3IJSA

Structure of s67-27 in complex with tsbp
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsA01
2H26B 5CJOL 2VMFA 3FQWA 3VA6A 4F37F 5CWSA 3FO9A 1YMME 3NA4A 4OZGF 3OX8A 5I1KH 1D6EB 3F65A 4MXWH 4BJLA 1WCBB 3IKCA 3TJEL 3CVIH 5I1DA 1OAQH 4GAFB 4MZ2A 4U4BA 3WXVL 1LO4H 1MVFA 4MD4A 3Q1SL 5FDYA 2QL1A 4PJ8D 4ONFL 4EOWL 3VXSD 1CD8A 3KJ6L 4R9HA 2VISA 3RX8A 4PGCB 1NFIA 3J8F7 4X4YB 2FX9L 1N6QL 5EORH 2IBGA 2VAAB 4ZXBD 5C0IB 4LPWA 2J5LC 3T8XB 3S7GA 3IFPA 4NBZB 5D1ZA 3LQZA 3QNZA 1S7TA 3BO8A 1K4DA 3RY6A 2UZIH 5JTWA 1J0YA 2FJHB 4RRPA 4KKNA 1KIQA 2CGRL 3NOIA 3HA0A 4ZO6A 5E2TH 1EEZA 3MRGB 1LEIA 3GNMH 2R69H 3DSFL 3L3KB 2FYYA 3IETB 3WCYA 3C6LA 1PKOA 2DM2A 3PXJA 3MV8D 5D7KD 5DJ2B 3TA3A 4X4XA 4Z7UA 3VXUB 4H8WC 4KJWC 1X5YA 5HPOA 1WTGT 4X9HA 4WV1B 4NYLA 1OTUD 4K3HA 3IF1B 3K3QA 1T03H 2V2WA 3C2SA 2P8LB 1CFQB 5FYLL 5T5FH 1IFHL 1RJZA 1ZLUK 3PQYD 3VWKC 3X17A 1RZJH 5AWNH 4ERSH 5IVZA 5SX5K 1BLNB 3GRWL 5AZEL 1KYOK 5LGHH 4XMKL 4YDJA 4X8JA 3KPQB 3QJHB 4QRSB 2MCG1 5FO7B 3GMNA 2D0HA 4JY4A 4LOUC 3QZWB 5D2NB 3MLUL 4XAWH 1PD6A 2A1WH 4XWGL 5CEZL 3UPRB 5ISZE 2FX7L 4AY0A 4BH8A 5BZWA 2EYRA 3QUXB 5DMYA 2XXCB 1NMAH 4GRMA 1BF8A 5GGVH 4BZ2H 1YDPB 3KS0J 3QIBA 4LNVA 1YJDH 3QCUL 1EO8L 1BQSA 4P4RA 3RUGB 3SY0B 3JWOL 4GKZA 4K8RL 3T4AB 5K9KA 1IEBA 5FAAA 3HI6H 4F33A 4TNVF 3CVHL 3ZKMC 1P4LB 3RGHA 1VGKA 2OTWB 1FL5A 4EDXB 1QRNE 2L0DA 1KXVC 3S96B 1A6VH 3WFZA 1NCUA 2V7NA 3IJYA 2YWYA 5F21B 3VI3F 1LO2H 3BSZH 3PWPB 5J06A 2GUOB 4NRYA 2Z4QA 1NCCH 3HNSL 5GRUL 3LRSB 2VDMH 4JREB 2HFEB 3AMLA 3QUYC 5T33L 3MLZH 4LPTA 5I30L 1EEYA 5GGTL 1LO5A 2EIBA 2APTA 1OF2A 3VFRB 5EO0A 3MLVL 3QUKB 4G9DA 1D5BB 3U4BH 2F54B 1U8JB 1YNKH 3GMOB 3O45A 4PRBA 3HG1B 5DZLA 4DZBB 4OJFH 2KQMA 5MEOA 4CNIA 2L7JA 2MQ0A 1M7DA 1OY3B 3MBED 1DQDL 4YR6A 4HWUA 1ED3B 4OTXH 4TVPL 1LK2B 2DQEL 3NCJH 4MAUL 1QSED 1F58L 4XCCH 2BY2A 1LHZA 4I3SH 3V4VH 4WNQA 5LBSL 4M6MH 3SDCD 2ICWJ 1VACB 4NO2A 1T04A 5CMAA 3D3VA 2XNAA 4YPGB 4LF3A 1IJ9A 2NX5D 4GRLB 5DI8B 5KSBE 3D0LB 1SM3H 4D0DA 3AB0C 3RX7A 1XF2A 2DQUL 5I1JH 1OGTB 3ALWA 1I8MA 2VXQL 2P44B 2PETA 1BIIA 4X9IA 3TBWB 2JB6A 4U3HA 4J8RB 4HV8A 2ZNXA 4QXTA 4G6FB 1CLZL 2DIAA 1XZ0B 2VL4A 1F4WH 4ZAKA 3UTPE 4HIHB 4ORGA 3H9YA 2J6EA 1OSZB 1A9BB 2JJUA 3BH8B 3SO3B 3QEQD 4FNLH 5FCSH 5GSRA 4PYHA 3IFNH 3LPWA 5DJAB 1PKQE 3KJ4B 1FNEA 4IHOB 4M9OA 4NNYA 4S2SA 5DWUH 5LAXB 5FEBA 1KTDB 5GS2H 5I1HL 3HMXA 1O7VA 3P4NB 4YQXH 1QOKA 3BQUD 3OR7A 3PWVA 3ARXA 3GK8H 2VTFA 5DC4B 3WFHB 3FB6A 4J6RL 3P2TA 3RJDA 5KSUA 4OFKA 5L2KE 4ZS6D 1NSNH 4C54A 5IQ9B 1R3IH 4KUZH 4LAQL 4RSVA 4DOHB 4U1LA 1F02I 1YEJL 4HWEH 1B2WL 4JFYB 4OCYL 2SEBA 5HY9B 5JPNB 3K8MA 3PGCB 2E7CA 5D5MA 3T0VA 3ROLB 1CR9H 1INQA 4G8FA 2C4XA 4R4ND 4UAOB 1HHGA 1L7TH 3RX5A 2GFBB 1AHWA 4NO0B 4ZSOE 2NXZC 1I85A 3S5LB 5BS0D 5JHLL 4HK0B 1LDPH 3T0BA 4LGRB 3HRZA 4P5KA 3CDCA 4MCZB 4TNWF 3VH8B 1OLLA 1Y0LA 4PRID 4LCCA 4EKXA 4MJ2A 1TJHL 4AZ8A 2NXZD 4B41A 4XXCC 3VFVA 4KI5F 2HP4A 2VLKE 1H3UA 1EHAA 4PTUA 1A1OB 2DLIA 4WHCA 5I2IB 4MA1B 3MV7A 2J8UF 3FQNB 2FNBA 2X4NB 3PP3K 2G5BB 3DGCR 3VXNA 2V5TA 1KTLB 5GGSB 4Z8FH 3MBXL 2YSSA 4HPOH 4P46C 5JA8B 2HMIC 1DBAH 3SHSA 3ARPA 2AK1L 4KRPB 3ZE0F 1PFCA 4W6WB 1R3JA 3WO4C 5J11C 5LKNA 5DRZA 2X4OB 1FZKB 5E8DL 5FKPA 4NQDE 1WZ1L 1IGYB 5K59F 5A1AA 4OCMC 4PJCF 4K94L 3ZO0A 3EGSA 5TF1L 3QXTA 1ZHBB 1FCGA 1IGTA 4RFNB 1ZTXL 5DUPH 2JELL 1QFWL 5E4IA 4GMTL 2I07A 5J1SC 4WI9A 3LKPB 1SJHA 4E5XA 3JV5A 3QUML 4YFDB 4C4KT 3X3FL 2DKSA 3UTZA 1I1CA 1SEQH 2WWMC 4K23L 3DURB 1KLGA 1ZHKB 4KZEH 1DLHB 1JWUB 4LRNH 4N0UE 4R4BB 1EAPB 2WINA 1CGUA 4Q9BA 1I1AA 1UADC 2WWMD 1MIML 1DLFL 1TPXB 4HIXH 2J4WH 4ZQKB 1YEIH 3CFDA 2EH7L 3ARFA 5KANG 4ISVA 3IJHB 4W6YB 4WCYH 4X4MA 4G8GA 1A14H 4L4TD 4QRQA 1UWGH 2X40A 1J5OL 5EU7C 5ACMA 5H2BB 3O3BB 4IRJC 1LO3L 5D71H 3F58H 3H3PL 3DXAB 4EI6A 3X11A 5SWZA 5C2BL 2DWEA 5IOPA 3FKUS 1FO0L 4LVNB 1SEBA 2B2XH 4JANA 2KZ1B 3BP6A 5T1LD 4NP4L 4MDIA 4JFQA 4MJ4A 1L0YA 1JL8A 2DOCA 4LVOB 4EI5B 1CLOL 4XPAH 1DVFA 5FYLD 3OAUH 3KPRA 2G5RA 5CFHA 3UDWA 3QG7H 4XNQA 5DYOA 3MRRA 5SWSD 1RUPL 2XWTB 2CLRA 5GJTH 3ET9F 3TZVB 3P73B 1MCSA 4NKIH 1HXMA 4I4WB 4NWTL 1HYSD 4XBPA 4PGDA 3FT2B 4LLWB 4JVUA 4WFFD 1L0XA 3VRIA 1KJMB 2IH1A 3NTCH 5FGSA 2V17H 1QVOB 1DN0B 2ATKA 1NC2B 3OKNA 4BZ1H 2A6JB 2JIXD 3M17A 5DRXA 5FHAH 1VFBA 5CEZD 1XFPA 1N26A 1IC5L 5JDSA 3EJZD 4MJ6A 4J4PD 4WEBL 5JW5B 4RX4A 2CKBH 2K7PA 2VLMD 3JV0A 1UM5L 3C08H 1F2XK 3O4LA 4RISL 4OBRA 3QA3B 1IT9H 5E8OB 4PS4L 3KPNA 3QEGH 1QBMH 2BVOB 4F57L 5HHOB 1F6AA 4P48A 4X6CF 3LKQA 4HBQA 5F6HI 4JN2B 5IHUH 2R4SH 4M3JA 3V0VA 5I1GL 1BWMA 4PB0L 1G7LB 1RJYA 5C09B 1NUFA 4L5FH 1DCLA 5DJ6A 1XF3B 3ZDZF 1CE6B 5D1ZC 2AJ3A 1DANT 1UACH 2YPVH 5I76B 2EDLA 4HZLA 3RY6C 3UYRL 5JLZA 1UB5B 1Q9WA 5TDPB 3QULB 1G9NH 4M1CD 1C7TA 1ZVYA 1UB6A 4YE4L 2R4RL 4CBPA 4RGMB 4QYOA 2FO4A 4YHOL 2C1OA 1XF5A 2VITB 1HKLH 5TFSL 3C6LC 3SDDD 3TCLB 3ULVL 4UOJA 3LQAH 3OKMB 1HQ4B 1CFNB 1JGEA 1IC1A 3OMZA 3TA3C 4P2QB 3MZTA 5KVGH 5HYJB 4K3DL 1DQTA 2GAZA 3B9DA 3F12A 5JNYA 3GO1H 5JR1H 1HH9A 3B5GA 4MCYB 4AH2A 5C0DA 2BSRB 5EDXA 2IALA 2RCSL 3FQRA 2J8OA 2OI9B 5DLMH 4H26B 4F2MA 2M8XA 4PPTA 5EH1A 2CIKB 4ZUWA 4G8IB 5MI0B 4M02A 5D1QA 5LCVL 2VXTH 2HKFL 2WBJB 3QUZB 5KN5A 5MENA 2MHAB 4XPBL 2H32A 4QOKE 5AUMA 3DRQB 3KS0H 3QEHA 1ACZA 4TVPD 4WO4D 2YPLB 3E3QE 3RWIB 3AC0A 4NUGH 3GSVA 2YZ1A 4FQJH 4XCYA 1N0XH 5JHDB 1FC1A 4WUUA 1J8HA 2VKWA 2GEEA 4LCIH 1DANU 1E4WH 1M4KA 3RVUD 2PW2B 4XBEL 1HOCA 5JW4Q 1AKJA 1OCWH 3HR6A 3PHQA 4PD4J 3RHWF 2CDGA 4QHUB 5LWYH 1ZT4B 3DVNB 4Y4FA 1KBGL 1GCFA 2DMKA 3PHOA 3SN6N 1AGEA 3QIBC 4HJ0C 4LKXB 4KZDL 1MJJA 2HKHL 2OS7A 2EDNA 5EO1B 1EFXB 3K1KC 5BRZD 3LZFL 4U6HB 1T2QH 4ZDHB 3U9UB 2P8PA 1VFMA 2AKRA 2R1YA 1LK3L 3OJDB 4JPIA 4GAYA 4JFPB 3M07A 2XZZA 3QIBD 2OL3B 5JMRA 5GZOD 4HS6B 4WIQA 4X99B 1MI5D 3DI2B 4P4KB 3SPVB 4LPXA 3DX8A 2JJSC 2F74B 4M7KL 1RU9H 5CS7A 1XCTB 3C2AH 1RK0A 3QWRA 2YC1A 4JM2B 4OV5A 3IU3B 4I77H 3WXWH 3KYKH 3RL2B 2FSEB 4NQVB 4TSBH 1VFAA 2XZQH 2DTMH 4GAGL 2X42A 5AYUL 2HN7B 35C8L 5TH2B 2R0LH 3VFPB 5FDWA 1MJUH 3RDTD 1GGYA 1MLCB 3RTQA 3C5JA 4G9FB 4I2XA 3HUJF 1PZUB 4KK8C 3LSOA 1N5AA 4L3ED 1NAMA 4EUPH 1TMCB 5CZKA 4QF1A 1AGCA 2HLAB 5F89A 3QDAA 4GBXD 4BUGA 4EDWL 3HPLA 1UWXK 3Q6GL 1KB9J 1Z3GL 4G80B 5EZJA 4A6YH 1FNSH 2EDYA 4WW1B 4AG4H 4O02L 1AIFA 4JPVL 2ED9A 2AEQH 3I75A 4WUKL 5KVDH 4YDIH 3DX7B 3T2QA 2B20A 4KVNH 5J56B 1KJ2H 5HYSG 2W59A 2VDOL 1XGYL 2I9LB 3GHBH 3FO2A 4Y2DD 4L3CA 3GMPA 3HPJB 3E2HC 4WW2A 3ZE2E 5DD6B 1YEEH 4X7CC 2BNRB 1NGWB 4XH2B 4P59L 1I3GH 3DSNA 1Z9SA 5E6ID 4W70A 3H9HB 4FTVA 4CAGA 2D4DA 4X7SH 1NDMA 2N1KA 4KKLC 1GGBH 4PRHB 4PV8B 4XNXL 4GXVH 3PIQA 2IJ0C 4S0SD 4K94C 4HEPG 1FZMB 4WGVB 4ENED 2YWZA 5JXAL 3SBWA 3QG6A 3QHZH 2W9EH 1JCKA 3C8DA 4V1DE 4EQ2A 3DIFB 3L5WA 3JUZA 4M5YH 2B39A 4ZAKC 4YUEH 4FHBD 2XTJB 4ODUA 1O0VA 1BD2E 2YBRB 5I1AB 1OGAE 5CILL 3V0AC 4PRNB 3F6LA 4UINH 4G3YH 4RA0C 4HHAB 4JZNA 3P0YH 4UDTB 4ZAKD 3TVMD 4JFDB 1MPAH 2ORBL 4DN3L 3V6ZA 5EN2B 1CFSB 5CSBA 3ZDYE 4MA8L 4N0YH 2NXYC 2Y5EA 3PWUA 4QHLA 4PR5A 5TDOA 4RGNB 2V7HA 3NH7L 1UJTA 5D7LB 3NIDE 1T1ZA 4ZODA 1KB5H 3TN0B 4IS6B 4P2OD 4X80H 4KRNA 4R96B 4U05A 1F4AA 2Z93B 1EXUB 3HE6C 4K3GA 5C07A 1TQCC 5GS0C 3VXPA 4ODWA 3MLYL 3D2UA 4XPTH 3C09B 1CD9B 3FQXA 1CFVH 2O5ZL 4NCC2 4TQEL 3VXTB 3UP1A 1NAML 1AHWC 5I74C 4M8QB 1I85C 4YHNA 3WNPA 2X9WA 3B3IB 4PJ8B 2Q76A 1LWRA 1MCEA 1I9JL 1ADQH 3VXOA 1MCOL 4NCDA 4LCCC 2HLFC 4Z77B 2X05A 5F88A 1M05B 3BKCL 4JDTL 2FB4L 3DETD 3NCYS 4ZXBB 4ZFZA 5EBLB 2ESVA 4H25B 4XAKD 5CIPH 5E56A 5EIVA 5KZCB 4LIQL 1D6VL 2P8MB 1S7SB 2VERN 2E27H 2EIZB 1QP1A 3MMEA 3SDXF 3ARDD 2RFXB 1GZQA 2XWBA 1ZHNA 4F3FB 3LS5H 2J5LB 4N8CH 2XWJB 2DBLH 1B3JA 1U3YA 1OD9A 2NLJA 4YLQT 4UUJA 1IKFH 4RDQF 4G6MH 1GPOH 2W0FA 3DUUA 1RZ8B 3BKJL 5EC2A 3FOLB 2UUDH 4WI2A 1T6VN 1I8LA 5LQBL 1ZHLA 4YNYB 3LY6A 3MV8B 4R26L 5IM7A 4TRPL 1BBJB 1HHIA 1CDJA 4RZCA 2PNDA 3VFWA 4ZFGL 3WHE0 1S7VA 1KCRL 3DGGA 5JUEH 5ABDE 1DBKH 1MCWM 5GGQL 5DK0B 2VDKH 1FVCB 1EUTA 2DIJA 3ROOA 3RAJH 4AIXA 4OF6A 3RIFK 3WFBL 3I2CL 4R2GD 2W60B 2NY4D 4U6VL 4M61A 5TE4L 2HWZL 2O5YL 2NY5H 1EEUA 2ZCKH 3VWKB 1X5JA 3E6HA 4KGLA 3KLHC 4L8BB 4U2ZA 4WEUD 4X0KA 4D3CL 1EVTC 2LTQC 5GIRA 3KYNA 4FZEL 5T1KA 4IM8A 3VFUB 2C3XA 3IFLH 3F7VB 2JE8A 1E27B 2Q7YA 1QFPA 1A22B 3O2WL 4GW1A 3LKNA 4KI1A 5K9JH 1N5YL 1I1AD 1BM3L 5JPMA 4GMSH 4MZ3A 1MRFH 3MLRL 3OXRA 3ARFD 2OLDA 3JTTB 3UTTB 1P6FA 4AT6B 4Y1AD 4Z0BH 3QH3B 5D93C 3ULVD 1TZHA 2CK2A 2EO9A 4RWHA 2RB8A 4G8GD 2ITDA 5KS9E 4HXAL 2YEZA 2X6MA 1JHTA 4ALAH 1SYSA 2MOVA 1NANH 1G6RH 3OPZL 5EU6A 1DVFC 5HHPB 3BWAA 1IE5A 3SGDI 1NEZG 1FH5H 1FDLL 3UDWC 5SWZD 3LKRB 4KAQH 4YO0B 3RL1B 3QDJE 4YGVA 1C5BH 4NN7C 3L9RA 1IL1B 1WFUA 3BGFB 3BX7C 1JRHI 1IGCH 4JFXA 2CLZB 4MMXC 1K6QL 4LCWA 4HC1L 5IMKA 4K3JH 4K7FB 3FRUB 5HDQH 5D8JL 3CSBA 2P42B 4FQLH 5MERA 1MEXH 2YMXL 3Q6FA 5F3BA 5GGRY 1MCPL 1DEDA 2EXYC 3UAJC 3CLEH 5T5NG 4I1NB 4MNGE 4HBCH 1J0JA 1A4JB 4FFYL 1F45A 1JNLH 3ZKNC 3D85B 1Q1JL 3EYQC 1BVLB 3CZJA 4F7TB 4PLJD 4AM0A 4J2XA 5I1CL 5C0FA 2F5AL 3G6AA 3OKOB 3OJMB 4G6KL 3ULSA 1MELA 5D7IF 5MEQA 5D6DA 4BH7B 3EYQD 3O3EA 1QLFA 4IRZH 3VU2A 3SDCB 4PY8I 3G08A 2R2EA 5IB5B 3W11D 3W9EA 4FFWC 3B2UC 5FF6A 4WHYG 1ITCA 1OSPH 1U92B 2WP3O 1OQOA 3P30L 3Q5TA 3BIAX 3EO1B 4Z18A 5D2LF 4UV4H 4M7LL 1J7VR 3O0RL 3RVTD 5INCA 4MD0B 5C0GA 2ARJA 2OX5A 3BD4A 2ZJSL 2F8XC 4PLKC 1QSVA 3MJ9A 4MNQD 3AB0B 3LMJH 5IBUG 1Q38A 3MRMA 1S7WB 4B53A 3I3EA 4DJMA 4PJAF 2VZTA 5IFJA 4OV6F 4XXDB 4PGEB 3RU8H 4ZUSA 3O3AA 3MQIA 4PJXB 5GGRB 1FFOB 3TBSA 3EOTL 3QCTL 3S36H 4OCXL 1AO7E 1CDBA 4ETQA 3EO9H 3GBNL 2HJLA 3S34L 3H3BC 3W2DH 2BK8A 3D0VB 5J89A 3ZKSD 5D1QC 1ZGLP 4PJDB 1H3GA 5JW3H 3TBTB 3VFTB 5JZ7D 1GH7A 2MJWA 3PHSA 4RWYH 3RZCA 2VXUH 3B9EA 1TCRB 1S9KC 1A3LL 1JNHA 3KPLA 4F7CA 2OSLA 1X6NA 3WN5B 3RWDA 1G1YA 3C6SA 4G7VL 2XN9E 1GGUA 4LSPH 3D25A 4ZO8A 3VDCA 4OIBA 3U36B 5DZNA 4M7JH 1DUZA 5D4QA 2BNQE 1NCWL 2FIKA 4GG6B 5IHZB 3OF6D 3EDEA 1T7YA 4Y4FC 5ICXB 1TVHB 5DJXB 1RUKH 1N6VA 3R0MA 3G5VB 1WF5A 1INDL 5DK2B 1W0VA 3CSPA 4PRIB 1N4XH 3QFJE 1RZIB 2IAMA 2HTKD 2NXZB 3QRGH 4Y8AA 3P9WB 4OLVL 2AQ2A 1S7UA 4MX7B 3NBNA 4PB9H 2D2OA 5A3ID 5C0CD 3VFOA 4NIKB 3FT3A 3QHFL 4PGJA 3BI9X 1WBYB 5DRNB 3FO1B 4KV5E 1O7SA 3V52L 3KPSB 4NPYA 2Z31A 3TO2B 1NC4D 1FYTA 5E08H 1YZZA 2R56L 4GUPA 4LDLB 2CUMA 2AV1B 3SDAD 1Q8MA 12E8H 4M00A 3SE9L 2UWEF 1OAZH 1WFTA 4YHPB 3RTQC 3EZJB 1PEWA 2A77H 5DD0H 1UXWA 4A2MA 4P46B 2GTZB 5ESQA 4P2RE 5C86A 5HHXH 1XR9B 5ANMB 1LP9A 1MH5A 2YOCA 4XP1L 1AD9A 2C3WA 4Z7WE 3BMVA 4PG2A 2VL5A 4P5TA 5EUOA 2P5WD 6CGTA 3WO4B 3MJ9L 4KJYA 5J11B 4KKCC 2X89A 2UVFA 4RFOL 4IOFC 2IH3B 1QBAA 1MWAA 3BP7B 2M26A 3QDGA 5I66A 1Q72H 3U82B 5BO1H 1MCJA 2XKNB 5EIIA 1K4CB 4FZ8L 1BQLH 3RWFB 3U9PL 1A0QL 5DEFB 1ZAGA 1S5HB 3EFDL 2NY2C 4WW2C 3K4AA 5CHNB 2AI0H 1DBBL 4KK6D 4QHMB 2LVEA 4XNYL 1R5IB 3MROB 2RGSA 5F7UA 2X2YA 4UV7H 4YEEA 5FA4B 2Y07L 1WFOA 2GJ6A 3ZT6A 1KXQE 1KENH 4OUUA 3U0TB 4KY1H 5DT1H 2EEBA 2CD0A 2VZVA 1WZMA 4R7DA 1BIHA 4QNPE 3BRFA 3SBWC 9CGTA 4IRJB 5I71C 2Y9RT 2D7TL 4RFEB 4U6YB 2EZ0D 1QYGL 4PJGF 3UC0H 1IZKA 3GMQB 3V0WH 1NGXB 3JWDL 1MQ8A 5C2UB 2W9DH 4PJ5A 3I6GB 4H1LG 3HKFA 2AK4A 2H2PC 1FVDB 2PXYD 4KC3B 2FDBP 1BVKA 2YZ8A 4ODVH 5CD3A 3VFGH 2NY7H 4C56A 3A67H 4L8CB 1FORH 3IS0X 3CFCL 1PBYA 1FCCA 5BVJA 5C7XL 2AEPH 4ELME 4KQ4H 1KLUB 1RJLA 3OKEA 1AE6H 4C58B 1FJ1B 3MYZA 1A3RH 3AAZB 1M71A 1KN2L 2ZWLT 3PG2A 4LLYA 5CD5D 3VFNB 5DVNA 2RQ8A 1XR8B 1XGUA 5E8EB 3ARBD 4WHTA 3RWCA 5D7SH 2K1MA 1CIDA 4Z7OE 3FQWB 2ZG3A 3FO9B 5CWSB 3OX8B 1AR1C 4PJFE 5EULV 4BUHA 2YK1L 3IKCB 3CXDL 3HNVH 3O6KL 1YYLL 5I1DB 2BJML 4DGVL 2WBWB 1RUMH 2YN5A 4MD4B 5IMOA 3MTRA 4RAHA 4HCRH 3QDMA 2WIMA 3QP3A 4R3SA 3TO4A 3UTQA 4M1DH 2VISB 1NFIB 2X4RA 3HZYA 4Z7NF 4H0GA 5FGCB 3VXMA 1U8QA 3AS1A 2KPNA 2F8OA 1A02N 2UZYB 3IFPB 5D1ZB 3QNZB 5F9WC 1S7TB 3BO8B 4HUNB 1K4DB 1JNNL 3N85L 4FQ2L 3TT3L 1ZLWK 3MGOA 4ZTPH 1FN4A 1I8LC 1KIQB 3ZE1E 3B5TA 2IGFL 2N4IA 3DOSA 5F44A 1EEZB 1LEIB 3H9SD 4KK9C 2FYYB 1GC1C 5D70L 3LDBC 3C6LB 1UCBL 43C9A 3R8QA 1V8HA 5HYIA 5EOTA 3TA3B 4X4XB 4Z7UB 2PTTA 4NQEA 1HILA 4YXHH 1TVDA 3ZYZA 2NY1C 4NYLB 1LEGA 4WHDA 3O4OC 1QZ1A 2VZ1A 3CFEA 2V2WB 3VD5A 1XEDA 4F9LA 4GXUM 2F5BL 1RJZB 3PP4H 3VXUE 2EDQA 1NLDH 4AL8L 1RK1A 4APQD 4QO1A 5IVZB 1MJ8H 4HWBH 4HPYL 2HT3C 1U36A 4YDJB 4X8JB 3L5XL 4S1QH 5IQ7L 3I6LD 1YPZF 3C60A 3GMNB 4JY4B 4KQ3H 3V6BR 3SDYH 5T1KD 3MRCA 2Z8VC 1I4FA 4BH8B 4EN3D 1JZ8A 1V5JA 5BZWB 1J8KA 2EYRB 4GRMB 4HS8H 3HI5H 1DBMH 1JP5A 4QTIH 5ITFA 3STLA 4OFDA 4PLOB 3NA9H 1C1EH 3QIBB 3KYOA 4U6XA 1GHFL 5D2NE 3P4LA 2PKDA 2W38A 4G6AD 4P4RB 4WRLA 1P69B 5CSZA 3MRNA 2EDDA 4GKZB 1X5FA 2KKQA 5K9KB 1IM9A 1IEBB 5E94A 3WO3B 3MA9L 1JGVL 3FFDA 4F33B 3L5IA 3LEVH 3HNTL 5IIEA 1VGKB 1FL5B 1TLKA 2ADIA 1JZ4A 3RUGE 3QXVA 5EIQA 3P11H 3H42L 1SHMA 1NMBH 2V7NB 3SJVD 3IJYB 1J1OH 4L4VD 2WP3T 3BW9A 3VRJA 4NRYB 4J3XA 1AY1L 2Z4QB 3T0EA 5I15L 3MCLL 2DQTL 4K9EH 4RGOH 5JDJA 3OBAA 5DR5L 2E6PA 1EEYB 2IAND 3KXFD 1LO5B 4HWZA 2OZ4H 2IPTL 5IESH 4O51A 2JCCF 3PWPE 1U58A 1XGTA 4QRTA 1OF2B 5EO0B 1CXFA 5ALBL 3FONA 2XI9A 4G9DB 3C87A 1NBVL 4L9DA 2CR3A 3MJ7A 2XOTA 3O45B 4PRBB 4OLXH 1CDYA 4NSKA 4JKKA 4YHKH 2BERA 2Q8AH 5MEOB 4CNIB 1UCTA 2V9QA 1M7DB 1OP5H 2F54E 5D6DC 1GVIA 3IXAA 3HG1E 1XIWD 4YR6B 3PWLA 5CUSH 4Z7VA 3NCMA 4ZOBA 3RVWD 1VEOA 1MCKA 5KSAA 4NHCL 5D9SA 3E2HB 1A7RL 1QLEH 1VERA 3QAZB 4WNQB 4D9RE 2PW1A 3OKLA 4NO2B 1T04B 5CMAB 3D3VB 3UO1L 2XNAB 2NY3D 4LF3B 1UZ6E 4F7EA 4NT6A 3CSYA 4Y5VA 4B5EA 5F9OH 4JO3H 4D0DB 4GW4A 4YDKH 1XF2B 3S88H 2N7AA 1AP2A 4U1HA 5IVOA 1I8MB 4OFPA 2QBWA 4OZIA 2AJSH 1BIIB 1KJ3L 4RNRA 2WUBL 2JB6B 5DQJA 4HV8B 4QXTB 3DTXA 3BKYL 5A2LH 1RPQA 1Y6NR 4OLYL 3RGVD 1OARH 3P0VH 5L88H 2OJEA 4MVBC 4ZAKB 2MPAL 4ORGB 1A1MA 5EG6C 4NRXA 1A8JH 4X6DA 4XC1L 3RFZC 5DD3H 5GSRB 2HFGH 2F53A 1FNEB 4NNYB 4S2SB 1A7PL 4MVBD 4TVSa 3RZCC 3O8XC 3NGBC 1CT8A 1PSKH 3BPNC 1ORQA 3OR7B 2WM0A 3PWVB 2NXYB 3I9GH 4RBPK 4JFEA 3FB6B 1DSFL 2LU3A 5KSUB 3RZCD 4FRWA 1QFOA 1AD0A 3HZVA 1T1YA 4NWUL 5IT2L 1I7UA 3MV9D 3TJEH 4AENA 1OTSC 1N0LA 4MHHG 3WXVH 4U1LB 1H8NA 5T3ZL 2H9GA 3Q1SH 1MREL 1TQCB 2SEBB 2ZUYA 2W91A 4KHXL 4ONFH 5D5MB 1L6XA 1CS6A 4EOWH 5DJZA 3WIHA 3KJ6H 1OTSD 1MCFA 2CR6A 1PLGL 4G8FB 2PR4L 5E2JA 1HHGB 2FX9H 4P2YA 1N6QH 4YC2C 3JWDC 5EOQL 1P6AB 2IAMC 4DOHE 3ULUE 1AHWB 5I74B 1YNTA 1LE9A 1ZEAH 4PGBA 5FYKH 4FQIL 2BC4A 3HRZB 4XHQA 4P5KB 2HA1A 1JF5A 1Y0LB 4NKOA 2Y06L 4UI2A 4LCCB 2CGRH 2IAMD 1CLYL 3IDUA 4NC0B 2Z0BA 3VFVB 5AYQA 4OD1L 1WAAA 3JTSA 4PTUB 3DSFH 1HCVA 2Z31C 1HH6A 4IDLA 3MV7B 2OCFD 5FGBC 4FQQA 3ZMRA 1XGPA 3VXNB 5FHBL 1S9YA 2D7OA 4IEFB 3ARVA 3ULVF 1BZ9A 2YSSB 3NFPA 1I8IA 3EYSL 3BD5A 3IDGA 5FYLH 3VGBA 1IFHH 4S11A 5JA9A 1CDCA 4PG2C 5JOPE 1G7IA 4P5TC 5IEHA 1P5VA 1P7KA 2MKLC 1R3JB 2GSIA 3JUYA 5DRZB 1T5XA 4PRPD 5ICYA 3OZ9L 4LAJH 4P99A 4X83A 3GRWH 4HLZH 3WFDL 5L7XH 3ZTJH 4XMKH 5C6TL 4YXLL 3EGSB 1IGTB 1D9KA 4P5TD 1NLBL 3O2VL 2I07B 1F90L 3FT4A 1SJHB 4E5XB 3BE1L 4FQHA 4DK6A 1OTTD 3MLUH 2D7NA 4XVJL 3UTZB 4XWGH 5CEZH 2FX7H 1GOFA 1KLGB 2YUXA 3WDJA 4LDOB 3AROA 4JQXA 1A7NL 4P9HC 1CVRA 2WINB 1I1AB 2LTQB 3HFML 1WC7A 4OI8A 1MHEA 3OB8A 3QCUH 2VZOA 1EO8H 2ICES 3OJVC 1AGDA 5GS3A 3CFDB 3ARFB 4AEHL 3JWOH 4ISVB 3DYMA 5CAYB 4KI5E 1W2KT 4G8GB 3CVHH 1IM3A 4QRQB 2H2SC 1HIML 4TSCL 4BQ8A 4E41A 5D93B 3DUHA 4WU5A 5DJ0A 3ZYJA 2OR7A 1K85A 4EI6B 3X11B 3WIHL 5SWZB 2VOTA 2DWEB 3RVXD 5IOPB 1EHXA 1SEBB 4OKVA 4JANB 2RBLA 1KGCE 3BP6B 4OZGA 2VXVL 3L3OA 4MDIB 4G43A 4JFQB 2CMRL 3HNSH 1EO7A 5SX4I 1DVFB 4XVTH 5GRUH 4X5WA 5CCKL 2CKBA 4ODTL 3KPRB 5T33H 4XNQB 5DYOB 3ZE0E 5I30H 5GGTH 3MRRB 3DXAE 4ZNEE 3GGWA 4Z95L 4OQTA 2CLRB 4XNUL 4NN7B 1X5ZA 4D0BA 3MLVH 1HXMB 2YA2A 4XBPB 4QTHA 4PGDB 1GGIL 1HHJA 3DARA 2ICEA 3VRIB 3NIFE 4JFFA 2XICA 2IH1B 4WWKC 3N1GC 3CD4A 2ATKB 3OKNB 4RIRA 4QRRA 4I5BA 4U49A 3TH4T 5IFAL 3M17B 2VZUA 2EDXA 5DRXB 2DKMA 1VFBB 5JDSB 1RMFL 4MJ6B 5DUML 5E7FA 2B0SL 3D39A 1DQDH 2CJUL 3BKML 3CMOL 1S5IL 4TVPH 4S1DD 2DQEH 15C8L 3KPOA 3O4LB 4MAUH 1S9XA 1F58H 2ITCA 3KPNB 3G5ZA 4GAJL 3FFCA 5LBSH 3GEWB 1F6AB 3U46A 3TO4C 3LKQB 4U0RC 2DN7A 3V0VB 5A16A 1RIUL 4O58L 1RJYB 2DQUH 2VXQH 5DJ6B 4C83A 5F9JA 5HHOE 1KLFA 2AJ3B 1HI6A 2VLJA 3H2WA 4HZLB 3X14A 5JLZB 2EYSA 3LH2L 1UQSA 1CLZH 3VXMD 4J3UA 1CK0L 1A9EA 1Q9WB 1T2XA 1UB6B 1LDSA 1RZJC 5C09E 2CDEA 3B6SA 3KDMA 3MRHA 3RPIA 4QYOB 4MJID 4XPGL 2FO4B 3NCBB 2C1OB 1XF5B 4NJ9L 1FFPA 3WS6A 4NBXB 1CYGA 1H3VA 3IXTA 1MJ7L 5I1HH 1MIEL 4P57A 4GLRH 1A6TA 5GRXG 2VIRA 1JGEB 3M8OL 1JZ6A 5JIKA 3B8YA 2NY0D 2GAZB 3O41A 5JNYB 3F12B 5MHSD 4J6RH 1HH9B 5HYQA 3MLSL 4AH2B 5C0DB 2WW8A 2IALB 3FQRB 4X9BA 4F2MB 4CN6A 5F7HA 5IW6A 2X4QA 4F9LC 3GSRA 4ZUWB 2AXHA 5D1QB 1YJDC 2XY2A 1YEJH 3O6LL 4P2QE 4OCYH 5KN5B 5MENB 5ALCL 1NGQL 5HYJE 2H32B 4JQIL 4KTEL 5AUMB 4L4JA 3QEHB 4OGAC 2FECL 5C0JA 1U3HA 3GSVB 4XCYB 4OQTL 5ETUA 4WUUB 1X5LA 1J8HB 3WNNA 3C60C 2QEJA 4LQ1A 5JHLH 4JY5L 5IB3A 4JZOA 1HOCB 1AKJB 3QZWG 4JRXD 1TENA 3M1BA 3ZSSA 2YPLE 3PHQB 1G7HA 2PYEA 2CDGB 1TJHH 3ZDZE 4Y4FB 1ODAA 4I0CC 5JHDE 3PHOB 2P5EA 1AGEB 4MA7L 1MJJB 1QTYT 1YC8A 2DKUA 5JMOC 4RCAA 5ICZA 2P8PB 2R1YB 2AKRB 5K9QG 4NNXA 4JPIB 1YY8A 4GAYB 4LEXL 4HKJA 1JI1A 2WLYA 4EUPA 3WBDA 5GS1A 1LQSR 3WFEL 3H6JA 2E9BA 4FMKA 3DX8B 2OXHA 1K8DA 1JPGA 2FEDD 3MUJA 2XYCA 4EXPX 2AK1H 1RK0B 5DA4A 2YC1B 4A6YA 4OV5B 1JWMA 4NDMA 3QWOA 2ICWA 4KROC 4MAYD 5ESVA 1VFAB 3QNYA 1MCCA 1MFAL 3BP5A 5E8DH 2ADGA 2FLRT 3RKDC 1WZ1H 1KEGL 4OLUL 4NRZA 5FDWB 3W0WA 4K94H 3DX6A 2CDFA 5TF1H 1KJ2A 3RTQB 3C5JB 4I2XB 1ZTXH 2B4CL 3LSOB 1HN1A 2JELH 1QFWH 1N5AB 4GMTH 4M1GL 5T3ZD 1NAMB 3T0ED 1W0WA 1WZKA 3ZHDA 4QF1B 1AGCB 3QUMH 5ADPL 3X3FH 2NCMA 2DYPA 1JF6A 5F89B 4K23H 4KKBC 3HPLB 1GOGA 3B9KD 4O2EA 4G9FE 2XTLA 5EZJB 5F7MC 2A0LC 1CFBA 4LSDA 3T0WA 2DI8A 2W07A 3N0PB 1MIMH 1AIFB 1MCLA 1DLFH 3GSNL 3QIWA 3I75B 4KKBD 2EH7H 4NO5A 5B4MD 1HEZA 1TETH 1ZLVH 3S35L 3G9VA 2A6IA 1KXTB 4I3RL 2AS5M 1G0YR 4QT5B 3FO2B 2EECA 4GOSA 5KSAC 2HJKA 4L3CB 3GMPB 1J5OH 2NY2B 4WW2B 4AK1A 1LO3H 2C9AA 5C0AD 3H3PH 5C2BH 1FO0H 3DYOA 3V5HA 2XQBL 4NP4H 4FTVB 4S0TD 4Y5VC 1NDMB 4CU8A 3BIKA 4R4FL 1CLOH 3U2SA 3VWJA 1S9VA 5IF0B 5I8CA 3PIQB 4NC1E 1YMMD 1RUPH 1A4KA 3Q3GA 5BXFA 3DV6A 2BNRE 1KB5A 1OAYL 1CXEA 3QG6B 4NWTH 5I71B 3L5WB 4PRHE 4ODUB 1X5KA 1U8IA 3KWWA 1AXTL 5T1DL 5ID0A 2IFGA 3JBG7 4NM4L 4YZFF 1T0MA 2BVUA 1A7QL 4ZUTA 1JVKA 4JZNB 4PJHA 3LVEA 3EDKA 3RNQA 3V6ZB 1IC5H 2XTJE 2D9QB 3RY4A 4WEBH 3PWUB 4QHLB 5IFHL 4PR5B 5TDOB 4L3AA 1ADQA 4BFIA 2XXMB 2V7HB 5D1XA 1UM5H 1T89A 2XKSA 4RISH 1ACYL 1T1ZB 3UBXA 3VXRA 4JFDE 4ZPTA 4PS4H 5CIPA 4F9PC 1M1SA 4F57H 1XT5A 2J8UA 4XWOC 5I0ZA 4S1SL 3HE7D 5C07B 3VXPB 2PO6D 3BD3A 4ODWB 3D2UB 4RGNE 1MQKL 5EBGA 4M5ZL 3FQXB 3MCG1 3EJYD 5D7LE 4LHUG 5I1GH 2EIEA 4XWOD 2C7UA 1NCDL 5HDBE 4YHNB 3WV0A 1LEKA 2Q76B 5LVEA 3S5LG 3UYRH 5FCUL 3VXOB 3VGEA 1CXHA 3F7PC 4AQOA 4MHHI 2AQ1A 5F88B 3VH8G 5DHVH 2YD9A 4PJCA 4YE4H 2R4RH 1DJSA 5KAQF 4ZFZB 2ESVB 2EDWA 4YHYC 2VC2L 1G7PA 4DN4L 3H9ZA 4YHOH 2MMXA 3ECBA 1X5IA 5TFSH 3MMEB 3NN8A 1K2DA 1QHOA 1GZQB 2XWBB 3ULVH 1ZHNB 2WANA 2XA3A 2NNAA 1S8DA 2NLJB 3ZYOA 2B1AL 5F9WB 4UUJB 4M4RA 3QIUA 1VA9A 43CAA 5BVPL 2W0FB 3DUUB 4K3DH 4U1NA 5L2JA 5EC2B 4JHAL 5ISZD 3TEUA 1ZHLB 2RCSH 3CLFL 1H3WM 4AMKL 3N1MC 5IM7B 2IEPA 1HHIB 3P9MA 5LCVH 4FABL 4RZCB 2HKFH 5E6YA 3VFWB 4XPBH 1GRWA 4R97C 3LDBB 4P9ML 3LKOA 3Q5OA 3VG9C 1S7VB 3DGGB 3IS1X 2FD6H 1DTUA 3MV8E 4GSDH 5DHXB 1HNFA 1AI1L 4N0FA 1D9KC 1FYHB 2YKLL 4ZOEA 4M6NL 3ZT7A 4Y19A 3UZEA 3ROOB 2AEIT 5GISL 3BGMA 3O4OB 2X4SA 4XBEH 2GK2A 3U0WL 4HIEB 4HUMB 4GKOA 3MRLA 5FXCH 5TPWL 4M61B 5J7CC 3E6HB 2D7PA 3MSPA 1KBGH 3IAPA 4JQXC 4X0KB 4XP5L 1G6RA 4KZDH 2HKHH 5GIRB 3KYNB 5CP7A 3IFOA 5T1KB 3LZFH 4FQXA 5I8OH 1AH1A 2Q7YB 4GW1B 4PP1D 3LKNB 3BH9A 2I26N 5AZ2L 3RWGA 5F1KC 5JPMB 4HH8A 3SKUD 4WI8A 5C08A 3OXRB 4M7KH 1ZGLM 2VZ3A 4LLAA 4NZRL 3QRFM 1TZHB 2YD1A 4UTBL 5F7FA 1VADA 1FVEA 2ITDB 2YEZB 1CFNA 3K2UL 4PTTB 1JHTB 1SYSB 3S9DB 2AJYL 4GAGH 5AYUH 5HHQA 35C8H 4E41D 5EU6B 4WV1C 3UTTE 3BWAB 4DCQA 4DWHA 3QPXL 3EYVA 2DLGA 2LU7A 2WQRA 3SJVB 3W82A 2F19H 4YGVB 2P45B 1MHCA 1NFDF 4X6CA 3L9RB 3QO0A 2VDRH 1W0YT 5AAWA 4LSTL 1GXEA 4EDWH 1QLRA 1IAOA 4JFXB 3Q6GH 4I18A 1Z3GH 4LCWB 2KBGA 4JO1L 5IMKB 5I8KL 3C9NA 5DUBA 4DKAA 5A43C 1NBYA 4O02H 4JPVH 4WUKH 5MERB 4OUOA 3Q6FB 2BVPA 2Y6SC 5F3BB 3LRGA 2CLVA 1XGYH 4KJQC 1BFVL 1KCVL 1G9NC 1NL0L 4GRWB 2DDQL 5F6HJ 3UTPD 4LVHC 3TH2T 2B7DT 1C12A 3D39D 4R6UA 3BEWA 5F1SA 3C8HA 1KT2A 4KJQD 3O6FD 3ARWA 4AM0B 3U4EA 5C0FB 4P59H 3LQAC 4ZD3L 3HHRB 4Z76A 3G6AB 1OVZA 3FB8A 3ULSB 4XNXH 5MEQB 3FFCD 3O3EB 1QLFB 4ZG1A 5GSVA 3G08B 2R2EB 3W9EB 5FF6B 4QHNA 1JK8A 5TJWK 5AG8A 5JXAH 3FQUA 3OAZK 1T3FA 1Z9MA 4X9FA 3BEVA 4KTDH 1SJEA 3CPLA 5INCB 3OG6B 2PTVA 4AYFA 5C0GB 5FUCE 5CILH 1S7QA 4K07A 3WS6C 1ZV5A 3L5HA 4BK5A 3MRMB 3FN9A 2ORBH 1NCNA 4DN3H 4ODSL 4MA8H 5IFJB 1HCFX 1CWVA 4ZUSB 3O3AB 3NABL 3OHXB 3NH7H 4DUWA 5C0NC 5IG7A 3TBSB 4OZHA 2EXWC 4ETQB 2HJLB 1ZLSL 4EZMA 4OFVA 2VLKD 2D3VA 5DMJB 5C0ND 3MLYH 3RZCB 4PJXE 4PJBF 1P7QD 2EXWD 2O5ZH 3KPPA 4TQEH 1JNHB 2A6DA 3NGBB 5DDHA 1U3HC 3KPLB 3BPNB 3K8KA 1J1PL 4F7CB 5JIIA 2OSLB 1N64L 3RWDB 1NAMH 3U30C 2YD8A 3C6SB 4HEME 4PJDE 3A0OA 3D25B 5IVNA 4KK5D 1QRKA 4CUCA 1I9JH 1DUZB 1R5WA 1PQZA 3BJ91 1MCOH 1IQWL 2FIKB 3GI9L 4LPUA 3BKCH 4JDTH 2FB4H 1LILA 4YBLC 3T09A 3HUJA 2WK2A 4NQDD 5B39A 4LIQH 1D6VH 1W0VB 2DM7A 2D0FA 4YC2B 1FNAA 4ODHL 2IAMB 3X3GL 1L9MA 4GG6E 1EGJL 1DN2A 5GS1C 1S7UB 1EAJA 2OR9L 2J7LA 3G9AB 5AEAA 3VRLF 3VFOB 3FT3B 1P4BL 3BKJH 4W6XB 2EKJA 2RR3A 4PRIE 1UM6L 4DAGL 1UWEL 4R26H 1MCDA 4H0IA 4EIGB 4TRPH 3EYOB 4NPYB 1U42A 1EPFA 1F97A 2VYRE 2Z31B 3VE0A 1J88A 3VFMA 1FYTB 4ZFGH 4XI5D 4GUPB 1RAMA 1KCRH 3VMNA 1CICA 4LSRL 4N5UA 5F8RC 1EBAA 4CJ0A 4C55A 3TWCL 5GGQH 3KPSE 1UXWB 3HMWL 2EDTA 5I8EA 5ESQB 2COQA 4MA3A 2WV3A 3KNBA 3WFBH 3I2CH 1LP9B 1UYWL 1ZT1A 1MH5B 1TJGL 1ZVHA 2LFGA 4OZFH 1AD9B 4U6VH 5E5UB 5TE4H 5C8JA 2HWZH 2O5YH 2VL5B 3FJTA 5HI5D 3T1WA 4P5TB 5EUOB 1NBZA 4KJYB 2JB5L 4XHJC 1M6OA 4D0CA 2WUCL 2P4AB 4D3CH 3HC3L 4OCWH 3G5XA 4FZEH 1J12A 1UXSA 4WFHE 1FZOA 5ANME 5GGUA 3QDGB 3VXSA 4JHBA 5I66B 2EIDA 3L6FA 4BSWA 3O2WH 1N5YH 5EIIB 1BM3H 4H25A 3QIWD 5DD5L 3MLRH 4DVRL 3W5MA 2NY6C 2V9TA 1LE5A 1AR2A 3W39A 1NUNB 3HAEG 4MA1C 1P2CA 3WL9A 4I0PD 1F6LL 1UM4L 4HXAH 2Y36L 5FYKE 2BNUA 2NY6D 3WNLA 3OPZH 4OZ4A 2VABA 1Z5LA 2GJ6B 4UTAH 1FDLH 4R0LA 4UB0L 2H3NA 4OUUB 3QXUA 4JM4L 4MLSA 4YNYA 3V9FA 5ADOL 1IMHC 3WHE1 1ROWA 4KRPC 1XCQA 4R7DB 2DMCA 5L6YL 1KPVA 3VWJD 4NQXA 4YHIA 1H3PL 1EH9A 4XBGA 3KPMA 1K6QH 5BCAA 1G7MA 4HC1H 4XVSL 3PQYA 5KOVC 4PJ5B 1TZIA 5EU7E 5D8JH 2AK4B 2YMXH 1C5CH 4MXVE 5E8PA 4IMKA 4WWID 1FAKT 1BVKB 5GRZA 1U91A 1MCPH 5CD3B 3DROA 5C9KA 5HD8D 1U2CA 5D1XC 4HT1L 4C56B 1T89C 2Z9TA 4DFHA 4HCRA 2A38A 5BVJB 4LASL 4FFYH 3SDXA 4C57C 3VFUA 4UT9L 1RJLB 3OKEB 1Q1JH 1Q9LA 2A9NL 1M71B 1DFBL 2DQIL 4XRCA 1PX4A 4E9LA 4LLYB 5I1CH 5E6ZA 3UZQA 1DBJL 2F5AH 5E1HB 4G6KH 1XGUB 4YFEA 1HWGB 4WHTB 3RWCB 3S3SA 5D72L 4N5ED 3EHBC 2HAZA 3P30H 1KOAA 4LVNC 1V05A 5IMOB 1A6ZA 1RULL 3QDHA 3QDMB 4M7LH 3O0RH 1UKQA 5F9AC 1RZKL 4R3SB 3TO4B 1CU4L 3UTQB 4U0RB 3PE9A 2X4RB 2ZJSH 3O6ML 3HZYB 4M6AA 2C4FT 3VXMB 1U8QB 3K0WA 3F62A 1DQML 2DJSA 2D31A 3QIUC 1VFOA 3MGOB 1FN4B 3EKCA 3OAYK 2NY5C 4D9LL 3EOTH 3QCTH 4A2LA 2X7LA 4OCXH 5FGCE 4QRPA 3GBNH 4D2NA 3S34H 3V2AR 3QIUD 4HWBA 5EBMA 3SEPA 3U7WL 1IAIL 3LOWA 1Y18A 1F3JA 43C9B 4ZNCD 1A3LH 5EOTB 1HHKA 1QSFA 4JPWL 1D5IL 4NQEB 1T1WA 3V6OA 1HILB 1CBVL 5E70A 2DM3A 1HINL 2EDEA 1LEGB 4G7VH 3MBEA 2WMPA 3CFEB 1F3RB 2QV2A 2I5YL 1K8IA 1NCWH 2VN4A 1IEAA 3GZKA 4Z7UE 1QSEA 4UIMA 4FXLA 2AXGA 1RK1B 4HH9A 3VMOA 1U9KA 3QFDA 3QXDA 3SDCA 1INDH 4FQXC 2C4FU 1KYOJ 3GJFH 4KKAD 3RWHA 5J8OA 4QKXB 1T4KA 3AS3A 2NX5A 1QO3A 5EWIL 3C60B 3HCVA 3LB6D 3T0XA 5CZXC 4OLVH 3EO1A 4J1UA 4O5LL 3LCYA 4OFIA 1T7XA 1IEHA 1A21A 3MRCB 1I4FB 3QHFH 5A40E 3B43A 3VG0L 1DZBA 5ITFB 3STLB 3V52H 3G6JF 5SWQA 3KYOB 4U6XB 2HG5A 3CX5K 1QBBA 1RHFA 3UBXI 4OGYL 3QEQA 2EE9A 2R56H 2ZUWA 5F96L 4L1DA 2OZ4A 5CSZB 3SE9H 2NW2A 3MRNB 2BOCA 2DQGL 2HT2D 5IVXF 1IM9B 5E94B 3VDAA 1TQBC 3FFDB 2BZDA 5T1MA 4FN0A 3BQUA 5KBNC 5IIEB 4J3WA 2ADIB 3MNVA 3PNWA 1QSZA 1QBLL 4XP1H 5D7IA 4CRPA 3S6CA 2XZCH 4KROB 3MJ9H 3BW9B 4I18C 25C8L 2V5MA 3VRJB 1ZA6A 3T0EB 2UZXB 1XGQA 2DL9A 4RFOH 4FMFA 4S1RL 2VNCA 4S10A 2VLLA 3DJ9A 3DBXA 1KPRA 3LKSA 3VMPA 4KDWA 3U36A 5D2LA 4HWZB 4U1IA 5DMGC 4O51B 4MQSB 1HKFA 1U58B 1XGTB 4QRTB 1F4YL 3SKMA 4FZ8H 1OL0A 1F2QA 3FONB 5BS0A 4V1DD 5CEYA 3U9PH 3V4VL 1A0QH 4LLUA 2GHWB 3MJ7B 2IQ9L 4CVZA 1BD2D 1S7RA 2VRAA 1OGAD 3EFDH 4GW5A 4NSKB 4PJAA 2A9ML 1DBBH 3MO1A 1PX3A 4QXWA 4XNYH 1LD9A 3GDBA 1KNOA 4PJ9D 3SGJA 4G42A 4LGPB 4PP2A 3SCMD 3EOYG 2Y07H 3IXAB 5DVKA 3PWLB 1WWAX 4LLMA 2VLRA 2MWCA 3DV4A 5BV7L 4Z7VB 3WSQL 5KSAB 5IB4A 5D9SB 4UOW1 3RY5A 3RWEA 1N2RA 4N0CC 2PW1B 4OF7A 1QYGH 1CLCA 3QI9D 4F7EB 4NT6B 1T0PB 3CSYB 4Y5VB 1BGXL 3JWDH 4GW4B 1EJOL 4U1MA 2APBA 2DS4A 5LGJA 1AP2B 4U1HB 1AGBA 4OZIB 4RNRB 4OF8A 4JE4B 4HMCA 3D3VE 3SKNA 1I3RA 5DQJB 3DTXB 4DVBA 1L7IL 4UIKL 4JO2L 2OJEB 3CFCH 4BK4A 4V2CB 1KCKA 3VD9A 2N56A 3KYMA 5C7XH 1A1MB 4NRXB 4X6DB 1FFRA 1CGWA 1E6JL 2VR4A 2F53B 3EIFA 1F8TL 1KN2H 1WAAF 2FGZA 3CFBA 1IQDA 4ZFOL 2BVEA 3P4MA 1CT8B 2BHUA 3O2DL 1DEEA 1ORQB 2Q86A 2BSSA 1B0WA 4JFEB 3QXAA 1V7ML 5CBAA 1WIOA 5KTEL 1AD0B 3HZVB 1T1YB 1I7UB 2YK1H 3CXDH 4NC1C 5D7JD 3O6KH 1YYLH 5E9DD 4AENB 1EHLL 3FHQA 2BJMH 3WFCL 4L4TA 4DGVH 5FO8A 3QQ3A 2UWEA 2H9GB 4YBQD 2LVCA 2QADD 1AQKL 5DJZB 3GSXA 4N1EA 4HMEA 1A1NA 1SQ2N 1BJ8A 3EOAA 1BQHA 5T1LA 3H3KA 1YNTB 2BFVL 1LE9B 4PGBB 3CH1A 2BC4B 5DC0A 1B6DA 1JNNH 2NYYC 3ARUA 3N85H 4FQ2H 5D5ME 3TT3H 5DF0A 3WKNA 4KDVA 4JLRA 5EZOL 4NKOB 5SWSA 5J6GA 4YFLF 2IGFH 3FB7A 3PDOA 3MRBA 4N8VA 4YHYB 4KXZH 2NYYD 1ERNA 3JTSB 3QXWA 1BOGA 3E0GA 1HH6B 5HJ3A 5D70H 4NM8L 1UCBH 1CICC 4TYUA 1OP3K 4FQQB 3S97C 1XGPB 1EZVY 1JWSA 4JO4L 2JIXA 1S9YB 1GAFL 4LFHG 5DO2D 1BZ9B 3NFPB 1I8IB 4J4PA 1TTUA 3IDGB 4U6TA 2QSQA 3MV7E 3D6GA 1KCSL 2O5XH 4XCEA 2F5BH 4QLRA 5J1AA 1FNLA 1NUDA 1G7IB 2Y23A 5IEHB 3FB5A 3K4ZA 4AL8H 2GSIB 4R97B 1T5XB 3VG9B 5ICYB 1AXSA 4HPYH 4Q9CA 4PJ8C 1L0QA 5BOPA 3L5XH 1D9KB 2W65A 5IQ7H 3TPUA 2E6QA 2XPGA 3CVHA 3MREA 1GYAA 3MRFA 3FT4B 3V4PL 3N1PC 2BY1A 3MGAA 3QDJD 4FQHB 5IEKA 4PJGA 4RMWA 4ZXBC 3L3IA 2DLFL 5KSBF 4NOFA 1F3DJ 4GQPH 4MMZC 1FZJA 3ES6A 3TGXA 2Y4SA 3ARED 4YHML 1GHFH 1U3ZA 1WC7B 2CRZA 1MHEB 2V9RA 4XP4L 1AGDB 1BHGA 1WBXA 1YEHL 2A83A 1J87A 1JTOA 5GGTA 2FBJL 4QHKJ 3SDDA 1CZ8H 4X7TA 2MSPA 3MA9H 1JGVH 3CGTA 4H88L 5DHYA 1IM3B 5IUSA 3HNTH 3GHEL 4NCC1 4E41B 5GPRA 4WU5B 1OTUC 1CDHA 5DJ0B 3H42H 3JXAA 3SOBL 4X4ME 2DAVA 3FRPG 2R23A 4G8GE 4OKVB 5HYEA 2OBGA 4OZGB 1RUQH 3L3OB 1AY1H 4G43B 1FV1A 5I15H 3TBYA 1X5AA 3MCLH 2DQTH 2V2TA 3JV4A 4DUXA 3LQMA 4X5WB 2CKBB 5DR5H 4WO4A 1JPFA 3GGWB 4IMKC 2IPTH 5SWZE 1CIUA 1WSST 4D0BB 5M94B 5ALBH 3HN3A 4G7YL 4QTHB 1NBVH 2E7BA 1HHJB 3UPAA 2ICEB 3OGCA 3KPRE 4JFFB 2LAAA 1IC4L 2UYLA 4RIRB 4QRRB 4I5BB 4M8VA 4LKCA 1DQLL 2HFFA 4HUVA 4AQ1B 1BWWA 1UH2A 3TBVA 2VXSH 4BYHA 5BRZA 3E1F1 1P84K 4XB7A 3D39B 3ELAT 1BZQK 2NR6D 3KPOB 1S9XB 1WZLA 2OTUA 1MI5A 3DECA 4HGWA 2ITCB 4LVHB 2AW2A 2JJTA 3BZDA 4NHCH 3G5ZB 1A7RH 5F6IC 3FFCB 1BREA 1UENA 3U46B 4UT7H 5DFVC 3O4LE 1U8LA 5A16B 1FFNA 2APFA 5KOMC 4U3XA 1J9CT 4C83B 3IGAA 1QFUL 1EA9C 5F9JB 1KJ3H 3IRZA 2WUBH 4POZD 1HI6B 2XN9D 2VLJB 3BGFC 5DFVD 4NFDA 3RDTA 3X14B 2EYSB 1R5VA 4Y16D 1UQSB 3BKYH 5DJCA 3DRTA 4OLYH 4OCLC 1A9EB 4L3EA 2BNQD 2IPUK 3WUWG 5M95B 2AQ3A 2MPAH 4XTRD 5D6CA 2CDEB 3FMGL 3B6SB 3KDMB 3EBAA 2QLVB 3MRHB 3RPIB 2FR4A 4XC1H 2VXTL 1YPZA 2VR5A 3UX9B 3BRDA 4GBXA 1FFPB 1E4XL 1UFUA 4CMHC 1ZLUH 2J1KA 3P4OA 1A7PH 1RY7B 3IXTB 4LHUA 3QFJD 3C5ZA 4P57B 4RAVA 1A6TB 4QRPD 4U1JA 2VIRB 3IVKA 5SX5H 3V6OC 3JZ7A 1RIVL 3O41B 5HYQB 3PUCA 1DSFH 5L9DH 3MBEC 1MFCL 5IT2H 5E1AB 5IW6B 2X4QB 1QSFD 5BV7C 3GSRB 4RMVA 2YD6A 2NQCA 2GYSA 5T3XE 5T3ZH 1MREH 4Y2DA 5BJTA 5HSFA 1EBPA 4KHXH 4OM0L 3SKJL 4JDZA 4PJIF 3K4DA 3PABA 1Y6KR 1VGEL 5FUCC 3SDCC 1PLGH 4OLWL 5C0JB 5DSCB 1U3HB 4CJ1A 3KLSA 5EOQH 5E6IA 5ETUB 2ZOKA 5F1NA 3U30B 4ZO7A 3RKPA 3W81A 4ONOA 5MENE 4FQIH 2ZUUA 4Q6IA 5IB3B 4P2RD 4JZOB 3D1MC 4NZDA 4P23D 2Y06H 3M1BB 1G7HB 1RU9L 2PYEB 1CLYH 2JJWA 4NKMA 5GS2D 1B0GA 3K7UA 4YBLB 5HGDA 4WUUE 1J8HE 2P5EB 3BJLA 4OD1H 3GM8A 4K9EC 2JCCA 1F4HA 5ICZB 3WYRA 3IDYC 5E99L 4MQXD 4IOIA 4NNXB 5A2FA 1YY8B 1HSBA 2IF7A 4HKJB 4EUPB 3L7FA 5GS1B 5FHBH 3QUMA 2XKUA 1X4YA 3TVMA 4H0HB 5EBWA 5E5RB 1N7ML 3MXVL 1K8DB 3BQUC 3BDYL 1JPGB 3MRIA 4LPCA 3EYSH 3REVA 4F58L 3VD7A 1D3CA 4A6YB 2R0WL 4Y4KD 1JWMB 2JK5A 4NDMB 4ZS6C 3ZDXE 3QWOB 2ICWB 4PJIB 4P2OA 5DA0B 4FXGB 2VDQL 3QNYB 5ESVB 3ARQA 3BP5B 3LEXA 2ADGB 3WN5C 3OZ9H 3PF2A 3WFDH 4NRZB 2OP4L 5C6TH 3W0WB 3DX6B 3NFSL 2CDFB 4YXLH 1KJ2B 4JG0L 3DI3B 1UT9A 2ERJC 4R4NC 3OJ2C 4MB5A 3O2VH 1F90H 1VEPA 1W0WB 3BE1H 3DVFA 3GMLA 4GQ9L 4XVJH 5T5NF 2DYPB 3ULUL 4X9GA 4GT7A 3WD5L 2O61A 1EDQA 2A73A 1I7TA 1K9TA 2CRIA 4FQCL 2CH8A 2DQDL 2HH0L 1BFOA 4Z7QE 4O2EB 1FO0A 1GGCL 1MCIA 1A7NH 4I2XE 4U31A 1MNUH 3U6RA 5IV2A 3HFMH 3OXSA 3BPCA 3QIWB 4MJ5A 1UC6A 5EO9A 3DO7A 4AEHH 4PJHF 3SGJC 1Q94A 4NO5B 4CW1A 3D5OF 1HEZB 4FP8L 2PF6A 4CVWA 3ARDA 4XGZA 2A6IB 1NDGA 2Y1VA 1P1ZA 2EDFA 1HIMH 3QHZL 4IRSD 4TSCH 2NY6B 5I75C 2HJKB 1H0DA 3WIHH 1AGFA 2VLRD 1HDMA 2E5EA 4OD2A 4LEOA 3V5HB 5CJ8A 2VXVH 1R6VA 2AV7A 3ZHLA 4ODXA 2CMRH 3BIKB 3VWJB 3A6BL 2XV6B 3U2SB 1S9VB 5I8CB 5CCKH 4ODTH 2YS4A 1I8KA 4UBDD 3EYFA 2ENSA 5DURB 5SV4A 1A4KB 3LN4A 3Q3GB 5C0RL 5JW4R 4Z95H 5FM5M 3DV6B 5BXFB 1KB5B 1MHHA 4XNUH 4W4NA 1QPPA 4FTVE 1NGZA 1GGIH 1ZS8A 3U7YL 2E8ZA 1U8IB 3KWWB 2Q1EA 3ARGA 5ID0B 1T0MB 3GI8L 3CFIC 4ZUTB 5GRVK 3I84A 4PJHB 5IFAH 3RNQB 3FQTA 1RMFH 2BRRL 5DUMH 3QPQC 2B0SH 3CJJA 3F7YA 4OF0A 2CJUH 1HZHL 3BKMH 3CMOH 4BFIB 5IP4A 1G7QA 5D1XB 3I02A 5DHVA 15C8H 1VKXA 2HTLD 1CE1L 3UBXB 1YUHA 1RV6X 4LQFL 3QWQB 2BX5A 3VXRB 7FABL 2RIKA 4ZPTB 5CIPB 3QPQD 4X6FA 4G8EA 4GAJH 2J8UB 3U48A 1NKRA 4KPHL 2NZ9C 4Y1AA 3GSQA 3NCEB 3INUL 3K46A 1RIUH 4O58H 4E42A 2EE2A 4WTWA 2C7UB 1CD0A 3MRQA 4JFOA 5C3TA 2NZ9D 2X70A 1SY6A 5C07E 1LEKB 5EA0L 2Y72A 5C0BA 2YXFA 3LH2H 1WBZA 3PP3H 1RHHA 1CK0H 2YR3A 3BXNA 2IMNA 3LN9A 4PJCB 4AJ0A 1WISA 4MNHA 1U8KA 3VXUD 1G7PB 1UH3A 1HYSC 4XPGH 3BFOA 4LSQL 4NJ9H 2ZUSA 3ECBB 1ND0A 3UMTA 3NN8B 1K2DB 1J11A 2JJVA 2IPUG 1MIEH 2I24N 3RIAK 1JGDA 2NNAB 1S8DB 4QGTA 4BQ9A 2CRYA 3M8OH 2ESVE 2VDKL 3QIUB 43CAB 4YZFE 3HR5A 4U1NB 5L2JB 3SE8L 2PUQT 1TNMA 3EJZC 3KAAA 3MLSH 4J4PC 5MEPA 3WKML 2G2RA 4Z6AT 3CUPA 5KW9H 4PUBL 4FFVD 3VD3A 2DI7A 2CKNA 1KTKE 3P9MB 1CF8L 3O6LH 4KMQA 1F3DH 3RNKA 5ALCH 1S78D 1NGQH 3JVGA 4J23A 2XA8L 3LKOB 4JQIH 4KTEH 4PGZA 1T21A 4E0RA 1YNLL 3RIFF 3JWOC 2FGWL 3EDFA 4K8RC 3QUXD 4UNTA 5DQ9A 1P4IL 4N0FB 4OQTH 4Y19B 3ZE2F 1YEKL 3BGMB 3MJGX 3CXHK 4JY5H 2X4SB 1BVZA 1RJCA 5BZDA 4K8RD 3QHTC 1QNZL 3MRLB 3IDMA 4JFHD 4CU6A 3OKDA 1HE7A 3VXQA 2N7BA 4XC3L 4BZYA 1ZE3C 1CFTA 4MA7H 1I3UA 2DRUA 1G6RB 4U33A 1NMCC 4M1CC 2QR0A 5CP7B 3SQOL 3IFOB 4FQXB 3U83A 3SGEH 1T80A 3PGFL 4OB5L 4LEXH 4MNQA 3SDDC 3BH9B 3WFEH 4P3DA 3RWGB 3PWPD 5GXBB 4OFYD 1I7ZA 2KUTA 4Z5RA 5C08B 1EZVX 1JZ3A 4N1HB 5IGXL 5GHWL 1VADB 4GXUN 4ORZC 1FVEB 3ZL4L 5E7BA 3ZDYF 4BFBD 1V3MA 1YY9D 1MFAH 5HHQB 3KHQA 2ZCHL 1KEGH 4OLUH 1K5NA 3VGDA 3UJIH 1E0OB 4DCQB 2F54D 3HZKA 3NIDF 1SY6L 3HI1A 2X1XR 1TQBB 3EYVB 3HG1D 4WO4C 4WTZG 2H1PL 4M1GH 2VQ1A 5F7EL 1MHCB 5CLWA 4X6CB 5ADPH 3QO0B 2X44D 3Q0HA 5EU6E 1EHNA 3L3JA 3HAEA 2R1WA 3RVUC 4D9RD 1QLRB 1IAOB 3CDFA 1Q0YL 4I18B 1YQVL 3SJVE 1FAIL 4JDVA 4RAUA 3OF6A 3CX2A 3C9NB 5DUBB 1NBYB 2I25N 1OAXL 4M43L 1SBSL 3GSNH 4JG1L 3NIGE 2BVPB 2HVJA 3H8NA 4L29A 4K2UL 2RAMA 4LCWE 2CLVB 1JPTL 5DK3A 1EERB 1RFDL 5E8NA 4GRLD 4I3RH 1ONQA 3CSGA 3UTOA 5GZOC 2X4UA 32C2A 5C0CA 1IRAY 1C12B 4K3EL 4OZHF 5HHMB 3BEWB 1FG9C 1KT2B 4POYA 5HGAA 2GI7A 3FZUD 4G6FD 4HFWA 3U4EB 2XQBH 4Z76B 1H9VA 3WS3A 4GRWE 3FB8B 4R4FH 4WI5A 1NC4A 2OL3L 5AD0A 2LE9A 4HKXA 5GSVB 3X12A 3SDAA 4DGIL 1KULA 5F71A 1NGPL 4QHNB 1JK8B 4QXGH 2ARWA 3RDTC 5I17A 1OAYH 3FQUB 2WAHA 3QR2A 3S36L 1T3FB 2KL6A 1B4RA 1JHKL 3BEVB 1SJEB 3CPLB 5J12C 4UQ3A 1AXTH 1S7QB 5T1DH 3MLWL 4GBXC 4NM4H 3KLAA 3MZGB 1QA9A 1CQYA 1A7QH 2P5WA 2F15A 1BJ1J 3ULUD 4RMTA 5IFHH 4ZUVA 1YN7A 1E28A 1WEJL 2K7QA 2GTWA 2YD5A 4Q2ZA 2GCYA 4LHUD 4OSUL 5IG7B 3SKOA 2GSGA 1ZA3A 3C5ZD 1ACYH 4OZHB 3S35X 2GW5A 2NTFA 4NO0D 3NCCB 1N59A 3MXWL 4FS0A 3RA7L 4S1SH 4Y2DC 4YWGL 1MQKH 1VPOL 4M5ZH 2FX8L 3KPPB 2DQJL 2A6DB 4XMPL 5E9DB 5DDHB 1K3ZA 2HVKA 1NCDH 4QT5A 5E6IC 4ONGL 4JPKL 2CO7B 4TPRL 3QAZC 1R3HA 1WFNA 4DKFL 2QADB 3ARSA 3S37L 3ZTNH 5FCUH 1R5WB 5GJSL 1PQZB 4YPJA 3QEUA 4JHWL 4KTYA 2W92A 5H37G 5TE6L 4ENEC 5JOPD 3HUJB 1F4XL 2VC2H 5IF0A 4DN4H 1U6AL 3MV11 5B39B 3VW3H 3LIZL 4RMSA 2FATL 2Z8RA 4M62L 2IFFL 4LSUL 1A64A 4NOBA 4AIZA 2WBKA 1GOHA 3P9LA 2B1AH 5DMKA 1KELH 3FCTA 3TVMC 5BVPH 4OZFA 2Q87A 4JHAH 2PXYA 4I8DA 2G60H 3CLFH 1PEZA 4NHUA 2ZSVA 4I48A 1FNGA 3OQ3B 5DVLA 3IRPX 4FABH 3P77A 3VE0B 4P2OC 4WFEE 3VFMB 1UA6L 4P9MH 4QRUA 3N9GL 1UWXH 1QEWA 3FAXA 1CICB 3RQ3A 3T2OA 5FOJA 4HUUA 1AI1H 4NFBA 3M45A 2YKLH 4CN1A 4M6NH 4EBQL 4GLRI 5GISH 3V6FA 3ARBA 5I8EB 4MA3B 1FYTE 3KNBB 4ZO9A 3MNWA 3U0WH 1ZT1B 5TPWH 1INEL 5C8JB 2OMNA 3QNXA 4F7MA 2FHFA 1NBZB 4LSVL 4LLQA 3T3PE 2FH6A 4PBWD 1M6OB 4XP5H 4D0CB 4HG4K 4HJJL 3G5XB 3GIZL 3DETC 2PN5A 3BYTA 1JGLL 2K3TA 1UXSB 4Y88A 4QWWD 1FZOB 1LP9E 5GGUB 1Q0XL 3VXSB 4WHYH 5CEXA 1WT5A 1TTFA 2AEWA 3L6FB 4BSWB 4DZ8A 3DXAD 5EUOE 1FL3A 3ARDC 4KY1L 5AZ2H 1RVFH 5L8JB 3O3UN 4EI5D 5ERWA 2OQJA 1BFSA 4NZRH 1LE5B 3QDGE 2RJMA 3W39B 4HC1A 4UTBH 1P2CB 3WL9B 5TQ2H 3VCLA 3WNOA 4UDUA 5KVEL 3DLQR 1WVZA 3K2UH 2UV3A 2AJYH 3TZVD 3BYYA 2BNUB 5DFTA 1RQ5A 3H9SA 4OZ4B 2VABB 4FG6D 1Z5LB 3QUYA 5JXED 4JRYA 4R0LB 2H3NB 1CGSL 3V5DA 5EZIL 1NC2D 3MJ8A 1WITA 2C26A 1UZ8A 1XCQB 1MFEL 1KPVB 4HF5L 4NQXB 4YHIB 4HUXA 3EFFA 2AEPL 1A6PA 2GJ6E 4LSTH 1PY9A 5FYJU 4XBGB 3ZKXB 2ZUTA 3KPMB 4R2GC 2NY4C 1G7MB 4JO1H 3A6CL 1FLRL 3OKKA 3ARRA 5I8KH 4NQCA 3PQYB 4LSSL 2F9BT 3MLXL 4LLVA 4AEFA 1OM3L 1TZIB 4H8WL 2DL2A 4APQA 2ZKHH 2OK0L 2R1XA 3D9AL 5E8PB 1E6OL 4HIEA 3ARGD 1MCHA 2GY7B 3F7QA 2X1WL 1U91B 5KVMC 4LLDA 3DROB 1OAUH 3UTSA 5DEZA 1BFVH 1KCVH 2J8HA 1IBGL 1QFWI 2DDQH 2V5RA 1I1AC 4PJ5E 4DKDC 3SDXB 5C09D 4ZOAA 2AK4E 1Q9LB 4EN3A 2QKIA 3ARFC 1PJ9A 5I19L 4XRCB 1KFAH 4M1DL 3ULVC 4C56E 1IGJA 1OAKL 2G75A 4K7PL 3OR6A 4KV5F 3NACL 4O9HL 3UYOD 3UXFA 2AJXL 5IK3A 4PTTA 4YXKL 5F6IB 3CFKA 1REIA 1A6ZB 4KWUA 4J3OC 5C0BD 3V8CA 5HYJD 3GIVA 1MFNA 1BF2A 1U95A 1L6ZA 4LCUA 3TIDA 2AJUL 3FAWA 3PJSA 3SJVA 5ID1A 4X6BA 4L4VA 4PREA 3DNKA 4ODSH 3AY4A 3QDME 4Z7WF 2WBJD 2D31B 3DMMA 3QUZD 1CN4A 5HI4D 3BN9D 1OPGL 2IANA 3KXFA 5CJBA 2CIIA 2YPLD 2X7LB 3VXME 4CVXA 3U7AA 4QRPB 5JHDD 4FOMA 5H94A 1ZLSH 5EBMB 3IDNA 4PRDA 2V5YA 1YMHA 1FGNL 3GJFA 4CMHB 1RZ7L 3JVGC 1Y18B 1F3JB 3HC4L 3CC5A 4JN1H 1R3KA 3MCKA 1HHKB 2V2XA 1QSFB 4PLJC 1T1WB 1J1XL 3FN3A 1N64H 3U1SL 4FA8A 3V79C 3R8BB 3HTLX 3AU1A 1IGIL 1QD0A 5B3JF 2LU4A 1EFXD 3MBEB 5MHSE 2AJZA 3OB0K 1Z6JT 4XX1E 1XIWA 4M7ZC 2EYTA 4CL7A 3W11C 2VO5A 5BV7B 3GI9H 1IQWH 1K8IB 4HS8L 1IEAB 2ZPKL 4YDLB 4JZJA 1QSEB 4NQEE 4UIMB 3NA9L 1VENA 2AXGB 4HH9B 4P4KD 4MXQD 4LL9A 3QFDB 3QXDB 3GBLA 1NFDA 3RVTC 2L7UA 3RWHB 4QNPF 3BZ4A 4ODHH 1T4KB 3X3GH 2NX5B 1QO3B 4X5XA 1EGJH 4JM2D 3HCVB 1R3LA 4J1UB 5EU4A 2OR9H 3TCXA 1TVBA 4NN6C 1P4BH 4X7DC 5I1LA 2FJFA 1ZANL 4LNRA 3ILQD 1UM6H 4DAGH 3TNMA 4NKQB 4G9FD 3RGVA 2BMKA 5SWQB 2HG5B 1A7OL 1UVQA 3D69A 4H1LH 1KIUA 4XCFL 3IDYB 3QEQB 5HHVL 2NW2B 3OHXA 2BY3A 2BOCB 4LSRH 2MQ3A 5JZ7C 3T3ME 3TWCH 4ELMF 4TTDD 3AM8A 4HAFA 5T1MB 4R8WL 3BQUB 3HMWH 1I7RA 3MNVB 3PNWB 2AJVL 3S3JA 1UYWH 1TJGH 3EOBA 5D7IB 3MV9A 2BCKA 2JB5H 4Z7OF 3WDHA 1ZA6B 1XGQB 2WUCH 3HC3H 4PJFF 1UEMA 2P46B 2VLLB 3BMWA 3DBXB 1KPRB 1MF2L 3LKSB 2DQFA 2I9TA 2W0KA 5D2LB 2ERJB 4U1IB 5I6XC 1OQXA 4HQQL 2BNRD 1EV2E 3SKMB 5T3ZE 1ORSA 2HTKC 2KH2B 3S4SG 3T0EE 4BQBA 1LVEA 5BS0B 5CEYB 2BDNL 4PRHD 3FN0H 4DVRH 2QHLA 4LLUB 4CVZB 5A3IC 4Y4HA 1DL7L 1S7RB 4GW5B 3FRPA 4MD5A 4PJAB 2DI9A 1UM4H 1U93A 3MO1B 2Y36H 1ZVSA 1LD9B 5CINL 4XNMA 1KNOB 1QKZL 1R24A 2EEAA 3EAKA 4G42B 4OF3A 4PP2B 3VA2C 3ZE1F 3WIFA 2XTJD 1RIHL 1SYVA 4UB0H 5ADOH 4JM4H 5J4MA 4LLMB 3SDAC 1BJ1H 4KGJA 2VLRB 4YEFA 3DV4B 4ZS7L 4AEEA 2VQTA 3EYOA 5L6YH 4PJBA 5I75B 5IB4B 4JFDD 1H3PH 3VJ6A 3RWEB 3GUTA 4TTGA 1N2RB 5C0AE 2E9WA 4RGND 4MYWB 1EMTL 3J7HA 4XVSH 4Z7VE 4U1MB 3TN0D 4HIIA 5LGJB 5FO9A 3L5JA 4PRPA 1NQBA 1AGBB 1T66D 2ZG2A 3SKNB 1I3RB 1BEYL 4JR9L 1RZFL 4DVBB 3E6FA 5K9OA 3IB4A 3O81A 4HT1H 1UH4A 5GQBA 3W9DA 1GZPA 3KYMB 4LASH 4OZIE 4UT9H 3BUTA 2A9NH 2DWDA 5IW1A 1DFBH 2DQIH 3AVEA 5FKAA 3CFBB 2ID5A 1IQDB 1DBJH 3P4MB 5FM8A 3GFUA 4KK6C 1DEEB 2Q86B 2BSSB 5ACZA 4TSAL 2P7TA 1IGFL 1ZEAL 4X6DE 5D72H 5FYKL 3QXAB 3FO0L 5CBAB 5KZCD 2F53E 4NQSA 5HXMA 5L8KB 4Y2OA 5TE7L 3WUWA 4L4TB 5FO8B 4HXBL 4KH2A 2JF1A 2UWEB 3NAAL 3QQ3B 4X5LA 1RULH 4MLIA 4JFEE 2FBOJ 1RZKH 1IARB 1B90A 1CU4H 1UEYA 1VSCA 2R2HA 2X9XA 3GSXB 4P5MA 5IKCA 1A1NB 1CL7I 3O6MH 2EZ0C 3T04D 5JQ6L 2P43B 3EOAB 1BQHB 3HB3C 5T1LB 4D9QE 8CGTA 1DQMH 3RUGF 5IHLB 3CH1B 5JO5A 1AFVL 3N50A 1A6WL 4JLRB 4PBVC 5SWSB 2PXYC 5J6GB 3HB3D 4D9LH 2LAGB 3FB7B 4TOYL 3RBGA 2IWGA 4J3SA 5I16A 3CNKA 4JFZL 4KJWD 3PDOB 3NFNA 3MRBB 3KPTA 4N8VB 1MVUA 1CG9A 3U7WH 1BOGB 3FHAA 5HJ3B 5C6PB 1IAIH 5L7XL 3NPZB 4JB9H 1JWSB 4JPWH 1D5IH 2JIXB 3VWKD 1NCTA 1GSMA 4NZTL 2Z8WC 5CD5C 1CBVH 3DUSA 2VDNL 3T4YA 1HINH 1WAAE 5C1MB 3ARBC 1EK3A 3ARTA 5CGTA 4XCEB 2I5YH 4TUJA 4M6OL 4YJZL 1G7JA 5J1AB 1KF9B 2MFNA 1M7IA 4LOUD 1QFWM 3FB5B 1KEML 4Y7MA 1AXSB 4IDJL 4ETYA 3UTTD 3CZFA 3WEXA 3QJFA 2R0ZL 1BP3B 3EZ8A 2W65B 2O26U 1EJ6A 3TPUB 3CVHB 2DICA 2XPGB 3MREB 5EWIH 1WT5C 4HDIA 3MRFB 4LPVA 5FOBA 4ZPVA 5F1OB 4FQPA 5IEKB 4O5LH 4PJGB 3L3IB 2JJSA 4FXKA 1UZ6F 2BVQA 3C5SA 3UJTL 3VG0H 1FZJB 2ZOLA 2NPLX 3ES6B 4DUVA 1NMCB 3QQNA 3ZKMD 5CZVL 4Z0XA 1PYWA 1WBXB 4OGYH 5F96H 3MOBL 2A83B 4MJIA 2Q20A 4HS3A 3IDIA 4XVTL 3WE6A 2BOBA 2ZUVA 4WY7L 5ILTL 2DQGH 4MDJA 4G5ZH 5INDA 3SDDB 4X7TB 4URTB 4I13B 1U41A 3R4DA 5DHYB 3U0PA 2AABL 1J0IA 2YD4A 1X5XA 1MY7A 4OM1L 5F70A 3QUYD 3X13A 1BX2A 1QBLH 2EDHA 4XP9L 4JRYD 4N1CA 3MPCA 1G84A 1D5MA 2R23B 2M1KA 25C8H 2QQKL 1FV1B 4D8PA 2BVTA 3TBYB 4S1RH 4U0QB 1JYNA 2V2TB 3JV4B 5IW3A 4E41E 5LXGL 4APQC 4UILL 3IU4L 3D85D 4JKMA 4WO4B 1JPFB 3BN3B 2AGJL 2BY0A 3GB7A 5E24E 4NQCD 1F4YH 2G9HA 4OZGE 1ZKAA 5EUKA 4G6JL 2QSTA 2B1HL 2QSCL 3OGCB 3RBSA 3L3GA 2IQ9H 1WWCA 4JRXA 4EN3C 3ULUF 2UYLB 2YXMA 3TH3T 3F8UB 2PYFA 2A9MH 4LKCB 4ODBD 4YX2L 3UTSD 2EE6A 4X6EA 2HFFB 4HUVB 2APXA 1ZSDA 4OIIL 5KJRL 5CGMA 3TBVB 5BRZB 5IJVA 4JFFE 3TV3L 3TYFA 1U8HA 1FIGL 4G6AC 4NBYB 5FYJL 2Y7QA 4QRRE 2EDKA 5E03A 5B21A 5BV7H 2XFXA 3WSQH 2OTUB 1MI5B 4HGWB 4N9GA 2F8VA 3EJJX 1ZLWH 4KHTL 1DR9A 4ONHA 4HFUL 3D39E 6FABL 2X5PA 1OT1A 2EDBA 5EPMA 2AAVA 5A2IH 4R90L 2GT9A 3EW3B 1BGXH 3B2VL 1U8LB 5J3HC 1FFNB 4MAYA 1EJOH 5DJYA 3O11A 5GGSY 3NZHL 1BECA 3FFCE 3IGAB 1PY4A 5DC9B 3AY4C 5EU5A 3MFGB 3DMMC 2E9IA 3RDTB 1TZGL 3L7EA 1KPUA 1R5VB 5J3HD 5DJCB 2AP2A 5F7WC 3DRTB 1L7IH 4UIKH 4L3EB 4JO2H 4BKLA 4NGHL 4I3GA 2QSVA 5D6CB 5J12B 2FR4B 5B38G 3DMMD 3HE6A 1YPZB 4OCRL 4N68A 2BVYA 4F80A 1E6JH 4GBXB 1KCUL 1F8TH 2VLJE 4WENB 1T20A 2Q7NA 3B9KA 2OMBA 3P4OB 4LHUB 3HZMA 3C5ZB 4RAVB 4U1JB 4XX1G 3OL2A 4NQUA 2IPKA 3HLAA 2FEEI 3O2DH 3IVKB 2OXGA 3Q5YA 1T5WA 1A6UL 1JZ7A 1I9EA 1Q9KA 4Q97A 3G5YA 3G6JA 3DX9A 1FNFA 1V7MH 4PJEA 5F7KC 5KTEH 1FG2A 4Q58C 3O9WA 5L0QC 4M48L 1EHLH 1XIWC 3WFCH 1FL6A 4JZJC 2Z92A 4Y2DB 5BJTB 3RVWC 5IVXA 4M3KB 4QGYA 1S3KL 4JDZB 3QCVL 1AQKH 3PABB 4OBSA 5C0AA 2EE3A 2NY3C 5DJDA 5E6IB 5F1NB 2ZOKB 2BFVH 4RQQA 3KPSD 3TIEA 4Q9RL 1PAMA 3GMRA 4Q6IB 1LO0H 1S7XA 1JUFA 5EZOH 1YMMA 4NKMB 1B0GB 4LFHD 5H35A 5HGDB 4WI3A 3RGVC 5EZLA 4Q0XL 4P46D 2JCCB 3VI3E 3QO1A 1B0RA 2QQLL 3TYGL 2HMID 3WIIL 4WFHD 3H0TA 4IOIB 4NM8H 1HSBB 2PYEE 3L7FB 4JO4H 3ILPA 3V5KA 3QUMB 3MRKA 5KVFL 2P5EE 1CXIA 2QJDA 3NIFF 4HD9A 1GAFH 4NKDA 5EBWB 3TVMB 3AM8C 1GIGL 3MRIB 1UG9A 4NUJA 3DVIA 3REVB 1U3JA 4F37K 2J6EL 3KVQA 1KCSH 4I9WE 1A47A 2JK5B 5C92A 3TC9A 5TF0A 1PZ5A 4P2OB 1UKTA 4BSVA 1X6LA 3HMXL 3LEXB 5FYKD 3PL6A 5CJOH 1VDGA 3HE7A 1FP5A 2PO6A 2CQVA 4M7LT 5FUOL 1HYRC 5E00A 5J1TC 1WICA 1TETL 3KG5A 2C3VA 4PJIE 3V4PH 1FFQA 2J2ZA 5F7DA 3GMLB 2DLFH 5CJQL 1UGNA 3W0WE 2A73B 2O61B 3MRJA 1I7TB 5GS0L 4OI9A 1BFOB 1FO0B 4Y4HC 1MHPL 1ES0A 5HVHC 1RURL 2E3VA 3U6RB 4ZYKA 5IV2B 4YHMH 1NH6A 4XP4H 1WWWX 2DBJA 3OXSB 1DUYA 1CDGA 1A5FL 2DLTA 3BPCB 4MJ5B 1QHPA 1YEHH 5EO9B 3DO7B 4IRJD 1Q94B 4CW1B 4Y4HD 2FBJH 4LHJB 2KDGA 1JRHL 4WTZA 2GK0A 3L3DA 1II4E 3ARDB 4N90D 4XGZB 4H88H 4JVWA 1JV5A 8FABA 2VUOA 5DD1L 1NDGB 1P1ZB 5F9DC 4DKEL 3GHEH 1CQKA 2DJUA 2ZP0T 5ISZA 3BZFA 1H0DB 4WDIA 4HIJA 3SOBH 2DQCL 1AGFB 2JLLA 1HDMB 4FFZL 4OD2B 5TQ0L 4XPFL 3THML 4LEOB 2AV7B 4M03A 4ODXB 5FA3A 2E6JA 4U3CA 2R2BA 1JPST 5DGQA 4EVNA 1I8KB