDH 3QWOA 3NYKA 4YGVA 5K9QG 3AQXA 4N90E 1KIRB 4M43H 1JGDA 4GW5B 4FLQA 5FYJH 4KTDH 2X4OA 1Q9KA 1IBBA 5BS0D 1BFSA 2ID5A 1O7DC 5EZOL 2K1MA 1SEBB 4HLJA 3VU2A 4IRSA 1U21A 2YRPA 3IFLL 1A5FH 4NNPH 4X6DE 2QGBA 3G3LA 4FYTA 4NCC1 4OY9A 2ESVE 2NQDA 3S4SB 1JPGA 3U0WH 1PGRB 1XZWA 2E86A 2VQ1A 3MRKB 4LCVA 2XWXA 1ZAGA 2BDNH 4Y9CA 3VGGA 4W9CC 4CVXA 3AITA 2ZYRA 3GBNL 4MNQD 2Y1ZA 4N6QA 4EVNA 3PWVA 4PJEA 1DP0A 2KLRA 4JM2A 1FBIL 3MRLA 4UTBH 1NAMA 1IEBA 3UZQA 2P8MB 4OQTL 1YPZA 4N1CA 4HC1L 4HHGA 1T03H 1E8ZA 1IAIM 1D5BA 2P26A 1QBAA 3X2QB 4NB7A 2FATH 2XRAL 4TVPH 4XN1A 2WCGA 3QDGA 5ETUA 2X53A 4BSWB 1W8NA 2X2UA 5JHDB 2VJ0A 1A25A 1HILB 2KT6A 3PGDB 4MJIE 3ET9F 4FQJL 2P52A 1ERNA 2JXMB 4KI5D 5IKCB 3ZTEA 4LSTL 5C09A 2Y0SA 5I8OL 1D9KA 4P2QB 5C70A 1MCKA 4B7IA 3AS2A 3CG8A 3CV5A 1MNUL 1AJ7H 4HJ0D 4NUGL 4Y2NA 2O5YH 2DTML 2VSKB 5HGHB 1FAKT 2XI9A 1TQSA 4UINH 3F12B 2ADFL 3QPKA 4LIQE 4OLZL 3D0VB 4BCXA 1A6VL 3EZ8A 3E1F1 3FYIB 1T04A 3PFQA 3O3UN 5DI8B 3TA3A 4P2RD 2ZWLT 1H3GA 3CFCL 4IJ3C 3SDCA 5T5NF 1HTYA 1MCRA 1RU9L 3MRIA 1CICB 4JQIH 2ENJA 1FHGA 1T1ZB 2QKIC 4HUUB 4F7CB 4IRJD 5BZZA 4JKPH 2QL1A 3KYAA 1UWFA 4KRPD 3I2CL 1H8SA 2J1ZA 3VFMB 2LABA 5AOLA 1OANA 4G6MH 3SSGA 1HOCA 3RQ3A 1CDIA 1XF5A 4IDJH 3G08A 5F6IC 4BQ9A 2JCCA 4KVNH 1EX0A 3V8CA 2WO3B 2BNRA 2QVIA 4MS8C 4XNMB 1GGCH 3VGBA 4K3GA 4G8IA 1AR1C 1CCZA 4PRID 4RWYL 1MFAL 2QELA 5HDBB 5C2UB 5J6GB 1TFHA 1WIPA 3DVNA 3FCTA 3GB7A 1R3JA 2O5NA 5DJDA 3ZL4H 3B2UC 3L4YA 1T83A 4ECNA 4MJHA 1KBWA 3BSZH 4ICXA 1OWWA 3ABGA 5DC9B 4JFYA 4ZAKD 4GRWB 1N68A 1RP9A 2D03H 4X4ME 1FVDB 4H88L 4L9DA 1J8HB 3GRGA 1NGQL 4GINA 2VRAA 4PN6A 3WD5L 2VR5A 4RZCB 2IPUK 4PJ7B 1U41A 3SYCA 1DQMH 1T80A 3QJQB 4XMUA 1Z9MA 2GTWB 3GMNA 2X6VA 5DVMA 4LCCC 2X6AA 1NGPH 1FC1A 3AU1B 4G11A 4XGZB 1S7TB 2A74B 3D3VB 4HUWB 5E2TH 3VO0A 3HE6B 2F08A 5F1IA 3W9EB 3WYRA 1QSEA 2KBGA 3EDKA 1LEIB 4MB5A 5ECGA 3H85A 3GSOA 1KJVB 1Q9OB 5T1KA 1WZ1H 1X9RA 2O6CA 3DJTA 4N8VB 5LDSA 4XP6L 5CJXC 3ZQWA 3IMWA 4JM4L 5AAMA 3OKKA 4KDTC 1MXGA 2J12B 3H9YA 3BAEL 2VXVL 4YXLL 3APCA 4ZOAA 4ZUUB 4JRXE 1CFMA 3GMOB 4M5SA 4U1LA 5T1MB 5T5FA 1SYSB 4PV1C 5KSAB 5FAAA 2IALB 1XWVA 4X99B 3RWEA 1KIUB 2BOLA 5FFOA 5BZWA 3UJIL 3O4LD 2Z31D 4QR7A 4EDWL 4FFWD 1MHHA 3GSVB 5BRQA 3W2DH 3GMMA 5DEFA 4ZMPA 4KJWC 3RNQA 3SPHA 4L4VE 2HFGL 1CT8A 3QPXL 3FH8A 4LLYB 3S36H 5EA0L 1PY4A 3QUZD 3ZN6A 5M7QA 3BDYH 1QWUA 1OCWL 4P9HC 4ZX6A 1PZDA 3FT9A 4KJYB 4PVBA 5C71A 1MQKH 3HS0C 5HHQA 1EMTH 1PCSA 3NJKA 4KXZI 3HTLX 3AFLA 5SWQB 3K6SA 3UPRB 4KRNA 1IEAB 5TPWL 5D70H 5FYLH 1JG9A 4WHTB 3DX4A 3IXTA 1O7DE 4R3SA 2P5ED 1CU4H 3U48A 2O30A 4XH2B 3MJ7A 3I74A 5FHAL 2F7PA 3RJOA 1SMOA 1KPRA 4H0IA 3SQOH 3JVGC 2DLTA 3G6JA 1M1XB 1ZS8B 4G80A 3P54A 1I1YA 1TZHA 3R0MA 5DT1H 1R0AH 2J8OA 3V5DB 3A3YB 1Y0LB 3TYFB 2WXKA 4M5TA 2ISDA 1RCYA 4PTUB 4S2SB 3KNBA 2A9CA 4OJCA 5ADPH 4JZJB 4YSPA 3WHE0 3IDNA 2NYKA 4LP8A 1JWUB 2DH3A 2ITCB 5JOFB 3L3HA 1XF2A 5JIDA 5JDSB 2VJXA 3U6RB 3QG7H 1ZJAA 2HKHH 2VDNB 5KSBB 4HFUL 5LBGA 4KNTA 3REVB 3VQ1C 1HQRA 3MUY1 1P7QD 4PS4H 1MIEL 4OLXL 3KMDA 5B38G 3E6HA 2I7OA 1YEWA 2Z6FA 4AOFA 4JPWH 3C5JA 3ABLB 1H3PH 4FYSA 4YPJA 1F4AA 3L45A 2F53A 2FNWA 3HRZB 2PP7A 2Z7ZA 4RFEB 1T2QL 2GABA 3VU1A 2HRPL 1DBBL 8FABB 5KVDE 2LU5A 1DZ0A 3LMJL 2NT0A 3E6FB 5TTRA 4YDVA 3S5LA 4OZFA 5JMOC 2FX7H 4ADJA 2VISB 3FL7A 1OE2A 5GIRB 4ZFFB 3MRCB 1UJ3C 2A77L 1S46A 4K8RC 1QHPA 3ZL1A 2NY1D 1IL1B 5C8JA 3ETSA 2P3YA 3SOBH 3FF7A 4N4YB 1WYJA 3E9TA 4NQSA 3PQYE 3WIAA 4EN3B 1WFOA 4JEGB 4IRSC 1RJYA 3DJZA 1MCSA 5HGAA 1PBYA 5FYJE 5I76B 5F3BB 4CKVX 4GO8A 2WWNA 4JFXA 3B9KA 2VLRD 4Y2OB 4OSUL 4YFLF 5FA4B 1TETL 4ZTEA 3LSOA 4U33A 4XP4H 4JK0D 3V55A 3MV8A 4GBXB 4X4YA 4H25A 1YEEH 1EFXB 3ZDXB 4Z5RB 3L5HA 1E9PA 1LDPH 2XQYG 4EI6B 5C0BE 2CJUL 1Q1PA 3O4OB 2D2OA 4ILDA 4MKTA 1Q9LA 3B3IA 5JIMA 1SBSL 4AE0A 1RJCA 3GBLA 4LLDA 4PUBL 5LG1A 3X3GH 4MAYB 5HYIA 3FB5B 4F8NA 1HKLH 4M1GL 2B59B 4J7RA 1F6AA 1O6SB 5A1AA 4OZGE 4CVUA 4QXGH 1WD9A 1ZSDB 4RIRB 4ZDHB 4XMLH 1DLHA 2VLME 3BUYB 4TS6A 2CMRL 1OPOA 2JB5H 2UXTA 3GLDA 3HR6A 4TPRL 4EUPA 2EDNA 2NXYC 2VW7A 3MLSL 1K3ZA 4TVPE 2X2JA 3ALPA 4MA8L 4TRPH 1WWWX 2R1YA 5ICYB 4JY5L 5I6NA 1UQSA 1MHCB 2XU9A 4UNIA 1IAIH 4LKCB 1D9KC 3WSQL 3KLAB 3M17B 4JGJA 4LHUB 1E43A 2MOQA 3MAWA 1BFTA 5F96H 4KFZC 5IVXB 3CC5A 2Y7SA 5AZ2L 2OI9C 2A38A 2X40A 3CVHL 3REWA 3TPKA 5GS1A 1TFPA 1JGEB 2OMNA 1SQ2N 4MQ7A 4KTGA 3MJ9A 4ELKA 1JK8A 4D3CH 4NQEA 5HGGS 1PF3A 1S9VB 4GMTL 1OL0A 4LHJB 2SODB 3TH4T 1FC2D 2CSPA 3QIUA 4QYOB 3SDCC 1BV8A 5FLVA 5T1LD 2C26A 2R1XB 4F7TB 5D7KE 4LEXH 1PKOA 3IGUA 3IMVA 4CNIA 5E6IB 5JOPD 2HKFL 4ONFH 3W11D 3WTXA 3IJSA 1QR1A 1I9EA 5C3TA 1JGVH 2F15A 1X5YA 5DMYA 4PJFB 2QVKA 5TDPB 4H20H 4LPVA 2EE2A 3VE0B 2CH8A 5BVPL 4GO6B 3EOBB 5K93A 2IANB 3S2AA 3CZSA 4B5ZA 3OG6B 1DBML 1UZ8B 1XXFC 3H2QA 1C1EL 2CCLA 1D6EA 1FFQA 5CMAA 2H8PA 3EF7A 4GKLA 4B9PA 3RJQB 3T4YB 1UGNA 2JI1A 3BPCB 4N2DA 4YL9A 3EHBC 4L4TB 4PJBF 5GGRY 3NEEA 3MLVH 4PEEA 5D7EA 4P99A 3TCLA 4U1GB 4PJ7F 3ABZA 4I9XA 4C83B 1EEYB 1RIHH 3ZR6A 3MSPA 5C0RH 1QZNA 1OOAA 3F6LA 4FI7A 3N55A 5KSUA 5CBEB 1X6NA 3EYQD 2DS4A 1BIHA 4RISH 3QUHA 2KZWA 4PIRF 3RVTC 3T0EB 3KYKH 2ATPB 3D85B 4UBDC 4ATWA 2PR4L 5JHLH 4OW6A 4C57C 1D5RA 2XJLA 3EJZC 3PL6A 5CZRA 1PYWA 4I48B 5DQ9A 1J11A 4HJJH 3SDXB 4XCEA 3UO1H 3IN0A 3LV3B 3QUMH 3Q6GH 4OFKA 5I1CL 1BDYA 4QD2E 5EDSA 3BKJH 1YLBB 3P02A 3Q6FA 4HKZA 3WFEH 4X4XB 2DI8A 1BD2A 1BZDA 4IKIA 2C4FT 2OZNA 4WI7A 4WO4B 3ARBA 3RU8H 1FN4B 1XGRA 1QBBA 3MACH 4MX7B 2MCPH 5C0CE 1G1OA 4CU8A 2O26U 2W60B 2XG5A 4PBXA 5AAMC 3S35H 4DUVA 3F58H 1JGLH 1U8OB 1JERA 1ACCA 3OLDA 1A6PA 3QI9D 3QDAA 4DZBB 3PRZA 2MPAL 1M42A 3KG5A 1I1FA 1OT2A 3BX7C 4BQ6A 1OPGH 3EJSA 4GFXA 3PY9A 1UEMA 3GPEA 3QULB 1YEDA 2OP4H 4NKIL 1FORH 1N0LA 4PY8I 4XVJH 1CVSC 5EU5B 4DP6X 4JHZA 2OMXB 4ZPVA 5CCGE 3HHSB 4XOEA 3ZX1A 5CJ8A 2CZNA 2A6IA 1I7ZA 2FHBA 3MNVB 5ANMA 2WMPA 4I3GA 3FO9A 3JWDL 1JNNL 2A1WH 2CHZA 3PYCA 4MD4B 4Y19E 4I0PA 5K9JL 1FNHA 3PV7A 4G82A 1QSVA 3FRUA 3N85H 3GRWA 4TNFA 2Y5TA 1GL4B 3RL2A 4G6JL 1IMHC 1KLUA 1J1PL 2VR7A 5FUOH 3ZT5A 5I1DA 1MFEH 2G75B 4XXCA 2BNQE 1D5ZB 4M3JA 2AEQH 1HKFA 4PJGB 5ALCL 1YEGH 4MCNA 2FECI 1OSPH 4OR1A 2JELL 3UJTH 4YHNA 2FLRT 4HD9A 4Y4FB 3HI5H 1C8PA 2BVUA 1DDHA 2YC1B 4G5ZH 5DLLA 5FYKU 2WXQA 1VDGA 5L2KE 3HZYB 5ID1B 2DQHL 4ABVA 2HVBA 3T6ZA 3T0WA 2VXQL 4PJDB 1FZOB 5ENWB 4H4NA 2Y7NA 3TPUB 3NMEA 2IBZX 1B9KA 1RFDH 2XG4A 4WY7L 5KAQF 4KMTL 3BH4A 4AH2B 4B9FA 1OLLA 2BIIA 2FH8A 2H32H 4WK4B 4ANWA 2XIDA 2I9TA 5ACMA 2ZSWA 3DXAD 3PXHA 3TL5A 4R7NA 5KVFL 4ZJ9A 3ZHDA 2FK9A 3BT2H 4L8BB 3GC3A 4O5LL 4P8QA 4K3EL 5IW6B 1BAFH 2FT7A 5EUOB 4HWNA 2E7HA 3LXBA 5DHVA 1SM3H 3V95A 1C5CL 4IHBA 2VZTA 1I3VA 3FO0H 1RHFA 3BP6B 4WUUD 1OF2B 1G7LA 5K9OA 1DJWA 4HCRH 4YZWA 2WLMA 2H6PB 3CFJB 5HI4C 4ETQB 4J2XA 5DJ8A 3MQIA 5F9OH 4BIKA 1IM3B 1U8HA 1RD6A 3C6LD 3TT1L 3VXQA 5I6MA 4JVUA 1GS7A 1XD1A 2YD5A 2EDFA 2IAAC 1HWHB 4KNSA 1AQDA 4FEIA 3OKLB 2X2YA 1QBLL 3LS4H 3MYJA 3O8XA 3U2IA 4NN5B 4D0BA 3FB8A 3VMNA 1LHZA 1RUMH 3N06B 4AJWA 5AD0B 5KG9B 1NMBH 4A7UA 4FA8A 2CKBA 2ZOLB 4MXWL 1LE9B 1MJ8H 2FQGA 4HWEH 4HWZB 5C08E 1BLNA 4NO5A 3RWHB 4UTAL 5I1KL 1LWJA 1UOWA 3HC3L 4NO2B 3LIZA 1AG6A 1E2ZA 1U95A 5I1JL 4HSAC 3ZE0B 4K71C 3F04A 4Y1AA 4QRAA 2YEQA 1DUYB 4EJ1C 3DSNA 5FDWA 1V3KA 3DV6B 4RMVA 1D5XB 2VB5A 1PZAA 2A6KA 3CSTA 1YAIA 4HF5H 3L3DB 3HFML 4K94L 4KAQL 1X3DA 3S48A 3NSDA 3SKMB 5DZNA 3ZTNH 2E27H 3O2WL 2ETWA 2D3LA 1FFOA 1QSFE 2WXIA 3P3TA 1ACZA 2C1OB 4W9LC 3VXRE 2KHAA 3HE7B 3HNSH 4XPAH 3B8YA 3AUWB 4HOZA 1Y6NR 1HWGB 3QHTC 3VI3E 1C9SA 4R4ND 5AW9B 1OALA 1EZLA 4J3UA 4V1DB 2AK1H 5HVWA 5GGRA 1B2YA 2X3AA 3FOMB 4FABL 1WFNA 4GAAA 1D6VH 5AUMB 1JZDC 1KG0A 2HJFB 3VGEA 2YN5A 3GEFA 4LEEA 1IV8A 4MQXC 1PTZA 3NRPA 4Y9BA 5IFJB 4IS6A 4F3FB 2TAAA 3TWCL 4ODTH 5EOCJ 5B8CC 3T1WA 4QXWA 1A3LL 2DJ4A 3H7BB 5F7MC 3ROLB 3HUJB 5F7KC 3PDOA 1FLRL 2B0SH 3JWNG 4XNZB 3W3BA 3U46B 2O1AA 3A6CH 5GS1C 4XNYL 2ZXAA 4W4OA 3GMLB 3PV6A 4PAZA 5C0EA 3V0VA 3APDA 4WWID 4Y5VA 3QIUC 5D1QD 3B5HA 1TQBB 1K9TA 2D7QA 2I69A 3IDJA 4KKNA 4NSKA 3FQ2A 3T3MF 3ML8A 3VWKA 2BMKA 5DHMC 1K8DB 5D1XD 2AK4E 3UOAB 5H4ZA 1WBZB 1IARB 2ZIDA 3O6LH 4OVVA 5D2NE 4PY7A 5F44A 5FX3A 5CSBA 1LO2L 4LEOB 3VWJA 4R84A 5ITBL 1IGYB 2LFEA 4XWGL 3PHOA 3QFJB 4ORZC 4X6CF 2XKNB 1TTBA 2QMKA 3J7HA 4M8QB 2FSEB 4JG1H 1AZNA 2AQRA 1SHWA 4E41E 5DUMH 2NLJB 4HMCA 3KWVA 4D8PB 3TJHC 3ZPDA 1U0QA 2W9EL 3HIZA 1I7UA 2AHIA 1CS6A 1TTGA 3ARFD 1EPFA 1QUNB 2HFEA 3BIKA 5CWSB 5T5NG 4R7VA 4JRYA 4ELME 1XGTB 1HN1A 5JXEA 5K69A 1KT2B 1PKQE 3E3QC 4FMVA 3CDCA 3O2VL 2D7MA 5AVTB 3S3PA 2WVVB 2K6YA 4BSVA 1M9SA 2ICEA 4FG6C 1CD1A 1NAKH 1YVLA 3BVNA 4I8DA 2L7QA 2PTTB 3N50A 2M1KA 3DO4A 4UDTA 1AO7D 4PJAA 1OE1A 2F7QA 5D7SL 3RGBA 1ZGLB 3MJGX 2DKUA 4ALAL 3LXUX 5FWQA 3FT0A 5IEKA 3H42L 2BOCA 2GIYA 4C8XA 4XXDB 1ZLUK 5E94A 3TVMD 5I1AA 2X70B 3F7YA 1AAJA 1M4KA 1RJZB 1BX2A 1T5XB 1NEZA 3QNFA 1BVLA 1WWAX 3QQ9D 4I0KA 2YK1L 5FV1L 3V4VA 4NPYA 3HNVL 2TSAA 3IMUA 5CBAB 4PJ9D 1ZCRA 3MNDA 2WYHA 4M6NH 1UD8A 5HYSG 1A4JB 1AFVL 4Q6YA 4YSTA 3KW8A 4UIKL 2BXYA 1BG1A 2X05A 1T3FB 2R0LH 1UXWA 5B3NA 1G7PA 1A6TB 1CXFA 1KWKA 1SHSA 3B7SA 4TL5A 4KHTL 1CLZH 3TTSA 1U4FA 3K2KA 3LNIA 1VPOL 4LLVA 2KERA 1MFDL 3QCVL 1TJMA 2IO5A 3QK0A 2HVKB 3QAZB 4QMEA 5T3ZD 5HHMD 5C0DA 2VDNL 4KPHL 1N5YH 4GSDH 1GY1A 4JCLA 1GR7A 3TO2B 1CO1A 3O6FA 2QQLL 5TE6H 2BSRB 4DKFL 2JB6B 4YE4H 3PG2A 2FHCA 1FYHB 4X6BA 3VWJC 5HPMB 5BXFA 1KBVA 1SOSA 35C8L 1MWOA 4I0PC 1V27A 1DVZA 3CUPA 3ULUH 5F89B 2NTFA 5DQJA 2QFPA 4NZJA 1U36A 5CN2A 5B39A 1CN4A 4WI5A 4YDLB 4G9FE 4TNWK 5E99H 5HJDA 2GJ6A 4MVBC 5L0QB 4ZPTA 4XXCC 5H2BB 1NGYB 4FQXA 4JPIA 4Y5YA 4KV5E 2EDTA 1HL4A 1XH0A 4XN5A 2CO2A 2IDUA 3RWDB 4PJHF 4PWGA 2B16A 1BFVL 4ODSL 3QEUA 3MUZ1 1XBRA 5MERA 1V3LA 5MEQA 3CHRA 3X11B 2VITA 5D7LD 1FYTE 3F7VB 4XCYB 4D0DA 3D87B 1AHKA 4DO6A 1B0IA 4X0KA 5LGHH 4JDZA 4LCWD 4NCC2 5DZAA 5GPRA 2XWDA 2RQ8A 4Z7UB 3QDME 1PCXA 3LS5L 4GS7C 3G5ZB 1X4XA 3QSKB 5DK2B 4MZRA 3LN5B 4B9YA 2A6DB 4AYBA 2Q8BL 1ZLSH 1DJXA 2JQMA 4WNSA 2R4RH 2B15A 2HUEA 4JFFA 3N41F 5C0NC 3DIVA 4W9JC 4FQ1H 2IADB 1HHJA 2PW1B 3VRIA 2EYTA 4XPFL 5I0WA 1SHMA 1TZOA 1YN7B 4WFHE 2A9DA 4N0CD 1EHAA 3H9SD 5CLTA 5D7IE 4DPRA 4W9FC 5EU7C 4B3VA 3WTSA 1IC4H 5CZXC 2P47B 1CXKA 2HPTA 1MFNA 1ZA3B 3P3SA 5SWSD 5J1TC 3JWNH 4J2QA 2HT2D 4UF7C 2MQ0A 2EO9A 2NPLX 4EAEA 5KUKA 3NEOA 3S3JA 2VZUA 1H8NA 2ZE0A 3OAYH 4M3KB 4GKNB 3RP1A 3OSVA 3F7KA 5DJ0A 3L4VA 4OV6F 2Y7QB 1OAKH 4JN1L 1I8AA 1ZT4B 3MLRL 3U6XA 3O8XC 2D7NA 3FCSA 4IK7A 3AM8C 4IOFC 4MJ6A 2FJFA 1KYUA 3ZO9A 4YJZL 4RH4A 1AZVA 4TUUA 2R83A 2CHXA 1AY1L 3FQTA 3NFSH 5L2JA 3L48A 5F88A 1PJ9A 1BBDL 2O5ZL 5C1MB 2FLBT 4UQ2A 4LLUB 3N44B 2WYIA 1V7MH 1CFTB 4QHMA 2YBRA 2EIDA 1UD2A 4P07A 4Z1PA 1VGKA 1RL1A 3FUEA 3S35X 2N4IA 1JMZA 5CR8A 1XCQA 3SCMA 1PDKA 2XFXA 3WKPA 1OTSC 5GJTH 4KTYA 2OYKA 3PWUB 1RK7A 4EPSA 4IJ3B 2BOBB 3N9GL 1W0WA 5KBDA 4YDNA 1OW0A 1CFSA 3FQNA 1CYWA 1QLEH 3O81A 4LSPH 4ODWA 3KYNA 3S8WA 1IRAY 2TSBA 4MMYA 3CSGA 4OIAA 3HUJF 1JD9A 5D4QA 3E3QE 4YDZA 4OGYH 5TDNA 3VFPA 2CPUA 5F6IB 3KCWA 1J1OH 4GXUN 1A7RH 3X12B 3GJFB 2EEFA 5IT2H 2P8PA 4WJ5A 1LNUA 4IBUA 4ZSOE 1AR1B 1UA6L 4OI7A 1I9RL 4JFED 1A6ZB 1KGJA 1G0DA 2FT6A 1F4YH 7FABL 1Q38A 4QRSA 4G6AD 4XPGL 2OW6A 4U3SB 2UYLB 2OV0A 4KO5A 1HL9A 4W4OC 1S7UB 2JIXA 3MBEC 3ULAB 2P1YA 2XZAH 4Y5VC 1N7MH 1TVBB 5CCJA 2FYYA 3R1GH 5D7JA 1DL7L 3VWKC 2WUCH 4YHMH 2IGTA 4WV1B 5CGMA 3MV9D 3VRLF 3SJVD 1E5AA 3MX0A 5HYJA 5E2JA 1HL8A 2NUTB 5D7HA 1FPTH 4XX5A 3NIGB 4U3HA 5I16A 2EIBA 2JFCA 4GXUM 4GG6B 4LCCB 3FQXA 2R2EA 7PCYA 1N6QL 2NY2D 4FFYL 1O6VA 2F8VA 3GSNH 3U9UA 3PJNA 4JHWH 4HXAH 1RIVL 5I0VA 2Y3NA 4YHKH 3TH3T 4JQVA 3WAKA 1FGNL 4QRRB 3ARGD 5MENE 5BZDA 1QI4A 3DX0A 4B9CA 3Q01A 3WFHB 4AKPA 3I50L 4QHLA 3VB9A 4UAOC 3UTSB 4HAGA 3OAYK 5JXEC 2P5WA 3MA9L 2VXSH 4M6OL 3MRDA 4LOEA 3VD3A 1OE3A 4WU5B 2FB4H 4ODHH 4TSBH 1RZGA 3I9IA 5CIPB 3MFFB 4GI8A 2EKJA 4YMPA 1NBZB 4Z8FL 4M7KH 2VN3A 1T2XA 3K72B 4JDVA 4NT6A 4ZD3L 3C9NB 4FNLH 3QWRD 2WZPD 2IH9A 4IOSA 3Q2CA 1DEDA 2ZWSA 1JZ3A 4C54A 4NPKA 3RGVA 3BH9B 1XGYL 2ICES 3L5XH 4IU3A 3QG6B 5AW2B 2BIHA 3IS1X 3SBWA 4OZHE 4YO0A 3EJUA 3GGWA 3EH2A 1F58H 1MPAH 2CO3A 3IJEB 4L5FH 3O3EB 1KGWA 1YYML 2O6DA 3MLXL 3TOPA 4XP1H 2ZJSL 3IETB 4JFZH 2EXWD 5HJ3A 4D0CB 3V6BR 3NCEB 5CEZL 3JUYA 3GPSA 3TF7C 3EFOA 4P3WA 1KZQA 1RZ8A 1RHHA 2FD6H 3RKDD 1RSFA 2XWBB 1NLDH 1HI6B 4IU2A 2DQFB 3GMRB 3MLUH 3O45A 3VXUA 4TLTA 3T65A 3T3PB 4K7PH 1UASA 2BP0A 4HCIA 1H6UA 4FQQA 2ZWZA 1BZQK 1BQ5A 4XMPH 1DE4B 3MRQB 1AGFB 3QO0A 5JW3H 1SMDA 1Z0MA 2JSFA 2OYLA 4HWBH 2EDEA 2NXZC 3GBDA 3STBA 2AJZA 1SEQH 1CDHA 2IEPA 5EU7E 4IRJC 2WCSA 4NRZA 5DHYA 2MHAA 1W8EA 4OLYH 4G83A 1N4XH 4WTQA 3V10A 1SRDA 4EN2A 1OM9A 4F20A 4CJ1A 3JWOL 3C8KA 1NGZA 3C2SA 4HGWA 2PO6A 3GXMA 4ES8A 4O2EA 3BE1L 2GK0A 2XN9B 3OC8A 1KDJA 1LEKB 4NZUH 3OLIA 4O2CB 5IBUG 2CR0A 1HEHC 2EYSA 1T20B 1USZA 5B1AB 1RUKH 1XF3A 4DAGH 4XN7A 2J5WA 2PPAA 5F0PB 4Y5YC 2W9LA 4L0YA 4RA0C 3TO4D 3O41A 1SDDB 2Z1PA 2VDPH 3PP4L 4PCYA 1GZHC 3UFIA 5TH2B 1UJ3B 1U8MB 3QWOB 4YGVB 5DO8A 1D3CA 2I9LA 1Z3RA 4NM8L 1JGDB 4HAFA 2X4OB 1UD3A 1Q9KB 3DPBA 3DTUB 4QJ5B 1A7BA 1KF9B 3P30H 1ETZB 2VGLM 1DQQA 4FI6A 3US1A 5KBNC 2Q5BA 4IRSB 5F2FA 2EAEA 1X5JA 3L4UA 3ZDYB 5AAWA 2FEDD 2CBQA 2PNDA 3HMXL 3N42F 3WUWA 2ZKWA 2XYBA 1M7DA 1JPGB 3F84A 2VQ1B 4JFQA 3E7JA 5IROD 5IVOA 4Q56A 4KKPA 2PCFA 4MQTB 1AGCA 4CVXB 3ZTCC 4LASL 2GI7A 3ARTA 3EJQA 1UD6A 4WNQA 4EVNB 3PWVB 4PJEB 4JM2B 5DWUL 1DQVA 2CLRA 3MRLB 5BQ7A 4ZS6C 5F0MB 1NAMB 1IEBB 3UZQB 3N40F 2Y06H 3AQZA 1JOIA 3GSUA 4UANA 1YPZB 3ARQA 4HH9A 5J3HC 3OM3B 2ZP8A 3JYCA 1D5BB 1OCRB 1FRGL 1SJMA 3FB6A 4XXWA 1UWGL 3QDGB 5EOTA 4K73A 2CCWA 4PJ5E 3FN3A 4WWPA 3VH8A 3BMWA 1XB8A 3A21A 3JWNE 3QUYA 1FAIL 4IBLT 5LCVH 3L6FA 1U8CA 4N6RA 4L0PB 3N44F 1X5FA 5E08H 3OXSA 4HT1L 2F74A 5AL8A 5C09B 1HINH 2Y6TE 4AYGA 3UG3A 1AMYA 4NERA 5CGBA 4R97C 1JHKH 2ZCHL 3KXFE 2OI9B 1IM9D 3U6XS 4UAHA 4GUCA 5HTSA 1T04B 3ISYA 1NDMA 1IGCL 4A38A 1P4BH 3TA3B 2GPZA 5BO1H 4E5XG 1NUFA 5BS0E 2X2IA 3OKMA 2XA3A 3IYLW 3D18A 3SDCB 3MRIB 3HR5A 4S1QH 1OW0C 1PZBA 3HVDA 4XAWL 3LZPA 2VH5H 1DQTA 1L3NA 3MLZL 1CGYA 5I74C 5ACZA 3CSFA 1H3TA 2APXA 1XGZA 1FL5A 1IC5L 2M83A 2X10A 4JR9L 3ETBF 4LEBA 4FQLL 4WFED 1IZJA 1GGIH 1WK0A 2PWGA 4BQ8A 5FUZH 1HOCB 1XGUA 4MSWA 4A2LA 3G08B 4MNQE 3U0PB 3H4HA 1B4TA 2JCCB 1DVSA 1IGFH 25C8L 2BNRB 4EO5A 1YNKH 2AXGA 4G8IB 3V0EA 3ZSTA 4HIIB 2IFFH 3WKML 4P23D 1H9VA 3FCTB 4MA7L 3GB7B 2E74C 1R3JB 5DJDB 4MAUL 1QNZL 2D3VA 4NC2B 3QRFM 2KI6A 4GAYA 2C3WA 3FTUA 4PRHD 3MUHL 3V4PH 5A43C 4M62H 3RZCA 4JFYB 4YXKH 1KTBA 3LEYH 1FV1B 3VXMD 3WIHL 3T09A 5C0AD 1HAWA 3NN8A 5D7JC 1Z3GH 1YUHA 3Q2LA 5HHPA 4KRLB 2EO1A 4L0ZA 3ZE1F 5C0GA 1DVFD 3GMNB 4ADIA 1KBPA 1IJNA 2WXGA 4GW4A 4HLZG 1YRKA 1HE8A 1JWSA 4XVUC 4MWFA 5FW8A 2KS0A 1URIA 2FNBA 3VMOA 2WKLA 3BWUF 5F1IB 2OFQA 5JDJA 1QSEB 2XC8A 4QRPD 1EJOL 2WKOA 2VRKA 3GSOB 4JQVC 5T1KB 4MZ2A 4Z7QE 2Z7WA 2OAAA 4P2RE 3OC5A 3JUZA 3AREA 2MSPA 1TJHL 3IK2A 5AYUH 4H0HB 1P7BA 4Q6KA 3OKKB 3LNDA 2F58H 4RDQF 1XH3A 4U1LB 4XNAA 3RWEB 4BFIA 1B4JH 4MXVF 3FKUS 4AENA 5BZWB 1L9NA 1Z5LA 3UTTA 5GS0C 1P1ZA 4KK8D 2PCYA 5C3LD 4YSQA 5CN3A 5L7XH 1HXKA 1BAWA 1MHHB 1NL0H 3V4LA 3GMMB 1MWAH 4G7YH 1G9HA 4HIHA 5DEFB 3RNQB 4LL4A 3MPCA 3V52H 1CT8B 3PAVA 3VSQA 2F18A 4N5UA 3O0RL 2ZUXA 3QNXA 2GJ6E 1T7XA 3BVVA 4R90H 3KL3A 3BZ4B 3RGVC 1DVQA 5IUCA 4BV1A 4JKNA 4N0FA 3L1OH 5HHQB 2F54D 3L2MA 4Z95H 4PJCA 3HVNA 4O2FA 4ZODA 2A9MH 2VWEE 4F57L 3K6SB 3CXFA 1KIQA 1OAXL 3H3PL 2V5SA 2AEPH 4M93B 1BVNP 3DSFL 3IXTB 2W80C 4R3SB 5A6MA 5D5ME 3EYUL 3VM7A 3MJ7B 3MRNA 1EUUA 1KPRB 3VA2C 4MZ3A 3IRCA 4J12A 4OB5H 3G6JB 4G80B 1CG9A 12E8H 1TZHB 1UB5A 2XT1B 1SLXA 2WWKO 4CILA 2I32A 1NCJA 1G7MA 2IPTH 2VSDA 1OF0A 3RRQA 2AI0L 3GIZL 1KBKA 4N3UA 4UV4L 4IRZL 3KNBB 1QEWA 4LRIA 4LSQH 2NW3A 3IDNB 4KJQC 5HI5D 1TLKA 3NZHH 1DJGA 1XF2B 3QFGA 5GJSL 3L2LA 3QXTA 5KS9E 1N0XH 5JTWA 1M1SA 3N0AA 4CW1A 5IW3A 3FYEB 3NCYS 1SN2A 2BIOA 5AVVB 3ZMNA 1HQRB 5E8EA 4FHJA 3AUVA 1NFAA 4MXQC 2WZ5A 1GKOA 4L37A 4TUOA 5AW5B 3C5JB 2ZXGA 4DCQA 3O4LE 3QZPA 3C60D 2F53B 2IG2L 4B0MM 2XWTA 4WKXA 4KY1L 3VGFA 2Q8AH 1KIPA 1MOEA 2VSMB 2VLKA 3S5LB 5LO7A 4YDVB 2BSBA 2OSYA 4OZFB 4RGND 2NNFA 3IWUA 3SE8H 1UACL 2IH3A 5AALA 2X1OA 1E8YA 4Q4IA 5C8JB 2K45A 2XIBA 3QJVB 5FR3A 1E27A 5EOQH 4NN7B 4NQSB 2DZEA 2YQGA 1RJYB 4NO0D 5G2NA 2BWQA 3VB8A 4XMTA 5ISZE 5HGAB 1PG7L 3ZIYA 2VAAA 2DWDA 1JHTA 4N2KA 4TKWA 4EMZA 4WFFD 3B9KB 2DRUA 4HJIA 3LSOB 4Q9QH 1J05A 1YPZF 3EJRA 1NZRA 3MV8B 2P5EE 4X4YB 4H25B 3EDEA 4FFZH 3OG4B 3KD4A 4UOQA 1E9PB 3U0TA 2WN2A 1A4AA 3BUDA 5AOZA 4FXLA 4BFJA 1BBJA 1Q9LB 3B3IB 4K71B 4PJ8B 4U31A 3VXTA 1KV7A 4LLDB 5E9DE 4KGJA 1I53A 3TWYA 1HZKA 2PXYD 4HEMA 5I30H 1BZ7A 4HZAA 2XY1A 4K3DH 1YY9C 2QADD 4W81A 4MB1A 4J27A 4XXWC 2HCZX 2IQ9H 1GGBL 1QP1A 3X1NA 1DLHB 1DQLH 4ONGL 4DQOH 5FM4A 3BWAA 1INEH 2MKWA 3JTTA 3WIIL 1DFBH 4EUPB 4R8WH 3NDZE 1MEXH 1VEMA 5CSZA 4DPAX 4H1LG 2R1YB 2Y22A 2X09A 1UQSB 4BZ1A 1JVLA 2WTOA 3SO5A 1ZE3H 2Y07L 5GZOA 3MCKA 3BISA 4HLZH 1NC2D 4YXHH 1KGIA 5EORH 1MFVA 1KEGH 4DK5A 1TO5A 1JPEA 3CC5B 2C34A 2WTRB 2DBLL 1P1VA 1B2WH 4LAJH 1PL3A 3ARWA 1BIIA 4W70A 3REWB 3R0NA 3LKQA 4XPTL 5GS1B 3F01A 4MQ7B 3SDYL 4ELKB 1JK8B 3MRMA 4NQEB 3S5ZA 1EH9A 4M4PA 4DOHB 3AG2B 1R47A 3QIUB 3IDIA 4EZMA 5CR1A 1ZHLA 4CNIB 4KDWA 1XL4A 4HJ1A 1YSOA 5GGUA 4CGUB 5F7NC 3NABH 2JJVA 2VLRE 1UYWH 3IJSB 3AC0A 3K6IA 4XBEH 4NKMA 3AMKA 1QR1B 5IQLA 3LJ3A 1MXDA 2PW2A 1FNGA 1VEPA 3K46A 1YEJL 2GYSA 6FABH 3KDPB 1QW9A 3WFCH 1KEMH 2P4AB 3H3BC 4LE8A 4HOWA 2Q6WA 2BY2A 4MA3A 4JFDA 4XWOD 4AMKH 4N0UE 4M7JL 1MSPA 4YN3A 4XMZA 2EILB 1D6EB 3H7LA 4AVJA 4LLWA 5CMAB 2H8PB 5J06A 3GZKA 4JKWA 2OTPA 1LL1A 1J8RA 3HPLA 3H2WA 3SPCA 4XNDA 4UT7L 2W81C 3TCLB 2H1PL 1MCFA 2XZCH 1AD0A 1O5PA 1IQDA 4FTDA 5EOCH 3G9AB 3T77A 1Z1WA 3ECBA 4LU5L 3T6WA 1MCQA 4KX7A 3EXLA 1L9SA 1PY9A 4OD3H 3RZCC 4OCSH 1CZ8L 1YUKB 5KSUB 3CHOA 1JZFA 4P9HL 1ZHNA 2Z8RA 2PPFA 1UCTA 3VD4A 4P2QD 2UXGA 5B38A 1SHXA 4HFWA 5KBLA 3FSVA 2F7RA 3DIDA 4X4KA 3PL6B 1EA9C 1PYWB 3C09C 4MHHG 5DQ9B 1RULL 1UURA 4XCEB 1W6WA 5JIHA 4D8OA 3KLHC 5GRJL 1DBJH 4RBPH 4HPYL 1OGTA 3Q6FB 4HKZB 2PLTA 4KZEH 3KW7A 4BFEA 1BD2B 1KTJA 3WV0A 4P3CH 1G1KA 3ARBB 2J44A 5KYYA 4OZIE 2NY0C 1FWXA 3NAAL 1XGRB 2C9XA 4Z7VE 1C7TA 3D0AA 2P43B 3JZ7A 5BO0D 2MNWA 3AREC 2XG5B 4AQ8A 2RQEA 4ZO9A 4UDUA 4OLUL 3DHUA 4QO1A 4QKXB 5TQ2H 3KCPA 1Z5HA 1GGUA 5CNHA 1FA4A 2OZ4L 2HLFC 4W9KC 2PP9A 4OBRA 5E2VL 4R0LA 1I1FB 2G60H 3GNMH 3NIFF 3QE5A 5F3FA 1XXDC 4P5MA 2R29L 2VC2B 4B41A 1YEDB 3CN3A 3IAQA 1N0LB 2M26A 1U8IA 5LG6A 3AGWA 2XQYA 2AJYH 5MI0B 4ZPVB 4B9ZA 1L7IH 1OGAA 3NJFA 3V0DA 1MI5D 4K3JL 1UZGA 2X3CA 3RDTA 2A6IB 2R56H 1I7ZB 3C5SA 3S7GA 4NQDD 5ANMB 4FQPA 3Q1SL 2WMPB 3VWJB 3FO9B 3LRSA 4K2UH 4I0PB 1NMAL 1ZGLM 4OM1H 5I28A 3FRUB 2XXGA 5I15L 4XPBH 5J4MA 2BM3A 2QPSA 2Y5TB 4MMXA 3RL2B 4UT9H 4GI6A 1M2VA 2C9QA 1KLUB 4ZO8A 2APFA 4NN6C 5I1DB 2X7LA 4PGJA 1G9MH 4I3RH 4PYGA 3SYQA 1E4XL 2EEAA 3GD1C 1J8HD 4K8RL 4JO2H 5FYKE 4YHNB 2J43A 2CKNA 2VQ4A 5D2LE 1TJGH 4YK4C 4AGNA 1DDHB 4OV5B 5DD6A 1PX4A 2K0RA 2AJXH 4XMXA 3VXOA 2ERJC 2R2CA 5K1NA 1V3JA 1CXLA 4Y9GA 5EF1A 2ZKXA 3HE6D 2OQJA 1B4LA 2CIKA 5F7DA 5H35A 4N5EC 3RIFF 2XG4B 5E9NA 3VI4F 1CLYH 2RH0A 4LRIC 4X5RA 5D1XC 4UILH 1HK6A 3M7FB 2O61A 2W9DL 1QFWM 4HJTA 3GKZA 1YNTA 3I9AA 4H1LH 4JRLA 2Y2YA 2ZSWB 2I9TB 1IVTA 3ILPA 3DUSB 3KPQB 4UNTA 1NAML 5KSAD 1VJSA 3KPSA 2Z91B 4QOKA 2UWEA 4PJIA 5IB3A 5IBTH 1RQ5A 3LZRA 4KU1A 5DHVB 5T3ZH 2WLJA 1A14H 2I60H 5I1HL 1I1AA 2YKLL 3GINA 3NK4A 4WEBH 2AQ3A 4A6YH 5KZCD 5K9OB 2CALA 5FEBA 2BK8A 3UIZA 4WJG3 5FHBH 1OARL 5CZKA 3QQ4A 1U8HB 2XFGB 5I23A 3BFQG 1L7TL 3VXQB 3Q8FA 4RBPK 5IHHA 1NIEA 2HZHA 3E9UA 3QCTL 1Z9SA 1VADA 3ZK0A 2Y6SC 2HWZL 2OR8A 4LMQI 1RZJH 4U1JA 1ZT7A 1AR2A 1AQDB 5I6XC 3ZMRA 4IBSA 5EIIA 1GXEA 2PYED 3MYJB 3O8XB 1V54B 5F9DC 1L3WA 1WTLA 2FO1A 1IQWL 1H8OA 4X8GA 4D0BB 1ND0A 3R4DA 2J5LB 3FB8B 4BZ2H 1WFIA 4NWUH 4LT7A 5INDA 2CKBB 1LDSA 3TU6A 1JZEA 5A6IA 4TOYL 1BLNB 4KHXL 4LVOC 4NO5B 1UFGA 2AABL 2GKIA 1U95B 3FUKA 3M8OH 5LBSA 4Y1AB 2XN1A 4HS8L 5AW6B 1PQZA 3FQUA 3DSNB 5FDWB 4E9QA 2XV2A 5AWNH 1CLOL 2A6KB 2H26A 3CHSA 4S1SH 5D8JH 4DGWC 4EKXA 2DMKA 3ZHKA 4X7SL 5J89A 1FFOB 3ULSA 3B7TA 1UH2A 2FBJH 1GC1C 4CMHC 4OD2A 3Q2VA 1NCGA 1T5WA 2HTKD 4PBDA 4ZX3A 3QB7C 1MRFL 2CNYA 2WBJA 3DXAE 3M46A 3FT3A 1V05A 5GGRB 2DQ6A 4RQQB 7TAAA 3HAEA 1Q0XL 4NQXA 1FL3A 1KG0B 4QTIH 2HA1A 5GZOC 1KPUA 1LK3L 4B3EA 3RFZC 4JJHA 4PCKA 1D5MA 4IS6B 1PJWA 1KJ2A 2DJSA 4MBOA 4B9KC 2P42B 1JWMA 4WUUE 4K23L 4EIUA 1VGEL 3O9WA 3TJEH 3PDOB 1M3JA 5FW7A 2NY3D 3CFIC 1MJ7L 4CGTA 2P80A 4WTZG 2Y2WA 4RWHA