4JRWA

Crystal structure of clostridium histolyticum colg collagenase pkd domain 2 at 1.6 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
GSAPIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
molecule keywords Collagenase
total genus 18
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jrwA00
1A6WL 2Z8VC 5C9JA 1G7LA 3WXVL 3VFVB 5C0RH 2AERT 1I8IA 4R4FL 4NZDA 2B1AH 5TF0A 1IKFL 1FQ9C 4LLQA 2HLAB 2FJHA 1A21A 2W38A 2YHGA 1X5ZA 3DX8A 4LCIL 2P24B 1OSZB 1T0MA 3HNTL 1VFMA 1GZPA 2DTML 3MJ9A 1EHAA 4ODXA 5BO1L 1P9MA 2BHYA 1C12A 5EC1B 3BWAA 4Y19E 4OQTA 2X70B 3PDOA 1XH3B 4PUBH 5DJZA 3PDDA 1QSED 3TZVB 4HFWB 2EE6A 2R56L 5I2IB 1MOEA 3K81A 1X3DA 3V6OA 3L3IB 2PO6A 2H32A 4MA3B 4NKOB 3QEHA 1A0QH 3FZUD 2HMIC 3MUZ1 2B1HH 1HE7A 4DCQA 5HHXH 1PG7W 4F7CB 5IFJA 1FNGB 4WW2B 3CJJA 3SGJC 4ZDHA 1IKFH 1U42A 4X6BA 5D2NE 1U93B 1ADQA 3LQMA 2O26U 4PJEE 5DVMA 1TZGH 3DO7A 5MI0B 1BZ7A 4HKXB 2V2WB 4OUOA 3L3HA 2CJUH 5JR1L 3F7RA 3FL7A 5LAXA 4AMKL 5ESQA 4JM2D 4G6MH 1U92A 3IDMA 5FDWB 4QWWD 3T0EB 4Q6IA 1A7NL 1W8OA 1F45A 4X99B 1F5WA 4HBCH 1K4DB 3T4AB 3K3QA 4MB5A 3U46B 4N5EC 4FP8H 2XRAH 3NCFB 5DD1L 4YR6A 4D3CH 5EOQH 1DDHB 4UU9A 4BSVB 1QO3B 1JHKL 1SEQL 1JFQH 4AG4L 2BVQB 2QHRL 1IC7H 3O3AB 3DYMA 4KKAD 3I2CH 4H25A 3MRKB 4LHUG 2L7JA 4HKJA 5E9DE 3ULUH 1MHEB 3I84A 3HI1B 4JRWA 2Y25A 1C08B 3PWPB 3VXRE 4G7VL 1YDPB 5DRNA 5D7IF 5KJRL 3GBML 1T1ZA 1E4WL 5EBWB 4WDIA 3Q2CA 3SE8L 2R0ZH 4BH8B 1IM3A 1JWSA 3ZDXF 3V52H 5CBEB 1DL7L 4JVPA 3OKMB 4PJDA 3CFBB 1LK2A 1HWHB 3KDMB 5ADPL 1SVCP 3BIAX 3DRQB 4ZO6A 2PNDA 1MNUH 2J8UA 1DQML 2W91A 4K94L 2MTPA 2VDKL 3L7FB 5ISZD 2WBJD 4KRPC 5EO0A 3F6IA 3FMGH 1CFNB 3VI3E 4GMSH 3BEVB 1MCKA 3HMXA 4K71B 1KLGA 1MWAH 4QHMA 1MLCA 2EDXA 3BKMH 4MD0B 1CD0A 3NACL 4YIQB 2AJSH 4A6YA 4TUKL 4JM2F 3MNZB 4YXLH 3UJTL 2GITA 1I1FB 3W11D 3V4PL 4XP6H 2EXYD 1N6QH 5AYUH 1KB9K 1EZVY 4X4MA 3QFJD 3B5HA 15C8L 5T1MB 3HAEG 5F1OB 5IB1A 3WFEL 4C83A 4RA3A 5CZVH 4PJ7B 3TBTA 4NBZB 1A1OA 1Z9OA 2DQCH 2NY4B 3WNPA 1BQSA 4HJ0D 3MROA 1QBLH 5C1MB 1NMAL 1DUZB 4HWBH 3CIQA 4LBEA 4Y5VA 4NJ9L 1T5WA 1FNFA 4JRYA 1A6VL 5E2VH 2DQFA 5TQ0H 1YYMH 4I5BB 2APXA 5J6GB 1KLUA 2I5YL 3M17A 4S0SD 5JXAH 1ORQB 4M7ZC 4KHXL 5GGSA 2VDPH 4MNQB 2DKUA 2EO1A 5F1IA 5CP3A 1N6QL 1C5CL 4OCWL 1G7QB 1MCFA 1FYTA 1RZGB 2BVUA 4WEUD 4YHKL 4I48B 5GHWL 4NC1C 3CFEB 5ITBH 1U3HB 5C07E 2IPKA 4LNRB 5CGMA 3IJSA 5TQ2H 4PJ8B 4NQSB 4CAGA 1F4AA 2ZWLT 1UB5B 2VMFA 4PY7A 5E2WL 4GAGL 5JOPD 1NGQL 4Y5XA 3RWFB 4G8GE 1HI6B 3HPJB 1OGAE 4RQQA 2MSPA 4LASL 3D5OF 5EUOE 2A6KB 4UV4H 3F7VB 3RY6C 1ROWA 4CJ1A 2BRRL 4LCIH 3OAYK 1KACB 1T5XA 2X4TB 2BOCA 2VE6B 1FIGL 3MJ7A 1UGNA 4PGCA 1A1MA 1T1WB 3VFVA 1MCDA 4HGMA 4I0PB 3RFZC 5KOVC 4NKIL 1JNLL 3IS0X 4WWKC 4D3CL 2HYMA 3LEXA 1RZKH 3C5ZA 3T8XA 4CN4A 1N2RB 4DJMA 3CXHK 3OJMB 1E0OB 2MCG1 5F1SA 1J1OL 1N26A 3SE9L 3BPOC 3G5XB 4W6XB 4HBCL 5DMKB 3QQ3B 3TZVA 4Q9BA 1WWWX 2MHAA 1KN2L 1YNLH 4FTVB 5BJTB 1IKNC 1D6EB 1QRNA 4YPGA 3ZSSA 5IESL 5CMAA 3EJYD 4O2EA 3QQNA 3WJLC 4WI9A 2VDNL 3DUUB 4J3XA 5FA3B 1SMOA 1N8ZA 3WD5L 1NFKA 2BP3A 3QO0A 4FFWC 1BJMA 4ODWB 3IDJA 4XVJH 1NUNB 5K9QG 5GGTH 2AXJA 4DN4H 4PJ9A 3RDTD 1RZKL 4F7EA 5EIIA 4JLRB 1ND0A 4OGAC 2BVPA 4L3EB 5F7LB 5MENA 1SEBA 3WFCH 2RIKA 2X4TA 1A7RH 3FQRB 3B9AA 1TENA 5M95B 1TLKA 3JTSB 4MDIB 1FO0B 5FCSH 1QUNA 4QGTA 4RMSA 2OQJB 3ARXA 2GTZB 2VZSA 2X41A 4ZOCA 4LFHD 5JMOC 2QR0A 1YJDC 5HGHB 3L5JA 1Z0MA 2I26N 2X1XR 2IGFH 2WMPA 2XWJA 3BUYB 3O6FC 5MERB 4Y16A 1WFNA 4FMKA 2APTA 2AK4D 1MJUH 4X8XA 3MCLL 2B4CL 2IBZY 1CDCA 2F9BT 3JV6A 3DV4A 2RFXA 3IDMB 3VXME 4FABH 4OIIH 3NA4A 5ILTH 4UU9B 3D2UB 3WFZA 1FZJB 2DL9A 5GRUH 3IFOB 3RZCB 1K4DA 5ESAA 1UJ3B 3PGDB 3IJHB 4XP4L 3QEQA 3PGCA 5GISH 5JQ6H 1BVLB 4PJXE 3FB5A 2GK0A 4Q7DA 5IBTL 3WDHA 4FN0A 1KPRA 5KVFL 1TVHA 3OZ9L 5I30L 1CDGA 3CFCL 5GQBA 3QHTC 2NLJB 5HI5D 3BKCL 3O8XD 3QPXH 3H9YA 3PF2A 4JO1H 4LLUB 4R7DB 1CICB 1OAUH 3MMEB 3QWRD 4L5FH 3V6ZA 2F58H 2PXYC 5GIRA 1S9VB 3OJ2C 1MCBA 5L0QC 2C9AA 5A16A 4HJJL 3WS3B 1Q38A 5GRYA 1RURL 3JTTB 4OCSL 1QBLL 2CXGA 3O2WL 4YGVA 3WLBA 1F90L 5FUZL 3E6HB 1T83C 2XA8H 4X9BA 4OGXH 3QG6A 3QWQB 4QTHB 1HEZB 4PGEA 2OK0H 2F54A 4KTEL 2VLMD 1UM6H 4U6HB 1QA9A 2O5ZH 1EEYA 5CP7B 3G5ZA 3MRFA 2BSTA 3KYOB 5I1CH 3VGFA 1DANT 4LHJB 3VFUB 1IGJA 3I75A 1TJHH 3W81A 4FQJL 2QQNH 5KSAB 2YD3A 3BKYH 2D4DA 2R15A 2WUCL 1RIHL 1YN6B 5JIHA 2EC9T 1WITA 5F6IB 4HCRL 1NEZB 3INUL 4OKVA 3TT3L 4AMKH 3GMLA 3BZDA 5K93A 1P4LB 3PHOB 1XT5A 4M61B 5D7LE 1OTSC 1ITCA 4Q6YA 3RZCD 3CFCH 5DJ6B 1RSFA 1DL7H 5EBLB 4LEOB 4HIIA 4OLXL 4ELMA 4X4XB 1LO3L 2IPUK 3KPRE 3G6JB 2EYRA 2FSEA 5JZ7C 1EAJA 3MRRB 4LVOB 4G6KH 4OF6A 3UTTA 2YS4A 1R3IL 3BYTA 1MRDH 2H45A 1RUPH 3IVKB 1IC1A 5EUOF 2PYFB 2ORBL 4Z0XA 5E1AB 2JE8A 4DWHA 5IHZB 5L9DH 2E6JA 4MMXC 4F7PA 5IVXF 1WJ3A 2F54B 3R8QA 3L3GA 4WHTA 1NMBH 4ZUWA 1AGEB 4TOYL 3HE7D 1MFBH 1EAPB 1I3GH 1NCWH 1U8LA 1ZWIA 2HMID 4PJIF 4RMQA 4KKBD 4KJPD 3MLRL 5TE6L 4NQSA 1ZA3A 3ORJA 2NX5D 1TETL 4L1DA 5DT1L 3PL6C 3RDTB 3WHXB 1J8HA 4M6OL 3QJFB 4EZMA 3L7EB 2RJMA 3W0WB 3DUHA 1BBJA 3U48A 1JWUB 3FO1B 4A6YH 4P3CH 4XWGL 3S4SB 3GSNB 2ATKA 4PRBA 3HUJF 3VXNB 4ELMB 5DJ2B 3UTQA 3WJLA 4DZBA 1NGYA 3UTSE 5IFHL 5IWLA 1MFEL 4MCYB 5T33L 1H5BA 1YPZB 4ONFH 2VKWA 3KPQB 4XPTH 4HFUL 4JQXC 3DGCR 4RDQG 3TIDA 5C0CA 4JHAL 5DA0B 3RTQD 4LHUB 1OAQL 1RMFH 3QDGB 5BMFH 1EVTC 4O4YL 1B2WL 1NBYA 3VWJD 3VI4E 5L6YH 4NKDB 3KJ4B 1RZFL 1YEHL 2BCKB 4GSDL 1U3ZA 3UYPA 5LWYH 4I8DA 3KPPB 1TDQA 5IROA 5KS9B 1VPOL 1R0AL 3MA9H 3T2OA 4K55A 4TSAL 4GG8A 2H6PA 4HPYL 4M7JL 3LIZH 1DE4B 2AJZA 3E2HC 1B9ZA 1HSBB 1HHJB 3OKNA 4KGLA 4XXDA 1CXHA 2NY6D 3NFNA 4LOUD 4XVUC 3IF1B 5T1LD 1IGML 3T2NL 3IDJB 3H3PH 4TSCL 1CI5A 2I60H 5HBBA 1JF1B 2NR6D 2CSPA 2Q8BL 5F3HA 2A38A 3TA3A 2Q6WB 2N56A 4MJ6B 5D7JD 3QXTA 2F5AL 2OTUA 1CD9B 1MY5A 1JGDB 4DFIA 3ULVC 1S9WA 1XF2B 4O00A 4HJGA 4X6DB 3THMH 5DHYA 1IEHA 3O9WC 5C8JA 4FQXA 4U0QB 4IIQB 1XFPA 2GJ6B 3TFKC 4F80A 1TZIB 3SE3A 3MACL 5DTFA 4DN3H 2VLRE 1FO0H 3P4OB 5MEQB 5FK9B 1QNZL 2HT2C 4QTIH 3GSVB 1H15A 5DK0A 1DVFB 1QSFD 3L95B 4NZUL 3I6GB 2D31B 3G5VB 4DEPC 4PGDB 2WANA 4MA3A 4JKPL 4EUPB 2HT3C 3MBEC 2UUDK 3U82B 4HDIA 1MH5A 3TVMD 2O5XH 1HXMB 1GGUA 1QKZL 5C0CE 1F4XH 1I3VA 1U8NB 4XPAL 4L4JA 4NRXB 5E2VL 2WW8A 2DLTA 2DIAA 4KI1A 4RAHA 5CS7A 4ZFOA 1BOYA 2DWDA 3L6FA 3PWVB 1RULH 4QXTB 5A16B 1TNMA 5E2WH 5IB2A 4G8EA 4JM4H 4LARH 3CDYA 3L5HA 5DEFB 1HK6A 5I30H 4AM0B 4KTDH 4WCYL 5EOTA 1IE5A 5BV7H 3TT1H 2OJEA 3FOMB 1A3RL 3LKRA 3I9GH 4MHHI 3RWJB 3ZDYF 2DKSA 4PLJC 4ELKB 1HEZA 3F7YB 2RCSL 5FCUH 3EO0A 4F7TA 5CINL 5CILL 2ZCHH 3IT8D 4L1HA 4M43L 5DI8B 5JOFB 1EEQA 3P0VH 3GIZL 1YZZA 4S1DC 1XZ0A 4Z9KB 4QTHA 1F4WH 1OPGL 1MI5A 2AABL 4Z7WB 4LQFH 3NPZB 1W0VA 1AJ7L 4R90L 3QULB 4YBLB 4EUPG 1PY9A 3OR6B 3GMQB 4AT6B 5F7DB 1ZLVH 3ARTA 2CIKB 1EFXB 1L6XA 2NY1B 1YN6A 4H1LA 2CLZB 4XBEH 3QZWA 3CLFH 4HGWB 4NM4L 2LU3A 3VFOB 5GRZA 2IPTH 2R1YA 2F53A 3KYKH 3LRGA 1FORH 5E8OA 3MUGB 3I3EA 4JHWH 5ESVB 4G8FB 4MXWL 1M7IA 4D8PB 1GJIA 2XZAL 4NQVB 1AQKH 1MAKA 5DURD 5KN5A 4DUWA 4XMLL 3G9AB 1UVQB 2P4AB 3GSUA 3MV9B 4RFEB 4MNQA 3G04B 1I9IL 3QRGL 1LO5B 3QUZD 3GIZH 2BVEA 2EDQA 4B7LA 2D7OA 1ODAA 2ORBH 4YE4H 3DIFA 4I48A 4Z5RA 1D6VH 3JWNC 3BMVA 3OJDA 3B2UD 4GMSL 1IRAY 1BLNA 1S7SB 2BSED 5F70A 5IV2B 3VXSE 3IFLL 4ELME 2B8OT 5FYLL 2UWEF 4QOKE 1RJZA 3ARWA 4EI6A 5J6HA 1G0YR 2XA3A 1A7PL 2J5LB 3MODL 4XCNB 4YHML 1AI1H 4BQ9A 3SE3C 4EBQH 4J2XA 2GTWB 3V6OE 1I1RA 3SCMA 5E2TH 3JUZA 3HZYA 4GO6B 1BQHB 1DBBL 4QOKD 3EGSB 3AAZB 3ZT5A 4WENB 4OFVA 1JZ3A 3MV8A 2EDDA 1MCOL 1NSNH 3ES6A 1IEAA 5CEZE 4M7LL 4LHQB 1YECH 1P2CA 4OZ4A 1CE1H 3T0BA 3EDJA 4WVRA 1ZHLB 3BDYL 5HHOE 3OPZL 4PREB 3OKOB 2BNRE 1ZSDB 4EDXB 5H94A 2E9JA 4G6FB 4UAOB 5EUKB 1FO0L 3T0EE 2W0FB 3QQ3A 4PJ9C 1NDGA 4E42A 4PR5B 3SKMA 2IFGA 3D18B 3RVTC 2LQRA 3SDAD 2OX5A 3VFMB 4Y5YA 5DQJA 4DTGH 4X6CB 4GKNA 4HIXL 4JFDA 3WYRA 2DTMH 4POZC 5TFSH 3O3DB 2KPNA 4U3CA 3V79C 4NQCE 3QNYB 4JG0L 2BJML 4ZOAA 5D1QA 1KXVC 4KKLD 4TUJA 4L8SC 4KK6C 1QVOA 2Q86B 2A73A 4MQ7B 4PJCB 2GAZB 4JQVC 3WLWC 3BRFA 2PXYD 5INDB 5D7LA 4OSUH 4XPHH 1I7ZB 1J0HA 4BKLB 4TVSa 1I1AD 1UCTA 2F5BL 1OSZA 1T0MB 4OLZH 1JVKA 4NJAL 3GB7B 1MPAL 4QY8A 3MLTA 1YMHB 3KYNA 4JR9L 4FQIH 1IMHC 4EEEA 3FB8A 1JGEA 4E5XB 1AXSB 3D69B 2C7UB 2F8XC 2H3NA 4ZAKC 4PG2A 4DUVA 4RBPH 3TBSB 3MJ9L 3NZ8B 3MGOA 1ADQH 3E3QC 5IMKA 1LO0L 1NAKH 1VACB 5E4EB 3IFOA 2HFFB 4HKBA 3I6KB 3CFKA 1KEMH 1O7SA 5C08A 5K9OA 4XNYL 4JRXD 1PBYA 2BC4B 4P9MH 4DQOL 4OAWA 4OSUL 5HDQL 2NYYC 1B0RA 4X4ZA 4MA8L 5FOJA 3S36H 3K1DA 2HTKC 2XWTA 3U7YL 4KVCL 3V9FA 1MJJA 2C3XA 3NCJL 1RUAL 4PJ9D 1LE9A 4JPIA 2XY2A 1I8MA 3L5XH 2BZDA 4P2QB 2R0ZL 1QSFA 3H3BC 1E4KC 1IGCL 3ZKXB 4V2CB 5BXFA 1F42A 4W6YB 4DVBA 3D3VD 1CGWA 3DVIA 5B4MC 3EYQC 4X83A 5C0BB 4A2MA 4P23C 3S34H 5F6IC 4NKMA 3WS6A 2AEPL 2EE2A 3BX7C 3CVHA 1P6FA 3TO4B 2NPLX 4ZS7L 2HVJA 3BZFA 5C0DB 1RK1A 3K2UH 4WUUE 3BN3B 1IAIL 3MRFB 1U91B 4KXZI 3T4YB 1PKQB 3NN8A 5CZKA 5DRXA 1FZJA 1PVHA 5JW5B 4I2XE 1WBZB 4HX1B 3IU4L 5B22A 5KS9F 1DFBL 1OGAB 1WTGT 2XN9A 4J4PD 3ARGA 3NIDF 1EO8H 2QJDA 3QUYD 2OP4H 4IMKA 1CCZA 3R06B 1T1ZB 5EBWA 3CSYA 1I9JL 3BQUB 3X14A 4Y19D 1J8HE 4RFOH 4XH2B 4QYOA 2R8SH 3NOIA 4WJ5A 5GGRA 1R3KB 3ARVA 1I1YA 3P9MA 3HPJA 3U7YH 1CD8A 1TQBB 3HCVA 3DOSA 4C57C 1CBVH 4PP2A 1QBAA 2X4OB 4L8SA 1PLGL 3CK0H 2DIJA 4QXUL 3W9DB 1DJSA 2R1YB 1JRHI 4H1LG 4U1LB 2R0LH 4S11A 1UZ8B 3HE7B 4LEXH 4MA1B 4LSDA 1CFQB 2FGWL 5IHBA 3DIFB 4NSKB 2W0LA 4X8JB 3VE0A 2VDLL 2NXZB 1A6ZB 3GSNL 5AUMA 4LKXA 5KSVB 2R9HD 3MV9A 1JRHL 4NC0B 4RFEA 1CXLA 3MLSH 3SY0B 5C0CD 3IDGB 4UTAL 4P2OC 4OQ1A 2DYPD 4PB0L 4KHXH 4LCYB 1NBZA 2VDOL 1I7RA 1OLZA 3OKLA 1WZ1H 1ZWIB 5AG8A 3MOBL 2VR9A 4EQ3A 3NMEA 3RZWA 3TYGL 5J13B 1ONQB 4O2FA 1A22B 4EI6B 5CZXC 4KZEH 1K5NA 4XPAH 1J18A 3LS4H 4DAGH 4L4TA 4LLAA 4E0RA 2YXMA 2GCYB 3QJHA 4V2BA 3ZZ1A 1MCJA 4NO2B 4U31A 1RIUH 1VFBA 3QDME 1NCAH 4YHYC 2QV2A 3HG1B 1G0XA 4MSWB 1DQJB 3FTGA 1KSRA 2R23A 4GRMB 2AEQH 5EIIB 1XGTA 2JJTA 2YMXL 2EDOA 1J0JA 5F9WB 3GSWA 3CNKA 4OZFH 5EOCH 1S5HA 3S98A 1VESA 5IT2H 4MCZB 5TFSL 5HHOA 3OAZH 5MEOA 3TIDB 4P4KC 4UQ2B 1JPFB 3GI9L 1JNHB 5GXBB 5DRZA 4HEPG 4LLVA 3WNLA 1UA6L 4Z78B 4YC2C 3LRSA 2X70A 1XH3A 2R69L 2JELL 1FGNL 3RWFA 3QUXA 3SE9H 3VXTB 4P46D 4AQOA 1QFWI 3DUSA 1W72B 4LGRB 4BH7B 3PWJA 4KRPD 3OKDA 1C12B 2P5WE 1FJ1B 4P4RB 5DYOA 1IQDA 3LOWA 3N9GL 5FIEA 4K8RC 4YHIB 2P7TA 2EDEA 3GKZA 3TF7C 4FOMA 4L4TB 4MXVE 4XCFH 2ICWI 1MCOH 3D6GA 4UDUA 3P4MB 5D9SB 1QFPA 5I2IA 4IRSA 4PJCA 2D03H 1VA9A 1T03L 3MA9L 1K8DB 3ARZA 1IEBA 1JWUA 4NQDA 5CFHA 2NW2B 2J8OA 3EYOB 1A7QL 1LEGB 1DBKL 1NGPH 3QG7L 2Q3ZA 4RAVA 2VDNH 5IQ9A 1EGJH 5IEHA 2X4NB 2A74A 1PG7L 2W9EL 3ZKMD 5MP6L 1PG7X 3DSNA 4GW5B 1A7PH 1EPFA 1QLFB 4P46A 2ESVD 1TJGH 1SQ2N 3P9LB 2IF7A 1TZIA 2NZ9C 1Q0YH 3X3GH 5FDWA 2D0GA 5CJQH 5IHUL 3MNVA 3PWLB 4E5XA 5KVGL 4JN2B 1J1OH 5ADOL 3DECA 5IVNA 4ODTL 1JF5A 3AM8C 5DVLA 4CKVX 4L3ED 3CX5K 2A6JB 3B5GA 2XPGB 4UOJA 3MGOB 1S78C 2YC1B 2AV1A 2IC2A 3G5VA 5D2NA 4QHNB 2AV7A 3CC5A 4Y4HC 5INCA 1W72A 4Y4FB 3H7LA 1A6UL 1JPGA 3GIVA 3QUYB 3TIEB 4H8WH 2NXZC 5CEZL 1YY9D 3P4NB 4YQXL 3MRHB 3BEWB 3KYKL 4R3SB 1TETH 4N90E 3QYCA 4IDJL 4PJ5E 5GRJH 3IDUA 5IB5B 1FC2D 3DJ9A 3O3BA 3O45A 5L2JB 5FYKE 1FHGA 4NUGL 4XVTH 5E99L 3NFPA 5DJ0A 1BOGB 3MRGB 4PYGA 3BDXA 4LCWD 4PJDB 3SGKA 2IQ9H 2ADGB 2AK1H 5KTEL 1J9CT 3HC3H 3F7YA 1T20B 3LV3B 4IMKC 4OFYA 1IM3B 2VZOA 3D39D 4RAUA 2LAAA 3JZ7A 3ULVD 1H8NA 2ZCKL 5DUPL 4GS7C 4ONFL 3PIQB 3LN4B 4NO3B 4TN9A 4QHUA 2EXWC 4RFOL 1BZ9A 2ARJQ 1VENA 3AMKA 5FYJH 1C1EH 1JMXA 3UTZA 1AR2A 4GS7B 4V1DE 1KLGB 5DRXB 3O81A 1CBVL 5DEGA 1Z3GH 3TVMA 4MS8D 4ETQB 3GM8A 5IW6A 4OLYL 1OGAA 2L4OA 3UPCA 5GZOC 5HGGS 4FMFA 1G9MC 3PABA 2A6IA 3BPCB 1IGIL 3CDGB 2QQNL 4GRWE 4OF0A 5EC2A 4HK3J 1ZV5A 4D8PA 4NGHH 5L2JA 1ZANL 3SDYL 1VEOA 4KAQL 4NN7C 1FZOB 1UVQA 4HMCA 1BOGA 4J4PA 2CK0L 2ERJB 5ID0A 4O5LL 2CGRL 1G7LB 2EEBA 4YFLI 3VFPA 3JWOL 3S7GA 2UVFA 5GGQH 3QEGL 3ROOA 3HG1E 5D5MB 1QFUL 3QUYC 3NBNA 3L3KA 5FYKD 1BLNB 1ZHBB 4OLYH 1JNJA 2DQJH 2I9LA 4I3GA 3C6LC 1JK8B 4P46C 3ET9F 1NDMB 1IGIH 1HHKB 3LMJH 4LLYA 1M05B 5I1JH 1VEPA 4H0IA 1MJ8H 3TO2A 4PJFF 1OB1A 3FONB 3VG9C 5ANMB 2KZWA 2YD5A 4RGNC 4ISVB 4FQHA 1NGPL 3QUKB 4ZAKB 5HHPA 1B3JA 4LNRA 3TNMB 1U3YA 4JRXA 2EYSB 4DGIL 2JIXB 5TH2A 3SDDD 1ADQL 3BXNB 1NMCB 4UILL 4F7MB 1JJUA 3MJ9H 4GKSB 3U0PA 1WISA 4Z95L 1UM4H 5I1EH 1HSAB 1ZVHA 2FB4L 4XCFL 1NAKL 1MRCL 1WLHA 5E2UH 4X6BB 1AD9B 1NKRA 2R1XB 5DD6B 1WFOA 3RVXC 1CGTA 5FUOH 1G7IA 4PJFB 1JPFA 4G8IA 5F93C 1SBSH 5BRZE 3HE6B 4NNYB 2UUDH 4J3OC 1FGNH 3BP4A 1F11A 3WJJC 4P49A 1U8QA 2FJGA 3PJSB 1A8JH 3VMPA 3H9HB 4WU5B 3L3KB 2HVKA 5F9AC 4F9PA 2E9WA 3G6DL 1PZ5A 1TCMA 5B39B 1XGPB 3MV7D 4WTZA 1L4IA 3RJQB 1AXTL 3GFUA 5TDOA 1JK8A 2Q20A 3ULVH 2Q76B 5E8EB 5GSRB 4NQEE 4CADA 1JGLL 4NBXB 4MHHG 1ZLUH 4YQXH 4NP4L 4Z95H 2DQGH 2YN3A 3WFHB 3QUKA 1I7TB 2I07A 2HJKA 2YPLD 3B4NA 4S1QL 1QFWH 2EIEA 2C1PB 1XCTA 4F57L 4ETYA 3VRIA 1L9NA 3BXNA 2G60H 4O2CA 3FQXA 4OQTL 2OTPA 2V17L 1G1YA 4BKLA 3T08A 1HHGB 2HLAA 5I15H 5E8NB 1JGVL 1YY8B 3T65A 1XF4B 5DJAB 1A4JA 3TWCL 4QY8B 32C2A 3GMOA 3QFJB 1AXTH 1VHPA 1CZ8L 2YSSB 4YHLL 1KFAH 3BUYA 2D9QB 1AKJB 1GRWA 1HIMH 3DRQA 4Y16B 2EDYA 5C71A 1BMGA 1QG3A 3QDMD 2NY1D 2JK5B 3QDJE 1BVZA 3UMTA 3LN5A 1XIWD 3VRLE 1AC0A 2Z35B 3MRBB 2P42B 4FZ8H 4MD4A 1G7JA 4WFGE 3PGDA 5I66A 3SDAC 3O3DA 3T0AA 3PV6A 4PGZA 4PLJD 4P2OA 1XZ0B 1PFCA 3FQTA 3HS0A 4YDKH 3NABH 1JN6B 2ID5A 3F12B 3N9GH 1JPGB 3KPSA 4CUCA 2UWEB 3QDMA 3W82A 4C83B 1MWAA 4ZD3H 2NLJA 2Y1VA 4NPYA 5T3ZH 4N5UA 4XBPB 2AKRA 4KV5E 2FR4B 1BX2B 1BM3L 1QFUH 4PB9H 3I85A 2Q8AL 4XI5D 2WLZA 1ULVA 3MO1B 4JZOA 2V5SA 5E6ZA 4MAUL 4LBEB 5F96L 3K46A 1VFUA 2LV4A 1AY1H 2ADFL 3SKUD 3ARBA 1I85C 5IW1B 5L2KB 1A3LH 3TO4A 3B8SA 3SDYH 1D7FA 4CDHA 1S8DA 3EDDA 4FFYL 4BJLA 3LDBC 4FFWD 2JF1A 3GJFH 2R0WL 3U9PL 5F97E 4LSUL 1P7HL 4ODUB 3QH3A 4XXCC 35C8H 5DFVC 1UWXK 1AO7A 2BVOB 5CCKH 1GSMA 4PG9B 3SDXF 3AS2A 3VGHA 2CGRH 2EDRA 1O5DT 1XCQA 4HX1A 3VD7A 1NCCH 4JREB 3A6CL 5C6PB 2EDFA 2DQUH 5FUCC 4F15C 5ENWA 3QEQE 4EXKA 1U8NA 4WFHD 4JFEB 2VIRB 1YNKH 1DCLA 1OGTA 3SDDC 1JN6A 4K3DH 3PHOA 1ZT1A 4XPFH 3ULSA 4BQBA 1DDHA 3GMLB 2F53D 1E6JL 1MCSA 5DD0H 3GHBH 5IB2B 5J1TC 3O6KL 1NL0H 4UIKL 1A02N 4DGVL 4Y4HB 4WFHE 1MREL 4UIMB 1I3UA 4HUXB 35C8L 3A6OA 1TFHA 1P4IH 4MJ2A 3U0WH 2VJXA 3BGMB 3UC0H 1CN4A 4ZUVA 3UPRA 2MJWA 4TULL 2V7HA 5CINH 3NPSC 3VCLA 3TV3L 1UEYA 5F71A 1JGUL 4OB5H 3WO4B 2VUYA 5ICXB 3RWCA 3WUWG 3RA7H 2IBGA 3LHPL 3RBGA 1MVFA 5I76B 3GMQA 2YA1A 5HYQB 3AB0B 2A6DB 3RNKA 2PYFA 2DBJA 1F00I 1YYLH 2J6EH 1TIUA 2Q1EA 4DK3A 2D4FA 4JFXA 5FA4A 1DBAL 3ALWA 3BZ4A 4G6AC 1DFBH 3O4LB 5DSCB 4JRYB 4J3UA 3TGXA 5D93B 5D1XD 2W07A 1DQTA 2A1WH 1KBGL 1MEXH 4ODSH 5I8CB 3S96A 1Q94A 1KIRB 3RL2B 5C07D 5EDXA 4RMVA 3SGEH 4C56E 4MJID 5AZ2L 3RVUC 4NQED 1JZ4A 3MRJB 3O6FB 4M6ML 4WFGD 1R5VA 1ZHKB 4AEFA 4D9QE 3RGVD 1BBJB 1FZMB 4OCXL 4F2MB 3MACH 1YPZA 1J86A 1H3PH 3DX8B 1WF5A 4GFTB 2UYLA 1UH3A 4OUUB 1RJCA 4HWUA 1YMHA 1CE6B 4YDLB 3OF6A 5DJ2A 5KVEH 1I8KA 1GHFH 3SJVD 1F4YL 4G43B 5C07A 5AG9A 2IFFL 4DW2L 1I7RB 4XNQB 5ADPH 3OXSA 1P53A 1DBJH 5DQDL 3U0TA 3N1FC 4YHYB 1HYRC 1HHJA 1LMKA 5JPMB 5C92A 2R69H 1OF2B 2EH7H 4PJIA 2IH3B 2LU4A 3O8XC 3SDXA 1NCNA 1HIML 4XHJC 1B0RB 4LASH 1LVEA 4X6FA 1CQYA 3EFFB 5SWZE 1LO2L 1OAXH 5EB9A 5TF1L 3T2PA 2FJFB 1PX3A 2Q7YA 4QRTA 5CSBA 4JY5L 1JP5A 1OHQA 2V5TA 2IGFL 4K9EL 2FB4H 3SDCB 2F5BH 1FNGA 3KWWA 3TEUA 3ZDXE 1YY8A 4U4BA 4JR9H 1RJYA 2R4SL 4H0GA 4JN2A 1FL3A 2CRYA 3NVQA 5HHNA 1OWRM 2YK1H 5HDLA 5HHMB 3RTQA 2XPGA 3QSKB 5I66B 3OHXA 4KQ4L 5DO2C 1IM9A 5T3XE 1KELL 1UM4L 2EKSA 4X7TB 4TQEL 2C3WA 1BPVA 4KWUA 5HI4D 5IBUG 3RU8H 1P7QB 4PRPA 5F7EL 3OAYH 3ULUD 3NPSB 3LCYA 4L3EA 4G42B 1CFVH 2AJXL 1U2CA 1UG9A 4IEFB 1C7TA 4J3TA 3QPQC 3ARGB 3U7WL 1YNKL 1MRFL 1FLRL 3OBAA 4XP1L 4BZ1H 4CVUA 5T1LB 2X42A 2GY5A 4JKKA 2E27L 3A6CH 4TPRL 4JFFD 4YXKH 2NW2A 2K9UA 4M61A 3L5WB 3VI3F 5J3HD 2JCCE 1ND0B 2DLHA 3MOBH 4JPKH 4NN6B 4TTDC 1U8OB 1N7ML 5HPMB 2XTLA 4EKXA 2J5LC 3TBVB 4ZXBB 2VDOH 3JWDL 4UOW0 5IF0A 3GSQB 1CVSC 1T80A 4RGMC 3FOMA 1HH6B 3WKNA 5KSAC 1KCSH 4Y4KD 3UJJL 4D0BA 1T3FB 2J12B 4G6KL 3KPSE 3H9SB 1LK2B 1FIGH 5C08B 2P45B 1M4KA 1CD1A 4UB0H 4DFHA 2BNQA 4Q74A 3ZKXC 5HHMD 3WL9A 4OZIA 3U4EB 4P5TD 1TQCC 5CBAB 5JTWA 4ZTPL 4G7YL 1A6WH 3IU4H 1W0VB 3DV4B 4IRSD 4NOFA 3RP1A 1MIMH 1RULL 3GJEB 3U4BL 4B53A 2X7LA 8CGTA 2NY5L 1U95B 3FQWA 3N85L 3O4OB 1Z0NA 1ZT4A 3DVGA 1E28A 5EIQA 3WHXA 1FVDA 4ZFOL 1D9KC 1NEZG 2VXTL 4YBLC 3STZA 2BY3A 3BGMA 5E4EC 1IFHH 1PAMA 1TJHL 1MQKH 2Y36H 4TPRH 1V3JA 1MFNA 3RPIA 4HUXA 3HUJE 1ZHNA 5FB8B 4U1HA 1TQCB 2H1PL 4YEFA 3VFGH 4WUKH 3LRHA 3FT3B 4X7DC 3SQOH 4LVNB 4OCYL 1EFQA 4ZTOL 2OZ4H 2IH1B 4ZUSB 5TPWL 4OCMC 2C3GA 4Y19B 4PJXA 5DEZA 2FX8L 2Z91B 1YQVL 2G75B 3GEWB 5DS8B 4BK4A 4EJ1C 4X7SL 1OOAA 1U8KA 5BVJA 1IL1B 4KHTL 5CCKL 1HHHA 3C6SA 4H26A 4O2EB 4ZO7A 5DHVH 3S37H 3QNXA 3RWIB 4NN6C 1FYTB 1GGYA 1RZGA 1QRKA 3MV7A 3VFTA 4HWZA 4ZXBC 3OZ9H 3G5ZB 1WGOA 1U2HA 2OCFD 4MNGB 2GTWA 4YZFE 3RL1B 3C2SA 4R90H 1GZQB 3FN9A 2LABA 1B4RA 1X5LA 1OTTC 1A6UH 1MCWW 1IQDB 4L4TD 2B4CH 1NGZA 3PABB 1L0XA 2VC2H 5GS2D 5JHDA 2X9YA 1FN4A 2MCPL 5A3IC 2FYYA 3IKCA 4PJEB 1QSEA 4LAQL 3V0VA 5GRUL 5KVGH 4HS6B 1MF2H 5EIVA 2D7PA 3AAZA 3ARRA 4KRNA 4NN5C 5F3BA 4ONOA 2NY3D 1GGBL 4KZDL 1L7IL 4NNPL 3ZTJG 2W0FA 4ZPVA 4GSDH 4I0PD 1KJVB 5A2LH 1YEEL 1QFOA 4M3KB 3DBXB 1LWRA 3D18A 1NGWB 1JGDA 3WNMA 2YKLL 2F53E 4YHPB 1P2CB 4OTXH 5DUMH 4Y19A 5DJYB 3SE4A 4OZ4B 1OAZH 5C09A 4DK6A 2X4QB 3SE8H 4XPGL 1FFOA 3S5LB 3GRWL 5SWZD 1HHKA 3PHQB 4LLYB 2HT2D 5A2JH 3R0NA 2FGZA 2HLFC 1UJ3A 1CLYL 3QO1B 3SDCC 2P48B 1CLZL 2VLLA 4R4FH 1G7HA 4TUOA 3CX2A 2IFFH 2AV7B 1SVZA 3SDXE 1B6UA 4JFYB 5IW3A 1CVRA 4WWKB 4F37F 1T7YA 3PWPE 3VXNA 3EYUL 3X12A 1RVFL 3KYMB 4OD1H 2DDQH 4Y4HD 1A6TB 4YEEA 1KTKE 2C3HA 4X7EC 1YJDL 4PJCF 4Y1AD 1U93A 3RVVC 2D7MA 2HAZA 1AD9A 3GGWB 5CSGA 5BW7C 5D7JA 3C5ZD 2B4CC 1ZOXA 1MHPH 2Z4QB 1CYGA 5GS1A 1NCAL 2RR3A 4OCXH 3MRGA 2AJVL 4JFED 1DBML 1T21A 1EO5A 4ODHL 4KV5F 1KJ3H 4IRJC 9CGTA 5B39A 3D3VA 1HCVA 5EBMB 4P3DB 1R5IB 3P9WB 3KYNB 4U1KA 1FC1A 2VUOA 5IMKB 4GG6A 1LK3H 4OLUH 5DDHB 5E94A 3LQAL 4UUJA 4F8TA 2YUWA 4CADB 2JB5L 3TBSA 3FB7B 2X89A 3TM6A 4HFWA 2BHZA 5JXEC 3BW9B 5IEKA 4M7ZB 3TV3H 4U6XA 3WMSA 4TULH 4P2RA 5MEPB 4OFYD 2E9BA 1UWEH 4WV1B 3QIBC 3X3FH 2N7BA 1D9KD 5DJ8A 2P8MA 3BIKB 3DTXA 5DJ6A 1MFEH 1I4FB 1RJLA 2IBZX 5C09E 3Q6GH 5M7QA 1H8SA 5H37G 5J9PA 4P2QA 3VG9B 4FQXB 1O7VA 3DX9B 3JWDH 4WTWA 1CDYA 1CK0H 4OCWH 2XZAH 3ARYA 1S8DB 5F89B 3EO9H 4NUGH 4XVTL 4PJ5A 4R97C 3PHSA 5D7LD 4EI5A 3KLDA 2P5WD 5ETUB 3P0YH 4HS8L 1T6WA 5DFTA 3O4OC 2XZQH 5JIKA 3ELAT 5DVOA 5F8QC 2B5IC 5DHYB 4Y4FA 4RGOH 2Z8SA 5BS0E 4GG6B 1J12A 3BOVA 5I19L 5ANME 3TN0B 3EYVA 1RZIB 2XNAA 5E95B 3RHWK 3LVEA 4K07A 4JHWL 4OCYH 4OI9A 3GI8H 1VDGA 1JYNA 4NN7B 4PJAE 1N0LA 4G8GB 1HKLL 1R3LA 3HUJA 3LPGA 1HN1A 4OF8A 3OB8A 5EH1A 3UDWC 3TP4A 2VWEE 1BFTA 2DLGA 4PGDA 1Q9LB 5HVHC 3AXLB 1DTUA 3QHZL 3H8NA 4LP4A 2DF3A 2W65B 3B9EA 3D25B 5DF0A 4XMPL 4LRIC 3IXAA 1IAIH 3BD3A 4LQFL 1RUML 3MGTA 1M7XA 1UZ8A 3HE7A 3CH1B 4X4XA 2WBJA 1CGSH 5EZOH 4JREC 3MNWA 3HCVB 4RMTA 3U30C 3QCVL 1NKOA 4G9DA 5EFIA 1Y18A 4WFED 2IALB 1AIFB 1E4XI 1JUFB 5KJRH 1U9KA 4CW1A 3VFRB 3U2SB 1VGEH 2ZOKA 4HKZA 2EYTA 4KK9C 2OYPA 2PTVA 4LCYA 1CLZH 5HTSA 3V52L 5JW4N 5DFVD 2JJSC 5L0QB 3CCHB 4M03A 3IDIA 1E4XL 1T22A 2AVGA 3WO3B 4XPGH 1NC4D 4ELMF 3GHEH 2AJZB 3D0LB 1YEDB 3FHQA 2F53B 3UTPE 2XKNB 2E6PA 1Z5LA 3ULUL 2Y9RT 3PP3H 3S96B 3C2AL 3PWNB 1L7IH 1NLBL 3BO8A 1G9NH 4NNPH 3SE4C 2YWZA 2C1PA 3TWCH 4QRQB 2FO1A 3VFWB 4GRMA 1YN7B 4PJHE 1UJ3C 4JGJA 1IGCH 4PJBF 3IKCB 4PJEA 1SJEB 3KPNB 5IFJB 2AJXH 3T3MF 1LP9B 5K9KB 2ZG2A 1FV1A 3WIHL 4NBYB 3KPQA 3EYUH 2IAMB 3QDJB 4QHKJ 2VDQL 5FOBB 1I8KB 5KVFH 4U1NB 4DZBB 2V2WA 1NANI 3U6RA 1NGXA 4UI2A 3C5SA 1NGWA 4PTTA 5E8PB 5T5FH 1S7WA 5GISL 5FGRA 4J1UA 2ICCA 3PQYE 4P9ML 2ZCLL 4PRPD 3VW3L 3VGBA 1GOHA 4GW1A 3TBYB 4MNQE 2HFFA 3ZE2E 3TYGH 1NC4B 1NFDE 5K9OB 2VXSH 5DHXB 2P7TB 3MZGB 3JV4A 4UDUB 3RKPA 3QIUA 4P4KB 2VOTA 3T4AA 2WNGA 4PY7B 3T0VA 3VMOA 3ZL4H 3TA3C 3DUSB 4HAGA 5FM5M 3VJ6A 4X6FB 4P5MB 4LVEA 1SBSL 2H26B 4YDLC 4U1SA 5DR5L 2G5RA 3ULVL 4BZ2L 2F74A 4KZDH 4JZJB 3TBWB 3QFDA 5E2UL 5I73C 3BP4B 5D7JB 4DKAA 5IQ9B 3S97C 4Z7UE 2X4NA 4TSBL 3IAGC 5CEXA 2A74B 1A1MB 3QIWC 1D9KA 1Q9WB 2VAJA 4NQXB 1G6RL 4W68A 1MUJB 1CIUA 4Y16D 1HQRA 3VWKB 5A2KH 5GS1B 4UILH 1VCAA 4S0TD 4D0DA 4GMTH 3H6JA 3GHBL 4LPCA 5KAQF 3WNNA 2OBGA 4K7PH 5DJZB 4X6DA 1F3DH 3T1WA 3QH3B 2A73B 2FL5A 1UZ6F 1MJ8L 3U0TB 1T1YA 5JA9A 1PY4A 4X5XB 1JCKA 1PSKH 1VFAB 5LGKA 1EFXA 4JFDB 4MQSB 4EN3C 4MWFB 1JWMA 4JFEA 4OGZA 4FTVE 4U6XB 3GNML 4G6JH 5F72S 4GG6E 4WFEE 1CU4H 3EOYG 4OZIF 4HZLA 1RUMH 4JY6B 4QRPE 3WHE0 2OI9C 4XMKH 3V0WH 1MEXL 3TESA 2AGJL 4PJAB 1QRNE 5F89A 1QSFE 4Y4HA 2Y06H 1MCLA 2R9HC 1RZ8B 2X40A 1AE6L 4RAUB 1DBAH 4FQXD 5F96H 3UDWA 3DLQR 1HQRB 5HGAB 3H0TB 4F8QA 1A6AB 3STBA 3LN4A 4RMUA 5I9QB 4KAQH 1E4JA 3Q5TA 4QRRB 2EC8A 2UZIL 3FT4B 4PJEF 4FXLA 3N06B 1F2XK 2CUMA 5L88H 5DMJB 2XFXB 3LV3A 4N0CC 2DM3A 2NTFA 3MRMA 4JDZA 4K3JH 2YRLA 5FHAL 1ETZB 4JFPB 4PB0H 4L5FL 4LU5H 1K2DB 3CLEL 3C5JA 4G9FA 4OBRA 3O4LE 1JI1A 1S5IL 3UTSA 3NCCB 3O3AA 1JHTA 5I1CL 3MRKA 3TVMB 1OWWA 2N4IA 4XGZA 2BC4A 2EZ0C 1K5NB 4G8GA 5HXMA 3TYFB 3RI5F 4K3EL 2IBBA 1G7MA 3HZKA 4LEOA 3W0WE 2BNRD 3H7BA 1BGXL 3BPCA 4ENED 1LILA 3MV8B 5DJCA 1NAMA 3BE1H 3Q6GL 2YRPA 4UQ3A 4OLVH 1X5GA 3D39A 4OIIL 5I1HH 3RKDD 5IW6B 5LBSH 2ZPKL 7FABL 4JY4A 3VFPB 4WI6A 3GM0A 1PW3A 2HVJB 1OAXL 2AEIT 3K8MA 4ORZC 4JCMA 3C5ZB 3M45A 5I0DA 2HN7B 3DROA 5DC0A 4LLMA 1OT2A 3MUGA 4BM7A 1UB6B 3NCYS 2DQUL 1KTDA 1UFUA 3DMMB 4JQVA 1EAPA 4LRNH 4QRUA 4DKFL 4YX2L 4PJHB 2AQ3A 3CVHB 4HUKB 1QQDA 2XZQL 4K94C 4M8VA 1HHHB 3CDCA 4QT5A 4F7PB 3BJLA 1LP9E 2EKJA 1SY6L 4YPJA 3RY5A 3SKNA 4UBDD 1CLOL 3G5XA 5C70A 1H3UA 2IPUG 5ID1B 4NWTL 3DETD 3U4AA 1RJZB 1N0XH 2WBWB 4FA8A 5A2FA 4W70A 2W60A 5T5NF 1CFTB 5EU4A 3FN3A 3ZYOA 5HHXL 3ZO0A 5FFLA 5JXEA 4ERSL 3NZHL 4HGKC 25C8L 4N8VG 3OWEA 1U6AL 3IB4A 2VL5A 2AI0H 4NFDA 1KXTB 1E27A 1NCDH 3D9AL 1K8IA 4RCAA 1JYWA 4RAVB 4WO4C 1U8IB 1H3VA 2GKIA 3QUMH 1UB6A 4MZ2A 1QBBA 1DZBA 5E9DD 4HT1L 4M6AA 3NTCL 4HC1A 4LLQB 4WU5A 3NH7H 3OPZH 2OJZL 1AO7E 1XGPA 3BD4A 3MUY1 3FFCD 4M7LT 5EOQL 2WP3O 2BDNL 2I25N 4QT5B 4GKZA 2CO6B 5FEBA 3BSZL 3CX5J 5EC1A 2HKHH 4R4ND 1YEGL 4ORGA 5MI0C 3UYRH 4DW2H 2AV1B 4JFYA 1RIVH 1SM3L 2VLJA 3FTGB 4RIRA 4LCUB 1QBMH 5E2TL 4L9LA 5D7KD 3QCVH 1NCDL 2H32B 3D9AH 3IRZA 1G9NC 4LMQI 5ACZB 1RUQL 3PGCB 2OMBA 1QVOB 2Q86A 5L6YL 4HMEA 5JR1H 2MCPH 4J6RL 2AEQL 32C2B 5EOCL 2F54D 5BZWA 1A47A 1A4JB 2Q7NA 2ZJSH 4ZO8A 2Q6WA 3SBWC 5BOZG 3L3HB 3TZVC 1QYGL 1HZHH 3DO7B 2IEPA 1HHGA 4Q6IB 5HY9B 4MYWB 4I18B 3DMMD 3BH9B 3BUTA 2DRUA 5HD8D 3TPKA 1EHLH 1EV2E 4IIQA 3E2HB 2ERJC 4MD4B 1QRNB 4YPGB 1BVKA 1IILE 5IJKA 3NTCH 3DARA 4XBEL 2DWEB 2Z92B 5T1DL 3W11C 3PWUA 5JPMA 1BFVL 1FL5A 1Z3GL 3MLVH 2NZIA 4JJHA 3W39A 1RUKH 1FDLL 4NCC2 2BFVH 2DM4A 3LKOB 4IRSB 4ZTOH 3L95A 3SGJA 1EMTH 3CLFL 5DT1H 1JRHH 2EIZB 1AXIB 1GPOL 1HH9A 3CSPA 4QRRE 5KSBE 4WI8A 1NPUA 1R3KA 3HNVH 5EU5B 3LH2L 1T83A 3I75B 2DQHH 3CMOH 4P2QD 5AYQA 2CKBL 5DEFA 4XXDB 1UKQA 2VSCA 3EYFB 1T0NA 1LO4L 2G5BA 4F3FA 4WY7H 1EUTA 5FO7B 2AJSL 5HYFA 3MPCA 5HJ3A 3K8KA 5H2BB 1EZVX 5HHNB 1KNOA 3ARGD 4B7IA 5HY9A 4N0UB 4DKDC 5F44A 2J8UB 4L8CB 3TT1L 4QHNA 1DQMH 3IAPA 5INCB 1QHOA 4XCEA 1TXKA 1I75A 1AGEA 3V6BR 1TPXB 4IRJD 4ZUTA 3UJIL 3MLRH 4CNIA 3QULA 1H3TA 5TPWH 3EDEA 1IBGL 3U30B 1TCRB 5I18L 2ZSVA 2VDRL 3BPNC 3WFEH 4XVUD 4FZ8L 2CKBB 3CZJA 4DKEH 1CTOA 2CLZA 4I3SL 4UMGA 1P7QD 4HGWA 3GK8L 2A9NH 2WIIB 2DOCA 3C5JB 3QNZB 4G9FB 5KSUB 4NO2A 3MOQA 1KG0A 1T2XA 1ES0A 1OD7A 3QISA 5F7DA 3NACH 5T5NG 1N5YL 4FFYH 4WJ5B 3S5LG 4APQC 3P4NA 4KK5D 1A3LL 1CG9A 1HYSD 3BAEL 4LVOC 4PRBB 5FV1L 4BZYA 3U0PB 2ED9A 3V5DA 1A64A 5GRVK 3V4PH 5IKCB 2DDQL 4MCYA 1ZLVK 1WICA 4UZGA 3T3PE 3OTTA 3BD5A 3H9SA 5H2BA 1OTTD 1YEKH 1WCBB 5BZDA 4GXUM 4KDVA 1CFVL 1Z9LA 1U3HA 2YD8A 2QADB 2IPKB 3AUVA 3D85B 2FATH 4U7SA 2WWMD 3HE6A 4LCCA 3INUH 3TT3H 4DEPB 2BY0A 3P77B 3HPLB 1KTLB 2BY1A 4U49A 3KXFA 4OCLC 5B3JE 5CP7A 4OKDA 2Y7QA 1I9EA 4Z77A 2ILLA 5F7MC 1CQKA 1T4KA 4BSJA 3CXDL 1C5BL 3T77B 4JO4H 4MQTB 4PJ7E 1QEWB 2DL2A 1BZ9B 5E5UB 3N1GC 3G6DH 4DQOH 1U3JA 3QR2A 3EOTL 1AHWA 2YD9A 1W0WB 4FQIL 5JZ7D 2MQ3A 2AP2A 3OL2A 2H2SD 1DQJA 1YN7A 5DD1H 5LCVH 1BD2E 5TE4H 1DLFH 1IQWH 4YFEA 3UCRA 4HJ0C 3RIFK 5GS0L 3LZFL 3NCMA 4PJXB 3S8WA 1C5DA 1ZT7A 1JV5B 2YD7A 2YMXH 3QIUC 5I73B 1KT2B 1A9EA 4QEGA 3MV01 5DRZB 2WAHA 3TA3B 3MBXH 3NCBB 1S5HB 3QXDB 3HPLA 1T21B 5I1AB 2ZJSL 3HZVB 1H5BC 1S9WB 1DSFH 4PY8J 3I6GA 1MVUA 3LMJL 1R5IA 4MNHB 3T1FB 4QNPE 5ABDE 4IOFC 3ZHDA 2CRZA 2Y23A 4NHUA 1LP9F 3P4OA 1FN4B 3KPTA 4YHZH 5FK9A 2DQHL 3CMOL 4TUJB 3VWKD 4RFNC 5DLML 3VXSB 3EFFA 2FBOJ 2H41A 2ADIA 1NUFA 5INDA 2DLFH 2EYSA 3P30L 4KUZH 2BVQA 1FDLH 1CE1L 1BX2A 2BVPB 1IZJA 1CR9L 4QOKA 4X7FC 2LE9A 5HYSG 1UADC 4MB4A 4K2UH 5DC9B 4U6TA 5JDSA 1Q0XL 2DQDH 3Q3GB 3FQRA 4LEXL 4NQDD 4NQDB 5I16A 2X4QA 2FJFA 1P84J 5C0AD 3ZYJA 1Z9SA 3OKOA 4JDVA 5ICYB 4P4KD 1J1PH 4YK4C 3U6RB 4WFFE 1LO3H 3RZCA 4TNVF 4G7YH 3ECBA 1HQ4B 2YRZA 2I07B 3BMWA 2DLFL 1EO8L 2BVOA 1HHIB 3BEVA 2Q3AA 3G6JE 2Y5TA 5DXWA 1MLCB 1HH9B 1P9MC 1WIUA 3L1OL 4RBPK 4X5WA 4GBXA 4I3RH 4GAJL 2E3VA 5IVXA 2FHFA 4JPIB 3AGVA 3FZUC 4WEBL 3CDGA 3UTTE 4JG1H 3AROA 3MREA 2HFGH 2QQKL 3DMMC 1MJJB 1P7QA 4ODSL 3VXRA 2OL3L 3QCTH 4A6YL 1LNUB 4P59H 5H37H 2R2BA 4LPXA 1A1OB 2PYEA 1FL6A 1I8MB 3TFKD 2DD8H 4G9FE 2HKFL 5HYSB 3MJGX 5GSVA 3VGGA 2FWOB 5IMMA 2ATPB 1OSPH 3Q1SH 2OR9H 4HLZH 4I3SH 3T65B 2XA8L 4NQXA 1PJ9A 1WWBX 4FQQA 2CLVA 3LHPH 3LEVH 3P0GB 4PJGA 3OJVC 3VH8A 2V7HB 1A3QA 2H9GA 3BQUC 5EWIH 2WQRA 1EO7A 1TZHA 4HBQA 3S36L 3TVMC 1LO5A 5SWSD 4MD5A 4GAFB 1VFOA 4YFLF 5LGHL 1OB1B 4HK0A 1KB5H 2WIIA 4L3AA 5ANMA 1EJ6A 3VXMA 3UTSB 3A67L 5I8KH 4HUWA 1QA9B 3R8BB 5AD0A 3ZE1F 1QPXA 3NAAH 1P5VA 1U3HC 1P4IL 3MXWH 1EVUA 1LO0H 1I4FA 1I8LC 1RJLB 4M48H 5F7FA 5HYIA 5KSAA 5DZOA 4CN1A 1WC7A 3H7BB 2F15A 5FA4B 1MAJA 1YDPA 5DRNB 1U95A 2ED8A 2RCSH 3FQWB 5FCUL 3V7MA 4KDTA 2A6IB 1ZT4B 2CKBH 3DX9A 1E28B 2B20A 5IJVA 5SWSA 5BV7B 3O0RH 4N68A 3MRRA 1T2QL 3VXSD 2QKIA 4ETQA 4PB9L 4M7KL 4CRPA 4XPFL 4JKMA 5CAYB 4R97B 4XP9H 5HYSA 2AK4E 3VG0L 3GDBA 5LGHH 2E7CA 4M1DH 3MRPA 5D2LB 4CJ0A 4ELKA 2FEEI 2VE6A 3WFCL 1XCQB 2YWYA 1FZMA 4MB3A 3QIBB 4HWBA 3RPIB 1MCRA 4I1NB 5JPNB 4PJBE 1TZHB 4GKNB 4U6YB 3RBSA 4MQXC 4GAYB 4MMZC 3PDOB 3FQUA 3SJVA 5T3ZD 4AH2B 4PTTB 5E8PA 3IGAA 1NDGB 2CRIA 3CU7A 1UKTA 1N5YH 1N5AB 3KPLA 5DMKA 3B3IB 3S34L 1TTGA 2BY2A 1CZ8H 4YHLH 4GW1B 2NY2C 3RL1A 4NKOA 4P9HL 4WUUB 5D7LB 5HDBE 4JGMA 4PJIE 5ALCL 3V7AE 4HLZG 3FHAA 2YZ8A 4Z7WF 1WTLA 5CKAA 2X1PA 3ZKNC 3QXWA 4IRJB 2FYYB 2K1MA 4QHLB 5MP6H 1XGRA 4GBXC 1QSEB 3TZVD 2R23B 5B3NA 2I60L 3LPWA 4WNQB 1Q9OA 1NGZB 1QTYT 1RZ7H 3FRUB 5L8KB 4CW1B 1IAKB 3T3PF 4U1MA 2KUTA 1NJ9A 4GMTL 5JORA 3K4AA 2XT1B 4KUZL 1J0KA 2VLKA 2A6DA 3RNKB 3LS4L 2DQDL 4ODXB 1N6UA 1FL3B 3B6SA 4HPYH 1FFRA 1YEDA 3H3PL 4TSCH 2C26A 1Q0XH 1ZA6B 3MLUH 2HP4A 3H42H 4JFDE 4PUBL 1FPTH 3FO0L 4KQ3H 3KPPA 4U1IA 1MVUB 4XMKL 3LAFA 3REVA 4PJGF 4YHOH 3P11H 1GGBH 1CU4L 1T1XA 1RMFL 4X6EB 1KCRH 4LF3A 2I9TA 3FQNB 5ISZE 1J0YA 3RUGE 3ZYZA 2VN4A 2XOTA 3NFNB 5J11B 3OG6B 4YC2B 1YEHH 2YN5A 3U0WL 4N8CH 3OKNB 5IWLC 4POUB 4JFOB 1CGXA 2CR6A 1FNAA 3PWPA 4KC3B 4F2MA 3A0OA 1CGYA 4I77H 1FYTD 2YUZA 2DM2A 1TZGL 5H35A 1VB9A 3LPFA 4YWGH 5E8DL 5I1KL 4TQEH 3T8XB 1CLOH 3LZFH 1BZ7B 4I18A 3QWOA 4WWKD 4PRAA 5E03A 5AAMA 3QDGE 3U9UA 3GSQA 1OTUD 5IGXH 1EJOH 2AJ3B 5JXAL 3GMOB 3QFJA 5GGTA 5ICZA 1ZVSB 1KCRL 2UYLB 3NN8B 4R8WH 4L8DB 5DK2A 5IMLA 1G6RH 2YKLH 4PJ5D 4M62L 2NY2B 5F1NB 3GO1H 5A3ID 4IDLA 4N8CL 1K4CA 2H32H 1KCVL 2BNQB 5GRVL 1MLBA 1N8ZB 1J0IA 1ACYH 3QG6B 2J4WL 3P40A 1RK1B 3QI9B 1OVZA 2ESVB 2ZG1A 2BNRA 5T1MA 4RIRB 4ZFOB 1MCIA 3UJTH 4YXLL 2AXFB 3CAFA 1NCWL 5BVPH 5L7XH 3HNTH 2CK0H 4KI5C 4ZMAT 4WI2A 1F3JA 4JN1H 2MMXA 3QDGD 1NMBL 3W5MA 1HXMA 2FEDD 4JO4L 5D1ZC 2EE3A 2CPCA 1AGDB 4LVNC 4M48L 5JQHC 5A40E 3VFSB 1GAFL 3MFFB 1DBBH 3FKUS 3BIKA 2NY5H 4MX7A 2PYEB 5SX4I 1XGUA 4FG6C 4JY4B 5CLTA 4XRCA 1MIML 2IJ0C 3WHE1 4ENEC 3SO3B 5I1JL 4K94H 4Y1AE 3GMMB 3ARDA 1IGYB 3KXFD 2NY1C 1DUYB 5JHDE 5HI3C 5L2KA 3EO0B 2AK4B 4F58L 5E7BA 4F9LA 1ONQA 2AXHA 1JHKH 4X9HA 4M6MH 4AG4H 1E4WH 1U8KB 3WEXB 5BVJB 1V5JA 5DI8A 4PLKC 2VL4A 5ENWB 3REWB 3RUGF 2OMNA 2Y06L 3CC5B 2P8PB 3L3GB 4IS6A 2KKQA 2KBGA 1CTNA 2VRAA 5KTEH 5HVWA 1UACL 4KK8C 3MLPA 2QSQA 1KN4L 1B88A 5FF6B 3H9ZA 3VXPB 3ZT6A 4CMMA 4YJZL 4RGMB 3WUWA 3VXUE 2ZUYA 1JYXA 5E6ID 2YA2A 2J7LA 1BWMA 5IJVB 4RA0C 2GUOA 3WXWL 4NQVA 4CGTA 1BFSA 3KS0J 3TCLB 4JPVL 4O9HL 5ESVA 5J6GA 2X4SA 3I02A 3OSKA 5K9QI 1U8HB 2HG5A 5F3BB 15C8H 2XFXA 2M2DA 3O8XA 5J6HB 1I9RH 1MFAH 3CH8A 1LE5B 5BS0A 4L8BB 4D0BB 4FQ1H 2FO4B 3ARGC 4YDIL 5IV2A 2BK8A 2Y4SA 2J8HA 2VQ1A 4ZFGL 4TVPH 1G9ML 1LO4H 2IQAA 4LHUA 1MI5D 3VDCA 1KB5L 1G7MB 3HZKB 4F7MA 5IVZA 1FIEA 3FOLA 1Z5LB 3MXWL 5DMIH 2V2XB 3WS6C 1FYHB 3TNMA 4YZFF 4C55A 2NNAB 1AP2A 1EGJL 4JY5H 1DQQA 3GBNH 4YDVB 4GXVH 5B8CB 3U36B 1MPAH 3RL2A 3MRDA 4KPHH 1HSBA 3V5DB 1QSVA 1ZLWH 2CIIA 1LP9A 5K9KA 4Z7VF 4Z7QF 1MJ7L 1QKZH 1EA9C 5EU6B 1A7RL 4OI8A 4HH9A 3DMMA 4XCCL 3RZCC 3RAJL 3CVHH 4C59B 5KSVA 2FRGP 3GGWA 1BIIA 1EBPA 4FFVC 1TVDA 4I77L 4ZYKA 5GJSL 4PRID 5I1AA 3O8XB 3H9HA 3KXFB 4E42B 5HDBF 3PXJA 1LE5A 4AK1A 1WIOA 5D96C 4P59L 4MNGA 5I17B 4XAKE 1H0DA 3UAJC 4NHCL 1HNFA 4JFHE 5KVEL 3FB6B 1CICD 3TIEA 1FFNA 4GBXD 5ELIA 4HLJA 1SJHB 2H2PD 3MRLA 4N1CA 4LKCB 3TCXA 2Y6SC 3D2UD 5LG1A 1JZ5A 3QJFA 1QBML 1X5FA 3LEYL 5JLZA 3QIBD 1UYWH 2F74B 1W72H 4HPOH 3VRIB 4O2CB 2OZ4A 3CZFA 4OFKA 4PJ9B 1J8KA 1YEGH 1OF2A 1AQKL 3L5IA 2X05A 3QIUB 4P4KA 4CMHC 1IGMH 3UYRL 3PL6A 4I2XB 1T89A 3DTXB 3LD8B 2BDNH 2CUIA 3QZWG 4KPHL 4P5MA 4Q9RL 3BSZH 5JA8B 5GGVL 3ZMRA 1UH4A 4EIZC 4XNMB 5DQ9B 1JNHA 4UV4L 1EUUA 3RGVC 2OJZH 3NZHH 3V8OA 4DGYL 5HI3D 1GHFL 5EO9B 1NGQH 3BHBB 3KLAB 2HVKB 1UXSA 3BP6A 3KLSA 4YHMH 5C0FA 1HDMA 5C0GA 5IMLB 4OD3H 2GW5A 4XP9L 3BJ91 4F7TB 1TITA 1L0YA 3OXRB 4NM8L 3G6AB 4NPYB 4HC1L 4Y2DC 1MLBB 4HKBB 2EECA 1JWMB 4QNPF 5EU7C 3KPRD 2NY7L 3WFBH 4TVPD 4NDMA 3UC0L 4OQTH 3WFHA 4N8VA 3STLB 4FNLL 4LPWA 1KIPA 5FGCE 4JJ5A 4R2GC 2AXFA 4UINH 3VXUA 1P84K 2KQMA 5J1SC 3TH4T 4DVRH 4QLRA 3CFJA 3ILQC 4K7FB 3S37L 4OFDA 4NP4H 2PTTA 3Q5OA 3WN5A 2VH5H 5HPMA 5EBGA 1AFVL 2J6EL 4ONGH 1IGTA 2CUHA 3D3VB 2NR6C 5EBMA 1IQWL 5FO8A 2Z31C 3DWTA 4UT6L 3W2DH 1CFBA 2ARJB 2DI8A 3IDXL 1ZKAA 5TE6H 3CXHJ 5CHNB 2DWEA 2Z92A 4JRYD 3OKMA 2Z91A 1WCBA 5BZDB 2XI9A 4HQQH 2UV3A 4APQB 4JO2H 1KXQE 1U8PA 5EU7E 5LCVL 1H9VA 4Y7MA 2UY7A 3VXUD 1M1SA 4OZHA 2FH8A 3VMNA 5AD0B 1K2DA 1GC1H 1INQA 2LTQB 5HI4C 5CZVL 2M26A 1I1FA 4JRXB 4OF3A 4RISL 2ZOLA 2XQBH 5JMRA 5TJWK 4M6NL 3Q6FB 3VD4A 4XT1C 4A2LA 1PLGH 4H0HB 1DUZA 3K4ZA 5DJCB 4XX1G 1MFDL 2NY7H 1INEH 4D9LL 4WFFD 1KIPB 5C0AB 1KV3A 5AZEH 3SGKC 4QXGH 3V0VB 4QYOB 3QG7H 1DBKH 3PE9A 2LVEA 3EDKA 1TJIL 3PL6D 3VXPA 2KH2B 4R9HA 4RZCB 4H8WC 5EN2B 4GXUN 1ZGLB 3VI4F 5C0BE 4M9PA 4LU5L 1XIWC 3VA6A 3OKEB 3T2NH 4L4TE 2DQFB 4PLKD 2VLKD 3ES6B 1F3DJ 4PYHA 1MAMH 4XNUH 3Q0HA 3BKYL 3AY4A 5F6HI 4NO3A 1Q72L 3VE0B 1ORQA 5JW4Q 4TSAH 1ZHLA 5CJOH 4X9IA 4WUKL 2IQAB 5ETUA 2Q76A 2PF6A 4POYA 4HV8B 4M1CC 1VADA 1BF2A 2FO4A 2AJVH 4M4RA 5HYJA 1G7HB 4MJIA 3BYYA 4PR5A 5E7FA 4YUEH 4MNHA 3T1FA 2PO6B 1RURH 3B9DA 3PDGA 1OY3B 3BH8A 2D9CA 2GCYA 4NHCH 3O4LA 3O9WA 3F7VA 3GNMH 4G6JL 4IRJA 5EU4B 4P57B 2ZKHH 4I18C 3RU8L 2QKIB 4LDOB 1GZQA 1G9EA 2HJKB 5IG7B 5HGBB 1SM3H 3AMLA 2A6KA 4LSPH 1KULA 1ZLUK 2R2HA 5CJXC 3RAJH 5EZIL 3M1BA 3OR7A 3UXFA 1AGCA 3SPVB 1N2RA 4GOSA 3SQBA 2XN9E 2GT9B 4NO5A 3QUMA 3BP7A 2Y7QB 4JN1L 1IZKA 5HSFA 5DUPH 3LN5B 1KCSL 1WQVT 4AEIL 2WLYA 1A2YA 4UQ2A 1U92B 4D0DB 1K3IA 2A0LC 3SKOA 5E94B 3HC3L 5SX5H 1D5BA 3ZL4L 2QHLA 2XZZA 2FLRT 3BFOA 4J8RA 4U1IB 3FONA 1DLFL 2VXSL 1H15B 2VLLB 5AEAA 5I76A 4NN5B 3CGTA 1UWEL 3KLHD 1FFNB 5BO1H 1CXEA 2E27H 4HXBL 3PHQA 4EUPA 2LU7A 5B3JF 1BFOA 3EYOA 3MUHL 5DR5H 5J8OA 2V5YA 5ERWA 1L7TH 5DMIL 5D6DA 5GGVH 2EDWA 3MCKB 5DLMH 3P4MA 5D9SA 3T0ED 4HFUH 5IEHB 4U2ZA 2CDGB 4PJ8C 2R0LL 3EOAA 1FV1B 5IG7A 1HXYB 3VXRB 1FO0A 2XKSA 3HAEB 4BSWA 4M1CD 4G8EB 3IFPA 5C2UB 3D1MC 5SX5K 1MFAL 5EUKA 2NYYD 4RFNB 3UPAA 4EI5B 5DWUL 2FJHB 4K8RH 1HNGA 3C8KA 4PPTA 1KTRL 4L29A 5FKAA 2EXYC 3QA3A 4DKFH 1J05B 1S9KC 4OM0L 4U1NA 1QFHA 4YGAB 3WXWH 5E8EA 5GSRA 3PP3K 3OHXB 4OBSA 3SOBH 1BQLL 5D1QB 4QRSB 2ESVA 3I6LD 5B8CC 4K9EH 1GGIH 1I1AB 1S7VA 1ETZA 4JFPA 4MQ7A 3WIHA 5KSBF 4HHAB 4L4VA 5D70H 1IAII 3MYJA 1S9XB 3WJJA 2CMRL 4PJ7A 3D48R 5GZOD 1IFHL 4CU7A 2VLKE 4G42A 4LPTA 1Q72H 4MJ5B 3VA2C 4ACPA 4OCRL 3F7PC 4TRPL 5FYKL 3PQYA 1R5WA 3N85H 3QQ4A 3RHWF 3EOAB 1JI2A 2HFEB 1CDIA 4BK5A 1KJMB 2JJWA 2HTLD 5D2LE 4NC2B 3ARDD 4E41A 3HRPA 3RVVD 4BSWB 3O0RL 1IC5H 2FHCA 3ECBB 3D0VB 2G5BB 1EEUA 2FIRT 4U7MA 1EIBA 4XBGB 5ALCH 4WHYG 3ILPA 5D7KE 5FYJL 1MF2L 2W92A 1KIQA 2NY4C 5I74B 4ZFGH 5JW3H 3WLBB 4OGYH 1G7JB 1DEEA 2GSIB 4UBDC 2Y5EA 2DB8A 4GRLD 1FYTE 5H8DA 2CR3A 3RWDA 2GFBA 4MNGE 5DSCA 3DV6B 4XI5C 3UBXI 3UTZB 4KUCF 1KGCD 3KNBB 2DLEA 1QO3A 1E6OH 1B4JH 1KB5B 3LKSA 4WUUD 3EAKA 5ITFB 1QSEE 1F3JB 4CBPA 1SY6H 1JZ8A 2GJ6D 2HT4C 5K9JL 2VAAB 2ZUQB 2HKFH 4LPUA 3FRPG 4PJDE 1X6NA 1IARB 4BH8A 3RX7A 2PCPA 5D1ZD 1KN4H 5IW1A 2VDRH 3V2AR 2O5XL 4EI5D 4PRHA 3E0GA 5DGQA 5GS0D 4OLVL 4WI3A 4ZUUA 4HS3A 2P43B 2C4XA 4P5KA 1P7KA 3D0VA 4F33B 4FG6D 3HB3C 1U8IA 4XZUA 3MX0A 4RRPA 4OZFB 3EO1B 4ZQKA 2DYPA 4K9EC 1T3FA 3MTRA 1Y0LA 1EXUB 5BJTA 4Z76B 4U6VL 2NY6B 2P46B 2CDFA 3C09B 5I8KL 1A3RH 4YFDB 3MGAA 4LLVB 3E6FA 5DURB 5TGBB 3FOLB 2BFVL 2ZOKB 3NIFF 4HKZB 2WP3T 3GMNB 4GKSA 3FCTB 3MCLH 4GRLA 2NW3A 5HYJB 4Z8FH 4ZUWB 4GAJH 3H42L 3OXSB 1BBDH 4ZD3L 4LCWE 1N64H 4PJGE 4X9GA 5ALBL 2XWBA 4PV9B 4ZAKA 1W0WA 5HHPB 1ZA3B 4HWEH 3BO8B 4MXQD 4I9WE 3NIGE 4FRWA 1XGYL 4N0FA 2FX7L 1HWGB 1BEYH 1DBMH 3L7EA 3PNWA 1SJEA 2YBRB 1Y6NR 1LK3L 4PRHB 4X6CE 2P24A 1H3GA 1MSPA 1XGQA 3NH7L 4P5TC 4OIBA 4U6YA 3JXAA 3SKOB 3DROB 4KJQC 2NX5B 1NGXB 4JB9H 4QCIB 4M4PA 1HKFA 1K85A 2BNQE 4Y2DA 4JFFB 1ZEAH 4GQPH 2FL5B 1GZPB 5DVKA 2IAMA 3QDJA 3PV7A 3L1OH 3WIFA 1MHHA 5IESH 4NHUB 2XACC 4HIJA 1Q9KA 1C16A 5I15L 3D2UA 3DX7B 4NCDA 1UH2A 3QO1A 4J6RH 2XZCL 5CUSH 3EZ8A 1YMME 2QADD 2D0HA 5E6YA 1BVLA 4QHLA 1QD0A 3L9RA 3IF1A 5LQBL 2E7LC 4JAMB 3GRWH 2VYRE 3TBYA 1NLBH 5JDJA 3GKWL 4K7PY 3QIWA 4RNRB 3BGFC 4DCQB 1D5XB 5HDOA 1T7VA 2CKNA 5JORB 5BRZB 3EYFA 3VXSA 4PFEA 1CLYH 4U1SB 1X5IA 4NJ9H 3ZDYE 2FX7H 2VLKB 4HJGB 2VL5B 3KJ4C 2XYCA 5C8JB 1S7QA 4NZRH 1X44A 4MJ6A 1JIBA 2DBLH 3ROLB 2BSRB 4LSQL 4TSBH 4NRZA 1S9YA 3SO5A 2KDGA 1KUMA 1BD2A 5I6XB 5C0FB 4HAFA 5TDNA 1P4BL 2PR4L 2Z35A 4P23D 4FQLH 1INDH 5E6IB 4HHAA 4OZIE 5I8EB 12E8H 1MWAB 4P2QE 4Z7OE 3A6BH 3QXVA 1RK0A 2W9LA 4QRSA 2YEZB 1I9RL 1II4E 5DD3L 2V9QA 4NZJA 4P2OB 5C0EB 5GPRA 5GGVY 1NEUA 1R5WB 1V3KA 2FGWH 4D94A 2BXZA 3UZVB 3LKPB 3ETBF 2FD6L 4XHQA 5JIIA 4URTB 4LSPL 4L3EE 5CBEA 4M5ZH 3ULUE 1MCHA 2BJMH 5MENB 1C08A 4Z18A 4CMMB 4IOIB 1A6TA 5FO8B 4HIXH 1X4ZA 2ZNXA 1OP9A 3C60C 5FYKH 2XQYG 5M94B 5FYJU 5IB3A 5HHVH 3OB0K 4YX2H 2PO6C 3SCMC 5EORH 3O11B 2L0DA 2Z8WC 1UEMA 4IRZH 3ZKMC 1WBXB 1A7OL 2VZVA 4KXZH 4HZAA 3RTQB 1E6OL 2EE9A 4PLOB 5HVHB 2AJUH 3GSOA 4UT9L 4FTVD 2HFGL 2DN7A 3ARUA 3RWIA 4DKEL 4WEBH 5CJBA 3OKLB 1BQLH 1QRND 2R29L 1EH9A 5BV7C 5CGYC 4OZFG 5HYJD 2A1WL 4MAYD 1SBBA 4UUJB 2ADFH 1CK0L 1WZMA 5B38B 2J3SA 4MD5B 2GK2A 1S7RA 1DN0B 3RUGA 3RVWC 3UTOA 5DWUH 2FBJL 2VKXA 5LXGH 4JJ5B 3U79A 5IVOA 1YY9C 3KS0H 5I75B 1I85A 4BFEA 4WV1A 4NNXB 4H1LB 2D7TL 3TO4C 4R4BA 3QPXL 2BNQD 5FKPA 3I3BA 5C0NC 5E5MB 5DRWA 4ZTPH 4G3YL 1RIHH 4MA8H 1GAFH 4IOSD 1Z9MA 5F1IB 5CP3H 4I5BA 3RIAF 5JOEA 1X4YA 5J06A 2VXVH 3ABZA 5I8OL 5BVPL 5L7XL 3UPRB 1D5ZB 1I8LA 3JTTA 3PIQA 1GVIA 4L9LC 4D9RE 2JTDA 2CKBA 1G7IB 4H5SA 2NXYB 4O58L 4PJFA 3RIAK 5HVFB 4PJHF 2EIBA 3WDJA 1CDBA 4QRPA 4XZUB 1WEJH 4O51A 2FJGB 3LEYH 4XMPH 5CBAA 4Q2ZA 3EFDL 2F19H 2X4PB 3L3JA 4GAYA 5D6CB 3MLVL 4C56A 2GIYA 5J3HC 3V5HA 2VO5A 4G80B 1KCLA 4TTDD 1X5XA 5KG9B 2CDFB 3OKDB 2BSSA 1HI6A 5I9QC 3FB6A 3E6FB 2X2YA 4X5LA 5TGBA 4AEHL 3FQUB 2HJFB 5DZNA 5KZCD 2P8LB 5HYEA 1O0VA 2A2QT 5DHVB 1U58B 2VNCA 4FFZH 5F7EH 1IM9D 4D9RD 4K8RD 5C9JB 4OT1H 1G84A 3T3ME 3HR5B 3PGFH 3MV7E 1U8MB 2R4SH 3B2UC 3D25A 5JQ6L 1M7DA 3RWGA 4JFQB 1J8HD 4KUCD 3SEPA 1DQDH 3KPNA 1MELA 5LQBH 3BGAA 4Z7VA 4H88H 3WFBL 1YMMA 4N9GB 4Z7UA 5E8NA 2OTWB 5C86A 5L8JB 4RWYH 1ZS8A 4Y2DB 2JB6A 3MNWB 4NM8H 5DQ9A 2G75A 3RX8A 4X6DE 4NKQB 5T3XH 4OD3L 1AIFA 2F54E 4MAUH 1Q9KB 4Y5YB 5D7IB 2GJ6E 5DQJB 4U1MB 3C6LD 2V2TB 5IK3B 3JV4B 3ZE0F 4P2RD 2KZ1B 2VLRB 5DMGC 4JDTL 4P9HC 4X98B 5TF1H 1RZJC 2PW1B 4X4YB 1XF5A 3GJFK 3QPQD 5KG9A 1S7UB 4X6EA 2H26A 2EDJA 1BFOB 1WT5C 1KC5H 4LVHC 4X6CA 1T2JA 4LCUA 4KI5E 4PJAF 3DUUA 1NUDA 3K1KC 3SDCA 4IBLT 3PV6B 3VGAC 2D0FA 3SBWA 4XWOC 3QXAA 4GUPA 2C3VA 3F58H 3GHEL 3RJDA 3WBDA 2B1AL 4E41D 4JFHD 5CSZB 5T1KD 1U8MA 1U6AH 4I0KA 2R39A 4LQ1A 2CQVA 3QXDA 4KK8D 2ZCLH 5I1LB 3WN5B 4NRZB 3DBXA 5GSVB 5ESQB 5HGHA 1F2QA 4D9LH 1QPPA 4L29B 3RRQA 2NY4D 4GW5A 4LL9A 1F4YH 3HKFA 4HK3N 4MAYA 3MODH 2XQBL 1LQSR 5FYLH 4WW2F 3MRQB 1K4CB 2ENSA 4XTRC 2B2XH 4PJ5B 3PWUB 2R1WB 5FUCE 5KS9E 3TNNB 3W39B 3QI9A 3C9NA 4PJXF 4UT9H 3VFNB 1IT9H 2EC9U 1WWCA 1DQLL 4ZO9A 1F90H 4JM2A 4NWTH 3B2VL 5MHSD 2XXMB 4ONHB 4KROD 1AGBB 3CD4A 1N3NB 5EORL 3RA7L 1EFXD 5GS0H 4AL8L 4NO0B 3VRLF 4GUPB 3V6ZB 3C09C 4RSVA 1JWSB 5DJAA 3EJJX 5E8OB 3W9EA 4OGAD 3EYSL 3HLAB 5SWSB 1ZLSL 1CT8B 2FECL 1T2QH 1U8OA 2NY6C 3OMZA 1R3JB 3ZDZE 5DJ0B 4ZPTB 4NRYA 4AEEA 1JUFA 3MV11 1HQ4A 5LAXB 3B9KB 2DQEH 3BP6B 1UA6H 4M1DL 4LSVH 3QEUA 5C09D 5E9DB 1D9KB 1Q9WA 5F7UA 5EZJA 1XIWB 1V3LA 4YGVB 1C5BH 4JKLA 1IAOA 5D72L 3P0VL 1PEWA 2UZYB 2ZCKH 2MNUA 4E9LA 4OD2A 1J0ZA 1L0QA 3P73B 1JHTB 2QQLL 1INDL 2H8PA 5IR1A 5EPMB 2X09A 4KI5F 3ARDB 1KENL 5E70A 1YA5A 2BSTB 3KYOA 2ICEB 3GJEA 4CVXA 4JM2B 2E7HA 5BS0D 1KCUH 2YD1A 3AC0A 3QUZB 4XB8A 3ARFC 3HI5H 2C1OB 4XNXL 3CSYB 1NEZA 4OKVB 4HS8H 3BPNB 4JFZH 2Z0BA 2DMBA 3Q48A 1IAMA 1JNNH 5I74C 2DQIH 4PGBA 5SX4H 5GS2H 5I1KH 1SHMA 4PJAA 5I1HL 5HGBA 3VH8B 4Y4FC 3L3DB 5GGSB 1JBJA 4WW1A 4FXKA 5FM5O 3H9SE 3VFWA 2LVCA 1KJ3L 3JWOH 3AVEA 4PRDA 2EYRB 2FSEB 2OR7A 1AO7B 4R26L 1NAMH 1MCEA 4O51B 1CFNA 2AAVA 1UQSA 3MV7B 4QTIL 3VFTB 4QHMB 3KAAA 1MHPL 1PZ5B 2AGJH 4DZ8B 3AREB 3PP4L 3SHSA 1FCCA 3ARBC 2VXTH 1WAAA 1UWGH 1S3KL 2K7PA 5FGBC 1R24A 4Z77B 1JZ7A 1IL1A 4E41E 4Z7WE 2VXQL 1J88A 5IVZB 4GRLB 2NW3B 3FCTA 4QGYA 2X6MA 3SKNB 1DLHB 3V5HB 4ZNEE 4XXCA 5C0AA 2D7TH 4PJFE 4CU6A 5IIEB 5EULV 4FQHB 1X5HA 5LXGL 1RIVL 2WBJC 4FHBD 5HDQH 4HIEA 2ATKB 5JW4R 4R0LC 4PBVC 3FFCA 4YDKL 3BESR 2V2XA 1KJVA 4JFOA 2IG2H 1ZE3C 2CDGA 4MCZA 5FHBL 1NH6A 4N9GA 4ZAKD 5HPOA 4TNVK 1XF4A 4RWHA 2R29H 3HNVL 1FNEB 3VH8G 4HS6A 3LIZL 4N0CD 2JCCF 2WINA 4OTXL 3QFDB 4Y89A 5DUML 3G04A 5E00A 3VGAB 3M07A 1GIGH 2E7LA 4LGPB 3IFPB 4BZ1L 1EMTL 4DOHB 4Z7VB 4ERSH 4WWID 1WZLA 2WBKA 4JFFA 4U7KA 4LVHB 1OM3H 5KOMC 2VLRA 3O2WH 4MS8C 5C09B 3RNQB 1KTDB 4PJBA 4X80L 1BJ1H 1X4XA 4X98A 1MHCB 5JXED 1RAMA 3LN9A 4O4YH 4O02L 1A9EB 1ZK9A 2MPAH 1UJTA 3JVGC 1NBYB 4LIQE 4AEIH 3ULVF 1FVCB 1YJDH 3X12B 2YZ1A 4NT6B 3TPUB 2NMSA 3KVQA 1JGLH 3QUXB 3VXTA 4FS0A 2O5YL 3L9RB 1RVFH 1XGRB 4Z7NF 1F8TH 4F7EB 1Q94B 4PRNA 4L4VB 2FH6A 1K8DA 1WFUA 5EZIH 4F57H 3MRCB 3F58L 1RFDH 2QSCH 1GGCH 3FRUA 3HNSL 4S1SH 1OAZL 3T0XA 1QOKA 3QQ9D 1J10A 5IP4A 1A4KB 3QP3A 3TJHC 1J5OH 4KGJA 5DO2D 5B4MD 2QSVA 3WSQL 5GZND 2VABB 1LD9A 2JJSA 2ZKHL 5CKGA 4JZOB 5F7HA 1JHLL 2DS4A 2H2SC 4JE4B 5A1AA 3VFSA 1KOAA 4OUUA 1ACZA 5CD3A 3BN9C 1KCKA 3TH3T 4BFGA 4G8GD 1KB9J 3D85D 4PTUA 4QRRA 4EXPX 3F5WB 2X4RA 4KK5C 3DETC 1IGFH 3MA7A 3DI2B 3BZEB 4EVNB 5D93C 2EEDA 4KDWA 1D6EA 3FN0L 4DGIH 3R1GH 1E4XH 4JHZA 1MRCH 2EIZA 4OLZL 5IFAL 4J4PC 3B9KD 3DYPA 4OGYL 3FB7A 1RUPL 2P8MB 1N4XL 4K23L 1BGXH 4IOFD 3UROR 2DMKA 1RZKC 5FYLD 3WL9B 3K0WA 1ZAGA 2VC2L 2WWMC 3H9SD 5LGJB 1A1NA 3REVB 3QUYA 1PEZA 4OJFL 3O45B 1ZGLM 1CGUA 2M8XA 2YA0A 3CXDH 4MXVF 5EU5A 3VU2A 2QTEA 4P2RB 4XPBH 1N3NA 25C8H 4OFIA 2AQ1A 4I4WB 1MFCL 3PQYD 4PRAB 2ADJB 4AM0A 3ESUF 4W6WB 1UM5L 2OJEB 3RIFF 1J1XL 1S3KH 1MY7A 4GLRH 1G1CA 4OCRH 5I75C 3GJFA 1CT8A 4TOYH 1KN2H 1YNLL 5D1XC 5F1NA 1F4HA 3FB8B 3K7UA 2CMRH 8FABB 5AZ2H 2GYSA 4W81A 1UACH 3BH9A 4Y2DD 2VXUH 1WIPA 1EEYB 5JUEL 4EN3A 1D3CA 1QP1A 4ZOEA 3DGGA 1CGVA 4P23B 2G9HA 3OKKA 1PYWA 1JNNL 3AXLA 4N9OB 3LSOB 1RZIA 5T1KA 1MI5B 5HI5C 2W60B 3RTQC 4E0RB 2PTUA 1CFSA 4MLIA 2BMKB 1ES0B 3GI8L 1FG9C 4JY6A 5E4IA 2X4UB 3FT2B 1TVHB 4E41B 5ID1A 3C60B 1BBDL 5EN2A 5C0JB 4PV9A 1FZOA 3UJIH 4I4WA 1OAKL 1KIUA 4PRHE 4UOW1 4UTAH 5T3XD 3BPLC 5EC2B 4OZHE 2BX5A 2VXQH 4V1DD 3E3QE 5BXFB 4K3HA 2CIIB 3ILPB 3UEZA 4Z7QE 4JANA 4RX4D 5CEYB 1GC1L 1QLRB 1A6AA 1WUNT 4MDJA 1JPSL 3FRPA 3QHZH 1UM6L 4A6YB 4HG4K 1XGUB 4LCWA 3AREA 5KBNC 4FXKB 4EDWL 4I0PA 3C08H 3T77A 3U1SL 4GKOA 4L9DA 2Z31B 3MBEB 3O6ML 2ZUXA 4U6HA 3EJYC 1WV7T 4X0KA 3RWHA 1S7SA 2MHAB 4AY0A 3NGBB 2BSSB 3S3PA 3B3IA 2NY3C 1MHHB 5FF6A 3CCHA 2P8LA 1BQHA 3QCUH 1J8HB 2X9XA 4HV8A 1OAUL 1KELH 4ZSOA 3DRTA 4JFXB 3RQ3A 3ZE2F