4JRWA

Crystal structure of clostridium histolyticum colg collagenase pkd domain 2 at 1.6 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
b'GSAPIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
total genus 18
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jrwA00
1IAKA 3CH1A 2V17H 1N3NA 4D3CL 2DTML 5BV7C 3SJVA 1FFPB 1JPST 2IBZX 2XTLA 2X9WA 4MQSB 2RR3A 1JGDA 1HSBA 5E8PB 3SGEH 4U3XA 5IVZB 5EIQA 4XB8A 1R5VA 4L4TB 1Q9WB 15C8H 3FQNB 1CICB 4YDJB 3ZYOA 4LMQE 2FX9H 3C2SA 5L6YL 4G3YL 1MFDH 2R2BB 4QNPF 3WS3B 4NN7B 1TQCC 2QADB 2A1WH 4WO4A 4RFOH 4OF3A 4OI7A 4X5XB 4GQ9H 4OKDA 4MXVF 5C2BL 4M8QA 4U4BA 1MHHB 2P5EA 1AI1L 4UNVA 1QPXA 4K3DL 2AXGB 2JTDA 4PRID 2MQ0A 4BKLA 1T1WB 2ARJQ 2DJ4A 3VCLB 2X9XA 5F7HA 4LCWE 1M7IA 5E2UL 4ZS7H 1X5XA 2ZCLH 1EGJH 1QRNE 1IM9B 1UWXK 4PP2A 3DV6B 1BVKA 4Y5VC 4M1CD 2XWBA 4ODTH 4XH2A 1SJEB 1T6VN 2QR0B 2DLIA 4R7NA 2UZXB 1XIWC 1KN2H 2VZTA 3UX9B 2A6KB 3CCHA 2YZ8A 4DVBA 2X1OA 3H7BA 1TETH 4QXUL 2DQDL 3KPMA 3BIAX 3VI4F 4ELMF 4PLKC 5HHQB 1FO0B 3QHTC 4O58H 4QRRE 3JV0A 2OTWA 1KCLA 3VFUA 3U1SH 5E8NA 4HUXB 4E41B 1MELA 4DFIA 1WCBA 4LSRL 1ZXQA 5CBEB 3FCTB 5C0DA 2YBRB 1I9IH 3PHOB 2GFBB 4N0UE 3UPAA 4BK4A 5CEXA 2Q1EA 4XMKL 3TO4C 5JQ6H 2CMRH 3H3KA 5J6GA 4L4VE 4ZAKD 3RL2B 5K59F 5D8JL 5C08A 4NKQB 4PV8A 5F9DC 1IAKB 3CH1B 2QSQA 1KB5A 2PYEE 5SX4I 1WSST 1N3NB 2W60A 4G5ZH 1ZHKA 3HR5A 1JCKA 1ZA6A 3SJVB 3PXHA 4GRWH 3RGVC 1QFWM 2F19L 1JGDB 1X5KA 1NEUA 4UMGA 3THML 5KSBA 2FATH 3DPBA 1R5VB 3WJLC 3NA4A 5DD0L 4FNLL 5FCUL 4O4YH 1S9KC 2GJ6E 4PJIA 1TNNA 3HG1E 5IESH 2APTA 1OAQH 5E2WL 2GJJA 1F4WL 4Z8FH 4NCC1 4WO4B 1T21A 5BO1H 2CJUL 3MOQA 3K8MA 4K2UL 4M8QB 3PIQA 2NQCA 4OLXL 2P5EB 1RZKL 2NXYC 5F9JA 5D5ME 4LKXA 1JTOA 1RZ7H 4WUKL 1T5WA 4LAJH 3A6OA 2A77L 2FO4A 2X9YA 4BKLB 1JGVH 1IKNA 4LVHB 2HJLA 5C86A 3NA9H 3ARRA 1M7IB 2E9JA 5JIPA 1U3ZA 3AS3A 5T5FL 3AREA 4PP2B 4P4KA 3S37H 2X09A 1BVKB 1A6VL 1PG7L 3ZKNC 2XWBB 3O6MH 4XH2B 4Y16D 3B2VH 5K33A 3ROOA 3GI9L 4R7NB 4M03A 4WTXA 3QUMH 5CJ5A 3CCHB 4DVBB 3H7BB 1NCAH 5MENA 4CVUA 3JTSA 5ALBL 1HWGB 3KPMB 4JO3H 4LPUA 4RQQA 3V6FA 1MCHA 1EBPA 3LAFA 5CINL 2OTWB 3UJJH 1LE9A 2XTJD 1NMCC 2B4CL 4P57A 5E8NB 4QXGH 1WCBB 2AGJL 2MWCA 5C0DB 3P0VL 2DKUA 3DBXA 4IOSD 1A64A 2WW8A 2UYLA 4NBZB 2DM7A 5J6GB 4Q2ZA 4YHZL 3F5WA 2BRRL 2OS7A 5C08B 3EJZC 3TJEH 2A9MH 4PV8B 1KB5B 4N8CL 2W60B 1N6VA 1ZHKB 3HR5B 1ZA6B 3EDKA 3S6CA 3O4OC 1V05A 1MUJA 3QXDA 4HLZH 1G7MA 3CFEA 5KSBB 3DHJA 2P8PA 1RULL 3RWCA 5HVGB 2Y7QA 4PJIB 1OP3K 3ZO0A 1H3VA 1BP3B 1VPOH 5F71A 5DO2C 1UM4H 3UYOD 3H42L 3MBED 1NSNH 3MO1A 3W0WE 5LWYL 3ZE0E 1T21B 2QBWA 5E8OA 5I1JH 5JW3H 1ZEAH 3PIQB 4MXQC 5F9JB 4HWBH 4GXUM 1T03L 4LKXB 3QNXA 1IL1A 1T5WB 1Y0LA 5ISZE 1HZHH 3QEGL 2NTFB 2FO4B 3LS5L 5IFJA 1T7XA 1A6WL 1MQ8A 2HJLB 3ARVA 3C8DA 4LP5A 3AREB 5HYJE 2ADFL 4JN1L 3T4YA 5DD1L 1YEEH 3L95A 5J13B 4P4KB 4HUNB 2ESVA 1DL7H 5SWSE 4JEGB 3AB0B 5AAMA 3ROOB 3U0PA 1FNLA 1E6JH 1F8TH 4TVPD 5MENB 5TPWH 3JTSB 1YEGH 1BIHA 4RQQB 3V6FB 5KAQG 1S7VA 2DWDA 4S1RL 3D1MC 3T0EE 1LE9B 1CDGA 4GUPA 5FGSA 4P57B 4XPAL 2EDHA 2HFGH 4OGYH 5CS7A 3S5LG 4GG6E 3DBXB 1FBIH 2V2XA 5JO5A 1E4XH 5DWUL 4X9BA 4AH2A 2UYLB 4G8GA 2C9AA 1SYSA 1MREH 1SBSH 4Q2ZB 4DUXA 1FFNA 3F5WB 3HAEG 4WI2A 3QWQB 2D7QA 5T3ZL 1NC4D 3OMZA 3TBYA 1OP3H 3ZE1F 5FEBA 3AVEA 4Y88A 1MRCH 4X4YA 1MUJB 2OM5A 3QXDB 1G7MB 3PG2A 5GGUA 4DKFL 1O5DT 3CFEB 4AEHH 3ARDD 4POZC 3Q1SL 3SDXF 3E2HB 2P8PB 3BAEH 5L7XL 1ETZA 5DMGD 4YHLH 1MIMH 3QCTH 4DWHA 1GGCL 3MO1B 1LEGA 2BVOA 2ERJB 2XNAA 1KT2A 5E8OB 1IKFL 4YHIA 3FB6A 1UXSA 4GXVL 2OZ4L 4ZYKA 4NHCH 3QDHA 1WZ1L 3VW3H 3LMJL 3QNXB 1IL1B 2QV2A 1Y0LB 2AAVA 5DA0B 2VH5H 5IFJB 1L9MA 5AYQA 1P2CA 4P46C 3BQUD 1ZVYA 2O5YH 5GRVK 1S9XA 4U1JA 3EDFA 4RWYL 3FQXA 1WTLA 3QZWA 3O6KL 3T4YB 3L95B 4JFEE 2ESVB 4OM1L 4MNGE 4LLMA 4RGNE 1HINH 2V5RA 4JFHD 1K4DA 2WLZA 3U0PB 4FA8A 4PJHA 4OCRH 4Y16C 2Q86B 4FQ1L 5E56A 5I18H 3ZHKA 4U1GC 4CMHC 5HVHC 1W8OA 3FOMA 5K9JL 3DSFL 2JJSA 2EDEA 1P6AB 1TZHA 3K46A 2D0HA 3IRPX 4PJFE 4YBLB 4F7MA 1S7VB 2DWDB 4L3ED 4PFEA 4GUPB 4QRQA 1YJDC 1SHMA 1EO8L 1GL4B 1MRFH 2CXKA 1DBMH 2V2XB 5JO5B 5CCKL 2MNUA 2XTJC 1CDUA 5FDWA 3OXSA 4AH2B 4G8GB 1D5XA 1SYSB 5F6HJ 5C1MB 1FFNB 9CGTA 2KQNA 4OI8A 2DB8A 1RURL 3BE1H 5GJTL 3TBYB 3GSNH 1NMBL 3TM6A 4Y1AD 4OQTL 3NABL 3SN6N 5E08H 4X4YB 3P11H 1C7SA 5GGUB 2CLRA 3QDMD 3G6DH 1HIMH 4IDJL 4PJFF 3AC0A 4KVCH 3U0WL 1OD9A 5CEZD 2ZUYA 1QSFD 3LPWA 1ETZB 4QHNA 2B1AH 4KDTC 1IGJA 2FBOJ 5EU7C 3PQYA 1LEGB 2BVOB 1CGWA 1J0HA 2XNAB 3DECA 3QCUH 2DAVA 1KT2B 3T2NH 1EZVY 5DRXA 3FB6B 1UXSB 4XB7A 3BFOA 4IOFD 1JF1B 1KIQA 3TT1H 4ZYKB 5JW4N 3MBEC 1J0JA 1H8SA 4KI5E 1DANU 1ZV5A 4BUGA 5BMFH 4X4ME 4E9LA 3HC0A 4KGLA 1P2CB 4NO0B 1EIBA 1CF8H 1FZKB 3MA9H 1S9XB 4U1JB 4YHYB 2E6JA 3QZWB 3SDCD 1EJ6A 4Y4FD 5GGVL 1BD2A 4LLMB 2HVKA 2D03L 3BKJL 2VERN 3D87B 1K4DB 3V6BR 3NFSL 2FX7H 4ETYA 1ZVHA 1LP9A 2EH7H 2NY3B 4PJHB 1NC2A 2ARJA 1FORH 4X7FC 1NBVH 1A6UH 2VNCA 1IC4L 4K55A 5DR5L 4KI5F 3ORJA 1M05A 3FOMB 4DGVH 3DETC 1TZHB 3QNYA 4Z95H 5CJBA 3WUWA 1AHWA 4UTBL 4F7MB 5JOPE 4I18C 4QKXB 4QRQB 2DQUH 1CIDA 2IANE 4HH8A 1QHPA 4FQ2H 3QUXA 3B5GA 4NO3A 4HMCA 5FDWB 1JJUA 3OXSB 2KBGA 3VE0A 1D5XB 1XCTA 5ID1A 2JB5L 4X7SL 1HHKA 1EFXA 5KTEL 3QFJE 4JY4A 1NBYA 4QRPE 2OZ4A 1VFAA 3QPXL 1X44A 4OM0L 4LCWD 4FZ8H 4L8SC 2CLRB 1XF4A 1QRND 3WO3B 3BMVA 1QFUH 1EO5A 3OZ9L 2Y72A 3MXVL 4I9WE 4PRPA 4R4NC 5BS0A 4LF3A 4LQFH 1PX3A 4QHNB 2R0KH 2NX5A 1NCCL 4POYA 1IGJB 4DZBA 3LEXA 2X41A 4U1LA 2IBZY 3PQYB 4RGMC 1AFVL 5DRXB 3C08L 1OCWL 1YPZA 5CP7A 1OAYH 2FIKB 5DMGC 1F2QA 1KIQB 2DI7A 5DVLA 1HDMA 4QO1A 3GO1L 2HAZA 3HC0B 2EIDA 3IS1X 5B3NA 4WW1A 4XP4L 3S36L 3TBVA 3IU3A 1XR9A 3FRPA 3NPZB 2DIJA 1UENA 5I1LA 3BQUC 2HTKD 3GJFK 2VN4A 1Z9MA 4M5ZL 3ROLA 2GIYA 3MZTA 1BD2B 1FNSL 1KC5L 4YPGA 4DGIL 3JWOH 2HVKB 1CL7H 4RRPG 3EDDA 3M8OL 1RUQL 1WVZA 2PYED 3HHRB 1DR9A 1LP9B 1MLBA 3BI9X 4G43A 1NC2B 2ARJB 2H3NA 1MJ8L 4XXCA 4DAGH 1S3KL 1UT9A 2WMPA 4CADA 3P4LA 1M05B 4G6FD 5IF0A 3QNYB 3WUWB 3OB0H 1AHWB 4NZRL 4LHJB 1NUNB 2NY6B 4NKMA 2GJ6D 5I1IL 1IQDA 2GQHA 4AG4L 4Z7OE 3QUXB 5GGRY 5CGMA 4NO3B 4I3SH 4GAJL 5TDOA 1T3FA 4FQLL 3W5NA 3VE0B 3U9UA 4TQEL 4KV5E 1XCTB 4YFDB 5ID1B 1U8LA 4M5YL 5IHLB 5JNYA 3VXTA 1HHKB 4U1SA 3TYGL 3U6RB 4JY4B 1NBYB 2EC9U 1VFAB 1CXKA 3BGFC 5C6TH 3CJJA 2PXYA 2OSLB 1A7NL 1U3HA 1XF4B 2I9LA 3P77A 5FYLH 4MB5A 4PRPB 3EYUH 3TH4T 4BQ9A 3GKWL 2DI9A 5BS0B 4LF3B 3CFBA 2XWJA 1B4JL 5I1KL 3V5HA 2NX5B 4DZBB 4YXLL 1TTGA 3LEXB 4U1LB 1IBGH 1MCFA 5L9DH 1QHOA 2EKSA 3OJDA 3OX8A 1YPZB 3OB8A 3RJDA 5CP7B 1MCKA 1MWAH 2NY7H 3KPLA 1CDJA 1E0OB 4I77L 3GJFH 3VMPA 2DQJH 1HDMB 3MRGA 4O51A 3LQMA 3RVVD 3L7FA 3UTSD 4G9FA 2X70A 4WW1B 1PD6A 1WAAA 1WBYA 1NCWH 1XGTA 2YMXL 3IU3B 3X13A 1XR9B 4G80A 4UTAL 4MMXC 2BSSB 1OY3B 5I1LB 3ROLB 1VA9A 3AS2A 3B9KD 3CSYA 5EOCH 4R97B 1MHCA 2QLVB 4YPGB 1MAMH 4P2QD 3RZCC 5DMYA 3SDCC 1DZBA 4LAQL 4Y4FC 5C0CE 3QA3A 3SPVA 3DVIA 3VDCA 1X5GA 2DQHL 1MLBB 4H5SA 5I1GH 4G43B 5KSVA 2H3NB 4HSQA 5T5NG 1F45A 2X4PA 4CADB 1KF9B 1G9MC 1UQSA 5IF0B 3F7PC 4UT7H 4B0MM 1BQLH 1VACA 4NKMB 3RWIA 4ZSOE 2NY0B 3ULVF 3HFMH 1JZ6A 1PFCA 4XMLL 5TDOB 1T3FB 2XXMB 1XF2A 3U9UB 5F93C 5EZOL 3LKSA 4F57L 3D39A 1U8LB 5JNYB 3VXTB 4U1SB 4PRAB 1J87A 4P2RA 4U1MA 3PL6A 3LVEA 5IK3A 4JFZH 2PXYB 3MLUH 1EK3A 5F1OB 2E8ZA 4JREB 1U3HB 5FGBC 1MJJA 1FO0H 1X5FA 2I9LB 3P77B 5TE7H 4LHUA 3EFDH 5EN2A 1C7TA 5SWSD 4R2GB 3CFBB 1PKQA 3CXHK 2XWJB 1VB9A 3V5HB 5ADPL 5CSBA 1HOCA 3BZEA 2JCCE 2EKSB 3OJDB 3OX8B 3DRQA 2CO6B 2RHEA 3KPLB 3O6FD 2H8PA 2AJXH 3MRGB 4O51B 3L7FB 3HE7C 4G9FB 4Q58C 5I15L 1QFHA 2X70B 3NFNA 2QSCH 4DFHA 1IGCH 3VD4A 4YNYA 4QGTA 1WBYB 3N9GL 1XGTB 3X13B 1NCTA 4G80B 4M1GL 4HGWA 4NWUL 5JHDE 1RK1A 1F6AA 3CSYB 4DKEL 5FYJU 1MHCB 1B2WH 5IQ9A 3S35H 4IRJD 4M8VA 3IDYB 1KFAL 2JCCF 3QA3B 1JMXA 3SPVB 4KRPB 1AR1C 4H5SB 5KSVB 2W59A 3NCCB 4GMSL 2WIIA 3OPZH 2X4PB 4LGPB 3A6BH 1UQSB 5IBTH 3BEVA 1VACB 3RWIB 3BPLC 1VGEL 2ADIA 3BWAA 5I76A 1J1PH 3C5ZA 2F8XC 1UKTA 1IGYA 1XF2B 2IWGA 3LQAL 3LKSB 3QCVH 5DQ9A 3D39B 5GQBA 1V7NL 4TRPL 5CD5D 1JZ3A 4P2RB 4U1MB 3PL6B 3MUJA 1UJTA 5IK3B 4CBPA 3D48R 4I48A 4PJGA 3G9AB 2VXQL 1RJLA 3OJMB 4YXKH 2ZPKL 3U82B 1BF8A 5D7JD 1OTSD 1MJJB 5KN5A 3QWOA 5E0QA 2VISA 4PLNC 4JM2F 1IEHA 1D5IH 2HTLD 3OSKA 4G6AC 4JFED 4LHUB 3TT3H 5EN2B 2DLFL 3IFLL 3IFNH 1PKQB 2OI9C 4TPRH 4RGND 1GGBL 4ODWA 5E2VH 2IALA 1HOCB 1JPSL 1ULVA 3BZEB 4TTGA 3NTCH 3CSPA 3HMWH 4V2BA 3MNVA 3DRQB 4XBEH 5IB1A 2IQAA 1JNLL 2H8PB 5HVFB 2F5BH 5GSRA 4Y4HA 5HI4D 1KB5H 3UO1L 3NFNB 2LU3A 5CILH 2YWYA 1MCRA 1N59A 2A38A 4YNYB 3QQ4A 1OTUD 3RVVC 3I3EA 4G6JH 1AXTH 4HGWB 2OR8A 4M7KH 3RZWA 4JO1L 1RK1B 1F6AB 1H5BC 3C60C 5JIIA 3GHEL 1L6XA 4RMVA 1YEHH 1NGWA 5IQ9B 3U7WH 1UYWH 3B9KC 2UVEA 3RI5F 1FIEA 2FD6H 2WWKO 3VRLE 4ZFFB 2WIIB 4P3CL 5J3HC 4ZXBD 2MHAA 4N68A 1UJ3C 1A3QA 1QLEH 2UWEA 2KZWA 3MV7A 5HDBE 3BEVB 3TJHC 3SDAD 2VR4A 1D6VL 3LKRA 4KPHL 4PRDA 1KEMH 1QNZL 4R8WH 3BWAB 4YEEA 4GSDH 5JOFA 4J3WA 5I76B 4IRSA 4OJFL 3C5ZB 2HLFD 3HR6A 1DBBL 2B5IB 1OM3H 4XZUA 3NAAL 1IGYB 5I75B 4M9OA 5DUPL 3ZL4L 3LKQA 4J6RH 5DQ9B 4DZ8A 4KI5D 1M6OA 4K07A 5E5MA 5FYLE 2QHRH 4BJLA 3Q6FA 1KOAA 4I48B 4M6MH 1EEUA 4PJGB 1FQ9C 1RJLB 4D3CH 3IS0X 4JGMA 3NIDE 2I60H 5D7LA 4ODXA 4WHDA 3TIEA 1FYTE 4IMKA 4EN3A 3QWOB 3TZVD 2VISB 5KN5B 2EDTA 4XVSH 2DDQL 3ZYIA 3WJJC 1OGAA 5JZ7C 1E27A 4ODWB 4XVTL 3G5YA 3OKMA 2IALB 1LEKA 1CIUA 1OWWA 3WEXB 5E4IA 4KDVA 5L6YH 4G3YH 3MNVB 4MZ3A 5IB1B 2YN3A 4AEEA 3TVMA 3X3FH 3MNWA 5C2BH 3WFHA 3TFKD 5GSRB 4Y4HB 4W81A 1DJSA 4L4TE 3UDWA 4K3DH 3DXAE 2LTQC 3AXLA 1N59B 2IAND 5MERA 3QQ4B 1HK6A 4AIZA 3T0EC 4OFYA 1ACZA 1BAFL 2Q87A 4NNPL 3L1OL 4P9ML 4PJAF 4DQOL 1NGWB 3CDYA 3QFJD 4AT6A 1CLYL 4R96A 1P9MA 4XGZA 1QBLL 2FDBP 5IVXF 2HLAA 1J1XL 4IRJC 3UBXG 2MHAB 3S7GA 2UWEB 3VXSE 3ZDZE 2DQDH 3MV7B 3WDHA 4I9WD 5F6HI 4PBVC 2ZUQB 4U3CA 2BNRA 1TJIL 4PRDB 3C87A 2V7HA 2ZCKL 4RGOL 5JOFB 4FQXC 2EO1A 4IRSB 3VFGL 4KZDH 5C0AA 4UIKL 1BJMA 4LSRH 4XZUB 4Y8DC 1CZ8L 1O7VA 1TNMA 5GIRA 5CJQL 5D7SL 1J10A 2FL5A 5K9QG 4DZ8B 4XMKH 1JIBA 1M6OB 3TCLA 5E99L 3EYFA 3HMXL 5E5MB 3NIGF 5D8JH 5E9DD 4C4KO 1U95A 1G6VK 3Q6FB 3U0TA 4CDHA 3F12A 4E41E 3R1GL 5CD5C 2K7PA 4P59H 1EDQA 4LVOB 3N1PC 4F3FA 5D7LB 4ODXB 5KS9E 5D1ZC 5I74B 3TIEB 5D1QA 3OQ3B 5DJAA 4EN3B 1CE6A 4X7CC 1OGAB 3THMH 1C5CL 1E27B 5KZCD 1LO4L 1OTSC 3G5YB 3OKMB 4FNLH 1P6FA 4UT9L 1LEKB 4ENEC 2UVFA 4RGNC 2OJZL 2YD9A 2FIRT 2VDLL 4F33A 3TVMB 1CFBA 2CJUH 4PREA 1JWSA 3CSGA 3MNWB 3WFHB 1BMGA 4UINL 4K2UH 4OLXH 1RZKH 4I2XA 5FDYA 5D2NA 4NSKA 2DD8L 2P48B 3AXLB 1PLGL 2A77H 3KXFD 4Y89A 5MERB 3U48A 2Y36L 3RP1A 5KS9F 3WFBL 4NQCD 2B2XL 1CE1H 4AIZB 4OCXH 4GBXD 3NCEB 2QSTA 2P5EE 3V6ZA 4YGVA 1SQ2N 2DWEA 4Z78A 1FC1A 1A6VH 1CT8A 1AC6A 1PG7H 4AT6B 4R96B 1N0XH 4ZD3L 1VHPA 3GI9H 4XGZB 1W0YT 2HLAB 4RMWA 3PGCA 5KVFL 4M7JL 4R9HA 4NT6A 4OUUA 4M6NL 4GKOA 5ALBH 2CR6A 5IBLC 2MMXA 3PWNA 2ZJSL 1U41A 4ZXBC 1HQRA 1II4E 4LU5L 5C0AB 4JN2A 2B4CH 2AGJH 1Q0YL 1NPUA 5GIRB 1MIEL 3BWUC 3IFOA 3P0VH 4NC2B 4NJAL 2E27L 3ZTJH 1AXSA 2FL5B 1KV3A 5IFHL 3AROA 2DLEA 2RB8A 4YPJA 4HGKC 3EYFB 4YHZH 1OSPH 1U95B 2BRRH 1MOEA 3CZFA 3ZDXE 3U0TB 8FABA 5DQJB 2CK2A 2B20A 1R3KA 3F12B 1YN7A 5J8OA 3W2DL 4Z7NE 5C71A 3ECBB 1WWWX 5BVPH 5EOQL 1URLA 3KR3L 4F3FB 5C07A 5BZWA 3ULVD 5D1QB 5DJAB 1CE6B 4KKAD 2A73A 3VDBA 2K1MA 4MA1B 4WI3A 2HRPL 3BUTA 1RULH 5C08E 3UCRA 3QBTB 3CH8A 5D6DA 3D85A 1IAMA 4UAOB 3HLAA 1F6FB 2BVUA 3TO4A 4PG2C 4F33B 5LWYH 1RSFA 3FFCA 4PREB 1JWSB 1WICA 1WFOA 5KSBE 2HT4C 1F2XK 2NYYD 4I2XB 5TQ0L 5D2NB 2E7BA 4NSKB 5JW4M 4PJIE 3PDOA 4WFFE 5FFLA 5I8EA 1JNJA 3QPQC 1A6WH 1UB5A 4R6UA 1MEXH 2OK0H 3DJ9A 2ADFH 4JN1H 3STBA 5C0RH 3MRFA 5DD1H 5DD3L 1WBXA 3C5SA 3V6ZB 5A16A 4YGVB 2DWEB 4Z78B 1CT8B 4OZ4A 3I2CH 3WE6A 2Z93A 3PWLA 3PGCB 4NT6B 4OUUB 2F5AL 1SVZA 4OIBA 5FHAL 1KSRA 3SCMB 1MCCA 2R56H 3MRMA 4XP1L 3PWNB 3EOTL 5A3ID 3MLSL 1HQRB 5I1HL 5IGXL 3VGAC 5KAQF 4S1RH 4X6CE 4JN2B 2FGWL 4XPAH 1X7QA 4RMUA 1Y6NR 5HHMD 5M95B 2BNQA 3IFOB 4QRTA 3EOYG 1AXSB 4U1KA 1FVCA 1FZMA 4N8VA 4YIQB 5EFIA 3H0TA 1QFPA 3F8UB 1G7JA 3CZFB 5C09A 3IAPA 5T3ZH 8FABB 1AGBA 3RY5A 3RX8A 1R3KB 5DLML 4AQ1B 1YN7B 3Q2CA 4LDEB 3OF6D 1FJ1A 3IJHA 5L2KA 4JFOA 5C07B 5BZWB 2OMBA 4IJ3C 4Z7WB 2A73B 4DKFH 3HN3A 3EGSA 3FN0H 1F3DH 1EFQA 4X6CF 3ARFA 5CZXC 2DKMA 5L7XH 5FUCE 3KPRD 3D85B 4G7YH 1MVUA 3HLAB 3TO4B 5GGSA 5D72L 1IAOA 4OCLC 4ZTOH 5GRUL 3V0WL 2R29L 2WK2A 2VXUL 3FFCB 5KVEH 4EXKA 1IKFH 1BBJA 4GXVH 4WGVB 1VEOA 5E24E 4JM2D 2OZ4H 2VDMH 4AIOA 1WZ1H 3LMJH 3PDOB 1J8HD 4PJDA 5L0QB 2XKNA 4GG8A 3QEUA 5ENWA 4JVPA 5I8EB 1RZJH 1UB5B 3HTLX 5GGTL 5TJWK 3RIFK 3O6KH 5ITBL 1KCVH 3BX7C 3MRFB 1WBXB 3C5SB 5A16B 2RFXA 2O93L 4OM1H 4OZ4B 1N64L 4HKXA 1SJXA 2B1HL 3WE6B 1ADQL 3GRWL 2Z93B 3O8XD 1ZLVK 1JMZA 3PWLB 2L7JA 3VGEA 2UY7A 3SE9H 1EEYA 3RHWK 2R0WL 4QRSA 4FQ1H 5FYJD 3MRMB 5DUBB 4AL8L 3RDTC 3ARGC 5K9JH 3DSFH 5CAYB 4QXTA 3T08A 3R06A 4MNHA 3V8OA 4NQTA 4ZOAA 5IROC 1TVDA 1X7QB 5FGRA 2MFNA 4PRIA 1EO8H 4JRWA 4GO6B 3VJ6A 5J11B 2BNQB 5CCKH 4QRTB 1SJVA 4U1KB 1FVCB 1FZMB 4N8VB 2V6HA 1AXIB 3QJHA 5EFIB 1W0VA 3CFIC 3H0TB 3V2AR 1G7JB 5C09B 4NFCA 5GJTH 1AGBB 3O2WL 1JP5A 5IB2A 4YHKL 1FJ1B 3IJHB 5L2KB 3K2UL 3NABH 3LDBC 5TFSL 1IMHC 2O5ZL 3JXAA 1KULA 5SWQA 5DURB 2HFFA 4R26H 4HHAA 3EGSB 1NMCB 4IDJH 4N1CA 5FO8A 5IM7A 1WBZA 4TUJA 3ARFB 4ELKA 2Z8WC 1BQUA 1KELL 3CZJA 2AQ1A 4YBQC 1MVUB 5GGSB 1IAOB 4Z0BL 1A7PH 4G6MH 2EYTA 2JJTA 2VXSH 1SM3H 1BBJB 1BEYH 3R8BB 4FHBD 4M43L 5J1AA 4LKCA 5GGVY 2HT2C 2V2WA 2YD1A 4TSCH 4ZAKA 4WTZG 3ALPA 2HYMA 5I16A 4TVPL 4PJDB 2XKNB 2NYYC 4GG8B 3QEUB 4OGAD 5ENWB 1ZLVH 1T7VA 4KKLD 1N0LA 5FUZL 3J7HA 2E9IA 2C3WA 1A0QL 1KCSL 5GGVH 5I1CL 5DXWA 2RFXB 5FYLD 3QUYD 1FYHB 4HKXB 1S78C 3BKJH 1F4XH 4F9PC 4XWOD 2XI9A 3RUGB 4DW2L 3F65A 1I7RA 4QRSB 2Z31C 5F1NA 1BJ8A 4QXTB 2EH8H 2EC9T 3R06B 4MNHB 4UTBH 4NKIH 5E7BA 4PRIB 4PJHE 4C83A 3WHE1 4CW1A 5ECJE 3VJ6B 2EECA 4FQIL 4J23A 4XPBH 4AZ8A 1M1SA 2ZUXA 4NRXA 3QJHB 2UZYB 1W0VB 4L4TD 5HGDA 4YR6A 2FRGP 3QB7C 3LHPH 5KTEH 1ZTXL 3DXAD 3FZUD 5DTFA 5IB2B 3T8XA 2C5DC 3QPXH 4B41A 4HW6A 3SBWA 4FABL 5SWQB 1BOGA 2HFFB 1DEEA 5FO8B 3KAAA 3OZ9H 1WBZB 5GGTA 5IM7B 5C0EA 4TUJB 4ELKB 3G5VA 4WFGE 5CGTA 2BY2A 4HUKB 1NCCH 1ADQA 1GC1L 2EYTB 2YRPA 3GRWA 4U6TA 3WIFA 3C08H 3VXSD 2HVJA 4JAMB 5J1AB 4LKCB 1IM9D 4XC1L 2V2WB 3VFOB 3L3DA 4GW5A 3MPCA 4ZAKB 4ZUSA 5KANG 5I16B 5JQHC 5ABDE 2QEJA 3SO5A 1TXKA 4RISL 3PQYE 5EZIL 4XP4H 3LS4H 3S36H 2X89D 5E1AA 4Q9QH 2CUIA 5JTWA 2DF3A 4NUJA 2PF6A 3AM8A 3OJ2C 4M5ZH 3UJTL 3PXJA 5ACLA 3IT8D 4S1SL 1KC5H 5HHPA 4JG1L 4DGIH 5EWIH 3CFCH 2NPLX 1RUQH 4E41D 3NZHL 1JF5A 4KJQD 1LGVA 3TPUA 4W68A 1ZSDA 3MBEA 1MJ8H 4NNXA 1I7RB 4ORGA 1MCOL 1UVQA 3FT4A 4WDIA 5F1NB 5ANMA 1U3JA 5E6ZA 3QUKA 3KYOB 3ZLQC 5IHZA 1X5AA 2X05A 4V1DA 1KJVA 4NZRH 4B50A 1N6QH 4FTVE 1WIUA 1FSKC 4C56D 2EKJA 1KN4L 3LKNA 5C0GA 1LP9E 4C83B 1N26A 4CW1B 5T3ZE 4PJEF 4GLRI 4LCYA 4GAJH 4LNRA 4WW2F 3HNVL 5CEZL 1B90A 1BZ9A 4TQEH 3IKCA 4NRXB 1PKOA 5HGDB 4M5YH 5CIPA 4YR6B 4JFFE 3TYGH 5DTFB 3T8XB 4D8PA 1BFVL 4RFNC 4HIJA 1JN6A 2DQTL 2EYSA 4O00A 1A7NH 4DK3A 1X3DA 3X17A 1BOGB 4P99A 3SQOL 5MI0C 1DEEB 2GJZA 4I18A 1ZGLA 5C0EB 4HPYL 1JGEA 3GKWH 3G5VB 2PO6D 1B4JH 5I1KH 4TSBL 2XTJB 2YA0A 3WFDH 3BD3A 3MJ6A 3WIFB 1OAKL 1FHGA 4KWUA 4K3JL 5E94A 4I3RL 2HVJB 4WENB 1KPVA 3MODH 4PRPE 4WHYH 4MVBD 3L3DB 3O0RL 4GW5B 5TF0A 4ZUSB 5BS0E 1I1AD 4HUWA 4X8JA 1FCGA 1S7TA 1NC4A 4N0YH 3CPLA 4BZ2L 2IADA 2NX5E 4EBQH 1QEWA 3BN9C 1RIVL 2YD3A 3Q5YA 4CKVX 3B6SA 3UJIL 1RIHL 2YMXH 3W82A 1T0PB 5E1AB 4TN9A 2ZCHH 2R69L 4N0FA 1K6QL 4NUJB 2DYPD 4OGAC 1CFVH 3ARDA 4Z76B 1DSFL 5CUSH 5F7FA 4KKLC 1C08A 5HHPB 1UWEH 4CRPA 4F7CA 4M6AA 4WU7A 5IW1A 1G7IA 3TPUB 2DQHH 1ZSDB 2CKNA 3MBEB 3QI9C 4NNXB 4G8EA 4KZEH 4ORGB 1UVQB 3FT4B 5T5NF 4WDIB 5ANMB 4HWZA 4ZS6C 1D3CA 3QUKB 2WQRA 4V1DB 1KJVB 4I5BA 5IHUL 3T2PA 3BQUA 3LKNB 4PJXF 5D9SA 4CN1A 5C0GB 1WLHA 2YKLL 4XMLH 4LCYB 3GJEA 2ADJA 1X5ZA 4LNRB 2HRLA 4NQVB 1BZ9B 3IKCB 5CIPB 1WUNT 4PJCF 1AQDA 2MJWA 3QAZC 4GRMB 1CGSL 2YUXA 4QTIH 1IEAA 3KYNA 4D8PB 4HIJB 2WBWB 5FM8A 2F54E 1JN6B 2EYSB 4M7LL 3FZUC 1CICC 3BPCA 3QO1A 1FP5A 3S88H 2GJZB 4NN7C 4CJ1A 1TFHA 1ZGLB 2QADC 3O41A 3V0AC 1EUUA 1FE8H 1JGEB 2P5WE 2H9GB 4HXAL 4L3EA 5J57B 3BSZH 5EBMA 2VXTL 2B7DT 4GRLD 2WV3A 4HDIA 5E94B 1MCEA 3IVKA 2NMSA 3D25A 1JK8A 1G0XA 1KPVB 4P4KD 4FMFA 2PTTA 1WISA 1EERB 4HUWB 4X8JB 1S7TB 2NZIA 1NC4B 3CPLB 4N0CD 2IADB 3MXWH 5I15H 1QEWB 4Y19E 1T89C 3B6SB 4IIQC 4Y1AA 1J8KA 2YN5A 4S0TD 4NWUH 4LMQI 1RZGA 4N0FB 3QDMA 3BD5A 3ARDB 1FL5A 1AQKH 3LPFA 4HX1A 1C08B 3I50H 3L3GA 4RGMB 2EDXA 4F7CB 4WU7B 3TA3B 1QSFA 5IW1B 2X10A 1KFAH 5E8DL 1G7IB 1WAAE 6FABL 2KDGA 5EH1A 4G8EB 4EUPA 1U6AL 1E28A 4HWZB 2H1PL 3U7YL 1S7SA 3DX7A 4OIIH 4TNVF 5D6CA 5B4MD 4I5BB 2W0PA 4NOFA 1VGEH 3LD8B 3BQUB 5D9SB 4MD5A 3LH2L 3GJEB 2ADJB 1Z5LA 4FFZH 5H2BA 3LQAH 1CLCA 4Y4FA 3C6LB 4YHOL 1HHIA 1AQDB 4KJYA 5C9JA 1ERNA 2ZSVA 3KYNB 5DMIL 3QXAB 1ZMYA 2VXQH 4YBHA 3MRLA 4K3EL 1WEJL 3WKNA 3BPCB 3D9AH 3QO1B 1S9VA 4UV4H 3STLA 4OBRA 4KJWD 3D39E 3O41B 2YPVH 2DLFH 3IFLH 4WO4C 4P2RE 1GGBH 4HS3A 4L3EB 3PWUA 5EBMB 2XY1A 1JPSH 4XNXL 1LWRA 3ARUA 4KRLB 1GYAA 2EICA 3FB8A 4HDIB 4Z7QF 3GHBL 4HMDA 3IVKB 3RGHA 3D25B 1EV2E 1JK8B 4OZHF 3QR2A 2PTTB 1PKQE 1AO7D 3NCYP 3VFWA 2FX8L 3UO1H 5DRZA 4MSWA 1A22B 3DYPA 4MVBC 3O4LE 1FG2A 4NJ9H 3RY6C 4LCWA 5CGYD 1RJYA 1RZGB 4YH6A 4BQ8A 3QDMB 4Z9KB 3SDYH 1FL5B 4YZFE 4E42A 1QRNA 1GPOL 5IJKA 3L3GB 1QSFB 3WO4C 3EJYD 1RUKL 2FCBA 3PHQA 4XHJD 1WIPA 4PLOB 4EUPB 4P3CH 4BUHA 3B9VA 2VRAA 1E28B 2VWEE 4JJHA 1PBYA 3FQUA 5E6ID 1S7SB 2IBBA 3DX7B 5F96L 2W0LA 5IT2L 1J18A 1E4WL 5D6CB 4JY5L 3E8UL 1QNZH 4ODSL 1CTOA 3LEYL 4UT6L 2W9DH 4MD5B 3IDGA 4J4PD 1H15A 1F4HA 4TVSa 1Z5LB 3H3PL 2CUHA 3V95A 3MRDA 3NAAH 1NBQA 1H3UA 4Y4FB 5DUPH 3ZL4H 1JZ4A 1NEZA 4JPVH 1HHIB 1H3GA 5KVGH 4KJYB 5C9JB 1BQSA 1UA6L 2ZSVB 4MB4A 2YA1A 4GH7B 3MRLB 3TC9A 5GS3A 1S9VB 4CU6A 1P4BL 4PV9A 3STLB 4NQDD 1R3LA 2YWZA 4EDXB 1NKOA 4XVTH 4HS3B 2GJ6A 3EO1B 3PWUB 4NO0D 4PJGE 2LABA 3DARA 1NH6A 3FB8B 3VGFA 1NFKA 5K93A 2ZP0T 1IKNC 2W07A 3DSNA 3RVTC 1XF5A 5IR1B 1QG3A 1U8OA 4ELMB 4JDTH 3VFWB 4AEIL 5J13C 5HYQA 4P4KC 2FX9L 4MSWB 4PJ9D 3MLRH 3C2AL 3AB0C 1FG2B 4MWFA 2A1WL 1IE5A 4ZG1A 1MQKH 3UTOA 4LCWB 1RJYB 4GQ9L 4IOIA 3DVGA 3ZYZA 3ZZ1A 1BAFH 2I26N 4E42B 3L1OH 4P9MH 4KAQL 3MLZH 4DQOH 4JANA 1RQ5A 1SMOA 2ZOLA 1CLYH 4KTYA 1TJGH 2N4IA 3PHQB 4ZTPH 4ZQKA 2CPCA 3HC4L 4HWUA 1J1XH 4W6XB 1CR9L 5F9WC 4KKBC 2GI7A 2AXHA 2QSVA 1F6LL 1EGJL 3CGTA 4X6DF 3VFSA 3FQUB 1A4JA 1F4AA 5AG9A 2DBLL 2EDBA 3UTSA 4XCCH 1B3JA 1TJIH 3DROB 3KYAA 1XGRA 3QIWD 3MJGX 4J3VA 2HP4A 4RGOH 3ILPA 3S4SG 3IDGB 1I7UA 1H15B 1H5BA 4UIKH 4HJJL 3VXPA 1HILA 5ESVA 5FUCC 1CZ8H 4TUKL 2DL9A 2UWEE 3MRDB 5CJQH 5D7SH 4WFEE 3B9KA 3MV7E 3N1QC 1NEZB 4KKCD 2KQMA 4H1LA 4RZCA 5E99H 4JHWL 1FCCA 2Z8VC 4P2QA 3U1SL 5H94A 2OTPA 1AE6L 1UJ3A 3E2HC 1EHNA 4XCYA 1I9IL 1YYML 1JTPA 4M4RA 4PV9B 5JQ6L 3BPLB 2CMRL 1R3LB 4G6FB 3IU4L 2ERJC 4BELD 3BOVA 1LO4H 2GJ6B 4UT9H 4KJWC 4G5ZL 4EDWH 3T3ME 5JXAH 5D7LE 2Q6WA 4WI8A 2OJZH 1UZ6E 3TH3T 3L3KA 3L5IA 4UINH 1SY6L 2DMKA 1XF5B 3T0DA 1U8OB 5DHVA 3KPQA 5GGSY 3NFPA 1YN6A 5HYQB 3BKYH 4FTVD 1VENA 5IESL 4MA8L 2Y36H 2FHCA 4MWFB 2B2XH 5BO1L 4ERSL 2OI9B 3PWJA 4IOIB 4JO2H 3DVGB 4KK8C 2VABA 5SWSA 2DIBA 4JANB 4JFFD 5CGYC 1MCPL 3WIIL 2ZOLB 4QHMA 3G5XA 1PAMA 4YBLC 4ZQKB 5CBAA 2LE9A 4M7JH 3HI6H 3K80A 3WSQL 3SGJA 3O6FA 4BQCA 1GVIA 3VFSB 5GRWA 1A4JB 3MRRA 2IC2A 3I6KA 3SDXA 3LZFL 3O6ML 3O3UN 3UTSB 3B2VL 5A2JH 1ROWA 1XGRB 5DZOA 3ILPB 1P4IL 1I7UB 1H5BB 4EOWH 3VXPB 4OF7A 2FH6A 2NY2D 1HILB 1GOFA 1RZKC 2AJYL 1MIEH 3MRBA 5EU6D 3B9KB 4J4PC 1YMMD 5LQBH 2F9BT 4H1LB 2R39A 3VXUE 4RZCB 5BS0D 1RIUH 4P2QB 2CLVA 4LIQL 4IRJA 5H94B 1UJ3B 5C0AE 4XCYB 1GZPA 3KR3H 2R4RL 4FOMA 1BF2A 4OTXH 1MCQA 1XCQA 2WQ8A 3B4NA 3DGCR 5CEYA 3NCFB 2DJUA 2AXFA 2A9ML 3ABZA 3MLXH 5L8JB 3QG7L 1U42A 2IAMB 1K8DB 3I84A 2Q6WB 1A4KA 4LARH 4HCRL 1BLNA 3L3KB 4OSUL 1B0RB 4OZFA 3EIFA 4YHYC 2P4AB 4P2OD 4JRXD 1UEMA 2I9TA 1U8KA 2J5LB 5DHVB 3VFMA 3KPQB 5TQ0H 4X7TA 3NFPB 5JMOC 1YN6B 1VPOL 1G84A 2Z4QA 1NSNL 4N1EA 3PWJB 3OR7A 5D7JA 1MF2H 1NCNA 4PJ9C 5I1JL 1KB9J 2VABB 4HWBL 2NY3C 5AUMA 4JFEA 5SWSB 3HKFA 5DD3H 4I2XE 5D2NE 3G5ZA 1ND0A 4ODHL 4KROD 4QHMB 2NY0D 2JJSC 1FFOB 2PETA 5JW5A 2F54D 5CBAB 4M3JA 5HBBA 1IFHL 3I9GH 1EAPA 3RBSA 3O6FB 1YEEL 2LTQB 4AMKL 3EOTH 3I6KB 3SDXB 3MLSH 4PJFA 2P5WD 2YS4A 5IGXH 4PBXA 4X5LA 4QF1A 3OG4B 3X12A 1QFWI 3RWEA 4PGEA 4UNTA 5DJZA 3U9PL 2FGWH 4HIEA 4NQSA 1OPGH 5TPWL 2HMID 1QYGL 4TNWF 4K9EC 2NR6C 2EXYD 3MRBB 1FH5L 2CGRH 2V9TA 1NFDF 5EZJA 1XGPA 4R2GD 5D2LE 3JTTA 5I1EL 2CLVB 4HFUL 4IRJB 1SY6A 2BOBA 4Y19D 4JG0L 4OGYL 3L5WA 5DVKA 7CGTA 1GZPB 2VN7A 3WUZA 3VG0H 2H45A 1XCQB 1X5LA 2A2QT 1FL6A 1SBSL 5CEYB 3H6JA 5C0JA 2AXFB 2BSED 3ESUF 1UM5L 3ARZA 3SDAA 1INEH 4CVWA 4HEME 4OD3H 5FHBL 5C07E 3CXHJ 3SDDD 1AJ7H 2FBJL 3G6AA 1A4KB 4M9PA 4W70A 1BLNB 4X4XA 4Z7WE 2VXUH 2NZ9D 4AEHL 5D2LF 4OZFB 3PWPE 1KYOK 1JPFA 1NGYA 3BAEL 2I9TB 1U8KB 1HHHA 4HC1L 5GHWH 4X7TB 3M1BA 1KXTB 4JFXA 4YDLB 4YHLL 2Z4QB 1KJ3L 2EDOA 5KW9H 2BOCA 2APXA 2IPUG 1QQDA 1UCTA 2QKIA 3OR7B 5L88H 5D7JB 3FFCE 2EDRA 5GSVA 5GZNC 1MY5A 4OFVA 5FA3B 4KXZH 3TZVA 1QOKA 5ITBH 5AUMB 3P9WB 1C8PA 4NHCL 1KIRA 3V7MA 1RI8A 3G5ZB 2PW1A 1ND0B 2VH5L 4RGNB 2A6JA 3OAYK 2B1HH 1ADQH 5DK0B 3GRWH 1F11A 5JW5B 2E7CA 1JWUA 2NY6C 3SE8L 1EAPB 3MR9A 2F8VA 2JIXD 2M26A 2R0WH 2J6EL 3QUXC 1CFNA 3HNSH 4AL8H 3E6HA 4PJFB 5C9KA 4M4PA 1KEGL 4QF1B 3V4UL 5F7LB 2BDNH 4ZPTA 3X12B 4PGEB 3RWEB 4HIXL 2IANA 5DJZB 5DHYA 4HZAA 4HIEB 4NQSB 4OZFG 1XGYL 2E6QA 4LHQB 3N1GC 3FO9A 4BM7A 5I18L 4JCLA 1UB6A 1XGPB 2NY2C 1DBKH 4HCRA 3JTTB 3C9NA 2KH2B 1RZJC 3QFJA 2BOBB 4U6VL 3P3YA 5HYSA 3O2WH 3QXVA 1PZUB 5JMRA 1HEZA 3L5WB 3O4LD 4KQ4H 4D9RE 2BNQE 5TFSH 1FL6B 5C0JB 3ARSA 1QO3A 3QDJB 3SDAB 1A9BA 4HWBA 1AGCA 2PNDA 1JTTA 4W4OA 5L2KE 4Z0BH 3G6AB 2VLLA 4YHIB 4X4XB 3T0WA 5CIPH 3IAGC 2PTUA 1JPFB 1YC7A 1NGYB 4OGZA 4UV7H 4M43H 4KVCL 1JYWA 4I0PD 1HHHB 3ARWA 3IDXL 1NDGA 5E9DA 3M1BB 3OAYH 4JFXB 4R97C 4K3HA 4TVPH 3BZ4A 5GRVL 1RHFA 3N0PB 2BOCB 3QCUL 3LCYA 4F8TA 3T2NL 1QQDB 2QKIB 4N5ED 5GSVB 2WNGA 4XNMA 3U79A 3TZVB 2BHZA 2EDKA 5FUZH 1C5BH 1R3HA 1A0QH 1WT5C 1KIRB 1KCSH 4XXCC 2DQGH 2PW1B 1F3JA 1MPAH 1YNLL 1F11B 4LSVH 5F3BA 1JWUB 3LKPA 4GKZA 1HXYA 3MR9B 2NY0C 3WKML 2NCMA 1CFNB 4NNYA 2WM0A 2H2SD 1E4JA 3E6HB 4POUB 1MH5A 3DX9A 1A6PA 4XXDA 4ZPTB 2IANB 3KXFA 5DHYB 3RUGE 1UH4A 4QCIA 4NQCA 3PABA 2EIEA 1A6UL 4NGHH 4GBXA 4FQIH 2NY1B 2PXYC 4HKBA 3VI3F 4Z95L 4F15B 2HMIC 4JREC 1AIFA 3QO0A 3C9NB 3FAXA 3FL7A 2Q20A 1KGCE 2DQUL 1ZTXH 5HYSB 5ACZA 1FAIL 4R2GC 4PRIE 4HC1A 1HEZB 4RA3A 1P5UA 3LRHA 1OF2B 1L0QA 1EHAA 4FABH 3VGAB 4X7DC 3GSXA 2CK0H 1QO3B 5IROA 4YDIH 1F02I 1A9BB 4QHKJ 1UH2A 3T0BA 1Q72L 1FFQA 1CK0H 1F3RB 3W9DA 4FZ8L 2VLLB 4H25A 4ESKA 3QWRD 1GC1H 3RFZC 4Z7VF 3GMNA 2IPTH 1QFUL 1FZOA 4XC1H 3S37X 1WITA 3DUHA 2J6EA 1Z6JT 2NZ9C 1NDGB 2F53E 2VDPL 4LPYA 5E9DB 5ETUA 4IJ3B 1A7BA 3BZ4B 4LSTL 3CX5K 4H20L 5J56B 1TITA 5FYJL 4K3GA 1OAYL 4XNMB 4DUWA 1R3HB 1KTDA 3MV7D 2Q3AA 3VXMB 1J86A 4ODVL 5HDOA 1C16A 1S9WA 3UJTH 1K5NA 5I8KH 4S1SH 1ZWIA 5KZCB 3M45A 4JG1H 1F3JB 3KLHC 5E5UB 3KNBA 3HPLA 3S96A 5F3BB 3EYQC 5C0ND 4WI4A 3LKPB 5DJ2A 4GKZB 2N7AA 1HXYB 1WZLA 3PDDA 1MCOH 4NNYB 4RMRA 5LXGH 1CL7L 3GBNL 2ATPA 2IG2L 1TENA 4KHXL 3RU8L 5HHXH 1MH5B 3DX9B 3IYLW 1A02N 4XXDB 2YEZA 4H0GA 5I71C 2VIRA 4F8QA 4CDGC 3KXFB 3P4NA 5AEAA 1G0DA 4QCIB 1KN4H 4NQCB 3PABB 4DAGL 1LO2H 3PL6C 3VFRA 1J0KA 3VXOA 4GBXB 2APFA 1UFUA 2XACC 4HKBB 1K3ZA 3D0LA 3HNVH 5CEZH 4MQXD 4NKOA 2J4WL 3QO0B 2VO5A 3BMWA 4LSUL 2IPKA 4D0BA 5ACZB 4EUPH 1X5HA 3IXTA 4KMLB 1BFVH 5ACMA 3NACL 2RCSL 3SE3A 1UH3A 3P4OA 1K8IA 1P7KA 1QD0A 1OWRM 3FHQA 2BY3A 3GSXB 3SQOH 4HPYH 2HWZH 2EDDA 1BBDL 3JVGA 4TSBH 1OAZL 2JCCA 2P44B 3D5OF 4HJ0D 5GRYA 4H25B 2EE9A 3AS1A 2FJFA 3GMNB 4I3RH 1N7ML 5FYLL 5FUOH 1FZOB 5F9OH 3EYUL 3P0YL 3O0RH 2VWEC 1M4KA 5ETUB 3FQTA 3HCVA 2AVGA 3OF6A 1RIHH 2J7LA 5B38A 4M93B 2DBJA 4L1HA 1YEFL 3FN9A 1KTDB 2R69H 1K6QH 43CAA 2DQJL 5KVMC 4LNVA 4TTDC 1C16B 1S9WB 3VXUD 4U49A 1K5NB 4PY7A 4N5EC 1ZWIB 1JHKL 12E8H 4XPFH 2BX5A 2OP4H 4ZUUA 5EA0L 3KNBB 3KPRA 3HPLB 3S96B 1VFOA 5DJ2B 3V52H 1S7WB 4J3OC 2HFEA 3C5ZC 3HZMA 4LCUA 2B5IC 2ATPB 4JM2A 1BIIA 3BD4A 3DTXA 5I75C 2YEZB 2VIRB 1J8HA 5H37H 2GUOA 1OL0A 3P4NB 4I4WA 4OV6F 3VFRB 5CZVL 2YKLH 3OKNA 5ANME 3D0LB 2FNBA 1ZOXA 2WLYA 4UT7L 1GCFA 4NKOB 4V1DE 1TTFA 1U9KA 2IPKB 4D0BB 3IXTB 4Z7UF 3O8XA 3VRJA 1JBJA 3P4OB 1K8IB 1P7KB 2A0LC 4ALAL 1DBJL 1G0YR 4HF5H 5JUEH 1TIUA 1QA9A 1U8MA 1H0DA 4JFZL 4HXAH 4K8RD 4PJ5E 1KCKA 3CC5A 2JCCB 4XI5D 1OLLA 4P23D 2FEEL 5HHMB 1Q0XL 2J3SA 2FJFB 4H0IA 1FO0L 4IRZH 5I6XC 4YQXL 2E5EA 1NAKL 4NRZA 1R5IA 3GBML 3FQTB 3HCVB 3GM8A 5F7YC 5HI3D 5B38B 3F62A 1WTGT 2GY7B 3FJTA 3SCMD 3O2DA 4ZO6A 3ZHDA 3LV3A 43CAB 5LVEA 4WHCA 4PY7B 1HYRC 2FO1A 2QSCL 3MRKA 2LU7A 4ZUUB 5IBUB 1IGCL 1MY7A 3KPRB 2JLLA 5E8DH 5IB3A 3OGCA 4AIXA 6FABH 4QXWA 3GMRA 1VCAA 5DJ0A 4IRSC 3PHSA 2HFEB 1U6AH 3HZMB 4S11A 3ESVF 4MX7A 4LCUB 1B2WL 2FYYA 1U91A 1BIIB 2I25N 4JM2B 4LASL 4N5UA 2XG5A 3S35L 5FO7A 3U7YH 3DTXB 3MRQA 2EE6A 1GGIL 1HKFA 3FO1A 1J8HB 2GUOB 4I4WB 1CD0A 2R2EA 2D3VA 5TF1L 4Q0XH 3LH2H 4X83A 3OKNB 1AKJD 1BJ1J 2MSPA 4MHHG 5B8CA 3PWPD 4Q6IA 5IBTL 2F74A 3L3IA 4P5TD 2FHBA 2IQ9L 4YHOH 5B39G 5I74C 5HI5D 1X6NA 4X99A 3QUYA 1MCBA 3O8XB 3VRJB 3T1FA 3U30B 4QWWC 1KTLA 1KTKE 1I3UA 4K3EH 5A1AA 4ONFL 1WEJH 3QCVL 5I0DA 2X2YA 1VFMA 4KK5D 1V5JA 3TVMC 1QA9B 2PN5A 1U8MB 4PJAA 4F7PA 1H0DB 5HGAA 4JFHE 2IFFL 2EIBA 1IC7H 3CC5B 4NM4L 3UDWC 4NWTH 2F58L 1FFPA 2M2DA 1B9ZA 3R8QA 5IVXA 4H0HB 4H1LH 2JJVA 4APQD 1EZVX 4DUVA 4HJ0C 4TPRL 4RFNB 2ZUUA 5DEZA 2VITA 5LAXA 2VUYA 3FMGH 4NRZB 1T22A 4L3EE 1R5IB 3DXAA 2FX8H 3LQAC 3NTCL 3ARBD 5D7KD 2CIIA 1Z3GH 3NGBB 2IMMA 2V5MA 2VZSA 1UWGH 2F5BL 3VWKD 3CVIL 2P49B 1GPOH 2LAAA 3MRKB 4MNQE 4LLYA 1FFRA 5DHXB 4K23L 5D93C 2K3TA 5IB3B 3OGCB 4FS0A 4P48A 3GMRB 1UXWA 3O2VL 5DJ0B 4G9DA 4FXGA 4XRCA 3L3OA 3S8WA 4MX7B 5DHVH 3VXSA 4F37F 1F97A 1IM9A 5F7EL 2FYYB 1U91B 3DV6A 4WCYL 1YEHL 4FP8H 5FO7B 3U7WL 3MRQB 5F96H 5IT2H 4IIQA 1E4WH 1QSFE 3FO1B 4JY5H 3QIUD 4ODSH 3RX5A 3LEYH 2R2EB 2E7LC 4MCYA 2BMKA 2X89A 1QLEL 5B8CB 2PR4H 4Q6IB 4RX4D 2F74B 3L3IB 4OCMC 4X6EA 4PBWD 1OAXL 1QSED 3ARFD 4X99B 3QUYB 1KEML 4R8WL 4GSDL 2JF1A 5F7KC 3RWDA 4MA1C 2NY5H 2DQEL 3T1FB 4P5MA 1OM3L 3C09B 4WGWB 1KTLB 5KS9A 3RWGA 4J6RL 4UAOC 1P4BH 4MXVE 5B3JF 1ZHNA 4PJAB 4K71B 4F7PB 3BDXA 4M6ML 5HGAB 4P4RA 5GXBB 5CP3A 4OT1H 2X4UA 4C56A 3VH8G 3BT2L 5D2NC 2I60L 3TNMA 4A6YL 5IVXB 2C3VA 4XVSL 2H2PD 3QAZB 2DQFA 4P23C 2VITB 5LAXB 2R0ZH 3QUZD 1T22B 5DD5H 3V5DA 4AEIH 3DXAB 3FFDA 1CFTA 3V4PH 3C2AH 4W6YB 2CIIB 3SKMA 1V7MH 5ITFA 2BVTA 3X3FL 1J5OH 3MQIA 2QQQA 1CGUA 5FB8A 5HI3C 2YUWA 3VI4E 4ELME 4K7FA 4KAQH 3SCMC 1KGCD 1RUAL 4LLYB 2PO6A 5EC1A 1QBML 3MACL 1KBGH 2AJZA 5JW4Q 4DN4H 1G7LA 1ZANL 1CD8A 4OZFH 1UXWB 3HC4H 4G9DB 4FXGB 4XRCB 3L3OB 1CR9H 2BHUA 3VXSB 4D9LH 3NBNA 4LPXA 5DEFA 1FNGA 5IG7A 4FQPA 4IIQB 1I1AA 5L2JA 2DBLH 2VR9A 3NMEA 5K59E 3RY6A 5CJOH 4JY6A 1ZK9A 4MCYB 4HJJH 1KPRA 2BMKB 3MJ9H 2ZNXA 4DKDC 3SEPA 4TUKH 2DYPA 4X6EB 1CCZA 1J7VR 2F53D 4JHWH 2BP3A 4QRUA 1CDBA 2AEPH 3X14A 3RWDB 4KZDL 3PGFL 1CXHA 2ED8A 5C0BE 1AE6H 3WXWH 4P5MB 5KSAD 5HI5C 5I9QB 5D6DC 3J8F7 5KS9B 1E4KA 3ILQD 3RWGB 1YYMH 4NUGH 2ATKA 3IU4H 3MLWH 1ZHNB 5HJ3B 2XRAL 4P4RB 4ZO8A 2X4UB 3MCKA 2GITA 4KJPC 3UYRL 4C56B 4P59L 4RFEA 5DJCA 3TNMB 2VQUA 1P84J 2C3VB 3M07A 5IMMA 1PEWA 1N4XL 3W11D 5L0QC 1KG0A 2DQFB 1PX4A 1HCFX 1H8OA 1SY6H 4X4ZA 4CVZA 4APQC 2GT9A 3V5DB 1OT1A 2YRZA 4M48L 2EDWA 3FFDB 1CFTB 1BECA 4FFYH 1B6DA 2HKHL 4XMPH 1FVEA 2V7NA 4MA8H 3SKMB 4AYFA 4ERSH 5ITFB 1Z2KA 2R1WA 4XX1G 5KG9A 5EULV 3S5LA 5FB8B 3LN4A 1UWXH 4K7FB 1AC0A 3WIIH 1MCPH 2PO6B 4XBGA 4YK4B 5EC1B 5HDQL 1GXEA 2NTFA 2AJZB 3HAEA 1CE1L 1G7LB 2L7UA 4OCXL 4P2CG 4GRLA 4BFBD 3WSQH 1NLDL 4LSSL 3MRHA 3GK8L 1P1ZA 5DEFB 1FNGB 5J11C 2AV1A 3MGOA 3JWNC 5IG7B 1XGUA 1I1AB 5L2JB 3LZFH 1N0XL 3LRSA 1OAUL 4X6CA 3BKCL 4JY6B 1P4IH 1CDYA 1KPRB 2BCKB 3P40A 4IDLA 2WP3T 3BJLA 4ONGH 5JXED 1QFWH 2AJYH 2JE8A 3WO4B 2DYPB 4WEBL 3X3GL 4A6YA 3ZT6A 3UTSE 4QRUB 3VWJD 1KPUA 3X14B 4LIQH 4FFVD 3A67L 4QHKI 2APWA 4DGYH 5DFTA 2BERA 3ARFC 2UY6A 2R4RH 2ATKB 2X4QA 3V7AE 2G75A 4LQ1A 1DN0A 1OSPL 5GZOD 4P2QE 2E7HA 5M7QA 3BGAA 3ZKQD 3MCKB 2GITB 1U2CA 3QG7H 3L5XH 5BVPL 4RFEB 5DJCB 2EDQA 4OF8A 3FRUA 2BNUA 3O3EA 5IMMB 2UUDK 1GZQA 4HCRH 3VXQA 1KG0B 3S34L 3VGDA 4L9LB 4OSUH 2VLME 3T0AA 1BWMA 4LSPL 4CVZB 3K3QA 2GT9B 2Z9TA 3H9ZA 3S35X 3MZGB 1FVEB 2V7NB 1D5MA 4S10A 1YY8A 4CN6A 2VLJD 4XAKE 1F00I 2YZ1A 1RAMA 2R1WB 1T7WA 3FN3A 5KG9B 2OBGA 3RY4A 3S5LB 3LN4B 4K9EL 2FWOA 4V1DD 1ZT1A 1IQWL 4XBGB 5SV3A 4ODHH 1FRGL 2IGFL 4HEPG 2D4FA 3HAEB 3DIFA 1LO3H 4GRLB 1MEXL 3O3BA 1DEDA 1IFHH 1T04B 1G1YA 2BXZA 2OK0L 5C0RL 3SO3B 1J9CT 3MRHB 4XCFH 1P1ZB 3RPIA 5DZLA 2AV1B 3MGOB 5CD3A 5IMKA 2YPKA 4AMKH 1XGUB 1AO7A 3I2CL 2OR9H 3LRSB 2Q8AL 4PJ5D 4X6CB 4M1CC 3ZE1E 4LEOA 1UG9A 3U9PH 2Y5EA 1QYGH 2Q86A 1A14L 2R56L 5DDHA 1AD9A 4YE4L 3EOAA 4B7LA 4A6YB 1FH5H 4WI5A 3SDXE 1KACB 2PCPA 1KPUB 5I1EH 4HFUH 4PGZA 3LN9A 3FO2A 5F9WB 2QQKL 4HT1L 5F88A 4WEMB 4JG0H 5EUOF 4O9HH 4CN4A 4JVUA 4WRLA 3BRFA 1GGYA 1FG9C 1WQVT 2UUDH 4XP9L 4YC2B 5BOPA 4HQQL 2X4QB 2AJVH 3EO0A 2G75B 1HHGA 5E6IA 1DN0B 1H3TA 2JJTC 3HE6D 3ILQC 1UM5H 3QIBD 4MCZA 3H9HA 1RFDL 3T09A 1TZGL 5IFAL 2BZDA 2MQCA 4ZAKC 4HGMA 4KY1L 4J4PA 5FHBH 3FRUB 2BNUB 1G7PA 3O3EB 2W38A 2FBJH 1Q1JH 1GZQB 3VXQB 4U7SA 2EO9A 4WUUD 4L3AA 4L8DA 3FN0L 4I0KA 1SEQL 5MP6L 4A2LA 1OT2A 2XV6B 4HC1H 3GIVA 3TA3D 2EZ0D 3GDBA 2AK4E 4G7YL 1D5MB 4ZTOL 1YY8B 1KJ3H 2FHFA 3QDAA 1OVZA 1B4RA 5KVEL 5LGJA 5HY9A 3UAJD 3GIZH 1N5YH 2XA3A 2EXWD 1JF1A 4FXLA 4NQDA 1HYSD 2VAJA 2VDML 2FWOB 4L1DA 4EQ2A 1ZT1B 1LNUA 2OR7A 3RKDD 1G9NH 2WSKA 3AAZA 3QISA 4NO0A 1FZKA 2W65A 2P8LA 3FOLA 3DIFB 1RZJL 5D7IE 3O3BB 5H8DA 3SE8H 1KCVL 4QOKA 5GISL 5KOVC 2J6EH 3RPIB 3C6LD 3KYKL 5CD3B 1RV6X 5IMKB 1YEJH 2YPKB 2WP3O 1AO7B 2AV7A 5J06A 3I3BA 5AZ2H 2VQTA 3K2MC 4LSDA 4MA7H 1KEGH 3V4UH 4MD0A 4PJ9A 3ULVH 4HIXH 4PRBA 4LEOB 3OGOE 4WV1C 3SE9L 1XGYH 4NYLA 4HUVA 1JHTA 4UOJA 5IW3A 5DDHB 3TEUA 1DLFL 1AD9B 4NBYB 4EEEA 3EOAB 5LJYH 1R3JA 1CXIA 1RUML 3SBWC 2PCPB 1J1OL 2Q7YA 2M1KA 3MUY1 1OOAA 3FO2B 4ORZC 5D7IF 4U6VH 5F88B 4OLUL 4LDLB 5F3HA 2G2RA 3B8YA 3VWJC 2ADGA 4FFVC 3V5KA 1KLFA 5I19H 3EO0B 1HHGB 1DTUA 3P9LA 5E6IB 4OD1L 5I30L 2CR3A 1RZFL 4MCZB 5KVDL 4MNQD 3T3PE 3BRGC 3H9HB 1JZ8A 1FLRL 3QIWA 3VD9A 5IW6A 4RRPA 1UM6H 3IKKA 3KLAB 1X4ZA 2WZPD 1G7PB 3LIZL 1ZLUK 2RIKA 4KFZC 4R26L 4L8DB 3DWTA 4Q7DA 4XTRD 3QDGE 3QDJE 3CSBA 3FONA 3GIVB 3IDXH 3AM8C 3I85A 2AJUL 2Q8BL 1DQMH 1A7PL 3CFJA 4G6ML 3G9VA 2VXSL 3D69A 5LGJB 1SM3L 3MV8A 5HY9B 1BEYL 4PJEA 4NQEE 2FIKA 2AK1L 3MRPA 4NQDB 4O5LH 2W91A 5CKAA 4L9DA 2G5BA 4JQIL 4F7TA 4TSCL 3T3PF 4WW2A 4PP1D 5E7FA 1ACYH 1LNUB 2NY4D 1FGVL 2XQYG 3AAZB 1YNLH 2W65B 2P8LB 3FOLB 3Q5TA 5TQ2H 1CVRA 1T7ZA 3ISWA 4EJ1C 4LLDA 2MOVA 1T4KA 3OBAA 3WKMH 4PD4K 4QOKB 5BOZG 2ZG3A 5CSGA 1HSAA 3CDGA 5TH2A 2AV7B 1F4XL 3RI5K 4XAWH 4HFWA 1BQHG 2FR4A 4FTVA 5JR1H 4MD0B 4PJ9B 4PRBB 2DOCA 4LIQE 1EMTL 1XZ0A 2EIZA 3S9DB 4HUVB 4NYLB 1MI5E 4UOW0 1JHTB 3CLEH 3GMQA 3EDEA 1R3JB 2EH8L 3WMSA 2X4OA 4JFFA 1KENL 2GK0A 2Q7YB 1ITCA 4NKIL 4ODBD 5KOMC 2MTPA 5F3HB 1FAIH 2G2RB 4RIRA 4PJ8B 1R0AL 4XPBL 1ZLUH 4KUCF 3S3JA 2ADGB 3V5KB 4BZ1L 3F7QA 5IKCA 4OCYL 3P9LB 2LV4A 3IDMA 4OD2A 4ZPVA 1LK3L 2P42B 3LHPL 4WU5A 3U6RA 1WCQA 3QHZL 2X1PA 3QIWB 1IGIH 1TPXB 5IW6B 1Q72H 1AGFA 3HE6C 2OSLA 4Q9RL 5J9PA 2AW2A 4P9HH 4KDWA 3GI8H 4DK6A 5EU6A 4L5FL 1R3IL 1YMMA 3FONB 4Z5RA 1AGEA 5D1XB 2VDPH 1PG7X 3ARDC 2J12B 3O11B 4LSTH 3CFJB 1J0YA 4H20H 2VZVA 2A74A 4YFEA 4G8IA 5FYJH 3D69B 4PJXA 3TA3C 3MV8B 4JFDA 3HZYA 4PJEB 3MRPB 4M61A 3FO0H 4QT5A 2G5BB 4F7TB 5ALCH 4WW2B 4ODVH 2VB5A 5E9DE 2EXWC 4LL9A 4PJCA 2W0FA 1HYSC 5C0BD 2Z8RA 3LS4L 1I3RA 3CIQA 4LLDB 1D5ZA 3RKDC 4Q9QL 2BSSA 1T4KB 1I8LC 3LD8C 5KSUA 3VXME 1HSAB 4P2OA 4JRXA 3CDGB 4WWKD 5TH2B 3GBNH 5EWIL 2IG2H 1YECL 4KHXH 3RU8H 3UC0L 2X7LA 3CFCL 1GC1C 4HFWB 1YNKL 2PW2A 2FR4B 1D6EA 4FTVB 1BWWA 3C6LC 5E2TH 1XZ0B 2EIZB 2GKIA 3O2DH 1WT5A 1WZKA 3GMQB 3S3PA 5IEHA 1CFQA 2I27N 5BCAA 4XPTL 1XMWA 3MGTA 5C92A 2D7PA 2ZUWA 2RAMA 2X40A 2J4WH 2X4OB 1EBAA 4JFFB 2GK0B 4LSQL 2VOTA 2DS4A 1N6QL 4NN5B 4LSUH 2VDQL 1A7QL 3IB4A 3KXFE 4FQCH 1RU9L 4RIRB 3UZEA 2F54A 4NQCE 3NACH 2RCSH 2AS5M 3KPSD 4Y2OA 1QLFA 5F8RC 5IKCB 4WWID 4HMEA 3QP3A 4Q9CA 4KK6D 1BGXL 3EO9H 3IDMB 3PJSA 1JZ2A 4OD2B 4ZPVB 1FNAA 4PRAA 1AR2A 1JVKA 4WU5B 2P5WA 3QT2A 5JPMB 3ZTNL 4GXUN 1BBDH 3B3IA 1AGFB 1OAZH 2NY2B 3CD4A 3VD7A 5J9PB 1L0YA 4OI9A 5EU6B 1N7MH 1GJIA 1YMMB 3VGHA 1LDPL 3S97C 3P0YH 4Z5RB 5CZKA 1AGEB 3FQWA 4R3SA 3RNKA 2CDFA 2ZKHL 3WFDL 4Y19A 1WWCA 1NUGA 4NM8L 2A74B 3UYPA 4G8IB 4CMMA 4PJXB 3TN0D 3N50A 4JFDB 3HZYB 4M61B 3MODL 4QT5B 1YEFH 5D71L 4ZNEE 2OX5A 1UZ8A 4OGXL 4Y5XA 4N0YL 4IOFC 1JHKH 4EBQL 4PJCB 1KB9K 2W0FB 5EA0H 4E0RA 4PP1C 1I3RB 5IB5A 4C55A 1D5ZB 3UROR 5DQDL 3ULVE 3SDDA 2ZCHL 5KSUB 1PDKA 1CFVL 1W72L 4UDUA 5CUSL 4P2OB 4JRXB 4Z0XA 1RMFL 1UWEL 1HH6A 3KPOA 5DVMA 1EO7A 2X7LB 3DMMD 4LOUD 5JW4R 2PW2B 1D6EB 4LPVA 1EXUA 5DFWH 4H88H 4M1DL 4KZEL 4Q9BA 5CZVH 4XNZB 5EZLA 1CFQB 5DMJB 3QEQD 5IEHB 2SEBA 3T2OA 1P7QD 1MCWW 2VLMD 2W1NA 3DVFA 3RJQB 3MGTB 2FJHA 1T2QL 4J3UA 1CDIA 4KROB 4PY8J 3B2UD 3WNNA 5ESAA 5IHBA 1OARL 2F54B 2ARWA 2IAMD 4XAKD 3EFFA 2X6MA 1QLFB 2JIXA 2VUOA 2MQ3A 3PJSB 4ALAH 1DBJH 4HLZG 2P5WB 4WTWA 2EDFA 4QTIL 2ED9A 3MC0A 1ZKAA 3B3IB 1BM3L 2BY1A 3MOAL 3WNLA 2G9HA 1Q0XH 3QYCA 4F9LA 1TJHH 3S88L 4Y2DA 1FE8L 2X1QA 1WV7T 1FIGH 3A6CH 4YQXH 3FQWB 4R3SB 3RNKB 4MXWL 2X1XR 3HRZA 5DZNA 2CDFB 1NAKH 3BSZL 2BJML 4R7DA 4Y19B 2GCYA 3GBMH 2XWTA 4JZJA 5IJKC 3WLBA 2E8YA 4CMMB 2OLDA 3O4LA 4HKJA 5HHME 3TV3H 1TVHA 4G42B 1UZ8B 5CP3H 3TNNA 4Y5XB 4JQXA 3MXWL 4E0RB 3UBXI 5IB5B 4FQHB 2FEDD 3SDDB 1MJUL 1AQKL 5F1KC 4UDUB 3RL1A 4Z0XB 3I50L 3EYSH 1HH6B 3KPOB 4LASH 3BP5A 4I0PA 3INUL 2HTKC 2QQLL 5DK2A 4F7EA 1GGIH 3KPRE 2XZCL 1EXUB 4ZFFA 1CXEA 5K9QI 5TF1H 1JRHH 3ULUH 5EZLB 2ORBH 1M7XA 2BY0A 2SEBB 3T1WA 4FZEH 4MS8D 3VXNB 2FJHB 4N1HB 4OZHB 4GS7B 4OIIL 3MV9D 2IQ9H 3GM0A 4EQ3A 2X5PA 3EZ8A 5ESAB 1J8HE 2AK4D 3BP4A 4HJGA 3T4AA 3EFFB 3KYMA 2JIXB 4FFZL 4ONFH 4DOHB 5HGBA 5I71B 1OLZA 4OQ1A 4MD4A 3BZFA 1T83A 1F4YL 5HYFA 3OR6A 2A6DA 5FV2A 1J0IA 4JJ5A 2IFFH 5GRZA 2YUVA 3D3VD 5FGCB 2IBGA 1KNOA 2CD0A 4NM4H 2F58H 2G9HB 3ARTA 3D9AL 5E00A 4UV4L 3NIFE 5FYJE 4Y2DB 3TGXA 2YPVL 4EI5D 1U58A 3UBXA 5IQ7L 2XG4A 5AZEL 4ONHA 4X6DA 1W72A 3O6LH 5HD8D 2GTZA 3HRZB 5HHVL 1E6OH 4R7DB 2GCYB 2XWTB 4JZJB 4YLQT 3WEXA 1KYOJ 4NP4H 1C1EH 3WLBB 3VFPA 1GH7A 3O4LB 4HKJB 3MSPA 2CDGB 5HGGS 3EHBD 4PYGA 1TVHB 3U46A 5DI8A 3CVIH 3TNNB 1T66D 1VSCA 2C3XA 2MKWA 2ZUSA 4NIKB 1FVDA 1S7UA 4K23H 4NJ9L 3NIFF 4O2FA 3QWRA 1A1MA 3O2VH 3SDYL 2VZUA 1FLTX 3RL1B 1SEBB 5F7EH 1DUYA 1V3JA 4WCYH 3BP5B 4I0PB 2ITCA 5DK2B 1ONQA 4F7EB 5E2JA 2EC8A 4JB9L 4MJID 2DKSA 4LOUC 2FLRT 1NANI 1U3YA 4PJBF 2CDEA 5ILTL 1NUDA 3QDGD 3QDJD 5DUML 1OAXH 3HAEH 3BP4B 4HJGB 1O0VA 5I17A 1EHLL 2W9DL 3HI1A 2DQEH 4HPOL 3UTQB 3T4AB 3KYMB 2ICWJ 2ENSA 2PKDA 3B2UC 4NQED 1DBAL 1GIGL 4KU1A 5HGBB 3BPOC 2A83A 2IAMC 2I07B 3NN8A 4JPVL 4MD4B 8CGTA 5EO9A 5KVGL 3BZFB 3T65B 5T33H 1WFTA 3OR6B 4HLJA 2A6DB 4JJ5B 5T1MA 4XC3L 1JPGA 2J5LC 1KNOB 3G08A 3BT2H 1KJMA 3S36X 4A6YH 5E00B 3AMKA 1T2XA 3PF2A 1U58B 3UBXB 4ONHB 4X6DB 1W72B 2R0LH 5BVJA 2GTZB 4PJAE 5DJXA 4M00A 2VC2L 3TP4A 1OTTD 1Q9KA 3AY4A 3VFPB 1DQJA 1MI5D 1XIWD 5T3XH 5IVXE 4LP4A 1HCVA 4BQBA 3U46B 2D7OA 5DI8B 3FB7A 1KJ2L 4U2ZA 5EU3A 2NY5C 4JDTL 4PLKD 1Q8MA 4ZFZB 3SGJC 3O6FC 1A8JH 2LFGA 1RUAH 3MLRL 1FVDB 1S7UB 1QBMH 3MACH 1S5HA 4NZTH 4MQ7A 1QPPA 4LPCA 1MQKL 2W9EL 4O2FB 1ZANH 5I6XB 1A1MB 2NY1D 4N8PA 1NL0L 2YXFA 1A1OA 3CMOL 4DVRH 4BA8A 1DUYB 2FEDC 3MLZL 2B39A 1Y18A 2X44D 4XCNB 1CLOL 2ITCB 1ONQB 2BRQA 3NIGE 1T1ZA 1TJGL 2WINA 2R2HA 3FTGA 4ZTPL 4AQOA 3DURB 2AJSL 2E9WA 5C3LD 3RTQB 3SKNA 1CYGA 1R5WA 1QUNA 2OJEA 3RGVD 2CDEB 2CLZA 3VXUA 1CDHA 4XCCL 1YZZA 5I17B 4MS8C 3PGFH 3HI1B 5BW7A 1UCBL 2YD4A 1IJ9A 3TBTA 3RWFA 4K7PH 2A83B 3MREA 3WNMA 3NN8B 4F80A 5EO9B 1XF3A 1YQ2A 2NXYD 2E7LA 4PB0L 1HNGA 3P73A 4HH9A 2XRAH 5DQJA 5T1MB 1JPGB 3UYRH 3G08B 1P69B 3MOBL 3ECBA 1KJMB 4YDLC 2YD7A 5I0ZA 1DP0A 4JR9L 1N4XH 3VXMD 2EYRA 5JHLL 4LLQA 1VDGA 5BVJB 3ZE2F 5D7JC 1QBAA 4F2MA 5DJXB 1TZIA 2LU4A 1Q9KB 4EDWL 3D18A 2HTLC 4M48H 5FM5O 4C56E 2HKHH 5JXAL 1DQJB 1IARB 4KTEH 5IVOA 3UTTD 5A43C 3HA0A 3BO8A 3FB7B 1OW0A 2ZOKA 1LQSR 3CX5J 5EU3B 1EHXA 1UC6A 4XPHL 4ACPA 1I8IA 4ETQA 1NFDA 5H35A 3STZA 3PWVA 4X0KA 3TPKA 3MV11 3BKYL 4HWEH 4L4JA 2K7QA 4Y5YA 5HDQH 5HI4C 1S5HB 1PSKL 2RBLA 4MAUL 4MQ7B 1T66C 2N1KA 4MAYA 4P23A 4AK1A 4JO2L 35C8H 3TESA 4AEFA 3LEVL 1A1OB 1OTUC 4OLWL 1NLDH 5GRJL 3ULUE 4LSSH 5ICYA 1CTNA 1HI6A 3GK8H 3ELAT 1Y18B 1HWHB 1HN1A 1T1ZB 2BFVH 4YJZL 2WINB 2R2HB 3FTGB 1OAUH 3BKCH 4OLEA 3HUJF 4MDIA 3SKNB 3HI6L 1R5WB 1QLRA 1PGRB 5J12B 4PTUB 3ZYJA 1I3GH 2OJEB 4XPGL 5F1IA 3SCMA 4KMTH 2CLZB 1SVCP 4MB3A 4XVJH 4WEBH 3X3GH 5JDJA 3VXUB 5D93B 5D2LA 1JUFA 4OZIF 2HKFL 5CFHA 3NCJL 1IC5L 4JFYA 5DJYA 2ITDA 3A67H 4EOWL 3DYOA 5DO2D 3SDAC 1JI2A 2X4NA 3TBTB 3ULUF 3RWFB 1JFQL 3MREB 4RMSA 5LQBL 2VDNL 2HLFC 4K94H 2EDNA 4LLVA 1XF3B 1RIUL 4YIQA 4U1IA 4MXQD 3P73B 4HH9B 1KJ2A 1U92A 4RBPK 1BREA 4KI5C 1A7RH 4UB0L 4OB5L 1SMAA 2GTWA 4LVEA 4OTXL 4Z7WA 1AKJA 3S34H 3PWPA 2EYRB 4LLQB 2VE6A 3H9SE 1S7XA 4P5TA 4LSPH 4F2MB 1TZIB 3TZVC 3WCYA 3MLXL 1Z0NA 3D18B 5INDA 4O02L 2ENYA 3BRDA 2CKBL 4NRYA 4LARL 1OTTC 4HXBL 3BO8B 5CLWA 2ZOKB 5GJSL 5LBSL 4MLSA 1I8IB 4TYUA 4ETQB 1CQYA 1NFDB 4K9EH 5H35B 3STZB 3PWVB 2E3VA 4X0KB 1EUTA 3O3DA 1IQWH 3TFKC 4Y5YB 1FRGH 4YHNA 2IGFH 3MX0A 4JKWA 4MAYB 4P23B 3SHSA 4PGBA 1MF2L 3DLQR 4APQA 5BJTA 2J88H 5ICYB 1HI6B 2Q76A 1T0NA 2NY1C 3U4EA 2VTFA 2Q8AH 4F15C 5DD6A 3ARBA 3PE9A 3U4AA 3I9GL 4MDIB 1I85A 1RJZA 1QLRB 3PP3K 1A14H 5F1IB 5AYUL 2VQ1A 4YE4H 5DUBA 1HH9A 3VWKA 3ZT5A 1TQBB 4POZD 5CSZA 2RJMA 4LK4A 5D2LB 1JUFB 4RBPH 4JFYB 4JM4H 5EO0A 1HSBB 4PLJD 5DJYB 2ITDB 1L6ZA 1WF5A 1OPGL 2QQKH 4HT1H 4JPWH 4WTZA 5CJXA 1A3LL 3ES6A 3V6OE 5I8OH 2X4NB 4Y4KD 2BHYA 5DGQA 4W4OC 4U31A 2CGRL 1GSMA 2Z35A 3B5TA 4XP9H 2VZOA 2VLKD 4KUZL 4HQQH 1JYNA 2XPGA 4LLVB 3BYYA 4U1IB 5BRZE 2Y06L 1KJ2B 1U92B 4W6WB 2HN7A 4KQ3H 3JUZA 4EIZC 3HI5H 1RFDH 1TZGH 1ITBB 1U8IA 3QIUA 5IFAH 4P46D 1ZLSH 4KY1H 2GTWB 4KGJA 1U36A 3VG0L 1EX0A 2H32A 3MFFA 4NZDA 1AKJB 5KANI 3PWPB 5T3XE 4YWGL 4RX4A 1RVFH 4OFIA 2VE6B 4P5TB 1S7XB 1S5IL 1INEL 1SEQH 1QSEA 1T0MA 5MP6H 2YR3A 5INDB 2VXVL 4OD3L 3GSQA 4NRYB 3VXRD 1AJ7L 3RIAF 5E4EB 2OTUA 2OQJA 1INDH 4UOW1 4WY7H 4HIHA 4UU9A 1FV1A 3WNPA 5HHOD 5GHWL 4RAHA 2D7TL 3RVXD 3O3DB 4YHNB 5F7UA 5D5MF 5KW9L 5HHNA 4PGBB 5L88L 2XZQL 5FYKH 1QTYT 4APQB 3VFUB 3PP3H 5BJTB 1EVUA 5GISH 1ZA3A 2Q76B 2AERT 4P3DA 3KYKH 3OKKA 4GBXC 1T0NB 2R4SL 3QUZA 4ZFOL 1BJ1H 3U4EB 5B22A 1NAML 4PY8I 5CEXB 2DQIL 3RUGA 5DD6B 1VFUA 3ARBB 4P49A 1RJZB 1YC8A 2Y5TA 4HBCL 3F58H 4N90E 4NQXA 1DLFH 2VQ1B 3B83A 3L3HA 3HNSL 1HH9B 3VWKB 4Z7VA 1AGDA 5CSZB 1X4YA 4YFLF 4TNVK 5EU5A 1RUMH 3MFGB 1AO7E 1J1OH 2BDNL 5EO0B 2UV3A 4L3CA 1PG7W 4URTB 1REIA 4OLUH 1JGUL 3ES6B 5LKNA 4MJ2A 1QSZA 2CKBA 2Z35B 2O26U 1G9NC 1DBKL 4TOYL 2XPGB 3A0OA 3D6GA 1ZS8A 3JWDL 4OD1H 5I30H 2HN7B 4HBQA 1RZFH 5KVDH 1FLRH 3QIUB 1U8IB 2BVQA 4KQ4L 3LIZH 2H32B 3MFFB 1Q38A 2IH3A 2XA8H 4PB9L 3V9FA 1U8QA 2C7UA 3HPJA 3ULVC 4M93C 3UXFA 3NH7H 1T0MB 1QSEB 5FCSH 1JI1A 1I7ZA 2F53A 4KKAC 5SWZE 1LD9A 2O5XL 3FT2A 1UADC 2AJUH 3GSQB 2Q8BH 5JORA 3DYMA 5KSAA 2OTUB 1UKSA 2OQJB 4HIHB 2CUMA 4UU9B 4UV7L 2DM3A 3I6GA 1FV1B 4JAMA 2AK1H 3ZE0F 4JQIH 3DETD 3VFOA 2WAHA 2W0KA 5LGKA 1FGVH 2CRIA 5BXFA 4KXZI 5HHNB 3BKML 4JZNA 3G6JE 1C5BL 1T1XA 4NQDE 4D9QD 1ZA3B 4HIIA 4RSVA 4P3DB 3IF1A 2DQGL 3RRQA 3OKKB 4JQVA 1MRDL 4PRHD 3QUZB 1MPAL 2XZZA 4LSVL 4MJ6A 5TDPA 3DNKA 1EMTH 4CUCA 2Y5TB 3FHAA 4GMTH 4NQXB 1B6UA 3BW9A 4QOKE 3L3HB 3SE3C 4Z7VB 1AGDB 1WGOA 5EU5B 1MCJA 3KYOA 5ADOL 3TF7C 4R4ND 1DCLA 1KENH 3CX2A 4LVNB 4L3CB 1K2DA 1NCDL 5A3IC 3G6JF 5AD0A 4NGHL 2YPLE 4JGJA 4HUMB 5EG6C 2Y7QB 3JVGC 3RWCB 1R0AH 2GW5A 2NW2A 2CKBB 4PLJC 1NGZA 4BZ1H 5EOTA 4OCYH 4PPTA 1X5IA 4YUEH 4GG6F 4HZLA 4NOBA 1ZS8B 2X4SA 4Y4KC 1LK3H 2XZAL 4WV1A 1HKLL 4FMKA 3QHZH 2BVQB 1W0WA 3GKZA 4OFKA 3Q3GA 2FZ3A 1LVEA 2J8UE 4Q9RH 3U4BH 4O2CA 1ZT4A 4OAWA 2CK0L 5JXEA 4EKXA 3K1DA 2IH3B 3GMOA 4I8DA 4PG9A 4L5FH 1R3IH 1U8QB 2C7UB 3HPJB 4YDIL 1P84K 1HQ4A 1I7ZB 2F53B 3VWJA 1LD9B 2D4DA 5GS0H 3FT2B 1CK0L 2C1PA 5JORB 3MBXH 3KS0H 5KSAB 5GS2H 4ZFOA 3AGVA 1NAMA 3V79C 1K9TA 2IPTL 3PP4L 3I6GB 4JPIA 4XCEA 2YD5A 1HNFA 2ICCA 3WFEL 2DMBA 3SGDI 2J8OA 4HAGA 5BXFB 5IIEA 2J8UF 4JM2C 4YDKL 2XN9A 3RVXC 4JZNB 4Z7UA 1TCRA 3MV8E 2D2OA 4PJEE 1T1XB 3TH2T 4HIIB 3CFDA 4Z76A 1MFBL 3IF1B 5I8KL 5C2UB 3K0WA 1CGYA 1P4LA 1MCWM 1YECH 3IAQA 3UC0H 4MJ6B 5TDPB 1YNKH 4P9HC 1DQQA 1JL8A 4GRWE 4Z77A 3MRCA 2VLJA 4WI9A 5C3TA 5AG8A 2ICWI 3BW9B 1TVBA 3O8XC 5LXGL 3U30C 4XPTH 3HC3L 5FYKU 4RAUA 5HHXL 3PV6A 1J12A 2KUTA 1YA5A 3DO3A 4PGDA