4JRWA

Crystal structure of clostridium histolyticum colg collagenase pkd domain 2 at 1.6 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
GSAPIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Collagenase
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
total genus 18
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jrwA00
4PJAE 3MRBB 5T1MB 2IALA 5M94B 2FHCA 3VW3L 1MJ8L 5GJSL 5CZXD 3JTSA 3RWHB 1CD8A 3L5XL 1F4XH 1CFNA 1HE7A 4YK4C 4X5LA 1I8KB 3VXOA 4JR9L 2MNUA 4P2RA 1HKLL 2GJZB 2VL5A 1DLHA 4OF3A 4KJWC 4P4KC 3RUGA 1UJ3B 4LGSB 4MA8L 2CJUL 1ZS8A 1Y6NR 3PXHA 3TT1H 4MNHA 2N4IA 2AJ3B 3IJSA 4DOHB 1OW0C 4HWEH 1MREH 2PO6C 5DRXB 1KPVB 3ARDD 4U6XA 3ARDA 3MGAA 2XY2A 3MJGX 4MXQD 3MLZL 1TTGA 2A83A 4NKDA 5D1XB 3ZHKA 1OLZA 1OW0A 5EC1B 1IARB 4JFHD 4XAWH 5CILH 4AZ8A 5IIEB 4O2FA 3RWJB 1JV5B 1V7ML 4M8VA 4LDOB 2V7NB 3U9UB 1KLUB 4AG4L 2O5XH 2IPTL 2VR5A 1MI5D 2JCCB 1MI5A 3D0VB 3ARFA 3MUY1 1UH2A 4K94C 4OF6A 4LSRL 3L3IB 1T21B 2WIMA 4HK3J 5CINH 2W0LA 1E27A 3TBSA 1FIEA 2EZ0D 4R4BA 2VLRD 2VLRA 2CO7B 5CBAB 1DANT 2GUOB 1CQKA 2HVKA 2W9DL 3UZVB 3JWNC 1UM6H 1FAKT 1EVTC 5J6HA 1K2DB 1EMTL 3W9EB 3HPLB 1C5BH 3SJVB 4K3JL 5K59E 5E99H 4ZS7L 1MSPA 2D9QB 5HHVH 5J06A 3SGDH 1UWEL 1MQKH 5GGSA 1S7TA 3U0WL 1ZSDA 2PKDA 3MV7D 3MV7A 3BP4B 4NDMA 4Y4FB 4PJIB 5ESQA 4M5YL 5IM7B 4WWKB 1E4KA 2YMXH 1M7IA 1U41A 1MOEA 3T0EE 4DN4H 2HFGL 5C08B 2Z91A 2FYYB 4L4VE 5A2LH 1YNKH 4FQLH 2XTJC 2NXZC 3QUYD 2XY1A 5JR1L 1DSFH 4NO2A 1TPXB 1MCIA 1K8IB 4BH8B 3GSUB 3L7EB 5J9PB 4XVUC 4D3CL 3BUYB 5FYLE 1N6QH 1QRNB 3MCLL 5C6WH 5FO7A 3VXTA 1O5DT 3KXFE 5CD3B 3MNVB 4PJ5D 1RMFL 4PJ5A 3QEQE 4C56D 5TH2A 4C56A 3KLHC 1BJ1J 1G1CA 5E08L 4GUPA 1FFNA 1J1PL 3RWEA 1QTYT 4HZLB 2CLVA 1MFDH 4JZJA 2O93L 4FZ8H 1AGBB 1DBKL 4BZ1L 1HI6B 2JE8A 5DSCB 4MSWB 1RZKL 4MA1B 4BH7A 4I5BB 3STZA 5FGBC 1YEGL 3LH2H 5F8RC 2D7TL 1GGBL 3DXAE 5I1IL 5GGVL 2XTLA 3OHXA 3BPOB 2ICWJ 3BW9B 4MCYB 3VXSB 4M7JH 4GW1A 4PJDF 4H25A 5DEFB 5FGBA 2G75A 2X4SB 2DJUA 3GB7B 1KEGH 3G9VA 3FT2A 3ROOB 5ABDE 4JKWA 3DUUA 5T5FH 3QAZB 3QHTC 3BD4A 1KCVL 1KPRA 4EI5B 3F7YB 1N59A 3P40A 4HMDA 3NH7H 5EA0L 1KEML 4NO5A 4PJ8D 4PJ8A 5F8QC 2OJZH 4OZIF 4P49A 4O4YH 3FQXB 3LDBB 43C9A 4HULB 4M4RA 1A6ZA 3VD7A 5ICXA 2BXYA 2Z8WC 3OF6D 4BSWB 3OF6A 2KDGA 3F7QA 1N5YH 4PYGA 5DFTA 4OLUL 1VGKB 3QFDA 1RZGA 1PEZA 4K2UH 3WJJC 1UJTA 5DS8B 3GMOB 2JIXD 4NKOA 5DD5H 3L3JA 4NKQB 2JIXA 5I75B 1FVEA 3MRRB 3VFTB 4TSCL 1X6LA 4OZFB 4L5FH 3BH8A 1FH5L 1JPFA 3C08L 4ALAH 3ARXA 5EO1A 2BXZA 1PGRB 2AXJA 2DM3A 3ZYZA 5TGBA 4WNQA 4ZUVA 3IETB 5B3JE 2FGWH 3MGOB 4P46C 2GEEA 4NIKB 2WUCH 3Q6GH 5C8JB 5JHDB 3C87A 3ULUH 1UEMA 1CYGA 5IB4A 5E8PA 3CD4A 5DMKA 5CZVL 4EBQL 2ADFL 4Y0GA 1ZAGA 1B0GA 1IGJA 1LEGA 3WFCL 4CJ1A 3D87B 1A1MB 1OAUH 1M4KA 3F12B 3OXSB 1AGEB 5C3TA 2IEPA 4CN6A 3WXWL 3L95A 2WP3O 4HIIA 4ZNCD 1ND0A 1T83A 3C8DA 2VABB 3DVGB 4O51B 4ZFZB 3R0NA 3K8LA 1E0OB 1E6OH 1FVCA 2WLYA 3G08A 4TYUA 1ETZB 3GBNL 1AJ7L 1S7QB 1BVKA 3RIAK 4XP1H 4YDKL 1SVCP 5KZCD 3VI3F 1L4IA 3P4MA 1CU4L 4ZUSA 1EO5A 4R2GC 1ZVSB 3DGGB 2HVJA 4WFED 3W39B 4J4PD 4TTDD 3RVWD 1MCSA 2PETA 4H88L 1N4XL 5I1GL 4CADA 4IRJD 3SKUD 3HI6L 2B1HH 3O45B 4KC3B 2ICWA 3T2QA 4NCC1 1WF5A 2APXA 4YHOL 3BPCB 5BZWB 2VXTH 5DRNB 4KQ4L 1BWMA 5D7SH 1RZKC 3P0VL 1G6RH 1BBDL 3WO4B 1H3UA 3UJJL 3HC0B 3ULVE 5JW3L 1NFIA 4YPGA 4XP5L 1PKQA 3QPQD 2NLJB 2PR4H 5CHNB 1F58H 1WC7A 3IDNB 4LLVA 1F6AB 4X8JA 3CUPB 2R56H 2VLJE 2ZPKH 4OZ4A 4QXUL 4DGIL 3T3PF 3BZ4B 2CUIA 3MR9B 4G6FD 1OAQH 3LEYL 5K9QI 4YHKH 3RFZC 2QQKL 2IBBA 3MRPB 4TUKL 1LO3H 1KJVA 1MFEL 3WNLA 3SGEI 4MQTB 4WGVB 4OCYL 2NY4B 4F33B 4Y1AD 4QOKA 4F7MB 2WBJD 4Y1AA 5DD1L 2A77H 2WBJA 3QIUD 3QIUA 4ELKA 3HAEA 2BNQB 4LASH 1L0YA 3G6DL 4YHNB 1LGVA 2H2SD 2NZ9C 1RJYA 4XP6H 3C5SA 5A3IC 2FIKA 1XR9B 4P5TB 4L8CB 3VWKC 1TZHB 4PGDB 4Z76B 1UWGL 4OFKA 4TOYL 1ZLSH 2EE9A 3HUJF 3IS0X 3KYMB 3MJ7B 1KCRH 3TF7C 3DHJA 1CXKA 3M17B 5EIIA 1D6VH 2OXGA 4OZIA 2BP3A 2SEBB 2R2BA 2WINA 1D7FA 3FO0H 5TFSL 3CK0H 4OSUH 2I60H 3VXQB 5ANMA 1WTGT 4Y16C 3MRGA 1FNEB 5AYQA 2HT4D 2DMKA 1KLGA 1I7RA 3R06A 1BFOB 2A6KB 2CKBH 2ITCA 1ITBB 1MPAH 4KUZH 3IKCA 1C16A 1TJHH 2JB5L 1VFBA 3B2VH 4K9EL 2F8OA 5CIPH 5FB8B 3NN8B 1M71B 1I3GH 1CT8A 3QRFM 1QSFD 1QSFA 3G5YA 2Z4QA 3EDEA 3PGFL 2OTUA 3PWVB 1QQDB 1MCPH 2MHAA 4Y4HD 4OLVH 1DANU 4RGNE 2UUDK 4N5ED 2YPLD 2YPLA 2IH3A 2VQ1A 1DBBL 4NZRL 4M93C 1FNGA 4LCCB 2H2PD 2XZZA 1KXVC 1NGZB 5CD5D 4M7KH 2CXGA 4HKZB 3ZYJA 1AGDA 2VDKH 2AXFB 5IW6B 2NY1C 2A6DA 4CVXA 1R3HB 3N1PC 1Y6MR 4X6EA 3GI9H 3IDJB 5J1SC 3HAEG 2GAZB 2ZOKB 4OQ1A 2EIZB 3BSZH 1WIUA 4WHTA 5T3XL 3RL1A 2G5BA 3WDHA 3LHPL 3V5DA 1BIIB 3H7LA 4HWEL 4NQCB 1MREL 5FYJD 2VAAA 2YR3A 1RQ5A 3DECA 5EU4A 2PXYD 2VITA 1AP2A 4NQDB 4WUUE 1OY3B 2PXYA 3T1WA 3MV11 2QQLH 4IRSC 4GKZB 3WKMH 3MV8E 3NFPA 4N0FB 2JJTC 1UG9A 2AJVH 5TQ0H 2W9EH 2Z8VC 1PSKL 3FQTB 3T65A 3KHQA 3VMPA 5DD0L 4XAWL 1I9IH 3FQRB 1MFBH 1XGTB 4M7ZB 4XNXH 3X3GH 5E70A 4U6VH 5TPWH 4X7EC 2H32B 2X1WL 4Y5XB 3GO1H 2I25N 4XCNB 2ZZUT 2O5XL 4JQVC 3O6LH 4M6NH 1NEZB 2IBZY 1T5XB 3L3DB 3P77A 4Z7OE 1UENA 1UM4H 3O8XB 5CINL 2FO4A 3D0LA 2EYSB 3HC4L 1F45A 3MLYL 3W0WA 1F3JB 4R8WH 3P4OB 2HFEA 4M43H 4OZGE 3SDDD 1DR9A 1F3DJ 1T20B 5GRWA 2D0HA 4XVTL 4HUVA 5SWQB 3GHEH 4N68A 4ZG1A 4OF0A 3O3AA 4Z0BH 1NCWH 4RGOL 5C0FA 4I0KA 4NP4H 1S3KH 3KPSE 5E99L 5ESAB 1HSAB 1IEAA 1MQKL 1S7XA 5F1SA 5EN2B 3DROB 2P48B 4Q2ZA 2XN9B 2JJVA 1U8LA 2IALB 2YZ8A 4MHHI 5FKAB 1FQ9C 3QH3B 5EBMA 2Y72A 2P5WD 1XR8B 4P23D 4HJJH 1F4YH 4KAQL 4P23A 5AG8A 2LAAA 1XGRA 3AMKA 3T0AA 3MLXH 1CFNB 3AB0B 3BP6A 4P2QB 3CFEA 3MUGA 3SE4A 4FQLL 5IROC 4NKIH 4YX2H 4XVJH 1KOAA 1DSFL 3MRDB 2QSTA 2NW2B 2VL5B 4K9EC 3UYRH 1MFNA 5IB1A 1V7NH 1RURH 3RIFK 3WV0A 4U1GB 1HOCB 3G5XA 2H6PA 5L2KD 2A74B 3DJ9A 4U6XB 1NFKA 2ID5A 1WEJL 4C83B 4J2XA 4I4WB 5IW3A 4CN4A 3SKOB 3BD3A 3L3HA 1QSZA 3MA7B 1SHMA 5C09D 3BN3B 2AJZB 4NBZB 4FMFA 3BJLA 2C7UA 4ORGA 4I3RL 1F4WL 4M1CC 4ZQKB 1BBJA 1CCZA 5BOZG 1V05A 3EOTH 3QCVH 5K9JH 3E0GA 3EFDH 4LSQH 5E94A 4D0BA 2P45B 4BKLA 3QQ3A 4FQXC 3FO1B 4K7PH 4M7JL 3E3QE 4U1KA 1E27B 5KVEH 1EGJA 5J8OA 3UYPA 2YEZA 3DARA 3PGCA 2AJXH 1KEGL 2VLRB 3K8KA 1KULA 4OM1H 5GS0D 3NFNA 5I1CH 1RUAH 3NH7L 4KKLC 4DVRH 3IFPB 3FO9B 3DO7B 2OJZL 2L4OA 4HUKB 1R3LA 4LSPH 5F7KC 2QTEA 2H1PL 3W5NA 1GPOH 1ZSDB 4WV1C 5H37H 3WUZA 2GCYA 1NC4D 1FN4A 1NC4A 2AJSH 5FYKH 3W11D 3WIIH 5CEZL 5L2JA 1HQRA 4R7DB 4K2UL 4PTTA 1MJ7H 3QIBC 4QRPE 4A6YA 5F6HI 5LVEA 4WV1A 2MWCA 1CL7L 4YFEA 4UILH 5EBWB 3AM8A 2XG5A 4NN5C 3QUYB 4NO2B 1TCRA 4P3WA 3HG1E 5C07D 5EU6D 3V6ZA 5F7UA 5C07A 5EU6A 3RVTD 1A6TA 3M07A 3QNYB 1FG2A 1EFQA 5JO5B 1XT5A 4GRWB 5I17B 2AS5M 4YHLL 3WS6A 5ETUB 4KI5C 2VYRE 1QA9A 1G9EA 1NEUA 1JZ4A 4P59H 5KW9H 3L3OA 4C56B 5BOPA 1BWWA 3KPOA 1PJ9A 1OQOA 3WLWD 4Z7QE 4D0DA 1JK8B 1FO0A 3S4SA 4GUPB 1SEBB 2BRRL 5CEXA 4Y88A 4GG6B 3RWEB 2VZUA 3VCLB 5IMOA 3AC0A 1G7IB 4LK4A 1OAUL 5TDOB 4JDVB 5B8CC 2BVQA 4BH7B 2V5SA 1NC2D 1A7PH 5JDSB 1NC2A 1E6OL 4YPJA 1VPOH 4DGVH 1CDUA 1INDL 4R90L 2K1MA 1MNUH 3QEUA 2CDEB 1RZJH 1CVSC 1OCWH 4FQIL 4J8RB 5BZDA 5I76A 1KBGH 1LO0L 5GHWL 3PWNA 4Y19B 4L3CA 1F4HA 5CBEA 3VFUB 3DTXA 5FCUL 1MCLA 3KVQA 4PJGF 2FSEA 4RMUA 4MMXC 3S5LG 2B1HL 3X13A 3H42H 3OJ2C 2XRAH 4OQTA 4PJ8B 1A64A 5DO2C 3STLA 4EOWH 4JM2F 4KI1A 5FHBL 3IU4H 4LVNB 4X4YB 43C9B 2Z8SA 4Z78B 1G6RL 2VLKD 4WJ5A 1FNFA 2VLKA 4Z7NE 3MRQB 1LEIA 1AI1H 3FZUC 4K7FA 2P8MA 4YR6A 5T3ZH 1H3XA 3QFDB 3KPQA 1RZGB 1EAJA 4YHIB 1U8KA 2R56L 3NAAL 1FVEB 2ZPKL 3LKNA 1OT1A 3B6SB 4ZPVA 1JPFB 2EIDA 5FUOH 1GHFL 5DTFA 2FZ3A 2NPLX 3EO1B 1IGMH 1OAQL 3HNSL 4PRAB 1P7QB 1DQTA 1LO3L 1QBML 5KVDH 1H8NA 1Y18B 4GMTH 3S4SG 1MJJA 1IAIM 3SGJA 1OT2A 4GKSB 4FP8H 3ALXA 2DF3A 3PWJB 2BVTA 2A77L 4NSKB 4LASL 4FQHA 3VMOA 2FX9H 2V5TA 3MMEB 4MCZB 3EBAA 4OZHE 1IGJB 1JZ7A 1QLRB 4KDWA 2NNAB 1W8OA 2X42A 3VGBA 1IZJA 1G7PB 1U92A 4HIIB 3PHQA 3ULUE 3X17A 3G08B 4NN7B 1D6VL 3UCRA 2FD6H 3FB6A 3P4MB 3SE8H 4JRYB 2FX7L 1BAFL 3U4BH 4NO3B 2QHRH 4OI9A 2AXGB 3BRDA 1IQDB 4LMQI 1ADQA 1YECH 1MPAL 1KJ2L 2V2WA 3QUZD 4DKDC 4JFZH 1MFAH 4IRJB 5E5MB 2ZP0T 2X4TA 2DN7A 3IDMB 4MDIA 3QEHB 1S7SB 4JZNB 1FORH 1H15B 5J12C 3MRMA 1BECA 4K55A 1KV3A 4H8WH 2R15A 1DCLA 2NYYC 4HUNB 2BOCB 5DJYB 1AHWC 3G5VA 1MCPL 2OM5A 4RWHA 4OLVL 4PYHA 2XI9A 3I3DA 4YBQD 3OKDB 1M05B 1PQZB 1BQSA 4S1QH 1PKQB 2GW5A 1VA9A 3BRGC 1Z9MA 3DRTB 3N06B 4HEME 4HLZH 1AHWA 5I1AB 1IKNC 1KCKA 1TETH 4G8FA 5HVWA 5F89A 1S9XA 1QEWA 2EC8A 1S78D 2R1XB 3LD8B 5F97E 4LLAA 3QZWA 1OAYL 1A7BA 1T2QL 2OL3B 2X7LA 1YNLH 1RZIB 1BPVA 1EV2E 4P2OC 2EDJA 5FA4B 1KTLA 3C5JA 3PNWA 4QHLB 2W9LA 3PWUA 2GK0A 3G6JF 4NHUA 4MQXD 2ZUTA 3VRJB 4U7SA 5M95B 2VZVA 3C5SB 4PJDB 4UB0H 4YDIH 3WKML 5AZ2H 3VA2C 4WI2A 2AGJH 2EKJA 4GAYA 1SJVA 2W9EL 2CD0A 4I3SH 3TC9A 4F7PA 3DV4A 4L3ED 4W6WB 1MFBL 3IGAA 4XNXL 1CICD 4U6VL 2GTZA 5MI0C 1CICA 3K0WA 2X40A 5HGAB 2R1WB 3KWWA 5J4MA 1T7ZA 4JM2D 4JM2A 4HT1H 1OF2B 4XX1E 3O6LL 5F7LB 3BPNC 3MRNA 4Z77B 3RQ3A 1UM4L 4X7FC 2PTTB 3MRGB 1HDMB 1MCOH 3TZVB 3VWJD 3QWRD 3QWRA 3MACL 4X6CB 1NUFA 4R8WL 2CRZA 2FECI 2VZOA 4TTGA 3TNNA 4LPVA 3SKJH 1WZMA 4GRLC 2H9GA 3K2UL 2PW2B 2R1YB 4R4FH 1FNAA 2EC9T 3EDJA 4LSSH 2FBJH 1NCWL 3BN9C 2APTA 5C2BH 1C8PA 4GXUM 4ENEC 1IEHA 1XIWD 2QSVA 1XIWA 1H3GA 4Y4HB 5KN5A 2ESVA 5IMLA 4TVPH 2UWEE 3V0WL 3TBVB 2VDQH 2YPLB 3O6MH 1F4YL 4HJJL 2VQ1B 4NBXB 3EDFA 5SV4A 3QXVA 3MLXL 4P3DA 4NNPH 2DLHA 4YBLC 1SJXA 3QZWG 1DFBH 2AKRB 1DEEB 1GH7A 1CDJA 4FNLL 4NYLA 2C1OA 4Z7UE 3HE6C 2YKLL 3VGDA 3AREB 1B90A 4RQQB 3ECBB 3OX8A 3P11H 4MJ4A 1J87A 1WZLA 5IEKA 4P4RB 1F13A 1V7NL 2BNRD 1RURL 4JJ5A 3U0PB 3KGRA 1U8NA 5DMJB 1KJ2A 2QLVB 4F7CA 4N0UA 3QI9D 4ZFFB 3QI9A 2VAAB 4JN2B 3V4VH 1ZLVH 5EU4B 5AD0B 3VXRA 3O2DH 3WUWA 1RK0B 2EE6A 2E6PA 3OKMA 1BGXH 5F3HB 1DUYA 4LSTH 5F7MC 1LE5B 3MLTA 3T1FA 3U36B 4NZJA 4ZFOB 5GS3A 3V4PH 3L3KA 4LPWA 4QRRB 3PE9A 3EOTL 3AS2A 4DW2H 3EFDL 3QO0A 1FNSL 2ZUQC 1S7RA 4O5LL 5M7QA 1WBXA 1D9KC 4APQB 4LLWB 2FO4B 5FGCB 4PRHE 1GOGA 5KVEL 2AJXL 4MYWB 3LN5A 1EO8L 1X4XA 4AIZB 5C6PB 4OM1L 3SDDB 5K59F 4PJEE 3QWQB 4FFVD 3KS0J 1D9KA 4LCWE 3A67L 1BX2A 1TQCC 2OQJB 2FO1A 5SV3A 1QHPA 5DK0A 2B4CL 5C0FB 4DVRL 2XWJA 1CFTB 2Q8BH 3ZDYE 2OR8A 3ABZA 4JO3L 7CGTA 4LSPL 3RWDB 3H9SD 4QGYA 5HYFA 3H9SA 1NMCC 5BVPL 1GPOL 5E8EA 4Q2ZB 5EUKB 4UV7H 2F53E 2PW1B 5J13C 5J1AA 1MLBA 4TQEH 4JY4A 5EBMB 1XZ0A 2P5WB 2ZCHH 5FYKL 2BNUA 3WIIL 3ZSSA 4D2NA 4RAHA 1WLHA 1T0MB 1OAZH 4KRMB 1PG7H 3BWUC 2ADJA 4Q9RL 4E5XA 2Q7YA 5GSVB 3DIFA 5E1AA 1S9WA 3NCCB 3IS1X 4C55A 3ULSA 4R96A 5ITBH 2ED8A 3ILPB 3RL2A 4Z0XB 3LKPA 1IC7H 4HWBH 4U1IA 3HUJB 1HH6A 5CSZA 2XPGB 2FWOA 1FZKB 1U3HB 4WW1A 3WUWG 2P7TB 1FGNH 4OAWB 4WVRA 1UVQA 2NQCA 2H6PB 1BOYA 5L2KB 2YZ1A 4F9LC 1WAAE 2ZCLH 3QUKA 1RUML 3PJSB 4LAJH 3QQ4A 1UZ8B 4KRPB 2D31A 2E7BA 5EU3B 2RCSH 4HMCA 4N0CD 1FFQA 5IGXL 2B5IB 3KPRB 3U30B 3PDGA 2BSED 2BJMH 2D7NA 4JFXA 1AO7D 3QULA 5C09B 1MCFA 2C7UB 4ORGB 4QTIH 1YY9D 3FQWA 3G6AA 1QR4A 4PLNC 5HGDB 1VPOL 4LARH 3C60D 4DGVL 3C60A 1EIBA 1RIHL 4G8EB 1EO7A 3T0XA 4CDGC 1RZJL 5MERB 4O02H 2ZUXA 2Z8RA 2CK2A 4HFWA 1OCWL 3EO0B 2H26B 4P4KD 4DZBB 2YXMA 1EHLH 3I6KA 4QEGA 1KBGL 2C3VB 3CMGA 4JY5H 4NM4H 3E1F1 1QPXA 4NPYA 4L9LA 3NFNB 2PO6D 4WW2F 4G6JH 2ORBH 4QY8A 1KN4H 3H42L 5D7JD 4JLRB 4KJPD 1VESA 3L1OH 3S36H 4EOWL 4ZUWB 3T3ME 3IU4L 4PLKC 4DOHE 3S5LB 4MJ5A 4HG4K 3WBDA 3I2CH 2I9TB 2B2XH 1YN7A 1B0WA 4TPRH 1FN4B 1AI1L 1XF2B 5T3ZL 5D1ZD 4M1GH 1RZ7H 5E2VL 3CVHH 5B3JF 5FUOL 4OGYH 1YEHL 5D9SA 2WAHA 3FN9A 4PRDB 1TCRB 5CGYD 2JCCE 5EU6B 2B4CC 3IDXH 3QB7C 3VFNB 2MSPA 5KVDL 4PRBA 2BOBA 1K5NB 4NRXB 1RV6X 4EN3D 4Q74A 4EN3A 1P84K 1OHQA 2D7PA 4QHUB 2LU4A 3IJHB 3NZHL 4JREC 3RVVD 3L3OB 2DQCL 3KPOB 2H8PB 1J0YA 1CD1B 1Z5LA 2V9QA 3KPLA 2YD5A 4MZ3A 5HI5C 3SDYH 3FMGH 4G43A 3SJVE 3OR7A 4FS0A 2XWTA 1VADA 4WFHE 4PRPA 4U1NA 2VXVL 2BVQB 2MCPL 3NFSH 3X12B 3SGEH 4QWWC 4PJIE 1NL0L 2EDTA 5T1LD 3QUMA 5T1LA 3CFKA 1MIEL 5DYOA 1QYGH 1KCUH 4YDLC 2YRPA 4PPTA 4KKBD 3T0ED 1JHTB 3T0EA 2FD6L 5EFIA 4LPXA 2HJLA 3U4BL 5I76B 1AD0A 1DDHB 1Q9LB 3Q6FA 4H0IA 5E2UL 5KSAB 3PQYB 3U7YH 2DL2A 5C0ND 4L3CB 1RD6A 4FXLA 3DTXB 3BE1H 2AQ2A 4OUUA 1HKFA 1VERA 4Y7MA 5DDHA 1MFAL 3RVXD 1Z9LA 4OTXL 3AAZA 4HUWA 4D0CB 4JFPA 5FYLD 5KANG 1XCQB 2HKFL 1FORL 3QNZA 4ZPTA 3MGTB 1UB5A 3GI8H 3CCHA 1RZ8A 3V6OE 2W60A 1CXFA 1F6LL 1JUFB 4H8WL 2IG2H 3ULVF 3RWCB 4R4NC 4J1UA 1TZIA 3KXFD 3QEQD 5EOQH 4X5XA 1FVDA 1OTUC 1KUMA 2VLKB 3NTCH 1T3FB 3P0YH 5GGSY 1CTNA 5MENE 3UBXI 3OB8A 5C0GB 5HHXH 5E2TH 1RZJC 3BQUC 3BYTA 1IGYA 4CU7A 1N6VA 1AY1H 5GGTH 5DGQA 1GOHA 4ZPVB 4RFNC 3HMXA 5ID1A 2MQ0A 2EYRB 5DVNA 3H3PL 1FIGH 4NQXA 3RIFF 1TVHB 3SDAD 43CAA 1RZFH 3SDAA 3DXAD 3RWFB 3EHBC 1Q9KA 3HRZB 2ZSWA 3RU8H 1CTOA 1KIQB 1CLZH 3EJJX 2WBWB 2BHUA 2AV7A 1JGDA 5CP3A 4L1DA 3GSWB 1NGYA 3LKQA 3LPFA 4G6AD 4GH7B 1RUKL 3LEXB 5IHUL 4UB0L 4NZDA 3Q5YA 5IF0B 3L5WA 1LO4L 3JV6A 3CH1A 3GSNA 2PYEE 4WW2A 3UTSB 4KDVA 4KZEH 4ETYA 2R2HA 1FNLA 2M26A 1JWMA 3BFOA 3DSFL 5DVMA 3WN5A 5I0ZA 1XGQB 4PG2C 1YJDL 2J8OA 1U8HB 3MSPA 1TVBA 5F44A 1A4JB 5I9QC 4EUPH 3JV5A 5IKCA 4NNYA 1A6AB 3J8F7 2EXYD 5DJ6A 4P5KA 1MCOL 4KQ3H 1EHAA 1HILB 4GG8A 6FABH 2L0DA 5F7EH 5KJRH 3O4OC 3QYCA 3SKJL 3OPZH 3QUZB 4V2CB 4XZUA 5AG9A 1HHIA 4LSSL 2FBJL 4XWOC 3EYUH 3SCMB 3S35H 5JHDE 5IP4A 2BCKB 5HSFA 3HZYA 3LN4A 1DQDH 2CIIA 3HI5H 1FLTX 1CXHA 1F8TL 3BKCL 4TVPL 5GRJL 2Q87A 5IG7A 4K8RD 2CUMA 1BZ9A 4I18A 2VDQL 3O6ML 1NCNA 2X44D 3V8CA 3MX0A 1V3LA 3KYKL 1T1ZB 2VH5H 5HHOB 4NC2B 4LDEB 3TO2B 5CGMA 4AH2B 4NNPL 5C0RH 4GMSH 3PG2A 4ODHH 1IMHC 2Z92A 4WU5B 5F89B 2XKNA 2DI9A 3TA3C 3Q2CA 2VWEC 1YEJL 3P11L 3QZWB 2CPCA 3MXWL 3O6FD 2DQGH 5TE4L 1A1NB 2Q8AL 2A6JB 3QISA 4H8WC 1FSKB 1BM3H 4U1JA 2EH8H 3TA3A 1Z6JT 2HH0H 3NCYP 5C7XH 5F9JB 4NHUB 1TDQA 3QFJE 3V4VL 5JDJA 4JQIL 4U1LB 4X9FA 4ELMB 1EK3A 5BQ7A 5ACZB 1GC1H 4J23A 5I30L 1SJEB 3HB3C 4PGCA 1AXSB 2VXQH 5E8DL 4TNWK 5IBUB 3QQ9D 4JFFE 3QHFL 4X99A 4HJGA 4PJGB 2WUBH 2FJGB 1IM3A 3NA9H 4L3EB 2ARJQ 3BEWB 3V4PL 5DRZA 4Z7OF 3MTRA 2GITB 3U2SB 4ZO7A 3O9WD 3KWWB 2YD1A 3TJEH 4JM2B 3IDUA 3VXME 3ULVD 1ES0B 4QTHB 1ACZA 1GZQA 1II4E 3MRNB 4GAGH 4OZGF 1U8QA 5HJ3A 2VLJD 2B20A 1U93B 2GJJA 2VLJA 1FFPA 3VWJB 4KROC 1I4FB 4I48A 1U8PA 5IHLB 3IF1B 4Q58C 4HCRA 4AMKH 5F3BA 1QLEH 3GM8A 4S10A 1KG0B 4F80A 3KJ4B 5E5RB 5JXED 1OWRM 2K9UA 4MNGE 4MNQE 4K23L 1NAKH 4MVBD 1BZ7B 2Q8BL 5DVKA 1CVRA 4O00A 4NJ9H 3PV6A 4NO0D 4NO0A 4UV7L 4JQXA 5I8OL 4YHPB 1XIWB 4AQOA 5KN5B 3O3DA 3VXNB 2ARJB 5IMLB 1T6VN 2MQ3A 1HINL 2ZCHL 2CDGB 2ZJSL 4HKJB 3ARBC 5JW4M 1OGTA 4I2XE 1PG7L 4GKOA 4N5UA 3ZKNC 2VE6A 1J1XH 2LTQC 2HWZL 1EEUA 3D39E 2Q76B 2YA0A 1IM9B 5E2WL 3EYVA 3ARBA 1RULH 4JPWH 1IC7L 4XTRC 5FECA 3G04A 1Q9OA 1FAIL 5K9KB 4YGAB 2IQAB 2JKXA 2BNRB 3ZLQC 4JJ5B 3MNZA 3GSVB 5ILTH 4F7CB 2QV2A 5KSUB 1VGEH 3N1QC 3BZEB 3QI9B 3VRIA 2ZCLL 2XOTA 1JZ8A 1DEDA 2CRYA 4KK5C 2X4OA 1OD7A 4QXWA 1J7VR 4BZ2L 4UUJB 5I66A 4I13B 2VSCA 1IAMA 3OJMB 2BJML 5D7IB 4HLJA 4QYOA 3FB8A 4U1MA 1UACL 4ZAKC 1BLNA 4RGND 3F8UB 1A3LH 4LKCA 1Z0MA 4JFDE 1NAML 1VACB 5DUPL 3TCLB 5LAXB 1S7RB 2UY6A 4O02L 2EE2A 5FO8A 4OGAC 1I7TA 4ODXA 4X0KA 1BIHA 1EHLL 1WSST 4Q0XH 4G8GB 1P2CB 4YHYC 2EDRA 1X5XA 1IILE 3MLWH 4JY5L 2YD8A 3U0TA 4UNUA 1EUUA 3CSYB 1OP5H 1N64L 4G6JL 5T33H 2WWKT 1ITCA 4AT6A 2ORBL 2YBRA 1KN4L 2HT2C 1MFCH 5DK0B 5JMRA 4PTUA 3IU3B 4IRSD 3S36L 3FN0H 1I7UB 4PGEA 4NNXA 2FH6A 2RJMA 3A6OA 5L0QB 3CSGA 5J1AB 2B2XL 3UBXB 3DRQA 4RAUA 1HYSC 5GIRA 1PZUB 4NQDE 3D1MC 1T1WA 2BNUB 2A6IA 4HHAB 4WUUD 1OTTD 4WUUA 4FN0A 1LP9F 3MV8D 2RFXA 1RZ7L 5F9WB 1RIVL 1NMAL 2MPAL 5DFVD 3G6JB 3CVHL 1XFPA 2ZSVA 4V1DA 1C12B 3DIFB 3HA0A 4WI4A 2V9RA 4KVCH 1WCBB 3KR3L 3ULSB 3PHOA 5EWIH 5HGBA 1NGWA 4HX1B 3QG6A 3FQUB 1HEZB 1MAMH 3OAYK 2E9BA 1URLA 3IFNL 3QUXD 4U1IB 3FOLA 3QUXA 1IAKA 1SM3H 3BUTA 3IDXL 7FABH 3LMJL 4FQCH 4Z7QF 1WIPA 5E8NB 3V52H 2HFFA 1JPGA 5ADPH 4BFGA 3OXRA 4Y5VA 3ARZA 5FYJU 4V2BA 1J0HA 1NKOA 3SDYL 5C0DA 3HZKA 1AO7B 3ARGD 2JJSC 3KPSD 3QULB 1ZHKB 3ARGA 3KPSA 4DK3A 4Z7VF 4LBEA 2BVUA 3FQWB 3G6AB 4YK4B 5GZOC 1W2KT 4JANA 1TITA 3KLAA 4PJAB 3OJDA 4X6DA 3CFIC 3RNKA 3UYOD 5D1QC 2DTMH 1JRHH 3X3FH 1DUZB 1KCUL 5HHME 1E28A 2IAMC 4JPVH 1EX0A 2WIIA 3ZDZE 4DFHA 4P2QE 1U8IB 5DHYA 4LEXH 1FL5B 4P4KB 3OB0H 5DJXB 3H0TB 3SDCC 1FE8H 1SYSA 4HUXB 1T4KA 3BE1L 1MEXL 3OR6B 2HRPH 2PO6B 2IBGA 3GJFA 3GIZH 3NCEB 5D7JB 5CAYB 3PDOA 4CMHB 3GI8L 5BV7H 1C7SA 4Z7NF 5EOCH 4OJFL 5KG9B 3B2UD 2XFXA 2GKIA 3MV01 1A2YA 1L6XA 3RZCD 1U95B 5C0JB 3RZCA 4M1CD 3W82A 3LKOB 1G7HB 2GJ6B 4JO2L 4TSBH 4KJQC 5D1ZB 2BY1A 3VXPB 2E9JA 2LU7A 4Z9KB 1B0RA 4LLMA 2J6EA 3RVUC 2FJHB 4LCYB 5D9SB 2P8PA 1NAMA 4ONFH 4RISH 4OCMC 1FIGL 2M2DA 1RZFL 5GRYA 3CLEH 4QRQB 1BQHB 1PYWB 2XG4A 4WHDA 3TBWA 4PV9A 2E8ZA 2BOBB 3KPNA 4EN3B 1QSEA 4OZHF 1GL4B 4PJBB 1V5JA 3T8XA 1KB5B 2FB4L 4N0RA 1S7VA 2NTSP 3UC0H 3P30H 5EORH 3X14A 9CGTA 3UTZB 1B9ZA 3ULUF 4MAUL 2VQUA 4DCQB 2D4DA 5MEQA 2V7HA 4MD0A 4HUUB 4Q9CA 1JJUA 4KZEL 1KJMA 3VFPA 2NXZB 5TQ2H 4XNMA 5T1LB 3CFKB 1DBAH 4MZ2A 2N56A 5DZNA 3ZL4H 1UCBH 3CIQA 2HP4A 4CW1A 3MBEC 5FEBA 2HTKC 1IEBA 3N1FC 4KWUA 1CR9L 4P9ML 1ACYH 1LHZA 1MIMH 1VDGA 1S8DA 4QRPD 5JQ6L 4QRPA 4KQ3L 4L4VB 5C6TH 1S9YA 5DD3H 1LP9A 3G5ZB 5D7KE 3T4YB 5I1KH 5KJRL 5JW5B 5ALBL 3MBEA 1IGIH 3GBLA 3HG1D 3HG1A 2V17H 1WFUA 3Q5TA 3MREA 4MD4B 3QNZB 3UMTA 3FTGB 2W60B 3V8OA 3UJIH 3V5HA 1E4XL 1DE4B 4Z5RA 4MA3B 2Y5EA 3KXFB 3QEQB 3HI5L 2IANA 4HF5H 4Z95H 1R0AH 1IC5H 3DV6A 4GG6E 4FHBD 4POYA 2VTFA 1NBZB 1WBYA 2UY7A 4X6FB 4GOSA 2KZ1B 4YZFE 4BA8A 3S3JA 3FRUB 3FQNA 4GMSL 3GNMH 5ID1B 4JO4H 1YMMA 1OGAA 5HD8C 4YHMH 4NQXB 2XA3A 3SDAB 3DXAB 1I7ZB 4DKAA 2DBLH 3VGEA 5CCKH 4Z7VA 4PRIB 3ZT7A 2A38A 5HGGS 5DUBA 2XNAA 2A1WH 3X11A 2NW3A 2AP2A 4YAQB 1A22B 1BM3L 2AV7B 3PGDB 4XP4H 4Y19E 4UT6H 1MUJA 4AJ0A 2FLBT 1VEOA 3ZKMD 3L6FA 5EG6C 5GRUH 1GC1L 5HI4D 3VD4A 1LNUA 1MCCA 3BAEH 5ICZA 3U9PH 2EKSA 1DVFD 3GSNB 1DVFA 4MX7A 1DQLH 2WUBL 4UU9A 1T89C 3OKLA 3SEPA 1IRAY 4U6TA 3NACH 1ORQA 1WZ1L 3N85H 3QDMB 1BFVH 3TJEL 4BUHA 5AYUL 3UTTE 2L7UA 1R24A 4MJ2A 4N1CA 4L8DB 3S37H 4Q6IA 4NUGL 3UP1A 3TN0A 3LPGA 4NQSB 3BP5A 4PR5A 4P46B 3B9KC 2NX5B 3IVKA 3CX5K 1YYLH 5AUMA 2EEAA 1MELA 4Q97A 2OBGA 4AMKL 4XBPA 1IC4H 2XQYK 1HHIB 2VLLB 3KPMA 3SE3C 2KQMA 1NAKL 4I3GA 4M62H 2NTFB 2X09A 1JYVA 2YD9A 2UWEF 3INUH 1OB1B 5GPRA 1HHHA 3TYFA 4PP2B 4F57L 3LN4B 1QFPA 2CIIB 5T1DH 5KTEL 3FFDB 4XPHH 5L88H 4IMLB 4OZHA 3MO1A 2AAVA 3RTQC 2Y23A 4AEIH 3FB5A 2EDYA 4WHCA 4Z7UF 4YH6A 4JFYA 5DXWA 4ZYKB 3I75B 2FCBA 3MOAH 1DTUA 3D5OF 4R2GB 4R9HA 3ULUD 1IAIH 4WEBH 1YEDB 4X9BA 1VEPA 3WFHA 1K4DA 3TVMD 1Z0NA 3TVMA 4CN1A 2VDML 2PCPB 1Q72H 4J3TA 4OIAA 1P4BL 5HYQA 3HPJB 3O6FB 4TRPH 1LO2H 4JRYE 4GLRI 5IT2L 2I07B 1D5MA 4ODUA 4CMMA 4AQ1B 5E0QA 5ILTL 3GK8H 1S5IH 1EAPB 2DIBA 3QDJB 2J2ZA 4G3YH 1XF3A 5BQ7B 4O2EA 5DR5H 4PGCB 3BJ91 3HMWH 4U4BA 4UBDC 4UOJA 4PJFB 4LSUH 1OP9A 4OD3H 3SKNB 4G42A 3OGCB 3KPPA 3MLVH 3J7HA 3O9WB 5D70H 1A3LL 4H26B 4PB0L 2DKUA 2DQTL 5ICYA 4R0LC 1K8DB 5DI8B 4PJEF 1OSPH 4JGUA 1SYVA 1IE5A 4Q0XL 3D25A 2X4NA 1UGNA 4Q9QL 3PDDA 4UT7H 3OKOB 3VE0B 4N90E 1D5ZA 2ADIB 5DHVH 1CFSA 3SGDI 1GC1C 3RY6A 1W72H 5T33L 4JPKL 5GS1A 1MFCL 2XICA 1T04B 4K3GA 4QCIB 2D7OA 2YRLA 1U58A 2NY2C 3FN0L 4YNYA 1VENA 2X70A 3U46B 3UZQA 1TJIL 3VWKB 2VZTA 4HBQA 2Z31D 5C0IB 2Z31A 1ZE3C 5D7LE 5AZEL 3O3DB 3PIQB 4HPOL 5HY9A 3QJFA 2JELL 3GGWB 4HC1A 2OSLB 4EI6A 3WFZA 2DD8H 1HHGA 3U4EA 1HYRC 1KJ3L 5J57B 5DJZB 1JE6A 1KN2L 4QHMA 3VFSB 5JW4Q 2ZCKL 4KVCL 4Y16B 1ONQA 3VFRA 1R3IH 2DMCA 2FEDC 2M8XA 3FFCE 3MBXH 4UQ2A 4U6HB 4B53A 4P3CH 1MAML 5EZJA 5I19L 3QXTA 1WAAF 7FABL 3QJHB 5MEOB 4FQCL 4FXKA 4RDQF 3BISA 5E4EC 5TE7L 4FQQB 1NGPH 3C6LD 5TE6H 5HYJB 3C6LA 4XB8A 4JE4B 2X4OB 4OD2B 2W0FA 2E7MA 1ZGLM 1RPQA 4F2MA 3QBTB 1Q9WB 1JWUA 5I66B 1I1FA 4MMZC 1MWAL 5JXAH 1NBQA 3WJLC 1I3UA 5E9DA 4PLJD 2XWBA 5LJYH 5FOBB 5DRWA 5ISZB 4M93B 1NGQH 4QYOB 4K3EH 3TBTB 2X1QA 1OTSC 5HHNA 2C1PA 5LQBH 2UWEA 3WJLA 2DTML 1JRHL 3ZTNL 4R7NA 4JPVL 2VXUL 3W2DH 5BJTB 1I7TB 1BHGA 4OLZH 4GBXD 1G7QA 2NXYD 4GBXA 4PJ7E 3HZMA 1FE8L 3SPVA 5FF6A 3OMZA 4MAYC 2R2EA 3U0TB 4XMKH 5DMYA 1SBSH 2H45A 2HRPL 4XWGH 3WKNA 3LY6A 3V5KB 3VDAA 3MRIA 4EDXB 2GTWA 3HE7C 4PTUB 4YDJB 4H1LB 2V2XB 3V2AR 4IRSB 2HFTA 4UDUB 3CFJB 3LEVH 1SY6A 1D6EB 4P57A 3DRQB 4JM4L 4ODTH 3HE7A 2DLGA 3BH9A 5DURD 3WEXA 1CL7I 1ZHNA 1YMHA 1G7LB 4HKBB 2BSTB 3STBA 3MV8B 3NCYS 1KTDA 2AQ3A 1T0PB 1UEYA 4JFOB 4I0PC 1ZLWH 15C8L 2JCCF 5F6IC 2ZNWA 4ZS6C 1FZJA 4QRRE 5DJCB 5EC2B 5FAAA 4GAJH 4RBPK 5HHQB 3CLEL 3P0GB 3C9NB 3H6JA 2H3NA 3QUXB 1L7TH 3TJHD 1MH5B 3O2WH 3OKKA 1FPTH 4E9LA 4ZUTB 1JYXA 1NCCH 1TFHA 4IOFD 3QPXH 2UVFA 3NIFE 4RNRB 4WUKL 1WITA 4PRHD 3MCKB 1A47A 1JPGB 4PRHA 2A73B 4N9GA 2YXFA 2P42B 2IGFL 5GRVK 3RDTC 2KL6A 2J1KA 4OZGB 3EYQD 4M8QB 5H35A 4PJEA 1V8HA 4C54A 4G6ML 3UROR 4LCWD 2BC4A 4LCWA 5HBBA 5DUMH 3UC0L 4GQ9H 1E6JL 3VD9A 5BS0A 1LEKB 4E41A 4PJIF 1AGCB 3V7AE 1QO3B 1MVFA 2NMSA 2F53D 2NY3D 1I3VA 2Y36H 3HI1A 2F53A 3KLAB 4AENB 1RK1A 2I9LB 1JGEA 3MROA 4LLDA 1DBAL 3SBWA 3K4DA 2YD4A 2R29L 1XGPA 3ZL4L 3VFOA 2WIIB 1IBGH 1ACYL 1MIML 5HVGB 5DHYB 2LU3A 4NT6B 5D72H 1MLCB 2NY6C 5LG1A 4WO4C 5C6TL 3D9AH 1CI5A 5DD3L 1T4KB 3ZHLA 1HXYA 5KSBE 4Y8AA 5I1KL 1IT9L 1OAKH 5ERWA 5HXMA 3AS3A 1IGIL 3MRFB 1QKZH 4BJLA 3C8KB 3WIHA 5F9OL 5F1NB 1GXEA 1NUGA 2JLLA 3UAJC 1AKJD 3CXHK 1NANI 5EUOE 3HHRB 1AKJA 4YDVA 4F7TA 3C6SB 1UQSA 2QJDA 5GISH 1LMKA 4Z95L 1WAAA 5EZIH 1R0AL 3CFBB 1IC5L 3ROLA 3S36X 1MWAA 2NY0D 3KPRE 4KKCC 4S2SA 4M7LL 4KGLA 4CNIA 1QRKA 3GSRA 1I1AD 1CK0H 1I1AA 1NLBH 3QIWD 5E03A 4JVPA 3QIWA 4KK8D 1A3RH 4FQXB 4DGYH 4M3JA 4JO4L 1CLYH 4LL9A 4HK3N 8CGTA 5F7WC 4LVHB 4YHML 3LZFH 4E0RB 1CS6A 4Q7DA 1TIUA 3RWHA 4W6YB 2DBLL 5CCKL 2EIBA 3TBWB 3I6LD 3TPUA 2HYMA 2GT9A 2FX8H 1LILA 2V2TB 1KPUB 4LMQE 1X5YA 3RWIA 1I8KA 1UJ3C 4HS8L 2ITDA 1AC6A 4UT6L 4RMRA 4MLSA 1IGTA 2OR9L 5E24E 1I9RL 1W0VB 3T8XB 3ZDXE 2DQUH 2GJZA 3BGMB 2HMID 3RGVC 3IAQA 3ESUF 1UJ3A 4K94H 4Y2DC 3SY0B 1UB6A 2B39A 2C5DC 2D2OA 2A2QT 1DQLL 2AJ3A 3QIBB 1NLDH 4MD0B 3EJYD 3VD3A 1FZOA 1KPVA 3NACL 4XC1H 5EIQA 4X9HA 1BFVL 4R3SB 4XNMB 3MRJB 3TP4A 1ERNA 3S37L 3L5IA 5DEGB 5D1XD 3HNTL 3T2NL 5D1XA 2APWA 4UNTA 3UTQB 5EC1A 3H8NA 5IIEA 4NFBA 3RWJA 2DDQL 1AR1D 4BQBA 1JV5A 2V7NA 3U9UA 5LGJA 3HG1B 2JCCA 3D0VA 1ZTXH 4M62L 5ESVA 1JWSB 3L3IA 4RDQG 5B39B 4Z5RB 4M03A 3PABA 5A2KH 5CBAA 4C58B 2GUOA 3DV6B 4KRLB 4IDLA 4JG1H 5L88L 4JFEE 1U42A 4I9WE 1OP5K 5KAQF 3BYYA 1B2WL 1HWHB 1NSNH 4Y4FC 5I18H 1K2DA 3W9EA 3HPLA 3SJVD 4WWKC 1FFRA 3SJVA 3IXAB 1TJGL 3EIFA 4WFHD 1CD9B 3MOAL 3GSXB 4XPAH 4Z7WB 4ONHB 4WTZG 3JV0A 1IAIL 2V5MA 4Y4FA 4PJIA 3VW3H 1MJ8H 5IM7A 4WWKA 4OCWH 3CDCA 1IFHH 1Q72L 5F70A 1TPXC 2XNAB 1O0VA 2ATKB 3B8YA 5C08D 1LO2L 5C08A 2FYYA 3OSKA 4ZOEA 3I50H 3PQYE 3O11B 3GK8L 4OFYA 2CH8A 5HDOA 1MUJB 3I02B 1L9NA 1ZA6B 1RAMA 4G3YL 1K8IA 3HRPA 3IDGB 3KPTA 4BH8A 3GSUA 2YWZA 3L7EA 2YA1A 3BUYA 3HMWL 1K4CA 1AXIB 3B4NA 1QRNA 4MA8H 3V6OA 5F7YC 4YWGL 5CD3A 3MNVA 4KK6D 1TMCB 2CKNA 4HWUA 5D6CB 1O7VA 1JHLL 5MEND 1QFWL 4J6RH 4MA1C 2VISB 4UTBH 2BX5A 3FKUS 3C5ZC 3MLZH 4Q6IB 5F88B 1AGBA 4XH2B 1HI6A 5GGRB 1XGUB 5DSCA 3BPOC 3F62A 4MSWA 5AUMB 4LQFH 4I5BA 5CSBA 1V7MH 4NQEE 3LS4L 5DK2B 3BP7A 4AG4H 2IPTH 4NN6B 4W4OC 1A6VH 2VC2H 3EYFB 3KPMB 4K07A 3QAZC 4G9DB 4XRCB 4LSRH 5HYSB 4XHQA 3BW9A 3GSQA 4U7MA 2VO5A 3BGFB 4MCYA 3VXSA 4HXBH 2Y6SC 5DEFA 4ZTOH 3VFMB 3GB7A 3OB0K 1HHHB 5AWNL 3ROOA 4H0HB 4PG9B 4Y89A 4EI5D 3LDBC 4HH8A 5GZND 4EI5A 5INDB 4DN3H 4OZHB 5BW7A 3MLUL 5JLZB 2EXWD 2G60H 3DX6B 5BCAA 4NKMB 4EJ1C 2PYED 3FQXA 1UH4A 2FR4A 2WWKO 1VB9A 3UTSE 4HIXH 4S1DD 5CZKA 5E7BA 4BSWA 4U2ZA 5I71B 5EBLB 4LLUB 2JB6A 4M5YH 5ACLA 5FGRA 1XF4B 5DS8A 5HYQB 5F7DB 3GMOA 2RB8A 2HFGH 1JF1B 2ERJB 4S0TD 5DQJB 5FM4A 3MRRA 1TQBC 4L29B 2WWMD 4M6AA 5D2LB 3VFTA 4OZFA 1A14L 1IKFH 5F71A 5J12B 1JL8A 3TNMB 3GIVB 4S1SL 5JR1H 4PY8I 5IJKC 3IETA 3MGOA 5JPMA 4JVUA 3MCLH 4MA7L 3PHSA 5JHDD 2ICES 5C8JA 5JHDA 1NGQL 4MQSB 4Z18A 5GXBB 5LQBL 3OKNB 2XZCL 5L8JB 4IOSD 5E08H 1QZ1A 5HHOE 3F58H 5ICYB 3Q3GB 5EO9B 1A1MA 5K9OB 3E2HC 5I8KL 3F12A 1DBKH 3H3BC 3OXSA 1AGEA 4YBHA 4BZ1H 2X4NB 3QG7H 1RZKH 3LQAL 4P2OB 2VABA 3DVGA 3O3BB 4M02A 4O51A 4ZFZA 4XMKL 1YEGH 1G6RB 3EYOA 2D7TH 1ETZA 1GGBH 1MCNA 4D8PA 5I1IH 5IOPA 4PGBB 2VKWA 1S7QA 1X5GA 1KIPB 1A6PA 1FL6B 1ZVSA 3DGGA 3W39A 3AS1A 1JGUL 3DI3B 1T1YB 3LEVL 4W70A 2NR6C 4MB4A 2VXSH 1A7OL 3B9EA 3QFJD 4GS7C 4ELME 1P5VA 1KCVH 5MI0B 3VG0L 4UDTB 3O45A 3HAEH 1D5IH 1WVZA 3WO4C 5EA0H 1KEMH 1HHGB 2ZNXA 1EJOH 3BPCA 4JFFD 2MFNA 4JFFA 2E7LC 5DRNA 4QHNB 1Z3GL 3BPNB 4QHMB 5FGSA 4A2LA 1ONQB 3CVIL 2RR3A 4ZXBC 4EIGB 2ED9A 4OZFG 3HC0A 3VXMD 4OLUH 4BFEA 4XCFH 3ZYIA 1FL3A 2E7LA 3P73B 3BIAX 5CHNA 2NLJA 1G0YR 4GRLB 4FXKB 3IDNA 4JEGB 3NCMA 3ET9F 3QPXL 2MKLC 3MUZ1 5FUCE 4TSCH 2PUQT 3NCBB 3BZ4A 2BRQA 2NY4C 3O3EB 3H9YA 3MR9A 2WANA 4KVNL 3M1BB 4ODVL 3MRPA 5DUML 4MNQD 1A7NL 2DIJA 4MNQA 2B1AH 4HSQA 4OIBA 4KU1A 4TNVF 4RIRB 4AIOA 4F33A 2X4PB 2IMNA 4QRTB 4YBLB 4F7MA 1JN6A 2BNQD 3UO1L 1BMGA 3ZDZF 2BNQA 2ICCA 5CZVH 2CKBB 1GIGH 2C1PB 4EBQH 4YHNA 5KAQG 1JBJA 1GGTA 4LCUB 3LV3B 3WFCH 1HSBB 1U6AH 3HE6B 4P5TD 3CAFA 1I1YB 1XR9A 4P5TA 5CKAA 3GBMH 4L8CA 4KHXH 1IBGL 1TZHA 3Q5OA 4PGDA 3WCYA 5CIPB 3SGKA 5D72L 3OKEB 4GBXB 1ROWA 5EB9A 3KYMA 3D39D 3MJ7A 2P5EE 1A02N 1OAKL 4Z7UB 4PJ9D 3MZTA 3GBNH 3BXNB 1H3VA 1WFNA 2Q86B 4YDKH 3VXQA 1CU4H 1FNEA 1RJLA 1BFOA 2A6KA 1C7TA 5GISL 2ICEB 1N4XH 2H41A 1UXWB 5LWYL 4IHOA 5I1GH 1G9NL 5DURB 3HI6H 1YQVL 1F02I 1WJ3A 5FB8A 5D7IE 4DUWA 1M71A 2HLFD 3S7GA 2B8OT 1NFDB 4FG6C 4KQ4H 1R5WA 3QDGE 4LCCC 5D2NE 3LQAC 3CDYA 2W65B 5IBLD 3P0VH 4XMPL 3PWVA 1CLYL 1FZJB 1QQDA 3I6GB 1AR2A 3LZFL 3UJJH 4IJ3C 1JNNH 2MCG1 4JFDD 5JW3H 4JO1L 1NCDL 2LFGA 2F19L 4OLXH 2FX8L 2FHBA 5D2NC 5EU7C 2WW8A 4G8GE 3MV9B 3CFCL 4PRHB 3M45A 4PIRF 1NGZA 2OJEB 4KKNA 4YO0B 3A6BL 4HFUH 4HKZA 1T5WB 1NMCB 8FABB 4LIQH 3PP3H 5IW6A 5J13B 5IMMB 1PDKA 2QQKH 4DEPB 3IDJA 1YDPB 2GAZA 3WIFB 4GW5B 3WFEH 3WDIA 1FYTB 2ZOKA 1C5CL 2X1OA 1NLDL 3T04D 4J12A 1BIIA 5J6GB 4NQCA 2NY3B 3C2AH 1JFQH 1P9MC 2EDQA 3JWDL 3G6DH 4NQDD 4M7ZC 4NQDA 5HHPB 3UDWC 2HA1A 3AVEA 4GKZA 1T7VA 4N0FA 1L0XA 4HJ0D 4Y5XC 5ADOH 5I6XC 2RAMA 1UWGH 1I8LA 5JPNB 1LVEA 3FQTA 1P9MA 2DQFA 2VN4A 3FQRA 1XGTA 5E6ID 5E6IA 3WD5H 1P1ZB 3JVGC 5DMGD 5FV2A 2AK4B 3VDCA 4XCNA 6CGTA 1LK3L 2V5RA 2P24B 5EU5B 5TFSH 1NEZA 1ZTXL 3GMNA 3R1GL 4FFWD 4L8SB 2YUWA 1T5XA 4YC2C 3O8XA 1AKJB 1MCQA 5H94A 2EYSA 4WI3A 4GG6F 4LOUD 1F3JA 1T20A 4NGHH 4JG1L 1DN2A 3EGSB 4YZFF 4D9RE 4O2CB 5SWQA 1QBLH 2VR4A 1NSNL 2NY0B 1X5IA 3LSOB 3DBXB 3GJEA 4NC1C 4N8VB 5CZXC 4HWBA 1F97A 3GUTB 2RIKA 4P2RE 3S97C 5ESAA 3IXTB 4KMQA 3QIWB 4DKEH 1JGVH 3AB0C 3GFUA 3PGFH 2XN9D 3DROA 4XPAL 5EN2A 2XN9A 1M7DB 5LXGH 4MJIB 1S9VB 4HIJB 5FKAA 3QH3A 1INQB 4KPHH 1FV1B 1T7WA 3BT2H 1XR8A 5F7HA 4OCWL 3NZ8B 1IFHL 5HHMD 3TPUB 4NRZB 1DBBH 4NZRH 5I8CB 2GT9B 2VR9A 4P2QD 4R26L 3RWIB 4P2QA 3I50L 3V95A 2ITDB 5CWSA 5HGHA 1IGTB 1UWXH 1G9NC 3NVQA 3MRDA 1EGJH 5GSRB 1FP5A 4JHAL 2NW2A 3ZHDA 4OCNC 3DUSA 3ARDC 3EUUA 2LV4A 1MRFL 1UB6B 4X5WA 3MPCA 4MXQC 1NMBL 5T3XH 1HOCA 5SWSB 3LHPH 2A74A 3ES6B 4LSDA 2YD7A 3P9MB 1FZOB 1CG9B 3BZFB 4GLRH 2QR0B 3I9GH 3NMEA 1FLRH 1F3DH 3MRCB 4J6RL 2GJ6E 1RUPL 4UTBL 5GGUB 2EE3A 4C83A 3NIDE 4I4WA 3SKOA 1EDQA 4MXVE 2FL5B 3MA7A 3EJZD 1PSKH 4X4ZA 2AJZA 5DD0H 3ARFC 4OCSL 4NRYB 1NEZG 4QNPE 5IV2B 4ZQKA 4LQFL 4A6YH 4HS6B 4XCEA 4KK9D 4JREB 2EZ0C 5LGJB 1A6VL 2VC2L 5JIHA 3HC3H 5ESVB 2YS4A 3FO1A 3TYGH 1L9MA 3HC4H 4HXBL 2UYLB 4ZTOL 3BPLB 3MLYH 1F2XK 3PABB 4PJBE 4AIXA 4XMLH 1UCTA 1J8HE 3JWDC 1XMWA 1WWCA 3V7MA 2QKIB 3IT8D 4XVTH 2ADGA 3WFBL 3FRPA 4DN3L 4RGOH 2G60L 3DX7B 3IFPA 1E4KC 3FO9A 1FO0H 3DO7A 4FOMA 4YDLB 5JIIA 3WHE0 4ETQB 2NZIA 1U3ZA 4HIXL 3EYSH 2XTJE 1KXQE 1UKTA 3QUYC 5I1HH 5HI3D 4KAQH 4MD5B 4R7DA 5IFAL 3DWTA 4JCMA 3LIZL 2OLDA 5EBWA 1IKFL 4UOW0 1ZLWK 1ED3B 4QXTB 3QUYA 1YEKL 5D7KD 4W6XB 2N1KA 1JF6A 2CRMA 3QNYA 1F11B 1K4CB 4UMGA 1N7ML 1RVFH 3CSBA 5JO5A 2DJSA 3BQUB 2WSKA 5I17A 2E6QA 4QGTA 5ETUA 4JZJC 2XZQH 4RFNB 1F6FB 1WEJH 3REWA 5MENB 4HMEA 1J0KA 1JK8A 1JZ2A 1SEBA 4OM0L 4GG6A 3THML 2YSSB 3VCLA 3F58L 4WI8A 4XBGA 1G7IA 4F58H 3DSNA 5TDOA 4JDVA 4YUEL 3QG7L 4I3RH 1WTLA 1F4WH 1MCWW 3S37X 5JDSA 4BK5A 2EDXA 1HXMB 1T66D 3BP7B 3WE6B 3UJTH 4PRIE 1XEDA 1D5XA 2CDEA 2P8LB 3E6HB 5FM5M 3ILQD 4J8RA 2ZKHL 2HTLD 3GSQB 3FRPG 4F37K 3RJDA 1EBAA 4HDIB 4PJ8C 4Y19D 3GMLA 5CLTA 4Y19A 2VXSL 3GSOB 3VFUA 5GGTA 1CE1H 1AC0A 2X4QA 3WHXB 1D5IL 1NJ9B 3KHOA 1EJOL 3RX7A 1T6WA 3FB7B 1FCGA 1F00I 5I9QB 2FR4B 2PYEB 4X4YA 2H1PH 1VCAA 4L4TE 4Z78A 5A40E 2JB6B 3QDME 5DT1H 3MRQA 1T2XA 4LCIH 3UTTD 2DKSA 4XCFL 5CEZH 4X6CF 3O4OB 1LE9B 4YHIA 1JI2A 3V4UH 1A7RH 4HKXB 4G6KH 1N3NB 4CGTA 2NX5E 1CL7H 4RGMC 3B6SA 4OKVA 2K7QA 4RWYH 3FO2A 3EO1A 5I16B 3OJVC 4PRAA 1ADQH 1P7QD 3RI5F 1P7QA 4X80H 2B1AL 2FDBP 1OPGH 5JPMB 1Y18A 2HT3D 4YHLH 4EUPA 4GKSA 3P3YA 1KYOJ 3JTTB 3TBYB 3PWJA 4NSKA 1N8ZA 1GIGL 3DVNB 1T83C 3MMEA 4PREB 4MCZA 2BRRH 4L1HA 3IJYB 3FHQA 1U6AL 1T03L 3NPZB 1QLRA 4NN7C 5AEAA 3GBML 4KHXL 2NNAA 1U91B 2APFA 1G7PA 1TXKA 2KH2B 3VDBA 1CGSH 3KNBB 4J4PC 2BSSA 3EYOB 4TTDC 3RVWC 1INDH 5KBNC 3O0RH 4D8PB 4R90H 1AQKL 4QRSB 4CVZB 5IOPB 4FQ1L 3RY4A 4FTVB 2ZUYA 4IRJC 4FQIH 4X8XA 4JRYD 4JRYA 4NO3A 1LO0H 3FJTA 1P53A 4PGJA 4J4PA 5GHWH 2AXGA 3QDJE 1IQDA 5C9JB 3QA3B 1FFOA 2P49B 3MOBH 3PP4L 3QFJB 5FCUH 5C0EB 3PL6D 4OGXH 4IRJA 5E5MA 4ZNEE 1U8MB 5FYJL 3IDMA 2AJYL 3QEHA 4HIEB 1S7SA 4JZNA 4PJFE 2MJWA 1H15A 4QXGH 4YEEA 4JFFB 3CFDA 5F6HJ 1MCRA 5FHBH 3QPQC 2BOCA 5DJYA 2BHYA 1BFSA 4KROB 4PV8B 1MF2H 4ZFOL 5EOTB 1NANH 1JNNL 5I74C 3OKDA 1M05A 5J56B 1QPPA 1FL3B 1PQZA 3VXMB 3WHE1 4QOKE 4MJ6A 3LD8C 4OLXL 3DRTA 4OFPA 3I85A 3H3KA 2DI8A 3NAAH 5I1AA 4TUOB 2PF6A 4PLOB 1GHFH 4HFUL 4N90D 4EUPG 2R1XA 4LIQL 4NQTA 3HNSH 2WBJC 3T0WA 3QIUC 1F90H 2OL3A 4MNGB 4IIQB 4MNQB 3WFEL 1RY7B 1QBMH 2H2SC 1RZIA 3V6BR 1J0IA 3K1KC 5FA4A 5FDWB 3BO8B 4QHLA 3MNWB 1JN6B 5DFWH 3C2AL 2VAJA 5D7LD 1JFQL 1DQJB 3VRJA 3C2SA 1A4KB 4U3CA 4PJDA 5KSBF 5ADOL 4I2XB 4NWTL 4D9LH 1BREA 5CGTA 3WD5L 3D39B 4GQPH 5D5ME 3FFCD 2GSGB 2HT4C 5HGAA 1QBBA 2R1WA 3FT3B 3BI9X 4PJ9B 3CDGB 1OF2A 1FG9C 2BK8A 2VJXA 4Z77A 1C08A 2QEJA 2AVGA 2MOVA 3TZVD 1HDMA 1RJLB 2FX7H 2PTTA 1BAFH 3TZVA 1MQ8A 3H2WA 4HH9A 3VXUB 5HYJE 4JY6A 5F93C 4X6CA 2HN7B 4IHOB 4WENB 4KKAD 1KJ2H 4NGHL 4MHHG 4ZAKB 2PW2A 1QBLL 3DOSA 2R1YA 2EEDA 4Y4HC 1DBJH 5GS2D 4N5EC 1KT2B 4EEEA 4XI5D 4EDWL 5ISZE 1R5WB 1U2HA 3DETD 4DKEL 1JGVL 3MFFB 1DQQB 5LXGL 2H2PC 4Y4HA 4KPHL 5CD5C 3BT2L 3TBVA 4JFDB 4UQ3B 1O7SA 4NUJB 5EPMB 3ZDXF 4RMSA 3NABH 2AKRA 1DEEA 5JA9A 4XHJD 4CJ0A 3HN3A 1ZANH 4WDIB 1EGJL 3ARED 3AREA 2Y5TB 4RQQA 1JPTL 3ECBA 4H5SA 4D9QD 1OAYH 3BMVA 4M7LT 1T2QH 4P4RA 5I73C 2PXYC 5GS0L 1GVIA 3U0PA 3I3BA 3GM0A 3HZVB 4HK0B 4N1EA 4IDJL 2J5LC 3LRHA 3EOBB 4CVWA 5T1KB 4ZFFA 1CZ8L 3MC0A 3BMWA 4JN2A 5EOCJ 3I9GL 1FLRL 5AD0A 4UNVA 1YNTB 1RK0A 3W0WE 4JHBA 4R97C 5F3HA 2JJUA 1LE5A 3U36A 3HNVH 2DQFB 4ODWB 4ZFOA 1A6UL 5E6IB 4A6YL 4QRRD 2R23B 4QRRA 2R2CA 1E4XI 4I8DA 1JF5A 1F4AA 1IJ9A 2O5ZH 1RFDL 5INCB 4QHKI 3SDDC 3GMNB 3U48A 3HC3L 3TO4D 4APQD 3TO4A 4APQA 4LLWA 5H94B 3TYGL 3NCJL 3H7BA 3SO5A 1MHPH 1AH1A 4MDJB 5A16B 1YQ2A 3MACH 4XMLL 5DJDB 4AIZA 1EPFA 3K46A 3SDDA 1CGUA 4RMQA 1CDHA 3FOMB 3K2UH 2F74B 2OQJA 1H0DB 5D1QB 3S98A 3GJEB 1IAOB 1CFTA 1FO0L 4P23C 1YA5A 1GGIL 3RWDA 2IAMB 3GRWA 3F7VB 5EUKA 3EYSL 4U1SA 2PW1A 2F5AL 1M6OA 1G7MA 5BVJB 3SE4C 3ZKXB 3SDCB 2P5WA 3UX9B 3V0WH 1H5BA 5I1HL 3CZFB 4WFGE 5HHMB 1T0MA 1EERB 1NCUA 3MRKA 5GSVA 1UM5L 2F58H 4XVSH 5CWSB 5HGHB 1A6WH 3EAKA 4FNLH 5KSBA 3ILPA 4Z0XA 4DUVA 2YKLH 1S5HB 1X4ZA 3DUSB 2EH7L 2IQ9L 3HUJA 3OV6A 4X4XB 2XPGA 4WEUD 1U3HD 4JZOA 1RVFL 4X5WB 1FZKA 1U3HA 2P7TA 4OAWA 2B5IC 4OQTL 3U30C 5SX4H 2XZQL 5L2KA 1RJZB 4ZDHB 5EO0B 4M9OA 3PJSA 1NCBH 4KRPD 1UZ8A 3KS0H 5EU3A 3KDMB 3KPRD 5IB2B 3KPRA 4F58L 3DPBA 5C09A 2YHGA 3NBNA 2VRAA 5T3XE 4NZUL 1WCQA 4XNYH 4M6OH 4XCEB 5HGDA 5FA3B 3TFKD 4G8EA 4RFOL 1KELH 3UJTL 2DLTA 1FNSH 4XC3L 5EZLB 5MERA 4O5LH 3IRPX 4KHTH 5GS0C 1JTPA 3EO0A 3WNPA 1H3TA 2EEBA 2H26A 2YK1H 5KVFL 3MYJA 4DZBA 5J3HD 3CVHB 3UXFA 4WHYG 1CE1L 2C3VA 1EO8H 2Z35B 4LPYA 4JRWA 4YQXH 4Y5YA 1QFUH 1J5OH 2ADGB 3A67H 2P47B 1A0QH 2B4CH 4JLRA 5C0AE 3LAFA 3W11C 4JO3H 3BHBB 4ZUWA 1IL1B 1H3PH 5BVPH 1KF9B 1QLFB 3S5LA 2I9TA 1KNOB 3MJ8A 1NCAL 2IC2A 1N5AB 4ZSOB 3AM8C 5DT1L 2E27H 3WDJA 2WM0A 4LCIL 1XF2A 3WL9B 3V4UL 1A7RL 3QUMH 4G6KL 4G7YH 1P4IL 1TCMA 4Q9RH 3RVTC 3L9RB 4XGZB 1R3JB 1OWWA 5TJWK 3QXAB 4KI5E 4RWYL 3WS6C 3WSQH 3QRGL 4PRDA 3ORJA 2BDNL 1ADQL 3JZ7A 1MHCB 4OIIL 4X80L 5E8OB 3OG6B 1CWVA 1ORSB 3VFNA 3WLWC 1OPGL 3AUVA 3JWOL 4K71C 1K5NA 2HJFB 4NRXA 3ZTJG 3F5WB 4QHUA 4QF1B 1AGFB 3IJHA 3GMRB 4JPIA 4UTAH 5KS9B 5E6YA 2H8PA 3K80A 3V0AC 3ISWA 1RUMH 3REWB 1CD1A 2DJ4A 3PP3K 3K2MC 4I9WD 1BF8A 3T0VA 5IGXH 3PV7A 4LQ1A 4XBGB 3AFLA 1WFTA 1AIFB 2XZAL 1PLGL 3CLFH 4ZOCA 5DLML 1A5FL 35C8L 4Z7WE 2DBJA 4F9PA 3X12A 1CGSL 3BIKB 3LKSB 1RIHH 3HMXH 4FQJL 3B3IA 3O0RL 1VFMA 1BZQK 1D5XB 5DZLA 1JHTA 1NDMA 2V6HA 3JXAA 2G2RB 3S8WA 4ELMF 5KSAD 1Q9LA 1DDHA 3PQYD 5KSAA 3PQYA 3GMLB 5A43C 3QNXB 3EDDA 3MOBL 4P0DA 3WNOA 4OGXL 2X4QB 5CP3H 4D0CA 1XCTB 5IWLA 1XCQA 1Y0LB 3MGTA 4G5ZH 4QXGL 1QNZL 1JUFA 1WWWX 3RWCA 1LDSA 1KENH 1CDIA 2K3TA 1CGXA 1EEYA 2EECA 3B9KB 4OT1L 4MS8D 5DZOA 3TIDB 1U8OB 1MF2L 1T3FA 3LQZB 4M48L 4TN9A 5ID0B 3RHWK 5C0GA 3UTTB 2AV1B 3L7FB 5E2VH 5IVXE 5CP7A 1HZHL 1I85A 3E6FB 1MVUB 5SWZE 1Q0XL 4UI2A 1HHJB 4LPUA 4OKVB 3DURA 1YEHH 1EUTA 1EVUA 3FO2B 2AABL 2EYRA 3SGJC 4FQ2L 5IHBA 4NQED 1TVHA 1VKXB 1BEYL 1YEIL 4NQEA 3RWFA 2JJWA 1F90L 2DQDL 3HRZA 5CEZE 1KIQA 4EUPB 3IYLW 1JRHI 1JGLH 4QRUB 3NZHH 5DVOA 2YD2A 5DGRA 3MJ9A 3GSWA 1N8ZB 2CLZA 2DQCH 1DQMH 1JNHB 1UWXK 2IH1B 4UV4H 3RPIA 3LEXA 1QVOA 5IF0A 4C4KT 4J3SA 5I15H 4K8RH 3D18B 3TV3L 3ZO0A 4D9LL 2QSCH 1FRGH 3UTSD 3W9DB 2VXVH 3UTSA 4EQ2A 2MCPH 1GZPB 1QG3A 1YZZA 1XGQA 2BSSB 4OLWH 1NL0H 1U36A 1U8HA 1MIEH 4KUCF 1A4JA 2QQNL 4F7EB 3V6FB 1A9BB 1A6AA 3JWOC 5D2LE 2FNBA 4HGMA 1HH9A 4HGWB 5E2UH 3SOBL 4BQ8A 1HILA 1AE6H 1QFWM 5BRZE 4PP1D 5D7IF 1FFOB 2BMKB 2CR6A 4RMTA 4N8CL 3PL6B 3QUZA 2P44B 4KV5E 4OTXH 5H2BB 2ZOLB 1DBJL 32C2B 2HKFH 5TDPB 4YBQC 1GOFA 5FHAL 3SCMD 3SCMA 1B6DA 3CFDB 2Q3AA 2HG5A 2R9HD 2OZ4A 2IPUG 4GSDL 4R0LB 5BMFL 2IADB 2BCKA 2BVPA 4FRWA 4UAOB 5FM5O 4LF3B 5HHOD 4YXKL 4MJ6B 1T1ZA 3N9GL 5HHOA 1S78C 3TO2A 4AH2A 5FK9B 3ULVH 3NABL 5ITFB 4WU5A 4ERSL 1T80A 3RKDD 1ZVHA 2Y7QA 1MCBA 3H3PH 4ODSH 1ZANL 1JPST 3QR2A 5IQ7L 3VFGL 2L7JA 4MQXC 4HCRH 5IHZB 2VQTA 3EW3B 1A1NA 2A6JA 3K7UA 4M61B 4XPGH 4G80A 2PN5A 3JV4A 3IDIB 5F9JA 5D7LB 3KYNB 2VLME 4U1LA 2PYFA 1RUKH 4ELMA 5IHUH 3BKJH 5ACZA 1CICC 4J3WA 4X7TB 4JAMB 5CJQH 3QXDB 5DJ8B 4LRNL 1SJEA 4XNZC 5DHVA 1AXSA 3BEVB 3MLSH 4JM2C 25C8L 3QXUA 1LO4H 2A9ML 1MJUH 2FEEL 2G5RA 2FRGP 3ZKSD 4PJGA 3HNVL 1JZ6A 1KTRL 3D3VE 2FJGA 4L3EA 1MCDA 2JK5B 3BEWA 3QWOB 5E4EB 4MXWL 5I2IB 2Z0BA 3DSFH 3VWJC 2GITA 3U2SA 3FFCB 1T0NB 1YJDH 2R4RH 5CEYB 4PY7B 2HJKB 4U0RC 2O5ZL 5K33A 1ES0A 4RZCB 3HLAB 4NCC2 4QTHA 2LVEA 1C08B 4MB3A 2ESVE 3CJJA 1U93A 3VWJA 2Y06L 4HH9B 2ENSA 2AEQH 1MHPL 3LB6D 1I4FA 1I9JL 4JY6B 1CLOH 3KAAA 1RUQL 3IF1A 1J05B 1I3RB 2E3VA 1XIWC 1KG0A 1EFXB 4POZD 1I8MB 5L7XH 4PJAF 5IBTH 4YE4L 1OQXA 2AJUH 2I5YH 1BZ7A 3BRFA 2Q3ZA 4YGVA 2DYPB 4Y4KD 3CPLB 4YHPA 1P7KA 5CSGA 4FFZL 1F8TH 2QADD 3VXNA 2ARJA 1YC7A 3BKCH 4X9GA 5GRJH 4LPCA 1JZ5A 2Z93B 4MAYB 2CDGA 3KYKH 4HKJA 4N0UE 1K9TA 4F8QA 3DMMD 2QL1A 4Z6AT 4MLIA 3VXRE 2F58L 4PJ7B 4XVSL 4PBVC 1A6WL 1IM9D 1PFCA 2Q76A 2P5ED 1IM9A 2LVCA 2P5EA 3K81A 3MLPA 1YEJH 3QI9C 5A2JH 4H5SB 4CRPA 5K9KA 2IQAA 3MXWH 5TE4H 2BNRA 2Q8AH 5IJVB 2J12B 3GSVA 1VHPA 1E4WL 1JMZA 3KYOB 3MA9H 4KUCD 3NIDF 5IBUG 5KSUA 3BZEA 4I0PB 1FNHA 1EXUB 4OV6F 5E7FA 3UPRB 3HFML 4JQIH 3AU1B 5KSVB 1INEH 1NCBL 4RAVB 4UUJA 4QNPF 3LRSB 1CE6A 5I30H 5E8DH 1ZT7B 5D7IA 3QHFH 4HS3A 1NFDE 4NFCA 4P5MA 3ALWA 4UT9L 5ALCH 4PJHE 2CO6B 3QDGD 2IJ0C 3RIAF 4XNYL 1X6NA 4M6OL 4KDTC 1JNLH 1Z9SA 1KELL 5DJAB 3RDTB 1VACA 2PTVA 3H9SE 4PJBF 3TCLA 5LAXA 5C86A 2EYTB 4KTEH 4KHTL 3VA6A 4FFVC 2ZG2A 3TO4B 2CIKB 2YK1L 1G9MH 3MV9E 3H7BB 4G8GD 4KDTA 2ZWLT 4G8GA 4BSJA 1P2CA 3MUHL 2J8UB 4BFIB 4YQXL 1QFUL 3CSYA 3G9AB 5C9KA 1J5OL 5F1IB 3MODL 4X9IA 1A0QL 1FYTE 4K23H 3SDXB 1IAII 3IU3A 1KB5L 4OCXL 1I7UA 3MYZA 5C2UB 2CDFA 5F9WC 1H3PL 4P48A 3VRLE 1RIUH 3BWAB 4LPTA 5I8OH 4E42B 4U1SB 1M6OB 1G7MB 2NY6B 3UBXA 4WO4B 1CN4A 3GMQA 2P1YA 2B0SL 3D85B 1HINH 2E27L 1H5BB 4HHAA 2ZJSH 5FCSH 4MB5A 3K1DA 2HLAB 3IAPA 5IVNA 3QUML 1I1CA 3G6JA 4G7YL 5E1HB 3MRKB 1C12A 4JFQA 2GQHA 2J88L 5IFJB 1WCBA 5BO1L 2HWZH 3WSQL 3D69B 2AK4E 5KSBB 4HX1A 5E2WH 4XCYA 3FQUA 1KIUA 5IVOA 1HEZA 4P9HL 4BQCA 2A9NL 5IVZB 1FAIH 2A0LD 4JZOB 5D71H 1I1RA 1QFWI 3GJFH 5E8NA 5EUOB 5DJ0B 1AD9B 4N0CC 5FYLL 1JP5A 1LDPL 4BSVA 5B38B 1C1EH 1KGCE 4UTAL 3RGHA 3TPKA 1IGFL 4BZ2H 4D9RD 1YY9C 5HYIA 5F72S 1KCLA 3C60C 4R6UA 3Q48A 2W59A 1AO7A 4P2RD 1ZHKA 2UZXB 4U1HA 5J7CC 1CDYA 3CLFL 5BV7B 1NGXB 1AXTL 2FATH 1MHHB 2J6EH 1UACH 2KBGA 3ARPA 4MJIE 4PJAA 1X7QB 3OG4B 2DQIL 3HMXL 5ECJE 5KOMC 1NAMH 5DUPH 1DUZA 5FKPB 4L9LC 5I1DB 1U8IA 5DVLA 3MYJB 4KJWD 1YYML 3RGVB 4DZ8B 1FL5A 4P4KA 5D7JC 5DJXA 3H0TA 4Y2DB 4CMHC 2OCFD 4KJPC 4HUXA 5F96L 1FBIH 4Y5YB 1ZA3B 3OR6A 1N64H 3HS0A 2PO6A 3QO1B 3UBXG 5C0BE 3ZE1E 5D7JA 4G5ZL 5I8EA 4LHUD 4LHUA 5C1MB 5D1ZC 5KG9A 4XPBH 4X98B 5SWSE 1KENL 1FGVL 1AQDB 1OAXL 3WS3B 2Q1EA 3ARFD 3MJ8B 3O81A 1N0XL 3GSNL 1U95A 1KACB 3CU1A 5DK3A 4AEHL 5C0JA 2VKXA 3LKOA 1G7HA 1IZKA 1PEWA 1TTFA 2GJ6D 5JOFB 2GJ6A 3TH2T 3RNQB 2VDOH 5D1ZA 1RIVH 1NMAH 5CGYC 2XQBH 3VXPA 2MPAH 5L9DH 3V0VB 5IB3B 1RJCA 5C3LD 2FJHA 3SO3C 1LWRA 4AY0A 3EO9H 4LCYA 3KR3H 4EN3C 1S7WA 4S1RL 3CZJA 1ZHBA 3RVVC 3CNKA 3IFNH 4PRPE 4QRQA 1BQHA 1PYWA 5FYKE 4XNQA 3K4ZA 3LMJH 3RWGB 3V79C 4PUBH 1JGLL 3CGTA 4U3HA 4NHCL 4PJBA 1J8HD 4JPIB 1MAJA 1J8HA 1DQML 1WFOA 2BSRA 4UV4L 1KB5A 3OKYA 4JFEB 1F3RB 5A2FA 3JUYA 4WGWB 3AY4C 3UTZA 3C09C 4LGPB 1WT5C 5I15L 5JORB 4K8RL 4HPYL 2GI7A 2QSCL 4NM8H 1FRGL 3T0EC 3VGGA 3AXLA 4G9FB 4KKBC 4DCQA 4GXVL 3FCTB 4ZMAT 5HVHB 4HUUA 4BQ6A 2XTJD 4P9HC 2NXZD 4OLWL 4M5ZH 3AY4A 3B3IB 4UIMB 1T1XB 5C0NC 1WT5A 2R0LL 5E2JA 4UIKH 5BXFB 3RKPA 1NDMB 2Z9TA 5CMAA 4AM0B 3EFFB 3RVXC 3EOAB 4XVUD 4L4VD 2O61B 1FJ1B 4L4VA 4RMVA 4HEPG 1AE6L 3MLRL 1PKOA 4PJFF 4NWUH 1C5DA 3G5ZA 3T4YA 4LHUG 2X89D 5JW5A 2X89A 1MEXH 4N9OB 1T7XA 5EZOH 3VGAB 1G7JA 5LKNA 1MCEA 4LHQB 3KLHD 4MD4A 2BVOB 3FTGA 3C5ZB 4OJFH 1DE4A 2G9HB 2Y9RT 4CAGA 1EEYB 4MA3A 3KXFA 1KFAL 4TSAH 2OTWB 5HPMA 4LP4A 3QEQA 5L6YH 5IK3A 3P9LB 4HQQH 1XF1A 3FT4A 4X6BB 3OWEA 4JO2H 3WO3B 1NBZA 3SDAC 5CP7B 2JTDA 3ULVL 2ZUWA 4X6FA 1BQHG 4EVNB 1NDGA 1RU9H 3FRUA 2D03H 5JUEL 3DURB 1I9EA 4OI7A 4ODSL 1JZ3A 1N2RB 2W07A 4NQEB 5DJ2B 2DQHL 3DXAA 1I7ZA 3U4AA 4PRID 1OARL 4PRIA 2OS7A 4G6AC 4HCRL 1CXIA 1GGCL 4OD1H 5T3ZE 1PAMA 2CSPA 5F7NC 1JIBA 4L3AA 4XPGL 1VFAB 2VZ1A 4YAQA 1ZT4B 3PGDA 1Q94B 2CLZB 3P2TA 5J11B 4NOBA 1KB9K 4WW2C 1BD2B 3RPIB 2FB4H 2VERN 3BKJL 1QVOB 5CJQL 3WN5C 4OBSA 3MLSL 3S6CA 5D5MF 1JNJA 4MAUH 1MJUL 4HUMB 1JVKA 3WJJA 3VGFA 2GSIA 5LGKA 3KYAA 4L4TD 1OSZB 2EXYC 4L4TA 1TQBB 1WZKA 4TUJB 3QDMD 2NY5L 2R4RL 5IQ9B 2HRLA 3QDMA 5MP6H 2DRUA 1D5BB 4J3VA 3VJ6B 2BY2A 4HAFA 4IS6B 4L8DA 4OGZA 1CIDA 1ZOXA 3U6RA 3U7WH 1CR9H 4P9MH 5EULV 4NQSA 4P46D 5JQ6H 4P46A 4FABL 1HH9B 2NX5D 4U2YA 2AEQL 2NX5A 1W8NA 5MEPB 3VFWB 1CLOL 2YC1B 4PJXB 3H9HA 4DFIA 2YA2A 5ALBH 4GKNB 1LK2B 3WLBB 1G1YA 2VLLA 1A9EB 5D93B 4JHWL 4PD4K 4ZOAA 5F1OB 4NZTH 5IBTL 5L7XL 2AJUL 2NTFA 4I18C 2I5YL 4K8RC 1FDLH 2APVA 1E4XH 2HG5B 1OB1A 3RRQA 3E2HB 4CUCA 3DYMA 4PP2A 2BVPB 4DTGL 1GJIA 1Q8MA 3FFDA 4L8BB 5LBSL 4IMLA 3TIEB 1LD9B 1W0WB 3E8UH 2VWEE 4KXZI 4F3FB 5I1LB 2R69L 4AL8L 4ZYKA 3I75A 3DVIA 3O6FC 4R2GD 5GGQL 1A8JH 2Y7QB 4I77H 1YEDA 1UC6A 4CKVX 4GS7B 2PCPA 5TF0A 3SKMB 3MRHA 2WNGA 4FTVE 5F9DC 3FL7A 3S34L 3HPJA 3O6FA 3LOWA 4M1DL 3WYRA 2I07A 1U2CA 3MA9L 3ZT5A 4G80B 3QDJD 3QQ9C 1EAPA 1S7UB 3QDJA 3JV4B 1DN0B 1A1OA 3PWLB 2VIRB 2PYFB 1INEL 3L3GB 4ZXBB 3MZGB 4ZNEA 1Z9OA 5DHVB 3W81A 3O9WC 4MWFB 5FIEA 1LO5B 1W72B 1HQ4B 4PJFA 4GW4B 3ULVC 5ALCL 4HC1H 1X5AA 1T22B 3HR5A 1ODAA 2F54B 2IPKB 3CSPA 3SKNA 1X44A 3OGCA 2CLRA 1JNLL 1NBYB 1WZ1H 3O9WA 5AYUH 1SVZA 4H26A 4QOKD 3GMPB 4NUGH 4KTEL 4FXGB 1K8DA 4ZUUA 4DVBB 5DI8A 5JXEC 1G9ML 4KJYB 2ATPA 4MVBC 3RZWA 3OKOA 3VE0A 4Z8FH 4YHZL 1K3IA 2ADIA 4JQXC 4A2MA 5KVMC 4X4ME 4ZFGH 5JXEA 3LQMA 4ISVB 3O6KH 4WIQA 2COQA 1T04A 2LE9A 2NZ9D 4QCIA 3TWCH 2CK0L 5A3ID 3NGBC 4YGVB 3VWKD 3U46A 3RHWF 3VFVB 3VWKA 1RIUL 5C92A 4U6YB 3KLDA 4Y4KB 4F57H 5C0IA 2X4UB 1P7KB 1VFUA 2E5EA 4M6ML 1I8IB 3PIQA 1YJDC 2NY5C 2QADB 2Y4SA 5KTEH 1JHKH 3GGWA 2OSLA 2GY7B 1X3DA 3MFGB 2YPKB 3DMMB 1UFUA 1SMAA 5DJZA 4G7VL 4Y16D 3VFSA 2CQVA 4Y16A 5D96B 4X83A 4DKFL 2P5EB 2R0KL 5D5MA 4U6HA 1SJHA 4OV5B 4NQVB 4JRXE 2VDMH 4TVPE 2MKWA 1P4BH 1B4JH 3QJHA 5MEOA 1EHXA 1YC8A 5IT2H 4JCLA 5D71L 3VMNA 2OI9B 4XXDA 4JGJA 4FQQA 3VXUE 2C3HA 5HYJD 1YPZB 5HYJA 3SQOH 5DQ9B 1C1EL 1EEZB 3VD5A 4LLYA 4OD2A 1F4XL 3S96A 1PG7W 1Q9WA 1SY6H 1CE6B 3IDYC 1QSVA 4IJ3B 4LLQB 4RGNC 4HS3B 4P5MB 1CFBA 5ISZD 5FOBA 1H8SA 1CXLA 2X1XR 5ISZA 4J3XA 3QDGB 2FATL 5D2NB 2Q6WA 1U9KA 2J6EL 1ZXQA 3TBTA 5ENWB