3IJSA

Structure of s67-27 in complex with tsbp
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsA01
1D6EA 1JF1B 4KJQC 3U7AA 1HOCB 2UWEF 4AL8H 4GRMB 2DD8L 4PGBA 4JRXD 4PJAF 1QSZA 5K59F 4MAUH 1XEDA 4KROD 4PREA 2VXUH 3JV4B 5LCVH 1OAKL 1HI6A 3B3IA 4Y8AA 2OR9H 3SE9H 3P0VH 4M7KH 3QB7C 2PTTA 4HCRA 3RKPA 4HIXL 3HPLB 2Y4SA 4JDZA 5DRXA 3GKWL 4JFXB 2DQDH 4WI5A 1K5NB 1DFBL 4F2MB 1QSED 2RJMA 4CVZB 2BVUA 3FN0H 3SE4A 4WFEE 2MFNA 2CDFA 2QV2A 2J3SA 4OGXH 4GAYA 4PYHA 1CWVA 3GMQB 3FB8A 4QRQB 4ODTH 1RZIB 3W2DH 2ZG2A 3P9WB 5IFHH 2XTJE 4I3RH 3PGCA 1FNFA 3EDFA 4MDIA 4ALAL 1RMFH 1RUPL 1DQDH 5GS1B 1BWMA 4KK9C 3KPQB 4MMXC 4X7TB 2Y07L 1TJHL 1UB5A 1VGEL 3O45A 2DJUA 3TO4D 4APQC 1I4FB 3QUXC 4YHKL 4LVOB 5F3HA 4NP4L 4ZPVA 4C56A 2NY3D 2R1XA 1CLOL 1RUMH 2XRAL 4R6UA 4Z5RA 3O2DA 2CMRH 3OKYA 2VLME 4WFFD 1NAKL 1KGCE 4UTBL 2P5WE 4KMQA 5GGRA 1FZKB 1N6VA 4MAYB 1VFAB 4QRSB 2ZOKB 5J0BA 5CSGA 2NX5E 5I8OH 1AP2A 1CDUA 4OZHA 1OD7A 1WSST 4U1KB 4I3GA 5D5MA 3I50L 2R69L 4NWTH 4PRIA 1HHGB 4R97B 2DLHA 4XMKH 2YEZA 5ACLA 2HKFL 2OX5A 4BM7A 4LCCA 3AAZA 4GOSA 2LVCA 4U6VH 5MP6H 1OM3L 4QEGA 3MA9L 1M71A 3IJSA 4B50A 4PIRF 1GXEA 3LRHA 1L0QA 2FNBA 2A1WH 4H88L 4N9OB 1KF9B 1LDPH 4RZCA 1BQLL 2X1OA 4Z7OF 2C5DC 5FM5M 1J1OL 3V79C 1M7DA 2VLRB 1V05A 4F3FA 3OG6B 3HMWL 1QFPA 4FG6C 4NQEB 1MELA 3O4OC 4LP5A 1RHHA 2VZVA 5DUBB 5EC2A 5FK9B 5B8CB 1N5YH 3QUKA 3VU2A 2FEDC 3O81A 4OM1L 3WLWC 2AI0L 1XGRB 2NYYD 2VABB 4LOUC 3S8WA 3H9SA 1A1NB 3CD4A 5KVMC 3ULSB 1F4AA 1WITA 1WEJH 3GHEL 4GKZA 1ZHLA 4KXZH 2V5TA 4NQEE 1T1XA 2VIRB 1LP9F 1UB6A 1CCZA 3ZTNH 4BH8A 3MO1B 4UZGA 5H94B 3LDBC 1NBQA 1BD2B 4X6CA 1A7OH 5DEZA 3EFDH 5GGTH 3QUYB 4V1DD 5GS0D 4ZFFB 2VC2H 4YPGB 4JGJA 4P3CL 1MHHB 4R96B 4PB0H 3R8BB 4P46B 5GJSH 4OV5B 4CU6A 2QEJA 3QEGH 2J1KA 1FPTL 4YR6B 3NOIA 3U48A 1JGEA 4YBLC 3BSZL 1T2XA 4XPGL 3DI3B 1BVLA 4X4ZA 1BD2E 3HNVL 1NL0H 3C5ZC 2X4QA 3BJLA 3VFPA 4UQ2A 1IC1A 1MSPA 3PDGA 3SCMD 5C9JB 4GMTL 4WGVB 5TE4L 3EZ8A 3SDCB 4PGEA 1VEOA 2IQAA 1Q0YL 3GK8L 4ZUWB 2AEPL 1NCBH 5MEPA 3GJFA 1IJ9A 2IQ9L 2JJTA 2HG5A 3TPUA 1G9NC 1I7TA 2NY1D 4JRXE 2NTFA 3QFDB 1RJZA 4QWWD 4X6EB 5DT1L 2VDNH 1I3GL 5I1CH 1AD0B 2XTJC 4JEGB 2D7TH 2H6PA 3GB7A 5DRZA 4X6DA 2AJSH 5FYJL 4EDXA 3DVIA 1IEBB 1AH1A 1FH5H 4ZFOA 3KGRA 3B9KC 4R26L 4JFPB 3RZCC 2FEEI 1EPFA 4K71C 1QRNA 4JKMA 4QRRA 1MIMH 1MJ7L 1QSEE 2PR4L 4OIIH 4FA8A 2B0SH 1NSNH 1MWAH 3LKNA 4XBGA 3LMJL 4XP6L 4W6XB 3RL1B 1AFVH 3RWGA 3CUPB 4K3EH 3LS4H 3F12A 3QDHA 3QAZB 4NBXB 4PRAB 1NLDH 1I7ZA 1U92A 4I2XA 2YHGA 4G7VH 4JDTH 4M9OA 3QHZL 3MV9A 3VFSA 4Y4HA 1MRDH 4WI9A 4F7TB 5E8OA 5KSUA 4AT6B 1I3RA 4Q9RH 4K7PL 1CT8B 4D0BA 2Z4QB 1UM6L 1B2WL 1NC2B 1GAFL 2N1KA 3CIQA 1NCWH 2E9IA 2XNAB 1J1XL 4I5BA 4HUVA 4RGOH 4MJ5A 1I75A 1FBIL 5MHSD 1MLBA 2H41A 4OF5A 1BBDL 1WICA 3QUZB 5TE7H 1MCLA 2HFEA 3UZQA 3D85A 3DVGA 5KSBB 4ZXBA 4JM2B 15C8L 4R97C 5DWUL 4NQVB 5AD0B 3OB0H 4XNMA 1U6AH 2OL3A 1NUGA 1BAFL 4IMKC 3NH7L 3T8XA 2OJZH 3DRTA 3FRUA 1BX2A 2IPKB 1S3KL 3FB6B 1Q9OB 1FL6A 1XGTB 3LB6C 1QO3A 4N90D 4ODHL 3B2VH 3GBNH 3TCLA 5KSBE 2KQNA 5HHQA 1ZWIA 2W59A 1Q38A 4K8RD 1IAOB 5B8CC 1LNUA 4QHMB 3UPAA 4PLKD 2WIMA 1F11A 4KWUA 5D72H 4BQCA 4TUJA 1FRGL 3VWJA 1ACZA 4M6NH 3HMXL 1G6RL 3VWKB 3PHQA 2B8OT 3O6FB 4V1DB 2J88L 1A3RH 3PV6A 1OCWH 3RFZC 3RDTB 3FL7A 1NQBA 3ZE1E 4DKFL 1K4DB 3M1BB 4JB9H 3JWOC 3T3ME 1B3JA 3TJEL 1YEGH 3LSOA 4S0TD 3RGHA 3BISA 4U6XB 4JFFA 4DQOH 2B4CC 5FYKU 3EDKA 2DMKA 2R0WL 3GBML 3H8NA 1KYOK 2LE9A 4J4PC 4BFGA 5DMYA 1CIUA 1D5MB 5MI0C 4HIEB 2VXVL 4V1DE 1G7QB 1A6PA 2R29L 4Y19D 5JW3L 1OSZA 1P7KB 5CSZA 4KTEL 2Y6SC 2JELH 3QIBA 4POUB 5F1KC 5ALCH 3JBG7 4LLWA 3G6AA 2APFA 5KSVA 2D7QA 4KROC 3MROB 1F90H 1AE6L 1JPFA 3GJEA 5E2UH 3U1SH 1S7SB 1FE8H 3OB0K 3CX5K 5CBEB 4OLUL 3MLXL 2F53B 1LEKA 1H15B 5D6CA 3OR6B 1OP5H 5FAAA 4Y16A 3MLRH 4HXBL 3GGWB 3WIIL 5J11C 5SX4I 4PRID 1IAII 3TVMA 4E0RA 2VLLB 4UOJA 3UTQA 4J8RA 1WFUA 3TH2T 5EOCH 3FT2A 1UCTA 2V5YA 2J8HA 4D0CA 2B1HH 2XZAH 2GW5A 1WIUA 1IAIL 2COQA 4F9LC 5KZCD 3DBXA 1UJ3A 3HI6L 3QG7H 1A7PL 4O2FA 1NUDA 3RY6C 3F7VB 1HKLH 3BGFB 3MREA 3TO4C 4NSKB 5E95B 3C6LD 1CS6A 1QLFA 5GGQH 1CR9H 5DQJA 1T66C 3MV7B 5BZWA 4LVNB 2VDQL 3JV0A 1MQKH 4OAWB 1P7HL 2NY3C 3I02B 5T5FH 1CICB 1CF8H 5B3JF 4WCYH 5CEXB 1I9JL 2ZSVA 1X5AA 4JO1H 2FBJL 3AS0A 3MRLB 5HGBA 1KB5L 1D9KA 3CXDH 3MBED 3IAQA 4HUUB 1F00I 1MFCH 3HUJF 3MV7E 5CEZD 2HTLC 1ZA3A 2CIIA 3D6GA 1MCWM 4Y1AA 5ANMB 2ZUVA 1NBZA 4JFDB 3MRRA 4UAOC 3OAUL 2FSEB 4WY7H 5HVWA 1MUJB 2XQBH 2VB5A 4JM2C 1UZ6F 5MHSE 3O9WA 2QKIB 2JJVA 2DI7A 2LU7A 4O2EB 3QQ9D 3W11D 5J13B 5EBLB 5T3XD 3NCJH 1FNEB 1IAKB 4AG4L 2ZKHH 2WP3O 3OF6D 5F8RC 5ICXA 4RQQB 4JFDE 2NYYC 3AS3A 5FO9B 3IFNL 5TQ2L 4JLRA 5C0GB 3CK0H 4X4ME 5I1IL 3CAFA 4ZYKB 3BXNB 5KAQG 3DGCR 4N90E 1V5JA 4P4KD 1IGYB 2HN7A 3UJTL 3PGFL 3UROR 1AI1H 1U93B 2A6KB 5IB4B 1RPQA 4M9PA 3SDAD 5I74B 3X13A 2X4UA 3CZFA 3NA9H 3D69B 3OXRB 5EU6D 1F6AA 3MRGB 5GS0C 1R3HB 4ODUB 3STZB 5C1MB 4FNLL 3DX8A 4LEXL 1IC7L 4DN3L 1MWAA 1F97A 2E5EA 2ITDB 1YEKL 4PBWD 2MQ3A 2B4CH 2FIKA 5H8DA 2DDQL 1T0MB 3ULUF 1I8IA 2ZOLB 3GMRA 4QLRA 2Y5TB 5DURD 2JB6B 5KG9B 1E4KC 2IF7A 1HH6B 1T0PB 5BOPA 3VFRB 4UIMA 4YGVB 3WXWL 1O0VA 3SCMC 3QRFM 3WNMA 4OQTL 1FLTX 4X0KA 5L8JB 1DQMH 1KTLB 4J3SA 3N1MC 5GRVL 3MV9D 2IG2H 1VPOH 3IDXL 4Z0XA 2EDOA 2D03L 4FQQA 3OV6A 4C4KT 4G43B 4S2SA 3D3VD 4OCNC 4XP1H 5JORA 2H1PH 2NY1C 3T0AA 5M94B 1PYWA 2D2OA 4QWWC 4NUGH 2FX7L 2YSSA 1KNOB 1WAAF 3PQYA 2H9GB 3MR9A 3B8YA 3PWUA 3VGHA 3AB0B 2FJHA 4PJ5B 5ISZB 4GLRH 3TH4T 5DHXB 2VDMH 4O2CB 3ESVF 3QR2A 5E5MA 5FEBA 3U46A 1RUQH 4PRDB 1AGDA 2IMNA 1J05A 5FKAB 5GGSB 5KJRH 3OB8A 4BQBA 5I1GH 4LLVB 1WCQA 1S7XA 3BDBA 2Z93B 5A16A 4LPTA 1YMMB 5BVPH 4D9LH 2ICWA 5J57B 1UM5H 2CR6A 3BGFC 5GXBB 5JW4Q 2YK1H 4U6TA 5L7XH 4U1HB 3V4PH 3QFJB 4FXKA 3BH9A 4R7NA 3CSPA 2GHWB 2B20A 5H35A 3ARGA 4MNQA 3NIDE 4OBRA 3ES6B 1SEBB 3RY5A 1FGVL 2W92A 4ONHB 5TQ0H 4CNIA 1YMME 3CFCH 5AZEL 3EFFA 1G9MC 2GSGA 3D18B 5SX5H 5DJ0B 3WNNA 3V52L 3DX9A 4NO2B 1G0DA 5JMOC 2A2QT 1QQDA 3QFJE 3DNKA 5F44A 3RUGA 4N0FB 1FSKC 3LPWA 3IGAA 1RY7B 2V2TA 1PY4A 2D9QB 4XH2A 2F5BH 3GSQB 3ZE2E 5CEZE 2JJUA 4MD5B 2ADFH 4M7LH 1F3DJ 2LQRA 4MB4A 1KPUA 2DI9A 3WIHH 4ELKA 5DDHB 1BFOB 1QBMH 1Y18B 5HHPA 5FCSH 5D71L 1U8IB 1RFDH 4YH6A 5C07D 4MJ6B 1DL7L 2CDGB 3HFML 4U6HB 5L0QB 4OF0A 1JF1A 5DO2D 3O2VH 3V4VL 5I30L 5K9JH 1HOCA 1J5OH 4P4KB 4K8RC 4GRMA 1P4BL 1PY9A 5T3XE 1AKJB 2WLZA 4PLKC 4S0SD 4OFYA 1GC1C 3N50A 4FQ2H 4K07A 5DJAB 3JV4A 3ZDZF 1U58B 2J6EH 1JFQH 1JGUH 1GCFA 1KIRB 1HXMA 2VUOA 5DA4A 35C8L 1INQB 1JP5A 1JTOA 2VL4A 5I74C 3HPLA 4JFXA 1RZKC 1K5NA 4F2MA 3SKJH 2L0DA 4CVZA 1AC0A 1OAYH 5GS0H 2I5YH 2NY5L 4XPTL 5E1AB 2B39A 1I85A 3MJ6A 2P4AB 5EU6E 4MCZA 3GMQA 4CMHB 5HPOA 4QRQA 4FQJL 1RZIA 2C1OB 2X89A 4P3DA 4NJAL 4PG2A 4P4RB 3NCCB 5GIRB 3VXNB 1CE1H 4QHUB 5SX5K 3F58L 5CS7A 3RWJA 3D5OF 5GS1A 1UWGH 3O0RL 3KPQA 4HIHB 4X7TA 4BSVB 4QXUH 1FIGL 5D70H 4OSUH 2WINA 1I4FA 1EEYB 1TLKA 2NNAB 4H5SB 4JQVA 1IGJB 3C8KB 4DVRL 1Z9MA 2HAZA 2R1WB 3MYJB 5KANI 4UT9H 5E6ZA 1R5IB 3A6OA 3A0OA 1EZVX 3SKUD 1XGQB 5FUCE 3ZE0E 1FZKA 3B8SA 5CMAB 3V5HB 2QQKL 1H3UA 1X44A 4MAYA 1CGXA 4QRSA 2ZOKA 4W4OC 3CDYA 4OZFG 2EXWD 4KV5E 2R0ZL 3FAWA 1UQSB 3OXSB 3VI3F 1EJOL 4MJIB 5C0BB 1HHGA 1MI5B 5HYEA 3VXPB 1IL1B 3B4NA 1NMAL 1BFVL 1KC5L 1XIWD 4YHPB 5D7KD 3C6LC 3T08A 4PJGF 2Q8BL 1MFEL 4ZSOA 1QVOA 1RVFL 1YQ2A 2D3VA 3ZMRA 3VRLF 4JFOB 2VLRA 1S9KC 4YXKH 2H26B 4RFNB 4Z7WA 1WT5C 1AQDB 5CINL 2PXYD 5DUBA 5FK9A 5GHWH 5B8CA 5F3BB 4UNVA 1A4KB 1P2CB 1XGRA 2VABA 3P30L 3KYKH 3MBEC 1A1NA 4FN0A 2LVEA 4PB9H 5AYUH 4UIKH 5ILTL 5KVFH 4PJDB 3QEQD 4CJ0A 3T0EB 5DSCA 4EDWL 3NZHH 4PJXE 3CH1A 4QHNB 1OB1B 2VIRA 4HG4J 2IGFL 1G9MH 3BEVB 5DD1H 4AMKL 1MPAL 1TVBB 3MO1A 1RV6X 4NZUL 3OZ9L 1LO3H 5H94A 4YXLL 1BD2A 4X9FA 1C5BH 3ALPA 1A6WL 2GK2A 3QUYA 1N7ML 2CRZA 5BW7A 3ZT6A 3C8HA 4HT1H 4ZFFA 4YPGA 4JGMA 2WBKA 3QI9D 3X3GL 3N9GH 1MHHA 4R96A 2QBWA 4K3GA 3UC0H 4P46A 3W11C 1YDPB 2YA2A 3QEUB 1PZ5B 5C0RH 1G7PB 1CK0H 3LQAH 4TVPD 4P99A 5L0QC 1DSFL 5JIIA 5C07E 2O5XH 2O5ZH 5C9JA 4P4KC 4K8RH 3SDCA 4LSQL 1CFNB 3WD5H 1NGZB 4S1SL 4NO3B 1GC1H 3DROB 4WI8A 3SDAC 4KZEL 3G6DH 4MA8L 1T7VA 3KLDA 1LO4L 2XPGA 1T89C 4X6EA 1AY1H 5CILL 4M6MH 1AD0A 3MBXL 1NANH 5L2JB 4LSVL 1P4IH 1IEBA 3BUYB 1RZKH 4FOMA 4JFPA 2XY2A 4M1DH 3UZVB 5J1SC 5CZVH 3VGGA 2VTFA 3JV6B 3NZ8B 4P5MB 1M6OA 1P7QD 3EYQC 1MRFH 4PJCF 4V2BA 4KK6D 4WO4B 3CPLB 3RL1A 1F4XL 3CUPA 5FUCC 1FDLL 2W0KA 1ZVHA 4I4WB 5D96B 4PRAA 3OMZA 3VGFA 5IESL 1T7XA 4K94C 3KPRA 4ESKA 2X7LB 1WFOA 3GMNB 4WEUD 4PR5B 4F7TA 4AT6A 2ZCHH 5E2VL 2VXQL 1CT8A 2DKMA 2Z4QA 2AV7B 2BSRA 3G5YB 3BP4B 1NC2A 4KHTH 2VDLL 3VFVB 4PJ8B 3WS3B 4FFYL 4XX1G 1KB5B 4L9LC 5I66B 3D48R 4JN1H 1S5IH 2AJYH 3GBLA 3QUZA 3WIHA 1OP3H 4LIQL 5KSBA 4OD3H 2J4WH 4WVRA 1C5CL 1EUUA 2AXFA 1PAMA 4NHCH 5AWNH 2X1PA 4F7PB 3FQUB 4NKDB 2IH3B 3FB6A 1I9RL 1Q9OA 4LLQB 4CKVX 1F2QA 3WV0A 1T7ZA 1XGTA 5C08D 2GYSA 3UJIH 4JR9H 4G9FB 3WS6A 3BWUC 3HE6D 4OFYD 4RFNC 4HWNA 2CD0A 1VFOA 1MJJB 1UENA 5D1XB 4GRWF 3KYOB 3CLFL 3TBTB 3WDHA 4QHMA 4B7IA 2BY0A 1YPZF 4GRLD 3NCFB 3VWKA 2Q8AL 5AUMB 3SOBH 5IVXF 2ZNWA 3O6FA 3RDTA 1YEIH 1DEEB 1K4DA 3M1BA 5F7UA 1HSAB 1LO2H 2P43B 1MCRA 1G7HB 3PWJB 5HVFB 4XMPL 1O5DT 4JY5H 3PL6A 2P24A 4U6XA 2X89D 1FVEB 1F02I 1NFDE 4POZC 3LD8B 2UWEB 3IKKA 4O51B 1D5MA 2FIRT 4HIEA 1EUTA 2CO6B 1G7QA 4PJAB 5I73B 4I8DA 3WO3B 1PDKA 1P7KA 4EI5B 3U82B 3D39D 2XZCL 5EORH 1NKOA 4OCLC 1NMBL 5E94B 1BFSA 1S7SA 3K0WA 2UWEE 4XPHH 5CBEA 2MSPA 4WUUB 4NQCD 3E8UH 3DVFA 5FO7A 3RGVD 4JFZH 2F53A 3VI4E 4YHNB 3VW3H 3T2NL 1H15A 3DO3A 2E9WA 4YHOH 3ULUL 4PP1D 1EMTL 3K81A 1N6QH 4Y5VB 4BZ1H 3BN3B 4ZS7L 5E8NA 4OZFA 3HN3A 5TH2B 5EO1B 4YDIH 4GKOA 3NFNB 4OQ1A 2ZUSA 4Y4KD 4ZOEA 5E6IB 1I8KB 1RUAL 5J89A 1KUMA 3C9NB 4PYGA 3F7VA 1RHFA 4NSKA 2KL6A 1A9BB 3IJYB 3QXWA 3HHRB 4NRXB 4P3WA 2FBOJ 1YZZA 3MV7A 4PRNB 3LS5H 1OOAA 4HKBA 3FQWB 4HIJB 4LASL 1T7YA 4OAWA 3I02A 5EB9A 1CICA 3QIWB 4PS4H 5CEXA 3PDDA 1GGYA 3KJ4B 3NAAH 3OHXB 4HJ0D 4U3HA 2EYTA 4K94H 1Y6MR 3MRLA 1BP3B 3EAKA 5IMMB 3VA2C 1J8KA 2EKSA 2UZXB 3G9VA 3TLRA 3EOAB 5CCKH 2EXWC 5CIPB 5LBSL 1P4LA 2AJVH 2AAVA 2X1WL 2J8UA 2XI9A 5KSAB 5I1KH 1QR4A 2DYPD 1TZHB 1QYGH 3C87A 4FXLA 5E4EB 5JOEA 5ANMA 3VD4A 1JGDB 2AW2A 3QDMD 1SY6H 2P5EA 4JFDA 5DFWH 1XIWC 3RA7H 2GY7B 1PSKH 2FSEA 5T1DH 1MUJA 5CJQL 2X4NB 1HZHH 5C08B 3SKMB 5C2BH 4XGZA 1J18A 3QWRD 2QKIA 2H2SD 2PNDA 3FO2B 3HE6B 4YQXL 2Z92B 2H32B 3GSNL 5GQBA 4DUWA 1FNEA 3TESA 1IAKA 2PXYC 4RQQA 4HX1B 4PGZA 3WNPA 4FQ1H 1W72B 5C0GA 3ALXA 4E9LA 2DLTA 1LP9B 5C08E 4Z18A 1EHAA 3P4MB 4KGLA 5J56B 4AEIL 5JIPA 2P7TB 1U93A 2A6KA 4PV9A 1K6QH 2QQNH 3I3EA 1NAMB 5ACMA 4OZIF 2FO1A 1YY8B 2ZUQC 4X4XB 5E2WL 1FP5A 5IBUG 1YEHL 3WHE1 1OVZA 2GSIB 1OAXL 3D69A 5DMIH 3MRGA 32C2B 5DF0A 1HYSD 1R3HA 4JO4L 4U0RB 1VADB 3QI9C 4KY1H 3D2UB 1TPXB 3STZA 1LP9E 5D2LA 5DK3A 2YKLH 3C8DA 4OF3A 4TNWF 2LABA 1ZK9A 43C9B 4G8GB 2ITDA 2PETA 1T0MA 2YMXL 5E56A 2ZOLA 5SWZA 5BS0D 2Y5TA 3LD8C 3FOLB 2JB6A 5KG9A 4EN3D 3TN0A 1HH6A 3VFRA 1E4XI 5J12C 3TJEH 2ICES 3S36L 5C3LD 1Q1JL 4TOYH 3ZZ1A 2YUZA 1KTLA 5DD6B 4XC1H 3RHWK 2MCG1 4HS8H 3BD3A 1JPTL 4G43A 4G8GE 1JZ7A 4KRPB 2YPVL 4DKDC 1ORQB 3D39E 3GMPB 4ODVL 4BFBD 3HNTL 4FFZL 1KNOA 4RGND 3HLAB 1GPOH 2NMSA 5D6DC 3HR6A 5BQ7B 4IM8A 4I0PB 4Y4KB 4PJ5A 3KPSB 1OQXA 3MXWL 5ISZA 5DC0A 1CDHA 1QSFD 3QEHB 4JZJC 2DLIA 4NQCE 4XHQA 1SJXA 5KVEH 3KLAB 1CFTB 4O2CA 2YBRB 4F33B 3VMOA 2Q76B 5DEGB 2DM3A 4PRDA 4X4YB 5FKAA 5GGSA 1F8TL 2DS4A 1BWWA 1ZEAL 4JN2B 1J8HA 4KK6C 2XFXA 3C5JB 2I07A 4LLVA 9CGTA 2Z93A 5LGKA 3HNSL 1YMMA 2KDGA 4R90L 4LAQH 5DYOB 4FTVD 2BOCA 4U1HA 5TDPB 1RIVH 3UEZA 1IAIH 5E99H 1GH7A 4LQFH 4YX2L 4L8DB 2AXJA 3TBVB 1R6VA 3FTGA 2FH8A 1SEBA 1KXVC 3ARWA 2WMPA 2OQJB 4ONHA 3RRQA 3KJ4C 1TCRB 4YNYA 1MREH 4HULB 4WI4A 3D18A 4M1GL 4GUPB 4E41A 2HYMA 4AIOA 1N0XH 5HI4D 1BIHA 4HGMA 1RURL 3VG0L 1IC4H 4WV1B 3UPCA 4EIZC 5E4EC 4F7CB 3H9HB 4MD5A 5F96L 4K23H 3WHXB 2BVOB 1DP0A 1AXTH 2HJFB 3H42L 1BFOA 3K2UH 1U8IA 3AS2A 4MJ6A 4IRSB 4U6HA 4P57B 2DBLL 3HE6C 4WW1A 4YBQD 5EOTB 2BP3A 3S3JA 4CBPA 1ZLSL 2AEWA 4K3JL 2VLJD 3VXTB 5HTSA 2J8OA 5D7IE 1OF2B 4YWGH 5HD8C 2AJZB 2DTML 1AKJA 4GRLC 4PJIF 4OBSA 5DJAA 4GAJL 1MEXH 4ODXA 2P47B 1KOAA 1WWBX 2CLVB 3IU4L 4KI5D 3AC0A 1U58A 2NY2B 3MRMB 1KIRA 4HBQA 5DQ9B 3VG9B 2VKXA 3GIZH 3RJQB 1INQA 2DQHH 4YUEH 3OKEB 1ITBB 4WGWB 1DBML 4LSSH 1H3GA 3N1GC 3O6LH 1IT9L 3LH2H 2A38A 43CAB 3MRBB 3UJTH 2W9EL 5JW4M 3ARBB 2C1OA 2EDJA 3S5LB 4PRPA 4MQSB 5JDSA 1CDIA 3QNYB 3NFSH 4P4RA 5GIRA 4G8FA 3VXNA 3FCTB 3ZKXC 4QHUA 1CGWA 2YC1B 4G8IB 5DR5H 3T4YB 3UJJL 5C09B 4HIHA 4RBPH 1WVZA 5HDOA 4DGIL 2G60L 2JB5L 4OUUB 3AU1B 3DTXB 4DN3H 5BS0E 2ARJB 4H5SA 3DV6B 4FABL 1IGJA 3C8KA 1DLFL 2NPLX 3ZDYF 1H3XA 3RGVC 5JQ6H 1FAIH 1WTLA 3MYJA 5HHXH 1R5IA 4PP1C 4JM4H 1XGQA 2AABL 1C1EL 3IFPA 2VWEE 3CLEH 5CMAA 3V5HA 2CGRH 3EYOB 5DVKA 1MFBH 4KHXL 2XWJB 1UH3A 2I26N 1UQSA 3OXSA 2P5ED 4XVSH 4Y4KC 2BSTB 2R2EA 4MJIA 5C0BA 4RGNE 3S96A 1MI5A 5FUZL 3VXPA 1IL1A 4RRPA 4TUKL 5C8JB 1FO0B 2C9AA 1BQUA 4LLDA 4R3SB 5HGHB 1QSFE 4WHYG 4YHPA 2E6PA 5E24E 5ETUB 2IWGA 4S1RL 4PD4K 4U7MA 2VDKH 1EO8H 1M7XA 3I3BA 4JFOA 3K7UA 1ZLWH 4XC3L 2H26A 3LRSA 3RNKB 5I75B 3Q5YA 1PX3A 5JW4R 5IT2L 1AQDA 4HJ0C 2QSTA 1RSFA 4JY6B 2BVPB 3TJHD 3GKZA 5F3BA 3JSSA 3HUJB 1E6OL 1A4KA 3TZVD 3L3OB 3PE9A 4FTVE 3P0GB 4P23D 5DD5L 2PYED 2DOCA 3BKYL 4LARH 1BEYH 4PJDA 4KQ4L 3NACH 1NDGB 3T0EA 5B3JE 1ZANL 4XCYB 3QCVH 3X11A 3FQXB 2R4SH 5IV2B 4QHNA 3CXHJ 3ZYJA 1OB1A 3DSFL 4RBPK 3LPGA 4ZOBA 2AS5M 3BEVA 1TJIH 4F8QA 4NC1E 1R3LB 1TVBA 4FMFA 1TETH 2V6HA 2ATKA 3HMXA 5HHVL 1G6RA 3HC0B 4NFBA 3BZEB 5JUEL 4X5XB 1FGVH 3STBA 2XKNB 1KCKA 1LK3H 2H2SC 4K3HA 4WV1C 5F93C 3U9UB 3SJVB 4G9DB 5SWZD 1YDPA 3RVUD 1KLUB 4U1LB 2HWZL 3QEUA 1PZ5A 4U1JB 4ZUSB 5IB5A 4IRSC 5DLML 4KVCL 1DDHB 1T1ZB 4X98B 1T6WA 2H32H 3VXRD 2I9LB 2YR3A 1FIEA 3BKJL 3P0YL 2HVJB 1CFNA 1NGZA 5EUOE 2W0FB 1W72H 3DROA 2VLJE 5L8KB 1TDQA 3ZL4L 3O3EB 2DQUL 1HYSC 3NTCL 1CLZL 3KPMB 1ZLWK 1OT1A 5L2JA 3VG9C 2EZ0C 2N7AA 4KI5E 1NAMH 1VESA 1AO7B 4QTHB 1OTUD 3O3BB 4ZFZB 1ZLVH 3IFOB 1J8HD 1MAMH 3ZKMD 1TNNA 3P4LA 5IHZB 4NNYB 3T0XA 1Y6KR 2G75B 5MEOB 4LMQI 3JV6A 4EN3C 3NZ8A 4P5MA 3ARBC 4WO4A 1BQHG 5I6XB 2LAAA 4GW4B 5HVHC 5DHVA 3T1FB 4BSWB 1VKXB 5F1NB 1AO7E 4CW1B 2E27L 3NABH 1MRCL 1CTNA 2BNRB 5F1IB 2X7LA 4IOFD 3GMNA 2E7MA 4MQTB 2XIDA 4PR5A 4RGNC 4UILL 5E08H 2HH0L 1LE9B 2DLFL 2AV7A 1BMGA 3G5YA 3VFVA 4PJ8A 1IKFH 4IRJD 5J3HC 4E41D 3EDJA 3SE8L 2BRRL 3KYNB 3L3HB 3T04D 3TFKD 3WS3A 3QJFB 1CZ8L 1CD1B 1KB5A 2BY2A 3T2QA 5I66A 4WTXA 1WAAE 2DICA 2BNRE 5KANG 2DQEL 4P9ML 3K8LA 1FNLA 3V2AR 4EQ3A 3UMTA 4JCLA 2A77H 2B1AL 1JPSL 2IAMA 4F7PA 4QXGL 2JIXB 5IJKC 4WW2F 2IH3A 4I77H 4LLQA 5FHBH 4PRBB 2MCPL 4F80A 5KVGL 4P2OD 3DXAD 5HHMB 3PF2A 5C0CB 1KLFA 4G9FA 4N68A 2GFBB 1EHXA 4WU5B 4G6KH 1BFVH 5ID1A 3UYOD 3H3PH 1KIUA 4NC1C 5D1XA 4QTIH 7FABL 1CU4H 3KYOA 3TBTA 3C6SB 3LKOB 5DS8B 1CD9B 2R4RH 4XCFH 4RDQG 5LQBH 4R0LA 3IF1B 3BPNC 3L9RB 5TFSL 1JGVH 3P3YA 5HI4C 5AUMA 1PQZB 5IQ7L 4HJJL 5HHME 5C0CE 2PYEE 1KPRB 2BFVL 1HQRB 4ELMF 3O4LD 4X9HA 3PIQB 1HSAA 2BDNH 2Y7QB 2PYFB 4JO3L 4X7DC 3WJLC 3FKUS 1G7HA 1YYLL 3PWJA 5FYJD 5SWSD 4JFEA 3B43A 3ARDA 4O9HL 4PRPD 2J2ZA 3C2AL 4Z8FH 4FXGB 2UWEA 4O51A 2VZUA 3UP1A 4JPVH 4HS6A 2IC2A 2GTZB 3K80A 1L9NA 3QRGL 3S35L 4PJAA 5BXFB 2NY4B 2W9DH 4EI5A 4FQPA 1VCAA 2C4XA 5GGUB 1LVEA 4N0RA 5CD3A 4L3EB 1J0HA 2HJLB 4QHKJ 3WUZA 3TF7C 5E94A 2IPTH 4KI5C 2WBJD 5IUSA 1ED3B 2Z8VC 4WUUA 5F88B 1A6UH 1P53A 3VXRE 4XNZB 1DVFD 4YHNA 3GM0A 4PJHF 2XG4A 3WXVH 4M62L 3CX2A 4ZAKB 4AENB 1C16A 1U8LB 2VH5L 4Y5VA 4PJBE 3ZDZE 4MA7H 4X7SL 3WIFB 1HH9B 4M7ZB 4OCRH 2Q86B 2BHUA 3CVHH 1J10A 1D3CA 4LFHD 1NFKA 5KVDL 4BFIB 5F7MC 4XX1E 1I8KA 12E8L 5E6IA 5HGAB 2VL5B 3EYSH 2CLZB 4Y4FB 1WWWX 2I60L 4ENED 2H8PB 4XP4H 1QHPA 2LFGA 4XNXL 5IVZA 3QCUL 1IEAB 2V17L 3BQUD 3VFOA 3MFGB 3BIAX 3VD9A 1A9BA 3IJYA 3O8XD 5D7SH 4NRXA 5IJVB 5FUOH 3SGKA 2QSCL 3FQWA 4FQCL 1I8MB 4HIJA 4B5EA 4HG4K 3ABZA 3F8UB 4UBDD 3QIWA 3BZDA 4CU7A 5ADPH 3M8OL 1FGNH 3ILPA 5IMMA 4HH9B 3EOAA 4Z95L 1J86A 1S5HB 5JA9A 5CIPA 4NZJA 2EC9T 4DUVA 5KSAA 3PP4H 5FM8A 2HFGL 5DHYB 1T22B 3L7EB 3S4SG 1TZHA 2IFFL 3HRZA 1A7BA 4GFTB 4PJGB 3C08L 2EC9U 4LCIL 5GRZA 1JGDA 4DN4L 1UZ8B 2E6JA 3PWVB 3JXAA 1VERA 2A83B 4HFWB 5FGCB 3SGEI 3VI3E 4HQQH 5KBNC 3ARED 4M48L 3DUSB 1FLRL 4HLZG 3O2WL 4M5YH 1FO0H 2Z92A 2H32A 2EDKA 4PY8J 4EUPG 4YHLH 4U1NA 1IC5L 1KN4L 1FNSH 3TJHC 1MCJA 1T5WA 1ZT4A 3ARRA 4HX1A 3TZVC 1C5CH 1W72A 4P23C 4XPBL 1DANT 1C7SA 4KFZC 5FGCE 2ZJSH 3UYRL 1LP9A 3P4MA 2R2CA 1FYHB 2P7TA 1DANU 2X9XA 3RL2B 4PLNC 1YY8A 4H1LH 4X4XA 2FJGB 5EWIH 1Z3GL 5C3TA 3HG1D 2GSIA 4W81A 4P5KA 1NGQH 2OZ4H 32C2A 5T1LA 3W39A 3BP7B 3FHAA 1IBGL 5DMGD 1VADA 3D2UA 1KV3A 2VYRE 4UUJA 4F7MB 1C12B 3PWPD 1KJMB 1MAJA 4DCQA 1AC6A 3OJMB 3PWLB 43C9A 1D5IL 1GSMA 3I9GH 1F42A 1MF2H 1SQ2N 2R23B 1S8DA 2P46B 3PXHA 5FGBA 3A6BH 5SWSE 3FOLA 5ESVB 1XH3B 3GHBL 3UYPA 3EJZD 5B38B 1BQHA 5CZXD 5DD6A 3FMGH 4QOKA 4XP5H 3DHJA 2Y36L 1K4CB 3KWWB 4NO5A 3RVTD 1DQQB 3MNZB 1IGFL 2ADJB 1MY5A 3BDYL 1C7TA 3HAEG 1ORQA 4UV4L 3GMPA 4LHUG 1H5BC 2Z35B 4HFUH 3HLAA 5BQ7A 4O5LL 1JNLH 3E3QE 3CFBB 3GSOB 4I0PA 4OT1H 4AIZB 2YD4A 3KPSA 4LDOB 5EOQH 5IW3A 1OTUC 3QEHA 4ZAKC 2AJXL 4NYLB 4UT6L 4CRPA 3KLAA 1CFTA 1A4JB 1OQOA 4PJCB 4U31A 1QPXA 2Q76A 1VEMA 1U3YA 1QBAA 3UAJD 4X4YA 2RB8A 2IAMD 1KJ3L 3CFKA 4JN2A 1N8ZB 3EOBB 2EC8A 3C5JA 4L4JA 1FYTA 4ZD3H 3AS1A 4L4TB 2F9BT 1U8QA 3GI9L 5FYLL 4ZFOL 1XZ0B 2LU4A 2YRPA 4PJCE 1DUYB 3DURB 5TDPA 4IOFC 5ALBL 3MLPA 2MMXA 5FYJU 1NGWA 3MV8D 3QO1B 5DJ6A 1V3KA 4L8DA 1XAUA 5F71A 3TBVA 4KAQH 1VGKB 2E8ZA 4IRJC 2HT4C 3U79A 5GRJH 5L6YH 2OQJA 3TFKC 5DTFB 1TCRA 3DYMA 3R4DA 4UINL 2PTVA 4KDTC 4LASH 4PJ9B 2VZ3A 4JPIA 1KIPB 1NPUA 4Q9QH 1JN6B 5FV1L 3WFDH 2QHRL 5GGRY 3HC4H 5JPNB 3ARDD 1PG7L 4BZ2H 4F7CA 3H9HA 3WHXA 2BVOA 3MLSL 2E9BA 3AUVA 2HJFA 2ESVB 2ZZUT 2ID5A 2DN7A 4P2OC 1PEZA 4PP2B 4IRSA 4TSAH 4DOHB 3ALWA 4GRWB 4XP9H 3J8F7 3QQ3B 4P57A 5EOTA 2H3NA 1YPZB 3EHBD 1JUFB 4NJ9H 5F89B 5F7EH 3VXTA 1L7TL 3MOAL 1YYML 5IM7B 1VFBB 1OF2A 2AJZA 5IVXB 4AL8L 2GQHA 1R0AH 3QWOB 4XWGH 5J6HB 3S37H 4U1SB 4XBPB 4MAUL 1QNZH 3MRMA 5DQ9A 5BV7B 4GRWE 1T2QH 2VXUL 5BRZD 5LCVL 1YPZE 2OSLB 2OR9L 3SE9L 3WFHB 1UT9A 4OUOA 3P0VL 4M7KL 5CUSH 5IVXE 4K7PX 43CAA 2DQDL 1HILB 3VFGH 2YZ1A 5T1KB 3FN0L 3LEYH 5B22A 3BOVA 4KUZH 4WWKB 4OGXL 3FT3A 3QNYA 5D8JH 5DZLA 2PO6D 3V0AC 3FCTA 4ODTL 3PWPE 3W2DL 2D9CA 4G8IA 5FFLA 5IFHL 2DQTH 3T4YA 5C09A 4JO4H 4P2QB 5F1OB 4I3RL 1PVHA 4NFDA 1RMFL 4OUUA 1DQDL 2IALA 3AU1A 3DTXA 3HS0A 4FQLH 4IHOB 2WBJC 3U2SB 1QFOA 5JR1L 2ARJA 2BERA 3GO1H 4KTYA 4HWBH 4LBEB 1S7TA 1U8PB 2UZYB 1DVFC 2CQVA 3V95A 2JK5A 5GSRB 5GZNC 1EFXB 3HTLX 4XCNB 4MD4B 3E6FB 2G9HB 1RUML 1MCIA 2CMRL 1MFDH 1W0YT 3TC9A 3EYOA 3CSBA 5T3ZH 2Z0BA 2XWJA 4KUCD 2VDOH 3VXMB 1E4XH 4I48A 1KG0B 2BSTA 1CE6A 1W0WB 5I8OL 3VXOB 2D0HA 4XVTH 4NWTL 4Q97A 5C8JA 1FO0A 4XMKL 4D94A 5HGHA 1T4KB 4R3SA 3BQUC 1WK0A 4L3AA 3O8XC 4U6VL 1HHIB 5MP6L 1BZ9A 3RWFB 3V0WH 5FCUH 2K9UA 1ADQH 3WDJA 2A1WL 5F97E 4CN1A 3VXME 5IW1B 4OF6A 4UBDC 1LDPL 4GH7B 1IQWH 4LKXB 4JY6A 1QBBA 3UO1H 5K9QG 2BVPA 4GSDH 3HUJA 3WJJC 3EYVB 1N5YL 5HYJD 5I16A 1A7NH 4G6FB 4PJEF 2OZ4A 2CKNA 2OS7A 1ZSDB 3MV8E 2A74B 3FQXA 2PF6A 3TA3D 4AM0B 5IV2A 5T1LD 2NY6B 5MERB 1WEJL 1H8SA 4D9QD 4KZDH 5ABDE 5J9PB 3FONB 3UBXI 3ZTNL 3QQ4B 3AREC 6FABH 5BMFH 4X5XA 3WBDA 4M6OH 4PTTB 3ZHLA 1A7OL 4K2UH 3U9UA 1U2CA 5GGTL 2AKRA 3SJVA 4G9DA 2VC2L 3BESR 1FCCA 5DQDL 4CDGC 1KLUA 4PB0L 5GJSL 3T3MF 5JZ7D 4U1JA 4ZUSA 3QEGL 4JFYB 2VERN 3S34H 4L5FH 5HY9B 1H0DB 1DDHA 1GGBH 1T1ZA 4X98A 3SDDD 4C55A 2F54D 2I9LA 4DWHA 4OZIB 3QJHB 1QG3A 4U05A 4KKLD 1NL0L 4Q0XH 5DI8B 2R56H 1OGTA 2W0FA 3HPJA 2L7UA 2GAZA 1NCBL 3O3EA 1JRHI 5DMGC 4N9GA 5HI5D 5C7XH 1E4WH 2D7MA 4LKCA 4ZTPH 5HJ3B 2Z91B 3VD5A 5EH1A 2DTMH 4BQ9A 4RWYH 2I25N 1AO7A 2D7TL 3EO9H 3M07A 1IKNA 2DM4A 3KXFD 4JKPH 4OZ4A 4QTHA 2C26A 3O3BA 4N0UE 4ZFZA 5EUKB 5BRZE 1JZ3A 2AJSL 1GL4B 1NBYB 3ROLA 3BKMH 2FO4B 4KH2A 3REVB 4F9PA 2G75A 5C6TH 5MEOA 3BRGC 1FH5L 1T83C 2XXCB 1N0LA 3EJZC 4L3CB 5CZXC 3UTSB 1MIML 4DGVH 4J2XA 4OIIL 4HEME 4GW4A 4NN5B 4BSWA 2B0SL 1NSNL 2PKDA 5M95B 1MWAL 5F1NA 1VKXA 2F5AH 5MEQB 4CW1A 1AFVL 4IDJH 5E8EA 1WAAA 2APBA 4K3EL 4YDLB 3LS4L 1GHFL 1NLDL 4GAFB 5F1IA 3VXSD 4G7VL 5F21B 4JDTL 1LE9A 3IFLH 3ZDXF 5C6WH 1MRDL 4H20H 4Q9RL 2HLFD 5IP4A 3RP1A 1A2YB 4A6YL 1ZHBB 3QJFA 1WZ1H 2AP2A 1JL8A 1CD1A 3MA7B 1NCWL 3UAJC 3RPIA 5I8KH 3TYGH 4LCWD 4RGOL 2OYPA 1OGAB 2XA3A 4RX4D 3STLA 4JHBA 4GJTB 5TE7L 5IVNA 3T0WA 1JF6A 5JIHA 2JIXA 1U6AL 1NC4D 1A64A 4N8CH 3EBAA 4D2NA 1OPGH 2OJZL 4OLXH 1OAQH 2ICWI 5C0CA 2HJKA 2VDPH 4YIQB 1OGAE 2W0PA 5J1AB 4P2RD 3GSNA 3K8KA 3B2VL 3GBNL 3V6FB 5I2IB 1U95B 1BREA 2ZPKH 3LKOA 5DS8A 4S1RH 4ZDHB 2V7NA 2X9YA 4DGYH 5IR1A 3KPPB 2CPCA 3L9RA 1JIBA 2BC4B 1G9EA 3MZTA 3ZHKA 2X2YA 3DMMD 4M6NL 5HYJE 5IHUH 3MUGA 5IBTH 3PIQA 1A3RL 2AK1H 1OCWL 3V4UH 1JHTB 3HZVB 3LKPB 4MNGB 4R4FH 4JB9L 4XVUD 1SMOA 1YEGL 3ZTJG 2WZPD 4D9QE 5JPMA 4FXGA 4DQOL 4L8CB 3EHBC 4HKXA 4PJIB 2PW1A 3KLHC 1WGOA 1S7WB 3NCYP 1BPVA 4NZRH 4HWBA 4WHTA 4HUNB 2OTUA 5GGUA 5FM4A 5JUEH 2M2DA 2XN9A 3W9EA 4K3DH 2MKLC 4EJ1C 3MACH 4L3EA 4GRWH 4LSRH 3O3AB 3JUYA 2ITCB 5TPWH 4RAHA 2JELL 1SBSH 4ODWB 3ARFD 4TRPH 5ALCL 4KKNA 1ED3A 4B53A 5F88A 1F90L 3U1SL 5E2UL 4JCMA 1GGCH 5CSBA 1FE8L 4PJIE 1CFQB 4NPYB 1JYWA 3MOQA 5E6YA 4AENA 1U8LA 2Y23A 1CGVA 3BVNB 3WIFA 5BV7H 5EU5A 3MLRL 2Q86A 3C09B 5JOPD 1DBKH 3GUTB 4BFIA 3G6JF 5DJ8B 4GQPH 1WLHA 3ET9F 5HGAA 4OCMC 5EOCL 1G7IB 4LVEA 2PO6C 5F6IC 2VL5A 2CLZA 4Y4FA 1AD9B 2XY1A 3EO1B 2H8PA 2B1HL 2XZAL 3TBYB 5JHLH 1SJHB 4URTB 1IEAA 4WHDA 3QG7L 1CXEA 3V6OE 2EDYA 2UV3A 3TP4A 1B9ZA 1HKLL 5FOJA 2KUTA 5IJVA 4OZHF 4MWFB 5C0JB 1I8MA 4NN5C 3CXHK 3KR3L 2MKWA 5GGQL 1CR9L 4C83B 1YNKH 1U8JA 5E9DD 4LLUA 4J3UA 3B5GA 1MQKL 4ZUTB 3BWAB 1URLA 2HT2D 3OG4B 1HWGB 5T5FL 4U3CA 1CF8L 5E5RB 3RNQB 5D2NB 2OMNA 4WCYL 4KDVA 4HH9A 1KCVH 4JO1L 3BRFA 1S5HA 2F74A 1N2RB 2BNUA 4K55A 3P9MB 3VXSE 3CXDL 2ENYA 4OF8A 2YXMA 3L7EA 1MFCL 2EEAA 3AM8C 4JQXC 4WTZA 1ZGLP 3NIDF 4PJGA 2ICEA 1A6TB 1UZ8A 3GMLA 5C0FB 3PWVA 1B4JH 1NC4B 2A83A 1BVKB 4HFWA 2BY3A 5D2NE 4BH7B 4XMLH 3DUSA 4WY7L 3FJTA 4NO0B 3ARTA 3QXUA 3BUTA 2XQBL 2WQ8A 3OKLB 4LQ1A 1N64H 1FFNB 1KACB 3ZE2F 3VGAC 2X4SB 1NMCC 5FOBB 4X6CF 3NCJL 1SMAA 4NKMB 1HNGA 1EAJA 2ZKHL 3TPKA 4FQXD 5EDXA 4YHYB 3CK0L 3BP6B 4HPYH 4LHUD 3TA3C 1AGBB 3QPQD 3FO0H 4JJ5B 4P2RE 3RL2A 4I9WD 3VD7A 1A1MB 3RWIB 3KPNB 4RFOH 3E6HB 5L2KA 2A6JB 2NCMA 5CP3H 3BP7A 3L7FB 3VE0B 1TJGH 1RJYB 2NTSP 1SYVB 3NA9L 5EU3B 3QNZB 2IANB 4F7MA 1C12A 1CL7I 4QY8B 4AH2B 2Q20A 1I1YB 2PUQT 4XRCB 3U7WH 1TZGH 5JZ7C 1ONQB 2B2XH 5LXGH 1BZ7A 2GJ6B 1PKQB 4WRLA 4OB5H 5ESVA 2B4CL 3GSRB 3SDDC 5B38A 2DJSA 4RMRA 3CZJA 4HGWB 2A6DA 4KKLC 5AAWA 5I15H 5J4MA 3CU7A 1U9KA 2IANE 4O9HH 1WQVT 3FO1B 1DQML 3KWWA 2ZUWA 3DLQR 3MNZA 2IG2L 1VPOL 2ADJA 5DVMA 3KPOB 5HYSB 5JLZB 1PKQE 5HI5C 2Z35A 4XP1L 4G3YH 2H1PL 1GRWA 3QIUA 2DLGA 3G5ZB 4MDJA 4NUGL 4GLRI 4AIZA 4L9DA 3R0MA 4NYLA 1DUZB 1A4JA 1HQ4B 4RA3A 3C09C 2VDML 4HW6A 3S3SA 1H9VA 3G04A 5AAMA 1QLEH 1B88A 4M62H 3EOBA 1RUQL 4RISH 1ZT1B 2VUYA 5DJXB 4X5LA 5KJRL 2EIDA 4L4TA 1I8LA 1LDSA 3C60D 5I1GL 5T5NG 2P8MB 5F6HI 4U7SA 2EDBA 3P9LB 3QNXB 3RX7A 4JY4B 1HDMB 1XZ0A 1KCSH 2Y06H 3H0TA 1DUYA 3DURA 5BVPL 4D9LL 3WKNA 1UM5L 2LTQC 4Y5YB 1U3JA 1U8KA 2YK1L 5L7XL 4PRHD 1FCGA 3V4PL 1S7VB 2NXYD 2F19H 4Q74A 1F6LL 2BVEA 1VGKA 5HI3D 1G1CA 5EBMB 2HLFC 1MCPH 4TNVK 5JTWA 4R2GB 5DTFA 2G5RA 4TPRH 3RBGA 4JZOB 1MCCA 2JJSC 4FFVD 4OLVH 5D2NC 3NA4A 1NCTA 3NPSB 4PJ9A 3CFCL 2APWA 1KIPA 1JN6A 2AXGB 3UTPE 1U8OA 4U7KA 4F37K 4WW2B 4JANB 4OFDA 3WFBH 1VENA 4KTDH 1JTPA 4PJXF 5CJOH 4HV8B 5F7LB 2F5BL 4LRNH 4PY7B 2ESVA 1EGJH 2ADFL 4M7LL 4L4VD 1FAKT 3D0VB 3Q3GB 4PP2A 3WIHL 3VGDA 1QBML 3AY4C 3VXUB 1OW0C 5K9OB 4BQ6A 3QQ3A 2XN9D 3QUMB 2CRMA 1RFDL 5JXED 1FFRA 4ZO7A 4F7EB 4QRPD 2V2XB 5F89A 2GY5A 5IM7A 3O2VL 5IVXA 3BN9D 1J5OL 4M48H 3MNVB 3R8QA 4ELMB 3QXDB 3QWOA 1P5UA 4P2YA 4FQ2L 3FHQA 4U1SA 4XBPA 5CHNB 3VXUE 3DMMC 1QOKA 3HC3H 3DJ9A 2AK4D 3PABB 2J6EL 1JGUL 2OSLA 2GK0A 2I27N 3EGSA 5MENA 2QQLH 4XVUC 4I9WE 4BK4A 3RX8A 3GI8H 3QH3B 1ERNA 2WUBH 3ZT7A 3VGEA 1HILA 3SKJL 1LMKA 4ELME 3REWB 3BD4A 3MOBH 4LEOB 5T1KA 1OAYL 5GS0L 2I5YL 4U1MA 4WWKA 1AHWB 2VISB 4IIQA 4P2QA 5FB8B 4NBYB 2BXYA 3W0WD 3O6MH 1UWGL 1T0NB 4IHOA 2BMKB 3ARFC 3U2SA 4QXUL 4PJHB 1X7QB 1UKSA 3MGOB 3RBSA 1ETZB 4OSUL 2BX5A 1JYXA 4LBEA 4NN6C 1U8PA 5GSRA 4X9GA 1RZGB 1HYRC 3QDJD 4Z76B 2BNQB 4XCNA 1RZFH 4XCEB 4UT9L 2GEEA 1S9YB 3OJ2C 5GJTH 4NQDB 5ESQB 4APQB 2O61B 2YPLD 4WIQA 4Z77B 3DGGB 2F8OA 3QUXB 1ZT7A 1CD0A 1L7IH 4P5TD 1FC1A 3T3PF 5E4IA 1W0WA 3VXOA 1WISA 3CNKA 4A6YB 1DN0B 5E7BA 1U8MA 4ERSH 1T4KA 4PBVC 3G08B 1UKQA 4G80B 2BNQE 1HHIA 2C4FT 3BYTA 3RWFA 3Q2CA 3B9DA 3FFCD 5D93C 2SEBB 2ZG3A 2NY7H 3FQRA 5B4MD 2R15A 2NR6C 2BK8A 2VMFA 5JXAH 4NRZB 5IW1A 2C4FU 2CUIA 5C0AB 3LN4B 4LKXA 4YAQB 2HT2C 4YXKL 1V7MH 4PJFE 1RZJH 4N0YH 2VRAA 2QADD 5GHWL 2E7LA 5IMOB 3GI9H 3KYKL 3FN9A 1ZSDA 4PB9L 5L2KD 5AYUL 4UIKL 5KVFL 2W60B 3O4OB 4GG8B 1QFUH 5SV3A 5ALBH 5C0AE 3NZHL 3D1MC 4N8PA 5MERA 2RCSH 1UH4A 3F65A 1P6AB 3HB3C 5J9PA 5T33H 3FONA 1EERB 1G9ML 4UDUA 4HUKB 1E28B 4X8JB 1LO3L 1A8JH 2OXHA 1PG7W 1C5BL 4JREC 1RU9H 1GZPA 1HKFA 4HT1L 4UINH 4JVUA 1DBJH 3F7PC 5SWQB 3N9GL 4GW1B 4MNHB 1EAPB 4U2ZA 3UC0L 1YEDB 3ULVD 1TXKA 3VH8B 3OAZK 1ZMYA 1MCDA 3LDBB 1DLHB 4JFYA 4G5ZH 5HY9A 4MXVE 1H0DA 3QXAA 5C0RL 4L4VE 4Q6IB 1CK0L 3LQAL 4FQXC 1U3HB 2MTPA 4HWUA 4OGAD 1NFDF 5C0DB 4OZIA 1BIIA 4HBCH 4RMQA 4W4NA 1EHLH 2AK4B 2O5XL 2O5ZL 3SDYH 1CQKA 2P45B 4RIRA 3BKCH 4K8RL 1UWXK 2BOBB 1CBVH 3WD5L 4Y7MA 4EOWH 4WJ5B 4YFLF 1GC1L 5D1QD 3G6DL 3NN8B 1YYMH 3IU3B 2Z91A 5HGDB 2QL1A 1AY1L 3AMKA 4M6ML 2K3TA 1D6VH 4MCYB 4YHZH 3FB7B 1Q9KA 5EUKA 2AK4E 3VI4F 5FXCH 1P4IL 2F58H 5IKCB 3BDXA 2FO4A 4Z7UE 3REVA 1RZKL 4G42B 4M1DL 4L3CA 2XTJB 5CZVL 1AHWC 3UTSA 5CP7B 5I76B 2OJEB 3WKML 2VLKD 1MRFL 5AG8A 1SYSB 1B6UA 1GGIH 1TVDA 3N1QC 5EPMB 3B9KB 3QDJB 3RZCB 2IH1B 4K71B 2XZZA 4OGYH 3OR7B 2HA1A 4KQ3H 5HYSG 5D7LD 3WLBB 1CGUA 2CKBH 1MVFA 1G0YR 3TO2B 3L3KB 1QFWM 2W07A 2ZCHL 4P49A 2P5WB 5HDBE 4KHTL 2P44B 5JR1H 3MA7A 4FMKA 1EA9C 2E9JA 4ZOAA 2NX5B 3RTQD 2NW2B 1IM9D 5HSFA 3QDJE 3ZYZA 4G7YH 4X5WB 3HI1B 1XCTB 2X4TB 1EGJA 4ZO9A 4JN1L 1OGAA 1S5IL 2FHFA 3KHOA 4LRIA 2AJYL 3PUCA 5DMKB 5JW5A 1YNLH 1G7MB 3CC5A 4KVNH 3C60C 4U1IB 4OD3L 2J4WL 5FYKD 3FQNB 4N8VB 3EUUA 1QEWA 1KB9J 5J8OA 2L7JA 3GSWA 4H26B 4NHCL 5AWNL 5D1ZD 4ZS6D 3I3DA 5HHOB 3SGJA 1FNHA 1H3TA 2KH2B 3GRWH 3SO5A 1MCBA 1YC8A 1CLYH 5FKPB 3U0PA 4Q7DA 2NXYC 2VR4A 5E2TH 1KPVB 4JZNA 2GKIA 2WANA 3E1F1 1R5WA 3BIBX 4YIQA 5J1AA 4PV8B 5HI3C 3UJIL 1H8NA 4JR9L 5BO1H 1QACA 2DMCA 3GMMB 3V6FA 3DSNA 3OTTA 1U95A 5F1SA 3INUL 1AGCB 2B5IC 3RI5K 2R8SH 4ZDHA 1INDH 1FORL 4FFVC 3BO8A 4P2CG 4HGKC 4NQSB 3ARPA 5HHOE 3UTTD 4LNVA 3KPPA 1MLCB 5L88H 3S36X 8CGTA 4G8EB 2BC4A 5MEND 5E8PB 1OWRM 1JI2A 1YA5A 4NCC1 5DZNA 5CEZL 3SOBL 3N1PC 1A7RH 4JFQB 1OTSD 1R5VA 2APXA 4IS6B 4NRYA 2YUXA 4OZGA 4JRYD 1JHTA 3HZVA 3LKPA 4MNGA 1YEIL 4QNPE 1I1AB 1LO2L 2JE8A 4JY5L 3T2PA 1T6VN 4N1CA 4OLEA 4L8CA 1A14H 5JXEC 1HHJB 2F15A 2Y72A 3MRFB 1TTGA 1S7WA 3UBXG 5FA4A 3JVGC 4L1DA 4DZBB 3AVEA 3VA6A 4OD1H 5T3XL 1JK8B 3BN9C 1AR1D 5DJZB 3O3AA 1K2DB 2ITCA 3QUMH 4Q6IC 3ULVE 4UU9B 1U3HC 3ARSA 2X4OB 1A1OB 4K9EC 5D1QB 5DQDH 5EORL 5MI0B 2QR0B 5SV4A 2DL9A 3V8OA 5EZJB 1DQTA 3BP5B 5E5UB 3L5XL 2WWKO 3SO3B 1CFQA 4NPYA 4XPHL 5D7JA 3E8UL 2Z31D 4JRXB 4JFZL 3VW3L 2YN3A 3V6OA 5JHDD 4YHOL 3BVNA 2G2RA 3UDWC 2GCYA 1TZIB 4KROB 3IXAB 1N6QL 4BZ1L 3GUTA 2HTKD 5DJ8A 1F4HA 2JJWA 4YDIL 2PCPB 4GBXD 1CFBA 3EO1A 4C58B 3TBYA 1SJHA 3RIAK 1QSEB 5J11B 5FIEA 3SKNB 3T09A 4Y88A 4XNYH 3L3JB 3WL9B 4MWFA 1J9CT 1JRHH 4QRTB 4R8WH 1WBZB 1KJ2B 2Y1VA 1NUNB 3LS5L 2VLKE 4ZUTA 3BWAA 1Y0LB 3IXTB 4XXCA 4PS4L 2JJSA 3RNQA 3TO4B 2ARJQ 3NAAL 4K94L 1OD9A 5IROA 1N2RA 4P5TC 3IDJB 3P9MA 5CCKL 2FEEL 2K1MA 2ZP0T 4U49A 1YECH 4O02H 2AJVL 1GHFH 1P9MA 2NY3B 5IEKB 3LEXA 4OFIA 5I1KL 2BSED 2YPKA 1A6TA 1JHLH 3SGDH 5C0FA 3M17A 1EDQA 1QYGL 2VN7A 3BEWB 3OKKB 5FA3A 1JPGB 1BVKA 3HE7D 5JW4N 2HFFB 1SY6L 2YD2A 3RA7L 4BH7A 1ORSA 5KAQF 1PSKL 3L5WB 4A6YH 5IFAH 5T1DL 4NO0A 3AY4A 5E00B 3BD5A 4YHMH 1T5XB 4YC2C 1A6ZB 1HZHL 5C2BL 2WW8A 3OKLA 5GGSY 1FFNA 3VFNB 1Z9OA 2X4SA 5FYKE 4Y0GA 4WFFE 4PJEB 5FOBA 4UAOB 4R7DB 3PP3K 3VXQB 1KCLA 4O00A 2QADC 4Y2DD 2A0LD 4FQ1L 6CGTA 4XNQB 3BP6A 1N59B 2JLLA 3SDXE 3QSKB 1AGBA 3BHBB 2UY6A 3QXVA 4JJ5A 1FFPB 4YDKH 3WNLA 1A1MA 3RWIA 3KPNA 4Y2OA 3E6HA 5D7IF 4N0CC 1K6QL 2A6JA 2QQNL 4PJEE 4X9IA 5B39B 1PD6A 3VE0A 1RJYA 1MNUH 3MLUH 1SYVA 2WWMC 5DMIL 3QNZA 2IANA 4QY8A 4AH2A 2EECA 4KY1L 1BECA 1MCHA 5FF6B 1I1YA 4XRCA 1CVRA 1I1AC 3L95B 2YKLL 1ONQA 3KPTA 3ULVC 4XNUH 4JRYE 2MQ0A 5I1HH 2GJ6A 4HUWB 1PKQA 3QDGA 4ZPTA 5DJ2B 3SEPA 4BKLB 2VJXA 3GSRA 2HT3D 4OGAC 2BJMH 4ACPA 2V2WA 5I1LB 4GKSB 4D0DB 1UYWH 4U33A 4IRZH 4L8SB 3BE1L 3FO1A 4TOYL 3O41B 3NIGE 4HK0A 4OI8A 2FZ3B 3BPOC 4XC1L 5FV2A 1KEMH 3GSUB 1VHPA 1MCQA 1S9WB 3KPOA 2W91A 4HS8L 4K9EH 1I9IH 5D1QC 1FVCB 2Q87A 5HYSA 5JLZA 1CDBA 1CLCA 2CO7B 5IWLA 2GJJA 3G5ZA 4OM0H 4GS7C 3SCMB 4Y89A 3SO3C 1GPOL 4GXUM 1AGEB 1DUZA 4GBXB 1KJVB 2EDQA 4Y5XB 1BJ8A 4C56D 2NY1B 5KVEL 1TNMA 2X5PA 3DHMA 3K3QA 2IMMA 5JHDE 5I71C 3GRWA 4NNXA 3RWEB 1HXYB 1IFHH 1IARB 5I9QC 5DJXA 1KTRL 4FS0A 2P8MA 3WN5C 3MLTB 3U4AA 1G9NH 1PFCA 3P9LA 4JY4A 1HDMA 3MRCB 2ERJC 4Y5YA 3HR5B 4LAQL 2B7DT 1M4KA 4PLJD 2EEBA 4DAGH 2R9HD 1XF1A 1RIVL 1M7IB 2EXYD 4Z0BH 5E99L 5EBMA 4LQFL 2DQIH 3TIEB 5HBBA 4FFWD 4WI6A 1EEQA 3RTQC 3CDGB 2XTLA 3ZYIA 3Q48A 4JO2H 1X4XA 5TJWK 3KR3H 5DRNA 3ZDXE 1MREL 3DUUB 1NGYB 3U6RA 2AXGA 1S7UB 1DJSA 4WW2A 4JANA 1N0XL 3SBWA 3TGXA 4HF5H 1NEZB 3H9SD 4WHCA 1A7QH 1N26A 3B2UD 4K7PY 4N8VG 4W6WB 4XTRD 1IC4L 5D1ZC 4O4YH 4ZS6C 4PY7A 3MJ8B 4K23L 25C8H 1WWCA 1UXSB 1AXTL 3QO0B 2EIEA 4HWEH 5A3ID 3VXUA 2HRPH 3K2UL 5K9OA 5EU4B 5GGTA 3QUMA 1FSKB 5IK3A 1F6FB 1KLGB 1W2KT 4HZAA 1ES0B 3UBXA 4F7EA 4YGAB 2FYYB 2V2XA 1LEGB 3D25B 3VFUB 3Q1SH 1DQLH 3HI5H 4RMSA 1XGUB 2GJZA 1JPST 1RK1B 3WHE0 3MNVA 2OTWB 4YWGL 3QXDA 3T77B 4ZMAT 5INCA 5TDOB 1RK0B 4PGBB 4BSJA 4HXAH 5CHNA 1MEXL 4BJLA 1TVHB 1N4XH 4JG0H 3PABA 1OTSC 4ZUUB 1HI6B 3ZKND 5J6GB 3GIZL 2DQHL 2X09A 5IVOA 2CUMA 4YUEL 5EUOF 1ZAGA 5KW9H 2JTDA 1P84J 2PW2B 1I1FB 4LSSL 4BQ8A 2PTTB 3O6LL 4YFLI 3REWA 1NLBH 4LEOA 3LH2L 5DRXB 5LGHH 1HHHB 1AHWA 4UTAL 4HAGA 4GQ9H 4M5ZH 4KI5F 2VISA 5E70A 1XF2A 3ULVH 4JFHD 1AR1C 2UVEA 3NFSL 5EG6C 3VDCA 2VQTA 3GSVB 3UX9B 4U1GC 2DRUA 5DR5L 5FYLD 2BMKA 4PJHA 4H8WC 1X7QA 3MGOA 3JWOH 1EO5A 1ETZA 1UB5B 1QRND 4L8SC 4QRRD 1IGTA 5CLWA 5IB2B 1ZHNB 3IETB 4Y19B 1CXLA 1CL7H 2Z31C 3ZSSA 4Z76A 5JQ6L 1KYOJ 1FAIL 2BNQA 5HHXL 4XCEA 3BH8B 1REIA 3G6JB 4JM4L 4UB0H 4NQDA 5ESQA 4APQA 2RQ8A 3EIFA 4Z77A 2O61A 3DGGA 4Z5RB 1MHEA 3CLEL 1ZTXH 3QUXA 1KFAH 2HTKC 2CGRL 4PJ7A 5C92A 1QPPA 5GGRB 2X44D 1MFBL 5ID0B 4Y4HD 1MAKA 4A6YA 1ODAA 5GRYA 1DN0A 4GBXC 4XVSL 5EA0H 1AP2B 2W65B 4Y19E 4OZHB 1U91A 1G6VK 4Y5XC 3G08A 5D5MB 2CH8A 4PRIB 3F7RA 4XI5D 3G6JE 1J87A 3ELAT 5DGQA 4WNQA 2FB4H 4JHAH 1ZKAA 2SEBA 4YK4B 3QCTH 4KMLB 1SVCP 1M71B 4UNUA 4X80H 5F9OH 3CVIH 2C3GA 3SE3C 2VDKL 5KZCB 1EO8L 5C0AA 3D85D 3LN4A 4ZXBD 4YAQA 5CLTA 4RZCB 2YUWA 4NDMB 4OZHE 2ICWJ 2Q1EA 5D5ME 3C6LB 4PRIE 3S35X 1UACH 1T21B 1KJ2H 5IMOA 4CN6A 4MD0B 1Z0MA 4LARL 1BEYL 1VSCA 4CJ1A 1LO0H 3NACL 5TDNA 3QCVL 5HPMB 4OFPA 3BIKB 4OKDA 2OLDA 3QZWB 1GZQB 2R4SL 5KS9A 2CK0H 3RPKA 3HE7C 5F7KC 2NZIA 1TJIL 1E28A 4LGRB 2H2PD 1WZMA 3MBEB 4X8JA 1TETL 4S1QH 1UB6B 1PGRB 2CK2A 1NGXB 2ED9A 5FYKH 2LV4A 3VWJD 3QDGD 4X6CB 4E5XA 1KEGH 1LK3L 5I1EH 3QPXL 5SWQA 3GIVA 4GW1A 1TCMA 1EAPA 3H9SE 1UWEH 1YEDA 3H9YA 3VH8A 2C1PB 4Y2DC 4ONFH 2A0LC 4UOW1 4JFFD 4Q58C 1CIDA 4TUOB 3MCLL 1JF5A 1BVLB 4OCSH 4BK5A 4X6CE 1WCBA 2GIYA 3FO9A 2EYSB 5GZOD 4G6MH 1T3FB 1IQDB 5F7HA 3QP3A 1FHGA 3IAPA 4WJ5A 1YJDC 1HEZB 4RCAA 1W72L 2VNCA 4JPWH 3NN8A 5B39G 2P49B 1YUHB 2ZCKH 1BBJB 2ZUXA 3C5ZA 3IU3A 3QIBD 5HGDA 3TPUB 1I7TB 4B7LA 1G7LB 2NTFB 4MCYA 3FB7A 5CD5D 1YQVH 3FQTB 4KRMB 5F72S 1NAML 5IKCA 1RJCA 1BGXH 2H6PB 3SDAB 1DBBH 3CFIC 3P77B 2IFGA 5EU6B 4PJBF 2NY0D 3N1FC 1MAML 4Y16D 4G42A 1EBPA 1QZ1A 2HT3C 3M45A 1E4JA 3OQ3B 5CP7A 3SE4C 3TVMD 2OJEA 4RMWA 2HLAB 4LLMB 3WFEL 5EPMA 5I1AB 3B9KA 4XBGB 5BVJB 3RZCA 1CYGA 3OR7A 2E7CA 5DURB 4ZG1A 4X6DE 3NABL 4ZUVB 3F12B 3K4DA 3LQZB 4H8WH 3CMOH 5IW6B 1ZA6B 1YEFL 3U0WH 3PJSB 5FYLE 3TO2A 3L3KA 4I2XB 4CVUA 3MV9B 3VFSB 5E08L 1WZLA 2P5WA 3U9PH 4QRRE 5E8OB 5KSUB 3T65B 4YPJA 3D3VB 1IKFL 1U42A 4X7FC 2NX5A 2NW2A 4QF1B 3UCRA 5ENWB 3KYMB 4MB3A 3HI1A 1XCTA 5FDWB 2YWYA 1JMZA 4I5BB 5IBLD 4HUVB 1G7MA 4I2XE 4YDVB 1D9KD 1MLBB 3MPCA 3FQNA 4MVBD 4N8VA 4FRWA 3B9VA 3MV9E 3D85B 3DVGB 4H26A 2A77L 5HHOA 4L9LB 1KCUH 1VFAA 3D3VE 4P9HC 1F58H 4LCCC 4Y1AD 5FKPA 3UTZB 2OL3B 4I77L 4PLJC 3N85H 1QLRB 2R9HC 3EZJB 4U1KA 4YK4C 5FHBL 3MLYH 3DX7B 1KPVA 1W8NA 5E7FA 2EXYC 3DOSA 3VFWB 4PV8A 4E42B 3TBWB 3GMMA 3MV01 4G6KL 2WIIB 3KLSA 1QO3B 3O9WD 4IMKA 3F6LA 1RJLB 4FFWC 3H3PL 1X5YA 3W5NA 4KPHH 4NQSA 4QTIL 1CU4L 1MLCA 4ZO6A 3S88H 2R4RL 1IGCH 4G8EA 5I0ZA 3K1DA 4P59H 4XCFL 5E8PA 5F70A 4PJXB 1LNUB 5LQBL 3WE6B 4KKBD 2WP3T 4NQEA 3WNKA 1JGVL 3P4NB 3FT4B 3OPZH 3B2UC 4JFQA 2DB8A 4XTRC 2C3XA 4MGXA 4NN7C 2YXFA 3Q6FB 2BDNL 4UQ3B 3LHPH 3O6KH 1LQSR 2FWOB 1ZGLB 1KCRL 1CFSB 3OJDB 1TQBC 4PFEA 3WCYA 3ULSA 1UC6A 1HHJA 4Z8FL 1SM3H 3WFCH 1RZ7H 4JPVL 5GRUH 4DZBA 2D0FA 1JK8A 4CAGA 1CXKA 2QTEA 3P11H 4MZ2A 4HC1H 4DKAA 2W9DL 2EYRB 5DJZA 1UM4H 3U4BH 1K2DA 5C07B 1QA9B 4UU9A 2X4OA 3IYLW 1OSZB 2D7NA 3T0VA 4AQOA 4J4PA 2VKWA 5GS2D 2QR0A 1TQCC 3LVEA 3QIBB 1A6AB 3QQ9C 3TM6A 1Q94B 4OV5A 2IPTL 5C0IB 3BP5A 3ETBF 5IEHB 3KDMB 4YR6A 4Z6AT 3ZKNC 1A9EB 1A6UL 4I18B 5F9WB 5INDB 4X6BB 4JRXA 1YJDH 1NCNA 5DFTA 4J23A 3WXVL 3L5IA 5EIVA 1TZIA 3IXAA 1HINH 4NNPH 4MA7L 1DBAH 2JJTC 4Y16B 4OCRL 4EKXA 3L5HA 1A3QA 3CVHL 2PCPA 4ZUWA 4KDWA 3PQYD 1JI1A 3NCEB 3FT2B 3OWEA 3CH8A 1QSEA 3EYSL 4HCRH 3QFDA 1RZ8B 4XP4L 4RSVA 2DAVA 3RAJH 3SKNA 4UV7L 2AGJH 1PG7X 4O2FB 3L3JA 4ONGH 3WL9A 1YEJH 3MUY1 4QRTA 5D7SL 1WBZA 2ORBH 5FUOL 1KJ2A 3JZ7A 2CRYA 1F4YH 4F9LA 4I0CC 3DVNB 1QLFB 3KJ6H 1Y0LA 3IXTA 3RY6A 1CXFA 4LVHC 2GTWB 2YD3A 3TO4A 5ADPL 4XHJD 3WKMH 1FGNL 5ADOH 1CFVH 2ZSVB 2DQFB 4EQ2A 4Q6YA 3IDJA 3RVWD 3WSQH 4Y4HC 3VDAA 1QKZH 1T1WB 4LOUD 3KS0J 3PP4L 3S6CA 3ARGD 2X4RB 4MNQD 3O2DH 2M1KA 5HDQH 3OKKA 1NCAL 1JPGA 1BZQK 4XI5C 1GGTA 2HFFA 3T3PE 1UGNA 3I6GB 3L3DB 1NBZB 3L5WA 4XAKD 4J6RH 4HQQL 5E00A 1JVKA 3BAEL 2Q6WB 1A6ZA 2FDBP 5FGSA 2X05A 2XNAA 4ZXBC 5A40E 4IJ3C 1YEEH 3PDOB 4M5YL 1FO0L 4P9HH 1XIWB 4EVNB 4PJEA 3RWHB 3BT2H 4YHLL 4R7DA 4ETQB 3VXQA 4MQ7B 1FNSL 4JM2A 4NQVA 1NCDH 5AD0A 5ICXB 1N59A 3IS1X 2ZJSL 3O3DB 3Q6GH 3QHFH 1V7NH 2OM5A 5J06A 1J0JA 2IPKA 1TIUA 3C5ZD 1RQ5A 3IDMB 2PXYB 2Y5EA 3ME0A 2H2PC 5D7KE 5B39A 1KTKE 5EWIL 3INUH 3QEQB 3ZKSD 1NGQL 2OZ4L 1FORH 2EH7H 3X13B 2J6EA 3VWJC 2EICA 2R2HB 1D7FA 5FF6A 1WZKA 1IAOA 3ARXA 3L95A 4YLQT 2ZUQB 4DFIA 3X3FL 1IVLA 1NFDB 4TVSa 5K33A 1TTUA 1IILE 5DJ2A 3I9GL 1MF2L 3GFUA 5CEZH 3O11B 4V1DA 4F58H 3QI9B 3A6BL 4PGJA 5I1LA 3QEQE 4GKSA 4D0DA 4MJ4A 3GMRB 1V3JA 1FZMB 1I7UB 2WAHA 5GZOC 1CGYA 3FMGL 2FZ3A 4XP5L 4X0KB 5H37H 3GSUA 2VLMD 1NCCH 1S9WA 1KGCD 5DEFB 1E4KA 2R0LH 4JKKA 2V9RA 4LPUA 3QIBC 5J12B 3EJYD 5DO2C 5T3XH 3SCMA 2BZDA 4HFUL 1KB9K 3UZEA 4XVJH 5CD5C 4I18C 4MS8D 1Q72H 5F9WC 1AGEA 1JNLL 4OT1L 4RGMB 4X6FB 5EOQL 3QA3B 2EKJA 4TSBH 3GJFH 3MROA 2FJHB 4HLJA 4R4BB 1BFTA 2NY0C 4TVPE 4Y16C 3L5XH 1KIQB 3H7LA 3RWEA 1HXYA 1QBLL 3TVMC 4MAYD 3MRPB 5E5MB 3OR6A 4OFKA 1AGDB 4ZTOH 1ZLUH 3MLTA 1KBGH 4JZJB 4ZD3L 1KENH 1KN2H 3GGWA 1KTDB 3MRCA 1JNNH 2R2BB 3LZFH 3SQBA 1UJ3C 2VLLA 5LWYH 3HR5A 1LEIB 1P7QB 1VDGA 1R3IH 1M7IA 1QFWI 3BH9B 3TIEA 3LB6D 3TNMB 4KAQL 1PJ9A 5GRJL 3SPVB 5L6YL 2VLRD 3CDGA 2XKSA 4NQED 1PW3A 4LHJB 3DUUA 3OSKA 4WEBH 1NGYA 1BM3H 1S7UA 2V5SA 3P4OB 5I18H 5IBLC 3TWCH 2E8YA 4Q9QL 1D9KC 1NEZA 1AQKH 3WFDL 1QQDB 1ZXQA 3HC4L 1SEQH 4CADB 4BZ2L 5JQHC 1WIOA 1RULH 3MJ8A 1NFIB 1UXSA 4HUUA 4NIKB 4AZ8A 5ITBL 3QO0A 4HC1A 3BI9X 3EOYG 2FHBA 2BSSB 4ELKB 1KLGA 1BD2D 4TSAL 1ES0A 3LEVH 2FYYA 1LEGA 3QUYD 4HD9A 4XP9L 1MVUB 3VFUA 3O9WC 4NQTA 4RRPG 4XAWH 1XGUA 3GJFK 4NJ9L 2VZ1A 2OL3H 1RK1A 5D9SB 5F7EL 3RUGE 4P46D 4X4MA 4PBXA 1RD6A 3BPLB 1T7WA 2OTWA 5CKGA 3T77A 2IPUG 5TDOA 1RK0A 7CGTA 4G6JH 4KKBC 4O2EA 2Y6SD 2JCCF 4JPKH 1ZLUK 1R0AL 3H6JA 1TVHA 4XWGL 4TNVF 3KVQA 3S37L 5EBLA 3MRHB 1QNZL 4ZUUA 3DV4B 1T2QL 5J6GA 2XQYK 2DQJH 1GIGH 4G6AD 4M3KB 1XT5A 1HXMB 5FO9A 4GRLB 3SDCD 3V8CA 1XGYH 2N7BA 2PW2A 1I1FA 1VEPA 4F8TA 1MJ8H 4ZYKA 4F37F 5CUSL 3BXNA 4D3CH 3B83A 1HHHA 1IGYA 2BVQB 3VFGL 5IB4A 3LEYL 1L6XA 4KUZL 1JNHB 4MCZB 5L9DH 5D8JL 3OXRA 4MXWH 4P3DB 3GSVA 2H45A 2DQTL 4ODUA 4L8BB 1P5VA 2GUOB 3RWJB 3WO4C 3QG6B 3QISA 4FQLL 3OKNB 5F7FA 5IB2A 1ZHNA 3BX7C 3IETA 4Y19A 2WINB 3GO1L 2J5LC 4HJGB 3ZKXB 4HWBL 1T66D 1ZOXA 3D39B 4W70A 3BH8A 3G6JA 5DJDB 1OAZH 1XCQB 1HHKB 4YGVA 3LRGA 3BE1H 5TF1H 1MFDL 4OTXH 3KPRD 4NQCB 4PUBH 1NJ9B 3RGVB 5T3ZL 1N3NB 5ID0A 3TV3H 5LGJB 3U4EB 1AGFB 2VDOL 3EYFB 2VOTA 1E4XL 4RGMC 2W65A 2OI9B 1J1PH 4MZ3A 1VFMA 1NC2D 2FD6L 1MIEH 4XVTL 1A21A 2HTLD 2EE9A 4WUKH 1Q9LB 1ND0B 4W4OA 5IMKB 2H9GA 1RUKH 3B5TA 3EJJX 4D9RD 4MLIA 3V0WL 3KAAA 5BOZG 3QUZD 5FCUL 4ZSOB 1ADQL 3S9DB 1QVOB 4KUCF 3QWQB 4JM2D 1O7VA 4MLSA 3MGAA 1LK2B 4NDMA 1KELH 4FQIH 3JUZA 1A3LH 3RU8H 4XHJC 3C6LA 3VFTB 1IQWL 4Z7WB 5ITFB 5K9KB 3UO1L 3MRIB 4GSDL 4OIBA 5GGVH 4GG6F 1T21A 2D7PA 3RVWC 4MD0A 1QRKA 4M93C 2VZOA 1PKOA 2VAJA 4OF7A 1A7NL 3HRPA 1WT5A 4KU1A 1Z9LA 2OP4H 2HKHH 2FX9H 3ARGC 4ZSOE 3BIKA 5HPMA 2ZUYA 3LKSB 3QZWA 1GZQA 4ZFGH 3QFJA 5DSCB 4F57H 2Z9TA 4BA8A 4JG1H 3TIDB 3CH1B 5EZOH 3QDAA 1Z6JT 2VLRE 4KZDL 3MBEA 1Z2KA 4Z7WE 4P0DA 1NGXA 3ES6A 6FABL 2DYPB 4WI2A 5BMFL 3I84A 3VWKD 4M6OL 4XCCH 3O6FD 4K2UL 3SKOB 3RDTD 3QDMB 5DJ0A 4NO2A 2C1PA 4M8QB 1K9TA 4ZNEE 4N0FA 3PL6D 3DX6B 1MHPH 3S34L 4L5FL 2E3VA 1F45A 3MZGB 3GSQA 2XACC 4TUOA 1GGBL 3ARVA 5D7IB 1HIMH 1VACB 2EYSA 5DDHA 3OF6A 4LPWA 4Q0XL 1T3FA 1IQDA 1Y18A 3BPLC 4TYUA 3QDME 2R1YB 2R56L 1HEZA 1EVUA 2CDGA 5GISH 3RZWA 2X40A 1YUHA 1BBJA 5C7XL 1E4WL 2XPGB 3MJ9H 4ZTPL 1G7LA 4P4KA 5E2JA 5GSVB 4YEFA 3ROOB 3FQTA 3MRNB 2FX8H 1MCEA 4RWYL 1G84A 3SDAA 3EO9L 4JKPL 2F53D 3TT3H 3P77A 1T89A 5EU6A 5FECB 3BKML 2UYLB 5DUMH 4LSUH 5DGRA 5C6TL 4DTGH 3CVHB 3CMGA 2HLAA 4LLMA 1I85C 4DGVL 1M6OB 4UT7H 4GKNB 5I1AA 5JOFB 5BVJA 3WYRA 4PG2C 2F5AL 5BS0B 2HP4A 4IDJL 5E1AA 4UTAH 4ZUVA 3HZMB 4EN3B 3LQZA 1TFHA 5GS1C 5GS2H 5IW6A 2O5YH 1ZA6A 3EJYC 2IBBA 1ZHKB 3PJSA 3OX8B 3E2HB 3KPRB 1G1YA 4YE4H 1EK3A 3SQOH 4MS8C 5HVHB 3DWTA 3IFLL 4C4KO 3MV7D 4TVPH 4JQVC 4LVOC 3T65A 4BSVA 2BVTA 4H20L 3D3VA 4QF1A 2YD1A 2BSRB 3I85A 4MQXD 5ENWA 4MSWB 1CICD 3KYMA 1EEYA 3W9DB 1WZ1L 5FDWA 3L3IB 1Z5LB 2NNAA 3JWNC 2BHYA 2V9TA 4RGNB 5DJYB 1MY7A 4MAYC 2R1WA 5I8KL 3TYGL 2BHZA 4YDVA 3WFZA 4QKXB 4AEFA 4A2MA 3KPRE 5C2UB 4OJFH 1QSFB 3DECA 2EEDA 4LPVA 2OI9C 4Z7VF 1U2HA 1ROWA 4TSCH 4RDQF 4L9LA 4UNTA 2HFTA 3F6IA 1SY6A 2AXFB 4RMTA 3MNWB 2IEPA 3HA0A 3UTZA 3ESUF 1TMCB 4N8CL 1QLRA 4JFDD 3BFOA 3DX7A 4MA3B 4NOFA 1OSPH 1OPGL 2P48B 4OLXL 1OAQL 3VFWA 4E42A 1NGPL 1AJ7H 3TBWA 5EO0B 3CFDB 2VDPL 2WIIA 4NZTH 4D9RE 5AZ2H 1RJLA 5CJXC 1A02N 2DKUA 1P84K 4FTVB 1IGMH 3A6CH 1TTFA 3R1GH 2ZPKL 5CJBA 3BJ91 4HPOH 3L3GB 1IEHA 4HS3B 3L6FB 3K4AA 5EN2B 4DGYL 3MRKB 4PJXA 3WE6A 4MMZC 4EXPX 3VFMB 2P1YA 3P4NA 3FT4A 4YZFF 2C3WA 4PTUB 1S9VB 5IHUL 5IBTL 3MFFB 3Q6FA 1P2CA 2AK1L 3V4UL 3JTSB 4UQ3A 4H1LB 2FWOA 1S7QB 2IBZX 1KT2B 4GXVH 4M7JH 4R4FL 3BPNB 1ZGLA 5F7DB 4M43H 1CFSA 3OJDA 2RHEA 3PL6B 2P24B 5BW7C 3JWDC 3QUYC 4Z7NE 2VDRH 3JV5A 4UMGA 4JQIH 1XR9B 3MTRA 3FRPG 2GT9B 4HSQA 2DL2A 4P46C 2EYRA 4NZRL 3QXTA 5DK2B 1H3PH 1JJUA 1MH5B 1QA9A 5C07A 4K3DL 3X12B 5I19H 4S1DD 3MACL 4M7LT 3EKCA 3QPXH 4LSRL 1A6AA 5TPWL 1Q94A 1SBSL 1A47A 3ARQA 4XPFH 4TRPL 5EUOB 1AIFB 5C0IA 3TN0D 3RI5F 2VLJB 2QHLA 5IEHA 4YFEA 3KDMA 2WUCH 1F3DH 1A9EA 4I18A 4JHZA 5INDA 4X6BA 1G7PA 1GGCL 4G6AC 3SDCC 4YFDB 4RAUB 1OARH 5FO7B 2OTPA 3BGAA 3MCLH 2DQGH 1NCUA 1OAUL 5IGXH 5BV7L 1LD9B 1RIUL 1DBKL 2AJUH 5LKNA 5E8NB 3G5XB 4OZFB 4NO3A 3I2CH 1YC7A 2EDNA 3WUWB 4PJ5D 5ISZD 1RZ8A 5JHLL 2F53E 1U36A 2IBGA 4YHIB 3QT2A 3LN5B 3MODH 4BUGA 2ZWLT 3IS0X 1OP9A 2Q3ZA 3DVNA 3BUYA 4XBEH 4HKBB 1YNKL 2GTWA 3QAZC 2A9MH 1YMMD 4QHLB 3HZKB 2DQFA 3CPLA 3WFEH 2EYTB 3E0GA 3E2HC 1KCVL 4NWUH 3QFJD 2FRGP 4AYFA 1UCBH 2DKSA 2EKSB 4I4WA 3QQNA 1T1WA 1P4LB 4OLZH 2J8UB 2X4RA 4XZUB 1YEFH 1A0QH 2C3VB 3LQMA 1T03H 5EIQA 1NKRA 4HKJB 4CDHA 4NM8L 3I6GA 3L3DA 1B4JL 1O7SA 2MOVA 3THMH 1HWHB 1YN6B 2P5EB 3B6SB 2KKQA 2VQUA 3BP4A 1JZ5A 2Q6WA 4XMLL 3QUZC 5JNYB 3QULB 2KBGA 3RIAF 3L1OH 3PDOA 4XGZB 5TE6H 1OWWA 1XIWA 3P73B 4EVNA 3RWHA 2J8UE 1OP5K 1N64L 4ETQA 4MQ7A