2WCPA

Crystal structure of mouse cadherin-23 ec1-2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
b'MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CADHERIN-23
publication title Structural Determinants of Cadherin-23 Function in Hearing and Deafness.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA02
1SUHA 4NQQA 5DZVA 2OMXB 4ZMNA 4AQEB 1FF5A 3LNDA 2EE0A 1NCJA 2WBXA 3LNHA 4AQ8C 3Q2VA 3K6IA 3UBFA 4AQAB 4AXWA 2YSTA 4ZTEA 4XXWC 5CO1A 2X2UA 4AQ8A 2OMWB 3LNGA 1NCGA 1OP4A 4ZMPA 2OMYB 2WD0A 3Q2NA 4ZMLA 2A4EA 2QVFB 4QD2E 1Q1PA 4ZMVA 5CZRA 3QRBA 5JYMA 2OMUB 4ZT1A 2OMTB 3UBGA 3UBHA 4AK1A 2OMZB 2QVIA 2YQGA 3FF7A 1WYJA 4ZMXA 4NUPA 4OY9A 4ZMTA 4APXA 5JYLA 4ZMWA 1NCIA 3K5SA 4AXWB 4ZI8A 1ZXKA 4ZMYA 3Q2LA 3FF8A 4XXWA 3K5RA 1NCHA 1O6SB 3LNIA 4AQEA 2A4CA 2OMVB 2V37A 4NUQA 2WCPA 3K6FA 5KJ4A 2WHVA 3Q2WA 1L3WA 3PPEA 1ZVNA 3LNEA 4AQAA 4ZMOA 1EDHA 2O72A 3MVSA 1WUZA 4ZMQA 4APXB 4NUMA 3K6DA 4ZMZA 3LNFA
chains in the Genus database with same CATH superfamily
1KXQA 2UXFA 1M4KA 3BD4A 5DMKA 1FBIL 1A0QL 4JR9L 4NPKA 5G4NA 2JJTC 3M1BB 3GLZA 4JREC 2VM4A 5M95B 1ZS8B 3NTCH 1EZVY 2OL3L 1F90L 4PJ5A 1IAOA 3KM1A 4MA1B 5IB2B 4JFXA 1WC7A 3ZKXC 3N0AA 3ZVVA 4HMDA 1VADA 2WZAA 4X7DC 3TV3H 4FF9A 5H37A 4MCYA 1AR2A 2X53A 4Y88A 3SKMB 2WY3B 1ZGLB 1EZVX 1G9EA 4FXKC 2K4WA 4PRHB 3MRHB 4XXDB 4KVPA 1UJ3B 4RISH 4HJSA 5DT1H 4HPYH 1E9PB 4HAGA 4U1KB 1XF4A 2CBMA 3TYGH 1RK7A 3G6DH 4F7PA 2WWKO 2NXYC 3F12B 1X6LA 3F01A 3L3GB 4OF8A 2IQAA 4JRWA 2FHFA 4ZFOA 1WA2X 1DVFC 3HBGA 3Q8FA 3T77B 5IBLC 4QXVA 5DJ2B 3MLUL 3T8XB 2ZOOA 4YSOA 5BZDA 4Z8FL 2ESVE 4F2MB 3QQXA 3LEXA 1JGLL 3IMTA 3VYNA 1N68A 1E90A 3VVVA 1WUNT 4KTDL 3MV9E 2C1OB 3GD1C 1JV5A 3N42F 3NJVA 2JWYA 3OM3B 3VXQA 2YPLE 4QKXB 3M46A 1QO3B 2QVIA 5T5FL 4FKKA 3MRPA 2KPWA 3QDMD 4L3CA 3DX2A 4XTRD 2WOBA 5E94B 2QSTA 2EDWA 1OCWH 5F1SA 2EC9U 5FYLL 1U2HA 1BG1A 1IAKB 1AO7E 3MNDA 2YK1H 1FDLH 1WD8A 1DO6A 3JUZA 4UQ2A 4UM8B 2NQ3A 3UIYA 4NQDA 1G43A 1Q9KA 5EZOL 4XXWA 4UDUA 3ZDZF 2J25A 3V52H 3RX8A 3FZUC 5D4IA 3K6SB 1F4WL 3CSPA 1A6AB 3VMNA 3UAAA 2Y7SA 2DWYA 1IKOP 1AXTL 2IPKB 2NY5L 3D9AL 1QA9B 3FTYA 5GSVA 4KY1L 1AH1A 1OM3L 2H3XC 3PWUB 2NYYD 1EAPA 3NFSH 3WY4A 4N25A 4KKCC 5KVDE 2VAAA 3KYNA 4XNXH 1G4RA 2A7BA 5MHSE 3QQDB 4GP8B 1JPGB 2GCYA 5IFHH 4DETA 4IRZA 3DO7A 3REVB 5FLUA 4DP6X 4G6AC 4MJ6B 4OI9A 4HJUA 5JHBA 1GCFA 1JWMA 2NNCA 3GUTB 3EYOA 4H8WH 3CSTA 4WTXA 4M03A 4PRNB 4DZ8B 4HKJB 1HZHL 5DUPH 4NQED 1Z5LA 3F00A 1LMIA 4OSUH 4NQQA 4ZFFB 1AD0B 4HIHB 5FUCC 3SPHA 4D8PA 2FNWA 2QSCL 4MRCA 1YEDB 4OJFH 5DJXA 5C0GB 1QLEL 4RFOL 4NX0A 4PJBB 4YO0B 4R97C 2EH7L 2NXYB 3D87B 1KJ3L 2X1QA 1LO2H 2PYEA 3FSOA 2I9TB 2WAHA 3OAZK 2BVQA 2P24B 1FV1B 2VZVA 3QO0A 3AREB 1DVFB 3CVHH 4M5ZL 2HA1A 4ANWA 4XP9H 1HTYA 1MLCA 3F7KA 3IBEA 2BSSB 4HDIB 3MA9L 5HVWA 1AANA 3NJIA 3US0A 4F20A 4GKZA 2X6CA 1KCVL 1MFAL 4M6OH 4OFVA 3WFBH 1FC1A 2J5LC 1AGDA 1BV8A 2GYSA 5AYUL 4YUEL 3U1SL 1XMWA 1B9ZA 8CGTA 4R83A 2X4NA 5FYKE 4G42A 1RURH 4Y9EA 3IXTA 1VFOA 4QNPF 2X2JA 2DDQL 4XWGH 2V5RA 4PGCA 5DMGC 2D4FA 3OAWA 4P2OB 4GUOA 1MCCA 2ORBL 4JFDB 1FNGA 3BHBB 2N56A 4B6ZA 1ASPA 1YYLL 2Y5TA 4KK9D 5BVJA 3D25A 3LEVL 3TJHD 2EDMA 1N6QH 4GW5B 4IU3A 3SYQA 1XB3A 2WYZA 4QYAA 2Q2LA 1BD2D 5B1CA 4LLAA 4CC1A 5G4MA 5ALCH 5EC2A 4LQFL 2ZKHH 5AZEL 4PG9A 4PUBL 3FB5A 1CLZL 2YD7A 3TBBA 4Y7MA 5ITFA 1FG9C 4YHZL 3O11A 2Z0BA 2JQAA 1B4JH 3IJYB 3VDBA 2KLSA 3ZDZB 2E7CA 1A64A 3OVUB 3LNIA 1GKOA 3VXSB 1E5YA 5C92A 3V0FA 1JUFB 1JG9A 2QR0A 1YPZB 4EIGB 4TNWF 5FFOA 2NW2B 4FFWD 2H6PB 1DR9A 3N1PC 1Z9OA 1NA8A 5MEQB 2FH8A 2P5WD 1U3NA 2D7OA 4NKMA 2GKIA 1IC7L 2ZXQA 4LSSH 3WFCH 2BNRB 3QUKB 1IBGH 2EYRB 2XTJE 3TIEB 2GIYA 3NA9L 3PP3K 4R97B 5DMYA 1KCKA 2W81C 2YKLH 1TDQA 2X6MA 5K39A 3U36A 4JFFD 2GY7B 3EGXB 4A39A 4TULH 3X3GH 3TBTA 3GMRB 1BJ8A 1V55B 1YY8A 5ISZB 1P7HL 1FORH 1QSEA 4J7RA 4ZD3L 2NMSA 3FQTB 3KPNA 2NSQA 3BH9A 5BW7A 4IBQA 5B3NA 3KLAA 2QADC 2DYPB 1TVHB 4K9EC 2J5LB 1QQDA 4AENA 1XCTB 1DQML 4N2CA 5D7LB 1IAIL 1AS7A 2IFGA 5GRUL 4HJJH 4XBGA 1DFXA 3T2NL 1FVCA 1SJEA 3VXPB 1T6BX 5D1ZI 4WWID 3FUNA 2PP8A 1EXHA 2DTSA 5FGCE 3CFEB 2PXYC 2J88H 1G1YA 5DQJB 4LPVA 4UM9B 5DDHB 2VDNH 3BKYL 3HJEA 1JZ8A 1BLIA 3H9SE 5JIPA 4X5WA 5EZJB 1F45A 5AVQB 3IS0X 4ZTEA 4Y8DC 2KDYA 1UT2A 4RX4A 1KGWA 4LHQB 3V0IA 4S1RH 4IYKA 4OFIA 2WBKA 4NI6A 1IZKA 4AGQA 1ZSHA 4F1SA 2DOCA 3D18B 2CLZB 2J8UB 2DW5A 3SPCA 4QD2E 1RZJL 5HI4C 2NY7L 4H8QA 3RWFA 4BQ9A 2V0AA 3AM8C 1IX2A 1AGBA 1GYWA 2HPOA 4IS6A 3RBSA 4EI5B 5L6YL 1WAAA 3B2UD 5E6RB 3VFGL 1NAKH 4M3HA 4LCCB 1YN7A 3PWPA 1SOXA 4KJPC 3PF2A 3LQAC 1OWWA 1R5VA 2N7SA 3TBSA 1L3NA 1KUMA 1D5ZA 5C7XL 1W0WA 2MFNA 1IFRA 2P26A 4A6YH 4KXAA 1KT2A 4FLOA 3SCMC 5CWSB 1OGAD 3HR5B 4OD2A 1E6OL 1NPUA 4KHXL 2JTYA 3BKCL 4G1MB 4U1MA 5F88B 5J8OA 1ZHLA 4LP4A 5D6DC 1UTDA 3S34L 2X0UA 5I1LB 4B7LA 1CDGA 3KLKA 4I9WE 1KCSL 1R47A 4HC1L 2CR3A 3SB3A 5KVDH 2JB6A 5I5RA 1RIHH 2Y69B 1FFRA 4IDLA 3S5YA 1P7KB 1P5VA 1LP9E 2HJKB 3FPYA 4JPSA 3OKDB 3ABMB 2D31B 1JNLL 4DQOL 2ZUTA 4BEIA 4HJEA 4LASH 1KEGH 3EDDA 2EO7A 5C0BD 3MXWH 4AYEC 5AW2B 4AVKA 1VESA 2FECI 2WCSA 4LHUG 2XA3A 1FGVL 4C54A 4WUUA 1FNEB 3NGBC 1H0DB 4G80A 4LNRB 5IVNA 3Q1EA 1EZUA 4PRID 3S96B 1EJ6A 4AW7A 4K7PY 3V9EA 4J1UB 3OG6B 5TDNA 3EYVA 1G4MA 2FATH 1HXYA 3ARUA 2OSLA 3FTWA 4APQA 1K4CB 4G6KH 4P5KB 1NSNH 3R06B 3G6JF 3OF6D 2XSKA 1OAJA 4Y5VA 1FIEA 2QGDA 2DZEA 2VLKB 4PJ9A 2F54D 4JFED 1F5WA 1BQHA 2DICA 4K7PX 1YY9D 2F8OA 3LCYA 4NENA 3ILQC 3P4MA 3ZIMA 2E9BA 2WBXA 4BGDA 3BPLC 3RTQD 1JXFA 1QSFA 5FYKH 4ZPVA 4WEBL 3MLXL 2R9HD 4HXAL 3H6JA 3KL5A 3RU8H 5DJ6A 3X14A 5CFHA 1Q94A 3S5LG 4Y19D 3AZUA 5FV1L 4AM0A 4KI5E 3CPLB 2A74C 1ZGLM 4LFHD 5IJKC 4G7QB 4PD4K 3GMPB 4HS6B 2NDFA 4JANB 4WFGD 3BSZL 4FG6C 4GRWF 3HRZB 5CU5A 5E8DL 1SF3A 2CXKA 4JKWA 4UOW1 3S37L 2YAHA 5DZPA 4OFQA 4XODA 3A0OA 4XMXA 4IBYA 3ZDXF 2B4CL 5F3HA 2A4EA 4Q9BA 5C0JB 4KXZH 3D0LA 3SCMB 3VI4B 1CQYA 4JGNA 1KXHA 5EBMB 2AK4E 3HN3A 3VWKC 4XVUD 1P0SE 1FNSL 2FJUB 4I89A 3EFOA 4JFQB 4OY9A 3NCFB 4JFZH 5F0LB 3VFWB 4X6EB 4EMZA 1KIQB 2CBOA 4HPOL 4TL5A 5I19H 1E28A 4HH9B 4AEHH 5HHOB 2CE6A 2PYFA 2Z7ZA 4PLNC 4QTHB 4KJQC 3K8KA 1X5HA 1LM8V 1RIUL 3AC0A 5D72L 5EUOB 5FHAH 4X6DB 5DFWH 1FLRL 2BOCB 4PJDF 5BUGA 3RJDA 1CDYA 2Z91B 1NCDL 2B1OA 1K2DA 2FQEA 4K8RD 5C3LD 2DBJA 4G9FB 3HFMH 3GJFB 3OAZH 2R69A 4MAUH 1MSPA 4BZ1L 5EN2A 4B9JA 2AV1A 2DWEA 2V5YA 2C9UA 2I26N 3DUHA 5E7FA 1JWUA 5L8KB 1P2CB 1VPOL 3D39E 5HY9A 4AYID 3QULB 3WIFA 1NKRA 4D0CA 4Z7OF 4GYBA 5I1CL 4BFEA 5L9DH 3OZ9H 5SWZB 3T6WA 1XTMA 1AKPA 4Y9GA 1D5IH 2CO1A 5PAZA 4CADA 5I17A 1G94A 1L7IL 2R1XA 2XV3A 4OQTH 4WEMB 2Z8SA 5IVXE 4BFIA 2G60H 2XXCB 1CXKA 3BPLB 5IOKA 1AZVA 4RRPM 1GS6X 1SUHA 4RWYH 3GBEA 5GISL 4DO4A 2XG5A 4PJCF 3H56A 3PAUA 1ETB1 4HJ0D 4Z7NB 3G6JB 2X2IA 1SFHA 4NBXB 4EZLA 3ASWA 4IGBA 4HF5L 4ACTA 1T7VA 1YDPA 4BFBD 2A74B 4Q89A 2Q76A 2CBQA 4LL4A 2HFGL 5GRVL 4TQ8A 4Y4HC 5GZND 1U8QA 4WY7L 3BLBA 2BO0A 2ERJC 3WS3B 4ZZKA 5C2UB 4BE6A 4NNPL 1SY6H 2BMKB 2EIZB 1I1CA 4YIQA 3V4PH 1T1YB 4MRBA 5B38A 1LO4H 3VGDA 2J7LA 4G7YH 3VW3L 4E9LA 1SBBA 2D3JA 4XC1H 1P6WA 4FFVC 3VWKB 3UTSE 2QHLA 2VDQB 1NANI 4QJ4B 3S8GB 2WLKA 1N59B 1DFBH 3QS3A 4WZ9A 3GMOB 3MLRH 4PJ7F 5M94B 3IDYC 1A14H 3L9EA 1TG8A 4K9EL 4LP5A 1LEIB 2D3LA 4LPWA 3ZDXB 1LO3L 2MPAL 3BZEB 4YDVB 4N0CD 1Q4NX 5AVTB 1FFNB 1HKLH 3P3TA 3GSRA 2VL4A 5DS2A 4YSUA 3WDIA 2HT3C 4F2FA 3DJSA 3S3PA 3PP3H 3RY5A 3A67H 2CMRL 2O30A 2W60A 3P0GB 5JIDA 4RVBA 1SN2A 4PG2A 1HZKA 3F58L 3I9GL 3I6GB 3QH3B 4PR5B 2ZQKA 5AKSA 4FRWA 1S3RA 5B39A 3H6AA 4L4VD 3WENA 1G5GA 3MJ8B 1ECZA 1H6FA 1YEWA 2A9BA 2DMCA 2ILLA 1CFTA 5DRXB 3SGKA 7TAAA 2ZX6A 4K5LA 4FQCL 2BC4B 5E2TL 5GIRA 3KCPB 2Z7WA 4ZJ9A 4PJDB 1E2ZA 2VCOA 1QSZA 4MCNA 2FBRA 2R2BA 5EUKA 5T1LA 4L8SB 4P4KD 4XRCA 5C07A 3D30A 4GBXD 1OE1A 2O61A 2AEPH 5DURD 5E7BA 5F3FA 5I1AA 3IMVA 3JWNC 4L8DA 1IM3D 4TNVK 1WZMA 3I75B 5J5EA 3APFA 3HG1E 5IROD 1NFIA 4X6CF 5CJQH 4Y4HB 5C0AA 1Z3GL 3LQAL 5DHXB 1AZZC 2YXWA 1BFTA 4MZ2A 2ERJB 2NZIA 4UZUA 4X6FB 1NWPA 2FEJA 3FTUA 2R0LL 4GS7C 4XE5B 4M43H 5HDWA 3CVHA 2JKSA 3GC3A 4HEMA 2FZ3A 1FO0L 2RTTA 4Y9BA 3MLYH 2ADJA 3GI9L 1ND0B 1MCEA 2I9LB 2WBJA 3C12A 3EH3B 3P0YL 3C6LC 4K94H 1SXCA 4HKZB 4JFPB 3T5WA 1C5BH 3BN9D 1CDBA 4HIXH 3QI9A 1GPOH 4YH6A 3IDYB 1QR4A 5AZ2L 5JOFA 4F7TB 4MJHA 3KBPA 3MOBL 5I1EH 4UDTB 4OCSL 5CJOL 2VN6A 3ABZA 4NKIL 1ORQB 2L4OA 5D9SB 4HUUA 1TTGA 2E9WA 3O41A 2OXHA 2VWEE 3X3FH 4S2SA 2YQ2A 4JAMA 1IGJB 2JH2A 2VM3A 4M1DL 5I1GH 1JXKA 5FOJA 1E42A 4OGXL 3LNGA 3BLPX 4QXGL 4HOZA 2O6EA 4YFLI 4KRPB 4XMTA 3D12B 3LKPB 3GSQA 4DP5X 4HAFA 4BUQA 2VDMH 1XR9A 3LPOA 4KUZL 4NLHA 2AABH 5IBTH 2E27H 3UC0H 2MOQA 2BDNL 2VH5H 4X7TA 4P9MH 5CIPB 2E7LA 2X4UB 4LKXB 4OLXL 4CKQA 3E6FA 3C6SB 3PJSB 4KO7A 4K73A 2QTVA 2QV4A 2F1BA 2HFTA 3BZ5A 2F1EA 3PG2A 4QIRA 5H2BA 4QJ3B 2DQGH 4W70A 1VAHA 3GJEB 2YQ3A 4JCMA 2VXVH 4HWNA 5HDBB 3MMEA 1VFAB 4K3JL 5F9WB 1S7TB 1A7QL 3G08A 4JM2A 1T66C 3KPQB 1LE5A 3K81A 3B5TA 3T0VA 1G7QA 4LU5L 1HK6A 2QTEA 1OANA 4NIKB 3D4GA 1HYRC 5D7LD 5ALBH 4JJHA 2AW2A 3GSWB 3FU7A 3L5HA 4Z77A 1L6XA 1MCSA 2OMVB 4LOUC 4MXQD 2QKSA 4GS7B 1IBYA 4ZUVA 1ECYA 3MLVH 3ZE2E 4HSQA 1IGTB 1CR9H 2AJXH 3RILA 3S8WA 1UHVA 2H0JA 3DX6A 5FB8B 1T1WB 3U7YH 2YRLA 3KDMA 1BYOA 5E5MB 4X6CB 1V5JA 2FLBT 1PIFA 3GIVB 2VDQL 3GMQA 1IC5H 3RKDC 3N43B 2XWJB 4DP9X 2APVA 3HR6A 3NABL 1I3VA 1PBYA 1S7RA 1ZEAL 4PV9A 5D7JC 4GP4B 4YJZL 5I30L 4MNHA 2OP4H 2OXGB 3OKOA 4H26B 5DK0B 4BSVB 1U8LB 1T2QH 4G70B 1YMMA 1B0RA 2WVSA 1DP0A 4X8JA 2DQUH 4L29A 1ZIAA 2SODB 3GKWL 2ESVA 3FQXB 4N8CH 3T3ME 2DEYX 3M8OL 4PTUA 1NPNA 4FQQA 4QHLA 2EJ1A 3MXVH 4Q2ZB 3P9MB 2EDEA 4N4YB 2R0ZL 3FONB 4N9GB 4HWZA 5KBPA 2PCFA 5AW8B 4XMUA 3FYEB 4FD0A 1YNLH 1FQ9C 1AO7A 4N2MA 1KGXA 1OAKL 2AEQL 2HWZH 4Y5XB 5DD1H 2FCBA 4XNMB 5KYNA 4KRLB 1DTUA 3D34A 3MR9B 2WPGA 4MS6A 4F8NA 2WUBL 4J3OD 4UT9H 3SPIA 4IOIB 4BHUA 4A6YA 1A6ZB 4Z7WA 3NIFE 4KQ4L 1MPAL 3KXFD 5IM7B 4EUPH 4XC3H 4OB5H 5IB3A 1TZ8A 3HS9A 1NCAL 4LVEA 2F5AL 4R2GB 4H8UA 1CO1A 1IZJA 1MI5E 3M6DA 1XFPA 3CFTA 3SBPA 2H47C 2J2ZA 4IRSA 5MENE 2J4WH 2IQ9L 3D3VD 3SDAC 4PM1A 1D5BA 1P9MA 2GITB 1BP3B 3HG3A 3E7JA 1QLRA 3TEWA 1PZBA 2APWA 3UO8B 2WVVB 3ORJA 3LJ3A 3DWTA 1NUNB 4ZUTB 4ZYKA 5I16B 4LPYA 2IF7A 4UNUA 2F15A 2FB4L 1QOKA 3EDKA 3FTGB 3BKJH 4F24A 5LQBL 3CMOL 3RTLA 3SODB 3KG5A 2ITDA 5D7JB 3UJJL 4YNYA 3O3BA 1EEYB 4EDWH 4Y4KB 3QEQB 1RZFL 4HZLA 5FKPA 4MMXB 5C0CD 2IAND 2JLLA 4QDGA 1OF2B 1X3DA 3VXOB 5D5MB 3WFDL 2LAGB 4IMLA 4NPJA 4FEIA 2FJFB 2QQLL 4NWTH 4KDTC 5EOCH 3WFHA 2CBPA 2CNZA 4WDIB 4ONOA 1L5GB 1MCKA 5E1QA 5I1JL 1S5IH 4H25B 4CVXA 4M7LT 3B4NA 4DOHB 5INDB 1RLWA 1YYMH 2CJSA 4RMTA 3DRQA 3KLHC 3ATEA 2QMKA 5HVHC 3UERA 3E9UA 2YFNA 1Y18B 3ZTCC 2NSMA 4YK4C 4DP2X 2P80D 5DO2D 3EOAA 1BXVA 4NO0A 4ZXBD 1I7RB 2GTQA 4HHGA 4M8VA 1GC1C 2A73A 2FWUA 2O26U 4FN0A 5L4IA 4ALAH 1S7QA 1I9IL 2FAUA 3BWZA 1O9ZA 3GPEA 2BFVH 2WCGA 3GRBA 3HNVH 3ZZ1A 1FFOB 3KW8A 1F97A 3TA4D 5C97A 3T1WA 4MNQB 1BSIA 4J39A 4OVUA 4W4NA 1YEGL 3KWWA 1MVYA 2FJHB 2YPVL 1E50A 2ZUVA 1S5HA 5GGVL 3IAGC 4G8IA 4GKNB 1JPFA 1HXKA 4N6RB 3Q48A 5E03A 5AL8A 3V0VA 1SJXA 1JPSL 2EDYA 4UB0L 4AQ1A 4GQQA 3SD5A 5EWIL 4F80A 2V9RA 4BFNA 3BQUC 2Z7YA 2ISDA 1AXSA 2BS9A 4F3FB 5KYUA 3I3EA 1KCRL 3SDAB 1UUNA 5DSCB 5T3XD 1F56A 2YSSB 4UOJA 5AOJA 4P0DA 2APFA 3W38A 1ZLUK 4K55A 2A77L 3MRRA 4ZAKA 3A3YB 4TUJA 4HZAA 1H6EA 4L8BA 4BUHA 2A9AA 2F61A 1W6LA 3MRIB 1MCWW 4ODUA 4Z7UE 2EUXA 1WIUA 2AQTA 4U1JA 4G43A 1WG3A 4OLWH 4OGYH 3AG1B 1OAUH 1OCZB 3LXCA 3LS4L 2KQMA 5I8CB 3BEWB 5EBGA 4HKBB 1HILB 4GW4B 1GZHC 1PD6A 2LV4A 2WXQA 2B1AL 4EPSA 2IH3A 3TJHC 2MNJB 4O51B 3L6FA 3TO4A 2ZUSA 2Z4TA 3QFJD 1HC1A 2BJMH 5DFAA 3RLSA 5IJCC 4AH2A 3CV5A 4U7SA 1X5JA 2TAAA 4OQTA 1OZTG 2P52A 3RB5A 4V1DD 5HJGA 3LS5H 4X9GA 4TUKL 5HVHB 1U8PA 2BOBB 2YD6A 4UT6H 2KLTA 3QJHA 1RJCA 5J13C 4OZGB 4GQ9H 4YK4B 1LEKB 5A16A 5D7IF 1FFPB 1HNFA 3MCLL 3U83A 2P9RA 1W72B 2P8LB 2JV6A 4FFWC 1JXGA 5BV7H 4KKBC 1JZIA 3H9SA 3O4LE 1E0OB 5DZNA 5I73C 3V0WH 4XB8A 2AXJA 3WSQL 4JHWH 5L88L 4NRYA 3D52A 3L5WA 1SY6A 3GSXB 1GS8A 2OMYA 4LPTA 3VRLE 4NSKB 3V4PA 3BZFB 5TQ0H 3LB6C 3DKHA 3CD4A 5G55A 4ISVA 2FNBA 1RZ8A 4CC4C 4KQ3H 4DERA 3PCYA 1HSAA 3M88A 1JZHA 4NDMB 3BQUB 5FGBA 1QRNB 5J7CC 3OC5A 1JS4A 5JHAA 4QOKE 4W9LC 3RFRA 1XL4A 1ACYL 4QRAA 2C34A 3CZEA 5HTSA 3CBKB 3DMMC 5JQ6H 3B3BA 4PJ8D 3Q6GH 5KSBB 2XACC 5I6OA 4KPHL 3RY4A 3AT8A 3QEHA 2BSCA 5E08L 3B56A 1P7BA 3AY4C 2VXUH 2BXZA 1HH9B 2F6AA 4HIEB 3AG2B 2IDQA 2B39A 5CSZA 3ZE0F 2LE9A 3G6AA 4OLVL 3EJYC 2AKRB 4LEEA 3TZVB 3UBXI 2WJ7A 4R0LC 1K5NA 1RULL 4XNQA 4NGHL 5L2KB 5B7EA 4JO2H 1Q1JH 4PY7B 4OUOA 2Q7YB 3N0PB 5ANME 3TONA 3BZDA 4L37A 1G7LA 3AB0C 1JF1B 4UAOC 4S0TD 4TUUA 1E4KC 3TEXA 1A1OB 1IQDA 1LP9A 1NAMB 1U8JA 5K59E 3RVXD 3RE0A 3P4LA 3B7TA 5IWLC 1PMYA 5JTWA 1DEDA 3BUQA 2UZPA 1WIOA 4ONFH 4LDEB 3IXAA 4FQPA 1BA9A 2OJZH 4NNXB 3BUIA 4RLDA 1X7SA 1RUPH 3AJ7A 5J13B 5IEHA 3NJGA 3S35H 4JZOB 1CI5A 3GK8H 3B2UC 1HU8A 4NO5A 4PTTA 3LPWA 4IEFB 3CTTA 1I8LC 2MH4A 2W92A 1BZ7B 1WBZA 2DD8L 3HI6L 3K1DA 4G11A 1E27A 5AB0A 4JDEB 1E4XI 2EDLA 3C60B 5I73B 2C9XA 5GRWA 1USZA 2L04A 4FTVE 3HE7C 4KTGA 5TE7L 1MJUL 2HT2D 5CMAA 2UWEA 3BT2H 3UOAB 4QYOA 2NY6D 5BZWB 1XF5B 4OLZH 1TYRA 3EOTH 2DLHA 2ZSWA 1Q0YH 5EZIH 5FWQA 3VFRB 3VDAA 2APTA 4PVBA 1HCZA 4WSGA 1NIAA 3TJPA 3QUXD 4ERSL 5KUMA 2BIQA 1EO7A 4H0HB 2XJKA 3ELQA 2G0KA 2NX5D 4GUCA 2OYPA 5KYYB 5HDLA 3DMMB 5ETUA 1UD3A 1HH6A 4WNQA 5IHUL 1XV8A 3FSWA 3VXMD 1OW0C 4QKTA 1FL5A 4JEGB 1XDTT 5DS8A 4XBPA 5DMIH 3QDJD 2QQNL 3WGVB 3D7PA 3RWJB 1TT6A 5FYJE 2IOIA 1X5LA 3AACA 3FFCE 5D2NC 5HJDA 5JHMA 4XO9A 3QORA 3ULUL 5AAWA 3QYMA 3QR0A 3MCKA 2YR3A 2HH0L 3MV8E 3X11B 3QZNA 5HGDB 3VXRD 3T4YA 1MUJB 2EEAA 3VXUE 2ZCHH 1F13A 3IFPB 4XN1A 3ESNA 4PJFE 4K23L 5T1MA 3BP4A 2AK4A 1HDMB 3II3A 3BVNB 1CZ8H 3AB0B 2WV3A 4UAOB 2XICA 3H2WA 3UZVB 1A7PL 3PWLA 1FVEB 2Q86B 1MQKL 3QUZB 3GSVB 5E8PB 3KYMB 3V5KA 1A22B 1G9NH 3QPXH 5EZLA 1NCGA 2AJUH 3BISA 3JV5A 1HQ4A 3IM1A 1N64L 2XQ0A 3RNQB 1A4KA 2H9GB 2R9HC 3FU9A 4M7LH 2KT6A 3DRTB 4MLSA 5J6HB 1IGYB 3CX2A 3OPZH 3KPSE 5FGRA 3UZQB 4C58B 2X70B 1NGXA 5C0FA 3UZEC 5ILTH 2P8PA 1I7ZB 2MKLC 4QXTB 1GC1L 1CE1H 1MAMH 1FZOB 1KTRL 1W72L 5I18H 1OK8A 1QPKA 5LGYA 5IMKB 4HQQH 3SQRA 3GEFA 5EU5B 2G3ZA 2ITEA 3D39A 4JE0A 4E9RA 5E6ID 2R4SL 2V2WB 3HE7B 4NCC1 3CIAA 3KPPA 3VFPB 1BHGA 3U9PH 5EOTA 1MIEL 2EUZA 3OAYK 2XWTA 1N0LA 2E56A 4M3KB 3W5MA 3KYAA 4DKEH 2WQRA 4FFYL 1UD8A 4RGMC 1TTUA 2LU5A 3JT0A 4WU7B 5E9DE 2CUAA 1A25A 3KHQA 2CBTA 3IFLH 4LVOC 2BNQD 2F8IA 3LEYH 2C3VA 4Y16C 1MNUH 1Z7JA 4PRAB 4FLRA 1IEHA 4NRZA 5HDQL 2VLLA 4U3XA 3L3KA 4NM4H 3CFJB 4OJEH 4OV5A 1IVLA 1JD9A 1DQJB 2D3NA 5JMRA 1OPGH 1PDKA 5CJXA 2FJGB 4YDNA 4PMFA 4MAYA 2VQ1A 2JK5A 4YXKL 4YR6B 4H1LH 4NC1C 4KVCL 3MRMB 3L2MA 1VLXA 1D9KD 3OG4B 2P3YA 4G8FA 1VFBB 4WWOA 3ZX1A 2CCWA 5LGJB 3FSZA 5GQBA 1MCDA 3HZYA 3DETC 3E0GA 2IC2A 4TLTA 3SYPA 4DP0X 3H9HA 3B2XA 3UTSA 1VZGA 5MP6H 5CD5D 3TBYB 3DXAB 4PBWD 4RGND 5EMYA 2W5PA 2ZJSH 4I3SH 1NAML 4KTEL 4UQIM 4JFYA 3OJVC 4HSCX 1T20A 1CXIA 1ZLUH 4Q0XH 3ZYOA 3KLQA 1QBLH 2E75C 2Y07L 4XMKH 4ANXA 2CNYA 3ZGHA 3BGMB 2K3HA 3ARDD 5KSUA 1C1EH 3TBWA 3KD4A 1HIMH 2XZAL 4HJ0C 5I5JA 4C47A 4HUXB 3WUWB 2O93L 5FS5A 1MZYA 5F8RC 4JDVB 1WZ1L 4UT9A 4XB7A 2OQJA 3ESVF 4LE8A 1BVKA 3EJJX 2YXMA 5GZNC 2PPEA 3PHSA 1XGRB 4YVUA 3NH7L 5KN5A 3Q2CA 2MCPL 1X5FA 3SGDI 3SYAA 1AKJD 2XIIA 3S5ZA 4EF3A 3MBEA 5IBUB 5IK3A 3IMUA 4LDLB 2AEWA 3MGTA 5D7HA 3MGOA 4KDVA 3FB8B 2E47A 3GXPA 4I88A 1OP9A 1YPZE 1H8LA 4F33A 1B0GB 4OIAA 4HIIA 1H15B 5AEAA 2GHWB 2YD2A 1XMEB 4Y16B 3TP4A 3CUPA 1VEPA 4P59H 1ETZB 3SKUD 1GZQB 3TVMC 4Z0XB 1MAKA 4X4XA 4U6TA 2EEFA 4ZQKB 4N0CC 3HG1A 1ZAGA 1UM4H 5JYLA 2DBLL 4R96B 3CU1A 3R1GH 2F5BL 1LO5B 4C83A 1ADQL 3VGEA 4QO1A 1NFKA 1RJYB 3DARA 1WK0A 5BMFH 4QRTA 1A3RL 4I48B 1PLGL 5E2UH 2H2SC 1G6RB 3SJVE 3OR6B 3QAQA 1JGDA 3B1TA 4HJIA 4J3SA 3I6KA 2IJ0C 4ELKA 2GAZA 1K6QH 4XCEB 1V10A 2EC9T 4PJHB 1U92B 3P77B 1OQXA 3WXVH 1JYXA 2JFCA 1DANU 5E6UB 43CAB 1JN6A 5EEZA 1MH5B 1HEJC 3NP3A 5CHNA 3VX0A 4E36A 1NOFA 1QMUA 3WL9A 4OZIE 5AB1A 3D33A 5FYJH 1UZGA 1SOSA 2DJUA 4RZCB 1OLZA 2ZCLL 4XNYH 5BQ7A 2FSDA 3O3AB 3R18A 1UXSA 3MV7D 4ATTA 1J5CA 1O9WA 3MX0A 2WXRA 4P05A 2C9RA 4OZHF 5IHBA 4PHZA 4BV1A 3UTTB 1KC5L 4PV8B 4CU8A 3DGGA 4CKVX 3ROOB 2F8XC 2UUDK 1EERB 1QLFA 3HKFA 2H1LM 3REWA 1JVKA 3CG8A 3FL7A 4MB3A 5DJ0B 3I02B 5AVXB 2ZXBA 4CSZA 3OBAA 3Q6FA 2FSEA 2CPCA 1IEAB 1MCPH 1MLBA 3HFFA 3ESOA 3IFNL 1RXLA 3VTAA 4E0RA 4EDXB 3CFCH 5TQ2H 1WS7A 3PDOA 3NCYP 3BGFB 3MRNA 1DBJL 2XFGB 3TVMB 1U8NB 3ARGD 3H2PA 4N1CA 3LAFA 7CGTA 1UXWB 5EC1B 2OSWA 5DJCB 4EN3C 1DQQB 2WC7A 1J7VR 3GZQA 3QUMH 5DXWA 3E8UH 2DLEA 4K5OA 1F3DH 5JIHA 2XC8A 4UQCA 1MHHB 4N28A 4PJAB 4NUJA 4U6VL 4A7UA 1NANH 3ZGIA 1BX2B 1HHKB 1ZA3B 2HXAA 3LIZL 1Z1WA 1FZJB 4QI3A 3V4LA 1IGMH 3RUGF 2QJDA 2A3TA 4YDIL 4JQVA 5IQNA 5DC9B 5MEPB 2FIKA 4BDVB 1J5OH 2Q3XA 3SE9H 4M1GL 1X9UA 4NCDA 3FRUA 4BWWA 5GGRA 5ADPH 3VWJA 4OCWH 3ZKQD 5F8QC 5FKAB 4UT6A 5EU4B 1U2CA 3R4RA 2DM3A 3TN0D 4DPRA 3GTTA 2MJWA 1HHGB 2DI9A 5K9JL 3OLEA 3W0WD 4OTXH 4E9YA 3BP5A 3AMKA 4N8VG 5ACMA 5ID1A 3BAWA 4LCWE 5KJ4A 1Q9OA 1HCFX 3QQ9D 5DYFA 4C4BA 4ETQA 1I85A 2GBAA 4AVHA 1SDYA 4JM4H 3D69A 3TL5A 1DL7L 5HYJB 3HC4H 3QCVH 4FKHA 4LO9A 2NXZC 4Q6IA 3VFVB 4DQAA 5B8CB 3DX9A 3UP6A 5LNEA 2IPTH 4RAVB 2FX8L 1A7NL 2B08A 4B9GA 4FADA 4XN9A 5MEOA 5F3BB 4JHAH 2FBJL 4HS3B 1ZT4B 3BLKA 1VIWA 1WH0A 3HE6D 3QXVA 1RIVH 2HSIA 5JOPE 2UVFA 4PRBA 1CPUA 4AGNA 2JCCB 3L1FA 3SDCD 3DYMA 1JMXA 3JWOC 1GZPB 4OZHB 3L3JA 4N0UB 3TO2B 5EOCJ 1XF3B 5DD5H 1KJMB 1J0KA 4ZO8A 3HMXL 3WIIH 1ANUA 1E8YA 1DE4A 5FK9A 1CJYA 3NJJA 4EN3B 5ICYB 1Y1DA 2FYYB 1T83A 1KIRA 4MD0B 1IE4A 4YHOH 5HJ3A 2WLLA 3KGSA 1MJ7H 4WW2F 1WPCA 1NKGA 1X4ZA 2CU9A 2X3AA 3LV3A 3S4SB 1SMOA 3TH2T 4MNGB 3OAYH 5GHWL 4YBHA 3UBFA 1VRSA 2G2RA 1MI5A 4GB9A 3VFMB 1JWSA 3PREA 1SBSL 3E6HB 2CRMA 4XXWC 5MENA 3RFZA 1G6RL 3CXHK 4X0KB 1RPKA 2HT4D 4OF5A 5A2FA 3C60D 4L18A 1HL4A 4RDQG 1XGUA 3IGAB 4P06A 1RAMA 5F89A 2D03L 5DMKB 2VUYA 4GXVL 3MJ9L 1MY7A 2R2CA 3SO3C 4MXVF 1MWAL 4AMXA 4B50A 2FGWH 1DDTA 2CH8A 2JJVA 4PJ5B 1IAOB 3CN2A 4A2LA 4WKZA 3GBML 2GSIA 1WC7B 4JFXB 3FUIA 1VADB 2WQUA 2F53E 2LVCA 2K6YA 4ZZFA 1E5BA 4MCYB 1P69B 3I6SA 1VENA 4I0PA 2DEWX 4J3OC 3HLKA 4YWGH 2BVOA 2NXZB 3TU6A 4FFZL 2WLHA 4K7PL 4Y1AD 5HHMD 3I3DA 5J57B 4BCZA 1FAKT 1XF4B 3B9AA 4I85A 1TJGH 4DAGH 4F7PB 1R5IA 4IBVA 3AAZA 3IPBA 1YHPA 4LCUA 4OGAD 2IQAB 4I1NB 1MFCL 5BJTA 3PPSA 3MN8A 5JO5A 1C5CH 4GRLA 1UH4A 4ZFOB 1NMBL 4UI2A 3CK0L 3L4YA 2CHZA 3D6GA 4PP1C 5BZDB 2L0DA 2F7QA 4PB0H 3QJTB 3WE6A 2NY1D 3G7TA 1ZPUA 1Z32X 3EBGA 3LEXB 3LKOA 2NR6A 3VACA 1LK2A 4ELMF 3MRLA 3BAIA 2W91A 2YMXL 4XP4H 5F7MC 1IGIH 1EXGA 1JV5B 3E2HC 4Y4FD 3VXQB 3O2WH 1BEYH 1P4BL 3MRPB 1T4KA 4RRPG 2ZWZA 4JHZA 1Y6MR 3TA3D 1VEMA 1MXGA 3BYTA 4XCCL 3W2DH 4OI8A 2LLGA 1HOCA 3TPUA 4N8PA 2XG4A 5JMOC 3TIDA 1BGXH 2NNFA 4RMVA 1RK0A 5D1ZA 4UQ2B 4YQXH 4QJ5B 4NQDB 4WW1A 1Q9KB 2VR8A 5DEJA 4UDUB 5I28A 5E4IA 1SXSA 2EIMB 4Q97A 2HFFA 5I76A 1IQWL 5AG8A 5AFAA 2XKUA 4HBCL 1CDJA 2XRAH 5IJVA 2A6IA 5FUZL 5GSVB 5C8JA 4UQ3A 1THAA 3QNFA 1ODAA 2ZZUT 4U0RB 1EAPB 2R4RH 2IPUG 3QDGE 5D1XD 4Z7UA 2JKWA 3GXUB 2WINA 2VAAB 3KYNB 2J1XA 3O6FD 2EDDA 3V0EA 3IVKA 5F7EH 1RUMH 1NBVL 2XZCH 3JTTA 1EHKB 2GCYB 1X6NA 3DO7B 1OAZH 2PP7A 4M6NL 2EUWA 1JWMB 1ZANL 2IV9A 5CEZD 3EYOB 1BM3L 4EOWL 1Z5LB 2WTPA 5CCHE 2FBOJ 1MIML 2CGRL 4HISA 5GJSH 5H35B 3TCLA 3FKUS 1L6ZA 3INUH 3P30H 2IGFL 4D8PB 3TH3T 2WZ5A 4M48H 5DJXB 5C0ND 4M61A 1MEXL 1P6FA 3WLBA 3RGVA 3VA6A 2PYEB 2BVQB 1PCXA 4ZUUA 4JG1L 3QO0B 4WFFE 4WHTB 5D1QB 5C0IA 3THMH 4JDZA 1TETH 1MLCB 1A9EA 2D7TH 1KZQA 2QQQA 3O8XA 3QC5X 3HW7A 3C09B 4GKZB 3ZO0A 1UWFA 3QNZA 2DQIL 1R34A 4Z3FA 1AGDB 5T3ZH 2WLJA 3O4LA 5EO9A 3E2HB 3VE0A 4ZI8A 1CGVA 2WW8A 2X4NB 3L1OH 4G42B 2A9NH 4H1LA 3QXWA 4LCYA 4AQEA 4X8XA 3IXTB 4NUGL 1YECL 4KKPA 2R0KH 1BVOA 3C5ZD 5A6IA 2R0WH 3CQPA 4YSEA 2UUDH 4PGCB 5A7BA 1UA6H 2EYTA 2X42A 4D3CH 1DBML 5TF1H 4E9TA 4TRPH 3IU4L 3OKLA 1FNGB 2ZF9A 3FQWA 1K4DA 1XBRA 2Y5TB 4QOKA 4XP6L 5BVJB 1G9MC 1RI8A 3D25B 1TR7A 2VSDA 3Q9PA 3TCXA 4AWJC 4U6YA 4IU3B 2XQYK 4NJ9H 3U2JA 2VDPH 2B9AA 4FMKA 4GSDH 2XA8H 4NAQA 5EC2B 4Z7QB 4PG9B 2Y23A 4AJ0A 2Z31D 4YXHH 3FB5B 5ITFB 3KWVA 2DLFH 4Z95L 3O11B 2DEXX 2V8LA 4N8VA 3VD4A 1MW2A 2MMXA 2ZAGA 2H1XA 3T04D 3BH8A 2X4OA 3OHMB 1SDDA 4FQ2L 3RHWF 2PNDA 2FX7H 3DPBA 4E42A 1DCEA 4MDJA 2QR0B 4RAHA 2CZNA 4HWEH 5ANMA 4FA8A 1NEPA 3NCCB 5J6GA 5IESL 5A7EA 3AT9A 4R4NC 2JB5L 4P8QA 5HHQA 1OSPH 4WO4D 5HDBE 1JHKL 4D7BA 1EZLA 3SE4A 4MQSB 1AACA 1MFDL 3JWNE 2QMJA 3WBDA 1QACA 4FG4A 5K39B 3U36B 4LSVL 3MUGA 5E99L 1I8MA 1E2VA 3TBTB 1Q9WA 2PW2A 1YY8B 5DC0A 2HX7A 4ZFOL 1QSEB 4UILH 3KPNB 3BH9B 1LDPL 3KLAB 4PJ8C 4TNEA 3MOAL 3VVWA 1FA4A 3EO1B 4G72B 2V8MA 4E41E 5CINH 2XPYA 1QQDB 2WO3B 2PPDA 4AENB 3EGDA 4Y1SA 1E7VA 4QLWA 1NCUA 2DQEL 4FDWA 4FTVA 4XBGB 4KXDA 1FVCB 1SJEB 3L45A 3WD5H 5G2NA 1FGNH 1WRFA 4OCNC 5JR1H 1UADC 3ZHNA 4N86A 1IRAY 1JIBA 1SOQA 1T7XA 4K5NA 4LNVA 5FHBH 4NOBA 5DHEA 3T71A 3FT0A 3A24A 4OT1L 3ES6A 3H3KA 1CLOL 4X5WB 4EQ3A 3P40A 5TH2A 1F6AA 4UYPA 2P45B 3J8F7 1DQVA 3ZZQA 1Y6NR 4GW1A 4Y5VC 5K9OA 2D0HA 3K8MA 3G5YA 3GBNH 5KJRH 5BRZE 1MRCH 3EYFA 2OW6A 1CUOA 5C6WH 1CDUA 4F5CE 3U6XA 5I8OL 3NQIA 4NYLA 3FQYA 4MBRA 1IKFL 3L3IA 1QFWL 4AT6A 4CN4A 5KVFL 2EEXA 3FFCA 4RGOH 4LCVA 2GK0A 2YAOA 3RWFB 4IS6B 1AGBB 5KZCB 2PETA 3MV8A 4RH4A 3CDZA 2XUWA 4IRZL 2GPZA 4JO3H 5GSRA 3D08A 3VXUA 4AE0A 2W9LA 3DGDA 4PJGF 1YN7B 3PWPB 4PJFA 4QAMB 3ASNB 1NGYB 1JGEA 4W68A 2A9MH 4XH2A 2HT2C 3L3HA 1QFHA 1R5VB 1S9WA 4K2UL 2VYRE 2V17L 3TBSB 1ACCA 2YA2A 3VMPA 3JV4A 1AY1L 1S3KL 1D5ZB 2XKNA 4E9QA 5G5DA 1W0WB 3GIZH 5B3JF 1HYSD 5DEFA 1H3XA 4KJWD 1KT2B 4ZW5A 3BVUA 4OD2B 3OLGA 2J1ZA 2JKIS 4U1MB 2KS0A 1ZHLB 2B2XH 2F1AA 3PGFH 4H0GA 3HIZA 1HHHA 2VRQA 3KPSA 4I18C 1AE6L 2TSBA 2WXMA 1NCCL 1TQTA 3BO8A 1O5DT 1CYWA 2JB6B 5TK2A 3SKJH 3ZMNA 2VLRD 3NK4A 4QPEA 1P5VB 2DKSA 3WCYA 3K80A 3QUMA 4QRRD 2ZP9A 1BQSA 5GGUA 4AC2A 4AL8C 5DR5H 2FT7A 3QGVA 2RJMA 4BFFA 3QAZC 4NZDA 4H0IA 1J9SA 1DJWA 1TQWA 4KVNL 2E59A 5EOQL 5CN2A 1Q90A 2PWEA 5EB9A 3UG5A 4FE9A 3SKOA 5D2LF 2H26A 1HEHC 5CN1A 1I8UA 4WUUB 1HKFA 2XNAA 1FYTD 3F04A 2QELA 3BW9A 4G80B 4FXKA 3NAAL 4XAWL 4WNJA 3UIZA 5E9DA 4DK3A 4DP7X 3GPSA 3CLFH 3EYVB 1YYCA 1HXYB 4APQB 2OSLB 3DHUA 2DQJL 4GAGH 5GZOD 4TVPE 1E9OA 4QRUA 4DKFH 3PQYA 1AZBA 4XPAH 5FCUL 4Y5VB 1KFGA 4JZNA 5HGBA 4PJ9B 2NQDA 3QEQE 5IG7A 1BQHB 5BO1H 4NENB 4ODTL 3P4MB 5SWSE 1EMTH 1TUPA 1J8KA 1WAPA 2OR7A 4DSYA 1ZHKA 1U3HD 1QSFB 2EILB 3P9LA 3L95B 4L0YA 3FYIB 5E1GA 5K33A 5DJ6B 4PVLA 3X14B 1Q94B 5KVGE 3EYUL 4K3HA 4QRQA 1A1MA 2DMGA 1BOGA 3VSVA 4M62L 5DJDA 1Q8MA 3POHA 2X41A 2NPLX 4KHTH 3W39A 3QHFH 2XY2A 1GGBH 3NACL 2DWXA 1A5FL 2Y5QA 5H94A 2RCSL 5EORH 1UH2A 3D48R 1UUSA 4FQ1H 3UO1L 4YDLB 2F74A 1AR1C 4LLDA 3WYRA 5F3HB 5KS9F 4U1SA 3D0LB 3DHMA 3ZE1E 3RDTA 1DYZA 1XH1A 1KN2H 1E4XH 3LVEA 3WDJA 3VCLA 4PJGB 4AQAA 2FLMA 3D05A 4LCIH 2LW3A 1F1AA 2D73A 4PCYA 1S7UA 1D6VL 2D9QB 2VITA 5GGRY 3EFOB 5CN3A 3EUDA 3LNFA 2I69A 3F3HA 1E28B 1WWWX 2PYFB 2X1XR 1LYQA 1S78D 3OTTA 2NDGA 3FN3A 4CC0A 1CCZA 2YN5A 1YNTF 2AJSL 4BQBA 1OSYA 2Y36H 1KULA 2Y2TA 1DVQA 6PCYA 4A7GF 5B1JA 2F08A 4J6IA 3QDME 1A7OH 5EN2B 2AV1B 2DWEB 4JPWL 1N5AA 1HL5A 1JWUB 2X7LA 2EIEA 5HY9B 1EXUA 5FOBB 1G9ML 3WIFB 3SGKC 4D0CB 1OAXL 2AQ2A 2XQBH 3H42H 3QG6A 1UYWL 2A99A 4MQXC 4AG4L 1JRHI 1G7JA 2EH8H 2FX9L 1YEHH 3MDJA 4G8GA 3DSFH 4CADB 2R1XB 3VFOA 5I17B 4EKJA 1QFWM 3FFOA 3ZKND 4BFIB 2XFXA 2YS4A 3IJ8A 3SDDD 4NQCD 1QBAA 2QHRL 3KGTA 4H8WC 3VJ6A 4HXBL 5I6NA 3QDHA 3VD9A 3OKNA 1OL0A 2OMNA 2XG5B 1MZZA 3SJVA 1U8OA 5JUEH 4IGBB 3DJTA 1YDPB 1CLCA 4YXLH 1WIPA 1YQVL 2Q76B 4JG0H 5FPIA 1V3KA 2W0KA 4Z6AT 4O4YL 2QVMA 1U8QB 3O6KL 4N2NA 3TT1L 1AQDA 4PJXA 1UD2A 4A2FA 3CZUB 2BRQA 1F3DJ 4WHDA 2OI9B 3GI8H 1VF5C 5HJBA 5HP5A 1AR1B 4NQEE 3CHXA 4YIQB 5B38B 4GOSA 1RCYA 2PN5A 4PWJA 4B0MB 2V3EA 2W8CA 1H3GA 2HFEA 1WITA 4OU3A 4LL9A 4OZIA 3GXDA 1RUAH 2WBJC 3QZWA 2E6QA 2CLRA 3LKNA 5F7YC 5JPNC 3IDXH 3IRCA 1CFVH 3EH2A 5D7KD 4NC0B 3N1GC 4LKCA 3QI9C 4Y2OA 2NY4B 4KI1A 4BGLA 3M17A 1QRNE 3QUYA 4HSAC 1UWXK 1VFMA 4EBQL 5EEUA 2ADFL 2VW6A 2DIJA 1UA7A 1I3GL 3QHZH 4MA3A 3CXDL 3E1ZA 2W60B 1X5XA 3CFIC 4MHHI 3S35X 3MJGX 3WEXA 5DZAA 1T7WA 3IDIA 4YHML 4NO3A 1NPJA 2IEPA 4K71C 4JM2F 2YARA 5B39B 1AGCB 1UGNA 5G4OA 2VR6A 4JPQA 1CFTB 4DF9A 2E7LC 2VN4A 1YNTB 1NOAA 1G0DA 2L7QA 3NDYE 4FQJL 4P2RD 4WFED 5AALA 4MJ5A 5GIRB 2ZCZA 1YUHA 3CSGA 1UATA 2R2BB 5EUKB 5T1LB 5GS2H 4IOSA 5C07B 3DK2A 5D1QD 2OMUA 3GSUA 1FHNA 2EINB 1BD2E 4U6HA 2O61B 1BZ9A 1ERNA 3KPMA 5I1AB 5CZXD 4G3YL 4CNIA 5A6LA 1UGKA 3N9GH 3UYOD 4L8DB 1CFBA 1FE8L 3DX4A 5KVEL 4G7RB 3Q05A 1KTDA 3FT1A 1JDAA 7PCYA 2DLGA 2APBA 4W9ZA 1NFIB 4XPBH 2L7UA 3B6SA 2PXYA 3WLWC 1KPUA 5CJ8A 4OFPA 4PAZA 1OIOA 4TVPH 5FYKU 3RB7A 3BWUC 4X7EC 2C9QA 1JCVA 4M8QA 4XP1H 3IJ7A 1IKNA 4TYUA 2VLJA 3CVHB 1R33A 2KERA 3IAPA 2FZ3B 1HSBA 1YVLA 4MJID 4CJ0A 1GJIA 2PO6A 4P23A 3TBCA 1NFDE 4W9EC 1CD0A 1ZTXL 2ADJB 3HS8A 4MMYA 3SGDH 3N6YA 4IBUA 4LCWA 2WBJB 3ARGC 2F58L 2VXQH 1WQVT 3H0TA 4M1CD 1X5GA 5DJZA 3CVDA 4ZFGL 2EP6A 4JFFE 5KVGH 1CT8A 4AK1A 2W9DH 3QI9B 5JOFB 1NDMA 3GM0A 1U91A 2MTPA 2JJWA 3DVFA 4Z0BH 2JIXA 1DVXA 2R8SH 3RY6C 1WD9A 4P04A 1TQCB 3EH1A 2AANA 3AQYA 4XBEL 5JDJA 1J18A 5TE6L 5IP4A 1OCRB 3JWNG 2OXHB 2UY6A 3O41B 3OSVA 4N5ED 4S2SB 4H20L 3B9KD 3FJTA 5CP7A 1BG9A 5GJTH 4JAMB 5KTEH 2CCVA 1CICA 1XXFC 4TSBL 4N0YL 4IKLA 5E1IA 2R69L 1QG3A 4Q8BA 5INCA 4K71B 1E7UA 2LGNA 1I1RA 3GSQB 2CAKA 2OZ4H 1XR9B 4D0BA 1EJOH 3GZOA 1BPVA 4X7TB 4HIQA 4WCYH 2NY3B 1OGTA 3E6FB 4RAUA 5IQ7H 3NTCL 1N8ZA 2A5UA 1WCQA 2P46B 2M8XA 5EEYA 3CN0A 3QQ9C 4WJG3 5H2BB 4MAZA 5I6KA 1Q72H 2QFPA 3D85A 4NRXA 1H6UA 1QD0A 3MMEB 1BCIA 3TV3L 1RUQH 3G08B 2E5EA 4JM2B 1LE5B 2XIBA 1VCBC 3O81A 4RISL 1G7QB 2JF1A 4H0LC 5DZVA 5DT1L 4HPYL 4HIPA 1FNFA 3TYGL 1FC2D 3G6DL 4I2XE 2R2HA 3VD2A 5F7FA 3FHEA 1A6VH 2YGPA 3FU7B 3O6MH 4CILA 4Z77B 3MRKA 4OFYD 2E7HA 2HJLA 3VRIA 4BKTC 1TCRA 4ZUVB 4ABQA 5FW8A 1D3CA 3HAEG 2HLEB 4WIQA 2UYLA 6PAZA 1FL3A 4V33A 4B95C 4IRSC 5JPMC 3MLTA 2F53A 2V7HA 3DX6B 3N55A 1PX8A 5DA0B 3TXAA 4U1IA 1OGAE 3KDMB 3US9A 1A21A 3FB6A 4OLYH 2OK0H 4HLEA 3GMQB 5IJDC 2YPKA 4HHAA 1RP9A 3ARBD 1MCJA 4JZJA 4PWHA 4M3JA 3ZSSA 1OCWL 1S7RB 3NJXA 4OAWA 4OV6F 4PV9B 1PIGA 4YLBA 2VXTH 4MNHB 4X4YA 2VDNB 3DDGA 3OKOB 1ED3A 2YK1L 5LDSA 1FDLL 2X3CA 1I1YA 2BHUA 3RWDA 2HZHA 4ZW3A 5IJKA 1YMMB 1B0RB 2YBGA 4P2QA 1G1CA 4X8JB 3QT2A 3TV8A 2W0PA 4L29B 1MW3A 3I6LD 1G7PA 5C0BE 3V52L 2GSMB 3NMEA 2ESVB 1CTMA 5E24E 4V2BA 4PRDA 4BINA 4DHLA 2Y0SA 5CZVH 2OTWA 1IM9A 2GIXA 3WIHH 3FF7A 5D2NE 4PTUB 5EBLA 2JI3A 4FQQB 3WJJA 3TF7C 4QHLB 4PRIE 2BP8A 4H40A 5GRJH 1IARB 3NFSL 3NVQA 3C08H 2ID5A 4G1EA 4HWZB 4P5SA 5LDUA 2PCFB 4S1SH 1ZXQA 4XNXL 5C08D 2X89D 3W1ZA 2J56A 1NDGA 2WNXA 3CFBA 2BWIA 5IFHL 3Q0HA 2F54E 4JFEE 1AO7B 1ASQA 3NEEA 4KTYA 4GG6A 1SUJA 1Q0EA 5KSAD 1BREA 4NCC2 4H8WL 3NSDA 2YUZA 4LRNH 3NCMA 3MLZH 5DUPL 2IWGA 4OSUL 1NC4D 5EA0H 4L3ED 4GUQA 4NIYE 3D4CA 4FI8A 3RVUC 2N1TE 1ZHBA 2P5ED 2UZXA 1NIBA 3U6RA 2H7WA 4OJFL 4A6YB 1SMAA 1M05A 4ZX5A 2G4GA 4Y19E 5BRQA 4XN2A 4P99A 4P5MA 3PABA 1LO2L 4DW2H 5IB3B 5ECGA 4A7TA 3LDBC 1FI8C 1RP8A 4WFGE 1F4XH 2HTKD 1TNNA 3CVHL 3MZTA 3QDGA 4AQ1C 2FDBP 1KIPA 2HKFH 4XP9L 2X0VA 3TURA 2J2ZB 3NCJH 4IRSB 1MY5A 3QNXB 1D5BB 2BERA 4M6OL 3WFBL 1NKOA 4MDIA 2AXFA 1QLRB 4QHMA 4ZAKC 4ZYKB 1OO2A 1NWOA 1RURL 2IALA 1E4WH 4FAAB 2OAAA 4WWKA 5TTRA 3TA3C 2XN9D 4KU1A 3L3OA 3LNDA 5B7MA 1JZ5A 2ZUWA 5EG6C 3GUFA 2IH9A 4XWGL 2ITDB 2LHAA 4JQXC 3IN2A 4YZFF 4YNYB 3O3BB 1SM3H 2ZAHA 5JDSA 4N68A 3OV6A 4A67A 3L7FA 4HZLB 5FKPB 1JDDA 4LVNC 1J9CT 4ODVH 3GXTA 1A8JH 4LLUA 2FEDD 3PS6A 4IMLB 2A0LC 4P5TD 4R3SB 5DFVC 1N6QL 1V7MH 4GLRI 3WFHB 2QPFA 3OWEA 3MZGB 3DTUB 4UNTA 1MFBH 3WXWH 4X8GA 4CVXB 5ALCL 1NBZA 2ZKHL 3DRQB 5D1XC 4R4FH 3O6FC 4FX5A 1BF8A 2W07A 4UTAH 1KXVA 4RFEA 4ZTOH 5I71C 1B4JL 1H8NA 2XETA 4NO0B 1UWXH 4GKSA 2A73B 1AG0A 1S7QB 1ZVSA 3HNSH 3TM6A 5C70A 1H6TA 1K5WA 3KBEA 1UZ8A 1KCLA 3GINA 3MJ6A 1A4JA 1A66A 4PLJC 1TLKA 1EFXA 2ZWSA 4APXA 5IIEA 3KGRA 4WU5A 4LSSL 3WFCL 1IBGL 3KWWB 3LKRA 1S5HB 1AGEA 4G8IB 5DGRA 4JY4A 1UEMA 1JPFB 2YKLL 2AXGA 2Z4QA 4NQXA 4PJIF 3LDBB 3V0VB 3WMQA 2KPNA 4TULL 3X3GL 2Y1VA 4PYHA 2WQSA 2FO8A 4AQ1B 3NIDE 3ARQA 3ECUA 4B0MM 1FORL 3FUKA 3ZXAC 4NUQA 5FGBC 2GSGA 1AXSB 1URZA 4PEEA 5KYUB 1EIBA 1U42A 3PU7A 4NFDA 3OKEA 4O2CA 4FA6A 3JV6A 3MREA 3LNEA 2ETWA 1OTTC 1ADWA 4RIRA 5JQIB 1ZLWK 5TE4H 3MRRB 4HJJL 1GRWA 4TUJB 2DM7A 3CFNA 4P9HH 4L8BB 1ZJBA 1LP9F 4BSJA 1ZK5A 4IHOA 3HTLX 4ODUB 4XCYA 2J88L 2XTJB 2R59A 1URLA 4U1JB 1DVYA 1XGZA 4LLWA 3L2NA 4G43B 4Q9CA 2VDNL 5AVYB 4LOFA 1K8IA 3N44B 2VQ4A 2VOTA 1BQKA 3ZSTA 2IH3B 3RL2A 1J1PH 1X5KA 3BUTA 3L6FB 3TO4B 2XZQH 4XVSH 1KPRA 3B43A 4TSCH 3X1EA 4S1RL 1OT4A 3NCYS 4AH2B 1KTKE 3LD8C 1VACA 2HLFD 4E41A 1ES0A 2Z31C 4IBSA 4F8TA 2E8YA 1J8HD 2OMZA 3RGHA 1U8PB 4UINH 1SF5A 3ZYJA 3U4KA 1ZSDA 4L4VE 5B1KA 3QJHB 2GY5A 5FGCB 4AV0A 5A16B 3NSXA 1J9TA 4MX7A 1DJGA 2YOCA 3C6LA 3QNYA 3U4EA 1NAKL 2GJZA 3HG0A 3O2VH 4LBAA 5I1DB 2QL1A 4LVHC 3SPVA 3H9SB 1YEKH 5LCVH 3H7BA 3WKNA 4NNYA 2Q1EA 2XQYA 4NRYB 3WJMA 3VD0A 3IS1X 3L5WB 4KV5F 3ROLA 3QS2A 2OMYB 2Y7QA 4WV1A 4PHXA 1HJBC 3V4PB 4A6YL 5BRZA 2VDOH 4KBPA 2J72A 4MMZC 1UCBH 4F5CA 4CN6A 2H6OA 4ISVB 3WHXA 1J8SA 1RZ8B 3HAEA 1SYVA 5DGQA 4OFKA 1HZHH 3STZA 3T2LA 3W11D 1HSAB 3CBJB 2OSYA 2ZF8A 3MFFA 5KVDL 3NP4A 4K94C 2EE2A 1RIHL 1GIGL 1EO8H 2QSCH 4F7KA 2HX8A 1J1OH 3BAJA 1KYOJ 4KI5C 4RFOH 3A4DA 1PZCA 1P7QA 2UZYA 1EK3A 1NL0H 2CHWA 3DLQR 3F6LA 4ZFZA 1OP3K 1R4XA 2CO6A 1FIGH 4LASL 4HS8H 4MKMA 3UABA 2R2EA 3QEHB 4ANVA 1KEGL 5AW4B 3MXWL 3MJ7A 4IJ3C 5D8JH 2EE3A 3L1EA 5ACLA 5CSZB 2BIOA 3G6AB 1NGPH 3DC0A 2GEQA 3QORC 3DX0A 2D7MA 1UZ6F 2DIBA 2RHEA 2VC2B 4IIZA 5AAWC 4YPJA 5A43C 1K5NB 3NEOA 1TJHH 2FATL 2UZIH 4Y2DD 3ZYIA 4G6KL 1NSNL 2GUOA 3KPRD 1G7LB 4L37B 5F93C 2Z34A 1A4BA 3NSCA 2EADA 3T09A 4WI8A 3SKNA 3CFUA 1IQDB 1LP9B 3LD8B 1U8JB 1FL6A 4LEXH 4KC3B 1Z5YD 1NCBH 2JKTM 4A04A 3IXAB 5FYKL 3D2UD 4ZMZA 1C9SA 2Z0UA 4B9IA 3ECWA 5IEHB 3RU8L 2ZAIA 4M8UA 5T1KA 1O0VA 5IVXF 2YD5A 4NO5B 4PTTB 5BOJA 3V9FA 2GJ6D 3WKQA 1WBZB 1E27B 3BIKA 1OTUD 4LVHB 4JMXA 3TPKA 2FO1A 4L48A 3NJMA 3DSNA 1XGQA 3PWNA 3ZHFA 4OBRA 5K69A 2J21A 3DVNA 3QR1A 4LLVA 5CMAB 1I82A 2UWEB 4TNWK 2JSFA 2H3NA 4QYOB 3FDWA 3BAKA 3VO0A 3UG3A 4LHUD 5I6XC 5SWSA 1KGJA 5BVPH 4NZ8A 4WTWA 5EIVA 4K8RH 4TUOA 3T8MA 2ZSWB 3T1FA 2I25N 3NFNA 4IIQA 1D7BA 3WNMA 5LXVA 4AYFA 1DZBA 2GB2A 1EHAA 4L9LC 2G5UA 3ALPA 5CO1A 1IT9H 4WEEA 3RJOA 3CZGA 4NN6B 4NQVA 2AXHA 1MW0A 2VXSH 3MBWA 2AJZA 4JFZL 3U48A 3TS8A 1INDH 1PU0A 5I19L 5ETUB 4AEHL 1HH6B 4OZFH 5E95B 2LOEA 4WNQB 4BXVA 5CJXC 2F18A 4JRYD 1FL5B 2R1WA 5DS8B 1XGYH 4XBPB 3FCSA 4JE4B 5CZRA 5FHAL 4IJ3B 3GHBH 1OB1B 3ARFD 3L7EA 1DJSA 4QR7A 4C56D 1J0IA 3QORB 4QNPE 4P3CL 1MG2C 3MCKB 3HFML 4NHCH 4AYGA 4MAUL 3B7UX 1DQMH 4ZS6C 4ZMXA 3T3PE 3T4YB 5GZOC 5T1MB 2VDMB 3BP4B 3CFKA 3HUJF 2AK4B 5HI5D 2OZ4A 3ULVF 5L9DL 3ESMA 5F9AC 3FN0H 3JTBA 2OMXA 1D5IL 3PUUA 4N87A 4IU2A 1N12A 3B1UA 4OQTL 3OSKA 3V5KB 2J5WA 2G60L 5EZLB 1T04A 1U3HC 4JJOA 3WY3A 2WKOA 2ADIA 1NIDA 3F7YB 1AIFA 1M71A 4JFUA 5HHXH 2DH3A 2AP2A 4RWYL 1X9QA 1UC6A 1XIWD 2F7RA 1TF4A 2O6CA 1NGXB 5C0FB 2P8PB 2D4DA 4AYBA 4UANA 4JPVH 3TEYA 1CF8H 4UUJA 3QDMA 3T65A 2F7OA 2KLRA 4DP1X 5E6SB 1OE3A 1GGTA 1SRDA 3O3UN 1RMFH 2HG0A 5EBWA 5A3ID 3D39B 1UWYA 3QB7C 1JZ3A 3NJLA 2OTPA 3MBEC 1RZJH 2YRZA 3EBAA 5BNXD 3KPPB 1IL1A 4ZQTA 2VE6A 1SY6L 5EOTB 2BIIA 4XMLH 2ENYA 4NFCA 3V4PL 4N3TA 2WNWA 2XWTB 3FO2A 4L23A 1LO4L 1N0LB 1HWWA 4GAJH 3SEPA 1PEWA 4G7YL 5IVXB 3G5XA 1KB9J 5TGBA 1J05A 4ENZA 4XC1L 3KXFE 2C3VB 1Q38A 3FB7A 4LSQH 5BS0D 5JW4R 1DFBL 5GS3A 4X4ME 4NRZB 3MLRL 1A14L 2VLLB 3L3KB 4AY0A 4FZ8L 4OV5B 3MV9D 3QYNA 1NGQH 3LHAA 2CKBH 4ZMAT 3BP6A 1PDKB 3HOGA 1MAJA 1HKLL 2YPLD 3D3VE 4IM8A 3PRZA 2VMFA 4MAYB 2AZAA 2VQ1B 2JK5B 3BD5A 1EDQA 3DX8A 1H5BA 4PRPD 4WQOA 4EXKA 3EH4B 2BSDA 2EZ0C 4NQEA 4LFHG 4XI5D 4L0ZA 3A67L 1LVEA 4G8FB 2BS71 1UD6A 3LMJH 4N20A 2BY2A 3FUDA 3L4WA 4YE0A 3TTYA 3HZYB 4I1PA 3WIHA 3EYQC 3H9HB 3UTSB 5IBUG 1I1FA 1TJIH 4OCLC 3KHOA 2IANE 3IJEA 3OD3A 4QRPD 4S1QH 5I9QB 3ZKNC 2AQRA 4JFYB 1A7RH 3MLSH 1T20B 1ZLWH 4BD4A 1F3RB 1GVIA 2AEPL 1HN1A 5GGSY 2CA3A 1EJ8A 5KSUB 3H1ZA 3TBWB 5GRYA 4Z7QE 1LWHA 2OQJB 4ABVA 1BVKB 1OARH 2VR7A 5CJQL 5EU6D 3MRJA 4NBZB 3VM5A 5KN5B 2L8AA 4JO4H 3ZR5A 1CLYH 3QXAA 4WEBH 3A6BH 3MBEB 5IK3B 1A6UH 2ZP0T 4M43L 1AAJA 5IR1A 3MGTB 5D4HA 3MGOB 3HZKB 5JIIA 3QIUD 1AIZA 3OC8A 4QAWA 3MLYL 3TEUA 5GS0D 4OM0H 4F33B 5KBNC 1WZKA 3ECQA 1X5MA 1BD2A 4GKOA 4HIIB 3C9NA 5E8EA 4QRFA 4TL4A 3CUPB 4K94L 2OLDA 1OGPA 1Z5HA 2DAVA 4AGLA 1C5BL 2XWCA 3PLYA 4HIXL 1GPOL 4X4XB 1Y7VA 1P53A 4WW2C 2WTOA 3NPZB 3V4UH 3HG1B 3K6DA 2YMTA 1DLFH 5I1EL 4XHQA 1U58A 5T3XE 1KTLA 3DROA 5FIEA 4N2BA 4PJEF 5FO9A 4C83B 4QO1B 3X3FL 2R27A 5D6CA 3MKKA 2WWMD 4YEEA 5I1GL 2P5WA 4QRTB 3F2LA 3QVAA 1NFDA 4JKLA 3JWDC 3DDFA 4GT0A 1BF5A 5C9JA 4WKXA 1MVUA 2CALA 3B2DC 2QPEB 1JGDB 2ZWKA 3O9WD 2VDML 3D4ZA 4WNSA 2ZUYA 5DVPA 2AABL 1T7ZA 3I6KB 2GI7A 2E27L 3UC0L 4ELKB 2GAZB 2VH5L 4JFFA 4P9ML 3VWJC 3MUJA 4P4RA 4URKA 4CC4A 4OUUA 4OD1H 4UTAA 2WXLA 1OP3H 4A2MA 1CGSH 1JN6B 3OQRA 1J88A 3L8QA 1VHPA 3QFJE 1XX9C 5CHNB 4LPUA 3BPOC 4G83A 2DQGL 1ZA6A 2VXVL 2XX0A 3WL9B 5BV7C 1FUNA 4V1DE 3JWOH 5D7SH 4DH2A 2K6WA 1E5ZA 1WISA 3ZDYB 1JRHH 4EEEA 5BQ7B 4BK8A 1UXSB 1XAUA 4DGWC 1GAFH 3GBLA 3MX0B 5ALBL 4AW4A 3C6EA 4JS7A 5D71H 3L54A 4YEFA 1AXIB 3NQKA 5EF3A 1PGRB 3RVTC 3K4ZA 3AS1A 3DGGB 3HG2A 1QLFB 4GRWE 1AZUA 2VIRA 2ZCKH 4PSRA 2VL5B 1MFMA 4R0LA 1EEZA 1MF2H 3BVXA 3GNMH 3MLVL 3REWB 3B3IA 3FSAA 4W9FC 2XPGA 5F71A 3QG7H 3CJJA 1HE7A 4K07A 3RNKA 3Q6FB 4MJJA 3VAEA 2FSEB 3BUYA 4BE5A 2VMEA 1CR9L 2OJ1A 2AJXL 2HG5A 1MLBB 5J56B 1E4KA 4H5SA 4M1CC 3U7YL 4O9HH 4E0RB 3AFLA 1BF2A 2WANA 3PDOB 1J10A 4FJ6A 3MRNB 1IC5L 1L7TH 1WP6A 3QXUA 1P6AB 2PUQT 1F42A 3BEVA 5DWUH 5DEGA 1GHFH 3EIFA 4GQRA 1DBBH 4I2XA 4LLQA 1X9RA 1MKFA 3LZNA 4N1EA 2OP4L 1G6VK 1L3WA 2Z3FA 4PCTA 3K0WA 4KKZA 1MCFA 3QWNA 4N5EC 3B9KC 4EO5A 1P4LA 1T0PB 2J71A 1T2QL 4NUJB 1DVZA 2DQUL 4PS8A 5DI8A 3ZE2B 5BOZG 3F84A 5HI3D 1M9SA 2PR9A 3RFZC 2G2PA 4N8CL 4J3OH 2FIKB 1KB5H 2AMUA 1OGAA 3MXVL 4L1SA 2XVGA 5GGRB 3US1A 1F4AA 3VWJB 1ZT1A 3B9EA 1WFIA 2BVUA 2LU4A 4CJ1A 2WXIA 3K6OA 1TEGA 1JTTA 1KPVA 4NZRH 4QCIA 1OP5K 4DJMA 4Z7OE 4ETYA 4WI0A 3VGFA 1X9LA 3QZPA 1BJMA 4FQHA 1YNLL 5E5RB 4AKPA 4FXLA 1AJ7H 3BPOB 4BCXA 1CU4H 4JRXD 1J0YA 2HWZL 5DD1L 3BP5B 1LL1A 3RAJL 3CDCA 3B5GA 5ID1B 5BV7B 1DQKA 3D09A 1B6UA 1PZDA 1Q9OB 1HL8A 2MCG1 1E4HA 3D5OF 3PXHA 4ETQB 5LCVA 3VX1A 3D69B 5DS1A 2R15A 4AJWA 4F8OA 3EJQA 5C0BA 1OW0A 1JI2A 2NLJA 1H19A 4UT9L 4PJCE 4Q6IB 4KNQA 1PF3A 3T3MB 3DX9B 5GGTH 3V0GA 1JJUA 3QIBB 4X50A 5D2NA 5C0EA 4KK8D 2XLLA 4XC3L 3M07A 4OB5L 1C7TA 4PRIA 3S4SG 5MEOB 2B0SH 4BKLA 4BM7A 2M83A 5I2IA 1TMCB 4X99A 4GRLC 3OF6A 1T5XA 1A3QA 1ZKAA 2J4WL 4OJDH 4PRBB 4OIBA 2EECA 4I13B 2F54A 4JFEA 4I9WD 1JSYA 4S11A 2FO4A 4DT2A 1IILE 5I75B 1GTNA 2EDBA 2ZOTA 3VSUA 3ZT7A 5IMOA 2NR6C 3L3JB 1XD0A 3S3DB 3R7RA 2KZBA 4W93A 3IJHA 3AWGA 3RTQA 1DE4B 3DJZA 5FK9B 1QKZH 3BKJL 2W0FA 4HALA 3AQDA 2YQGA 1HS6A 4A2EA 4PJ7E 1KIRB 3NIFB 4Y19A 5TFSH 2NX5E 1AQKH 1D7CA 2DQCH 5HJ3B 2WLLB 3UZEA 4KGJA 4EDWL 4EZJA 4U2ZA 1AZNA 4ONHA 3LV3B 3SQBA 1Y07A 3DVGA 4DPAX 2IAMD 1W8NA 2ALAA 3GGWA 4OW6A 4G6FB 3VXME 2LQRA 1RU9H 1MI5B 2G2RB 4ADGA 1JWSB 3ZT6A 3R4DA 1CVRA 3QDJE 4LHJB 4NWTL 5EOCL 3VTMA 4OJAA 2DMKA 5JORA 5MENB 3RFZB 2X87A 2RACA 4O2EB 3N40F 5C09D 1G87A 2EDJA 1XD1A 3KWTA 1S5IL 1LTXA 1E4JA 1XGUB 1G9NC 4PIBA 3AUVA 5F89B 1YYML 2AQSA 3VXRE 2O5YH 3DX3A 2MCMA 4Z7AA 3WKYA 1RKRA 4WKZB 1WF5A 5KSAC 4MA8H 2GSIB 2HRPH 4MD5A 4ALAL 5K9KA 4Q9QH 3L4UA 4L8CA 2Y1AA 3HNVL 4WRLA 2B16A 4I0PB 2DLIA 3QJFA 1KV3A 3LZFH 5DTFA 3T0ED 1FWXA 4YHIA 2BVOB 2EKSA 2FWLB 1IBDA 4BZYA 4ZSOE 43C9A 2BW4A 2OW7A 3QXTA 4G9DA 2XVKA 3GB7A 4NOFA 3T2OA 3N5AA 4JNXA 1R5IB 1YEIH 3AAZB 2HTKC 3RGVC 5FYJU 4LCUB 1SEBA 3VRLF 2X3BA 5BJTB 4YGVA 5JO5B 2VW7A 1GGIH 4E9WA 4GRLB 3BRDA 3K2UH 3WE6B 2OSXA 3LKOB 3F12A 1MWAA 4FI6A 2J1WA 4OZFA 1LK2B 1WA1X 3MRLB 3IBOA 3P1VA 2C1PA 2AZUA 4J4PD 2E7BA 1RZQA 2AAVA 2BNQE 2K4AA 4WJKB 1M53A 1T4KB 1L9SA 1KYAA 4G6MH 4JVUA 4OLWL 4GMSH 4OGYL 5CBAA 1OAUL 1NM4A 3TPUB 1HOCB 4FFZA 4GRWH 2O5XH 1CF1A 2XBDA 2FEDC 3Q2NA 1RK0B 4J3OG 5D1ZB 5GZNA 3RPBA 3IU3A 4P5TC 1QZNA 4OI7A 4WW1B 3ECBA 2EQDA 2BJML 3GWJA 2X10A 2DQ6A 1ZEAH 1T5KA 2VRKA 4K3EH 4CMMA 5D4QA 2HFFB 2BSED 5I76B 3QJRB 3T8VA 2XIDA 2EDFA 4DO5A 2D9CA 1R0AH 3LS5L 3P11H 3GSOA 5IJVB 2A6IB 1DJXA 3HVDA 3SDXE 5C8JB 4NUPA 4UT6L 4MZ3A 4B9YA 3MUY1 4UQ3B 3RZCD 1NC2D 4CGTA 4X80H 2BVEA 1IGFH 4Z7UB 4XVOA 3K6SA 2WINB 2Y4SA 4RGNE 3N85H 5LNDA 3IVKB 5FW7A 3JTTB 1JERA 2FHCA 3HCVA 5LO7A 2VR3A 4X8CA 2XKSA 2HTLC 2ITFA 5BV7L 4LSUH 1MDAA 1WHOA 3L81A 3CLWA 4JHVA 3V0WL 2DI8A 4JHWL 4LT7A 2D0GA 1V3JA 2NW3A 4FC3E 4PU2A 3TCLB 4NN5B 4X7SH 3CGTA 5TQ0L 1HZLA 4UTBH 2V2TA 3CVIH 1KJ2H 2MIZA 4KH9A 4M61B 2DYSB 3GUTA 4ENED 3WLBB 1I8IA 4KQ3L 3RGVB 3ATDA 3D2TA 1PCSA 1TQVA 4L4VA 5ERWA 4ZUUB 5C0IB 4BQCA 1FNHA 3GRWH 4JDZB 2EVFA 5KUKA 5C0AE 1A9EB 2K3TA 5DRWA 3OR7A 1KIUB 4PW3A 3O8XB 5JQ6L 1QI4A 2WB7A 1I1AD 3N1QC 2ZXEB 2CKBA 3Q6GL 3QNZB 4PY8I 4QT5A 5AOLA 1TZGH 2QFRA 3DNKA 3O4LB 1F11A 4P4KA 5EO9B 3VE0B 4GBXA 4RDQF 2J55A 1BPLB 4PP2A 4FGMA 2VXUL 4UCFA 4H1LB 4LCYB 4AQEB 1J1XL 1T7YA 4RCAA 3FOLA 1NCWH 2VQTA 1IM3A 3NJHA 2P44B 4AEEA 2EYTB 2HRHA 2PTUA 5IROA 2YUWA 4JO2L 1Q1JL 1JTOA 3FMGH 3ULVD 1TQSA 1B0WA 2DQHH 4OCRH 3OKLB 2TRHA 1TEFA 2FB4H 2XWXA 1K4DB 3FQWB 3QARA 4QOKB 1PAZA 1NMAH 5LQBH 4O58H 2DTMH 1IGCH 2GC4C 4U6YB 2PTVA 1IC4H 2WIMA 2EVIA 4PJFF 1KY7A 5K1JA 4LLMA 3CIQA 4FMVA 1DHKA 4ONFL 3TTSA 4CVZA 2Y3AA 1K8DA 1QX1A 2OJZL 1RUPL 5E5LA 3W56A 1PG7H 4ABUA 3S35L 1KCUH 4HGMA 3GK8L 4GLRH 4N8VB 2ZXDA 3A6CH 5CILH 5AOIA 3VG0H 1AI1H 3VH8A 4ZMVA 2FHBA 3BH8B 2J57A 2X4OB 2BPBA 1SDDB 3DURA 3RX7A 3DPBB 1YN6A 4E42B 1XGPA 4MDJB 2C3WA 2WQVA 5IKCA 1IV8A 1EUUA 5ANMB 5KOMC 4IOFC 1QP1A 2NY2D 5IOPA 5J6GB 1J5HA 1TCMA 4AL8H 3HN8A 5HHQB 5LWYH 4Q9RH 2G9KA 3BT2L 4BUGA 1WICA 4F57H 2J3SA 2NY0C 3UAEA 5GRXG 1SHXA 2PPAA 5J9PA 1CFSA 2ZKMX 4XGZA 5AOKA 3B2VH 3LPGA 5CBEA 1JHLH 4Z3GA 4OLZL 3EOTL 1Q0YL 5EZIL 3L5IA 3MUGB 2XCMC 1OP5H 1I8MB 2XDHA 1EV2E 2VR5A 3BZ4A 4H2AA 5L0QB 1Q9WB 5CS7A 2PW2B 4B53A 3KCWA 1KYFA 4I0CC 5E4OA 1GYVA 2X9ZA 4EQ2A 4LPCA 1DQDH 5L8LB 2X1PA 3EHBD 3ILPA 3GMNA 3MU3A 2CDGA 2Y6SD 3KBFA 3ZMRA 3EGDB 4GMTH 1TMQA 4PJBF 3U4AA 5DMIL 4FTVB 3FC8A 4EZMA 3LY6A 2VW4A 3WEAA 1RZPA 2YUXA 1KENH 2A2QT 1J5IA 2OM5A 3CZFA 4ZO6A 3VFSA 1S7VA 4WK0B 4F8QA 4ZODA 4Y2DC 3ASOB 4LP8A 5D7LA 2ZCHL 3UYRH 1MCWM 3TCTA 3ES6B 2FYVA 1CZ8L 1EWHA 1R1CA 1J0JA 5TH2B 1F6AB 2JXMA 1HHJA 1D2OA 1DLHA 1LK3H 3FTZA 1RV6X 1UB6A 3MNMA 5GS1C 5K9OB 4GW1B 5DF0A 3KH4A 1JE6A 3G5YB 1AS6A 3N06B 1G9NL 1VERA 3OB0K 1YMME 3EYFB 3QPXL 5T1JA 3UAFA 2AJUL 1A4AA 4M7LL 3VYOA 3Q3GA 4NYLB 4IRJB 5T33H 2YD9A 4AT6B 3L3IB 3OPZL 3OZKA 1KELH 3FFCB 4IBTA 5ILTL 2GK0B 2FIRT 1IIIA 1CE1L 2YD0A 1MAML 5JZ7D 3UTPD 3MV8B 1IBBA 3CDZB 5GSRB 5I18L 4LSTH 3VXUB 4HQQL 3KM2A 4PJFB 3W0WE 3HI5L 1JGEB 4J6RH 4XH2B 3L3HB 4FNQA 1S9WB 4K9JA 1L9PA 3QZBA 3JV4B 2XKNB 3U9PL 3QRFM 5G5DB 2GC7C 4ZUWA 2CJ3A 1N6UA 5DEFB 1U8CA 4TVUA 4HIJA 4KAQH 1AHMA 2WXPA 5A2IH 4DKEL 3RDTC 2I7SA 1J9RA 5F9DC 3E38A 4BCYA 4ORGA 1ROCA 2ATKA 3IFLL 4OGQC 3LEYL 1HHHB 3KPSB 1YPZF 1MNUL 3ABGA 1IIKA 5DZOA 4Z7WE 3BO8B 4L4TD 4FQXD 1CFMA 1BQHG 3ARXA 1WBXA 2Q6WA 4JREB 2DIAA 1OPGL 3EJZC 1BIHA 3O3EA 3HHMA 3QUMB 2P48B 5DUMH 5GGUB 3EG9A 1R3IH 2MOVA 5HPMA 3ZKXB 4EAEA 1S7WA 1M7UA 5I82A 3ARFC 1PNDA 5AG9A 4AEIH 3GO1H 1T22A 1XVSA 1B0IA 3IGLA 3KR3H 4KKLD 3SKOB 4DUXA 2WZPD 2H26B 1T6VN 4KZDH 2XNAB 1U36A 1XR8B 4JPIA 3BW9B 3SBWA 5B1JC 4FXKB 5AW9B 1KB5A 4JQIH 3PL6D 5E9DB 3KXFA 1BBJB 1Z9PA 4A68A 3EOBA 5MP6L 2FR4A 5LGHH 3UCQA 1E9OB 4QRUB 3PE9A 2FECL 3PQYB 4X4MA 2ZJSL 3QIBD 4I3SL 4JZNB 2W65A 1VFUA 1L9NA 4RDBA 5HGBB 3WU1A 1W9XA 5IG7B 2RB8A 4GSRA 5GGQH 2N4IA 4Q0XL 1PPIA 2ALWA 3JTSA 1QBLL 5J4MA 4R26H 1SVZA 1E9QA 3D3VA 4XMKL 4N1HB 4AGMA 2C3XA 1ZHKB 2YRPA 4IKNA 1ZY9A 1C1EL 3NDZE 1HIML 3QO1A 1T4WA 3FU3A 3P9LB 2BNUA 3G5WA 2AJVH 1MJ8H 2GBTA 5JHLH 3MODH 2JE8A 4OF7A 2ICCA 4J3VA 2RFXA 2VO8A 4QRQB 2HVJA 1J11A 2JLPA 1A1MB 5I66A 1BOGB 1DVSA 5D7IE 5DJDB 5GGTA 5A3IC 3NBNA 3ZTJH 2DF3A 3MRQA 4ILDA 3W39B 2OV0A 5CP3A 1FF5A 4ODHH 4JKMA 5H94B 5C0CA 2F7PA 2IANA 1N18A 4UMSA 4JN2A 2F74B 4LLDB 2CJUH 4P49A 1W91A 1BVNT 2CIIA 1U41A 2J8UF 3O0LA 4FQIH 4U1SB 3RDTB 1F8TH 5FR3A 4Y1AE 1ORSB 3BN3B 3IE9A 3GS4A 2YMOA 2E6JA 5HHME 1CN4A 1UM6H 3DVIA 1L4IA 2FT8A 3WGUB 3PHQA 3K6NA 3KPLA 3MJWA 4AQAB 3VCLB 1CB4A 4P46D 1KLGA 3HJ0A 4P59L 1CVSC 5MI0C 2BW5A 5C6TH 1YJDC 1S7UB 1UD5A 4A2HA 2AGJH 2VITB 2XT1B 1WGVA 1UM4L 2P80A 2CK0H 4LGRB 4ZXBA 2GHZA 2Y1ZA 2D3VA 1LWJA 4R6UA 3QUYC 2Z93A 1SQMA 3U0WH 1QR1A 2ZX5A 4XI5C 4XHJC 5AAMC 3PP4H 5BMFL 1TTRA 2VTFA 5E2UL 3BUBA 4XPFH 3ZE0E 3KL3A 2I7OA 3HB3D 1OE2A 4MKTA 3SYOA 4H8PA 1F2QA 3C8KA 4XN8A 1EAQA 3MLPA 1N5AB 2X7LB 2QQNH 1K6QL 4YL4A 1EXUB 5IUSA 3WXVL 4AC4A