3IJSA

Structure of s67-27 in complex with tsbp
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsA01
4M7ZC 1A02N 3MRKA 4XVJH 2IWGA 1DQTA 2OP4L 1XF5B 3VRIA 3D39A 1IGMH 2DB8A 1BEYL 1Z5LB 1ZHKB 2HVJB 2R9HC 4G6KH 2CR3A 1QEWB 5IQ7L 5D6CB 4Y16A 3OB8A 2OQJA 4OZIF 5ACZA 2FEEI 2YD3A 3DX8B 3GM8A 3H9SA 4ENED 4CMHC 5EO1B 3QPXL 1MVUB 3PWPA 4M61B 5EDXA 3RUGA 1TZIB 4R4FH 3IRZA 1V05A 4OM0H 1MH5B 4G8IB 4HV8B 4QRQA 3A67H 1U8JA 5GRJH 3P4OB 3HZKB 2BY3A 4DVBA 2C3VA 1YEJL 2ID5A 3V5HB 4YAQA 1NGXA 3BPNB 3C60A 3OHXB 2ZNXA 5DHVB 5LBSH 1CDJA 5LJYH 3QNZB 4X4ZA 4Z8FH 3GJFA 3KXFA 4MD0B 4NQDE 3SJVB 2FDBP 5IEKA 1G7HA 2UYLA 5ENWB 4IOFC 5C09A 1CFVH 1U0QA 4UU9B 2FO4B 2AV1B 4JFFE 3IVKB 1CTOA 4Y4FA 4YO0A 3WL9A 3OR6A 4M8QA 1A4KB 2Q86A 4Y5VB 2YC1B 4YC2C 2QSQA 5GSVB 4NBZB 2DMCA 2XICA 5CJOL 3VXSE 1NLDH 1BJMA 1U36A 4IIQB 3RIFF 4KQ4L 4NCC2 5ISZD 4HC1H 4JFZL 5D70L 3CFKA 1I7UA 4P2YA 4LOUD 1G9NC 2PYFA 2Y25A 4TUOA 1BREA 3VDBA 1Z3GH 1IAOA 3QWOA 4BSVB 3K3QA 2QL1A 4P5TA 3VFTA 4LEOB 1NMAL 2QBWA 3JWNC 5BVJA 5C08D 4MXQD 4F7PB 4NNXA 2NX5B 1QBMH 1NL0L 3EKCA 3ARFD 5D2NE 4QHUA 5KTEH 1FGNH 2YN5A 4FS0A 5TFSL 2ZZUT 1CDBA 4YLQT 2EC9T 4AENA 3ZKXB 4M5ZL 4EUPG 3GKWH 3BWUC 3HHRB 3SE3A 5DUML 3F8UB 1A4JB 4J6RH 2G2RA 1F4WL 3OKOA 5DJXB 4HWEH 4OI9A 4B41A 1Q72L 1QFUL 1XIWD 3JWDH 1U95A 1FO0H 2H26A 2CK2A 1U8IA 4QGTA 2IPTL 2HTLD 3GI8L 2XPGB 2BRRL 1UADC 4X6FA 1RZKC 3MJ9A 1FE8H 4HJ0D 4F3FB 2HFFB 5HTSA 3G6DH 5CWSA 2KZWA 3WNNA 2DWEA 3KYKL 4Y2DA 4OB5H 3QUXA 5D1QC 3MXWL 3JWOH 5LCVH 5TPWH 3UTOA 2FLBT 5A2FA 1CFQB 3E3QE 2VLRD 4JLRA 2NTFB 5IFAL 4XI5C 4XNQA 1KBGH 1P5VA 1W72B 1RJZB 1KJ2A 3BZ4B 2PTTA 3DSFH 3OAYH 3GI9L 1AGCA 1BIHA 2GJ6A 1F02I 2N56A 1ZXQA 2ADFL 2EH7H 3UTSE 1RZIA 5CIPB 1Q9OB 2DQDH 4YUEL 3QXAB 2DS4A 1IGCH 4PTTB 4ZPTB 4JPIA 1ZTXL 4ZFOA 2IALA 1U58B 3MREA 3ARYA 3MV7E 1MREH 1PKOA 1MY5A 3EYVB 3PL6C 5EBMB 3MGTA 4E5XA 2J5LC 1KELH 2NY7L 3BVNB 5E00B 1TCRA 3C5SA 3VXUD 4F2MA 3SY0B 1XF2A 3O2VH 1P84J 3DX7B 1UQSB 4LSQL 8FABB 4GJTB 4ZOAA 1QG3A 3EZ8A 2VR9A 4GRLC 3QUYC 4FQLH 1QSEE 5JW4R 1KNOA 4DZBB 1WBZB 5DJ8A 4PJBE 1J8KA 2ZUUA 5CGYD 2JCCF 5JMOC 5HYFA 3VH8G 3V4PH 2EXYC 1IVLA 5BOZG 4DEPC 4B5EA 5ECJE 2VERN 1FCCA 4JM4L 4WHYG 4BQCA 2XV6B 3RWCA 3ZE1F 1N2RB 5I8OH 2CLVB 3S8WA 1WC7B 5ICZA 2CIKB 5ACMA 5KANG 3GHEH 1FNGB 3GGWB 3OJ2C 2JE8A 5DD6A 3WUWB 1ZANH 2LU3A 4FQCL 3GSVA 1Y6KR 4Z7OE 3KGRA 2I60H 4U6XB 3INUH 3MBXL 1DQML 1OTSC 1IC1A 4KRLB 3QI9A 2G9HA 5IFHL 4ZQKB 3L9RA 2AJYH 3WXWH 3GO1L 5HGAB 1UENA 3D69A 3L7EA 4CVXA 4JY6B 3JV0A 1PLGL 5FA3A 1TJGH 3ULVE 3LKPA 2YA1A 1FVCA 2H32H 4HH9B 3SOBL 3L3JB 1UB5A 3QAZB 5DZOA 1GGBL 1X6NA 3L5WB 4FQIH 4GS7B 2ITCA 3AMKA 2DLHA 5JR1H 4X4YB 5DUBB 5GRVL 1U92B 2RBLA 3OKKB 1OTUD 1W2KT 2R1XB 3VXTB 3W39B 2V2WA 1ZHBA 2YKLL 2KDGA 2OJEA 5TDPA 4K23L 3IS0X 1JK8B 4MAUL 3B9KD 3U6RA 1MI5D 3X11B 5BVPL 4RAVA 4GRWB 1X3DA 4TTGA 1X4YA 2Y06H 3D39E 4NP4H 1T2JA 1CL7I 1A1OB 4F9LA 1N5AB 5C0FB 3TESA 3UPRA 1FZJB 1ZT1B 3K7UA 4CDHA 3QNYB 5F9AC 3I6GA 3U36A 4TVSa 3MFFB 5C0RH 1GHFH 4EKXA 3QUMA 3MACH 3NIDF 4YHMH 1YNLH 2YA2A 1YNKH 4HG4J 1A14H 1RZFH 1MFBL 1NC4A 4YZFE 5KVGH 4AZ8A 5HYQB 4R4BA 1YN7B 1G6VK 3CLFH 3RL1A 4G43A 3RA7L 1EEUA 2XA8H 2E9WA 1YEIL 5E8DL 1GIGH 4FQ2H 3UROR 1A3RH 1OP9A 2PXYD 1GOFA 2DKUA 3SE4C 3AREC 2EDTA 3CSYB 4H8WH 2P7TA 4U6YA 5F88A 4GAGL 5BRZB 2X4SA 2YK1H 3OKDB 5IM7A 4XPAL 5EIQA 3RKDC 3WE6A 4OF0A 3H0TA 3EYFA 5D7JB 3TN0A 4YDLB 4OJFL 1NEZG 1V7MH 5IHLB 4WO4D 2J8OA 1X6LA 3DUUA 3D85A 5ICXB 1KJMB 4IJ3C 3U46B 4BH7B 4PGBB 4O2FB 1ZT4A 3LHPH 4B0MM 4NPYB 4M48L 3ZO0A 4R8WL 5CJ8A 3ZKNC 4IMKC 3T0ED 3RX8A 1J86A 4U3CA 1TFHA 5IVOA 1YPZA 4PRHE 2VR5A 1QVOB 3SN6N 2NNAA 1A8JH 4R26H 2Q6WB 2BRQA 5J9PA 1F58L 4Z5RB 1T22A 4PS4H 4PRPA 4TUJB 1NEUA 4HIXH 2FATL 4XAKD 2EYTB 2J8UF 4OFPA 2WIIA 4OFVA 3D25A 4EBQH 3KHOA 1WZKA 1XGYH 3BP4A 4LLDB 1KFAH 3SDCB 4JY4B 2BCKA 3HPLB 4PJ7B 3WMSA 4NUGH 3D2UA 5CUSH 1RD6A 1X5HA 1C12B 3GSQB 3S6CA 1K8DB 4AMKH 4D3CH 4E0RB 3MPCA 3VW3H 4KAQL 4FNLH 4HDIB 4XH2B 1CK0L 3RU8L 4TSBL 4PB9H 5C0CB 3TA3C 1DL7H 3CC5B 1Y6MR 1IQDA 3LD8C 4MDIB 1EMTH 5TDNB 4XVJL 3U79A 3CLEH 1XR8B 3CXHK 1T7ZA 1IGML 4LNRB 4JO3H 4G6KL 4F7MB 3QDME 3E6HB 2CIIB 2PO6B 1J0YA 2V5SA 2B4CC 2V2XB 4AK1A 3IDIA 1J10A 4R0LC 4M62H 1S7SA 4RGNE 4QHMB 3S4SA 4R4FL 4OZIB 4OM0L 3RWGA 2VDPH 3MTRA 1OTTC 3A67L 5GRJL 3ISWA 3H2WA 1LDPH 3KPOA 1BJ1H 2VAAB 4EVNB 1RI8A 2HTKD 3HLAB 4DGYH 4ODBD 4MD5A 1WTGT 5LBSL 3FB6B 2B1AH 2GUOA 4JFDA 4XBEH 4Z8FL 4AEEA 4HX1B 3ZE2E 4JANA 2XQYG 3AXLB 4Y1AA 5B3NA 5HGHB 1CFVL 3ARTA 2QJDA 2NY4B 3RGHA 1QQDB 2YD7A 2HFEB 4HS3B 1JRHH 3L1OH 4F7CB 1MY7A 1EAPB 3ULVH 3LN5B 1JUFA 2HJFB 1HHJA 2UZIH 5AAMA 5IK3A 2OXGA 5JPNA 1XF3B 1NLDL 5TQ2H 2KKQA 4DVRH 5HGDB 1EV2E 4HC1L 1ZLVH 3G5ZA 4ZTPH 1Z3GL 4DKDC 4CGTA 3IYLW 1ZVSB 1A6ZA 3MLZH 4LLVB 3W5NA 4PUBH 3ZZ1A 3Q5OA 4EXKA 1QBML 2VKXA 3S36X 4W4OC 5J12B 2GTZA 1L7TH 5KTEL 4G3YH 5C3TA 4QOKE 5IKCA 2W60A 3ILQD 1QSFA 1BQLH 3L3IA 3GKWL 3MUZ1 4J6RL 4L4VB 4DOHE 3JV6B 1G7PA 3C9NB 4HWEL 5C0AB 4TTDC 1EO5A 2FL5B 1RK0B 4GAYB 5FKPA 3JWDL 1HWGB 4HT1H 3TH3T 1FO0L 1FN4B 3QIWC 1ZHLA 4JM2D 5LKNA 2IFGA 2ZUYA 1X7QB 1WFUA 2FBOJ 4U1NA 4EI5D 1FE8L 1QRKA 3G6DL 4I48B 4D9RD 2C9AA 5C0BD 1T1WB 3FHQA 3S35X 2G5BB 1NFIA 4OB5L 5D7IA 3T1FB 1H8SA 3GJFH 3JWOL 3RDTB 5LCVL 5KG9B 1QFWM 4JFOB 2ADIA 2QQNH 1A22B 1BD2B 1TITA 5DEGB 2FIKB 2CDEB 2DBLH 3NCCB 1KBGL 5HI5D 1NCTA 4DKAA 2ARJA 1UH4A 3DSFL 2BY0A 3WIFB 1KN4H 4M1GH 2EH7L 3SGEI 4R96B 5CEXB 3MRMB 2F54A 3FT4B 4PJEA 2DQDL 1T0NA 4YBLB 1IGCL 3MJ8B 1KB9J 4JZJA 4OQ1A 3QUKA 5FK9B 1MREL 5EBGA 4ETYA 1SVZA 4QF1A 3UBXG 4P3DA 1KELL 3BQUA 3E2HC 3S36H 2X9YA 3LB6C 3LS5H 1X4XA 5I2IB 2P8MA 1JGDA 1FL3A 3O2VL 4LBEA 4MNGA 5HSFA 3WDIA 5L9DH 1UKQA 1XZ0B 3R8BB 3TZVA 1P2CB 3ARGD 3F65A 2HKHH 2EC8A 3IJSA 3QDJE 5D7LB 2MKLC 4FQLL 5GXBB 1D5XA 4TPRH 3ULUC 2MFNA 2JJSA 5H37H 3P0YH 3DXAA 3T0DA 1C7SA 4XVUC 5EFIA 4QTHB 3H42H 2WNGA 3QDGD 4GFTB 3V4PL 4MJ6B 5L2KD 4KKAD 5I66B 2JCCB 5JXEA 4X6DF 3QA3A 4PJFF 5DEFB 4LARH 5CBEA 4NRZA 4X8JA 4WI2A 3FN3A 3S35H 1A7BA 2EEDA 5I8OL 2WINB 5C0GA 5HYJD 4QRPD 4KTYA 4NQCE 3GHEL 4OFYA 2P5EB 1G7IB 4FFZH 1MCWW 1PAMA 1ZANL 4XTRD 1I1AA 3HS0A 3L3HA 1VERA 1A5FH 1O5DT 2QQKH 4MJ5B 5T1KD 2I60L 4PJ9C 3VWKA 3QIUD 1FYTD 2VABB 3INUL 1U3ZA 3MRRA 2P5WD 3DETD 4KDTC 2AJYL 3WXWL 3BHBB 4HBCH 4N68A 5F3BB 3L3OB 4IRSB 1KJ2H 4M5YH 1G7LB 3VXNB 3TEUA 4PRID 1TJGL 4C57C 3C6SB 2NR6D 3ARBC 1JPGA 2Z8VC 1HHIB 4IRJC 2X5PA 2HG5B 4H1LA 4PRPE 1S7VA 3UYOD 2J6EA 3QEQD 3MUY1 1Z2KA 5IVXF 5JR1L 3DVGA 3W9EA 5KSAB 2BNUB 5L8LB 1DCLA 3NN8B 2D31B 2VLJD 4PG2C 5INDB 1LQSR 5T1DH 2Q8BH 1YYLH 3QO1B 4P2OA 1CT8B 4GQPH 1WWBX 4EDXA 1HIMH 1MRFH 1KXQE 4Q2ZB 4PJGE 3RIAF 4IMLA 3VGBA 2W9EH 2YSSB 4IS6A 3IDXH 4WI4A 2PYED 4NQXA 2Y06L 4NP4L 2HFGH 3QIBD 1OL0A 2DM7A 3HMXA 3GSUA 3NCEB 4RISL 3WFEH 2HRLA 2E3VA 2APTA 2V5MA 5BQ7A 4YR6B 5C0RL 1GHFL 1NBZB 3GMQA 3F6IA 2YPVH 3MACL 4YHML 3BIAX 1YNLL 3PNWA 1C08A 1YNKL 4MSWB 3MODH 4M6MH 1A14L 5IBLD 3IU3B 1RZFL 2CGRH 3GJEA 5DK0B 2XFXA 4OKVB 4ZFGH 3WUZA 5KVGL 3P0GB 1UC6A 1EPFA 1HZHH 4M7JH 4WI5A 3CLFL 1OF2B 4QKXB 5LAXB 3BN3B 1AP2B 3HNSH 2HVKB 2XA8L 5M95B 5SWSA 4JFDE 1GIGL 4ZUUA 3WJJC 2H9GB 4NUJA 5E2WH 2BHZA 4FQ2L 1NBQA 3TVMC 2A6KA 5EU6E 2FGWH 1A3RL 4JHBA 2Z8SA 4Y1AE 3LPFA 1N8ZA 4H8WL 5I1AA 2EKSB 4LKCA 4ZS7H 4M7ZB 1CD0A 1HE7A 2XWJA 2YK1L 1YUHB 1RULH 4P23C 1SJXA 3IXAB 4OF5A 3X13A 4LQFH 3NCMA 1V7ML 4FXGA 1WF5A 1A7QH 3ZKQD 3FL7A 5IW6A 3LHPL 5CGTA 3P73A 4CMHB 3NA9H 1MFDH 1V3LA 4KTEH 4HZAA 3BP6A 3EOBA 4HWUA 2E9JA 3HE7D 2NW3B 4R26L 4XCYB 5DRNA 2D0HA 4IOSD 1GL4B 1JPFA 4K8RH 2EDOA 3ALXA 3EO0B 5IR1B 3MLTA 4U7SA 4PS4L 1DN0A 5J13B 4HIXL 2CLZA 3MJ7B 3SKMA 4Y89A 5F1KC 4EBQL 1CVSC 2VYRE 1XGYL 5ESQA 1KFAL 2X41A 2WZPD 3OSKA 3EJYD 4PY7A 4JZOA 3VXRD 5IW1B 1AD0B 4NUGL 5CUSL 4RCAA 5DVMA 2J8UB 5AZEH 4MNHA 1JWUB 1WIOA 4AMKL 4D3CL 2RFXB 1DE4B 4HH8A 2APFA 3VW3L 4FNLL 1CL7H 2BNQD 3OXSB 1P7QB 4PB9L 2HJLB 4YC2B 3RPKA 1DL7L 4N1HB 3QQ3B 4LKXB 2GQHA 2IAMA 3CH1B 1EMTL 3TYFB 5BZWA 1MIMH 1I3UA 4JO3L 1SY6H 5DJYA 3PWUB 5JHDB 1E6JH 5D7IE 3RX5A 2X9WA 4ZFFA 5A2KH 3S7GA 2VUOA 4M62L 1OGTA 3SCMA 3TO2A 3VGAC 1P53A 3D18A 4Z7WA 4YDJA 1EXUB 3ZDXF 2VDPL 2VWEC 5F7LB 1OSPH 1LDPL 2GT9A 3QJHA 2C4FT 5AUMA 3EOTH 3IFOB 5JHLH 3FQUA 1M71A 3LN9A 4J3TA 1Y0LA 4ZFZB 4DGYL 5GSRA 3S34H 5D5MA 5HI3C 2B1AL 1YMHB 2F54E 2BSRB 1E27B 5MENA 4XBEL 4C83A 3OKMA 4MZ3A 4LOUC 3DHMA 1KGCE 3QHTC 4OGYH 3WUWG 4NQDD 3RAJH 4L3ED 1DVFA 2EDKA 2ILLA 3BFOA 3QFJB 3U7WH 3VI3E 3WNKA 3PJSB 1ETZA 1T3FA 2BDNH 2MOVA 1S7RA 4JFFD 4LAQH 4MXQC 5JW5A 1JRHL 3L1OL 2AK4E 1ZE3C 1UB6A 3ULVL 2NY3D 5DWUH 1BOGA 2JF1A 2UZIL 3LV3B 1FBIH 3FOMA 5B38B 5D1QB 5TQ2L 4P2QD 4DVRL 1EFXB 1OLLA 4ZTPL 4GAJH 5IB2A 1JN6A 5J1AB 3F5WA 1CN4A 5C3LD 1XIWC 5DT1H 4JJ5B 4RFNB 5TH2B 3KPRD 2I24N 3MLZL 4K55A 5D1XA 4PUBL 5GS1A 2XQYK 3HCVA 3G08A 5IW3A 4Z0XB 3BAEH 4KI5E 2HTLC 4HIEA 1DLHB 2YPLB 1L7TL 3HG1A 4G3YL 4CW1A 5HHOD 4RFOH 3KPSB 3QHFH 1BQLL 2KPNA 3FT2A 4FG6C 3IDGA 4UQ2A 3PL6B 3T0WA 3G5XB 5FF6B 2J5LB 1MAMH 1T0PB 3I85A 3IDUA 5E7BA 5C0IB 4HT1L 5M7QA 3WYRA 1KYOK 3L3DB 3W2DH 2AJXH 4PG9B 1AO7A 4CDGC 2FEEL 3ULUF 3IXTB 2ZUQC 3QUYB 1BJ8A 4ZYKA 5I6XC 1G7QB 4L8CA 3TCXA 5ABDE 5KJRH 5TF1H 4YBQD 2GEEA 1NDMB 1UFUA 1BVLA 2AKRB 4L9LA 4MQ7A 3LEVH 1AIFA 4U0QB 2IADB 1BFOB 4MJIA 3VH8A 3OGCB 5KANI 2QQNL 4R97B 4OGAC 4DEPB 3BN9D 3FO1B 1X9QA 3MUGA 2DBLL 3OZ9H 5B21A 3LKOA 3U9PH 5L8JB 4FN0A 5CZVH 4JFXA 5HHME 3C5ZD 3RJQB 3ARDD 1KN4L 3TIDB 2LAAA 4M1GL 2H2SC 1DQQB 2ATKA 4FTVB 1HI6A 1I1CA 3EYUH 4M7LH 4F7TB 3T2NH 4DFIA 3K4DA 2C3GA 3HRZB 1H3GA 1MLCB 4WI8A 3MV7D 2KL6A 2W0FA 1RMFH 3RWEB 2EO1A 4JDZB 3S36L 4NC1C 4OIAA 3LS5L 3RVTC 4LRIA 1P1ZB 5D1ZC 3ZHKA 5SX5K 7CGTA 2CO7B 1AHWA 2PR4H 5L9DL 5HVFB 4JDVB 3NCBB 1N6VA 5C0DA 2HKHL 5E1HB 4U49A 2C7UB 1CGUA 1I8KA 1QSED 4RNRA 1EBAA 5ID0A 4TPRL 3AY4A 2WIMA 5KW9H 3SDAA 4YFEA 4N9GB 4U1LA 3H42L 1JWMA 3FTGB 4QRUA 1YEGH 3L6FB 3RTQC 4JHZA 4LARL 3S35L 1XGTB 3PABB 4K9EC 4MD4A 4EN3D 4X6DB 3FAXA 2PW1B 5JLZA 4HIHA 1A9BA 1YY8A 2Y6SD 4WDIA 4KJWD 4FFZL 3PDOB 5HYIA 3KG5A 3MGOB 4F9PC 5T3ZE 4GKSB 2QQKL 1A5FL 4JFED 4HJGB 5DTFB 2R2CA 4JQIH 4MLIA 4HKZA 3MRLB 3CUPB 4HBCL 3T4AB 1QFOA 1XF4B 3LZFH 4HK3J 1KJ2L 4M5YL 3D3VA 3B9KC 1H0DA 3UTTD 2Q7YB 3ULVD 4R4ND 3U0TB 5EO9B 4QXTA 3FCTB 2QV2A 1FFNA 5INCB 3GBNH 4PRDA 2XKNB 2NY5C 4WEUD 3BXNB 4X7TA 1Q9WA 2COQA 4UBDC 5T1DL 3SGEH 5ID1A 1YYLL 2P8LB 5IVXB 1HIML 1MRFL 1N6UA 4Z18A 1WQVT 4BH8A 1R6VA 3IJHA 3MR9A 5L7XH 3MRJA 3DV6B 3VD4A 3WFHB 5JTWA 2W9EL 2WQ8A 3SDXA 1IT9H 4IRZH 3CPLA 2HFGL 3D39D 1I7RB 4CMMB 4YDVA 1VGKB 4KKLD 2HLFD 1T7XA 1FH5H 4YZFF 3WFEL 3M1BA 5FIEA 4Y16D 4QHLA 4WFFE 5CCKH 3BESR 1N64H 2YPVL 1HSAA 3H9SD 2PXYC 3PWPD 4FZ8H 4M6NH 4Z7WE 1JI2A 3MODL 4M6ML 3WS6A 4L29A 2CGRL 4NYLB 3WNLA 1DR9A 1KB5B 1DQDH 4ZFGL 1JE6A 4C55A 5F1NA 1HZHL 4M7JL 2YR3A 4CN6A 4WO4C 5AD0A 3C60D 3FB7B 5D5ME 3HNSL 1BQSA 5GS2D 5J1SC 3MRPB 2X44D 2BSSB 5E2WL 1VFBB 3G6AB 3KXFD 2A77H 2UWEF 5E5MB 3RVUD 4HMCA 3T0EC 5BXFB 2FGWL 3D0VA 2FHBA 3TA3B 5C09D 3LD8B 4ZS7L 3RWHB 5E94B 5CLTA 3SO3C 1RULL 4JZNA 4CRPA 4Y4FD 2PW2A 4LQFL 4XPTH 1A7QL 1BPVA 1LK2A 2AP2A 3B9EA 1XGPB 3HAEA 4B50A 3CX5K 4GXVH 5SWQB 1IM9A 2YUWA 4R0LB 4WU7A 3NA9L 5FA4B 5GHWH 4GOSA 3TPUA 4TOYH 1MFDL 4KTEL 2X4PB 3BRFA 2Z93B 2XXCB 1Z9SA 1I9EA 5FYJE 1JWSB 4P5TD 3DI3B 4ONHB 5EU5B 4NQVA 4KK5C 3WKNA 3PV6A 2G5RA 3K80A 4K8RL 2BVQB 3L3GB 5ICYA 3BPLC 1B4JH 3KLAB 1NGPH 3WV0A 1IJ9A 2A0LC 4HKBB 2HWZH 4CNIA 5CEZE 4ODUA 2DLIA 5AZEL 4GG6F 4DN4H 4U1MA 3O3EB 3LIZH 3QFDB 2YD6A 1AFVH 1ZA6A 3JSSA 1CL7L 1TQBC 5E4EC 1ZS8A 43C9A 3VE0B 1CGVA 5JZ7D 4AIOA 1CICA 1AO7E 3CU7A 1QFPA 4UQ3A 1PYWB 1OQXA 5F7KC 2AJZB 1MIML 3RP1A 5KSBF 1W0VB 1SY6L 1FP5A 3V6ZB 1E6JL 3I6KB 3QUXD 4K94H 5SWZA 1JHKH 2UY6A 1U8HA 4L8SC 1U8NA 1I7ZB 1HKFA 5IHBA 2APWA 2WQRA 2H32B 2R56H 4FQQA 1TCMA 1OSPL 2W0KA 4JFQB 1TLKA 5FGCB 4U0RC 5CP7A 2ZOLA 3EOTL 5JHLL 5C07E 5HPOA 2GJ6D 1P9MA 2P24A 3S34L 2XWBB 1H3UA 6FABH 2D03H 1MUJA 2BSTB 3GMMB 4XC1H 3TV3H 4ZO6A 5T3ZH 1KJVB 1A6AA 4OGYL 1U8OB 3RAJL 3KPLA 4DGIH 1G6RB 3U7WL 4UDTB 1WBXA 3QIWB 2DQFB 4BJLA 1RHHB 2BDNL 3TBSA 4LAQL 4WI9A 4DCQA 2HH0H 3GSWB 5DWUL 5ESVA 1WJ3A 5E24E 1FBIL 3V5KB 1Q0YH 3KLDA 3ILQC 3S9DB 1K8IB 1VFAB 5E9DA 5FM4A 1U8KA 1S9YA 1HSBB 3NCYS 2WWMD 2EZ0D 4GAJL 4CJ1A 3FFDA 3AS1A 3C2AH 5DT1L 1LO4H 3SE8H 2VLKB 1UZ6F 3OAZH 3S97C 3BAEL 4JM2C 1ZOXA 4MCZA 3KYMB 4EI5C 3DTXA 3UBXI 4OCRH 3FB5A 4RFOL 2JIXA 1T83A 4D8PB 3HB3D 4XVTH 3QHFL 4ZDHA 3MJGX 1AKJA 1GOGA 3PWNA 4FXLA 1MLBB 1TZHA 1MAML 3E2HB 3U0PB 1SEQH 5BW7C 3TWCH 1A9EA 4JQVA 1W8OA 1ZEAH 5CJBA 3QI9D 5FCUH 3QEHB 3W2DL 2DLFH 2AJXL 5HI5C 4PJ5E 2UV3A 2GHWB 5FO9A 3D3VE 1LP9F 1B6UA 2GJZB 1FFQA 2VXVH 3B2UD 4WU5A 2NY2D 3QSKB 5TF1L 5KJRL 3EO1A 4EUPH 5JOPE 1BZ9A 1F4HA 2FZ3A 1T5WB 3LEVL 3P77A 4Z7UA 2VC2L 1ACYH 4TSAH 5FB8A 4YK4C 3I3DA 1FFRA 3OZ9L 3O3DA 2X9XA 4MQXC 5DLMH 3U9PL 4GBXC 3JV4B 5CZVL 4DGVH 4FFVD 3ZYOA 3Q3GB 3DMMC 3D0LA 4JKWA 1RZGA 2HT4C 4UT9H 3O6FC 5FUZH 2WSKA 1XF5A 3OKYA 3EYUL 4M7LL 1AD9B 3S37X 3T2NL 1Z5LA 1ZHKA 2HVJA 4PJ9B 1QEWA 5D6CA 3TJHD 2LTQC 3JXAA 4WUUB 5EH1A 3DX8A 1YJDC 5FYJH 4JVUA 1RMFL 5EO1A 3P4MB 5I74C 4M61A 1IMHC 2CXGA 1MH5A 2ENSA 2QKIB 4G8IA 4HV8A 4BSJA 3ARBB 1WAAA 2PR4L 4IRJB 1NC4D 3HZKA 4NO2B 5EU7C 2IC2A 5HHNB 2BNRE 3QR2A 3V5HA 2VXUH 3OHXA 3FO2B 5DHVA 4J3UA 5CEZH 4G9FE 4XTRC 1TVDA 1IAMA 5KW9L 2YUZA 1TJHH 1UACL 4MD0A 4BQ8A 2K1MA 5C0NC 2X4RB 3WHE1 3QIUC 3U9UB 4AIXA 1D6EB 4LLQB 1YEGL 3MMEB 3DETC 4UU9A 4NRXA 3K4ZA 5EZIH 1X5XA 1UXWA 4X7SH 1NCWH 4P5KB 1HYSC 2NR6C 2W07A 1NUDA 3TN0D 5FKAA 4Y5VA 5GSVA 2DIBA 3ARRA 4HPOH 2I07A 5ANME 3U1SH 5L0QC 4IDJH 5E5UB 4D94A 4X7FC 4JQIL 2JB6B 1GXEA 2NQCA 5CINH 3KPPB 3QQ9C 4BSVA 4NHUA 4LK4A 5F44A 3TFKD 3LZFL 4WHYH 3V4VH 3BO8A 1BWWA 4OM1H 3S37H 2NX5A 4PJCF 1F4YH 3T77A 4HJJH 1U8LB 3QYCA 3W11D 1FC1A 1JPTH 1KXTB 3PP4H 2R1WB 4PRPD 2C3HA 5E2TH 3HC0A 1URLA 4M03A 3GBNL 3TVMB 3HI5H 3LDBC 4M6OH 3VFGH 2ZUVA 4PLNC 1A4JA 5F6IC 3D2UD 4WFGE 2Z31C 1B88A 4NZUH 1OSZB 4P49A 3GKZA 3H9YA 3P9MA 2QHLA 3K8LA 5HI4C 3MRDA 4KK6C 5L7XL 3PWJB 4U2YA 2XYCA 1JPST 2XPGA 1IT9L 3ES6B 4IRZL 1YC8A 2LVCA 5FV2A 1IGTB 5DJAB 1AGDB 4K7FB 1FH5L 4Y4KC 4H0GA 4R2GC 1EX0A 4O2EA 1FJ1B 5CCKL 1N64L 3V6OA 4FZ8L 4L4TE 5DI8B 1F4XH 4M6NL 5IJVB 1CFQA 2NTFA 1M7DB 1DQDL 4JREC 1RJZA 2V7NB 3BZ4A 4HUUB 1GVIA 3RWJB 5IMMB 1ZA3B 4HIIA 32C2B 1Q9OA 4JFDD 4B7IA 2E7HA 2QADD 1TNMA 4J3VA 4HWZB 1S9KC 5GGTH 2A77L 4PJ8C 4PTTA 4YHPB 1U58A 1NBYA 5EN2A 4KZEH 4YDIH 1FLTX 5CD3A 3VFMB 1U3HB 4Y1AD 3HE7C 5GGSB 5IJKA 2UWEB 3P0VH 3EYVA 4PGEB 2A83A 3T3PF 5E99H 5JDJA 3MQIA 3RIFK 3QNXB 3IDYC 2PETA 3DX7A 1K2DB 3DOSA 2QSTA 2HT2D 4XPTL 1OAKH 5B8CC 8FABA 1Y6NR 2FJGA 4GXVL 1EERB 3UCRA 1OW0A 5GHWL 1EUUA 3S3SA 3VGAB 3RWFB 1I1FB 4TOYL 4DZBA 4G8GE 3LEYH 1WBZA 2ZG1A 1KACB 5F89B 1MRCH 1JYNA 5IWLC 1MEXH 5E2UH 3DROA 4JHWH 5I30H 2CLVA 5ISZB 2NXZC 1B4JL 1WC7A 1NGPL 2VNCA 3GGWA 2HWZL 1VGEH 5IG7B 2KBGA 1JZ5A 1CXHA 3IGAB 1LE9A 1VPOH 4YIQA 4WWKC 4DN4L 4NRYB 1T03H 3LIZL 1ZKAA 1BFVH 2VZUA 4NNPL 1GRWA 3MV11 4X5WA 4GG6B 5HGAA 3VRLF 5C0JB 3R4DA 2VDRH 2H6PB 4JY6A 4K3EH 4GW1B 5FUCE 4HH9A 2OYPA 2E7LC 4ONGH 3G5VA 4P9HC 1JYVA 1U93A 3ABZA 1FVEB 1I8IB 4WEBH 4K94L 1JFQH 3F7PC 4I9WD 5KSBB 4H20H 2FX9H 1JHKL 1Q9KB 4X5LA 1XIWB 2ZG3A 1LMKA 4X4YA 4Z7UE 3VGFA 3HI1B 1U92A 2ICES 2LU4A 1TNNA 2R1XA 2E8ZA 4RMUA 2R56L 3W39A 2NY3C 1JK8A 5D8JH 3HZYB 3BP7B 3CXDH 3X11A 1XCQA 1NGQH 4PJAE 1ACZA 2VL4A 1MRDH 2D03L 2YEZB 2F54D 5F8RC 6FABL 4G6JH 3RGVC 4XC1L 3MYJB 3BH8B 3E8UH 3FO0H 3TV3L 5D93B 5T3ZL 3OX8B 3QNYA 1OB1B 1XEDA 4DGIL 5D7KE 2X1XR 4Y19A 2GYSA 4MNQB 3ZDZF 4JVPA 1S9VB 1SBSH 1YY9C 3UO1H 4JFPB 2ZUQB 2HH0L 5CJ5A 1I4FA 5I6XB 1MJUH 1EJ6A 4QWWC 5F1OB 3IDNB 4FRWA 4GKZB 3HC4H 5HYQA 1YN7A 3TZVD 2IH3B 1Q0YL 2PNDA 2ICWB 4LFHG 5F70A 2BVOA 5T5FH 5D71H 5I19H 2WV3A 3GMOB 1CIDA 1G0XA 3GMLA 2E27H 4UOJA 4ELMA 4YFLF 3DXAD 4U33A 2V7HA 4J2XA 3C2AL 1X5JA 1FZKB 4KROC 3SJVE 3WLWD 1LO4L 4BKLB 1FNSH 3SE8L 3R0MA 4I4WB 4Z7QE 5EUKB 2EC9U 5KSVB 5JXED 4KI5D 2FLRT 3JBG7 1VADB 4JR9H 3Q48A 5BRZA 1K5NB 4MDJA 4TSCH 4PJDF 4ISVA 4OCRL 3RZWA 5JA8B 1HCVA 4YBQC 4NQTA 4XVTL 4Y5YA 1XFPA 4OFYD 5EZJA 4ZAKC 5ICXA 3RY6C 3U46A 4PGBA 4O2FA 2VJXA 2F5BH 1CDGA 1I1AD 4JDTH 4NPYA 2VISB 1SEQL 3CFBB 3TWCL 5AEAA 5IEHB 5D1ZB 1ZEAL 3BN9C 3UXFA 5FCUL 3WSQH 4V1DB 2DLFL 3RL2A 1SHMA 3RI5F 4NIKB 5FDWA 3RVXC 2VXVL 4Z5RA 3OV6A 1LP9B 4TUJA 3OKNA 4LSRH 2NY0C 4LLDA 3SDCA 4JB9H 3DIFA 5I8EB 4HCRH 3PHQB 1ACYL 4TSAL 3DYOA 4NKMA 3RTQB 5J3HC 1C12A 3GSQA 4P2OD 1K8DA 1NGYA 4E0RA 3TNMB 5DLML 5E56A 2RJMA 2NY1C 4DGVL 1I3GH 4XH2A 1F90H 5HHMD 5C0CA 3DV4A 1OGAB 3IRPX 3K46A 4QO1A 4EXPX 1PX3A 2DBJA 4UT9L 4MDIA 3JVGA 4ESKA 5TDNA 5FUZL 2DLTA 3IDJB 3WIIH 1BGXH 2PN5A 1V3KA 1KOAA 3SBWA 2J1KA 4F7MA 4LCYB 3E6HA 1IARB 1I3RB 2CKBA 2XXMB 5IMLB 5FYJL 1I1YB 2C1PA 4LCWB 5SX5H 4QHMA 4OZIA 4RAUA 2VXTH 3SKNA 3QDJB 1GC1H 4UTBH 4ZNCD 4O02H 2OR7A 1UG9A 4EN3C 5DK2B 2VAAA 3VI4E 2VXUL 3HLAA 1NSNH 4GW5A 5CEZL 5SWSD 5F7EH 3FQXB 1TJHL 4HX1A 2V5RA 3VWJA 5EUOA 2B2XH 1NCUA 4MXWH 4JJHA 5MI0C 4U3XA 3JTSA 3ZSSA 1F4AA 2Z92A 1QQDA 3A6BH 5EZIL 3CFEB 4X7SL 1NCWL 2KUTA 1UVQB 2AXFB 1EAPA 1K4DA 3LN5A 4R4NC 4OF3A 3RNQB 4L1HA 4HPOL 1A0QH 4OZFA 3IETA 5DHYB 3U1SL 1Q1JH 1XF3A 4IDJL 4LHQB 2AEIT 5HGDA 2PXYB 1WT5A 5DEZA 5DMYA 5CINL 3REVB 1U41A 4LPYA 3O4LB 4X99B 1ZVSA 1P4IH 4LLVA 4Z78A 3V4VL 4MA1C 1XGUB 4OM1L 4WO4B 3S37L 1Z6JT 3TT1H 1F4YL 4HJJL 1JPTL 3PP4L 4QNPF 2AQ3A 5E2TL 2BERA 4PJCB 3TO4A 2HLFC 1N7MH 5EO0A 3T0EB 3HI5L 5F9WB 3ZE0E 4M6OL 2EDHA 4R90H 3VFGL 5IROC 3U82B 1G7JB 4KV5F 2V17H 3JV6A 4Q9QH 1R3LB 1A1MB 1AC6A 4NZUL 2DQEH 5C0AA 3GB7B 3SO3B 5BS0B 2ITDB 1X5FA 5JA9A 3F7VB 3FQRA 4XPGH 5GISH 2H2PD 1FN4A 4RWYH 5GZND 2F15A 5DQDH 1KC5H 4HWNA 2CUMA 1B6DA 2IAMD 3MRFB 5BZDB 4KGLA 4N90E 3C60C 4I48A 1B4RA 2V5TA 3CVHA 4XPFH 3GSNA 2MQ0A 3T1FA 3UAJD 3RVUC 3RDTA 4POZC 3Q2CA 3SCMD 4LMQI 4YNYB 1IAIM 1F4XL 1LEKA 2EDLA 3T65B 1OD7A 3KJ6H 1BD2A 2MCG1 2FIKA 1MJJB 3STLB 3BPLB 4Y4FC 1T1ZB 3WIFA 4S2SB 5IT2H 4LLUB 1CFBA 2NYYD 2R1YA 4GRWE 4R96A 5DJ2B 5CEXA 1QR1B 3MRMA 3FT4A 1WLHA 4XBPB 1F13A 4PGCA 5MEND 5GGTL 5K93A 3HPJA 3VXUA 1T1YB 1TQBB 4KZEL 4YDIL 2X7LB 4PJXF 5E4EB 1DVFD 5FK9A 3M17B 4DZ8B 4P5TC 3P0VL 2PF6A 4N8VB 5DRWA 2D2OA 1LNUB 5E99L 3WJLC 3OR7A 1YDPB 2AK1H 4PYGA 4G8EA 3GMRA 4XZUA 2B0SH 4PFEA 1OAKL 1TTFA 7FABH 5J6GB 2H41A 4Y8DC 3RHWF 4LCIH 5FGBA 3SE3C 1NCDL 2E8YA 5GRYA 4WIQA 3FT3B 3LEYL 2EE6A 4LSTH 3HA0A 5GQBA 4QTHA 1W0WB 1MRCL 5DQJB 5F71A 4U0RB 5D1XD 1B3JA 4MJ6A 2JCCA 1MEXL 5E2UL 5GJTH 5DEFA 3FONB 1EHLH 2CH8A 4JHWL 4F37K 5IB5B 5I30L 5BRZE 3F6LA 4ZUTB 3HG1D 1RVFH 2WINA 1I7TA 5D2LF 1N0LA 3N1MC 2X4NA 1XR9B 2P5EA 1G7IA 1VGEL 4Y2DC 3LOWA 5DS8B 5CEZD 3AROA 2HT3C 3QUXC 5IVZB 5TQ0H 3IU4H 5DYOB 5DHXB 4K3DH 1VPOL 4MJ5A 1R5VA 5AZ2H 1T03L 1GGUA 2VABA 1BFVL 1JNHB 1QOKA 4YXKH 3P30H 3BHBA 4ORGB 5F3BA 2F8XC 3L3OA 4IRSA 1W72H 1AO7D 2VDRL 1G7LA 1KSRA 3VXNA 1F6AB 4K3EL 1GZPA 1I75A 4QY8A 4ONGL 4UT6H 5CIPH 2YXMA 2HG5A 4WEBL 1EEZB 1JFQL 4H20L 4C4KO 2FX9L 1E4XH 5KSAA 4DAGH 4PJ7E 4R7NA 3NN8A 5JW4M 4MJID 5INDA 5I1DB 1RZJH 4TNWK 1R5IB 3QO1A 4NN6C 1CT8A 5HDOA 1NAMB 4EI5B 3O11A 2DYPB 1S5HB 5C0CE 5DR5H 4D0CA 5D8JL 1PQZA 1S9WA 3BPOC 3CXDL 1ORQB 1NGQL 4MB3A 3P4NB 1MRDL 5CHNB 4G6JL 1KN2H 3PWVA 2FWOB 3E8UL 3FO0L 4PP2B 1AXIB 1TETH 3UJJH 3OG6B 2EZ0C 4YR6A 1NBZA 2J12B 3IFLH 4ZMAT 1SBSL 3NCYP 3UO1L 2VIRB 3ESVF 4J1UB 4OZIE 4MSWA 5KS9F 3MV8B 2K7QA 5EU4B 4D0DA 1MJUL 3N06B 3RWDB 4HFWA 3HC4L 3DGGA 1T2XA 2HP4A 1MHHB 2AW2A 5JOFB 2EXWD 3HB3C 5LAXA 5T5FL 5E7FA 1AP2A 5D71L 5I19L 4GG8B 5JPMB 2V9RA 4L3CB 4L1DA 4YK4B 4X5XB 3SDAD 3BKMH 3QZWG 4GBXB 2R4SH 2ZOKB 3C09C 1BBJB 3BRGC 1FNSL 3DMMB 4PRBB 4GQ9H 1NH6A 2EKSA 3O6FB 4JR9L 1JTPA 4OCSH 4OLXH 5EZLB 1OY3B 2Z9TA 4TSCL 4NJAH 3IXAA 2QLVB 2CDGB 3OKLB 5GS3A 4G8FA 4XXDB 2AEPH 2LTQB 4PJDB 4HHAA 2F5BL 3QDGB 2XRAH 4JRXB 5J56B 4JDTL 5I74B 4C56B 2AABH 1U2HA 2IH1B 3V4UH 3W5MA 1ZHNB 3W82A 4ONOA 3MOQA 4WEMB 1CF8H 3WSQL 1G7MB 3EDEA 1J8HB 3CDGB 4X0KA 3EGSB 4XCYA 5DRXB 3D3VD 2E7BA 5CGMA 1QYGH 4GRWH 3ZDYF 3BP5B 3NZHH 4PGDB 1BIIB 2N4IA 5IBUB 3MJ7A 4F9LC 4LSRL 5T1KB 1R3HA 4RX4A 4JB9L 4WFHD 5H35B 3B9AA 1FYTB 3QIUB 3T2PA 5F9JB 4HCRL 3TJHC 1AD0A 5EBLB 4L4VE 2J8UA 4X9HA 3HR6A 1JWUA 3UPCA 4NDMB 2A6DA 4FFYH 3RIAK 4WTWA 4CVZB 1YQ2A 2RFXA 5C0AE 1DE4A 1KCKA 2DTSA 1MELA 1FHGA 1AGFB 5IHZA 3VGGA 1I3GL 1F90L 1P7QA 3NABH 5HVWA 4S1DD 4LKXA 4GLRI 1R3KB 5EG6C 5L0QB 3WIIL 3QEQB 1BGXL 2VLJB 3KYNA 3PDDA 3PWUA 3VFUB 5I16B 1QHOA 4IEFB 1XGQB 3BZFB 2GTWB 2ZP0T 4HKJA 2VXTL 1BD2E 1MSPA 1GC1L 4UTBL 4D9LH 1MHEB 4O02L 4X9IA 3IFOA 1DUYB 4EJ1C 4WTZG 4A2LA 4HBQA 3LDBB 1NSNL 5F6IB 1YQVH 1QFWI 4TNVK 2ED8A 2BSRA 2Z31B 3HTLX 4MX7B 5F7EL 1WVZA 5I73B 1IZJA 4UNUA 3GMPA 2B2XL 3UTPE 5GS0H 4MXWL 5CKAA 1MCBA 2CLRA 3PJSA 3TFKC 2R0KH 1P4LA 3A6BL 2IMNA 1HH6A 1V7NH 4PB0H 3V8OA 3A0OA 3BKYH 2R39A 3KNBA 3W11C 2VE6B 4Y4KB 1EJOH 2A6JA 1AQDB 4R2GB 1A0QL 5B38A 5D1QA 1Q1JL 3E6FB 5D7LE 1IM9D 1EFXA 5C7XH 4NCDA 1KUMA 2VLME 4NZDA 5J1AA 5CLWA 4JREB 1MJ8H 2HYMA 1P4IL 2OX5A 4LCCA 4XHJD 4KJPD 4G5ZH 4KRPB 2JCCE 5IOPB 2EDEA 1J88A 3TT1L 1DP0A 2AI0H 1DLHA 2YPLA 3KPSA 4PJ8B 1N7ML 1BVKA 1BZ7B 4I3SH 4R90L 2P5EE 3KHQA 4WW1B 3ZE1E 5C6WH 2V17L 4I5BB 3CFIC 4WFGD 3ET9F 5H2BB 3R8QA 4Q9QL 3G5XA 4MHHG 2DQEL 4RSVA 1JF1B 2VOTA 4KK8D 5L88H 3TM6A 4XPGL 4G7YH 3IDYB 4ZSOA 5GISL 4RWYL 4XP6H 1KJ3H 3L3DA 5DQDL 5B8CB 1ZLSH 1KC5L 5E8OB 4PG9A 3RX7A 1CICD 1FVDB 3QEGH 4HUVB 2V2TB 2AERT 3BPCB 5L2JB 3IXTA 3QUYA 3OMZA 3GMNA 2YS4A 1EZVX 1NDMA 4XPFL 4H26B 4HSQA 1G9MH 1UJTA 5FV1L 5SWZD 3S5LA 2NY6C 2AVGA 2BNQB 4MYWB 1BFOA 3BH9A 5DRZA 2W65B 3KJ6L 1HHKB 4KHXH 1X5KA 5DGRA 2NXZB 5IT2L 2HT2C 3TIDA 4Q97A 1R5WB 2X4UA 3DARA 3AU1B 3PP3K 4G80B 5HDLA 1DQQA 4FTVA 5I1IH 4U1KB 2X4OB 4WWKB 4HLJA 3BD4A 2H1PH 3HRZA 5HGBB 3QWQB 1PGRB 1T4KA 4AIZB 2C1OB 4J4PA 1MHCA 5EOTB 4X6CF 4PJXB 3VXOA 3ARGA 1LVEA 3IDMB 1KIQB 2AK1L 2CDFB 2B0SL 2N7AA 7FABL 2EIEA 5FGRA 2PUQT 4QTIH 2C7UA 4LCIL 1QTYT 3CZFB 4UI2A 1MF2H 5E9DD 5DF0A 2YN3A 4G8GD 2GY5A 4ZO7A 4PYHA 4LSTL 5T1LD 1IGJB 5E8PB 4N9GA 2Q20A 3BGMB 2L7JA 1RUKH 2MJWA 2A2QT 1J0KA 5HHQB 2NY3B 3TNNB 1NGWB 1OARH 4OCLC 5GJTL 1FZOB 1EHLL 1D6VH 1KTLB 2SEBA 4P2QB 3PABA 3MNZB 4WI6A 1RVFL 3RGVB 3WXVH 2PW1A 2JIXD 3PGDA 3ULSA 4KVCH 5DFVD 2WWKT 1AKJD 5FO8B 3PDOA 3IU4L 5TQ0L 2WK2A 1G1YA 5K9QG 5D2LB 4K3DL 3BDYH 3KPRB 3BW9B 5AZ2L 4HJGA 3E1F1 4Q9RH 3MRLA 4HK0A 3CUPA 3QQNA 4YXKL 3P30L 1T2QH 5HHPB 1YMMB 1XF4A 1W72L 3FOLA 1AXTH 5HHOB 3VXMA 4N1EA 5FYLE 1KXVC 4WWID 4HC1A 1UZ8B 4RGMC 2GAZB 5D7SH 4UT6L 1BVZA 3LQAH 1CXFA 4N0CD 5INCA 5BV7C 1E4XL 4KROB 2C4FU 5GGRA 4DAGL 5CSZB 2Y4SA 3DO7A 3BXNA 4HMEA 1RZJL 2J8UE 5DSCB 5JW4Q 2BY1A 3DJ9A 4E41B 4F33B 3BQUC 4PLOB 3AC0A 4M6AA 4PD4J 1PKQB 4D9QD 3VD3A 1AGEB 5DR5L 3FRPG 3DV6A 1ZLUK 4ZAKB 1X5ZA 5HYSA 4PJHF 3C8DA 3PDGA 3VFVB 1KN2L 2ZCLH 3QH3B 4CMMA 4JG1H 1DBMH 1MIEH 1YNTA 4IMKA 3G04A 1TETL 1EVTC 1K6QH 3UJJL 2JJSC 5JHDE 1FO0A 5IMKB 5I1LB 5GGUA 3IFLL 1RK1B 5TGBB 2ZSVA 2J88H 4NYLA 2ENYA 3KJ4C 2O93L 1NUNB 5KS9B 1I9JH 2NY0B 2YUVA 4XNMA 4NKDA 3FB7A 3B3IB 3I3BA 1CGWA 2OK0H 1VFBA 3BKML 3G6AA 5E5MA 3J7HA 2NY1B 2R4SL 3VWKC 1GSMA 1ZT7A 2AGJH 5SV3A 3QFJE 4GQ9L 2HRPH 2XKSA 4OCSL 4OLXL 5E94A 1VFOA 3FN0H 4NJAL 3BD5A 1Z9MA 2AXGA 3VFSB 1DJSA 2R2EA 5F72S 1HXMB 5ADPH 1XGPA 3RZCC 1WCBB 5SWQA 2O26U 4WI3A 3EJZD 3WN5A 1ZAGA 2XRAL 1ZLVK 2AABL 4MVBD 4PJ5B 3V4UL 1FNHA 2Z93A 5DMKA 2ATPB 3T4YA 4W6YB 1SJEB 1CF8L 1G9EA 5IIEB 4EN3B 4CU7A 4ONHA 5FCSH 1WIUA 3TBVA 2NX5D 1J87A 5IB1B 2AJVH 1QYGL 1JP5A 1DSFH 3H9HB 4U1IB 3P9LB 3VXRA 2YPLE 4WFEE 5LVEA 3L3GA 3NZHL 4JFEB 1MCOH 1YN6A 1YPZF 1JTOA 3KLAA 3KPSE 1AXSB 4GRMB 4HKBA 5AG9A 5MI0B 5C0EB 4X9GA 3V79C 3B8SA 4FFYL 3O3EA 4I2XA 3QFDA 3MRGA 5FO7B 3ILPB 1HK6A 1MCQA 1QLRB 2IANB 4N8VG 3NABL 3VE0A 1EUTA 3Q6FB 2Z8WC 4NO3A 1INQB 3SPVB 1PYWA 3BKCH 1W0VA 4FOMA 2IQAA 2WBJA 5DVKA 5DJDB 3I6KA 5IFJB 4N0FB 1KPRB 1FFOB 4MA1B 1T6VN 1I7ZA 3SDDA 2X89A 2H32A 1B9ZA 3BKJH 4D9LL 4W4OA 4JGUA 4JFQA 5CP3H 4HGKC 3VRIB 4CKVX 4G9FB 2W91A 4TVPD 3L3KA 5HDQH 2HJKA 1T7WA 4OZHF 2XWBA 5ACZB 1ZWIB 1DQJA 1YQVL 1UWXK 2BSTA 5EU3B 3H9SB 3QG7H 1SYVB 4MS8C 5JQHC 1U8OA 4S1QH 5GS0L 2GK0B 4UDTA 3QIWA 1BHGA 2DQFA 1U8JB 3VD9A 4UOW1 4XP4H 4DVBB 2R0KL 2C3VB 3QUZC 4LSQH 1V7NL 4D0BB 4UIMA 4YXHH 4PB0L 3VXSA 5FYLH 4YAQB 2EIDA 3BKYL 1NGXB 3C60B 2FH8A 4P2RB 1EJOL 5E70A 3V5KA 3KXFB 1K8IA 2ADGA 5C7XL 3UP1A 5EWIH 1HSBA 2F19H 3QRFM 1UWEH 1LK3H 5C09B 2NZ9D 1RZ7H 1G84A 5D2NA 1MJ8L 4Y4FB 2VLKA 1XGRA 4G5ZL 2Q86B 5I17B 2IAMC 2AI0L 3KYMA 4ZODA 5DMJB 5T3XD 4X6DE 3CFKB 4PJFE 3CK0H 4AYFA 1G9NH 4TUOB 3RKPA 4I3SL 3EFDH 1IAOB 3QWOB 1JZ6A 3ROLB 1JGVH 1MLBA 4P5TB 2DQHH 4GLRH 3QXWA 5L88L 4G7YL 4XP6L 1KJ3L 2VQUA 3QEHA 4Y5XB 5JIIA 1IC4H 1ZLSL 1JCKA 2P48B 3QEGL 1KIRB 2EDWA 4AENB 3X3GH 2GJZA 4YGAB 1QSVA 2D7MA 3HMWH 3AFLA 2Z4QB 4PP1D 1G9ML 2UVFA 3OKOB 4OD1H 1T5WA 4JKKA 4ZUVB 2Z35A 2QQLH 2Y7QA 1DVFC 2BVUA 3BMVA 2ESVE 2CD0A 2E5EA 1CFTA 4KHXL 5IVXE 1QFWH 4ZXBC 3UTSA 2H45A 4CU6A 1QHPA 1RZKH 3Q3GA 4YHIA 4U6HA 5CAYB 4Q0XH 2DWEB 1FG2A 1ULVA 3I6LE 3P3YA 4Y2DB 4JN2B 5I1IL 1WFOA 4P3CH 4GKOA 1RU9H 4PJ9A 1NMCC 2H1PL 1F3DH 4Y19D 4KDTA 2EYSA 4Y7MA 1R3JA 1HXYA 5D1XC 1BJ1J 2PTTB 4PJEF 5GS1C 4MZ2A 2QKIA 3TIEA 4BZ2H 5FFLA 5CKGA 4IRJA 4BFIA 4WNQB 1SBBA 3CFCH 4X6CB 4NO2A 1WISA 4I1NB 1FC2D 5HHNA 1J0ZA 4QTIL 2OL3B 4JPIB 1T80A 3FO2A 4ZFOB 4LCUB 2IALB 3MREB 1D9KC 1MF2L 3LQZB 5IBUG 3AB0C 4PG2A 3F7RA 1MFAH 3GIVB 3MGTB 4E5XB 4F2MB 2XT1B 4LPVA 1XF2B 1RUKL 3U9UA 1RUPH 3VJ6B 1D6EA 4LLQA 3GK8H 3RJDA 3MCKA 2EE2A 1OARL 4Z7NF 3BPOB 2IBBA 3N1FC 1D6VL 4QT5A 5BRZD 3VU2A 4LPWA 5I1KH 3WXVL 5GJSH 5DJZB 1KNOB 1UM6H 1AY1H 4R8WH 4KVCL 4G9DB 3QO0B 5DJ8B 2QR0A 3FN9A 3SHSA 1KF9B 2EEAA 3BDYL 2JB6A 4Y4HC 4Q9RL 3KPPA 5GS0D 3QISA 4Q6YA 2YMXH 2VDOH 5BO1H 1T2QL 3V0VB 1AXTL 5ICZB 1KTDB 2FYYA 4XC3H 2BY2A 1SJVA 2DWDB 2ZPKH 4QRRE 5DD6B 5D7SL 1MCHA 2R1WA 2LFGA 4OTXH 3LQAL 1CLZH 3SGJA 3TVMA 3LKNB 3SDCD 3C09B 2JELH 3OBAA 4LASH 2G9HB 3P11H 3L9RB 3RVVD 5EBWB 4NO0B 4O2CA 43CAB 4JCLA 5FA3B 4LRIC 4JVWA 1JV5B 4YEFA 1FVCB 5C0CD 1Q9LB 3TH2T 5IESH 2DAVA 2DM2A 1RIHH 1WBYA 2ITCB 3U30C 4OV5B 2ZCLL 4KK9D 1IGTA 4JG1L 1AGDA 1DBML 5DJAA 5I1JH 1MIEL 3QQ4A 2DQJH 3GDBA 2F8VA 4K7FA 2NW2A 3AY4C 1K6QL 4URTB 2EIBA 2XA3A 4PJHB 4OI7A 4FQHA 2V2WB 1ZHBB 4W6XB 2OCFD 3QJFA 4KPHH 4PY8I 5TDPB 5IJVA 3AS3A 3U6RB 3CSBA 2J88L 4LF3B 4RAVB 3H7BA 1M7DA 5FGCE 3OXRB 4M00A 1I9JL 3ZDXE 3RWJA 1T1XB 5IMMA 4DQOH 1JZ8A 2BVPA 1F3JB 3I6GB 2OK0L 2B5IC 3QUMB 4X6EA 4HWZA 3WCYA 1T66C 5IB4B 3VWJD 1QBBA 4WV1B 2AGJL 3VFMA 1U3HA 2UWEA 4LU5H 4APQB 2NY4D 1FNEB 2A73A 4XX1G 4PRNB 1J1OH 2HRPL 5ITFA 1IAKB 3FN0L 1TZGH 2L0DA 2ZUXA 3MRQA 5DXWA 3S3JA 1K2DA 3UJTH 2RCSH 4ONFH 5ADPL 2V9QA 4S0SD 4PRHA 1I1FA 1BQHB 3HI6H 2P7TB 3O3AB 2AV7B 2X4SB 3UMTA 5F89A 2G60H 2VLKE 3EYFB 1QBAA 1TXKA 5E4IA 3D85B 2AJVL 4WTZA 1DSFL 1ZT4B 2OTPA 3OB0K 1MCOL 3NTCH 3TO4D 1SEBA 1KTKE 3KWWB 2I27N 1LEGA 5IV2B 3T0BA 4L4VD 4OQTH 1YPZB 3IGAA 2NNAB 4NRYA 5C0AD 1FNFA 4DKFH 1KB5H 4HKXA 4WW2A 5KVDH 4HUWB 3QDMA 4HEME 2H6PA 4GW1A 4CVWA 3BKCL 3U4EB 4Q58C 2A74B 1BZQK 5GGQH 2BCKB 1RIVH 3ULUE 1FVEA 4J3SA 1FZMB 3MO1B 5IHUH 5KSBA 2QTEA 1Q9KA 3RDTD 4E42B 3HI1A 3LQMA 1UXSB 3TBTA 1BD2D 5FECA 1IQDB 3BKJL 4BM7A 4LHUB 1LO5B 3ARSA 3CDCA 4MHHI 2DKMA 4W4NA 2CJUH 3HZYA 3BP7A 5HDQL 1UM5H 1RZ8A 1CXKA 1FNLA 1HH9B 1DUZB 2B4CH 5E1AB 1N26A 4AT6B 1RUQH 3MYJA 1S7SB 3QG7L 5DVNA 4OUOA 2RIKA 4OZHB 3S4SB 1QRNB 1OP5K 3OX8A 3DBXB 3U7AA 1ZSDA 1OB1A 4S1QL 5I15H 3RWGB 4B7LA 4WUUE 3S88H 3FFCB 2BHYA 4XP4L 2ICWI 3UZQA 1MCPH 5DVOA 5T1MA 4XHJC 4YXHL 1A7PL 3BUTA 4JFPA 5FYKU 5FYLL 3OWEA 4MD5B 3O9WA 3HE6C 4GKZA 4G42B 4N1CA 2IH3A 4U2ZA 2ICWA 4NZRH 2ARWA 1HQRB 2NY6B 2Q76A 1JBJA 4JANB 3V7MA 4DWHA 3GMOA 5EWIL 2F19L 2FNBA 1UWEL 1LK3L 5ALCH 1N3NA 4XRCB 5A3IC 3IT8D 1RZ7L 4R3SB 1FCGA 1FZKA 4HUXB 4BKLA 5EUKA 4QOKA 1JUFB 4OLUH 2WM0A 4P4KB 5KSVA 1HHJB 3L5HA 1CICC 1IM3A 1VADA 5JPNB 1K5NA 1I8LA 4PBWD 1QLEH 4LPCA 3UDWA 3B5TA 4JE4B 3G5ZB 5J57B 1ES0B 1Z0MA 3CK0L 3D87B 1G9NL 4M8VA 2P5ED 3EFDL 1JGVL 3ARQA 3D9AH 2DQHL 3LAFA 1A6ZB 35C8H 3VXPB 4N0RA 3CFBA 3UYPA 5LXGH 5D1ZA 3VRJB 4BQ9A 2DM4A 4KXZI 1ZMYA 4RRPG 4V1DA 1IC4L 4IRSD 4N5ED 1J1PH 2W60B 4HGMA 3KDMA 4KUCD 1QSFB 3X3GL 3BZDA 3L3IB 1P9MC 1TMCB 2R2BA 5IP4A 4NFDA 4RMQA 2J3SA 4GUPB 4RQQB 3HMWL 4LLYB 5B4MD 4Z7VF 1S78C 4OD1L 4OI8A 2QQLL 3VA2C 5FKPB 1A2YB 5I8EA 5KSAD 3PHQA 5MHSE 2VQ1A 1G6RH 5BJTB 1OOAA 3RTQA 1ZHLB 3U48A 3TNMA 1QFWL 1MCFA 3PP3H 4K3JH 4U1NB 1RZKL 1OGAA 5SV4A 2YRPA 4Q0XL 4RISH 2P44B 5EIVA 3IDJA 1JGUH 3IKCB 4P3CL 4L3AA 1RU9L 2ADIB 4LCYA 1INDH 1OD9A 2L7UA 1I3RA 5IMLA 3L7FB 1I1YA 4LCWA 5HPMA 1IEBB 2ARJB 1S5IH 1JJUA 4H0HB 1CLOH 1NFKA 2FSEA 4GKNA 3QDJA 1GC1C 1C8PA 4RGMB 4BZ2L 1SY6A 3CFCL 4PJEB 2V5YA 1T0NB 5DK2A 1NKOA 3RRQA 1PZUB 2F74B 5BV7B 1CDUA 3KPMB 2IG2H 4RMTA 1QNZH 4OCXH 3QUKB 1GGYA 1JZ7A 1EEYA 3THMH 1XH3A 4KI1A 3OJMB 1MFAL 4GXUM 4QF1B 3QRGH 1TVBB 4QXGH 3BQUB 1T0MB 4WRLA 4XWOD 4YGVB 4PJIF 3SE9H 1RUPL 2P8MB 4JQVC 2HMIC 3MV9B 1JGDB 1KCVH 1FL3B 3GK8L 4MNGB 2UWEE 4L5FH 4NQCA 3KYAA 4HAGA 2APVA 2EDYA 2VXQH 2E9BA 2H3NB 4RDQF 1A1NA 5I1KL 4ODVH 5TDOA 5GJSL 2D9CA 5A2IH 1UM6L 1IFHH 1AY1L 3RNQA 3ULUH 3DXAB 5DHYA 5F1SA 2D9QB 5EFIB 3MLUH 1MCNA 4F7EB 4NCC1 2B20A 3RI5K 1VESA 4IBLT 4NSKB 1MCRA 1B0GA 3IKKA 3REVA 1UWGH 3QA3B 2VWEE 1EZVY 1O7SA 1N6QH 5CBEB 3O4LA 4NRZB 4X99A 2YMXL 2VDOL 1BX2B 4FQXA 5BO1L 4I0CC 2B7DT 3PQYB 2BVYA 5FYLD 1XGUA 4XC3L 3CMGA 2VH5H 2ZPKL 5EORH 1ONQA 1GGIH 4MGXA 5ISZE 4OTXL 1CLZL 3FKUS 4HLZG 4RX4D 4DKEH 3VWKB 2X4QA 3MRRB 2JELL 3I84A 4LASL 1G7JA 2DTMH 4WHCA 3P11L 4TN9A 5I0DA 1R3LA 1A1MA 4PJGA 4U3HA 3NGBC 4MAYC 1ZLUH 4ZOEA 5BS0A 2ITDA 3ARUA 3UTQA 1JPGB 1P7QD 4GG6E 1WFNA 1VKXB 1HHHB 5IESL 4H1LB 3MRFA 5IQ9B 3RZCB 1OHQA 1RIHL 3BEWB 5BZDA 4BFEA 3EYSH 1LO3H 3EYOB 4ODTH 3MOAH 5I1JL 2DQJL 5HD8C 4NZTH 1JL8A 5KSBE 3SDXF 3DX9B 4KPHL 2FBJH 4XCEA 5A16A 3QPQC 3T65A 4O5LH 4NC2B 2XTJC 1IKFH 1EAJA 2EDDA 3CNKA 3FQWA 1MJJA 1VB9A 4OV6F 3STLA 3WFZA 2XWTA 1T1ZA 1QACA 3DUSB 1MWAB 3GSUB 1DBAH 4DQOL 5BQ7B 5EU6A 5TF0A 1QR1A 12E8H 3EJZC 3MZTA 3GHBH 1C08B 1CG9B 2UZYB 3TF7C 1U2CA 2VLRE 4ZS6C 3M17A 4MNQE 2XFXB 3QFJD 4DZ8A 4LU5L 1INEH 1J1OL 1LNUA 4MMXC 1JHTA 1TZGL 1CD1A 4WJ5B 3VD5A 3ZYZA 3UJTL 2RCSL 5SWSB 3NIGF 4LVOC 4ONFL 3B6SB 5D1QD 3IF1A 2EDQA 3ZKXC 1EFXD 2C5DC 2VQTA 4UV7H 1JIBA 5E8NA 1ORSB 1N8ZB 3HI6L 1O7VA 4LKCB 4OLYH 3MNWA 1CFSB 1W0WA 2G60L 3X13B 2VN4A 3OAZK 3TCLB 1T20B 4FXGB 2CK0H 3ESUF 5DO2D 2DL9A 3FONA 4JPWH 1BOYA 4ZUWB 5IB5A 1A6VH 1UZ6E 2YPLD 1FL6B 4WFED 1S9XB 4X7CC 3P73B 1X5LA 3NTCL 3KPSD 3O41B 4P9MH 4ELKB 4DTGH 1XR9A 4JPKH 3VFOA 2W1NA 2DQTH 4KKNA 5B3JF 5LGJA 3EOBB 3MA7B 5IVZA 4OQTL 5DYOA 4X9BA 4PPTA 3V6OC 3QUZB 4NC1E 1WZMA 3RBSA 5DRNB 2JB5H 3K4AA 2BSED 1JPFB 5AWNH 1JNHA 4NT6B 4DKFL 4HGWA 5I76B 2VITA 4M1CC 1AR1D 1KB5L 2DJSA 3MLTB 4V1DE 4XHQA 4CADA 5KVDL 3FB8B 1DN0B 2FX7H 3CDYA 4K7PY 2CLZB 1F6AA 3SKMB 4GT7A 3QUYD 4LLMA 1D3CA 1WZLA 5GGQL 4PY7B 4JZOB 1RIVL 3CSGA 3VDAA 4LL9A 2NTSP 3R06B 1LP9E 4MNHB 4ODHH 5IHUL 2XY1A 1EEZA 4HZLB 2NLJB 2WUCH 3CGTA 3O4OC 4HIJA 5F3HB 1R5IA 2IAMB 1RURH 1NAMA 2D7OA 1ND0B 2YBRB 1BMGA 1UWXH 1OGAE 2CJUL 1ORQA 1P6AB 4KY1H 1UM5L 3VFNA 5DJYB 2F9BT 4ZFFB 3P4NA 2B4CL 4UOW0 4FTVD 5CHNA 1RUQL 2XZZA 1OGTB 5EOQH 5DUPH 1L6XA 1QPPA 2F53B 2FIRT 1CFNB 4YDJB 5I15L 1OTSD 3S88L 1QBLH 2AK4A 4BSWA 5IF0A 4JRWA 3RQ3A 4LCWE 4J4PD 2GT9B 3QJHB 2VIRA 1MCPL 4J1UA 3ZYIA 4UUJB 1M71B 2A6IB 4QHKI 3O6LH 3RHWK 1X5AA 1E4KC 4XXCA 5MENB 1WFTA 3OKMB 5JOFA 4NZRL 1DEEA 2Y72A 4YFLI 1H3PH 5GGVY 5JPMA 1NAKH 1DVFB 4L3CA 5ALCL 4X5XA 4S0TD 4OUUB 1KPVA 2VDMH 4NGHH 5DC4B 4GBXA 4ZXBB 2YHGA 1BBJA 1UB6B 3DMMA 3PIQB 4OLUL 4PRBA 5D6DC 3O6FA 3FOMB 4PLJC 5EZLA 4U1HA 4XP9H 1QLEL 4OF6A 2CDGA 2OM5A 3ARWA 1QA9B 4XXDA 1NMCB 3CZJA 2DQIH 4PJDA 4GS7C 2PKDA 4NNYA 3F5WB 3D9AL 4JRXA 4C56A 5D1XB 35C8L 5GS1B 5LWYH 5LXGL 4OCWH 3EBAA 3O4LE 3N50A 4IOIB 1J8HA 4LVHC 3HG1B 4K2UH 1J1PL 3CDGA 3EGSA 5DRXA 3VXMD 3O45B 3NBNA 3KS0H 4LFHD 1D9KB 3AB0B 1EK3A 1EHAA 4UQ2B 4PGDA 1BIIA 3O2DA 2WP3O 4PJCE 3T0EE 5H35A 5F9JA 1W0YT 3CXHJ 4Z7VB 1CR9H 1BBDH 1G6RL 4I0PB 4NDMA 4NKOA 4CVZA 2YD2A 4K3JL 3NZ8A 2OJZH 1AGFA 3FRUB 5DMGC 5BS0E 4DJMA 2ICEA 1UJ3A 4L8CB 3DRTA 1H3XA 1UGNA 3OGOE 1MJ7H 2BMKB 2M2DA 1BVLB 4LVNB 3F12B 4XMPH 1PSKH 4QEGA 4MQ7B 1JGUL 4M3JA 2ZNWA 4P46C 4LDOB 4MJIB 4Y4HB 1INDL 3GEWB 5ILTH 2VO5A 4KKCC 3QXDA 3LKOB 2VL5B 5CD5C 5DD5H 1BQHG 1S5IL 3K2UH 3MRBA 3BZFA 1CLOL 4G6AC 5DJ6B 2J4WH 4LPXA 5E8EA 4JFHD 4IHOB 1HI6B 3MV01 1DANT 4BK5A 3C6LA 2IG2L 4Y5YC 1QNZL 4OCXL 3PHSA 4NN7B 1T7VA 3THML 3VMPA 1C16B 1CE1H 1NDGA 1WAAF 4MX7A 1IAII 3QRGL 4KKBC 3B9DA 4X8XA 4QXGL 3VCLB 1Q0XH 1LD9A 4XNZC 1HHGB 3SE9L 1KCVL 5C2BH 4RFEA 4LSVH 4L5FL 2VXQL 4PJIB 5GIRB 3U30B 5ETUA 1PZ5A 4RNRB 4ODVL 1HILB 5ADOH 5ID0B 3T3PE 2VE6A 1IFHL 3PG2A 4Y4KA 3ULUL 1MHPH 4QHNA 2XIDA 4KXZH 4U1LB 3MLUL 2X70A 1YECH 2GSGA 4HS8H 1JWMB 2VLLB 4QRUB 3C8HA 4PTUB 3RVVC 1QSZA 1UWGL 4H5SA 1N6QL 1RV6X 2Y5TA 3QEUA 4MD4B 1RAMA 1M7IA 4F57H 4K9EH 5LGHH 5I1GH 4OCNC 1N5YH 5JLZB 1YEDB 5JW4N 4HIHB 4LHUG 1H5BA 2VH5L 3MRIB 3JVGC 1RHFA 5EORL 2GKIA 2PTUA 1IGIH 2B5IB 1GGIL 4KK9C 4PJ8A 4ENEC 3SBWC 4DKEL 4WW1A 4HKZB 4QCIB 4OF8A 2DTML 2BVEA 4I5BA 5H2BA 1U8PB 3S4SG 1T5XB 1L0QA 3DURB 3QDAA 1EO7A 1JF1A 1F2QA 4YPGB 5D72H 1H0DB 3O3BA 2BJMH 2ICCA 5TE7H 4TQEH 4HUVA 5E8OA 1ED3A 4P0DA 1MNUH 2V2TA 1FFNB 5L2JA 2GY7B 2H8PB 3EYSL 4PRDB 5MEPB 4LPUA 1GZQA 5F9DC 1LO3L 3VRLE 4ODTL 1OAUH 3MOAL 4NBXB 2NY5H 1IL1B 1DFBH 4NZTL 1II4E 2WBJD 2DD8H 2B39A 2Y1VA 5FHAH 3VWJC 4BH8B 3TLRA 2FBJL 3IJHB 3MR9B 3HZVB 3SDDD 3DVNB 4O5LL 2X89D 2EIZB 3SDXB 1IKFL 2JK5B 4LHJB 4EUPA 3S96B 3CPLB 3GUTB 2WAHA 4D9RE 4S11A 5C0BE 3I75A 4UILH 1DBAL 3STBA 4P4RB 1R5WA 4G80A 5DDHA 1OWWA 4HS6B 12E8L 3GHBL 4WWKA 1J05B 4TTDD 5F6HJ 5I71C 1WT5C 1KULA 4L29B 2FR4A 5HGBA 3O3UN 1C5DB 3QIWD 4AIZA 3ARFC 4OAWB 1PFCA 4UIKH 5EOTA 1INEL 4PJXA 4A6YL 3IDMA 5IB3B 3MV8E 3TP4A 3VXSD 3ZDZE 2CDFA 1IGFH 2ZG2A 5JDSB 3TO4C 2CUIA 4K3GA 3O8XA 3CZFA 3D0VB 4UV7L 3N1PC 4XCFH 3MBEA 1IGJA 5E8PA 5GZOD 5CZXD 1MVFA 4L8BA 4OLYL 5JIHA 3V95A 1IILE 3WD5H 1I85A 3L5XH 2VLKD 3HUJE 5HHQA 4HJ0C 3OB0H 3TNNA 1NGWA 2CK0L 5I1HH 1X5GA 4GMSH 1KTLA 1KCRH 1LK2B 1T7YA 1OAXH 2HLAB 4JPWL 4RZCB 3HR5B 1A6VL 3OF6A 3HAEB 4G6FB 4JKLA 3MNZA 3K0WA 3RGVA 3KAAA 5FOBB 2X05A 3TPUB 1P7KB 1X4ZA 3IFPA 4P9ML 4DTGL 4JPKL 2DQTL 4PJDE 5FO8A 2EH8H 5K59F 4LEXH 1CE6B 3QDGE 4JRXE 5D2LA 3VFPB 4LLWA 3WDHA 5J89A 4C56E 4QYOB 3UZVB 1A6PA 3LB6D 3V5DB 2JB5L 5F1IA 4NQVB 1A64A 4GRLB 5AWNL 1FRGH 2IPKB 3HE6B 2UY7A 2Z0BA 1J8HE 1YMMA 5EU7E 3T0AA 2FX7L 2E6JA 2GFBA 5GRXG 1QZ1A 3LRGA 1KCSH 1CTNA 4XBGA 3WHXA 1YEEH 1UZ8A 2GAZA 5HVGB 4BQ6A 2G75B 2O61B 2VC2H 3ULUD 2ZCHH 4ODHL 2R0LH 1HKLH 1R0AH 1PEWA 1DN2A 1ZA6B 1FYTE 1VACA 2WUCL 2GJJA 4U7MA 2D0FA 5CSZA 4N0UB 1G0YR 4PGZA 5C07A 1CICB 1VEOA 5DSCA 4E41A 1RURL 5DJ0B 4PRIE 3W9DB 3UTSD 1HQ4B 3B9VA 1CGTA 4X7EC 4KY1L 3CD4A 3C8KA 1OP5H 4ZAKA 3RY6A 5SWZB 3MLVH 3QEQE 5CGYC 4WI7A 3QH3A 5DQ9B 3VFVA 5FGBC 5EOQL 5DUPL 1FYHB 2VLJE 4PJ9D 3GSOB 2MPAH 1IE5A 4E9LA 5IMKA 5I1LA 1QBLL 4WUUD 1NCNA 4RBPK 2QEJA 1MPAH 1RK1A 1KLGB 4RRPA 5CP7B 2D4FA 3W0WB 4ALAH 1S7QA 3LKRB 1S7XB 3O6LL 1TTUA 3ARBD 1E28A 4DN3H 1CBVH 3DWTA 4IRJD 1WWWX 4ODXB 5KS9A 5LQBH 3QWRA 4S10A 2BC4B 3PGCA 1NGZA 4MQSB 1UACH 1RJLA 1H3PL 1KPUA 3EOYG 3KPLB 1NAKL 4M7LT 2VSCA 1EHXA 1WBXB 2OTUB 3N85H 1J7VR 4NGHL 2VDML 2VZ1A 4XNXH 2FX8H 4NJ9H 5ESVB 1A7NH 5C6TL 3ECBA 4PJFB 4IRSC 4N5EC 5ERWB 4ELMF 4XP9L 2YZ1A 1P84K 5GGTA 5KN5B 4H1LG 2V9TA 5B4MC 4RMRA 2DQIL 2X10A 3FFDB 4HUKB 3ROOB 1OTUC 1M6OB 1FL5B 2ERJC 4PJ5A 5LWYL 5DURB 4OCWL 3FQNA 1NAMH 3DTXB 2CRYA 3FJTA 4K2UL 4AEHH 3F7YB 4NQSA 1XF1A 5IB1A 3H9HA 1AKJB 3P9LA 1UA6H 2FHFA 3AREB 2ESVB 5F7YC 3TVMD 4GRMA 5BMFH 1H15A 4QNPE 5MHSD 1CR9L 1BBDL 3OTTA 1NC2B 1UKSA 4GMTH 1ODAA 1P6FA 5J0BA 1NEZA 3ILPA 2OJZL 2AQ1A 4IJ3B 5JNYA 4XX1E 1LEIA 4KV5E 3C08H 3DUHA 1HOCA 1QLRA 2IANA 2IPUG 4U05A 4OZ4A 5HY9B 3JTTB 1MJ7L 1INQA 1BZ9B 4XMPL 1PSKL 4JRYB 3T1WA 2RAMA 3P77B 5KAQF 4KMTH 1MFEH 4BA8A 4AY0A 5ILTL 4N0FA 3O3DB 3IB4A 2DM3A 1FFOA 1QFHA 2BNQE 5DD5L 1EGJA 3K2UL 2IJ0C 3D0LB 1BP3B 2BNRA 2J4WL 3SQBA 1TPXC 4G9FA 3CVIH 4R9HA 3N0PB 4YXLH 1C1EH 3ALPA 5IROA 1ZWIA 4W81A 3CCHA 1CE1L 3QXTA 5EU3A 1YJDH 1NCCH 3NGBB 1OLZA 1Q0XL 1SYVA 4MAYB 1CGSH 3BGFC 4XVSH 5C2BL 5JORA 2GK0A 4F58H 1U3HD 3R0NA 4LSVL 3LMJH 2FJFA 4D0BA 2Y23A 4PJXE 1S7WB 4YDKH 5ANMA 4HG4K 1QO3B 4OSUH 4P2RA 5EUOF 5ADOL 1B0RB 5JO5A 2NXYD 2EYRB 1FORH 4WCYH 3GRWH 3M07A 1MHPL 5J6HB 5J13C 3GSXB 2FJHA 3MNVA 5DZNA 3O2DH 2KQMA 1T21A 2X4TB 1NFDF 1YECL 4L3EE 4HS8L 4PRHD 5CS7A 1J12A 1WICA 1KT2B 2MSPA 4NRXB 3QG6B 4KGJA 4QGYA 4M1DH 2XTJB 4OD2B 1UXWB 4QRRB 3QULB 3EO9H 4F57L 4K9EL 5LGHL 3V8CA 1TVHA 5I1GL 5FKAB 4RWHA 5I17A 1N5YL 2VDQH 2I07B 5EC1B 1CD8A 2NCMA 5HI3D 1IGIL 3G5YB 1KYOJ 1L6ZA 4P2QE 1J0JA 1A7RH 1S7UB 5CMAA 1K3IA 4XPHH 4RIRB 3ROLA 4NNPH 4YPJA 5D2LE 4NHUB 1MCEA 3KPRE 1PEZA 3BO8B 3WJLA 5D72L 5H94B 1R24B 4NQEB 2BJML 2HTKC 3T77B 4Y5XA 5TE7L 4TQEL 1H3TA 3TYGL 1MNUL 1YMME 5IBTH 3QP3A 4LVOB 2DICA 5GRZA 1KIRA 3QDMD 5HHOE 3HC0B 4NOFA 4EQ2A 2UUDH 2R0ZH 5E6IA 2XN9B 1OAUL 2NY5L 4P3WA 3EDFA 4RGND 1DFBL 1GAFH 2Z4QA 3H3PH 4L4TA 4KJYB 2DD8L 1UYWH 4ZUVA 5FHAL 4ZPVA 4Y2OA 3P9MB 3LVEA 3MRDB 3HZMB 3BRDA 2E7MA 2I25N 5ALBH 1L7IH 4E41E 4XCNA 3FQTA 2I9TB 1PKQE 1F8TH 1IAIH 5M94B 3SQOH 2BHUA 2FD6H 1J0IA 4UILL 3CIQA 1IEAB 4HCRA 5DC9B 4O2EB 4JN2A 4FG6D 1JYXA 2R8SH 3DO3A 1LE5B 5JW3H 4LGSB 4AH2B 1HDMB 5MERA 4JKPH 5D9SA 3QCVH 4MNQD 2Q8AH 2AEWA 5JXAH 4UIKL 4RFNC 3DNKA 4LCCC 4XMKH 3P2TA 5DO2C 3SKOB 1WZ1H 4QRTA 1CDYA 4HIIB 3O9WD 5EIIB 4WNQA 4X6CA 2XNAA 1IGFL 2DQCH 1M1SA 4MXVF 5KS9E 4G8GA 25C8H 4RMWA 5T1LA 2OL3A 1D5MA 2AS5M 4LCUA 1NBYB 5EN2B 4WGWB 3NFSH 5CD3B 3LQZA 3SDYH 2OI9C 3O4OB 3GIVA 2CMRH 4OGAD 3TBYA 1BM3H 4XCFL 4M3KB 2A83B 4NBYB 1KIUA 3WD5L 3L5XL 3VJ6A 1KLUB 3WBDA 3CFDB 4QOKD 4XWGH 2E6PA 5I1HL 1AR1C 4GMSL 1BAFH 1KCRL 1OAXL 4Z77A 2FJGB 2H2SD 2RR3A 1M05A 2GSIA 4OZGF 2JJWA 5DJZA 5C6PB 4G9DA 3QO0A 3UBXA 4ZNEA 4OLZH 2BP3A 2EH8L 4NQUA 1IC7H 4LEXL 4IM8A 1LILA 3ZKMD 4L8DB 4M4RA 3RVTD 3KPQA 2J7LA 4R97C 5HXMA 5D1ZD 1A6TB 3DROB 4PRAA 1FRGL 3BWAB 4GW4A 5FUOH 4V1DD 5CJXA 3V0VA 4BQBA 1KTDA 5E2JA 3WS3B 1NCBH 4HAFA 1KCSL 3ZYJA 1KG0A 2DWDA 1YEEL 3ZTNH 1LO2H 2MKWA 3IJYB 2OR8A 2ZCHL 3WLBA 2R0LL 1LE9B 4YIQB 3HNTH 1XAUA 1HKLL 1S8DB 2CO6B 4JFEE 1R0AL 3DSNA 3LKNA 1U91A 3ZDYE 4KUCF 1BLNB 2AJ3B 4IDLA 4XP1H 4X5WB 3AAZA 2P8PB 5TE6H 3RTQD 4J4PC 4JQXA 5LGKA 5EBWA 4NO0A 4ETQA 4FHBD 43CAA 4X4XA 4K8RD 4PJAA 3ARGC 2VXSH 3VMOA 3UTTE 1JV5A 4LGRB 2IANE 1VCAA 3MLXH 1B0WA 1OGAD 1VFUA 5EOCJ 3G5VB 1Q9LA 1PBYA 3I50H 4JGMA 1U93B 4P9HH 2AJSH 4BFGA 2XKUA 3G6JF 1CU4H 3MLVL 4OV5A 4OFIA 1NJ9B 3ZL4H 3KPTA 4RDQG 1VDGA 1MVUA 5GGSY 2LVEA 3WEXB 1TZIA 4PGJA 2MPAL 4PJHA 4KKAC 3MGAA 4TYUA 3WO4C 4LCWD 1MPAL 3HN3A 4LVHB 5AAWA 3P4OA 4HULB 3N9GH 4ALAL 1XCQB 4LF3A 3QDJD 4DN3L 1CBVL 5LQBL 3ZT7A 3FAWA 3NOIA 3OXRA 4AL8H 3QNZA 1T1XA 2B1HH 1D7FA 1MAKA 1F3JA 3MROB 4W70A 3EOAB 3SJVA 5KZCD 4Y19B 4BUGA 3N85L 5ENWA 3H9SE 4UBDD 1CXIA 3PWPE 1KB9K 5IB4A 3RUGE 2FO4A 2AV1A 4XNXL 3IVKA 1I4FB 3CX5J 4WV1A 1DZBA 2FX8L 1G1CA 4NJ9L 1A7NL 1A4KA 4LAJH 2PCPB 4APQA 2YC1A 1FNEA 4NQCD 4HUNB 2WP3T 4PRNA 5TE4H 2EDXA 1IAKA 2ORBH 2BVOB 4IIQA 5GRUH 4P46B 5E95B 4P2RE 2R15A 3GMLB 3TC9A 4Y8AA 4ELMB 1IZKA 3KXFE 2V7HB 3DLQR 2XZAH 3FHAA 4LSDA 5I9QC 4LEOA 4KRNA 5F9OH 4A6YB 4NN5C 1BQHA 5C09E 3MLWH 3O3AA 4F7PA 2AV7A 2YPKB 3O4LD 4FQXD 4Q7DA 4BELD 1NAML 4MDJB 4ISVB 4W6WB 3U2SB 4JO4H 4AEHL 1ZV5A 3QIBC 4Y5YB 2D7TH 5EZJB 1AGBB 3QZWB 1UA6L 4Z95H 1RPQA 1WEJH 5DJXA 4XNZB 5BMFL 3KWWA 4FXKB 4R7DB 3X14B 4P59H 3JWDC 4P23B 5IBLC 5IV2A 2X40A 2W9LA 3RL2B 4GMTL 4Q9BA 3VD7A 5DD0H 3VG9C 5BS0D 2Z8RA 3C08L 5FDWB 1NPUA 1O0VA 4F3FA 2HFFA 4HUWA 3OKNB 3U4EA 1YZZA 3DIFB 1I3VA 2A74A 3JWOC 5HVHC 3O2WH 4KMTL 1MFEL 2N7BA 1FZMA 3MO1A 4NKMB 1L4IA 1NGYB 2QSCH 2VMFA 4E42A 2BOCB 1W72A 1E4XI 3DV4B 1UXSA 4KJQD 4KK5D 4P48A 4P57B 3UTZB 3QCUH 1AE6H 4LHUA 1LO5A 5CIPA 3SGKA 3CVIL 3QXAA 4YHNB 3UX9B 4YXLL 2A0LD 3HAEG 1C1EL 4ZPTA 2IPUK 1FNAA 1HH9A 4RMVA 1DUZA 5EU6D 2CKBB 5E1AA 3BGAA 4ODWB 2C1PB 4AT6A 1YJDL 3WN5C 1NCCL 5EBMA 1CGSL 4OZHA 4B53A 1QRNA 3BVNA 4JO2H 4RAUB 5E00A 3DBXA 3SY0A 4ZO9A 3SKNB 1IQWH 4XVSL 2WLZA 4DUWA 4F58L 2CQVA 3FFCA 1GJIA 1UQSA 3LMJL 5KVEH 4YDKL 3X17A 2GJ6E 3KYOB 4GW5B 4OSUL 4KU1A 1CDCA 1UT9A 4LLAA 4X6CE 3EJYC 4G42A 4TUKH 4WCYL 1FORL 5C1MB 3GRWL 1NCDH 3ZTJG 3MLPA 1HQRA 3O2DL 3VWJB 5EUOB 1NCAH 4FQPA 4BK4A 3BEVB 4KDWA 4DK6A 3JTSB 3L95B 2Z92B 4XRCA 4O00A 4M1DL 2WUBH 5IMOB 1NFDB 4TULH 4R3SA 4HUXA 3EO9L 1MCDA 1N2RA 1K4DB 5E6YA 5C9KA 5F7NC 4P4KA 2VDQL 2CIKA 4Q6IC 1FNGA 5DFTA 4OZFB 3IETB