4JRWA

Crystal structure of clostridium histolyticum colg collagenase pkd domain 2 at 1.6 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
GSAPIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
molecule keywords Collagenase
total genus 18
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jrwA00
4IMKA 5E08H 4MAYC 5EU4B 1CK0L 4EN3D 4O9HH 1V5JA 5E1AA 2QSTA 1YEKH 3FO0L 4MA1B 4H20H 2YEZB 4C56B 1JNNL 2OTPA 2IANB 1VENA 1PEZA 4MAYA 3WHXA 3QUMB 3W9DA 4MB4A 4H8WC 5I9QC 2X4OA 1AP2B 3ZYJA 1DLHB 1D6VH 4YDIL 3WS3A 1KB5L 1MHHB 4RAVA 4BSJA 3OHXA 3VH8G 3QUZB 4GW5B 1BQUA 1ERNA 4ZDHB 2C4XA 2X5PA 4GBXD 1IAIH 4TSAL 2VSDA 3O6KH 4HW6A 4FQIL 4P9HH 1FFPB 3OB8A 1N4XH 3QUXC 4KI5D 4Z7UE 4W4OA 1XGQB 2AW2A 4TSBL 3WEXB 1QVOA 4M00A 1MREL 1QSFE 4ZYKA 2VXVL 5F44A 4YX2L 1F4XL 3REVB 3OKKA 4WFHE 2HN7B 3FQNA 1QQDB 3QUMH 4RDQG 3FQXA 1NC2B 4OM1H 3P0YL 1KTDB 5B38A 4BSWA 4FHBD 4OF5A 3L3OB 4ZD3L 4AEHH 5T5FL 3VWKB 3I6LD 3CXHJ 3KPRA 2WWKO 2I24N 1EPFA 4CDGC 2B5IC 4HMDA 4PGBA 3K80A 3V8OA 5D1ZC 3VGHA 5DURB 3QA3A 5GHWL 5F8QC 5EOCH 1HOCA 5FYKH 1KLFA 3HNTL 1Q0XH 3SDCD 3PWLA 3KXFB 1J11A 5I9QB 2NY1D 2BJMH 2AEWA 3ARGD 1JNLL 4JZNB 3D85A 3ZKND 1S9VA 3TYFA 4XCYB 1NL0L 2F74B 3FOLB 5C2BH 4M7KH 3DMMB 1U8MB 3TIDB 1SYVA 4X0KA 4Y4FD 3EDEA 3DUSA 1OL0A 4Y8DC 3PJSB 4NOBA 4JQVA 3L3KA 5SWZD 3RY6C 4PRAB 3QG6B 3D1MC 2XY1A 3U0PA 3OPZL 1F6FB 4JAMB 1MHCB 4X8JA 1BX2A 4FQ2L 4YXHL 1G7QB 4XPGL 1DUYB 5I15H 3O2WH 3CFKB 3U6RA 1ETZB 1FL3B 1M6OB 3SCMB 5KZCD 4GUPA 2UWEB 2JJSC 5SV3A 4RCAA 1P84J 1MIMH 3HB3D 5D70L 3BQUD 1WIPA 1GGBH 1U58B 3MLWH 1PKOA 4N0FB 3RJQB 1ADQL 2B1AH 1S7SA 2OQJB 2BY3A 2NY3C 3FRPG 1C12A 4Y19B 1TZGH 4UAOB 3X11B 3X17A 4V2BA 1TMCB 1TPXC 1CDBA 1NFDE 4WNQA 3RVTC 35C8H 5E70A 4G6KL 1GGIH 4XNZB 2F5BH 4OD1L 4ZSOB 5DK0B 4MCZB 5IMMB 2FHCA 3ZYOA 1R3IH 3PQYE 4P23A 4M93B 3O2DL 4FNLH 4YLQT 2AGJL 2VWEE 4G5ZH 4I4WA 4WFFD 3MGOB 3BP5A 3FT4A 3KVQA 1MHHA 3T0AA 1BQHA 4LCCC 1G0XA 5C86A 2IBBA 2YC1A 1IMHC 3QZWA 5IOPA 4GW5A 2DBJA 3VFRB 1DBBL 5C71A 1I8LC 2OR9L 3IETA 1HEZA 1K5NA 4F37K 3O2VH 3CIQA 4H25A 1TJIL 2XRAL 1KIQA 5FCUH 1Z2KA 3SOBL 3L6FB 5DQ9A 1HKLH 1ZLSL 4NQCA 1AY1L 4NZTL 1QLRB 4UIMA 3W11D 1BEYH 3G04B 4OD2B 4JKPL 1X5AA 1PG7X 3N0PB 1J05B 4U1SB 1BFSA 2IH1B 3I6LE 4AT6B 3O6LL 5D5MB 2H2SD 3PWJA 1PZUB 5IMLB 1VGKB 4H0GA 1NGWA 1S9KC 5FECA 4ENEC 3CVHB 1EHNA 3LPWA 3IU4L 3G6JB 4UTBL 4I0PA 4Q9CA 1A7NL 3P4LA 5ALBH 3R8QA 4XMPH 4MDIB 2OMNA 3F58H 3FN0H 5J56B 1SJXA 5GS0H 2NY4D 2PXYC 4X98B 3MV8E 1RIHH 4ACPA 1I7RA 5BV7H 2C7UA 1OQXA 3HC0A 1K2DA 4L8CA 3EFFA 2IADB 4P4KA 4Z0XA 2H8PA 2RCSH 3RUGE 4Y0GA 3I3EA 3BGAA 2DQEH 1BM3H 1HCVA 4KAQH 2YPVH 1EO8H 2V2WA 3I75A 3KPLA 4IS6B 4ELME 2J4WH 4LL9A 4OKVB 2B1HL 4KK8C 1OTTC 3JWDH 4LHJB 3ZTNH 3O3DA 5BS0A 4I18B 1II4E 3KJ6H 1LO4L 1FGNH 4FQQB 5DK3A 4HS8L 5IM7A 3V7AE 5ELIA 3OG4B 1KGCD 4IDLA 3U6RB 3G6AB 1DQTA 4L4VE 3SCMA 4QOKA 5ILTL 1KLUB 4R3SA 3X13B 2FWOB 1U8NB 5I1DA 1A6PA 3UDWC 4D3CH 4OBSA 1T5XB 3LSOA 5HI5C 5IMOB 3E1F1 2X4RA 1R3KB 3LN4A 5ICZA 2P8PB 4HKBA 3KWWB 4ZPTA 3M07A 3F65A 4QXGH 4F8QA 1DUZA 4U1MA 3KXFE 4ZSOA 5DK0A 1CWVA 2AJZB 2A83A 2JJVA 2UUDH 4OFIA 3SDCB 2HT3D 2X40A 4I4WB 5C08E 1UEMA 4FXLA 5C0AA 4K2UL 4HZLB 5D6CA 5T3XH 3LS5H 1MFAH 3EDFA 5DC0A 3PV6B 1VGEH 5J11B 4LF3A 5MENE 1NC4A 4NC1C 2CLVA 4Z7OE 5F7EH 4IRSA 4BFEA 5GGSB 2G75A 3VFRA 4KHTL 1TCRA 4PRBB 3HR6A 3I6GA 1WZLA 1XGRB 3K74B 2EXYD 4NQSB 3VMNA 2O5YH 2XI9A 1JI1A 3M45A 4LLYA 3VXRB 4H26B 5IFHH 5JQ6L 3TWCH 2X89D 5JW4R 5DQ9B 5L2JB 1CCZA 2CKBA 1QLRA 4RBPH 3TH3T 1MLBB 4G6JH 4JPWH 2HP4A 1KGCE 2DLGA 4XNUH 3FB5A 2JCCA 2NLJB 2ZSVB 3P9LB 4OLVL 2IH1A 3MV11 3V4VL 4PP1D 2YD4A 4HUUB 1MCLA 5JHDA 2PO6D 2IFFL 4JFZL 2D0FA 3CZFB 3RTQD 4FZ8H 2EDBA 1YNTA 5IMLA 3GHBH 4GS7C 3IU3B 1MF2L 2X4PB 5LCVH 3CVHA 4WEBH 4OLWL 5IVOA 3T1WA 1CGTA 3GFUA 4WU7A 1J1PL 1G9NL 2ESVE 3O11B 3GBLA 4OCWL 1X5GA 3UYRH 1JTTA 5GGRY 1YQ2A 5IJKC 3LKQB 4JHAL 2W9EL 2Z9TA 5TE6H 2DIJA 3BGFC 4M8VA 1D5BB 3IDNA 4Y16C 12E8L 2IANE 1N5AB 3AREA 3DI2B 1G6RA 3GI9H 3MQIA 4KDVA 2RIKA 3HC0B 5F9WC 2PW1B 1OF2A 3ULSA 2ZCHH 2IADA 4P4KB 4HBCL 3SDXA 5KVMC 1BJ1J 1QYGL 4Z7VA 5DJCB 4JHBA 1E4KA 2IQ9H 4WV1C 3IDMA 5SX4H 1G6RL 1U8KA 3SE3A 4PV9A 5ESVB 1EAJA 3O3DB 4YDJA 4I18A 3JSSA 3LQAL 1LO0L 3FAWA 4WCYL 4GXUN 5B3NA 5I66A 3F7RA 1A1NB 4Z95L 5HYJA 4F9LC 4XVTH 1FZKA 3QXTA 4LBEB 4M5ZH 5E9DD 1EXUA 4AEIH 5E4IA 5IGXH 4RSVA 4POZD 3T77B 5IVNA 1NMCB 2MOVA 3R0MA 5H35B 4B41A 2NW2A 5ICYB 5DQDH 5JZ7D 1FYTB 4U31A 4W6WB 2XG4A 1CFNA 1IKFH 1PBYA 4HPOL 1Q9LB 5E2WL 1IAOB 3Q6FB 1B4JL 4G8EA 5C09D 3PDOA 3FT2B 3VFOB 3P73B 3U4EA 1I3GL 1S78D 3S5LB 4DGYL 1U2HA 4JDTH 3VXOB 1R3KA 1KB5H 1IGTB 5DYOA 1EEYB 3GJEB 1KPUB 3RIAK 1OP5K 3UBXA 3KWWA 1A6WH 2J88H 3E3QC 4PGDB 4DAGH 1EHLH 1VEPA 4U1MB 2PYEB 3VXTB 1CGXA 5TDNA 5DJAB 2BDNH 2AJUL 3CFCH 1G9EA 4P9HL 3FONA 5TDOA 4F7EB 2VDPL 3OR7B 4M1CD 1T2JA 3MCLH 4S1SH 2NXYC 4RFOL 4YE4H 3MRJA 4GSDL 3JWDC 2GW5A 3EFDL 2X4NB 1P5UA 4NQDE 4NC2B 2PKDA 1MREH 5SX5H 3ULVD 5I74C 4PJ7A 5HI5D 4DVBA 4N0YL 2Q6WB 1CE1H 5FHBL 3GSNB 3LQZB 4OM1L 5A2IH 3KLHC 3VXRA 4XMLL 4U49A 4AEHL 5GRJL 2NW3A 2XY2A 2MKWA 3W0WE 4LCIH 2GY5A 4W4NA 5J89A 2YD1A 1NAKL 4RQQB 3VFTA 2ZSVA 4YC2C 4LU5L 2GJZB 5IBUG 4KMTL 3CXDL 2PUQT 1TPXB 5D7IF 5JW5A 4K7PH 4ORGA 1XCTB 1G7LB 2VDOL 4XGZA 3QDME 1FO0H 1Q0XL 1NC4D 1YNTB 2X4PA 1EDQA 3MLVL 3J8F7 2EDYA 4RMSA 4Z0BL 4L8BB 1C5CL 1A64A 1ZVHA 3NCEB 3Q0HA 5FV1L 4CVXA 4XNYH 4JFEE 3KYKL 3SCMC 3QJFB 1MUJA 2ZCLH 2HJKB 2ZP0T 1Y18A 2Q86A 4M7LH 3LD8C 1D5BA 3IDNB 4NN7B 1FNSL 1JPFB 1ZHNA 3P0VL 5IFJA 4OZFB 9CGTA 3KLDA 4R2GB 3RWCA 1MAMH 1OF2B 3ULSB 1T0PB 4ZXBD 1AO7B 2X4SA 1BWWA 2YKLL 1UB5B 4NZDA 5MEND 4D8PB 3REWA 2FECI 1SEBB 3U79A 4FQ2H 1LO3L 3D0VB 4I2XB 3O2WL 5I1JL 3SGDI 4ZSOE 3IDMB 4ELMF 1PZ5B 2JJWA 4Y88A 5ESVA 4RMWA 5TDPB 4OBRA 4UINH 5FCSH 3HMWL 4ISVB 1UQSA 3GSOB 2LFGA 4WY7H 3OXRB 1EGJA 1MLCB 1ZHBB 5HYJB 5F3HA 2EH7L 3QPQC 4ZXBA 4Q0XH 2B1AL 4WHTA 5D2LE 5TPWL 3K81A 3V0VB 1OAXL 3RUGF 5H35A 4YXLL 5D93B 3DETC 5TH2A 35C8L 2EDHA 3W0WA 4HIIA 1RZGB 1R3IL 5K9JL 4C4KT 3Q5OA 1IAOA 1WLHA 3Q6FA 3VE0A 3BN3B 2SEBB 2ICWI 3CPLB 3RVUD 4EDWH 3S5LA 4PJFF 2LE9A 5E00B 5IW1B 5E8PB 5DEFA 1HQRB 4MD4A 4IRSC 3MV7B 2X05A 2H1PH 1SVZA 2R2HB 4NUJB 3KLSA 3ULUE 4KV5E 1DCLA 1FZMB 2Q76B 1NBVH 1I8IA 1DANU 2PYEA 3VXTA 5EO1B 2OR9H 1A7OH 4KRLB 3JWOL 2G2RA 4OFVA 5FYLE 1TJIH 5I73B 4F7EA 1JZ3A 3VFNB 1A7PH 1T1ZB 4ZS7H 1EZVY 2VDML 4JRYA 3BUYA 1BBDH 4HUMB 1G7JA 2Y5EA 5EB9A 5FGSA 3UTQB 4JKPH 3VXNB 4PJ7B 4L29B 1MJ8L 4X6CB 3GSNA 3LQZA 3ARED 3O6LH 4IJ3B 3S3JA 3RWIA 2W9DH 5F7MC 4ORZC 4LASH 4U7KA 4QT5A 1SY6A 4P3CL 3SO3B 1CLCA 1FNFA 5H2BB 4D0BB 3QXUA 4JPVH 1A7NH 5BV7C 2NY5H 3WUZA 2Z8RA 2ZG3A 1B0WA 4LDLB 4HLZH 1T22A 3FN0L 5DHYA 1CZ8H 4RA0C 1A6UL 4XXCC 1G7LA 2DLTA 3QIBA 2WZPD 1XCQB 2FJFB 3C9NB 1RIHL 4KHXH 4OJFH 5BV7L 1NGYA 5KOVC 2I25N 1DP0A 3V79C 1NFDF 2BNRA 2NY0C 4WJ5A 4YDLB 1X4XA 3O41B 2FR4B 1U3HA 1X5HA 1MUJB 4ONGH 1KYOK 2HFGL 2ZCKL 4RMTA 4XT1C 1EO8L 1A6ZB 2OK0H 3IFLL 4JDZA 3C87A 2X4QA 2B1HH 2MWCA 3WO4B 4JFEA 3KJ6L 3EZ8A 5D7LB 4KTYA 4LVOC 4XVUC 4D8PA 3REWB 4RRPA 4NJAL 1BF8A 4G9FB 1KCVL 5HHVL 3VA2C 1U92A 5CEYA 4G6FD 2Z31B 4PP2B 1Z0NA 2Q8AL 2HJFB 3EO0A 1SYSA 1CGYA 4NKMA 4P23C 5ILTH 4X7DC 1R3HA 4NNXB 3KPRD 3FQUB 3TC9A 4MNHB 4WHTB 3EDKA 3N06B 4URTB 1HNFA 2FX8H 1GPOL 1N8ZB 4YPGB 1HXMA 5TH2B 5EIQA 5JUEL 3MBED 2R0KH 5B21A 1AH1A 4FOMA 4MA3B 4DEPB 4NN6B 1YEJH 1I3VA 3KPOB 1IM3B 4LPWA 4KK6C 1PYWA 5A40E 3IVKA 3CPLA 1GRWA 4LMQI 2GT9A 3QCVH 5EUKA 5J4MA 1VGEL 1ODAA 4MD4B 3PQYA 2WBJD 3RWGB 2EE3A 3OTTA 4PJ5A 4QXWA 1FZMA 2Q76A 4PTTA 1QFUL 1CF8L 3O8XD 5F1NA 4PGZA 4YH6A 5CJOL 2YD3A 4KHTH 1NH6A 2G2RB 2X89A 2QHRL 5MP6L 4C56A 4KQ4L 3JXAA 3QO0A 2AXGA 1BHGA 5DUMH 4ZOCA 4M9PA 4MAYB 2BCKB 4KY1H 4MXQC 4RMRA 3WHXB 4S1DD 4S10A 3UTQA 1N0XH 3CCHA 3RTQB 3HMXL 4ZS6C 2HJLB 2IPKA 4YFEA 2PTUA 3V4VH 2OI9C 3OHXB 5HI3C 2OP4H 2DLFL 4H1LA 2IFFH 1MHPH 1AGFA 1WTLA 2ZUVA 1FCCA 2HLAA 2D7PA 4FFYL 4H1LH 4PG2A 1FYTD 4NT6B 3WKMH 1J1PH 1G9NH 1KNOB 4FQLL 4OCWH 4TVPD 3O4LE 3QDMA 1NDGA 2F53E 4JHAH 2VDRL 3BZ4A 5J7CC 5HVHB 5D1QC 2CKBH 5SWSB 3U4BH 1BVKB 1PLGH 3OKKB 1LDPH 1AIFB 4KKAD 2HN7A 3FQNB 4A2LA 1NC2A 5E1AB 4AIOA 2YEZA 3L3OA 2PN5A 2ARJQ 2VH5H 2P24B 1VCAA 4K7FA 1JGLL 1EBAA 4LSVH 2DYPB 3RI5K 1T3FB 2J7LA 3LQAC 5ID0A 1RIUL 3IFNH 1DBMH 4PGBB 4LSDA 4QLRA 2I5YL 1CBVH 3MRNB 1LO0H 4JFEB 4AZ8A 1CICD 3ESUF 3SEPA 2XQBH 2BVOB 4Z95H 4HC1A 4B7LA 4D94A 2EO9A 1JWUA 3SBWA 3B9KA 3PWLB 2YN3A 3OKMB 4HKZB 5BRZE 2VZ1A 1MOEA 1BIHA 4HPOH 1QD0A 1SYSB 4NKMB 1A7QL 4IMLA 3I9GL 1YC8A 5IOPB 2WIIB 1R3HB 1VPOL 2VYRE 1IKNC 1NCNA 2H45A 5DVLA 3DMMA 5C07E 3TIDA 25C8L 2NX5B 2YMXL 2R1YA 4ZYKB 3PJSA 2PYED 3AU1B 2EDKA 3QIWA 3C09B 4UDUA 4JANA 1UCBL 1I1FA 2EYTA 4W4OC 2QQQA 4PJEF 3WFZA 3U48A 1Q9KB 3WXVH 3U2SB 3AMLA 3CVIL 4LSUL 3VWKA 1P6FA 1PYWB 4PS4L 3G6DL 4JHWH 3G5YA 4DKEH 3HE7D 4GUPB 2W65A 1ED3B 3QEGL 4JG0H 4S1SL 5EUKB 2PR4L 5L8LB 4RFOH 4GSDH 1G7HB 3EFDH 2ADFL 1QKZH 4GFTB 2ARJB 3KXFD 4PJ5B 1I9EA 3VGAB 5ACLA 4Y19A 2VIRA 1N6VA 5D6DC 5GZNC 3GMRA 2J5LC 2CRIA 4W81A 1L7IH 1NPUA 3MLSH 4HWBH 3BT2H 4OGZA 5FHBH 2IEPA 3ARSA 2CDEB 3QXAB 5GRUL 4PJEA 4WTZG 4JO1L 3EHBD 4JZNA 1QPPA 3QO0B 4XMLH 5F8RC 2VZUA 4KI1A 5GRJH 1QR4A 2L0DA 3BQUA 3C6LD 4PRPA 4YK4C 1MI5E 1U8MA 4U2YA 4HG4J 3RTQA 1NAKH 4OLEA 2IAMA 3ARTA 2J6EA 2VLJD 1J9CT 4LU5H 4XXCA 5FGBC 1BQHB 2VQUA 1T89C 3CXDH 1CIDA 4N9GB 1PQZB 4MXVE 4PRAA 3OZ9H 4NSKB 5I71C 5JA8B 1FO0L 1AGFB 3N1GC 3FZUC 4JAMA 1MHCA 1U8PB 2HLAB 3H7BA 1VACB 1DUYA 4KDWA 3CFKA 4NO5B 5F3BA 1I7UB 4LDOB 1NGPL 1CXHA 4H25B 5JR1L 4DGVH 4XNYL 1IGMH 4FABL 5E4EC 5F89B 2C5DC 2VXQL 2OI9B 2VXTH 3ZE0E 5LJYH 3BZ4B 1FNSH 1IM9B 5IB5B 3G04A 4NZRH 3P0VH 4DEPC 1AIFA 5FYJU 4WNQB 2IFGA 2N56A 5AZEH 2YKLH 3B9EA 4OLUH 3RFZC 4IRZL 2YK1H 3PXJA 5KVEH 2CXKA 3AROA 4XP5H 4XH2A 3V7AG 1P2CB 3TH2T 1T1YB 5DHVH 5ID0B 1IKNA 2R0LL 5DEZA 2PTTA 3BSZH 3B9KC 3GMQB 3SKJL 2IH3A 4ZNEA 4WI9A 1ITBB 3GRWH 2XNAA 2Z93B 5ALCH 1V3MA 4WY7L 1KCRL 4E41B 5D8JH 43CAA 3QZWB 4RMVA 1AR1D 1DEEA 3DYOA 3GK8L 4JFDA 4OIIH 4JREB 1YEEL 4X98A 5CSBA 4JKWA 1I7RB 3A6BH 1KFAH 3RGVC 1HKFA 3SBWC 5FYJE 3MCKB 1ZLVH 1N6UA 3P30L 4C54A 3QJHA 4U3XA 5ABDE 4NN6C 4PRNB 4EBQH 5AD0B 4LMQE 3FFCD 3VI3E 2ARWA 3MGTA 1UM5L 3BPNC 1JL8A 2ICEB 5GSVB 4GG6B 2JCCF 1X5KA 2GK0A 1OTSD 1HYRC 1T7XA 4JLRA 4IRJA 1RURL 1JBJA 1HIMH 4LAQL 4KZDL 2XA3A 1F8TL 4X6FA 1N6QH 2VLKA 2R56L 2X9YA 1JZ4A 2ZUXA 1UG9A 5FECB 4HCRL 4WWKD 3U7AA 4GQ9L 3G6JA 4K7PX 4PBWD 5B39A 1NSNH 4N5EC 4XNMB 1ED3A 4YBLB 1OAYH 1UC6A 3O3UN 5E94A 5BV7B 4HGMA 2P45B 4A6YL 1NEUA 1FG2B 4HXBL 4OZHA 3AB0B 3U30C 2VIRB 3VFMB 3SGKC 3WO4C 3LSOB 4MJ6B 2C7UB 1OTSC 2P4AB 5ICZB 2P8PA 2D3VA 4JFPB 1HSAA 2Q3AA 4G8IA 5JIIA 2H8PB 5C0CA 1JZ2A 4OZFH 4P99A 4WO4B 4YDLC 4RISL 3ZKXC 1R0AL 4LASL 1NLBL 3GSWB 4YXKH 4PRPB 4P3CH 1PX4A 3IKKA 3KPLB 1TIUA 2CQVA 4UOW0 5D6CB 2IAMB 3F6IA 3UJTH 4E42B 2FX7H 4U7SA 3IJYB 4ZPVA 3RDTC 1W72H 1A6UH 4ONOA 4XPTH 4NSKA 1U8LA 1XH3A 5GRZA 2XXMB 5ANME 1UH3A 4OJFL 1X3DA 4QRSB 1T7YA 4MX7B 1U8PA 3EYVA 5DFVC 1KJ2A 1P1ZA 1WAAE 3ILQC 3I6GB 4OF3A 3ETBF 4NYLA 3T65A 5KVFL 3QI9D 1KLUA 4JM2F 4ONGL 4IJ3C 2ZCKH 1U8OB 2HFGH 5KG9A 1U8NA 5I1DB 5L2JA 1EFXB 3OJMB 3WNLA 1UJ3B 5EULV 1MLBA 1IM9A 5GGTH 3DMMD 3P9LA 2MKLC 5CLWA 1FIGH 1BQLL 4YHOH 5DFVD 1NFDA 1DUZB 4H88H 5EPMB 3W5MA 3RZWA 2UY7A 2AXFA 3QP3A 2AK4B 1SJHB 3TPKA 1VFAA 4K94H 4OGXH 3TN0A 2Q8AH 2A6JA 1GZPB 4HZLA 1SM3L 4C55A 2XPGA 3RZCA 4EZMA 3Q1SL 3BKMH 1YYLL 3SO5A 3RAJH 2A6KA 4IRSB 4PD4K 4B0MM 4JFDB 4MCYA 3NA9L 4C57C 3GMMA 5HYEA 4NQDA 3D0LB 2FEEI 5B3JF 5IUSA 5JUEH 4XAWH 1XGRA 3NPSC 3IF1A 1S9XA 3KPSE 4RX4D 3MXWH 2J3SA 3TT3L 1AE6L 5CILL 5F1IA 1IT9H 1G0DA 4Z7VB 1VKXA 1F42A 2DM3A 1Y6KR 4MNGB 1U8KB 2X42A 4AL8L 1DEDA 2GK0B 3FB5B 3S4SG 4BZ2L 1Z6JT 4R9HA 4F9LA 2YZ8A 1HNGA 3T1FB 4OTXH 1FZKB 3DWTA 3MRDB 3VG0L 1CF8H 3MLPA 3IU3A 4LHQB 4MJ2A 3T77A 3W9EA 4Z5RB 1GGYA 1K4DB 1FYTA 3DLQR 5KS9B 3HG1A 3V52H 2QHRH 4HS3B 1Q9LA 3T3PE 2NXYD 5KAQG 1FNEA 4G8EB 3VGFA 3P73A 4KY1L 3P4NA 5DUPL 1N0XL 4RRPG 3BD5A 2PW1A 3T3MF 3HNSH 3CUPB 3H7LA 4R90H 1HHHA 2DLFH 2O61B 5T1MB 4J6RH 5IJKA 5GIRB 4ZFGH 2M1KA 15C8H 4O2FB 4WWKC 1E4WL 5DLML 5J6GB 5IWLA 3WKML 1T2QL 3FONB 3KNBB 3IDYB 4PV9B 4PJIE 3ULVH 4OI7A 5DMGD 4EQ2A 3MNVB 4P4KC 3HB3C 2VDRH 4UBDD 2AKRA 1FL6B 2LV4A 1B0RB 2CKBL 5J57B 3V4UH 3BWUC 4D9QE 1PLGL 4GRLC 1PAMA 4DTGL 4DVRH 4P59L 1LE5B 3K46A 4UNTA 3EYUH 2YA0A 2IWGA 3TM6A 5TGBB 4HPYL 4XHJC 2VR4A 2NW3B 4LARH 4P2OC 5T3XE 3ZDYF 1HXYB 3TGXA 1RIUH 1DQDL 3IFNL 1ZGLM 1CD1A 2VDKH 5F7FA 3W5NA 5IG7A 5J1TC 1CBVL 4Y89A 1MJUH 3ALXA 2GIYA 1OTUD 2Y5TB 3BP6B 3VXOA 3VD9A 3IRZA 5CD3A 4MA8L 1T66C 4D0DA 1OB1B 1RVFH 4LEXL 2K7PA 4JFQA 4FQ1L 5AYQA 1FFNA 1NMCC 4OF7A 5TDNB 2AK4A 1BVZA 5DZNA 4JFYB 2A6JB 2DLEA 3UX9B 5TDOB 1Z5LB 2EXYC 5CJ8A 4L9LB 2HMIC 3MRLA 3RHWF 3I9GH 4KZEH 4PJAB 4XWGL 2HJKA 3GO1H 5D7LE 1NFIB 4PRPD 4U3CA 3T09A 2A6KB 3EW3B 25C8H 3U4AA 5C0RH 3TA3B 1I9JH 3DOSA 5I19L 2H6PA 3D0LA 1ZT7A 4BKLA 5HGAB 3SHSA 1G84A 3O3AA 4K8RH 2YD5A 1WZ1H 1BZQK 4OF6A 5J11C 3MRGB 1S9XB 5EA0H 1MWAB 4JZJC 5C0JB 2APVA 1SEBA 4GQPH 5F1IB 3MRBB 4PY7A 1UGNA 3D0VA 5KSAD 3VA6A 4I2XA 5K9KA 5KTEL 2WM0A 3G6DH 3SGEH 3UBXG 2ORBL 2ATPB 4MJID 1FO0B 1P7KA 3V6OA 4GMTL 4R96B 4ZTOL 6CGTA 5EU6D 2R15A 2FBOJ 3GZKA 2ZUYA 4DCQA 1KJ2H 5F3HB 4Y1AE 2VLRB 1C5DB 3MRDA 1FNGA 1XF5B 4RA3A 1LO5B 4UQ3B 1J1XH 2CKNA 1FL5B 4HWBL 4JN1H 2DM7A 3VXUD 3KJ4B 1YEFL 5D2LB 4JO1H 4HUNB 2EDQA 2XV6B 3QJFA 1P7QB 3CU1A 1S7QA 4CNIA 3BAEL 5E00A 4U7MA 4FFWD 4K55A 4XVSH 1F4YL 1ZHNB 5IFJB 4OZFA 2EDJA 3TVMD 4PRIB 2E3VA 2P5WB 2R0ZH 3BMWA 3MV7A 4ZO7A 3UTTA 4NKDB 1HHHB 3OJ2C 1AO7A 2X4SB 1UB5A 2DMBA 3NTCH 1QRNA 4I3SH 2AEPL 1MVFA 4LHUG 1AO7E 3SGJC 4I0PC 5EO1A 4OFKA 4P23D 2PO6B 4LSQL 3O4LD 3FTGA 4JFXB 1UZ6E 1NGPH 2DM2A 1X4YA 5JR1H 3HE6D 3KNBA 3SQOL 4DGVL 1IGML 1TVHA 1OCWH 4OCNC 3GSOA 1T7WA 2DQJH 4PLJD 4HLZG 1FL6A 3STZA 2CMRL 3IJHA 2A2QT 1GCFA 3EBAA 1DN0B 4JB9H 3L5WA 5AZEL 4OLUL 2FL5B 2O5ZL 4HIIB 3TBYA 2DLIA 3CD4A 3MV9E 1ACYH 5IHUH 1R5IA 3NABH 4KH2A 4QT5B 3ARPA 2R0LH 3MX0A 3BSZL 5IG7B 3PHQB 1MRDH 5EORH 5E8PA 4CVUA 3BP6A 3QDHA 4UDTB 1YNKL 3FB6A 3PV7A 3MV01 4GAJH 2XIDA 1YEEH 1I8IB 1U42A 4GRLB 1KFAL 2PW2B 1MRCL 3VDCA 1E6OL 4S1RL 4NCC2 1I1AB 3I02B 1WWCA 1W8NA 3WIHA 4YFLF 3NA4A 3C5SB 1S5HA 1BZ7B 1HHGA 5MERB 1MCPH 3MRLB 3HKFA 4PGCB 3V6OC 1RJZB 3TYGH 3NPSB 1UM5H 4HJJL 1PDKA 3BUYB 4G7YH 3UTTE 3A67L 3QNXB 4DKFH 1L6ZA 3PG2A 5J8OA 1ZHKB 4MJ4A 4J8RB 3DUHA 1RURH 1RZJL 4GT7A 3O3AB 5DGQA 1HIML 4LAQH 5DJ2B 1T0NA 1DQLH 1N6QL 2AI0H 1QR1A 1KF9B 2KPNA 4QYOB 1BFTA 2R56H 3QSKB 5HHOD 2DJUA 4POZC 1EJOH 2OJZL 2VQ1B 3C8HA 4HCRH 5K9KB 1HYSC 5FO7B 2IGFL 3E8UL 3DPBA 3MLZL 4NUGL 4UMGA 1LGVA 1ZMYA 4D0BA 1DR9A 2WIMA 4O4YL 3UTSD 3IDJA 2H9GB 1OAYL 2VLME 1BJ1H 1FP5A 1T22B 5B3JE 2JKXA 4A6YH 5JW4N 4HXBH 2JELH 3T08A 5C0BD 1D5XB 4U1KA 1LO5A 3DX9B 4UQ3A 4G6AD 1MFEH 3CX5J 3ZTJG 5FYKE 5BO1H 2DJSA 4OKDA 3CX2A 5D2LA 5ECJE 4K3GA 4QKXB 2DQCL 5JMRA 1MCFA 2F5AH 4RISH 1P7QA 1CDGA 4YXKL 1BFVH 2ED9A 1KJVB 4BUHA 5GGVH 2EDRA 3RPKA 4Z7QE 5B38G 4MYWB 3UJTL 3LEXA 5C6TH 2P5WA 1A6TB 1RULL 3U1SH 3UTTB 2EDLA 4JPKH 4P2QB 4Y4FC 3RUGB 5CBEB 2F54D 4PTTB 1KIRA 5IB1A 3QR2A 3JWNC 5I6XC 3MCG1 3K3QA 2VDQL 2Z31A 4C58B 4M5YH 3ZKXB 3D5OF 2C3VB 3K2UH 3T4YB 1TVHB 1NBYA 1RHFA 5CGTA 4KWUA 2ZUUA 4B5EA 2HRPH 3IT8D 4Y5VB 2A73B 3PIQA 4YQXH 5JW3H 5I0ZA 1K8DB 5DO2C 1P69B 3MLRL 1BQLH 1SMAA 3L5WB 3L5JA 5GGQH 1K3IA 2RQ8A 4H88L 5F7DB 4AM0A 4U1JA 1IEAA 1OAQL 4MA3A 1OGAB 3L3IB 3P9MA 3QHFL 2MQ0A 1IM3A 4D9QD 2R1XB 3PGDA 4YNYB 5B4MD 5GRYA 4IOFD 4NT6A 4X4ZA 4OCYH 3VW3L 2F53A 1KNOA 1SM3H 3HRPA 4QHNB 4X8XA 3B5TA 3KYOB 4WUKH 3QDMB 4XP4L 3BKML 2QADB 4UDTA 4LCCB 2GSIA 4XC3H 2AV7A 3HAEG 1ZLUK 4WENB 3TZVB 4L8SA 1LDSA 1MNUL 4F3FA 1YDPA 5M94B 5KSBE 4DN4L 3BPNB 4XAWL 5EBLA 4X5XA 5CD5D 3S36X 1DLFL 4JFDE 3TEUA 1KPRA 5MERA 2EDTA 3U7WL 2P24A 1IT9L 4PJAE 1AHWA 5LGKA 5C1MB 1NLDH 5CIPA 1GH7A 1XF2A 1FJ1B 3QWRD 1RJLB 4TNWK 1A4KB 4AL8H 3PABB 2HJLA 2IPKB 2NY3B 3BIAX 4HEPG 2AJSL 3BZDA 5DR5H 1MFBH 4NQVB 3QDJE 3C5ZD 3ARQA 4JQXC 5DJ2A 3EOAA 4GW1A 4KK8D 4H1LB 4OTXL 2ZG2A 5F93C 3VG0H 5HDBE 4UV4H 1IL1A 3NIDF 1CDCA 4M6OL 4XC1L 3V52L 4RGOH 1N2RB 4HFWB 1DVFD 2H9GA 3B43A 3BDYH 5C9KA 5DC4B 2JK5A 1NDGB 4HCRA 3EJYD 4JO4L 1HWGB 3O0RH 4JRXE 2PXYD 3NZHH 3VXMB 4L4VA 3U82B 3DX9A 5DF0A 5KJRH 5HGBA 3MROA 5DFTA 4QWWD 4UDUB 4JANB 1A6VH 1AR2A 5E8EA 3RHWK 2XG5A 1AGDA 4O5LH 1WTGT 4U6TA 4K7FB 5DD5H 3LEYL 1IQDA 3CFJA 4R7DA 3MJ9H 1B0GB 2DYPA 4MS8C 1PX3A 1T3FA 5DTFB 5HGDA 4EKXA 4NP4L 3QZWG 4M7LT 3ULVL 1ZA6A 4WEUD 2NXZC 4ZUWA 4XBEL 4G9DA 2BVOA 4KGJA 5D1ZB 2ARJA 2C1PA 4TVPE 4R4ND 1KIRB 5IB1B 2J8UA 1JWUB 2B5IB 3GMRB 1I8LA 3V5HB 2B2XL 3DRTB 3OKMA 4HKZA 5FHAH 4DVRL 4RNRA 4PJEB 1ZV5A 2C3VA 1QBAA 4IMLB 1NBYB 3D18B 3FQTA 2WIIA 4PJXA 2Z4QB 5T3ZH 5J9PB 3FHAA 4QO1A 3I2CL 4DGIL 4NZUH 4Y5VA 4XP9L 5D7SH 3EJZC 4XI5C 1PEWA 2UZIH 3AU1A 3QIWB 1K6QH 3MRHA 3BOVA 1I1FB 1PQZA 4QCIA 1QBLH 1Q9KA 1RVFL 1SQ2N 1F2XK 4Q2ZB 1JRHL 1DQMH 5CHNB 4OLZL 3HE7B 4G42B 3RVUC 1OLZA 1RZIB 4G8FB 2H2SC 5AWNH 5I1KH 5LQBH 4LVEA 2HRLA 1U3HC 3OB0K 2ZOKB 3QDGE 5HGHB 4L4TE 3QUZC 1VFUA 1FC1A 4TRPH 5SWZB 5FV2A 2GSIB 3I84A 3O8XB 1GSMA 4HQQL 3TZVA 1I9JL 3ZMRA 5I19H 1YMMD 2HVJA 1PD6A 2R0WL 4Z7UA 4ZO9A 3UAJC 3HNVL 1YECH 5EU4A 1RHHB 2ZPKH 5EBLB 4Y16D 2J8OA 3OAZH 5MHSE 1J0ZA 1HK6A 5IQ9A 4GRWB 5EA0L 1CVRA 2XZAL 5TJWK 2JB5H 4HUXB 3MBEB 3BQUB 4K3EH 1AHWB 3WFHB 5IQ7L 1P2CA 2R4RH 3TN0C 1RJLA 1A4KA 2RGSA 3GMQA 2IH3B 3H3PH 4M1CC 1WFNA 3C6LC 4GMTH 4ZTOH 3WS3B 1BAFH 4NQVA 8FABA 4RAVB 4ZO6A 5HHMB 1FVEA 5MENA 3QUYC 3AVEA 4L5FL 3FFCE 3H7BB 4JN1L 3LKRA 1I7UA 4Z76A 1JPTH 1AD0A 3QG7L 5JORB 5F7NC 3OKLB 1JZ6A 4PRNA 1N2RA 1WIUA 3MUY1 2KZWA 5F89A 2WUBH 1WCQA 3QCTL 4LLMB 1NUFA 4NOFA 1XGQA 2EH8H 4OUUA 2HFTA 4XVSL 1F4YH 1F6LL 1YEHH 4MAYD 2D9CA 5HVHC 2IMMA 3MROB 4S2SB 2C4FT 2HT2C 3CDGA 2CUIA 3HC3L 4PLOB 1KENH 3STBA 5CZKA 5T1DH 3RDTA 1UACL 1MFCH 3OR6B 1AGDB 4MLIA 4X99B 2DQHL 3UXFA 3CDYA 4YUEH 1T1YA 4OCRH 3VH8A 3SQOH 3GBML 5KANG 5B39B 4JVUA 4XNMA 1ZA6B 5E94B 2V5YA 4N8VG 4HX1A 5MHSD 3ECBB 3M17B 3LY6A 3WFEH 3FZUD 5TFSL 1GJIA 2C1PB 3U7YH 3GJFA 3KPNA 5DMKA 5I18L 5D7JA 1SJEB 3O2DA 1QFWH 5HSFA 3KXFA 1FBIH 5DD0L 4JFPA 2HTLD 5E9DB 4F15C 3HC4L 3MBEC 2EYRB 5TF0A 5IHUL 3TYFB 4X9BA 4JY5L 4PJXB 1D5ZA 3GSWA 2GK2A 2CK2A 3NABL 3FOLA 1CFSB 2X1WL 5C2UB 4YHLL 2H41A 1SYVB 1MRDL 4L1HA 3DUSB 3QAZC 4JLRB 4P5TA 1KCLA 4MD5B 4X7CC 2DIBA 3L3KB 2ED7A 1YNKH 2X41A 2XZZA 4NJ9H 4HULB 1U8LB 3CNKA 1SY6H 4GAJL 3VXMD 4M1GL 1MFDL 4UI2A 5ID1B 2F15A 4QRSA 2C3HA 3RKDC 4KKLC 4OV6F 5EZJA 1F13A 1E6OH 4S1RH 1KJ2B 3ZYIA 4N8CL 3ULUC 4G8FA 3GGWA 3L5HA 2DICA 1FL3A 3PWUA 1NAMB 4CDHA 1OP5H 4NYLB 1AFVL 1RU9L 1U8OA 4HJJH 2AABL 5BW7C 2WQ8A 5ETUA 4L4TB 5SWZA 1FG2A 4G7YL 4OZHB 4N0FA 3D87B 4OAWA 1A3RH 1GVIA 2A6DA 1JPSH 3P9WB 5DVOA 3X11A 4KDTA 4X5WA 2FB4H 4B7IA 2BRRL 5FYLD 1HSAB 1DQLL 1TNMA 2A77L 2AI0L 4MQSB 4HJ0C 4X6DE 3OAZK 3LEVH 1KPVB 4WO4A 5CEXB 3C6LB 3RIAF 2DI8A 4RGND 3PE9A 2Z31C 1VFAB 2IGFH 3E8UH 2VDNH 3TN0B 3MLZH 5IB4B 2LAAA 1P4BL 3MGOA 5JXAH 2XPGB 1KACB 4E42A 1OT1A 4Q9QH 3IJYA 2Q1EA 3K2MC 2JELL 4AY0A 2GITA 5I8EB 3L3GB 4DUXA 1HHJA 4NQDB 1NBQA 3MRRA 4PJCE 2EIBA 1A3LL 3WNPA 1MFEL 3EYVB 1HEZB 4NQEB 1WITA 4CVZB 1FV1B 5BO1L 2Y23A 3O8XC 2V5TA 2DLHA 3OKLA 4HMCA 1FFOB 4DW2H 3NCBB 1KIQB 4LLQA 3GSVB 3PWNA 4QTIH 1VKXB 5EOCJ 1C08A 1BFVL 5E24E 4MNGA 4OUUB 3KPSD 5F9OH 3H3KA 3EJJX 1J05A 1UKTA 1J1OL 5FKAA 4ZFOB 1RULH 4AT6A 1KJMB 4BQCA 3PWJB 2UWEE 5I1IH 4TTDC 1NGQH 3OR6A 1NGWB 1DQQA 2AXFB 1A47A 3OJDB 5AG9A 3RPIA 5E1HB 1UH4A 4M5YL 5KS9A 3MSPA 3PWPD 1GZPA 5DJXA 5DHXB 5EFIB 4J2XA 3B2UD 3GBNL 2ZKHL 1HN1A 3NMEA 1ZLVK 4QY8B 1EO7A 2E7LC 3H9SB 4E41E 3QIUC 4G6ML 2A0LD 1N5YL 1M05B 2ICWA 3MXVL 5D7JC 1U3ZA 3QQ9D 3THML 1EVUA 1WISA 3DGGA 1FLRH 3HI1B 1YMMA 3IF1B 4PJXE 4BH7B 5EO9A 5DJ8A 4Y2OA 3QDJB 3QHFH 4O2FA 3AFLA 5F21B 1V7NH 5C0CD 3U0TB 5BRZB 1E4KC 2V2WB 1KV3A 3I75B 2AEQH 3E3QE 3GMPA 4OCYL 4N0UE 3BO8B 3LKPA 4PJ8A 2BSTA 4DN3L 4XP4H 5D1QD 1T66D 4MD5A 3HG1E 3T1FA 5KS9E 4FQQA 1AXTH 1RUPH 4XBPA 5ITBH 1A0QL 1WCBA 5HYSG 4DN4H 5LAXB 3RI5F 3PWUB 1MJJA 2XXCB 1ZGLP 3AM8A 1FH5H 2W07A 1HZHH 1HXYA 1NLDL 5D93C 3RP1A 3PWPA 4X6CF 5DR5L 1MCKA 2GQHA 5CD3B 3CMOL 3T0BA 4MNQB 3S34H 2OMBA 4D0DB 4LRIC 5T1MA 1OB1A 4M6AA 2ZJSL 5GIRA 5D2NB 5CEXA 3C6LA 1Q8MA 5B4MC 1NCBH 1CQKA 1DQJA 4MZ3A 1UA6L 4JFFE 2FEEL 5J6GA 1CU4H 2P8LB 4GMSL 3DROA 2NYYD 4M6NL 3PP3H 5D96B 3V5KA 3BDYL 4LF3B 4K9EH 1CFTB 3MNVA 4PJAA 5DD1L 5INCB 4ELMB 1KEML 4YBQD 1NFIA 1X44A 2B20A 2CLVB 3MOAH 1KTKE 2AKRB 4PGJA 3NZHL 4PJHE 2YD7A 3L3GA 1G7MB 1HHJB 5CJXC 3A6CH 3MRRB 5C0BE 1DE4A 1MI5A 4V1DE 4HK0A 1MWAA 4KQ3L 5TGBA 2JJTA 5KAQF 4LLQB 4O5LL 3LEYH 3KPQA 3UZVB 1C08B 5E9DE 4M6ML 2XOTA 1HQ4B 3VXUA 5L8JB 2CKBB 2YPLD 4HWNA 3U9PH 1BLNB 4C4KO 1FO0A 3SKMA 1XF3A 1QFOA 2NX5E 2JCCE 5HGGS 3H8NA 4DCQB 3L95B 1DDHB 3RU8H 5JHDB 4OSUH 4UQ2B 4PJGA 4JFQB 5LKNA 2XTJD 4FG6C 4D9RE 4EXKA 1DQQB 3OJDA 3DVNB 1YY8A 2V5RA 3BPCA 3VG9C 1WIOA 5FHAL 2CK0H 3LKNB 5I17A 1EMTL 4WEMB 3W39A 4ETQA 3MRPA 3S3PA 1W2KT 3ULVF 1FFRA 5DJXB 2EC9T 3HR5B 1WFOA 4ZS6D 3FN3A 3LKQA 4HWEL 5TE4L 4QY8A 1WBZB 1OT2A 1N64H 5T3ZL 3TBWA 4WI3A 4GRMA 5J06A 4NZUL 3IB4A 3O3EB 3EO1B 1ZT7B 5HGAA 5JXEC 1WEJL 3RKDD 4DOHB 3ARYA 3NN8B 3BDXA 2R2EB 4K71B 4XHJD 5C0JA 5DJ8B 4JJHA 2KZ1B 4NQDD 4QNPF 1JRHH 2PO6A 5EUOF 3VFUB 3TH4T 3WKNA 4PJDA 4HJGA 4PIRF 5IROA 5F7KC 3BKJL 4YBQC 2AK4D 5LGJA 4LIQH 4YDJB 4N0UB 2BSTB 1XF1A 1A1NA 2NZIA 3NOIA 3VDBA 2QEJA 2VLRA 3STZB 4LBEA 5EUOA 2BNRE 3HUJF 3LKSB 4EN3B 1CXEA 2IALB 2OJEB 3KPPB 4HUVA 2G9HA 4YFLI 5LAXA 3TP4A 3F62A 4P2YA 4YC2B 2XZAH 5EZOH 3TBYB 4PJ8D 3VFSB 2JB5L 1MY5A 4K3EL 3IDIB 2R4RL 3U4EB 2BHUA 3PWPB 3UJJL 1MHEB 3K1KC 3QEQE 3WLWC 3H3PL 4RFNB 3KPMB 3VXME 4HIXL 4BFGA 3Q6GL 1G6VK 3RDTD 4PGDA 5CWSB 5L2KE 3ZDZE 4ALAL 3QPQD 4NBZB 3K8MA 5D2NA 4JPIB 4JFOB 2OM5A 5E6ID 3SKOA 3QG7H 3ULUH 3ARRA 3C5SA 3H42H 3V5KB 3CSGA 4PGCA 1RSFA 3QDJD 1CFTA 4FTVD 4LGRB 4NRXA 1TETL 2X4NA 2EH8L 5EZIH 3QO1A 4J12A 4YFDB 1OHQA 4KK5D 3T0EE 1N59B 1YEHL 1ZHKA 2GJ6D 2X44D 1JMZA 5IFAH 3HC3H 4XMKH 1L0QA 1KENL 2VN7A 3DYPA 3CLEH 3HCVB 4U1IA 5T1DL 4LVNB 2V5SA 2D4FA 1PKQE 1AGBB 2COQA 4J23A 5LBSH 3TA3C 1YEIL 1BGXH 1CGWA 2Y6SC 3OWEA 1IC7L 3WDJA 4OCRL 3LN9A 4PJAF 2P5EB 4A2MA 3ZZ1A 4KKBC 1S7RB 4J1UB 5L8KB 3WFEL 3FB6B 5JW5B 4LEOA 4JY4A 4Y2DC 4XPFH 4U1KB 5I18H 1NDMA 5D4QA 2VNCA 1FBIL 3C6SA 2VLKE 3QHTC 4I77L 4Q6IB 5GGVY 1S7VB 3W39B 4O9HL 4ETQB 4L8BA 1S5HB 1BZ7A 2HG5B 3DXAA 4YIQB 4HBQA 1JNNH 4BFBD 5MI0B 4JY5H 2DQTH 4CMHB 4M7ZB 2F54E 3PGFL 2Z31D 3TBWB 2LU7A 4KVNL 1Q1JL 4EOWL 3VD4A 4ODWA 1F4AA 4YDIH 4HUWB 4FQXB 1BD2E 1PY9A 2R2EA 4M1GH 4YHKL 4QYOA 1T0MB 4TVPH 4X9FA 4TSAH 4HS6A 3O6KL 4D2NA 1GZQB 4L1DA 5C09A 4FQIH 5J0BA 1NMBL 2I07A 4DZ8B 3DO7B 1KN2H 1RU9H 5C0BB 1N4XL 1JNHA 2AABH 3GI8H 4NGHH 4MHHI 3TJHD 4ZXBB 3HUJE 4QHKI 4EN3A 1JPSL 1F4XH 3UTSE 1JYXA 4PJBB 4B53A 1LD9A 3P0YH 1AJ7H 4UT9L 4AM0B 4JGUA 2FCBA 4U1JB 3LEVL 3DETD 3DX7B 3VFSA 2PNDA 7CGTA 5T5FH 3HZMA 1YMHA 5IW1A 3R06B 1S9YB 1T2XA 5IT2H 3S35H 5DEFB 2F54B 3KPMA 3QCUH 1F11A 5J3HD 4P2QA 5FYKL 3HNTH 4LSRH 3WDIA 3MLXH 4XXDA 4Y5YC 1YDPB 1CT8B 4WUUD 4X5XB 5E2UH 4LQ1A 3IFPA 4R97C 1JNLH 2BERA 4DW2L 1GGUA 3T4YA 1Q0YH 3AY4C 1CVSC 5C2BL 5CIPB 1XF2B 4M7KL 4K8RD 4OQ1A 5F9OL 5CINL 2A73A 3PIQB 5E2TL 3WFBH 4QRRD 5A2FA 3BJLA 4L29A 4KJWD 4HZAA 5DMIL 1IFHL 1T04B 3EOAB 4GW1B 4PJIA 1ZHLB 5FKPB 4UZGA 3P77A 1RUAH 3UPRA 5I1IL 5CJBA 1IL1B 3MACH 1TDQA 1H8NA 4XPGH 4H5SA 4YPJA 2Y4SA 1A8JH 3MNWA 4HFUL 5I15L 2R1XA 5C0GA 4I0KA 1LEIB 2F53B 4NQCE 3ALPA 2VLKD 5DHYB 3MLWL 4F80A 4LSSL 3VXMA 3LB6D 5I0DA 1N5YH 4PRHD 4L8SB 1F90L 1TZGL 1NDMB 1FYHB 3THMH 4G8GD 4Q6IA 4G6KH 1GGIL 2BNRB 5JNYA 2LAGB 3O9WB 3O41A 2IJ0C 1EHXA 3OGCB 1NC2D 1IQDB 1ZSDB 3CFJB 4R7DB 4FNLL 4MXQD 5E56A 2AGJH 5SX5K 1CTOA 4FFVD 4G5ZL 2AEQL 5C0IB 4FQHA 5I75C 4DN3H 3OG6B 1F3DH 4UT7L 5D1ZA 2WSKA 4XPHL 5D7LA 2E8ZA 2NX5D 1T0MA 3PGCB 3V5HA 3CDFA 4HS6B 3WN5B 3P0GB 3S96B 3VI4E 2E7LA 3IAPA 4GH7B 5IB2B 3EGSB 3SE9L 1CL7H 2HJFA 1KEGH 3EO0B 3DO7A 1UVQA 5FCUL 1FH5L 3SJVA 4HC1L 1HZHL 4MXWH 5C0BA 5D96C 1JNHB 4J3OC 4WTZA 5DMYA 1OD9A 4NFBA 4L4VB 4PP1C 2P5ED 5HHME 1N8ZA 1Z9LA 4WO4C 4JM4H 1O0VA 3N1PC 5KN5A 1FYTE 2EDNA 5C6PB 3CMOH 3MRHB 2D7OA 1OAZH 4G6FB 4LQFH 1IRAY 1F5WA 4Y5XC 2DOCA 1P4LA 1MCWW 4ZUVB 2ESVB 1QP1A 2YD8A 4G42A 1JF1A 1UA6H 2VRAA 3ZHDA 5HGDB 3MO1A 1YMHB 3R06A 2ZOKA 2GT9B 5ISZE 1O7SA 1DBKL 4J3SA 4K9EL 2HKFH 1EBPA 4XMPL 1KEMH 3F58L 3OBAA 1F45A 3WNOA 1BD2D 4LCYB 5F1NB 2J8UB 4NCC1 4NHCL 1UXWA 3ZHKA 4XNQB 2AJXH 2VLJB 1U8HA 3SKUD 4WI6A 1VEOA 3OF6D 4PLKC 4C56E 3RX7A 4I2XE 5IQ9B 2RCSL 4YDKL 1IGCH 1UZ8A 2XKUA 2NY1C 2DQEL 3FQTB 3MBEA 1BM3L 4KAQL 1HI6B 3PXHA 3V6OE 3O6ML 3U9PL 3QI9B 3JWDL 4JVWA 3N50A 4WUUE 4ZFZB 4MA7H 4WI5A 4YWGL 4J3WA 1T04A 4KDTC 4Q7DA 1FVEB 4FRWA 4OSUL 4QCIB 3RWFB 3P77B 1EAPB 3UPRB 1KIPB 4HS8H 3TBTB 1EGJH 2M26A 3HE7A 3LKRB 1MVUB 4F9PC 4Z76B 3VWKC 2ZSWB 2DDQH 5C0GB 1LEIA 4YHYC 4APQB 5HGHA 4BM7A 1WWWX 1ZWIB 4XCEB 5TE4H 3MZTA 4KXZI 1NUGA 3QNYB 4GKZA 4ZUSA 2R8SL 5F71A 1MEXH 1BVKA 3BW9A 3GSRA 1RHHA 3KLAA 4QXGL 1WF5A 4P5TC 3RDTB 3O9WA 4XX1G 3V8CA 4Z77A 4FTVE 3KGRA 3QQ4B 4X99A 1ZSDA 5FM8A 1WFTA 5HHXH 3WFHA 5B8CC 5IROC 4BK5A 5HPMB 4FQHB 2F8VA 5EG6C 3MRNA 4MDJA 8FABB 3ECBA 3M17A 5CJ5A 3FFDA 4M4RA 5GSRB 4KK5C 1UWXK 1RAMA 4XAKE 1AGEA 3B9KB 2QBWA 4JQIL 5KW9H 4G9FE 3RJDA 2LTQB 1KYOJ 3O4OB 2X4UB 3AB0C 1AD0B 5JORA 1JYWA 2EYRA 4S1QH 3SJVB 4WUUA 1D5ZB 1K8IB 4F37F 4P46D 1CFSA 3VRLF 4WW2C 3UJJH 3T4AB 3VRLE 4TNVK 5L6YH 4AG4H 1X5ZA 4FS0A 4XNUL 1KG0A 4TQEL 4R26L 3VWJA 3VXSE 3QIUD 4NRYA 4FZEH 1JV5B 4NRZB 1SVCP 3CDGB 4H0HB 2EYTB 3HN3A 3CU7A 2ITDB 1I85A 3EYSL 4L3EE 4ALAH 5ID1A 3GHBL 4RBPK 2ZUSA 1IGJB 3G9VA 4X9HA 5F6HI 2CIIB 4OLWH 3VGAC 3GGWB 1X7QB 3ARBD 3V6BR 3ULUL 2A1WL 3VH8B 4XVJL 3G5YB 3B8YA 3IRPX 1JWSA 4ODXA 4OF8A 1EUTA 4GG8A 1G7HA 4PJFE 4HX1B 3U36B 5EZIL 2MHAB 5TE6L 1CLZH 4BQBA 1LP9E 1FGVH 4OAWB 12E8H 4LCYA 3GJFB 3KPNB 3GI9L 5DMKB 5D7JB 2QSCH 1SJEA 5KOMC 1LNUB 3RGVB 2DI9A 4XNQA 1OARH 2FLBT 3HZKA 5IFAL 1H3PH 4HBCH 5DXWA 3BEVB 1CFQA 1VHPA 3WUWG 4CN6A 1N26A 1UZ8B 1GOFA 3EYFB 5ESAB 1B3JA 1BGXL 1HI6A 2IQ9L 2JJUA 3MV9D 5IB4A 1T03L 1GHFL 2R23B 5EBGA 2FDBP 4LPXA 2OCFD 4V1DD 1A21A 4N9GA 4XVTL 1U8JA 5DFWH 4CKVX 3ZHLA 4PLJC 4KJPD 1TXKA 3MUGA 1VACA 2YD2A 5EZJB 4IOFC 3T0WA 4KVCH 4NQEA 4WVRA 2J6EH 4I77H 5F3BB 1NCAL 1ZT1A 4CVZA 1KULA 3RL2A 4D9RD 2ZSWA 1NAMA 1B90A 1IKFL 1EFQA 1FFOA 1PKQA 2DQFB 5E2WH 5DA0B 3QEQA 3QEUA 1B4JH 4XCEA 2WUCL 4L4TA 3PGFH 4HIJA 3S37X 1I3GH 4JGJA 2DQGH 4KVNH 1RZKC 4ZUSB 1Q1JH 4EOWH 2A6DB 1AQDB 1QHOA 3MJ7A 2OS7A 1I85C 1H15A 3PWPE 4X5WB 1IZKA 3W0WD 4TNVF 4FFWC 3U83A 1EHLL 1KJMA 4NM4H 1CFBA 4JFDD 4YHKH 1KPVA 4TVPL 3QQ4A 2D4DA 4WW2A 3V6ZA 4XH2B 1CGSL 2AJUH 4C59B 3BYTA 1QBBA 2XQYK 1NMBH 1OVZA 3FCTB 2DKSA 2CDGB 1KN2L 5EFIA 4CN1A 4XZUA 5IMKA 3BJ91 2VLJE 2XNAB 2Z93A 1N3NB 3GI8L 2FYYA 3D3VB 43CAB 4O2EB 3EJYC 1F4WL 1PSKH 2GITB 5I8EA 3H9ZA 1AGEB 4NWUL 4ONHB 4NKQB 4N0YH 1B2WL 5C0DB 1CE1L 1IVLA 3SJVE 3HI1A 5JIKA 1FV1A 1YMMB 4PRPE 1CDJA 1CL7I 2H2PD 4ZOAA 5F1SA 3WLBB 2VB5A 4M48H 4UT9H 2EE6A 5EO9B 3V5DA 4PJ9D 1J0IA 5JW4M 2MTPA 3GSVA 1JHKH 1V8HA 1OSPL 3KPSB 4H0IA 3U0TA 4LCIL 4U4BA 5GZOD 3O45A 4ODUA 2D0GA 3O9WC 5IT2L 3H3BC 5FYKD 3QULA 4PB9L 4X6FB 4K7PL 2VLKB 4XBPB 1HHKB 3P4MB 3ZT5A 3WUWA 1IGJA 3IDGA 3MLXL 1YPZA 3MLVH 3C5ZC 3BP7B 3RPIB 1X7QA 1YYMH 3VI4F 2ENYA 3PP4H 3KYKH 5A16B 1CXFA 1Q0YL 1VESA 4LPVA 3G6JF 4GG8B 2ZCLL 1FIEA 2NCMA 2P5EE 3U36A 4HV8A 3VGEA 1MCSA 3O4LA 1XFPA 1SBSL 5DD3L 4LP5A 3WFBL 3VFMA 4GAFB 4JM2A 2CUMA 1KN4H 1QSEE 5DMIH 5ITFA 1IFHH 2CR6A 2NR6C 3GRWA 4LSPH 4MNQA 4G8IB 2QTEA 3BEVA 5C0CB 1RUAL 1AGCA 1INEL 3MACL 5CBAB 5ICXA 4HFUH 1DQJB 5I1JH 2ZOLB 4KI5C 3GMPB 4UINL 5H37H 1IAIM 1H9VA 3HMWH 3BD3A 2HWZH 3QUZD 4ZPVB 5HHOE 5I1HH 1OWWA 2EH7H 2M2DA 4K3JH 5SV4A 1XH3B 2YUWA 1F90H 4MX7A 1DZBA 1WCBB 5K9QG 4F2MB 4WO4D 1P1ZB 4RGMB 1B6UA 1ZT1B 2Z0BA 3HE6A 2WBKA 5IB3B 4EVNA 3T65B 3N1MC 1KC5L 4K07A 3QEQB 1UYWH 5KG9B 1FDLL 1EFXA 2X9WA 5EU5B 4BH8A 2I9TB 3X12A 5E7BA 4P2QE 2EDXA 4NNYA 4MNQD 3F7YA 1AQDA 2VC2L 4KPHL 5L88L 2FIRT 3QBTB 3W11C 3ROLB 4RDQF 3RVVD 4XPHH 5ISZB 1UM4H 4PJGB 1YY8B 3BPCB 3V6ZB 5F6IC 5FXCH 3LKNA 1TITA 5CSGA 5KSBF 1RFDH 2X1PA 3SE9H 2P8LA 3DROB 1KEGL 1QSED 3IXAA 4CUCA 1T1WB 3NPZB 2V9QA 4ZS7L 3MREB 4MD0B 5INCA 2VDMH 4ELMA 1FORH 1BBDL 1G9MC 1WBYB 4O2EA 3G5ZA 2A9ML 3TNMB 1QRND 4MCYB 3C2SA 3O3EA 1G7MA 2WWMC 5HXMA 4ONHA 4JM4L 5DK2B 5C0DA 1T20A 2XZQL 1DE4B 1MI5B 2Z92B 3LB6C 4LQFL 1HINH 5C0AE 2W9DL 4HK0B 2VITA 3V5DB 2NTFB 3KPQB 4G9FD 4N5ED 3QQ3B 2ED8A 2DS4A 3VXUB 4HJGB 4U1NA 4U6VH 1V3JA 1BD2B 5DS8B 1BLNA 1DBKH 3LRHA 2Y06L 4JPVL 2NY5L 3RBSA 3W81A 3SKMB 2HKFL 4W6XB 4Q6IC 1LHZA 2XA8L 1CZ8L 1DDHA 2DTML 3GB7A 3K1DA 4GJTB 2IG2L 4UQ2A 3LKSA 1HSBA 2VSCA 4NHCH 4X6EA 3WUWB 4Z5RA 2AJXL 2IALA 3VFGL 3BP7A 3SE4A 3MUJA 3KPPA 4UILH 5H8DA 32C2A 4HS3A 4MSWB 4YDKH 1ADQA 5A16A 3VI3F 3HR5A 1FNEB 4NQXA 2OK0L 3IFLH 3O4LB 4ODBD 5HD8C 3AS0A 3O6MH 4GRMB 3P4NB 1MHEA 1EHAA 1GGCH 3MLTA 2AQ2A 4MA7L 4Z7QF 5LXGH 1BJMA 4YWGH 3HRZB 1A9BA 5DUBA 2E7HA 2O61A 5CWSA 3IS1X 3QB7C 3MV8D 2XICA 3BKCH 4JFOA 5EU6E 3QUKA 5JQHC 3W82A 1FRGL 3QI9C 4PJDB 3ARGC 2DDQL 2X6MA 2B7DT 1O7VA 4KMLB 2AVGA 4N0UA 3TLRA 1KTLB 1WFUA 3QO1B 3WJJA 1WBXA 2R8SH 5EUOB 1B0RA 2FX8L 4YBHA 4MQTB 1MEXL 2OJEA 1B88A 5IVXF 1LE5A 2G9HB 4KUZL 4TPRL 3RRQA 2DTSA 2R0KL 3HE6B 3HCVA 4PRDA 1CD0A 4ZAKC 4R2GC 4M7JL 5J12C 2XTJC 5GGTA 1XT5A 2HYMA 3CFDB 3IDIA 4GAYB 5IVXB 5IW6A 1CD1B 2P5EA 1EERB 1JWMB 1L9NA 3QCVL 1S7RA 3TVMC 3AS2A 3RWHA 3SDYL 4J1UA 3HZYB 4MXVF 5E5UB 3FAXA 4JY4B 2DBLH 1QFUH 4EN3C 2NY3D 1FFNB 4JPIA 4LGPB 5I1CL 1EEQA 4P5KA 5JHDE 1S7VA 1YY9D 4JFYA 3P11L 5IEHB 5MP6H 3FB8B 1T21A 2HG5A 3DXAB 4FTVA 4S1QL 4GBXC 4KQ4H 2BNUB 4L9LA 5DSCA 1T1WA 2CPCA 1YN7B 2XWTB 3QXVA 5BS0D 2ICWJ 5D71L 2YRZA 3TNMA 3FB7B 1N59A 3ARXA 4AG4L 3C2AH 3WN5C 4GRLD 3TA3A 3HMXH 4CRPA 4R26H 4BKLB 4ODWB 1ZK9A 1T20B 1F3JB 2FIKB 4FZEL 1J10A 4HUWA 2OP4L 3EYSH 3ZE1F 1J88A 3MRGA 1MHPL 3JBG7 4U1IB 1S9WA 1RUQH 3AREC 3MRBA 4PY7B 1W0WB 4FFYH 4AMKL 5EC1A 4FQPA 3LN5A 4XVJH 4OZGF 1CDHA 4FMFA 4FQLH 4M61A 1MJ7H 5DS8A 1S7WB 1P7KB 4R96A 4RGNC 5D1XA 2QV2A 1RZ7H 3VG9B 5HHNA 1C5DA 2Z8SA 3BXNA 1FL5A 1LDPL 1OARL 4N0CC 3UTTD 5D5ME 3ESVF 4HWZA 1LD9B 3BYYA 5GS1A 2VDLL 1P4IL 4MSWA 4PTUB 4YIQA 3DX7A 2VH5L 1X5LA 4HIEB 1JGLH 4LSVL 3MTRA 4KRPD 1S7QB 4CNIB 1T03H 3B4NA 4EQ3A 5E6IC 5JPMA 4KTDH 1Z3GL 2I5YH 5IK3B 1E4XI 4PRIA 1UEYA 2Y9RT 1J18A 4FQXA 3EOYG 1QRNB 2HFEB 3FN9A 3SDXE 4JCMA 3VDAA 4I9WD 4KVCL 3K7UA 2J6EL 1MI5D 1CT8A 4NN7C 1FNHA 1GZQA 3FTGB 4JFXA 5KVGL 4QXTB 5KSUB 2I07B 3IFPB 1VSCA 1XGPB 2DWDA 4J3TA 2L4OA 5GJTH 1VPOH 5F9DC 1QRKA 4X9IA 2N4IA 3IJHB 4I5BA 2Z35A 2PO6C 1QFHA 3WJLC 4PJBA 1UCBH 4HKXA 5I1AA 3E6HB 5GS0D 5FDWB 4PRDB 3D85D 3WXVL 5E6ZA 3QRGH 2XN9E 1TLKA 3CVIH 1HWHB 3EAKA 4LSUH 3UMTA 3MNWB 1R5IB 1CGSH 4Y16B 3CFDA 4PS4H 3LPGA 4M1DH 2HA1A 2WW8A 3VD7A 3DYMA 4NO0B 5IW6B 5GGSY 3PHQA 3QEGH 4JG0L 3MBXH 4NN5B 2J8UE 1XEDA 2F54A 1INDH 1J0KA 2ADFH 3HZYA 1F11B 4WI2A 1V7ML 5I8KH 3QQ9C 1NKOA 2XWBB 1PSKL 2GAZB 1YN6B 4PJDF 3MLSL 2GI7A 1L7IL 1MQ8A 1B2WH 2FGZA 4WRLA 1I1AA 3I02A 5AAWA 5GRUH 2BZDA 5K59F 2YRPA 4M48L 5GZOC 1HHGB 1T21B 2BY1A 3CC5A 4FTVB 2BNUA 1OWRM 1U8QA 3QDMD 3OGCA 1OSPH 1EH9A 3OQ3B 5I16A 3B9AA 4F7TA 5L7XH 4Z7UF 3QNXA 5GS3A 5BQ7A 3VCLB 4PB9H 4DFHA 1ZHLA 1FAKT 3OZ9L 4Z9KB 3S6CA 3M1BA 4TUOA 4QWWC 2RB8A 4H5SB 3S96A 5FO7A 5HHQA 5EC1B 3EGSA 3RNKB 3T0EB 4M7ZC 1OGAE 1UVQB 3IDJB 1S7WA 4FABH 1A9EA 2VXQH 5J3HC 2K9UA 3CFEA 4POUB 3EIFA 1RZFL 1SBSH 2V2TA 1D5XA 4N1HB 5HDQL 1P5VA 5HHOB 1KN4L 1WT5C 2HTLC 2BC4A 5DRNA 2APXA 4PJXF 1M7IA 1UB6B 5JNYB 4IRZH 2YK1L 4AJ0A 1MCNA 3JTSB 4LLVA 1INEH 4XP5L 4KKCC 5JIHA 4OZHF 3DSFH 4Z7WF 3JUYA 4IM8A 3LEXB 2NY5C 1QSEB 5ALCL 5FIEA 1A6TA 4LVNC 5I1HL 1I1RA 5D8JL 5EN2A 3BPOC 1F3RB 4K3JL 4IOIB 3GK8H 5CBEA 3RUGA 1YEGL 2HFEA 3MA9H 3A6BL 3PGCA 3D25A 4HDIA 1IC5L 5C3TA 4X5LA 2I26N 3WN5A 3P30H 2DN7A 2A9NL 4QXTA 3J7HA 3Q5TA 4X4ME 5KSUA 3SDCC 4DZBB 1OAUL 1KC5H 3GSXB 4EDXA 5L2KD 1UYWL 1FDLH 3L5IA 3SE3C 4BELD 3KJ4C 1IGIL 1E4JA 5HI3D 4R6UA 2Z35B 1KXVC 2VC2H 3OKEA 4KPHH 4RFEB 4UV7H 5L88H 1UJTA 2IAMD 4KZDH 3N9GH 2XN9B 3E6HA 1IEAB 1OGAA 3L3IA 3P9MB 2ESVA 4ZUVA 2KQNA 4XRCB 3PGDB 4YNYA 4GQ9H 3OKDA 4EI5A 1RFDL 4J3VA 1XGYL 3MO1B 1Z0MA 4W70A 1JGVH 3AM8C 1NSNL 3PNWB 4JFFD 4QHNA 1ZOXA 4YJZL 3KYOA 3TN0D 4GXVH 3JTTB 2A9MH 5FGRA 4IRJC 4PRIE 4GKZB 3QNYA 3DV6B 2R4SH 1EFXD 1UXWB 4G7VL 2VLJA 2XZQH 1U8HB 3EDJA 4X7SL 3GSRB 3BKYH 3S35X 5HHMD 4KMQA 1KPRB 1QBMH 1MCDA 4ODVH 4WU5A 1U8QB 1R0AH 1MCRA 4ZG1A 4NCDA 4KTEL 4ZOEA 2CDFA 2VN4A 4Y4HD 3OAYK 3ARGA 1FJ1A 4BZYA 1TQCB 3GIVB 3QI9A 5HPMA 3PABA 2Y06H 1A4JB 5T33L 3SKNB 2FX7L 1DFBH 3X3FH 2PTVA 5GS0C 2KH2B 2XA8H 4LRIA 3FFDB 4J7RA 1U2CA 4P49A 4LKCA 3RWFA 1KIPA 3TBTA 5JOPD 3TFKC 3QIUA 5M95B 1KCUL 4UILL 2X4UA 3E0GA 1WAAF 1JNJA 4APQA 2HFFA 1G7PA 4ZAKA 5JZ7C 4Q6YA 5BXFB 4WUUB 5I1EH 3PDGA 1QA9B 4HLJA 3C5ZB 4P2RE 2HMID 1GGCL 5GGTL 2QR0A 2DL9A 1Y0LB 5LXGL 5ACZB 5JPNB 1KXTB 4NRZA 3RBGA 2BC4B 5DRNB 2ITDA 3DX8A 4TYUA 3KDMB 5K9OB 4Z77B 4QEGA 2CIIA 1FRGH 4K94L 2V2XA 5DTFA 4XTRD 2P42B 4E5XB 1CDUA 5A1AA 4R4BB 1JWSB 2NTSP 5BW7A 3O6FA 5H94B 4ZUWB 1ZANH 5BRZD 3Q1SH 5BMFH 3DXAE 4IOIA 3MJGX 3NA9H 4M02A 5JIPA 4WW1A 5DVKA 3DRTA 2BVQB 1CICA 3NIFE 4WFGD 1E0OB 3LQMA 1ZAGA 4TPRH 3GM8A 4RNRB 1H0DA 3KR3L 2XWJA 3MXWL 2E9WA 2KDGA 3TT3H 1RI8A 4YGAB 2VZOA 4DZBA 1BVLA 4PJ7F 3D18A 2V5MA 3H0TB 4GBXB 2E27H 1K8IA 2Z4QA 3PL6C 5J9PA 2BVPA 3UEZA 1FVCB 4HT1H 3T4AA 3NACH 5CZXD 3VWJB 4BZ2H 2KKQA 1V3KA 4NRYB 1JV5A 4KRMB 2CSPA 2XN9A 3QNZB 2BOBA 3OX8A 3LZFH 4Q2ZA 4X6DF 5CHNA 5D7KE 5D7LD 3RL2B 3P11H 1MRFL 3NCFB 3QEUB 2FBJL 2DAVA 1VDGA 3DHMA 3I3DA 3HE6C 3O8XA 5D71H 4AH2B 4EJ1C 3C2AL 2LABA 3B9VA 1D6EA 1KELH 1T80A 3OKNA 3RA7H 4LHUB 1LNUA 4XVUD 4Z7UB 3RGVA 3U9UB 1T89A 4K23H 3HZKB 5DURD 4EEEA 4R90L 4R0LB 3ZTJH 5DHVA 1CFQB 3TO4A 4WU5B 1W0VB 2DKMA 4HUXA 1RUQL 1FLTX 4X4MA 5C0AD 3VFPB 2DL2A 4HK3J 3EYFA 4AMKH 5IP4A 1E4WH 3ARGB 1T2QH 2R23A 2Y07L 3OAYH 3QUXB 1AC6A 1MJ7L 1A4JA 3DGCR 4XZUB 3B2VH 3RGHA 5IMKB 1M4KA 1NGZB 1MSPA 5I1GL 3K4AA 2FYYB 3D3VA 4DQOL 5F88A 3ZE0F 3OV6A 1U8JB 3LV3B 4LRNH 4ODHH 5MENB 2VLMD 4AIZA 4MQ7A 3MUGB 4JRYE 3V4UL 1A2YB 2WQRA 2E9IA 3RWJA 3FRUA 4PJCB 1UJ3C 3MUHL 3GUTB 5AZ2H 2VDLH 2FGWL 3AC0A 1P4IH 1PKQB 2DQFA 2JB6B 4N0RA 4NQCD 5BXFA 2JIXD 4HPYH 2Q3ZA 1IGFL 2YXMA 4LARL 4LLMA 1Z9SA 3VRJB 3NH7H 5HYJD 4CL7A 4HIJB 3O45B 4ODUB 3UTZA 4PRID 5FUCC 2VDKL 3WNNA 1E6JH 1Z3GH 2EIEA 3MJ7B 4S2SA 3ROOA 5JPNA 3QULB 1JTOA 2AK1L 2D03H 4HF5L 3DX8B 4ZAKD 4LEXH 2VLRD 2DRUA 3DARA 2IAMC 4Q74A 4WW2B 4PG2C 1NBZB 4E5XA 5CP3A 4P46C 4X7EC 4L4JA 2CIKA 4Z8FH 3LH2L 3O6FB 5H94A 5F1OB 2W9LA 3MFFB 4G80B 3D2UA 4XWGH 1H5BC 1RIVL 2DQDH 1P53A 5CEZH 1DVFA 1FZJB 1JMXA 1GOGA 1U8IA 5C0RL 5DMJB 4PJFB 3HLAA 1JHLL 3NCJH 4K8RL 5ITFB 3VFWB 3LPFA 1C7TA 5E9DA 3MOBH 3WLBA 2XWJB 1LEKB 3QRGL 4PREA 4MA1C 4P46B 4GG6F 3KPSA 5HHPA 2ZOLA 2CH8A 2ORBH 4NC1E 3LOWA 3OAUL 3MBXL 4MQXD 3KG5A 1TZIA 3ABZA 4PGEA 4P5TB 1DL7L 1INDL 3RVVC 3IDUA 1A3QA 1V7MH 5I8KL 2BOBB 3P4MA 4UIKL 3L3HA 4CN4A 3BRDA 3TZVC 1J5OL 4OF0A 2J5LB 5EC2A 4M8QA 2WP3O 1J1XL 1YPZB 2G60H 4MMZC 4V2CB 2DQUL 5EO0A 4JRWA 3CK0L 4YZFE 3DVIA 1NCDL 1XF4A 4YHYB 3TFKD 5CAYB 5ETUB 1RV6X 4DOHE 1RK0A 4L3CA 5DI8B 5L7XL 5EU5A 4L8DB 3BAEH 4FQJH 4JM2B 1NFKA 3MRQA 3WNKA 1P6AB 3MRIB 5ISZA 5F7HA 4F7CA 5DHVB 1T1XA 2AEPH 2GFBB 4I3SL 1AC0A 2YS4A 1AGCB 3L3JA 1FG9C 5CIPH 5CBAA 2FH6A 3GNMH 1FFQA 2P43B 2NY1B 3FJTA 1LP9B 2HT3C 1OCWL 1MWAL 4Z18A 1U95A 4I48B 3MREA 4MD0A 3GSQB 4NDMB 4OZIF 2BHYA 1FNLA 2CO6B 1RZFH 3GJFK 4F15B 5E8NA 3LV3A 2CMRH 2NY2B 5GGRA 2X1OA 3TO4D 5HDQH 4UOJA 1J0HA 1A2YA 2HLFC 5GRWA 4F2MA 1OP9A 4WIQA 3SGKA 1OW0C 3C60B 2WANA 3RGVD 3FFCA 2O5ZH 2AS5M 2JB6A 4LPYA 1I8MA 2NTFA 3PWNB 3DJ9A 2YUVA 2VZSA 1C8PA 4OCLC 4Z7NF 3QQ3A 3DSFL 3DHJA 2BK8A 3WL9A 4ODTL 3ZKMC 4FMKA 4U1NB 1BD2A 4Y8AA 1D5IL 5GRVK 3AXLA 4NNYB 1S5IH 4YHZL 1DSFH 5FKAB 2Q20A 3V95A 4ZFOA 5I71B 1I3RB 3GB7B 1YEGH 4P2RB 3MA9L 5DJ6B 4U3HA 3T0DA 1Q94A 1IC5H 4OZGA 2ADGB 3G5XB 1FPTL 1H3TA 2VTFA 3FO1B 1KSRA 3BI9X 1XGTA 3IS0X 4M62L 3PL6D 4HXAH 2R2CA 5DVNA 3ULVE 3BUTA 2PETA 1OAUH 1G1CA 1MCPL 2Y7QA 3DECA 3WFCH 4EIZC 2BHZA 3TYGL 1YJDL 5EU3B 4LDEB 3IFOA 5I30H 3H9SA 5FYLL 4PR5A 3G5ZB 1IGIH 4DKFL 1M05A 2ICWB 1TQBB 4UV7L 1RZJH 4JQXA 4XP1L 4MNGE 3DGGB 1A9BB 2Z92A 5DUBB 2L7JA 2X4TA 2DWEB 4BH7A 1L0XA 2P5WD 4PB0L 4OLXL 3VXPB 4PREB 5KZCB 3QUKB 1EJOL 1WVZA 2OJZH 3CXHK 3QDJA 7FABH 2Y36L 3WSQH 5BRZA 3F12B 5CP7A 1XGYH 4NUGH 1JGVL 4YAQA 2B8OT 3BO8A 3LKPB 4PJ8B 4PGEB 4P2CG 4JJ5B 1NQBA 5F9AC 1I1AC 4K94C 1WBXB 2GHWB 5EZLB 3L3HB 4X6EB 5EC2B 2K3TA 4M8QB 4G7VH 4QRRA 1YEDA 3LRSA 4E41D 5HBBA 5DRZA 5INDB 3BKYL 4NHUA 1MJJB 2ERJB 3FO2A 1JN6B 1P84K 3IJSA 1UM6L 1QBML 4KC3B 4ODVL 2DQCH 2ITCB 1NJ9A 1RUKL 1QLEL 3HI5H 3CSBA 4NQXB 4PRHE 2DD8H 3MA7B 3E2HB 3QHZH 4XCFL 5EDXA 3MODL 2A0LC 5E8OA 2QSVA 4L8DA 3RVWC 3MLTB 2YBRA 3HE7C 4Y5XA 2B0SL 4Y7MA 3RWHB 5C6TL 4GKOA 1DFBL 1KT2B 3BE1H 4QRUA 5JMOC 2ZUTA 5KS9F 3X3GH 2NY4B 1CLOL 1LK3L 1TQCC 4DJMA 3TZVD 1T5WB 3MMEB 2EC8A 2VDQH 4P5KB 4KI5F 3HA0A 4P9MH 3BGMA 1Y6MR 4Y4KD 4UOW1 5HDLA 3ALWA 1ZA3B 2BMKB 3T0EC 1YN7A 5I1EL 1U95B 4I48A 1KTLA 3UC0L 2HRPL 2X70B 3VFVA 4X80H 1I7ZB 3QFJA 1JPGB 1YJDC 5FOBA 4YQXL 5GGRB 3ILPA 5JW3L 1JGEA 4OFYD 2YWZA 1F3JA 4YHNA 3ARDB 4PD4J 5GGQL 3P4OA 3RX5A 3TBSB 3FFCB 3EOBA 1OAQH 4R7NA 1KB9K 3DVFA 1I8MB 1OSZA 2B4CL 2C1OA 2BNRD 1HQ4A 2VXUL 4NQEE 3VW3H 3D39D 5EOTA 4M61B 5A3IC 1JWMA 2DQIL 5TE7L 4WUKL 5E5RB 2GJ6B 1XF3B 4ERSH 4DK6A 1IILE 1QTYT 3L95A 4KROB 2H32A 5E5MA 4PUBL 3EO9L 1LO2H 1MNUH 3DVNA 3BXNB 2O5XH 5I17B 4HWZB 5GS1B 2FO1A 4FQXD 2UZYB 3KR3H 3MRPB 3T2QA 5IEHA 1DLFH 1ZVSB 4OB5H 1RUMH 4WDIA 4CU7A 5C0EB 5CUSL 2EDDA 2XWTA 3SDAA 2F58H 1WBZA 4U0RB 2Y1VA 4PR5B 5JLZA 1X5IA 5DT1H 3L1OL 5JHDD 3KS0H 4I9WE 5I8OL 1JGUL 4U1HB 3EO1A 4QRPD 2AJSH 4NKOA 5F9JB 1MFBL 1TVBB 2EO1A 3BPOB 1ITCA 2FIKA 4Z6AT 4GLRH 1S7XA 3TCLB 3QUYA 3NN8A 5JXEA 3PP3K 2OR7A 1LEGB 1IE5A 1S9WB 3GKWL 5E0QA 4UV4L 1VEMA 2VKWA 2CD0A 1D7FA 4OGYH 3VFUA 4OCXL 3VXRE 5E99H 2R1WB 1MRFH 3AY4A 4RGOL 5LGJB 3BD4A 3QXWA 1LP9F 1J0JA 4K3DL 1D9KB 5D1XB 2FBJH 5F72S 4JO4H 3ZDXE 2VLRE 3KLHD 2EE2A 2VAAB 3HZVB 2FJHA 3EJZD 3F7PC 4FN0A 4XI5D 3RA7L 3TIEA 3IDXL 1FC2D 5C07B 3SDXF 2CJUL 2R9HC 2W1NA 3F5WA 4HUVB 1ORSA 4OGAD 1JZ8A 3DNKA 5FDWA 2QADC 4CU6A 3PUCA 2VR9A 1NEZA 6FABL 4O2CA 5E8OB 4PJ9C 2Y07H 3BVNB 5CSZB 1N7MH 5DJYA 4MWFA 1RZKL 4JO3H 1OOAA 2YBRB 3CVHH 3B2VL 2RAMA 2AJYL 5IK3A 1KT2A 1SEQH 4TSCH 3T8XB 3D9AL 4LRNL 2XWBA 2P49B 1JPST 4NO2A 3VXQB 3QRFM 2NXZD 3SY0A 3WS6C 1YN6A 1JK8B 1T5WA 4Y5VC 4LLUB 3JUZA 3SKOB 3T2NH 2DJ4A 5AZ2L 1XGPA 4OLYH 1OGTB 3IDYC 1R24B 1YZZA 4MAUL 4NRXB 5DA4A 5I16B 3NH7L 3R8BB 4F7TB 3I2CH 2HT4D 4P5MB 1I7ZA 3QFJB 3RVWD 4I5BB 5D7SL 2XACC 3WMSA 4F7PA 4YHNB 1K6QL 4HKXB 3QXDA 4HF5H 3P4OB 3TBSA 1QBLL 3M1BB 1UKSA 2D7TL 4NN5C 2X9XA 1IBGH 3JV0A 1AGBA 1DQML 4OLZH 2C1OB 4Z7NE 3O6FD 5LQBL 2AJ3B 1BJ8A 4PY8J 1J8HA 3DUUA 3OKOB 4Z8FL 4XBGA 2GJ6A 3CFEB 4TRPL 1RIVH 4Q58C 3G08B 2DQDL 3CFIC 4EI5C 4LEOB 2HH0L 2V2TB 5MEOB 5E5MB 3VGGA 3ZE1E 1LILA 2VXSL 3WNMA 2R0WH 4LCWD 4Y2DA 2WV3A 3QPXH 3C6SB 2OR8A 5D7IE 1YECL 4TTGA 1E4XL 3RY4A 2IAND 3MOBL 1M7IB 2W0PA 4NC0B 2V6HA 4WI7A 3ZYZA 5C0EA 4GRWE 3H9SE 3TNNA 5I2IB 1RZJC 5H37G 5DWUL 3WS6A 4JZJA 8CGTA 1I7TB 4U1HA 4J4PC 3VCLA 2VZVA 1DL7H 1BP3B 3HFMH 3WJLA 2FECL 4L4VD 2YXFA 1JZ5A 3BHBB 3P2TA 2OSLB 3SDAD 2G60L 1H3XA 2P7TA 5C09B 5J1AA 5GPRA 1A6AB 4YGVA 3RNKA 4DZ8A 3T0EA 5E6YA 5IVZA 1KB5B 2VL5B 3HS0B 3E6FA 5D7IB 4KXZH 4JKLA 3CLFH 4Y4KA 3I3BA 5KSAC 3TBVA 4LK4A 4HMEA 5CKGA 5K9QI 4I3RL 4FQJL 4E0RB 2YD9A 5HHOA 4H8WH 4OI9A 5IHZB 5IJVA 5BVPL 1DBAH 3ZL4L 1ORSB 2C26A 5MEQA 4RGNB 3MNZB 3TT1L 1WGOA 5CCKL 5IVXE 3JTSA 4LLVB 2CGRH 4P2RD 2DQHH 3GHEL 3GNML 4R4FH 1CD9B 3HZMB 4HGKC 1PY4A 3BVNA 5CSZA 3GBMH 1RY7B 1S9YA 1KCSL 4EI5D 4ENED 4GO6B 4QRPE 1MWAH 1QSEA 2I9LA 3GSNH 4ONFH 3X14B 3K4DA 5HYSA 4MVBD 1MIEH 3HPJB 3U7YL 2NMSA 3D25B 4HDIB 1QFWL 4XXDB 4DKAA 1AKJD 1VA9A 5J13C 1ONQB 3HAEA 4U05A 1CK0H 1YEKL 1AO7D 4KK9D 4U6YA 4I8DA 4NM8H 4EDXB 2FRGP 1R24A 5IWLC 3UPCA 5EH1A 4ODTH 4YHLH 2EXWC 3ULVC 3VGBA 1DBJL 1D6VL 3SKNA 3UROR 3OKEB 3MJ8B 4RFEA 4YHZH 4GKNA 4PJIB 5FKPA 4JCLA 4TULL 4KJWC 5AAMA 5E7FA 4OT1H 3OMZA 1IAIL 1YA5A 3CX5K 3QFDA 4XB7A 1J8HB 1QLFB 3B6SB 3DUUB 1ZLUH 3OKOA 2HFFB 4LLAA 1TENA 3PNWA 1AFVH 2FZ3A 2ATKA 3WFCL 2JTDA 2P47B 3L7FB 1QA9A 5FYLH 2NYYC 3C5ZA 4BFIA 5DC9B 4TSBH 4PFEA 1A3RL 5FA4B 2VXVH 1Y0LA 4KROC 3D3VD 5KSAA 5F6HJ 1EO5A 3MV7D 4CMMB 3HHRB 1SMOA 4PB0H 1RZ8B 4JE4B 2NXYB 5E2JA 3B9KD 4ZD3H 7FABL 2Y36H 3WSQL 1CN4A 3TNNB 5KSBB 3VU2A 5SWZE 3KHOA 5C0IA 2NY6D 4FFVC 1CXIA 2I27N 4BK4A 2F9BT 1A5FH 3N85L 5CJXA 3H9SD 4KKLD 2FLRT 4K7PY 2OSLA 2P8MA 4YHPA 4QRQB 1FSKC 2BVQA 3QIUB 3PDDA 5FYJH 1AR1C 2BJML 1FHGA 3S5LG 5IB2A 4YGVB 1UM6H 1A7RH 1I1YB 4CMHC 5MI0C