2WCPA

Crystal structure of mouse cadherin-23 ec1-2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Cadherin-23 Function in Hearing and Deafness.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords CADHERIN-23
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2wcpA02
5KJ4A 1NCIA 3FF8A 3UBFA 4ZMXA 4AQAB 3LNGA 3Q2VA 4OY9A 4ZMWA 1L3WA 3Q2NA 4AQEB 2OMWB 2WD0A 4ZT1A 3LNFA 1EDHA 1NCGA 2OMVB 2OMZB 1NCHA 3UBGA 2WCPA 4APXB 3K5SA 3LNIA 2QVFB 4XXWA 4ZMZA 1SUHA 3PPEA 4APXA 4AXWA 2A4EA 1ZXKA 4ZMLA 5DZVA 3FF7A 4XXWC 5JYLA 5CO1A 2WHVA 2O72A 3K5RA 5CZRA 4ZMVA 2X2UA 2OMTB 1Q1PA 1WUZA 4AQ8A 4ZMYA 3K6IA 4ZMNA 4NUQA 3UBHA 3Q2LA 4ZI8A 4QD2E 5JYMA 1NCJA 1WYJA 4ZMPA 4NQQA 4AXWB 1FF5A 3K6DA 1O6SB 2A4CA 4ZTEA 4NUPA 3K6FA 2OMXB 3QRBA 4ZMOA 4AQ8C 4ZMTA 2YSTA 4AK1A 1ZVNA 2YQGA 4AQEA 2EE0A 3Q2WA 3LNDA 2V37A 2WBXA 2OMYB 4ZMQA 2OMUB 2QVIA 4AQAA 1OP4A 3MVSA 4NUMA 3LNEA 3LNHA
chains in the Genus database with same CATH superfamily
1ECZA 3I02B 5BXFA 1J1PH 4N68A 4MJIE 3AY2A 1WZAA 3MOBL 2AXFB 2VSCA 3VH8B 4JFVA 4XVUD 3DTXB 2I32A 1OAJA 2ZOKA 3L3OC 1I9EA 4PLNC 2WLLB 2YSSA 1KLGB 4ZOCA 2P5ED 4HF5L 5LAXB 1NAMA 2ZPKH 4PWJA 3AS3A 4XH2B 3BWAA 2XA3A 5J3HD 3UDWA 3DRTB 1LEGA 3FH8A 3V4PH 2DLFL 1KZQA 4LASH 1KENH 3L6FB 4LCCB 4WGWB 3S96B 1OQOA 1CLOH 3PIQA 5JHDA 4ZUVA 5E2TH 5I1KH 4NC1E 1H5BC 3FO2B 1JVOA 1LDSA 3ARXA 4S1SL 5D72H 2VUYA 3F01A 1PS3A 1BQKA 4DZ8B 1WFTA 4HCRA 3G5XB 3QEQE 2OSWA 3M07A 4EPSA 1A02N 3P73A 3PP3K 1WIOA 4ZK8A 1I3RB 5KVDE 5L6YL 3PWUA 4C58B 3IDMA 5K9QG 2Z1KA 3EFDH 3ZKMD 3QRFM 2AC0A 3VGAC 3I75B 5DD5L 2PLTA 3VACA 3PXLA 3X3FH 4F2ME 1HNGA 4UBDC 4JM2B 5CMAB 5GIRA 3L3JA 1A7QL 4DKAA 3KWWB 1JZ3A 1S7QA 2ZONA 2OS7A 5F3BA 2ZP9A 4CL7A 3D3VA 1U3HA 3MODL 3MGAA 1ZE3C 4FHBD 1MCOH 4AVKA 2B59A 2ZYHA 4DN4H 2COVD 3MO1A 3JWNG 5F97E 2WNXA 5TTRA 2J1KA 3QCVH 4NQEB 4AH2B 5FO2A 2X9XA 4JRYA 3SDCD 3SPJA 4HS6A 4PGCB 1HQRB 1O7VA 5M95B 1NAKL 4JDEB 4Q6YA 3ESPA 3GLAA 2H2SC 4JANA 3RURA 3ZE0E 1M7DB 1GSKA 4Z7QB 2D4DA 3B3IB 4PRHE 2QZ5A 1U8HA 1WZ1L 1BQ5A 4G7RB 2CR3A 4HX1B 1NGYA 4L48A 5DC2A 5JW4M 4Y4KA 4CC1A 3RVTC 1FZKB 5K9JL 5GS1A 1RERA 2PPDA 4HUNB 3HPLB 2NLJB 3SDXA 3DOIA 4L3EB 4OZGF 2IDSA 1LK2B 5B38B 5C3IA 3G5VB 1NGZA 5D1QB 5L2KA 4JFHD 2XWZA 1FNGB 1WICA 1JGUH 1WDAA 4K7FA 2R4RL 1TJXA 4MJ6A 3AG3B 3WTYA 3FQNB 2CNYA 5IB1A 5JXAL 3V6OC 1FFRA 1F58H 3HUJA 3WHE0 4FGMA 4KWUA 1CZ8H 3HR5A 2JKIS 4DK5A 5KSBB 1NGYB 5E1GA 3ZIMA 1HCZA 3M1CA 1E2VA 1NANH 2FX9L 4N2KA 3ILPA 1MW3A 1EVTC 3CU1A 4LPVA 2IDUA 5DJAA 5E5UB 2Q1EA 2R0WL 3STZA 2DBJA 5EO0A 3BMWA 2I85A 3DVGB 1WC7A 3PWNB 1HILA 2VITB 4JRXE 3QNZB 3BJ91 4HT1L 2OMWB 5E03A 3ETBF 4RFOH 1EANA 1MEXH 4ALAC 2AMGA 3DYPA 1C1EH 2BOCA 5F7DA 1R5WB 3ABGA 3UMNA 3VYPA 4QRRB 3BUBA 3B1TA 4UTCA 4GKNB 4WNQA 5DHYB 3I50H 2ENPA 3LQAL 3IS1X 1I8MA 3L2MA 4NRZA 4O2EB 3LIZA 4AGQA 4NKIL 3FKUS 3P3SA 3JBG7 2BW5A 3JWDC 3A4AA 2Z31D 3DECA 3V0VA 4G8EB 5EMYA 5E9NA 4EI5B 5TDOB 1LD9B 3KPRE 4W4OA 1N7MH 5EF1A 2OTPA 4MD0B 5IB5B 2AJYH 2HX8A 4OVVA 1EJFA 4ZSOE 1MVYA 1OAUL 2B4CC 3SE9L 5GZOD 5F7DB 1X4ZA 4N9GB 4UB0H 4LLYB 3U9UB 4RETB 4X8CA 4AJWA 3WKYA 3EXJA 3ULUD 1TJHH 1FV1B 4HWBH 3FB8A 2QELA 1G4RA 2ICEA 3I6LD 3UTQA 2C9SA 1DUZA 1BAGA 4P4KA 4YVNA 3WHE1 5D6CB 1V54B 3KYKL 3OMIB 3TYGL 2NY3B 3WKMH 3I6LE 3G08A 4XXCA 3RY4A 4WFFD 4LCUA 1FYTB 4AV4A 1G4MA 1JZ4A 2X70B 2R29L 3VWJA 1MFNA 1DE4B 3QJZA 4MQTB 5DR5H 1NM4A 3WE1A 4JHUA 3ECUA 2EVHA 1S7TB 1N59B 3CFJB 2YAPA 2K7PA 1ASPA 1MLBB 3FN9A 2OXHA 4AZUA 1AG6A 3AADB 4LPWA 1Q9OB 1DUZB 3UABA 2NQ3A 3D85A 4OJAA 4EO5A 1TVDA 2TRYA 4D9QE 3B5TA 4CU7A 2EIZA 3LNDA 4NP4L 5JXED 1AIZA 4DN3H 1TTFA 2V2TA 4WWKC 4FQHB 4NQXA 4WFED 3X11A 1DR9A 5JNYA 2XU9A 4XP9L 1A4BA 3MLWL 2YN3A 1LE5A 3FB5B 2AAAA 1Z1WA 1CDYA 1U36A 4U6VL 1EX0A 3PDGA 3WN5C 2QSCL 4POUB 4OF3A 2NW2B 4G6JH 1UXWA 1HT6A 3F7LA 3MROB 4UT9H 1AZBA 2CBPA 4RLDA 1D9KB 2V5YA 5IQ7L 4BRVA 8FABB 3B7RL 4G42A 3D51A 4QGYA 3T04D 1BZDA 2KKQA 3I02A 3TBTB 1P5UC 5KWYC 1V3MA 4LB8A 4LARH 5AAPA 3GMMB 3G5ZA 4DGIL 1JPTL 3UTSE 2ZWKA 4JRYD 4NPJA 1FG2A 4MSWB 4DIXA 1XSIA 5CCKL 3QULB 4PU2A 3UTSD 4LPUA 2FQGA 3DJ9A 4JRYB 1A3ZA 2PN5A 2ZG3A 3IJ7A 3SDYH 2EUXA 1SLWA 3BSGA 2DLHA 4GPVA 4RRPG 4UV4H 1E4KA 3P3YA 3WEMA 3D3VB 3L5JA 2XA8H 1EJ6A 1CG9A 3IDYB 4NNYB 1QHQA 3QG7L 4KZ0A 43C9B 2R1YA 5EG6C 1RZ7L 5DJCA 1N26A 1UGNA 5EU6B 1YEFH 1A4JB 3BO8B 4PGDA 3ULUH 4IQHA 1PZ5B 2FB4L 2FSEA 1UGKA 2AQ1A 4RZCA 2VDRL 4HC1H 4ZOBA 2Q3AA 5ISZD 1J5HA 4DVBA 2KYIA 1A65A 3S5LA 4KHTH 3D4CA 5F1IA 4Q9RH 1N67A 5DYOB 4M02A 3RPIA 2HFGH 1KNOB 4WHDA 5EEXA 1C12B 3CZGA 5CIPA 3TFKC 2CO7A 3SOBL 5IHWA 3N06B 3IJSB 3AWFA 1G7PB 4G2AA 2P5WA 3F7YA 3APMA 5G2NA 1ODUA 1QFWM 2BCKB 3OF6A 1FNLA 4UQ3A 2BDNL 3FOLB 4PGCA 3A47A 2GFBA 4PHXA 1T7WA 1UA3A 4W9KC 2F19L 2VB5A 4WKXA 1E8YA 4KY1L 1XGTB 1A47A 2EYRA 5MI0C 2WO4A 3VWJB 1H19A 4TSCL 3A24A 3V5HA 2LT9A 2PETA 2OL3A 3NP3A 5K59F 4ESKA 5T3XE 3UOAB 3T09A 4DCQB 3KLLA 3NQKA 5BMFH 1YECL 2VC2B 4U6XB 2G5BB 4IJTA 4NN6B 5I1JL 3D06A 5AB0A 3E1ZA 4M9PA 5F44A 5LNDA 3H9SE 1FRGH 3QDHA 4IGBC 3GZOA 3KMDA 4F7TA 3TGXA 1MCJA 5FF6A 3E2HB 1NZRA 4D9LH 2EUZA 1X9UA 4NFBA 4R5TA 2FJHA 3O6LH 3KPPA 5F6IB 5BOPA 5H37G 3S3SA 2AHIA 3AABA 4G6MH 1T4WA 2JF1A 1LMKA 4LU5H 1PY0A 4BJLA 2FQFA 2ADIB 4M43H 1JGEA 3GGWB 4LLVA 1IAIH 5DZOA 4BQ8A 1RZ8A 4OH2A 4FXKC 4H8WC 5A2KH 1HKLL 1IC4H 2CM5A 2OJZH 1WCBB 4RMBA 1MFBL 2ZF9A 1NCDL 3TTYA 2EXTA 2O6FA 3G6AB 5CGMA 2ZUQC 3DNKA 1XL6A 5B8CC 3TF7C 3BPOB 2LV4A 4F7EA 4XPGH 4D0DA 4NC1C 5DHYA 4JJ5B 4G7QB 2W0KA 2JXMB 2VAJA 4KNTA 4M1GL 5IT2H 1R0AL 2DQGH 3MUUA 2DQMA 2ZOWA 1X6NA 2PCPB 3GTNA 2EXSA 4NRXA 4KXDA 1U8LA 4V1DB 1ETZA 3HC0A 1F2XK 3GC3A 2MOVA 3TV8A 5CJ5A 2GEEA 2J5LC 4OZHE 4YLBA 2G3ZA 1T03H 2DTML 1JWMA 3E8VA 2YPVA 1HKFA 3OQ3B 4X5LA 3T0EB 5D1XB 1E9QB 4EDXB 3W39B 1D5IL 2F7PA 2A2QT 3CU7A 5JQ6H 4GUPA 3W3BA 2FEJA 1RZPA 4AYEC 2LW3A 3UTZB 2Q87A 3N5AA 2G9HA 2XCMC 4N0UA 3GSWB 4GSDH 1EBAA 2WYIA 5ACZA 3MUJA 2IIJA 4Y19E 5EHFA 3L4TA 1PZCA 1B9KA 1G7JB 1NFKA 4PRAA 4MXWH 5JDJA 2FTAA 1J12A 1YPZF 4NGHH 3ZHFA 3TIDA 1V7NL 1W91A 5I75B 5HHNB 1PKQE 2AEQL 5JHLA 4PMFA 4NJ9L 4WW2B 1PAZA 3OAZK 1I53A 4BUGA 1F4WL 2JB6B 4IJ3C 1BYPA 1R5VA 3ZJAA 1HZKA 4LGSB 4U1IB 3BD3A 3BAJA 3UZEA 3IE9A 5T5FA 4JRWA 3FFCA 2W9EH 1K3ZA 4N2BA 5AQ0A 2B15A 3BT2L 3WIHL 3K3QA 4U0QB 4BZ1L 2OXHB 1NCWH 2ICWA 1RIUH 3T1FB 5EA0H 4UINH 2GSGB 1JZ6A 4WSKA 4OVUA 3ZKSD 3ZMRA 3GI8L 5ALCH 2VRQA 1ASQA 2AJSL 3HI6H 1X3DA 3SBRA 1BZ7B 1JXDA 2XWTA 4XZUA 4P2OA 1HE7A 3HPJA 4WLCA 3K6OA 4YHZH 3MV7A 4P5TB 2MCPL 3HMXL 5I2IB 3B37A 1NC2D 5F1NB 1JV5B 2UWEE 1AY1L 1MHCA 5I0VA 4YGVA 1HHHB 5IGXL 4KUCD 5I15H 3CX5J 1H9DA 1RIHL 3RILA 3X17A 3D39D 3OKMB 2C3GA 2CHDA 5E5MA 3IAPA 3K8KA 1MRFH 4N26A 4KITB 5D1QC 2YR3A 3E6FB 4HHAA 1GHFH 5ADPL 1HEJC 4PJGF 4HLEA 1HU8A 1CYXA 3DRQB 3D39E 3TCLA 5I1DB 3C6LB 2D0HA 4JG1H 1S7UB 1QRKA 2P49B 1FGVL 5CU9A 4JDTH 3IFNL 3UJIH 4MJ5B 5E2WH 4PSPA 2Q6WA 3NH7H 4CDHA 4J8RB 3MGTA 4PD4K 1E5CA 3PHSA 5FYJL 1B2WH 4AUUA 4XNZB 5TQ0H 4QXVA 4X83A 5A7EA 4CADA 1H3WM 3R0MA 4X5WB 1CD1B 2J88H 4OCYL 1MCNA 2PO6B 3JTTB 1B6UA 1SJEB 4IOFC 1L0QA 2Z4QB 2AQTA 3C6LA 3ML9A 4KJYB 3QIBA 4PS3A 3DVGA 3WO4C 4HETA 2P5WE 1FZJB 1GC1L 2MNUA 2QQKH 5DS2A 4ZQKA 2I25N 2NX5E 1UJ3C 4XMWA 1TNNA 2VN6A 3NN8B 3QVAA 4BKLA 5HDQL 2Z8WC 1B3JA 4IIQA 1KGCD 4DAGL 1DBMH 1DQKA 1NPNA 1XBDA 1E9PA 3D9AL 3IF1B 3LDBC 4PCKA 1F5WA 1F45A 1RJLB 2O26U 3I9IA 3MLPA 3NABH 1QNZH 2J5LB 2YLKA 2PWHA 5HGGS 4HWEL 3EYOA 4PJEB 4Y4HD 5H94A 1F11B 1FI8C 1PJ9A 2QQNH 2QMKA 4HIQA 5E4AA 4CKQA 4AY0A 5IW1A 3FCUB 1X5GA 4PWHA 2R2CA 3QIWA 4BWTA 5A3IC 3P3TA 3WMSA 5CLYA 4GW1A 1RZIB 1UFUA 2YXVA 1E4XH 2XWXA 2LTQB 4PJ9B 1YUKB 2J8HA 5ETUA 4A6YA 3QDJB 2WM0A 4HWZA 4Y16B 1KXTB 1NL0L 2XJKA 2DBLH 1TLKA 4DHLA 1G1YA 1FORH 5JPMB 2OTWA 3KM1A 2DWEB 5GRYA 3WYRA 3HHMA 1KFAH 1PG7W 3IJ8A 4OFYD 5E7FA 3MCLH 3VFTB 4QHMA 1OKEA 1RZKC 4UCFA 3KGUA 2DI8A 3OTTA 4KDTA 5D4HA 1X7QB 1R3IH 2PUQT 5C0EA 3LNGA 5D2NB 3DRTA 1HKLH 1XD1A 3BIKB 4P05A 1LO0L 2WLHA 3KBFA 1YEJL 4N2EA 4PMEA 4DKFH 3HG1D 1SM3H 2E7CA 4LU5L 2R2EB 3ECQA 1T4KB 1CR9H 5IJKC 2GVYA 3O6LL 3GTTA 3SDXF 2FX8H 4K3HA 5AW1B 4K9JA 4ZW8A 4YBLC 1BZQK 1T5WB 1FVCB 1K4DB 2F2HA 3RIKA 4LCVA 4BZ2A 5I71C 3RLSA 1PZ3A 1A1OA 2DIAA 3MA7B 3CBRA 3QZMA 5AW2B 2G9HB 3QDGE 1A14L 3ETBJ 1HXMA 3FU7B 4M62H 4F20A 1AHWB 4CW1B 1CE1L 3MOAL 4KBPA 3QEQB 3E6HB 3CC5A 4QHNA 4KK8D 4J3TA 3CNKA 1EFXD 2O6PA 4GMSH 3HE7D 3JUYA 4KVCH 2VLRD 4YDLC 3HN8A 4M93C 4XXDB 3EG9A 4TV3A 4I0PC 1QLFA 2QKIB 1HHGB 5EEZA 1PX3A 1YAZA 2G2RB 3DIDA 5JQIB 3VFRB 2ORBH 4NRYB 4BDVB 1FVCA 1AR2A 2FNBA 2EIMB 3SBQA 4Z3GA 5KAQG 2DQHL 1GZHC 3QS2A 2FJSA 4G1EA 5A2JH 2EDLA 4PY8J 2YUZA 1DQQA 1EEZA 1RZKL 4URKA 3KXFD 1IMHC 3WKPA 4KI5C 1BAFL 4NI3A 5FKPA 3SQBB 1FFOA 4XOEA 4NQDA 5GGVY 2GSGA 1MLCA 3H0TB 4LEXL 5CZXD 5B38A 1BMZA 1OE3A 1UM4L 3CFBA 1M9WA 4RBPK 1UASA 4WTZA 1FC1A 3A22A 3MLSL 3NJXA 1FORL 4Q9BA 1MQKH 5IQMA 3MNVB 5IHZA 2NYZA 4ORGA 1A6VL 4L2YA 1PVHA 2D0GA 3JWNC 3QUZA 5IJVA 2I9LB 2B08A 1EXUB 1KN2L 4G7SB 1T1WB 2J1ZA 1UCBL 4Z3IA 3RZCB 5JIPA 1RMFH 1SZNA 4LFHD 4QWWC 2DYPD 3B9KA 3WBDA 3L7EB 4XCEA 2WLYA 4XNYH 1AGCA 1B4LA 1HWGB 4GW1B 1FO0B 3F7PC 4RBPH 3ERXA 4XP4H 2DMHA 1EAPA 1QRNA 5ABAA 5K9KA 3ZKNC 4Z3HA 1G9MH 4AVIA 1NCIA 5JIKA 2DYPB 2YAFA 4YHPB 3SKMB 1B0RB 1U8NA 1XWVA 4J27A 1BJ1J 4Z95H 2E9BA 4OLEA 3MR9B 3NZSA 4YHNA 3S37H 2X10A 4IBTA 1EXUA 3MV7D 1BVLA 1NDGA 2VR7A 2HAZA 4NC2B 1EGJA 1P69B 2A9NH 3IDNA 1JN6B 3IXTA 3MCYA 3KLSA 3QIBC 5F9JA 5EEVA 3PWJA 3Q8CA 4UQ3B 1L4IA 4NQCD 4Z7NE 3W2DL 2VZUA 2UZYB 2RQEA 4J5VA 1AD0B 4KQ3H 1M2OA 3QWNA 3WTTA 3ZK0A 4XNXH 1MJ8L 2FEDD 3GNML 1ML0A 1U9KA 3BXNB 4TVSa 1NDMB 5F9OH 5F3HB 4W6YB 1K5WA 4PI0A 1B0RA 3KR3H 2EZ0D 1D2OA 4JG1L 3T6QC 5ICYA 4KVNH 1FLTX 1DVFD 3AXLA 3B9VA 1E3ZA 2YA1A 1EK3A 2E5EA 3E38A 3VSVA 3D48R 2GK2A 4PIRF 1YUHA 2F58H 3B2VL 1XGYL 4W70A 4X9YA 3TPKA 1NCOA 3UJJH 2Y5QA 4XNUH 3GXFA 4ATTA 1ZJAA 4KVNL 4X6CA 3APNA 3N43B 2E9JA 2XG4A 1JHKL 4KXZI 4X4MA 2XQYK 5T5FH 1AY1H 1DN2A 1E5BA 3UJTL 4YHOL 4JB9L 1G7IA 2WAHA 4KH9A 1JZ7A 4OFYA 4D9QD 1LE9A 2FJHB 1CFBA 1H3UA 2K4AA 4FQ1L 4KDVA 3LEVH 4GQ9L 5T3ZE 2L7EA 3CZSA 3D08A 2O30A 4OQTH 3GSUA 1DVFC 2BIOA 4L1TA 4AWJC 2XWJB 3RWIB 5FEBA 5GS0D 1D5MA 1NGXB 3ZE1E 3FQWB 3O8XC 4PRNB 4XH2A 2QL1A 3SDYL 3V0HA 2DQHH 2QPUA 3CQPA 4PV8A 2GAZB 5FUZL 2PTVA 3ME0B 3T2PA 3TEZA 3GKZA 2KI6A 3EO1B 1IAKA 2GTZB 3WGVB 3P4NB 4I77H 4G7YH 3CSBA 2F53A 1KPVB 2WVVB 2CUAA 2EKJA 1DN0A 1YPZE 2VRAA 4G6AD 4TXVB 5E4IA 5C09B 5T1MB 4BZ1H 4DVRL 4EN3A 2VMCA 2G9KA 3GJFB 4PGEA 4FLSA 4MHHI 4AQEA 4MRCA 5E94B 5HJBA 3KWXA 5I18L 3QAZB 4LZKA 4V2CB 5FOBA 3DUHA 1KCSL 3OHXA 3VWKA 1PZ2A 1PAMA 1GW0A 5DVLA 5G4OA 1T89C 4OFIA 5I74C 3ZQWA 1XR8A 3TH3T 4PGZA 5KYUB 4Y1AA 2DQCH 4ZTPL 1TT6A 4U6YA 1R5IA 2A77L 1VHPA 3DKHA 3MV01 3O41B 3TEUA 4M7JH 2BP8A 4N8VA 4OUUA 2NCEA 3T8VA 3G5ZB 3GSNB 1QI4A 4NB7A 1CCZA 4PIBA 2VZSA 4EN3B 3HA0A 1HSBA 4OY9A 4P9HH 1RUKL 3RUGB 4M48H 3MLSH 4CSSA 1H0DA 4LNRB 5E1AB 2X4NA 5D5MB 3PNRB 3F5WB 1NEPA 2ERJC 3QQXA 1JNHB 4BCZA 2JELL 4OD2A 3FSAA 2B3RA 3V79C 2OMUA 3PV6A 2KH2B 3HLAB 4HBCH 3WGUB 1IJ9A 3HUJE 3NUKA 3EYOB 4PJEA 3AS0A 4PJFE 5H94B 2HJLB 2E7MA 4R7NB 1ZHNB 4LP8A 1KIQB 3O45A 3S36X 5D1XE 1FL3B 4GUQA 1KFAL 1A2YB 5CGYD 4LKCB 4U2ZA 4RNRA 2R1XB 3OZLA 4GLRH 2ENJA 3S4SG 3F00A 4XHJC 1TTRA 4OZHB 1Z5LB 2DZEA 4W9HC 4BFOA 3MX0B 1SMAA 4W68A 3ZDYE 1TVBA 1L7TL 3Q01A 2VLJE 4JFFA 1BYNA 5AKTA 4APXA 2ZKYA 2GC7C 1IB5A 3WDIA 5D7IF 1IVLA 3HR5B 2E4TA 4H20H 2QQNL 3Q8BA 5BZDA 3H7LA 2VXVL 2EAEA 2AV7A 5T3XD 4DP2X 3D9AH 4FXKA 2X44D 3M7FB 2EUWA 1NLDL 3EJCA 2ETWA 1A7OH 3HE7C 3O2WH 3VFRA 1J9CT 2QQKL 2V2WA 1SEBA 2DLTA 5DWPA 4YHIB 5HYQB 3MLZH 4NUJA 5I0XA 3APFA 4MDJA 1BSIA 3M46A 5I0YA 1JZ5A 2AJXL 5KYNA 4Z9KB 1XMWA 1CDHA 1TQTA 2HP4A 4IHOA 5JMOC 4IBUA 2YPLD 4HC1A 2PCYA 5IBLD 3HFMH 3T6ZA 1BM3H 3I74A 3CN3A 3GMOA 1YY8B 3U6RA 5FYLH 3BAEH 3JWOC 4JANB 3DX1A 1T1YA 1J9SA 1BZOA 1KJ2B 1KC5H 3MCKA 5EF3A 5HDBE 4FNQA 1GSMA 4MCYB 4OB5H 5E2WL 6FABL 2Q86A 4NKOA 5GHWL 5D1ZC 5B7FA 1KOAA 3L1GA 2HVBA 3GJFA 1USQA 2ZUYA 3MJ8B 4NZDA 4JG5A 5B22A 2WXLA 3QH3A 2P5PA 4WEBL 5I6XC 3QJSB 4M00A 4N2DA 1MRFL 2R2EA 3VD2A 3AFLA 4JREB 4JZJB 4KFZC 2GT9A 3DHMA 5D6CA 3FHEA 4ZTOL 4WV1B 1S9XB 1I8IA 2MEJB 4OQTL 5I1GL 3BDYL 1S6NA 1YNTB 4ZFFA 4N8VB 4R97C 1KTDA 3RL2B 1IFGA 1UWXK 1JK8B 1FZMB 1N5AB 1YYML 2AQPA 3GIZL 4EAEA 3NJKA 5A3ID 1IO4C 1B0GA 1CLZH 2W38A 4MQSB 4MQ7B 4PWFA 1ZVHA 3EUUA 5CEYA 3UO1L 1CPUA 2G75B 2YD5A 1CGVA 3BWAB 1CO1A 3SGEI 4PR5B 3JWOH 3GRWH 4P46D 1MXDA 1BFOB 4R2GC 3HAEH 5L2KE 2HRPH 2YKLL 3HS9A 3EJSA 3QO1B 5F7MC 5HGHB 5FA3B 4Z7VB 1AAJA 1PD1A 3ZBMA 2EIJB 4ZMZA 1IQWL 4NX0A 1JZJA 1HCFX 1QWNA 4GUPB 3D85D 4PJHE 3HN3A 3HZVA 4P4RB 4HOXA 4G82A 1PGRB 4FNRA 2PO6C 1FCGA 3VW3L 4M4RA 3CZJA 4HIEB 4K7PX 3OM3B 4IIZA 4P2RA 4JE0A 1FAKT 1GZPB 2N3JA 3JWOL 1TTCA 4NZJA 4MXWL 4ZMVA 3SY6A 2KZKA 2IMNA 2FL5A 4IBLT 4OLXL 5FKAB 3QXVA 3OR6A 4LRNH 3VYNA 2VN7A 2BNRD 3PAYA 5IBLC 3V4PB 3VXRE 3TBYA 3MO1B 2X40A 5B8CA 3RIAK 4KK9D 1V7MH 1BF5A 5I15L 5C09A 4UIKH 4F37F 3F62A 3DHUA 1OTTD 4TMPA 4OZGB 3BD5A 4Z7OB 1QZNA 5CJQL 5IVXF 5D1QD 3PWLA 3PAZA 1AQDB 1ZTXL 4KOCA 5ID1B 4UM9B 1RXLA 4I85A 1PSKH 4JGMA 4PV8B 1T03L 4XCEB 3HNTH 1H3PL 2ZAIA 3QQDB 1JPFB 5ENWA 1MJ7H 3NFSH 2IWEA 1BVNT 4X4ZA 3WTVA 3SY0B 2CM6A 1M7IA 2F1BA 3GMOB 3U6RB 1RUAL 3QDME 5E6YA 3FQXA 5FHBH 1ED3A 1UD5A 4XB8A 3CUPB 3MUGA 4UTAH 2V4LA 5FECB 3H2QA 1WH0A 4QOKB 3BPLB 1MWAL 3QIUB 1XGRB 3X3GL 3WFHA 3BPNB 3KYNB 5ICUA 3LN9A 3K6SA 3HC2A 3QP3A 2IPUG 2W9EL 5EDXA 5ILTH 1NBZA 2MTPA 2QLVB 1PG7H 4UQCA 5B1CA 4CN6A 5J1SC 4UM9A 2OSLB 1WAPA 4DEPC 4PJAF 5J1AA 2Z93A 4WIQA 4A67A 5GZNC 3FRUB 4UOQA 4ODHH 3MMEA 4G5ZL 2HUEA 4Z7AA 1PLAA 1V10A 2ERJB 3D09A 4M8UA 4K7PY 4PJXF 3ZHDA 4JQXC 2V3EA 3ZE2F 4ZUWA 1SGKA 1QEWA 2VAAA 3ESNA 3BUTA 3QJRB 1F0LA 2X1OA 1M3JA 1NDMA 3GMNB 2GTWA 5K1VA 4M6OH 4NKDA 1BOYA 4FXLA 2BVUA 3SYCA 2K6ZA 3N1GC 4BFNA 1N10A 2GFBB 1NM9A 2W0PA 2CO3A 2HXAA 4XCNB 1EDHA 1JD7A 4KMTL 1YNTA 4Y5YC 1XF4B 2IQ9H 3AG2B 1RU9L 1SY6A 3PGDA 5GGRB 4PJIB 4L4TB 1SLXA 5GSRB 3QQ4A 5E8NB 3T6WA 3HS0A 1SBSL 3BE1H 3QNXB 3ZTNH 1M9SA 5F0JB 3U9UA 5GGRY 2OW7A 4MTMA 1YECH 2AANA 3TJEL 4X0KB 1X5FA 4NKIH 4ZSOB 3CH8A 5I6MA 1DLFL 2ZXWB 3T0VA 4AVHA 3US0A 1EZSA 1G0DA 4J3XA 1MI5D 4TSCH 5ESQA 5LCVA 2V0AA 4XBEL 2CK2A 4UUJA 3QCTH 4S1RL 1Z9OA 2W9DL 5KYYB 1RLBA 1RHHA 1V55B 4IRSD 1EAPB 3D4YA 4Y89A 3GB7A 3P77B 3ISRA 1MEXL 2YLHA 4I1NB 5IHUH 2ZX8A 4Z7OE 4MA7L 5I17A 4FMKA 4G6AC 1V8HA 4B7LA 2Q9OA 2H6PB 5C97A 4ZX4A 4AQ8A 2AJ3A 3VXRB 2I7SA 1JG9A 1NCDH 3N50A 5HHOD 3KJ6L 1ND0B 1GS6X 4JFUA 4G80A 4GI6A 3H54A 3MA9H 2WZPA 3TH4T 1FG2B 1O6SB 3R8QA 5FM8A 4JDZB 1O5PA 2ZYRA 5CIPB 5HYSG 1YEFL 2F53D 5L4MA 1UH2A 2H1PH 2RACA 1IM3A 2DIBA 1BD2A 3IJYB 3N2JA 4W81A 3DXAD 1C5BH 1SY6H 3AWEA 5I17B 5EBMB 3S3JA 2G4GA 2YXWA 4ZTPH 4TSBH 4UYQA 3LXBA 4PLJD 3W57A 3D4ZA 5EBGA 3DX8A 4FFWD 2FJUB 3BW9A 2D8KA 1TOXA 1U4EA 4YBQC 4QLWA 4HKJA 3SE8H 3PJSB 4YSPA 4OV5B 1W0VA 2NY4B 2P48B 4JFFB 1MCPH 3GS4A 2OK0L 2YGQA 3EDFA 3B8SA 4L3EE 5FO7B 3LRHA 1O6SA 4FTVD 4K94L 2R29A 1FL6B 1AFVH 2P80A 4MKMA 4DAGH 2A9AA 3FU9A 2I60H 3EBIA 2JI1A 1BVKA 1JN6A 3PUCA 4HIHA 5ITFA 3GXDA 5FYKL 4N0FB 5IW6B 3KE0A 3AW5A 3MBWB 3ZO9A 3BP6A 3WIIL 4KUZL 1ZHNA 4TVUA 1W8NA 2NY5L 3LVTA 4N3UA 3BVUA 3LKOB 2AK4D 3MA7A 3STLA 3CPUA 5E08H 4N90D 3T0BA 1NIBA 3OR7A 4ODHL 1GZQB 3EGDA 5IROA 3ARGC 4EIUA 4H8WH 4LAJH 2XIDA 4YDNA 4DK3A 2CK0H 1CXLA 1DUYB 2Q3ZA 1OCRB 2FNWA 2NY2D 5T1MA 3QUML 1XTMA 3O3AB 1JF5A 3LPPA 3QI9B 4MB1A 4P59H 4ZFOL 4EJ1C 3NGBB 4F8OA 2JJTC 3FXIC 4X5QA 3BCFA 4JPWL 1NOLA 3Q6GL 4JL1A 3H2WA 1RY7B 5FV1L 5DMGC 1HWWA 1ORSB 1W15A 5TD4A 1J0KA 5FHBL 5E8PA 3RA7L 5D72L 1YAIA 2ZWYA 2D3NA 4P4KB 5EWIL 2UWEA 1RFDH 4NNPL 5JNYB 2ARJA 1KF9B 3F58L 4ZMLA 5AB2A 4OIBA 2CJTA 1CT8B 5SX5H 5C8JB 5D2LB 3FF7A 5DDHB 1PQZA 3PP4L 2UUDK 2Y6SC 1DANT 3AGWA 1YO4A 3APCA 3Q8FA 2CWRA 1F2QA 3D39A 3NCCB 2ZT9C 2E6PA 4HVBA 1I8IB 2F74B 2K70A 4OZIA 5IREA 3KWTA 3NSYA 2XKUA 3BISA 1SVCP 1TXKA 5AYUL 1E3FA 2OR8A 4F93B 1WCBA 1MCEA 4CNIA 4JQIA 3I85A 4B9JA 1MFDL 1ZIBA 4Z7WF 1KEGL 3KNBA 1CTNA 1UWEL 1FDLH 2VDQL 4K5NA 3WFDL 4XVSL 4EDWL 2W91A 3EJTA 3K71A 1MY7A 5LXGL 1BP3B 5I23A 5GGQH 4F9LA 1ZLVK 1FFTB 5HPMA 2DPKA 1AYRA 3VVWA 4HMDA 4X5XB 1F90L 4H0HB 4XP4L 3N44B 2APVA 1XGQA 4K9EC 4DWHA 4Q56A 1UB6B 3EGXB 1N8OE 2EH7H 5DQ9A 3AM8A 3FTSA 4M1CD 1GAFH 1DCEA 1OTUD 4WWNA 4Y2DB 5C3TA 3UGEA 2IQAB 2DWXA 3LKQB 2AFNA 4B96A 1FJ1A 3II3A 2A6KB 3MR9A 2OX5B 2ZKWA 4PJ5D 3B4NA 1MSPA 1KN2H 2WJ7A 3L3IA 3O6FD 5E2VH 2JIXD 1OGAD 1T21A 1U0QA 4WTXA 1VPOH 4KMQA 4WK4B 3TNMA 3RVXC 3X13B 1SEQL 4BZYA 4WO4B 2G30A 1M6OA 1A6ZB 1AKJD 1GS7A 1QX1A 1CLZL 2YARA 1EJOL 2XV3A 2ZUQB 3IGFA 3LH9A 4ODVL 5LLIC 1YYLL 4L0PB 2AEOA 1UXSB 1QR4A 4XZUB 4F7CB 2J5WA 2CG9X 3ZIYA 2Q7YA 4O4YL 3LRKA 1GGBL 3LIUA 1DJIA 3SGDH 1MHEB 1P0SE 4OF7A 1PCSA 3MXVL 2OP4H 4LMQE 2Y2YA 2F0CA 5I8EB 1KTJA 2HB0A 4G9DA 4YHLH 3QXAA 1NCHA 3VFWA 2Z8SA 4PJIE 6PAZA 1TZGH 5DJAB 5LGHH 4RMSA 2YHGA 1NCAL 3L4YA 5D1ZB 2C5DC 3OC8A 2DQTL 2WTOA 2YAMA 4PGDB 1ND0A 2GUOB 2WYZA 3WEXA 1XXFC 1ECYA 4JQVC 1DBBL 3ALXA 3K2KA 4DW2H 3NSFA 2CU9A 4LL9A 1CTMA 3IM1A 2WIIA 4GIOA 5K9JH 3QEHB 2FO4B 3A23A 2K6YA 3TBYB 4RMRA 3FNKA 4NDMA 5HJDA 7CGTA 5JOEA 1RH8A 3EKCA 5MEPB 3VI3F 1KLFA 1W72B 2CXGA 3QFGA 4BE5A 4BSWA 2OW6A 3ULVC 3WIFA 4WUUB 4HUWA 3PGFL 4R90H 2IGLA 2EDXA 3WXWH 5BVPH 2NY2C 1E8WA 4Y4HC 3RAJL 1AZRA 1CFSA 2NY5C 5ERWA 1YY8A 2FBJL 2YFNA 4PS7A 3ZZ1A 5C0RH 1I7RB 3GBML 2K8MA 1DQLL 2I9TB 5CCJA 4JPWH 4LAQL 2B77A 3B34A 4H2AA 4JFWA 1BJMA 2VABA 4BSVA 2WZPD 3SQOH 3BKCH 4NJAH 2JKLA 2EH7L 1HL4A 3LZFL 4HJ0D 2NYYD 3KYAA 1M53A 1T6VN 4EZLA 4JKMA 4QRUB 2ID5A 5DD6A 5DA0B 1N12A 1W0VB 4AM0B 3MV9D 5C7ZA 2WY3B 3U0TB 3LKPB 3NACL 5IW1B 2ZP8A 1UWEH 2VDQH 4Y9CA 4GIAA 5CZVH 3BRGC 1A1NB 1S78C 5AW8B 4NS0A 3VFVA 3MYZA 3OGCA 5D7LD 1DQML 2DQFA 3VXUE 4ZYKB 4ZAKD 3DMMD 2E8YA 3T0EA 3UYRL 3CHRA 2E59A 5GISL 2VXSH 4LLVB 4M7KH 2AEPH 1U3NA 2YPVL 3IDIB 3VMPA 3BEVB 5TDNA 4ZFFB 3EH5B 4N2HA 5DGRA 1CL7I 1CFVL 4C56E 1GGTA 2C3XA 5F71A 2HFGL 4HS3A 1PLGL 3K7UA 4P0DA 3CAFA 3E0GA 1KIQA 2WLJA 1FFOB 3W56A 3QSKB 5I16B 1I8UA 2WXPA 1CFVH 2WD0A 5EN2B 4GKZB 2Y2WA 3QHFH 2J8UA 5C0GA 3QUYB 1U8IB 3QJFB 4I3RL 4LVOC 3UYRH 4TM9A 3GS0A 4IRZL 5ID1A 1DVTA 1ET7A 5JIQA 4L9DA 3CFKB 3LTVA 3B9KD 3QHFL 3LZNA 3EDEA 3L17A 5FYLD 1MI5B 4GS7B 5T1DH 4EBQL 3KYMA 4O02H 43CAA 2B20A 4OD1H 2EDHA 3S88L 2A6JB 4QJ5B 3BPCA 4HHAB 5GGTA 3HAEA 3FTXA 3NYKA 1P2CB 3VX0A 1ZHBB 4QTHA 2L4OA 3F83A 4LIQE 3SEPA 1U8HB 3FQYA 4HPYL 2GEQA 1N4XH 2HJFA 3EJZC 2NZ9D 4QTFA 1P5UA 3WS6C 4NUGH 5HI3D 3K2UH 1L5GA 4WK0B 4D0BA 1R3HA 1RPQA 5B1JA 4C55A 1OPGL 2R23B 3OJDA 2YUXA 2ICEC 1IGIL 1AMXA 1U3ZA 2FHCA 2HYMA 3FU0A 4S1RH 4U1GC 4YQXH 3NJFA 5E94A 4ZO7A 1ZLDA 5KSAB 1BXXA 5DA4A 4WI7A 3M86A 3V6ZA 1DLFH 2X12A 4GMSL 4L5FH 4HLJA 1F3JB 5L88H 3SJVA 3EDJA 3AT8A 5AOMA 1QSFB 1FJ1B 3K6NA 1JL8A 1R5IB 1JGLH 4XPFL 3VFUB 2IANE 2VYRE 3F7QA 5ACMA 3T2OA 5CGBA 1MFVA 1IBGH 4PJIF 2IVFC 1EZLA 2WLZA 3QPKA 1DQLH 1X6LA 4JMNA 4K5OA 2OKMA 1G1OA 4A2EA 3QZLA 4WEMB 4X7TA 3UBXB 4YZFF 3A67L 4V1DA 3UJJL 2GQHA 1OAYL 2X4RA 1CE6B 1PTZA 2ADGA 2F58L 3B2VH 2Z92A 3GYRA 4JS7A 3TH2T 3TPUA 5JXEA 4XCYA 5T1KD 2C9QA 3VFOA 3BZ5A 5C0AD 2HLFD 2VUKA 4HLZH 3MVSA 4HWUA 3S5LG 5C9JA 1KGWA 1YEJH 3IWUA 3VRJB 5ECJE 4RGOH 4YNYB 4MB3A 4R6UA 2J4WH 4OM0L 3GFUA 1OO2A 1OGAA 3T4AA 3ATFA 4Z78A 4AVJA 5T3ZH 3BH9B 1URZA 5LGYA 4DNLA 4OKVA 2FEEI 1DQQB 1EEZB 4KZCA 4MXVE 5D7JC 5BS0B 4GRLD 2E7BA 2P26A 4U7MA 5IFAL 2NW2A 3TEXA 2X4RB 1CE6A 2ADGB 3GBDA 3MJ7B 1DFBH 2VLJB 2COQA 4UU9A 2NXYD 5JPNA 5AWNH 3QO0A 3GIVB 4YDVB 1CJYA 1J8HA 2O61B 2VIRA 5I1AB 5E8PB 2JB6A 4FQJL 4Z3JA 5HYJB 2NXYB 2XZQL 3RB5A 2PTTA 3VDBA 4WU7B 5KZCD 2BNRE 1JFHA 2A1WH 2R2BB 3CXFA 1LP9A 3C6EA 2A1WL 2W0FB 3EYVB 4NLHA 5BS0A 2B39A 4MLSA 4YHIA 1AMYA 4CDGC 1RMFL 1TQWA 1I85A 4P2CG 2B5IC 5K69A 1AZUA 4GRWH 2XVBA 4BM7A 4TTDC 4MQXD 5H8DA 1IUZA 4X6FB 4PJEE 1VLXA 4LRIC 1EEYA 4M1GH 1P7QB 4O51A 3NTCL 4O9HL 4L29A 1VA9A 3T2NH 5DUMH 4P23C 5J6HA 5E6UB 3BVNB 2ZIDA 2LAGB 4JDZA 5MEQB 2P42B 5IR1B 2R0LL 2WSPA 1BIIA 4MNQA 3QJVB 5JO5A 1YA5A 3NIGE 1LNUB 4N1CA 4QCIB 3OWRA 5HGDA 2CHXA 2OYPA 4HQQH 3UZVA 5DC0A 2V17L 4NBXB 4U6TA 3DSNA 5LCVL 4ZX5A 4WF7A 5FAAA 4NZTL 1A1NA 1L6XA 4IKIA 1HL8A 2VDKL 5CKGA 2DKSA 1OF0A 3RTQC 3Q2CA 2WZ5A 1H3PH 1IVTA 1DO6A 2GHZA 1RP9A 4PVBA 5EUOE 3M1BA 1BZ9A 3WEXB 3MRHB 4FMFA 3T8XA 4HG4J 3KL3A 4JVPA 5ICXB 4IBWA 4Q89A 2D7TH 5D70L 3FL7A 5E0FA 1H3TA 3OC5A 4MSWA 5T3XL 3VAEA 1WZ1H 2FT8A 4HZ1A 4WENB 2XZAL 3BP6B 1G7QB 2JIXA 1P4BH 3SPCA 4ZMXA 1NBYA 1LEKA 3LSOB 4ZXBA 2Y24A 4GAYB 4A7GA 3RTQB 1UB5A 5DD0H 3BPOC 2ZJSL 4ZOAA 3E3QE 1UKSA 2KDGA 4JN2A 2A6JA 5E9DA 4F7TB 5I1LB 4JM0A 2XVKA 3PWPA 4XCNA 1IKOP 5TFSH 3I84A 5DMIH 1W8EA 3C9NB 4QRTB 1T7VA 2UV3A 3CFKA 2XV2A 1ZA6B 1UM5H 2BVQB 1X7SA 3EOTL 1AKJB 2OXGA 4WFGD 3UBXG 3J8F7 3K72B 5JOFA 4H40A 3GBNH 1GGCH 2ADIA 4FNTA 1P9MC 1T6BX 4Q52A 1QFHA 1Z9PA 5C2UB 2OK0H 3S98A 3TOPA 3UFIA 3I75A 3FB7B 4JCMA 5DJYB 1RP8A 4IDJL 1HJBC 3QUZB 4J3VA 5IJVB 1PYWB 1NIAA 2VERN 2NY5H 4ABQA 3QXDA 2OI9B 4G5AA 5I28A 1KT2A 4IRZH 2DJMA 1SUHA 2FX7L 4ALAL 1XCTB 5B7MA 4BSWB 4G8IB 1XHHA 4WI2A 2PMZA 3VFTA 4QRAA 4NRXB 5JXEC 3NIDB 4NKMA 5MENE 1EZUA 2B1HL 4U1SB 2CLRB 1NC4B 1SF5A 2WSKA 1GY2A 2X2HA 3BUDA 3GSVB 5D8JH 4FJ6A 2OMVA 1SOQA 3QQDA 3FTVA 4UT7H 1RLWA 2VN4A 1KPUB 4Y4FA 2A9BA 2D2CC 1C5DA 3FHAA 1ES0B 1L9TA 4HFWB 5DJXA 1X5YA 1BQSA 4MA7H 4OGXL 3O9WD 5C9JB 2EEDA 2ZCHH 4L3ED 1Q9LB 3P3RA 4LHUG 4LP5A 2FLRT 2FWOA 2DJUA 5GIRB 3U1PA 2BXYA 4IOIA 1IM9D 3VD9A 3WLBA 5L8KB 2BNRB 2VERA 2CO7B 4ZMOA 4XPGL 4JHZA 4IOSA 1PQZB 5C0BD 2O6EA 1I1FB 1JF1A 2C7UA 2CBTA 1VADA 1PX4A 1RKRA 4GSQA 1JSYA 1KB3A 3SYQA 1BHGA 1QFWI 4OFKA 4KDWA 3OKOA 3KJ6H 5D55A 1O7DC 3GBNL 5T3XH 1RJZA 4TTDD 5BW7C 2ADFL 3ZXAC 2OLDA 3L3HB 4N90E 5FYLL 4ZMQA 2HZHA 1AZNA 4IEFB 3FTGB 1F3DJ 5F8QC 5AVQB 4GMTH 1NFIA 3T3PF 1XV8A 3WEBA 3SQOL 1KY7A 5AVZB 3EO0B 5SWZB 3WHXA 1S9VA 1P1VA 4AEFA 1I1AC 2AITA 4HK0A 4GW5A 3G5WA 4JFPB 3AB0B 1R5WA 1UQSA 4QYOA 4YDKH 5K9QI 4QOKD 3CN2A 1HZLA 1BFTA 2WBJB 4HOWA 1X9RA 3TTSA 1G6RH 4I48B 4A66A 3AT9A 3IGKA 4J3BA 1GYCA 1H6EA 1HZHH 1N18A 2J1WA 3FRPB 3LPWA 1NGXA 4HLZG 1P84J 2CRMA 4BQ6A 2VH5H 1P6FA 1UB5B 2N01B 2R29H 2W81C 1FPTL 1T1XB 1ZMYA 2J72A 3HZKA 5CIPH 2WJ5A 3LNFA 1ZT1B 4CGTA 2NZIA 2QSTA 1RU9H 3LZLA 3HAEB 5E9DE 1RK1B 4GYBA 2J6WA 1TETH 1GYAA 2B2XL 1KCKA 3QUYD 4BQ9A 4A7GF 4FG6C 1X9LA 1Z9SB 3O6MH 2KERA 5EUOF 2QGDA 4AM0A 5JLZA 2FVNA 1U8JA 4MMXB 4D7PA 4HQQL 4RFEA 4JFYA 4FAAB 4D0DB 1TJMA 4YHLL 4J4PC 3M8OL 3HNTL 2CCWA 1DHKA 2XBZA 1FQ9C 2CBMA 2EDTA 4Q2ZA 2EYSA 1GGBH 3LEVL 4GQ9H 1PG7X 4L8SA 1OSEA 3T0XA 3T65A 4KNUA 3REVB 3OKYA 2Y22A 1NLBH 2DTSA 2FB4H 2IDQA 2B0SL 3NA9H 2RJMA 5EDSA 3P2DA 5TK4A 3IN0A 1FH5H 4XNUL 2XN9A 5ANMB 1JWSB 3RGVD 5DMYA 1FE8H 4FMVA 4OF6A 5BQDA 3DJSA 2ZXBA 1UG9A 4H25A 4LVOB 4YDJB 4ETQA 2JCWA 1XEDA 1TSRA 4Y16C 3D12B 4JRFA 1AXTH 4BFKA 1WD9A 1QHOA 2CHNA 4FQXB 4FADA 2ZOLB 1K4CB 3FTZA 2ZUWA 5JOPE 2V2WB 2GYSA 3PWPD 3QXWA 4EOWH 3A4DA 4PJ9D 5CD3A 4LCWA 1UZ6F 3LKPA 4LE8A 3ZDZB 1MW2A 4Q4IA 1TZIB 2F8OA 3M1BB 3D6GA 1MG3C 3F12A 1TKWB 2F8VA 4JO2H 2ALAA 3DX0A 3GLDA 1HOCB 2FH8A 2A38A 3PWPB 3GJFH 1EXGA 4AE0A 4PJ5B 1LO5B 4PJGA 1WCQA 1T1YB 1TDQA 4LLWA 5LXGH 1FDLL 4KH2A 4YDJA 4X8JB 1HINL 5FUOL 5GZND 1ZGLM 5E5MB 3ZYOA 1INEL 2X09A 1DLHA 3QR1A 4AGPA 3VM5A 3RZCC 1YDPB 4QWWD 2R8SH 2QQQA 5SX4H 4PJFF 1V3KA 3EYFA 4KJQD 2YBRA 4O58L 1CL7H 4PW3A 4ZO9A 1YYMH 3GIZH 4LHUB 1D5ZA 4OGYH 4TQHA 1OANA 1Z3RA 2PYEE 1UD4A 2ZKMX 4WTZG 5AVVB 2E7LC 1FP5A 3QZOA 1T20B 2ITCA 4OLVL 2HJLA 4R7NA 2X4SA 4MJID 4YH6A 4ZPVB 5HTSA 5JQHC 2FR4B 5C0CA 4XB3A 3BGFB 2PYED 3L3JB 1I8LA 3ZT7A 1N0XH 2E7HA 5KOMC 3F58H 2IH3B 4PV9B 1CXHA 2ZXQA 5HSFA 5HDBF 1XIWC 4XVUC 2XACC 2MPVA 1LWJA 4KI5D 4YSDA 1AS6A 2PWGA 3HG4A 3JZ7A 2DI9A 3D39B 4YEEA 1AZVA 4OGQC 1CFTA 4FERA 4IDJH 4OZFG 3X14B 1C7TA 3IXAB 5MENA 4EUPG 1ZS8A 3CZKA 4LLDA 1UA7A 3QPQD 2WXIA 4PJXB 2E4FA 1D5XB 1GMEA 4L5FL 4CW1A 4HUKB 2ITDA 2DIEA 4BINA 2YD9A 1KV3A 5KS9F 3WNJA 3S88H 4HPOL 3DOSA 1EUUA 4PGBB 1A6UL 3INUH 1BVOA 2HCZX 5AG8A 2FBRA 4KK8C 4KUZH 3DX6A 1YVLA 2ORBL 4ES9A 3HZVB 3DO4A 5CHNB 1LQSR 2RB8A 4A2LA 3KW7A 2Q76A 2UY7B 2A3TA 4N2MA 1KBPA 5CJOL 3ARRA 1F18A 1DSWA 2XKNB 1AFVL 4FF9A 2XPYA 4ELME 3DSNB 2DW5A 4HPYH 2VMDA 4Z7UA 3UL4A 3X2QB 2FL5B 1GGYA 1K2DA 4QF1A 5I66A 2Q3XA 4F7PB 3PABA 5JIHA 1JWSA 1T1ZA 1QI5A 4ES8A 2IOMA 1WWBX 1HYRC 4HCRH 3TWYA 2DY2A 2A9MH 4IOSD 5EV7A 1A2YA 4XPBH 4C47A 1KCVH 2AJXH 4DP9X 1LE9B 4NPYA 2MKLC 2WUCL 4KKNA 4KGLA 5D2NC 5HVWA 1AZCA 1RZ7H 1IC7H 2VQ1B 3WLBB 3LPOA 3QIUD 2EDBA 4QNPE 3CFEA 4ZZKA 2BY1A 3PL6C 1I1AA 3QNYB 5TDPB 1U91A 2RAMA 5BPPA 1SLUA 4KROB 3DVIA 2X2YA 3KLAB 1R75A 2Z93B 1J87A 2DS4A 3QARA 5L8LB 3ME0A 4NWTL 4CMHC 2VUOA 1NFDF 2AVGA 2HTLC 4W4OC 4GQQA 1JGEB 4XC1L 4WJKB 2QDWA 3OKKB 2YRBA 3ES6B 5DFVC 1RIVH 3I9GH 1TR7A 1WD8A 1RZKH 1UXLA 4GO6B 4NWTH 4Y5VB 1B0GB 5J56B 2OMBA 2R59A 4NPYB 1M42A 2XNAB 5GISH 1ZT1A 3OR6B 4MAYB 2AJUH 2XKSA 4U7KA 2YBRB 1O9VA 2OQJB 1UCTA 1VRSA 1SYSA 3WKNA 1T0NB 1QR1A 1QATA 1IEBA 1EGJL 4I48A 1E6JH 2R0ZL 3MBWA 4NENB 4ODXA 1PYWA 4X6BB 5KBKA 3NACH 2WLLA 2MPAH 4D94A 1AQDA 4WI5A 4JAMB 3VI3B 1R3JA 5KVGH 3K71B 3HG5A 4YDIL 1JCKA 3L3DB 4QO1B 5CBAA 5E56A 2P1YA 1ZSDA 5DMKB 2NDFA 4IOFD 5GRWA 1PDKB 2VSMB 1B6DA 1UURA 4Y8AA 4NQVA 1EHLH 4HJGB 4BV1A 1C5CH 4F33B 4XTRC 5D7SL 4L9LB 5DEGB 3U7AA 4J7RA 1IGJA 2D9CA 5DRNA 1SF3A 4E41A 4KJPD 2PWFA 5B7EA 1DBJL 3VI4A 3LEXA 3PGFH 4R90L 4LOUD 2YMXL 3BX7C 3LSOA 4P5RA 3OBAA 5T1LA 5ABZA 1J5DA 1U8MA 1VFAB 4X9HA 5CGTA 4I13B 5IV2B 1OAZH 3NCYP 2PXYC 2VXQA 3EJUA 2OJEB 1Q1PA 5HVHC 2A6IB 1WA0X 2TSBA 2Y7LA 4NQUA 1G7MB 4B60A 1XGPA 1JV5A 4UI2A 2R0LH 3P2BA 3U6XA 2QVTA 1T0OA 4AQ1C 1IC1A 1QPPA 4ZYKA 1D7FA 3DXAB 4KV5E 5DUML 1FF5A 2Z1PA 4TN9A 1ODAA 3AU0A 4X9IA 2A9CA 3RGBA 2BY0A 1AANA 3NDYE 3SDDA 4OFPA 2AZUA 1TZGL 3C87A 3DYMA 4YPGB 5EPMA 3QZPA 5B3NA 2EXYD 3FB6B 3HI1A 4FYRA 5F7HA 5AVSB 5JHDD 1DL7L 4P23D 2ZG1A 1EHNA 3AQXA 3AJ7A 3OV6A 4ORGB 3ZQ9A 1YEEH 4Z7NF 3PNWB 4MNQB 3SKNB 3IK2A 3ARFD 2YAOA 3MC0A 1PD0A 2JH2A 4AUYA 2ZSWA 3S3PA 2P8MA 1B0WA 1F90H 1KELH 4MXQD 1UT2A 1BFSA 1X5ZA 2JLLA 2X6AA 5IVOA 3O4LA 3U4EA 4NSKA 1MFEL 3NVQA 2YD6A 3GSQB 1M71A 2WYTA 3FQ2A 3RDTA 3SDXE 4OLXH 5D9SB 3LQAH 4G1MB 1PX8A 3CZLA 4WJ5A 4L8DA 1KEGH 2YOAA 3RWCB 2YRLA 1MIML 2HX7A 5AOZA 4CC4A 2H32B 3OZ9L 3DV4B 3FQUB 4OF8A 4AGMA 3RUGA 2Z31B 5EN3A 4Y88A 3D3VE 1YMHB 4KK6C 3WG7B 1HCYA 1LP9B 2X6CA 2B8OT 2JKNA 1HL5A 3NH7L 1MREH 4V33A 1IE5A 3EYQD 3BDBA 4JRYE 1IM3B 1X9QA 5I1IH 3UBGA 1WIUA 1IEBB 4JFOA 2AEWA 3DV6B 1CZ8L 3MDJA 2IPTL 4JFDA 4RGND 2FD6H 3KM2A 1TENA 2HPOA 4P2QB 4PI2A 3T0ED 2IBBA 5AW6B 4QUOA 2HT3D 5C0FB 1A1OB 2VWEE 4JHVA 2XN0A 1E5YA 1IKFH 2H8PB 4OU3A 4Q8BA 1Z2KA 3UO1H 4B9PA 2BP0B 2D31B 4ELMB 3OGCB 1HEZB 3X1FA 1CFQA 5HHPA 2FIKA 4S2SA 4I9WE 5C08E 4FJYA 3QEUB 3EO9L 3UTTE 4CAGA 1AJ7H 4WSGA 2V9UA 4EQ3A 4HFWA 1HDMB 5CBEB 4I3SH 4LBAA 4JM2D 5EZPA 1Z9NA 5FUCE 1VKXB 5DWUL 1E5ZA 3SDCA 2DM7A 4G43B 3EW3B 3F8UB 1Y18A 4LO9A 4E9YA 2W07B 3TBWB 3V0DA 1T6WA 5GGSA 2D7PA 3ARDD 4Z1PA 4XXCC 3QJQB 2WXNA 2IOOA 4G8IA 5H37A 3D4GA 3QT2A 3NN8A 4BKLB 4KKQA 4F15B 4RWYL 1ASOA 2EP6A 2PR9A 1Q0XL 3CHXA 3K2UL 4XAKE 3N44F 1EH9A 4WFHD 4FEIA 5DZLA 1NBQA 5IB1B 2HFEA 5I8CA 1J5OL 2PO6A 4U1LB 1E42A 1IGTB 1FN4B 1MFBH 5IJKA 4HH9A 2HH0H 2G5UA 1P5VB 1ZLWH 1WZMA 4JM4H 4L18A 4IRSC 1YN6A 2XZCL 4ADJA 3MUZ1 2EE9A 5BO1L 4EKJA 4LPTA 4YPGA 4G9FE 3BPLC 4PWKA 2YRPA 5HI3C 3K1KC 4LHUD 4G6ML 3BKCL 3GSOB 4EZKA 2XJLA 1S7QB 4MAZA 4PJGE 3IU3A 4LVNC 1GC1C 3CXDL 3K46A 4JY4B 1N8ZB 2VR5A 1VCAA 1JJUA 1MCQA 3KHOA 2OCFD 5IBUB 2W5PA 3TJHC 4UTBH 4NC0B 4BD4A 3OAWA 2VSKB 1ET8A 2L0DA 1D5BB 4QHLB 2WWMC 3NJIA 4G8GD 4KNQA 1OGSA 3FJTA 2ZPKL 3RB7A 5EIIA 3D50A 1KWGA 1P7HL 3FQXB 3NT0A 5DHVH 3BUYB 3DO7A 2ZAGA 4JFEB 3SPHA 2V8LA 4PUBL 4EE2A 1M56B 1E4XI 1HH6B 1LWHA 4KRLB 3HRZB 3GXMA 4JG0L 2D7NA 4JFYB 4J8RA 1DBBH 3WENA 2FJFB 4FXKB 1SN5A 3O3BB 5EO9B 2RMNA 5LGHL 1E4XL 1P1ZB 3RZCA 4BELD 1EO7A 3ZY7A 2Z4TA 5CZVL 2Q10A 1F1GA 5JIIA 4UYPA 1GL4B 3QHTC 4GEJA 2ZX7A 2L7JA 1LK3H 2KLSA 2YMTA 4I89A 2IQAA 4ZAKC 5AW3B 3BHBB 3MX0A 3V9CA 3EZ8A 1IAIL 3FT2A 3L4XA 3IN2A 3BEVA 4TLUA 5TDNB 3W9DA 4WDIB 4IU3A 3VRLF 3UTOA 3FTYA 4GG6B 1K2DB 5I66B 4PG9B 4E68A 7FABL 4J3OH 2ODIA 5TGBB 2XNAA 3FSWA 1QVOB 1S3KH 2J6EH 4G6FD 4QHNB 1GH7A 2XOTA 3UAAA 2GJ6D 1JS4A 4M7JL 4AG4L 2XA8L 1JHLL 2VZOA 1IAII 4O2CB 1NEZG 4EXKA 3FUFA 4X6CF 2K78A 2XSKA 4MD4A 3GO1L 4P3WA 4JK0D 1FH5L 1RJYA 1YC7A 3ZL1A 3MV9B 2GJ6E 1WS8A 1RHHB 2E6JA 1L0YA 2G0LA 3QRBA 2B0SH 3B7YA 5BRQA 2GB2A 4K94C 1BXVA 3K2IA 2J71A 1M71B 3ZRCC 1ILUA 1ONQB 3SBWA 4QO1A 4HU2A 1JDCA 4JN2B 5E9DB 5TK2A 2EDYA 4WCYH 4JZOA 4AW7A 3Q2WA 4M7ZB 3BQUA 4X6EA 5CSZB 1YJDL 5DZNA 1ZHBA 5A2BA 1TVBB 3I6KA 3RDTC 2XYBA 1VB9A 4OCYH 3C8HA 2ARJB 2HT4D 1LEIA 2H9GB 2YQ3A 3L5IA 5F7YC 2VDNB 5DJ0A 4ZUSB 5HHME 3UG3A 2AJVL 1KLGA 5LAXA 1A3QA 3MJ9H 4NDMB 4BE6A 1ZGLB 4LLQA 3R4RA 1C8QA 2VDLL 3VGFA 3WIHA 2GSIB 1KMGA 3MLWH 3KBHE 5DSCA 1RV6X 3IJEA 3DX7A 1I82A 5DZJA 1AQMA 1T0PB 3U4EB 4L0YA 1CICB 4F2MB 1BBJB 4WY7H 1CGYA 3BXNA 4UTAL 1H8SA 1U30A 1YQ2A 4QCIA 3LMJL 1H0DB 3BESR 3HG0A 4LNRA 5E1AA 2J21A 3BWZA 3SO3C 2BVOA 2VLRB 3W11D 3BUYA 5EA0L 5IWLA 1HI6B 1V5JA 2IFFL 3G6JF 1YEGL 4GSXA 4XN9A 2AABH 4OT1L 2HT4C 3EHBC 2ZE0A 3S2CA 1KGJA 5GGRA 1KGYE 4XXWA 4F7EB 1BFVH 1PZ5A 3IDJA 1GGUA 2HTKD 3UAJA 5BJTB 3BP4B 3UG4A 2NR6A 1AGBB 5CEZD 1FSKC 2FLBT 4NQEA 4P4KC 4TLKA 3LJ3A 1EO8L 1XCXA 3PWLB 4NJ9H 4HUXA 3L2LA 4PTUA 1NWPA 1SVZA 2ADJA 5LNEA 1MIMH 2H2PD 3MRNA 4NO5B 5EFIB 5CEZE 3QISA 5FXCH 3WFCL 2X3AA 3NDZE 5ESQB 4R4BA 4JGJA 3PXJA 3F05A 1JYVA 1U8OA 3OZKA 1BQLH 3W39A 1AGDA 3L3HA 3M6DA 3KLKA 1R3HB 1HEHC 1UOVA 3AREB 5D71H 5AYUH 3F2LA 4LPXA 4PGJA 2O6DA 3ZDYB 4IU3B 4OUOA 2P5WD 3Q8AA 5AW4B 3AXIA 3TBBA 3FT3A 4Q9CA 5BZWB 3N43F 4NQQA 4B0MM 3BH8B 5E6IB 1SJVA 1UC6A 4QGTA 4ZO6A 5F3FA 4ETYA 5CR1A 4XX5A 4QLRA 3ARED 1IBYA 2D7MA 4FJZA 1V27A 5LJYH 4BGLA 1PCXA 2IG2H 1JYWA 1ORQA 1ZVNA 4XN8A 5DMKA 3KYMB 1UJ3B 3FSZA 5LB1A 1SY6L 5C7XL 5HGHA 3WAKA 5K9KB 4HEPG 5C0JA 5HHQA 3RA7H 5IG7B 5H35B 4X9BA 4AJ0A 4LEEA 5I74B 3PHAA 3X12A 4WTQA 3G5YB 2XIBA 1IL1A 4LEXH 1XQ4A 1UM4H 2C3HA 4JRLA 5I9QC 5DU7A 1S9WA 1YY9D 4YC2C 1I8AA 3CN4A 4NFCA 4TPRL 3CBJB 1NEZB 1E4WH 5A6MA 2VDLH 5IV2A 2AQRA 3NOIA 5FKAA 2MMXA 3KYKH 4UILH 3TYGH 1JZGA 4AV0A 4XPAL 1YEIL 5IJDC 3L9RB 5E4EB 3GMQA 1IEAA 1KB9J 4HWBA 1ZVSB 3P4LA 5ETUB 1ETA1 4YWGH 2BMKA 5C0BA 4A6YB 2JTYA 2UX7A 1F1AA 3QI9D 3GF8A 3C60C 4YHMH 2JI2A 3D0AA 3UTPE 1AHWC 1Z3GH 2WIMA 2WWMD 2LAAA 3BPCB 4KVCL 1PDKA 1OP5K 4F7MB 1DVFB 5F0PB 4PRID 4LFHG 3RVVD 3ZUNC 1CG9B 1N6VA 3MLTB 1N70A 2I5YL 1FPTH 2OJZL 1LQBC 2N1TE 5CMAA 4WW1A 1BX2A 3HVDA 4FA8A 1RL1A 4LPCA 2E76C 4PJDA 1U3YA 3RPBA 2M1KA 4O02B 5FFOA 3TO2B 3MV8A 3U36A 4JL2A 2WKOF 3HR6A 3ZE1B 3ARZA 3PPEA 4KTDH 2R0ZH 2TAAA 4PJ7A 3C5XA 3S34H 2X1WL 1BBDL 3UYOD 5JYLA 1B9ZA 1E7VA 3ZYZA 2H1PL 3D87B 3V5DA 1CR9L 3ZRFC 1A3LL 1W0WA 1ZD6A 1PKQB 2EVFA 4FFWC 3ARDB 2Z7WA 2H0EA 1HXMB 3FU7A 3KVPA 1LO0H 5L4FA 4OKVB 1GR7A 1N4XL 3TBVA 2R0WH 4PJ6A 1HN1A 4G8EA 2J56A 4NM8L 3P4NA 2FX9H 2GJ6A 4Y9BA 1XO8A 4TPRH 3CDGA 3BZEB 4Y19B 4GBXA 4MD5B 1J5OH 2G3MA 3K81A 3QUYA 1U8IA 3KPMB 2F74A 5T1DL 1WEJL 5BXFB 2EXWD 1NL0H 1ZGLA 1E0OB 1NCCL 1E9PB 2VO8A 4JM2C 3TLRA 4L4VE 1JXGA 3KGSA 2P3YA 3L45A 2ZCHL 4X5RA 3L95B 1QPKA 2HJKA 1I8KB 2BSRA 4LASL 4Z18A 3RIAF 3BH8A 3QBTB 4LQ1A 4XBEH 4JO5A 3GI9H 4HDIA 1MHCB 1CGXA 2J20A 2EABA 4PG2C 5JW5B 1MIEL 5IB3B 1DJSA 2VJ0A 4JZJA 4GW4A 4UT7L 1AOHA 1MLCB 5MEOB 5MERA 4M4PA 2KQMA 2VR9A 3CVDA 4AM0Q 4RGNC 1JUFB 3FCSB 3QDJA 4K8RD 2Q0ZX 1I3UA 1J1PL 3GZPA 4IM8A 3MJ8A 4YJZL 1WLHA 3PWVB 1KB5H 4ZW3A 1VSCA 3HB3C 1C5DB 4GOSA 1O6VA 2ICWJ 4Q97A 1EZVX 3WHXB 2FD6L 2J88L 1MCOL 3VXPA 4CVXA 1T21B 4HD5A 1OXYA 2VZTA 4CBPA 1D5XA 3DRQA 1BEXA 4GRWE 5FO8A 4W9IC 3G04B 4Y9GA 2PCXA 3KPNA 2RGSA 1QUNA 4J39A 1LO2L 4DUWA 5I76B 5TQ2H 4AEHH 3EOTH 1AQKL 3QIBB 2KUTA 4G7VL 3X3GH 2R9HC 3LN5B 4KPHH 1YEGH 1ZS2A 4MXQC 4RAUA 4ONHB 3GWJA 1D7CA 2NY0C 4I77L 5HYEA 1QBLL 1K4DA 4U6XA 4GKLA 5C0RL 5F7AA 1GHFL 3CQQA 3UBXI 3B7UX 4AEIH 4NIKB 4RMUA 1JZDC 1A1MB 5HY9B 3GMLB 1G7LB 1TVHB 2BIHA 3K4AA 5AL0A 3BQUC 2QSCH 4HJUA 2GK0B 3HJEA 4RFEB 1QKZH 4HF5H 4TS6A 4CVWA 3QIWB 4CKVX 2LE9A 3OHXC 2AZAA 5CKAA 2VDPH 2Z64C 1EDQA 3GSNL 4O00A 5SWSE 4AITA 2CLZB 3Q3GA 5C6TL 2QKIA 2VDMH 4QR7A 4XNXL 4FABL 1MJUL 2AS5M 4ZFGH 2YEQA 4KKAC 3V5DB 3KPSA 3LS5H 2HMIC 2NOYA 1S9YB 3RFRA 1VIWA 5HD8C 3AREC 5CWSA 5EOQH 4NZTH 1KLUB 1AO7E 5D7EA 1CLVA 4YQXL 4PWGA 4JQXA 5BZZA 3MNDA 4NUGL 1L9QA 2F7QA 1A22B 4HKZA 3FB7A 4RIRB 1CGUA 2EE0A 3LD8C 1TJGH 3SE3A 5CD3B 1XD0A 3MUY1 15C8L 2KQNA 1Y6KR 3W2DH 1UT1A 4NSKB 4PHZA 2G0KA 5FDYA 3NESA 1AGFB 4FZEL 2GG1A 4RVBA 1RJZB 1OE1A 3GM0A 1EFXA 4FTVA 3ATEA 3EGXA 4GY4A 4NPKA 1KYFA 2BNUA 2NY1D 1W6LA 4UOJA 4X4ME 4F24A 1A6VH 3RY6A 4GQPH 2X6BA 2Q20A 4UB0L 5IEHA 3U25A 4GG6F 1NLDH 4M8VA 3BVNA 2XXMB 3NSCA 4X7TB 5CLXA 1NUNB 3TESA 2DH3A 1T5WA 3SD5A 4JFPA 2VXVH 3PCYA 5KG9A 3SKMA 4PY7B 5J89A 1CLYH 3CLEL 1W80A 4FXGB 1VEOA 4IHBA 5D96B 3JSSA 3CZFB 5I0DA 5C0DA 3POHA 5EO9A 1TTAA 4I8DA 1FNSL 3UROR 1TYEB 2VL4A 4M7KL 1GW6A 4XVSH 3SE6A 3R4DA 5EF2A 3EOAB 2J8UB 5EBMA 1DQMH 3CD4A 1DBAL 4P5SA 4DP8X 5IFAH 4U1SA 5D1XD 2CLRA 4I4WB 4G9DB 1E9QA 4OD3L 5DC4B 3GMPA 3UCRA 2WGNB 1HSAA 2ITFA 5DJ2A 3MUHL 5EIIB 5KBMA 4FI6A 5AAMA 2FLMA 5JW3H 3ILEA 1ZT7A 2BIPA 3QUZD 4HISA 4NQED 4KUCF 2WWKO 2AEIT 3PL6D 1YDPA 1B4RA 1MLBA 5DRWA 3P9LA 5DJXB 4EUPA 1G6RB 3SGJC 1MKFA 1KYOJ 3NPSB 2J12B 3HI1B 1X5AA 2JJVA 3RWGB 4JKPH 4MCMA 3N1PC 4JY5L 4NNXB 3TC9A 3WJLC 3N0PB 3AG4B 4F3FA 1U3HB 5EZLB 4KZDL 4ZFOA 4HMCA 1FO0L 4G9FB 2DB8A 1FYTE 2ZQKA 3J27A 4L1LA 5CHNA 3S34L 3ZYJA 2FX8L 4TVPE 3OXSA 5I5JA 4KKZA 2E8ZA 3ALPA 2B5IB 4W6XB 3FZUC 3IMWA 4FULA 1GZQA 2EDRA 3O0RH 2CIKB 3KXFB 4JY5H 4UUJB 4ELKB 4FLQA 4X6BA 1MN4A 2LOEA 2KPNA 3CVHH 3J7HA 4J3OF 3AROA 1UM6L 2XFXA 4XMVA 4BRJA 2EE6A 1WZKA 3TCLB 3ZGHA 5J12B 3C12A 3KG5A 2P8PA 3KPSE 4X7SL 4H1LH 3CHOA 4I2XA 1BQHB 1I9RH 4PG9A 1NDGB 5BV7C 4WK2B 1ZANH 1TO5A 4GRLC 2YGPA 4RMTA 1O9WA 2EEAA 1RK7A 5HHXL 5K93A 3KPRB 2Z31A 3I9PA 1VACB 2VE6B 2HJKB 4M03A 3SODB 1OP4A 2UXFA 5MHSD 2WBJD 2BHUA 3T2QA 4L8SB 4PJCB 4RRPA 5KUKA 1QRND 2ZOKB 4ZW7A 2Y5TB 5EO1B 1NC2B 4NWUL 1H6FA 2Y7SA 5EC2B 3MRCB 3CE1A 4XR8C 2HLFC 3ZTJH 3I9GL 3UH8A 4KKPA 3US1A 1XB8A 4X98B 4Q9RL 4U1NA 3P3UA 1XAUA 1Y1UA 2PPFA 5IWLC 2FJGB 3ECVA 4NP9A 2XETA 4JB9H 5G4MA 3LYRA 2X89D 5I6KA 1OAXL 3KPRA 3FTWA 5BZWA 5FCUH 2F7RA 1IFHL 3RP1A 2WKOA 3TT3H 4F8QA 4KKCD 1J9QA 4EZJA 1ZWIA 4X0KA 2Z7ZA 3HE6C 3CSYA 4HP5A 2AK4B 2CHZA 1J0IA 2GHWB 3GRBA 5FB8B 4G6KL 4XMLL 4Q6KA 1BVZA 2KZ1B 1I7ZB 5DHVA 2VJXA 4FNSA 1G7LA 3UO8B 3C08L 2F54E 4MCNA 2J8UE 4NN7B 2W65B 4MJ6B 3EGSA 4AI7A 1C9SA 2CO6A 1MPAL 5A2CA 3NABL 3DX6B 2IDTA 4U4BA 4MZ3A 4OJFL 2GI7A 4GO9A 1YEWA 1UM5L 4R2GB 3F6IA 4YAQB 3S35X 5HI4C 2BOBA 1OWRM 1PFOA 5DMIL 2CD0A 5EF0A 4MA3B 4AMKH 1NA8A 3P69A 2X2UA 3QNFA 5T33L 4FFZA 5IQ7H 3D2UB 4XN2A 3AU1B 4OW6A 4GG8B 5AW9B 3S37L 2QHLA 4L8CA 5EEUA 1A6UH 2M8XA 3INUL 2E7DA 3LPGA 2DV6A 4UNUA 4MZRA 3ZE0B 5C0IA 3V5KB 1R33A 1QAWA 3E8UL 5CJBA 2FBOJ 2WBKA 3LS5L 1RIHH 4MBRA 1N2RB 2ZXEB 1AGEA 2ZCLH 4L3CB 1SNRA 3VXRD 4UAOB 2IH3A 2MCPH 2XKNA 4M6AA 2VO5A 1GGIL 5ICZB 1IQDA 3VM7A 1FA4A 3DX8B 1OEZW 1LM8V 4HWZB 4PRDB 4Y16A 5F0LB 5F1KC 5T5FL 5CU5A 5FHAH 4G8FA 1KTRL 3GBMH 2AKRB 3X12B 1IAKB 2GTZA 2ZG2A 3GQFA 4X5PA 4JFXA 2NQDA 5F96L 5JLZB 5L4JA 3BP7A 3E7JA 5DJ0B 4GP5B 2MCMA 4XO8A 1JHTA 1TEYA 3QJTB 3OXRB 3F6JA 5C0EB 1JE6A 4YL9A 4BHUA 4HIIB 4PRPA 3CFEB 1RQ5A 4JFDD 2OTUA 1NLBL 1X7TA 3TPUB 1LILA 3QORC 3QWQB 3MRMB 1CI3M 4JPIB 1DJGA 4HGWA 3SE3C 2WBJC 1HESA 2WZAA 4JFFD 4QYAA 2MFNA 3Q2VA 4OCRL 2YPLA 4UMGA 4F5CA 1ZK9A 2EZ0C 2ILLA 4FTVB 4QRBA 3TBWA 2R8SL 4D7BA 4EI0A 1OGAB 2A9NL 1PLBA 4JFFE 4ACTA 4Y19A 4JO8A 3P02A 3MNMA 1HINH 5FUOH 4OCXH 1RIUL 5C07D 5FOJA 3S7GA 1QW8A 5GS0L 1LXMA 2J2ZA 4A7TA 1TJHL 4TLTA 2V6HA 5DHEA 2OZNA 4MJIB 3FT4A 1J8SA 2F15A 2Z0BA 4KK5C 4QXUL 4L23A 1UENA 3UXFA 4GKNA 1LO3H 2AJYL 4LPYA 4A7QA 2X41A 1F02I 4HKZB 3ULVE 3B2PA 3FHQA 5CJQH 4B9KC 1IGTA 4BCYA 3BIKA 1MCPL 2K9FB 4K3GA 3ZKXB 1O9ZA 2JLPA 5JW4N 4PCSA 3FN0H 4EOWL 1YYLH 2OM5A 5HYSA 3NZ8B 5K39B 2WC7A 5FV2A 3W9EA 5DEZA 1O0VA 2OMZA 3B7SA 3CZEA 4NGHL 1KEML 1OM9A 3V0WH 4XBPA 3FBQA 3L48A 5DK0B 1VPOL 3VD0A 4HJJL 3CVCA 5AWNL 4AIXA 3MRRA 5E2VL 5IB5A 1RZJC 4PJFB 1I7UA 5HYQA 1A6TA 5H4ZA 2ROYA 3H7BB 4HIXL 4K4KA 4YSUA 3BH9A 4XCCL 1MCIA 5EU6A 3ULAB 3BRDA 2ADFH 1U95B 2XPGA 4WU5B 3HEIB 4GT7A 2EEXA 4R3SB 3GD1C 1P9MA 1L5GB 1R3IL 4D0BB 2IDCA 5IVNA 3NBNA 1Z9MA 4PREA 4GKZA 1SQMA 3M8OH 2GCYB 5FLVA 1VFBA 4EN3C 5HHOE 1RURH 5IVXB 1NUGA 4HIJA 3SCMD 1PF3A 1Q90A 5AAWC 5JXAH 1T80A 2XWBA 3WJMA 3PNWA 1G9HA 3SKNA 1T7YA 3H9YA 2DM4A 5CP7A 1X5KA 2J57A 3QCTL 3ZE1F 43CAB 4PP1C 4RAHA 4JPKH 4LSUH 4UQDA 4O5LH 3VFUA 1YJDC 5DHDA 1GMIA 2Q2LA 2N0MA 1TO4A 2QLYA 3LZOA 4K5PA 4LEBA 3VXUB 2NY1B 4DESA 3EJJX 5B4MC 1FVEB 2AKRA 4D9RD 2YC1A 4PTTB 3T4AC 5C09E 4E41B 4KJPC 2BZCA 1D3CA 2P28B 4U3SA 3KCPB 1AOZA 5KJRH 4P8QA 3CH1B 2ZKHL 4YXHL 4D9RE 1TZIA 5I73C 3OJDB 3WNOA 1RFDL 1FC2D 2KLTA 4N0UB 4BKTC 3KLDA 3QCVL 1E67A 1KCLA 1DZBA 4PRPE 2XQYG 3CXDH 4ODWB 2BNQD 2LU4A 3L54A 4PJXE 4Y1SA 1YYCA 2FYYA 1AACA 3MODH 4YWGL 3RJQB 3RTQA 1XVSA 3M1OA 4Q58C 3C09C 1TZAA 2CSPA 3NFNA 3QJHA 9CGTA 3V52L 3CMGA 1I9JL 3SPGA 5BRZD 4UNTA 3CC5B 4MMYB 1YHPA 1VAHA 3FO1B 1CXEA 3D7PA 2QQLL 3Q0HA 4OZHA 5KVGE 4DT2A 1K8IA 1NUFA 3EFDL 3IFPA 3NPZB 4O02A 4ONFL 3VA2C 4N0UE 5DRXA 3V52H 3U30B 1SHWA 1T5XA 1O7DE 3L5XH 1TQCB 3ARSA 1C8PA 1MWAH 1KDJA 2W94A 4KKAD 3ALWA 4DCQA 2F19H 3I9AA 4A2MA 4E42B 3VGAB 1AD9A 2DBLL 2KPWA 4IS6B 5IBTL 5FYKH 1X5JA 3BZ4B 3RWGA 4E9RA 1BWMA 3ATBA 3CHSA 1DVUA 3WN5B 3CWGA 1N0XL 1P4BL 3EGDB 4L4VD 1U3HD 4OTXL 3D18A 5AZUA 5KSUA 3ATAA 4TNGA 1XF2B 2VDMB 3K5RA 4FS0A 4KFMA 3CXHK 5BW7A 1A5FL 1G7PA 1PLGH 3QJUB 5HXMA 3U0WH 4HWEH 1XB3A 4DZ8A 1A7NL 4BZ2L 1QSED 1SDAB 3EO9H 4ZBJA 3ROOA 1XR9B 1J0YA 1UADC 2AERT 2B1HH 3GSXB 5E8OB 5FK9A 2YPVH 2R1WB 4JPKL 4LSUL 4OIAA 1U41A 4JE4B 1I7TB 5EPMB 3IRPX 3WNIA 3MGOA 2XQ0A 4Z5RB 1HYSD 1E5UI 2R4SL 3CLFL 3QHZH 1VJSA 3K72A 5JOFB 4ODUB 2OMXB 4HHWA 1OOAA 3WFBL 2WNKA 2X5PA 2XICA 3E2HC 1ROCA 1UD3A 3ZDZE 3ZHKA 3TNMB 3WDHA 5HHVH 3V0JA 1AH1A 3Q9PA 4IGBB 1EO8H 1IGFL 2X6VA 1JZIA 3QDGA 1OGPA 1IV8A 5KVDL 3IVKB 1HXYA 5KSAA 1F8TH 3BFOA 3BEWA 4NQCE 3TIEA 2G60H 3O41A 2X1QA 4JHWL 4I3GA 3NCWA 5EEWA 1CI5A 3K91A 3KEDA 4LLYA 1MFUA 3LXAA 1RVFH 2F5BL 1XCTA 4DGIH 2FO1A 3AT0A 4M48L 3OKOB 4UQ2B 4P2RE 2ARJQ 1UWGL 3LEXB 3ZYIA 4I0CC 4PH8A 5CEXA 3MUGB 3NCMA 2Z31C 1FFQA 3LKRA 4BFJA 3BZDA 3N42B 3Q6FB 2VLLA 1BD2E 4MMZC 1FE8L 2GTWB 2OTUB 2AXJA 4AQEB 2NXZC 2PWEA 5DS8A 3B56A 3FT4B 4NN5B 5GGSB 3WN6A 4DP7X 2N0KA 3SGEH 2JSFA 4UOW0 4N25A 3C6LD 4M1DL 5EZIL 3DXAA 1KJVB 1ITBB 2ZSVB 3DTXA 5IJCC 3B2XA 1OAQL 2E6QA 3P4OA 3TO4A 1DL7H 4GB9A 1LO4L 3Q1SH 2IAMC 4HKBA 5GS0H 4Y5XB 3VA6A 2CLVB 5KN5A 4LCIH 5SV4A 2WB1A 2VLLB 3I2CL 3JWNH 1D6VH 1TPXB 4NZRH 2X4OA 1SMOA 1MCFA 3WTSA 5ACLA 4KXZH 1YJDH 2GY5A 2HLAB 2OP4L 3QIWD 5GZOA 2EDFA 3PJNA 1OAUH 3SE9H 1GCFA 4OB5L 6FABH 3N9GH 4GKSB 4ZDHA 3HLAA 3G5YA 4EI5D 3GDCA 4L8CB 4L0ZA 2XWDA 2MNWA 2OR9H 3RGVB 3G6JB 1U95A 2XPGB 3FCBA 4WU5A 5LBVA 2VLME 2VH5L 1OVZA 3DROB 3V6OA 2WHVA 4QI3A 4H88H 3DSFH 3E9UA 3C5SB 3W5MA 2FHBA 3QQ3B 2CCVA 2ATAA 5F3BB 4ZMYA 4E9SA 2WUBL 2Q7NA 1DDHB 1OAYH 2QKSA 4ERSL 5I1EL 1DBJH 4U49A 5LBSL 2N4IA 2XVGA 1ZKAA 1MJ7L 1AGCB 3NFSL 5IMLA 5IF0A 3UYPA 3D2UD 1ICTA 1R47A 4TVPL 4GSDL 2B1OA 2H2SD 3JWDL 5KVEH 4APQA 3LX9A 4W93A 1GGIH 3FO9A 4X8GA 4JDEA 5IMMB 1A6WL 2YQ2A 3HE7A 4Y16D 1MJ8H 3GNMH 5I1JH 3VTAA 5J8OA 1COBA 4PJBA 4LKXA 4QXGH 1CWVA 4N6RA 1JPEA 4YDIH 2EYTB 2XZQH 3OAYK 3QNXA 4JR9H 4ZS7L 4ODWA 1CF8L 3KNBB 4WWKB 2NZ9C 3VXPB 1Z6JT 1OT1A 4Z7VA 1L7TH 2QJDA 4MAYC 3JV6B 2JKSA 3OMNB 1F58L 3UERA 4UBDD 4F9LC 3T4AB 1CC3A 1IGIH 3NIFF 4LCWE 4AJVA 4Z78B 2QVIA 5CFAA 4GKOA 3CZNA 3IE4A 4KXBA 4C83B 3WNMA 3TNNA 5DJCB 3BIAX 4Z95L 3GRWA 3B2UC 2DQGL 4LT7A 2SEBA 3MBXH 4PJ8A 2AJUL 5DFTA 1P6WA 3QG6B 3GHBH 4HEPA 5LUMA 2XI9A 1ZOXA 4G83A 1THAA 3B9KC 1TTUA 4N0YL 3GRGA 3MNZA 3QRLA 4KC3B 5F89B 1NMBH 4AJYV 4FG6D 2P45B 3ZVVA 1FFPB 2EIZB 3IYLW 3QUYC 4ONGH 2B4CH 2JELH 3C08H 3F3HA 3L3KB 2EXWC 3KL0A 2WOBA 1IAIM 5I8KH 1HHKA 4XI5D 3QXUA 3H8NA 4RNRB 6PCYA 1UEMA 1WG3A 4NQSB 4X6DA 1KPRA 5JR1H 1S5HB 2NNFA 4JNXA 1E4HA 1XCWA 2FYYB 4F2MA 2QR0A 1ONQA 5ENWB 2MHAB 3WE6B 1FRGL 4JX0A 3BVDB 4HAFA 4HCRL 3C60B 4IW4C 4N1EA 3IRCA 1FG9C 1JGLL 2DQEH 4NCDA 4XNMB 2H6UA 4PTUB 3GB7B 3RWCA 1KCSH 3CC1A 1BLNB 2V8MA 3SZKC 1RUPL 1T5XB 3X3FL 1S46A 4J3SA 2X28A 5DD5H 1FL5B 3FUKA 1ZSDB 1HHKB 1ZXQA 2YC1B 2OZ4H 3FUJA 3QUGA 4FFYL 2H2PC 3GINA 1NAML 1XGUB 3RWEB 1EEUA 4NQDE 5B3SB 2BH0A 2IBZX 3IPFA 4P4KD 5B1KA 1G0YR 3GUTA 4HH8A 1GRWA 2I69A 4U1KA 4I1PA 1G84A 3GPEA 3IVKA 3RNQB 2F9BT 5GHWH 3H42H 1XF2A 2VM4A 1E8ZA 3WTUA 3S0PA 2Z7UA 4GIPD 3DBSA 5LG1A 3S8FB 4U1JA 1W72A 2VN3A 3BLKA 2W92A 1GJIA 4NHUB 1SN0A 3W11C 4FZ8H 1QRN