2I7OA

Structure of re(4,7-dimethyl-phen)(thr124his)(lys122trp)(his83gln)azcu(ii), a rhenium modified azurin mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan-accelerated electron flow through proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i7oA00
3QJRB 4KNSA 2Q9OA 2IWFA 1MG3C 4BXVA 2GI0A 1AZUA 3WI9A 1RZPA 4E9SA 2XVBA 1A65A 2NRDA 1JVOA 1QHQA 4HCGA 5TK2A 2QDWA 1N68A 3BVDB 4BWWA 1V10A 1L9RA 1EHKB 2YXWA 4YSDA 2PP8A 2WO2B 1ID2A 4YVUA 2HX7A 1JERA 5FC9A 3T6WA 4F2FA 1WA0X 1NTDA 2DY2A 4YSTA 1AZBA 1OE3A 3T71A 4YSAA 1NPNA 2EIJB 2VM3A 1KDIA 3UADA 5I5MA 2AVFA 1BQ5A 5I6KA 1OE2A 4E9VA 2XXGA 3QPKA 4KNTA 2J56A 4HIPA 2I7OA 4KO9A 2FTAA 1AACA 1IBYA 4DPCX 1IUZA 3NJMA 2FT8A 2BW4A 3SQRA 2VSKB 4DPBX 1NIAA 1NWOA 1SDDA 2BZ7A 2EILB 3IN2A 4HCFA 1RCYA 2CUAA 2YARA 3CVBA 3SBQA 3FU9A 4GP8B 1R1CA 1SJMA 3WKQA 4A2FA 4HAKA 1ADWA 1KGYE 1TKWA 4HALA 1GY1A 3H56A 2PCFA 3WG7B 1ET5A 4DP7X 4ZK8A 2FNWA 3PAUA 2PP9A 3PCYA 1ASOA 1PNDA 2WO3B 2P80A 2J5WA 2CALA 2YAFA 1FA4A 4A2EA 1OV8A 1E67A 3NJKA 4KO5A 1M9WA 3TBCA 3SBPA 1T5KA 4A2GA 3UGEA 3AZUA 1GYCA 4M4RB 3OD3A 4GY4A 1E5YA 1PLAA 3FU8A 4G71B 2XV3A 1PNCA 3NSFA 3AG4B 5B1JC 3IEAA 3NP3A 2XV0A 2OCCB 1BQKA 3BQVA 5ANHA 1PLBA 2HRHA 4K9JA 4AZUA 3UAEA 2ZONA 1PZCA 4PAZA 1NDTA 4YSOA 2YAHA 2HZHA 2HX8A 3UACA 5AZUA 3AG2B 1ILSA 2H47C 1AS7A 2PPCA 4E9QA 2QPDB 2EINB 1AAJA 3JTBA 3CZUB 1JZEA 2FJSA 2X87A 2YAOA 2AANA 4YSQA 1GS8A 2FQDA 2GB2A 3QQXA 3S3CB 4ENZA 1AZRA 1AQ8A 1ASPA 4DP6X 3ERXA 4DP4X 2DWSA 4BWUA 1OOWA 2Y69B 2GC7C 3PAVA 3X2QB 4FA7B 3CVDA 3FQYA 1PLCA 2YAQA 2XYBA 3ABKB 1ET7A 1W8EA 1ZDSA 5F7BA 3X1EA 1CYXA 3CDZB 4A2HA 2N0MA 1JOIA 2RACA 1JZJA 4DP8X 2OJ1A 1L9PA 3CVCA 2IDUA 4TXVB 1XB3A 2PPAA 1J5CA 1L9QA 1B3IA 1PZAA 1PCSA 4WKXA 2BZCA 1AZNA 1SDDB 2E86A 3TASA 1OCOB 2AZAA 2HLEB 6PAZA 2CCWA 2PPEA 2BW5A 1V54B 7PCYA 5AFAA 4DPAX 2QDVA 1JXFA 2FQEA 3ASNB 2DYRB 2JFCA 2VW4A 1SF5A 2FQGA 4G72B 2YAPA 4A67A 2XUWA 3EH3B 2FT6A 2PPDA 3HB3B 1KCBA 5I6OA 6PCYA 2IDTA 4A2DA 4DP5X 4E9RA 1A8ZA 2JKWA 2YXVA 3OMNB 2VM4A 3U25A 1FFTB 3D12B 1PY0A 4YSPA 3QJTB 3FYIB 4BDVB 1AIZA 3NJGA 2WSDA 4W1TA 1JXGA 1JZFA 2W8CA 4G7QB 4KOCA 4GXFA 2P80D 1CUOA 3FSVA 1PMYA 5D4JA 3EHBB 1BYPA 1ETJA 3FYEB 3S8GB 1W6WA 2QPEB 3DKHA 4PCYA 4BWTA 4BK5C 5F7AA 1MZZA 4GYBA 3AG1B 3H4FA 3ABMB 2PP7A 1TU2A 3X1GA 1KDJA 3WIAA 1NICA 1L9OA 3UAAA 2QT6A 1JZGA 3AW5A 3S8FB 3TU6A 1A3ZA 4JHVA 5EHFA 3WKPA 1W6LA 4A68A 1OE1A 1ILUA 4L0PB 3IBOA 2PPFA 1NIBA 1WA1X 3N55A 2YQBA 2UX6A 2UX7A 3FS9A 4F7KA 3NP4A 2YAEA 1QNIA 3NJJA 3PAZA 2UXTA 4HCIA 3NJLA 5E9NA 1GR7A 5I5IA 1WS7A 3X1NA 1KBVA 2GSMB 3WNIA 3IE9A 3PLYA 3OQRA 2MRYA 3ZDWA 3NJIA 2IDQA 3T6ZA 4DP1X 2ZOOA 1GW0A 5D4HA 2UXFA 1L9TA 1CC3A 3V9CA 2IH8A 1GSKA 3DTUB 2IAAC 4KO7A 1ZIBA 3FU7A 1M56B 3KW8A 5I28A 2IWEA 1JZHA 3OM3B 4AX3A 3ZX1A 4X4KA 1MG2C 4M3HA 3T6VA 4HHWA 1X9RA 4F2EA 4UF7C 5I6NA 1E30A 3NYKA 2ZXWB 3ABLB 1CURA 4YSEA 3ASOB 1I53A 1PAZA 3PXLA 5A7EA 3FSZA 4FAAB 1X9UA 3L45A 1NIEA 2GIMA 1NIDA 2BP8B 2B08A 7PAZA 3NJFA 1BAWA 3FT0A 5D4IA 4HZ1A 5B1JA 4YL4A 4E9YA 4JKNA 1AG6A 3AG3B 3ZBMA 1NPJA 2BP0B 2VSMB 5B1KA 1A4CA 1E5ZA 2R7EA 3H4HA 4RH4A 1BXVA 4YVNA 5I6PA 3T6XA 2UXGA 9PCYA 2I85A 3S3DB 5B1AB 3NSCA 2W88A 5B3SB 2DV6A 2EIKB 1N70A 1L9SA 4YSUA 1KCWA 4DP2X 1AG0A 2BHFA 1EZLA 2PCYA 2XX1A 4MFHA 2BWIA 1OF0A 1RKRA 2MTAA 4N8UA 2BWDA 4DP9X 5PCYA 4UANA 5I6LA 2ZWNA 3NT0A 3FQ1A 1KV7A 4AKPA 4BDVA 3PPSA 3QJVB 3EH4B 2A3TA 2AZUA 2BP0A 3WNJA 3X1BA 2GC4C 2GHZA 4BXSV 5B7FA 2IWKA 1ZDQA 3NJNA 3FQ2A 2FT7A 2UXVA 2IDFA 1AOZA 1TEGA 5B7MA 1GS7A 4G70B 5IY5B 1A4AA 2H3XC 4E9WA 1TEFA 2FWLB 2JXMA 4AKOA 3FPXA 3TA4D 5PAZA 4Q8BA 2XX0A 3FPYA 4UAHA 4QKTA 3G5WA 1OCRB 4E9TA 4GP4B 4YSCA 2Y1AA 1AS6A 2TSBA 3AY2A 2XLLA 1ASQA 3CDZA 1DZ0A 3CG8A 3X1FA 1MDAA 3FSWA 2J55A 3QJSB 3S3BB 3TBBA 1SFDA 1A4BA 2X88A 1GS6X 4G7RB 3SBRA 1BEXA 1AS8A 1XMEB 3MX0B 2FQFA 3FU7B 1SHXA 1VLXA 3KW7A 1JVLA 1WA2X 1IBZA 2CAKA 3N2JA 4JHUA 1WAEA 3V9EA 4E9XA 4P5RA 2DWTA 4Q89A 8PAZA 3GYRA 4CSPA 4KNUA 3UABA 1RZQA 1AZCA 1XB6A 1MZYA 2HX9A 1CYWA 3HEIB 4DP0X 4GP5B 4QLWA 1NWPA 1ET8A 3IN0A 3JT2A 1V55B 1HAUA 3GDCA 5B7EA 1BXAA 1ZIAA 1F56A 4WTQA 1OCCB 4KOBA 4AKQA 1NINA 1ZPUA 4NERA 2IH9A 4YSRA 1SNRA 1OCZB 5I5JA 3GXUB 1PF3A 1BYOA 4NAJA 1SFHA 1KBWA 1UATA 3EF4A 2R7EB 1GY2A 1BXUA 2I7SA 3MBWB 4P5SA 1AANA 1KYAA 5LDUA 1NIFA 1ZV2A 2Q5BA 1J9TA 2H5UA 2YAMA 4N4YB 2OV0A 4G7SB 2EIMB 3T9WA 2TSAA 3RYMA 1J5DA 4KO6A 2XWZA 5I26A 1SHWA 1DYZA 1XB8A 2PLTA 2CBPA 4HHGA 2BP8A 4CSZA 5I6MA 2GBAA 5B1BB 1PZBA 1AR1B 4AI7A 1URIA 4A66A 3EH5B 2VW7A 1JZIA 3FSAA 2VMJA 1BQRA 2XU9A 3ABGA 1IC0A 1JXDA 2VW6A 4YSSA 2XV2A 2DYSB 4W9ZA 2B3IA 1E65A 3DIVA 1J9RA 2HRGA 3C75A 3NJHA 2VN3A 3QJQB 1NZRA 4EF3A 2LLNA 2XXFA 1SF3A 1M57B 1IKOP 3OMAB 3OMIB 3QJUB 5AKRA 1HAWA 5TK4A 2J57A 1HFUA 2IDSA 3NSDA 2HXAA 1YLBB 2CJ3A 4NB7A 1J9SA 1J9QA 1WS8A 1FWXA 3ZIYA 2BO0A 2AFNA 1QLEB 3NSYA
chains in the Genus database with same CATH superfamily
3D5OF 4RGMC 4NCC1 3S34H 1LO3L 2OFQA 1A6UL 4F9PC 1D2OA 3ULVD 3PJLA 3OKMA 2ATKB 2LU4A 4ZRGA 4XPBH 1QO3A 4Z7QE 2YQGA 2NZIA 3QH3A 1JPSL 1QSEA 1X5KA 4JQIH 5TH2B 2CLRA 2D7PA 3QO1B 2UYLB 3I75B 3MV8E 1N64L 3OB8A 1E9OA 4FXGC 2XBTA 1U92B 3K2IA 1ZLWK 5ADOH 5EZLB 4LEOA 2WO2B 3DMMB 3O41A 4ORGB 5JOFA 4HJ0C 1JERA 1Z9OA 1PDKB 2X6BA 5GHWH 5J3HC 1V27A 2EKJA 1WPCA 1I8UA 3T71A 3HAEG 2FEEL 5IHHA 1NEPA 1DZBA 1UFUA 2ALAA 4N0FB 3VI3F 3QPKA 4KNTA 3GGWA 3QRBA 3GSOA 3U1QA 4LEXH 1QSFD 3IKCB 3V0FA 2IANB 4PMEA 1SDYA 1F4YH 4HEPG 4XXDB 4URKA 3C2SA 5BUGA 1UACL 2CO6B 4GG6A 4GSXA 5MEOB 3NIFE 5IVXE 4R7XA 2ATPA 2CUAA 2YARA 5I1JL 2F53E 3OAYK 1T7YA 3FU9A 1MCOL 1IE4A 1ZVYA 5E99L 3P73A 4HAKA 4JMXA 3C5JA 2G60H 2FBRA 3BVVA 4NZTL 5IOPB 3PWJA 3ME0B 4K73A 4HUNB 1XGUA 3PCYA 1IQDA 4GEIA 5FYKE 5ENWA 4WW2C 3QDGE 2Z8VC 3D1MC 4GW4B 2Z35B 2G3NA 1YPZA 2XJKA 4OZHB 4FFWD 1BVLB 1G6RL 2CDFB 2X6MA 5CCHE 1UM5L 2AJSL 4BSJA 1TJHH 4BJLA 3HUJF 3LXCA 2OXHB 2VZOA 1E28B 4L3EA 2W9EH 4F7EA 4GQPH 5BRZE 2AJZB 5C0AE 4JFOA 4KDWA 3GRWH 4O2FB 1NEZA 1VZIA 5CJQH 1ZT7B 1BOGB 1DSWA 1NFDA 2CUMA 2F53B 4PJCE 4W6WB 4NUQA 1INDH 2DEXX 4PJHB 4ORGA 2OCCB 3L3GB 4GSDH 1BQKA 1HZHH 3IF1B 2J88H 3VO0A 4I1PA 4EN3A 1NL0L 4YSOA 3Q1EA 4Y2LA 2AEQL 2H47C 1FI8C 4Z0XA 3H3PL 1WD8A 4MDIA 3QDGA 4S1QL 1AAJA 5DGQA 2FJSA 1S7XB 4NUPA 3NUKA 5IJVA 5DK0B 4YSQA 5D1QB 3CFCL 1ZA6A 4EVNA 3B2UD 3ES6B 4OFYA 3Q5OA 5FUCC 2K0RA 4ENZA 4F92B 1ZCRA 3AWEA 4NQEB 4HC1L 5IJKC 5KTEH 4RMQA 4C8XA 1BFVL 4LLYA 3DMMD 3ETBJ 3MBXL 3MRKB 1MVUB 4X6CA 3PABB 3QPQD 3DROB 1HEHC 3ILEA 4F9LC 1LL1A 4NZUH 5TDPB 2C9VA 3SKMB 4FLSA 2VLRA 1GIGH 4HJ0D 4MNHA 4YE4L 3RWHA 5A7BA 3UTTE 4IJ3B 5J6GB 1OW0C 1JOIA 1LMKA 5AAMA 5ILTH 4YDIH 3STBA 5HI5C 5BV7C 5SWSA 2BSBA 2H1LM 4TL4A 3V0GA 3V6OC 3GMMB 4GRMA 3RY6A 1I7ZA 5LGHH 3DX8A 1L9QA 1SOQA 2Y2WA 4Z6AT 2P3YA 1OSZA 3W9EA 3NZ8A 1UENA 4J3XA 4OM0H 1A4KA 2HLEB 3T2PA 1CDIA 1AQKL 1GYVA 2H9GA 3CNKA 2J12B 4I85A 4MGXA 3MUZ1 3WS6C 5C3IA 2HYMA 4X7TA 1CGSH 4G6FB 5D55A 3T1FA 1RJZA 3ZO9A 1VCAA 1NCBH 2Z64C 2VB5A 4MS8D 2OMZB 5DJYB 1S5IL 1WSST 3G3LA 4X9BA 3UTQA 3D25A 4TTDD 1G5GA 2D4DA 1BQLH 2I32A 5GGTH 5HDRA 3N43F 2FBJL 5ISZD 5FYKU 2VXSH 1C1EL 2EC9U 2QZQA 4LCWA 3TA3B 3IDJB 3PHOB 2ZIDA 1NSNL 2JKLA 4GKZB 4NWTL 3IJ8A 4Z7VB 5LNGA 4FI7A 3P2TA 5I15H 4RFNB 5EU5A 4B9GA 1SY6L 4P0DA 3QZWB 3IMTA 5F7NC 4KOCA 4RMWA 4U1GC 1WBZB 1KBPA 3MLZL 3VG9C 1U8NA 4MQXC 2A99A 3SPCA 3FQ4A 1IM9B 1RERA 3FYEB 1CG9A 4KI5E 1NGWA 4Y4HB 4KXZH 3NGBB 1BPVA 3N50A 3CFBA 2KDYA 4WHCA 3ZDZB 4ZMAT 2VGLM 2WVVB 3L3HB 1U8CA 1MFCH 1BZ9A 3WTUA 4GYBA 2C1PB 3GZOA 3RHWK 3SKJL 4D0DA 4ONOA 4XCYA 5CAYB 5DQDL 4K23H 1JGLH 3MLPA 4FNUA 2O72A 2KS0A 1YSOA 1FGVH 1MFAL 2IQAA 5KWYC 4KZDH 4O4YL 4L37A 5IMMA 1A3ZA 1NBZB 3FZUD 2BNQE 2I07B 3MMEA 3WKPA 1HSAB 2N3JA 2AC0A 3KGUA 2PPFA 1YDPB 3W0WB 5GS0D 3L13A 2D7MA 1ED3B 2VR4A 4XNUL 1KB5B 1MCRA 1UXLA 2EDQA 3K5RA 5D2NA 5E6IA 4FN0A 2UX7A 3JWOH 3PWPA 4HQQH 1DQDH 1TVHB 3MR9A 3IWVA 4CVZB 2NSMA 4WV1A 5LG1A 4IEFB 3QXDA 3HMXA 4X6BB 1QG3A 5L2JB 1YQVH 1Z9PA 2OMUB 4ANKA 5IB3B 1OT4A 2FJHA 4D8PA 1QTYT 5AOJA 1JFHA 5CBAB 1IBFA 1UZ8B 1T4KB 4NQVB 2EXYD 3Q8BA 5J3HD 4KTEL 4FQQB 4NKQB 1MWAH 4FQIH 4W6XB 2WBJA 2E9JA 5C7XL 1GMIA 2FO4B 3JUZA 5HDWA 1CGTA 3TWCH 1NGQL 3OM3B 1CVRA 4G43A 2HUEA 4ZDHA 1U91A 1XGTB 2Q8BL 5FGSA 1SMOA 3ATEA 4Z8FH 1D9KB 4HWBH 2O93L 4JJ5B 2RD0A 5DSCA 4F7MA 3NTCL 2C1PA 3W39B 1DSYA 4PRID 5IQNA 4MD4A 5ID1A 2YRBA 4AIEA 4HIIB 3US1A 3PY9A 1OTUC 3MNZA 4G9FB 4UB0H 4TUKH 2QSVA 3MBED 5L9DH 4IKIA 2WQWA 3GB7B 5I8KL 1QQDB 2LAGB 3C6SB 2NUTA 3STLA 1OGAA 5I1DB 1Q9OA 3HC3H 3TNMA 1M1SA 2VSMB 1KN4L 5I76A 1FNGA 1E5ZA 2CBMA 5B39B 5HHVH 3GUTB 3VFOA 1HQ4A 4QTIL 3T0XA 4N9GB 1RZ7L 2HTLC 5A40E 3G5YB 3R0NA 2BNUA 1KTJA 3PWNA 4QXTB 1JPFA 5EN3A 1EGJA 1IBGH 4KKCD 1PD0A 2BHFA 2AEIT 2XX1A 1JWUA 4LOFA 1M7DB 2BWIA 5EEXA 1UXSA 3COOA 4XVUC 4DO4A 4IGBB 4I1RA 2B3RA 1G87A 2MFNA 2NXZD 4IBQA 1LLAA 4QRSB 5IQ7L 1FLTX 4JG1H 4ZPTA 2F8XC 4LL1A 4OVVA 5D2LA 2EIZA 2AZUA 2BP0A 3QJFB 2VIRA 4GAGL 4AJVA 2GHZA 3ULVF 1ETZA 2IJ0C 5T3XH 3PJNA 4N2EA 2FT7A 1KLFB 2C7FA 4GXUN 4JFDB 1GS7A 4LRIC 4G70B 4JM4L 5EULV 1BQHA 3CSFA 4E9WA 2PR9A 3MDJA 1UJ3A 3GS7A 1F3JB 3AWFA 1G7LB 5J4MA 2P5EB 2BS71 2P5PA 4HIHB 4AMXA 3VG0L 2BZDA 4HT1H 3CDCA 1UYWH 3SY6A 1NFIA 3G6JA 3QJSB 4YGVA 4EI6A 3ROLB 3GKWH 4RGOL 1SFDA 1A4BA 2ED8A 2N7SA 3HBZA 4BQCA 1G4RA 5H4YA 4FEMA 1LGVA 5C0EA 5HYJD 4UM9A 2VDKL 1M3JA 2YD8A 3KW7A 2BOLA 2HSIA 4UNVA 4PUBL 2QPSA 1Q0XL 3N85H 4W9KC 4DH2A 2BC4A 1KJ3H 1SYSA 3GTNA 5CJOH 8PAZA 5ICZA 2Y1ZA 3GO1H 3CZFB 4PP2A 1A7RL 4LHUG 1Q0XH 5H4ZA 2IV8A 4RX4D 4XPHH 4UB0L 1SN2A 1FZMA 1I75A 2RQEA 1EAQA 2PWHA 3CIQA 3U0TA 1E4WH 3MROB 1QSFA 5E0FA 4BFFA 3RWJA 3LHPL 3ZY7A 5H35A 2FD6H 2X38A 4EO5A 4ZPTB 2JLLA 3GK8H 2EZ0C 1ZPUA 2X42A 4ERSL 5H37H 4EXPX 1UVQB 2DQHL 4HWBL 1ETZB 2YQ2A 1SJXA 1F5WA 4HT1L 3SYCA 1FFPB 2RQ8A 4CNIA 3TA3C 2I7SA 4I0PA 1EAPA 1QFUL 2X4TA 2E8ZA 1NGQH 4N90D 4F24A 3QIBD 4JPVL 4LSDA 5TTRA 2CJSA 3DX0A 4X6FA 4X7DC 1MCNA 1T5WB 2WVUA 4YZWA 3QC5X 2OSWA 1O5DT 2WSKA 3VRLF 2XWZA 2YWYA 5JHDE 1I3UA 2PETA 4NQDE 1KXVC 1XB8A 3LEYL 3CHXA 3O81A 4U1MB 3VWJA 2PUQT 1XD1A 2VABB 4L3FA 4WHTB 2HG0A 1T22B 1NEZG 1IEAA 1I85A 3VFRB 4P9MH 4OR1A 4X8JA 1NDMB 4GW1A 4F7CA 3ZXAC 1E43A 4HFWA 3BVNA 1U36A 3D4CA 4FJZA 4NO3A 1ZLSL 3SCMD 1E4JA 4DKDC 3DOSB 3KLQA 2BH0A 4M1CD 4GKOA 2FK9A 3L1FA 4JHAL 3MRQB 2FIKA 2R29A 1J18A 1MH5B 2HLFC 2BNRE 4O00A 2HT2D 5D7JB 5FW8A 5L6YL 3FQXA 4Z3EA 3CSPA 4U6HA 4J3SA 1YYMH 2AXGB 1I82A 3QEGL 4RQQB 2OK0H 3UEQA 4LKCB 1QLEB 1NFDF 3MROA 3EF7A 1Z9NA 1VZHA 3SYQA 3HRZC 4XMZA 2Q9OA 3KVPA 5DQJA 1OGAE 4HH8A 2P28B 2IOIA 4IHOA 3FTUA 3V5HB 3FMGH 4PM1A 5JQ6H 4HBQA 2R1YA 4OCRL 1RIUH 4TN9A 2RTTA 4MSWA 3U36A 1A1MA 3QR0A 5E7BA 1G7IA 1KIQB 4GIAA 4UCFA 2AQTA 4PTTB 5ALCL 3QWOA 2Z1PA 1WFJA 3BQUA 3ILPA 5AAWC 2VAJA 2DQIH 3C5ZB 3AQDA 1KJ2A 2EABA 4P2RD 3EYFB 1PS3A 4Y5YC 1VEMA 2K1MA 3HVNA 1NGYA 1NSNH 3OXSA 4MD5A 4NWTH 1VJSA 4QYOA 2AVFA 3VW3H 5IM7B 3N85L 2FBJH 3TTYA 2OMYB 4AGNA 3D2UB 4M6OH 2J56A 2N7AA 4FQHA 2OJZH 5GJSL 4ZFOL 4Z7UA 3T0ED 5ETUA 4X5QA 2A6KA 3BT2H 2YRLA 3I2CL 3U1PA 1KNOA 4EQ3A 1C8PA 4BZYA 1I9RH 2YD4A 4DWHA 3K6DA 2W0LA 5KSAA 3FCUB 1KPVA 4YHZH 2BY3A 3SE8H 4WW2B 3ZL4L 4UV4H 4JFED 4GKNB 5HGBA 1DQKA 5EBWB 1S7WA 1ROCA 4N2KA 3BIAX 1IB5A 4N2OA 4MJ5A 3NIGB 3RVWC 1TQBC 2LW3A 1K2DA 1S9XA 4GRLC 1QFWI 4PGCA 3LB6D 3Q9PA 4NI3A 5DLLA 2CALA 5AOZA 5LGJB 1CI5A 1GIGL 4YE4H 2KI6A 3HE7C 2Y2YA 1R3HB 1X3DA 4JG5A 4U1LA 4IHOB 5T3XL 1JBJA 5D8JL 2WM0A 4Q97A 3VXRA 5C6WH 2PW1B 5F7MC 3RWEA 2YD2A 3I6GB 4ZSOE 2Q7YB 3SE4A 3L4YA 5C08B 3GMPB 5F72S 4JFSA 3TNNB 4JKKA 2KKQA 5DUML 3KG5A 3KH3A 4ABUA 4E2OA 3G5XB 1KGCE 2A4EA 2DZEA 3NP3A 1AC0A 3MV8D 4ANXA 5ADPH 1F45A 1WIPA 1S7VB 4KI1A 1E7VA 1E4KC 1QOKA 2EYTA 1SVBA 3N42B 3C08L 1BM3L 1OGTB 3KBHE 4NUGL 4QTIH 1O6TA 1X5HA 1UWGH 3MLZH 1WH0A 1CFQB 2GUOA 2J44A 3I6SA 1TNNA 4OFQA 3BAKA 3NGBC 3S36X 2R2HA 3VDAA 4UILH 1J0IA 1OVZA 2XQYA 1S9WA 2GJRA 1Y1DA 3UJTH 3F7YA 1AZRA 1AQ8A 2E7LA 3QUMH 1NC4B 3JWNE 1H3GA 3ZW3A 2MNJB 3TPKA 4DP4X 4RMVA 4D0BB 3QRGH 1HWHB 3BLKA 4PLKC 3TF4A 1R6VA 5EBWA 4YDJA 1N5YL 1TJHL 4NQDD 4BBWA 4ODSH 1EXGA 1VCBC 4WSKA 3WEXA 4JB9H 2OSXA 5ALBL 2N0MA 5SX4H 2B0SH 4HF5H 3V8OA 5DMKB 4IRJB 4L4TA 2OL3B 5DQ9B 3KNBA 5AVSB 5FF6A 5HPOA 4U4IA 3BZ5A 1QA9A 3L4ZA 3MJGX 3IVKA 4R7DA 3QG6A 4PJBB 5HYQB 4PWJA 5J56B 3INUH 3AGWA 1C5CL 5EWIL 1AD0A 1NANH 1NPUA 4GQZA 4QRPE 5JIDA 1QFWH 5JXEA 1MELA 1BX2B 1T1ZB 5F71A 4QRAA 3W1ZA 3NOIA 4G8FA 3OLDA 5LKNA 1SF5A 1E4HA 5C0AD 1TMQA 2OXGB 3EH3B 4NJ9H 3TVMD 2VXTH 4QRQB 4Z0XB 4G2AA 2MJWA 4X50A 4UT6A 1OGAD 1A64A 3GKZA 4AJ0A 1N9PA 3AMLA 3J8F7 3UTPD 2W94A 4XNUH 3F3HA 1X9LA 4Y19E 2ZG1A 4OM1L 1CFBA 3HR5A 2IANA 5ALBH 3ARDA 4M3JA 3L2MA 1E7UA 4EIBA 1DANT 1YZZA 2H26A 3ARSA 4I2XB 5C9JB 3ROOB 5KOMC 4Y5YB 2C8NA 1ETJA 3PJSB 4X4ME 5EIIG 1OLZA 3NCYP 4B9JA 4I4WB 4JFZH 1J5IA 1BZDA 3DKHA 4I87A 4BWTA 3LMJH 3LSOA 5F44A 4B50A 4R2GB 2YA1A 3ARVA 5C0ND 1A6UH 4Z7QF 1TTCA 3SDXA 5FO8A 3ULUH 4L3CA 1F6FB 1UD3A 2ALWA 3MLTB 4W70A 1MFCL 2QT6A 2XPGA 2BCMA 4ZMWA 5AL0A 4PMFA 3DX4A 1JZDC 1MFMA 3GMQB 2EUZA 1FAIH 4YR6B 1MCPH 2OL3A 2VUKA 3IPBA 4XMKL 2VERA 3RP1A 2MCAA 3VRLE 3NIGF 5HHOD 4FQPA 2WLKA 3F7PC 2OL3L 3OAWA 2EVJA 2ZX9A 2D73A 4X7TB 1WA1X 4KPHL 3T1FB 1JZ8A 3BP6B 1I3GH 3EJUA 5IB4B 1L7IH 1FBIL 4MWFB 3EOAA 3IDYC 2IH3A 3B2UC 5I5IA 4C56B 3FFDB 4NCDA 3O8XB 4DQOH 2VERN 1JPTL 2PWGA 3D87B 2ZG3A 1FCCA 2FGWH 2ZWKA 5TE4L 5GS1C 3NJIA 2Z92B 2ZOOA 4DGUA 4OGXH 1QX1A 5BJTB 1QW8A 2WXHA 2RFXB 1INEL 1F4YL 3QZWA 1MNUH 2AJUL 5I30L 3BSZA 1K3ZA 4FZEL 1HH6B 3D7PA 4JRWA 3FU7A 8CGTA 1MEXL 2C4XA 4KK8D 2QQKL 4MNGA 1NMAL 4NZ8A 1P7BA 4GMTL 4F57L 1NEUA 5F6HI 2FIRT 4G1EB 5CJXA 3MRKA 9CGTA 1X9RA 1EUUA 4AT6B 5LN4A 5GHWL 1UADC 4P2OB 4WDIB 2TRHA 3QCUL 2VH5L 3K2MC 2A73A 2WN2A 5TFSH 2XWBA 3SOBL 3P1VA 3B56A 1SXNA 2O5ZL 3HPLB 5J6GA 1N19A 4OB5L 2VXUH 4G82A 5KVEE 3QDMA 2E9GA 4ZBJA 4OBSA 1SM3L 2FEEI 1Y6KR 2N0KA 2VOTA 4OJAA 2APBA 1KYOK 3QNYB 4L1DA 2VKXA 1SXBA 4YHKH 5I74B 1UQSA 3VW3L 4Y5XC 1PG7W 1UWYA 5DHYB 1D5XA 3WUWB 3HI5L 1AG6A 3AG3B 2ZUXA 3HPJA 2R2BA 4P46D 3S34L 4HJEA 1O6SA 4MNGE 4LLVA 3BO8A 4JCWA 4GNKB 2AQ3A 1YEGL 2H8PB 5E00A 5B1KA 2F54B 2Y07H 3H4HA 4OI9A 5GSRB 3VMOA 4WI8A 3BP6A 2WVSA 4A6YA 4HIEB 3QIUD 1A5FH 4EN2A 3CBRA 4BV1A 1XSKA 1BHGA 3S3DB 4AUYA 3D4GA 5I1LB 2APSA 1KGUA 4OCRH 1HDMA 1R3IL 3I6LE 4GSDL 4B0MM 2CDEA 3NA9L 3L16A 4OZ4A 4WUUA 5F9AC 5KUMA 3S9DB 3JTSB 3GSUA 4NP9A 3WXWH 5GGVH 5E2VL 4X6CF 4L4JA 3KWUA 1QPKA 4Q9RL 2BNQB 5HHPB 5CD3B 4RFOL 2F7PA 4R4BA 3UYOD 2K3HA 4G43B 5CGYD 4AVIA 1FYTE 4XBGB 4M6AA 4WGKA 1G9HA 2O5YH 1D9KA 5B7MA 1PCXA 1LP9A 2H45A 5GGVY 2P5WB 4L05A 4OTXL 3ZQ9A 3TX4A 4Z7WB 2YD3A 2Y9RT 4X7EC 1JHLH 5GS0H 2XX0A 4D9RD 2A73B 4PWIA 1WZLA 3EO1A 3G6JE 3P4NA 4YGAB 3E9UA 3AY2A 2K4WA 1GTFA 2WLIB 4XODA 4Y5VB 1KPRB 3L9EA 4FHBD 1UWFA 1SEBA 4XZUB 2W65B 1N59A 2Y5QA 4HOMA 1T2QL 5IGXL 1QYGH 5DEGB 1AO7E 3N6YA 3DOIA 3EFDL 3QYCA 3BH8B 5FGCB 4LCUB 4KKBC 2BY0A 4JPVH 4UQ2B 4TYUA 4TTGA 1TJXA 4LPWA 5LGYA 4JFHD 3ARFD 4KNUA 5IB3A 1KSRA 1RZQA 2GJ6B 2JH2A 1XCWA 4KRMB 1YNTB 4HUUA 4Y2DB 3X14A 2DM7A 5AW5B 4I0KA 3WFCH 3LOWA 2FD6L 1FFOB 5ADOL 3OPZL 2N56A 4RDQF 2YPVA 4QGYA 3LXAA 4AL8C 1EXHA 4UUJB 1S7SA 1MHCB 2Z8SA 5GS3A 4I5BB 3MU3A 4FJ6A 2APWA 2XYCA 3GXUB 2KZBA 1T66C 4XBGA 4YN3A 5ISZB 1HH9B 5DHVB 3OKKA 4CU6A 1BXUA 1WTGT 5CJOL 4ZOCA 3MRFA 5DDHA 5DD6A 2Q6WA 2AQQA 5CLZA 4JDEB 4OVUA 3RL1A 2EYRB 1MWAB 1YJDC 3ARWA 4JFDE 4PWEA 3QJZA 3SY0B 2OV0A 3VXNB 5F6IB 2VR7A 4WJ5B 4EIUA 1FC2D 1X5JA 2VDKH 3GI9L 2VQTA 3L8QA 1MI5A 3BKJH 2PLTA 2B1HL 1F1DA 4HIIA 3SYOA 1DSFH 2LU5A 2WLYA 4FG2A 1M6UA 5E8DH 2VMJA 3O6LL 1GMEA 1EFQA 4W9ZA 4GINA 3EYQC 1GAFL 2G2NA 2ZOUA 4EBQL 1BLIA 3Q1SH 1Q9OB 5IEHA 4C54A 4AYFB 3QJQB 4OLVH 4N3UA 1UM4H 1EFXB 3TVMC 3OMIB 1MCKA 1PEZA 1L6XA 4HHAB 5M95B 3QORA 4Y5XB 1F4HA 3E1ZA 3KLDA 3NACL 4KRPC 5F96L 3EDEA 1P4IL 3OR7B 1WS8A 3WS3B 4PRBA 4LDCA 1UZ6F 5KN5A 4YIQB 2AERT 5KW9H 3NN8A 5I2IA 1SVCP 1XT5A 4NBXB 2XQYG 4ZJ9A 1UFGA 2WTOA 3L95A 5HD8C 1RZIA 3UAJD 4K5OA 3MRPB 32C2A 4PJ8D 3QQ3B 1G9NC 4DGIL 1ODUA 1FFPA 2CO7B 4HUMB 4LNRA 3TOPA 3UDWA 4YHOH 2EXWC 4YLBA 3C8KA 4CRPA 2NRDA 3HG2A 3OC8A 1K4CB 3RWIB 4JAMA 1N68A 1GGBL 2R0LH 3BVDB 1ORSB 4M5SA 3RUGF 2HG5B 5JHDD 4OBRA 1Z32X 2YKLH 3QDJD 5JO5B 1QPXA 1MWAA 1ID2A 4YVUA 3R8BB 4B9YA 3K1DA 3VRJB 2ZSWA 4ZS6C 2G75A 5CN1A 5SV3A 4LB8A 4WFFD 5DYOB 4ZFOA 3KPLA 6FABH 1QRKA 1MREL 2JIXA 2G30A 2QR0A 3FU6A 2NTFA 4JY4B 2BXYA 2WXNA 1E9PA 3UBHA 4CUCA 3O0RH 3H1ZA 2J8UF 3RTLA 3G6JB 1WHOA 3LZOA 1CPUA 2PN5A 3GXFA 1BVNT 1JGEB 3QPXH 5F88B 2CK0L 1AACA 4JRYE 5IHZB 3DSNA 4YC2B 2HT4D 1CL7L 3ZOAA 3KLKA 2CDGA 2BIMA 2DLGA 4WHYG 4JY6B 4DT2A 3LKPB 1VGKA 2CK2A 2ZCZA 5I1EH 2ADJB 2ITDB 1P1ZB 1SJVA 3NTCH 2I9TB 3GIZH 3IN2A 1IAIH 2FIKB 5B22A 3CVBA 4APXA 1UCBH 4XNQB 2W91A 4DTGL 1AFVH 3UZQA 3MBEC 5DT1H 3VI3E 1MSPA 2FNWA 1CXIA 2Y6SC 3PWVA 5I18H 1B4JH 1IKFL 3MOQA 2J5LB 2IAND 4Y4KC 3K6SB 4MVBD 4M93C 4P4RA 2DMHA 4KK6C 1LDPL 4KH2A 1U3YA 5SWQA 4Y2DC 1JPEA 2MTPA 1UGNA 1HNYA 2OMWA 4L9DA 4M9OA 4XMVA 4JFHE 2BS8A 3ILPB 3AXLA 2WQUA 2R2EA 4PVMA 5D1ZA 1P7QA 3IEAA 4ZUWB 2E6JA 3FF8A 6CGTA 5IBTH 4NUJA 4F7PA 2X41A 4NDMA 4ALAL 2KPWA 5FIEA 5HVHB 2X6AA 3RKDC 3L3IA 2JIXB 1U95A 4PB9H 5AZUA 1KN2L 3T77B 5KZCD 1ILSA 1OB1A 1URZA 4O4YH 1NUFA 3SJVB 1HEZB 3H42L 2BINA 3R4DA 4RGNC 1DN2A 2FR4B 5IBTL 1QBML 1E4XL 3VFRA 3T04D 1AGFA 1J1PH 4K94H 2Z31B 2GTQA 3DRQB 3MRBB 3S3CB 3SPVA 5C71A 5ITBL 1G1CA 2VLRD 2C34A 5C0DB 4N2DA 4Z95L 5JNYB 1FHGA 1GGUA 3N0AA 5D7KE 3DUHA 4NFCA 5LXGL 4CC0A 1KCVH 1A02N 1M7UA 3B7SA 2EIDA 3KYNB 2G3MA 3EG9B 2EJ1A 1WD9A 3I3EA 3KMDA 4IRSA 4C83B 4HU8A 1CI3M 2I5YH 4U6HB 3PWVB 5FV2A 4XMTA 5FLVA 5E2WH 2V3EA 4PS8A 3F04A 4GG6F 1RAMA 1A7PL 3MRRA 1OAUL 2R27A 3TZVB 5FYJD 1OB0A 4TNWF 4TXVB 2D2OA 4HMDA 3FO2B 3H7BA 1JGVH 2QVTA 1E5AA 4M62H 4M02A 1T5XA 3QW9A 1MFBH 2AV1B 3RDTA 2D2CC 3SDAA 5FYJH 3VXSE 4DOHB 1O5PA 3L48A 4F7TA 3GIZL 3BZ4A 4PLNC 5H8DA 1XGYL 1CGSL 3ML9A 5CCJA 1F3DH 5DVLA 5CUSL 2DYRB 2JFCA 2XFGB 3SDYL 4AEHH 2VN4A 5HDLA 1S7TA 3RGHA 1Z66A 3U6RB 1M42A 2A9ML 1X6NA 3LRGA 2CQVA 1U95B 1P2CB 2HT3D 2IDTA 1KGCD 4BFOA 5L8LB 2W9LA 1CGUA 3H3BC 5GSVA 2QV4A 2Q3ZA 4HH9B 1H0DA 5HGHA 3IBEA 1CF1A 2JTDA 1FO0H 3FYIB 3FUDA 2XG5B 4H8PA 1JXGA 1C5DA 4LFHG 1R5VA 2W8CA 3CC1A 4UT7L 3NCBB 3IKCA 4X4MA 3WFDH 4GXFA 4G5ZH 4NNXA 2PKDA 2Z7YA 5E2TH 4L8DA 5AEAA 5DHXB 3UTSD 5L4JA 1NCGA 5C07A 1TQUA 2F9BT 3HE7D 5CCGE 5E9DD 2FHFA 4PJDF 1A22B 3MBXH 2VC2B 3QCTL 5CEZL 3MJ9L 3HMXL 4S1DD 4JO3L 2R4SH 1TU2A 4I1NB 1YNLL 2C1OA 4LARL 1PFOA 5EU6A 4A1RA 1LWJA 3ME0A 3WY2A 4JRYD 5DA0B 5BOZG 3SQBB 3NSJA 3DX2A 2OLDA 3NFNB 3IU3A 2H6OA 1WO2A 1II4E 5HGDA 3H7BB 4S1QH 1BF8A 1QHPA 4KK9D 1E28A 3BHBB 3CE1A 4NKOB 1UA6H 3EXLA 2YMXL 2VSCA 3HHSA 3BISA 3I6KB 4WAFA 4N25A 1WWAX 3QB7C 4B3EA 4KAQL 5CBEA 3NCWA 2QMJA 2F53A 4FXKC 5AYTA 2XG4A 1TQCB 4BH8A 3QJHA 2H0PA 3N55A 2JTYA 4ETYA 1GAFH 4F7KA 3NP4A 1DHKA 1G1OA 1T0NA 2WHVA 3BD5A 3O6LH 2WINB 4LLDA 3OWEA 1KEML 4YUEH 4JE4B 1LEKB 5GRZA 4ZO9A 3D33A 2EYTB 2WYTA 3HG0A 3KS0H 4UQ3B 3SYPA 4HMEA 1QBAA 3BH9B 5AB0A 1SVZA 1YJDL 1UWEL 1ZANH 2BVPA 3B9VA 4P05A 2VZ3A 1CL7H 3OR6B 1GSKA 5DC2A 4MJIE 3KW8A 1L6PA 1NC2D 4UZUA 1KJ2H 2FECI 2WQAA 2XWCA 4U7SA 3EFFB 4Y4FB 4NM4L 1OPGL 1UT9A 3T2QA 2F8IA 1X9QA 4N6RA 3B2MA 1EDYA 1IKNC 4JFYA 2KZKA 1WAAE 2QHRL 4HS8L 5FB8B 2RHEA 4FQ1H 1RPQA 1HYSD 4PLOB 1I9IH 3WNNA 2JJSC 4YSEA 1SPDA 4YXHH 5JDJA 1I7TB 3OPZH 3O9WB 1X7QB 1JTOA 3RFRA 1UKSA 7PAZA 3VD7A 1T6BX 3Q6GL 4NENB 2VLJE 1RU9L 2JELL 5DQ9A 4AL8H 4NQCA 4XN5A 3CD4A 1T1WA 3K6OA 1RK1A 3MBEB 4J1UA 2K7QA 4IOIB 1V7MH 1B2WH 5J6HB 3STZA 1DJZA 5CGBA 5KANG 1AD0B 3G5VB 4XNAA 3ZJAA 3IGLA 5IGXH 1ZGLB 1VSCA 4HIJA 4LOVA 2I85A 2BRRL 2K7PA 3CC5B 1SJHB 3OZLA 1N64H 4HIXH 4LLDB 2OMZA 1KCWA 3PFQA 1GJUA 4DP2X 4ONGL 2X40A 2YA2A 4NIYE 4B5EA 2AJXH 4DP9X 4U3CA 3ARBD 4UTBL 3IDUA 5GXBB 3O2WH 3LPWA 2QZ5A 3RIAK 4H1LH 3TBTB 2D7OA 4UTAL 3OR6A 4G42A 1CFSB 4X80L 3L2LA 3RTQC 4RA0C 1BFOA 4QR7A 5EOCL 4L3EE 2ZX8A 4TOYH 2JB6B 4XNMA 2VITA 1DVFB 4LSRL 1HI6B 4PRPA 3CFBB 2VQ4A 4TQ8A 1QSVA 4DK5A 3PQYB 1A6AA 4GXVH 4LSSH 3MOBL 2C9RA 5SWZE 4RMUA 4POZD 2BK8A 5EU4B 1AGDB 1TJGH 2D7QA 3Q6FA 3FO0H 3W2DL 4WK2B 2G3XA 2XY1A 4GFTB 4FLHA 1HILB 2HJLA 1DZ0A 4Y9BA 3X1FA 2IADB 1LP9F 4FFWC 2DMCA 1U4FA 4XNYL 2ESVB 1J0YA 3TJEH 3O3AA 4XE0A 5D7JC 3RL2A 5E00B 4AIXA 2FQFA 3A6CL 4J8RA 3H55A 1AGEA 2DQEL 1RLBA 5ID0A 1IBZA 4F37F 1TVHA 5EUKA 3HS8A 4LGRB 4L8SC 1MNNA 3NCMA 1DDTA 4TPRH 1MVFA 4P5RA 5E70A 1JZ7A 4YLQT 2DWTA 2YJLA 4OLYH 1CF8L 4D8PB 4UNTA 4KRLB 1DR9A 2LLLA 3FFDA 3JWDL 4MJ6B 5I8EB 2B7DT 1H15A 2OMUA 1KTLB 5ERWB 3FAXA 4GUPB 3PDOB 1RIVH 3BE1H 4GRWB 4R2GD 4EMZA 3IFLH 4R3SB 4TULH 3PHQB 4PY8I 1TCMA 4WTZG 1A7NL 4YMPA 2BNQA 4D9LH 2ESVE 2TAAA 2EDNA 4YBLB 3VFVA 4EOWH 1K8DA 3DV4A 4AKQA 2EE6A 1KCSH 4Y19A 1A3LL 5F6IC 2KC0A 4PG2C 3WY3A 4YSRA 1UC6A 3VCLB 2A9CA 2JB6A 1ONQA 4L4TD 4XNMB 2X1WL 2GG1A 4G8GB 4IU2A 2ZQKA 3EF4A 4UQIM 4Z0BL 3GMOB 3PXJA 1DLHA 4OLYL 1JCVA 2ZXCA 1KTDA 3GMNA 2X44D 1R0AH 2H5UA 1ZY9A 4JVUA 4MD4B 4U7MA 2BDNH 1IFGA 4AVJA 3AJ7A 2XWBB 4GB9A 2EADA 4KO6A 3MCLL 3OHXA 5CEYA 1EJOH 4KHTL 5DK3A 2JKRM 1OP5K 4OUUB 5CZVH 1YRKA 3U0PB 4WI3A 4D9RE 5FO7A 1GTNA 4WJKB 3PREA 5DHMC 1INQA 1UEMA 3MKGA 4RVBA 2NY3B 5FGBA 3VD9A 3QUZA 3EH5B 3HJEA 4XVJL 3V4VL 2KYIA 3QZMA 4P5TC 2ED7A 2WXPA 5AW0B 1L7IL 4LLVB 1AGEB 2B3IA 4YBHA 3NA9H 5C0AB 1P7QD 1GKOA 1DBKH 1TJGL 3MJ8B 1YN6A 3LNDA 2BWQA 5DRXB 3C60C 3O45A 2WWKT 1WC7A 2WP3T 2LU7A 1T7XA 4XX5A 4X9FA 5TK4A 2J57A 2IDSA 3CWGA 4DW2H 3M88A 4PRNA 2VLJD 4NQDB 1FFOA 4WU7A 2GSIB 2LT9A 3O6FA 5KOVC 4JPSA 3DGGA 1JDAA 1KXQE 3ZRSA 5D1QD 3TN0A 1JSYA 1QSZA 4AQ8A 5ABDE 3LMJL 1I8LA 1AZUA 4RISL 5DHVA 4KXDA 4WFED 5D1XA 1ONQB 3NSXA 4HIXL 2J6EL 1IM3D 5I0YA 5D7LE 2IBGA 2IGFH 3VXTB 1J1OH 5CF3A 1V10A 1FYTD 2MQ3A 1U8LB 5IVZB 5T33L 2BVOA 2ZCKH 5FYLL 3X3FH 4AJYV 3QCUH 4IOSA 5BS0D 4OM1H 1EGJH 5JR1H 2ZUSA 4HJ1A 2VAAB 1DQMH 1IGFL 4YSTA 2VE6B 5A1AA 3LN9A 4G9FE 4UV7L 4ODBD 1URLA 4XI5C 4KKPA 4AL8L 3EJPA 4OUUA 5L0QC 4JEGB 2FL5B 4HIPA 4JRFA 1NDGA 1P1VA 3K80A 4JFEA 1GH7A 4UINL 1BAFH 3GM0A 1EEYB 1BFSA 2FE0A 3EYVB 1UD8A 2J73A 4JZJB 3QNZB 4L29A 5D1XE 3WHXB 4F27A 12E8L 5TF0A 3JWDC 1S5HA 2R0WL 1RCYA 2FGWL 4AGLA 4XCNB 5IUCA 4D2NA 1SUJA 3NZUA 4NC2B 1PLGH 4UQ2A 5B8CC 3O45B 1R9FA 4AXWB 1RPKA 1TCRB 1FBIH 5BOJA 1GY1A 3DECA 2QFRA 2D0GA 4DP7X 1AQMA 3T3PB 3FCGA 1TPXC 1TZGH 2PO6B 3PAUA 4K7PL 3NH7H 4YX2L 1P5VB 5DA4A 3C87A 4AQ1C 1TTFA 3KDMA 4P4KA 1OV8A 4NC0B 4NZFA 3EDJA 1ZS2A 4KI5C 3P11L 3KR3L 4K7PX 3MQIA 1J0HA 2ORBL 1FHNA 1OK8A 3KL0A 3ULUC 4A2GA 1T5KA 4BUQA 3GIVB 4YFEA 3GXMA 2G0LA 3RTQD 3VSVA 4BE5A 3FULA 2P47B 3GXDA 1KBGH 2G75B 5B1JC 1NLDL 1XIWB 3RL1B 4JDTL 2NYZA 1NGXB 4PBDA 3K71B 1HHKB 1H6TA 3HN3A 4JY4A 4K7PY 3BAXA 3QUKB 5HDBE 2QQLH 3X13A 2XACC 5LCVA 3GSNA 1G43A 2XZQL 1X5ZA 5IW3A 1N0LB 5CLYA 3QA3B 4GRWE 2GFBB 5KSVB 4WO0A 5FECB 1H3XA 1U8HA 3NQKA 4GW1B 5IF0B 1KCUL 1VGKB 1J86A 3U6XS 5T3ZL 1T22A 1D9KD 2FH8A 1DQQB 1FVCB 1NGZA 3VXUA 3VWJD 1PQZA 3QJOA 1FVEB 2B59B 3QCTH 2W1NA 2IMMA 2EE2A 4C4KT 5AD0B 3F00A 4N1EA 1EFXA 1W8EA 4X7SL 2YN3A 1X5GA 4AC2A 3HR6A 1BZ7B 4RQQA 3L3DA 1TEYA 4P5TB 3QP3A 2C9UA 1J12A 2V3FA 3CN1A 5F7WC 2VR5A 5GGQH 3PNRB 1IFHL 2CKNA 1YEDA 2IDUA 3UO1H 4I77H 4BHUI 2OTWB 1DJXA 3DBXA 2F8OA 5FUZH 1BBDH 4OKDA 3QUGA 2B0SL 4Y19D 1AZNA 1RD6A 2C3XA 3CFQA 5FO9A 3ZL4H 5I1IL 2P5WE 2Y5TA 3CV5A 4P3DA 2WXKA 3QO0A 5DJ6B 4EIZC 1I8MA 3QEUA 2NY5L 4NUJB 1YMMB 4Y4KB 2QDVA 2V5TA 2VLKB 1JXFA 1W0VA 5DHEA 4AIZA 4M7JL 1JGUH 1WBYA 2EXWD 3ZSTA 3TO4A 3MYJB 2WLNA 3QRGL 2EDMA 3OBAA 4NNPH 1OB1B 2YEZB 4LT7A 1YEKH 1FL6B 3BXNB 3RVWD 5G5DB 5G2NA 3CSBA 3LXUX 4AK1A 5DUBA 5EEWA 4MAYB 4QXVA 3L3OA 4O9HL 3BIKA 3FTGB 2JKWA 2W80C 5I8CA 3ULUE 4TVPD 5IOKA 1EO7A 4HKBB 4YSPA 1IO4C 2CJTA 1RHHB 2DQIL 3HZYA 3A6OA 3KLAA 5D6DC 3DRQA 5AENA 1MY7A 1KENH 1J0KA 2A6KB 3OB0H 1UWGL 4FG6D 3B4NA 4JFFD 1XSJA 4OLUL 3ZYOA 3ESVF 4IU3B 3REWB 1A6WH 1BYPA 3SPHA 1WFOA 2ZX7A 3RPIB 2A5UA 1NBYB 3RLSA 3DTXA 1TG8A 2DDQH 3ARBC 4GI6A 4XMPH 3KD4A 3ZDXF 2YRZA 1JRHI 4CVUA 4EE2A 1LE5B 3ABMB 2ZOTA 3QS2A 3WTXA 4QXGL 1XGUB 3LKQB 1DCEA 3UAAA 1S9XB 5HYIA 2WNKA 4KK5D 3QEGH 3GJFH 1MAJA 1I1AD 2F7RA 4GXUM 3QAQA 4G11A 4ICXA 5K1JA 3UYRL 2ZG2A 4Y16C 1A1OA 1ZHLA 4IIZA 3WCYA 3MNDA 4P46A 3S37H 3UP6A 4P49A 3DVNB 1KN2H 4JHVA 1JNHA 3HZMB 3AU1A 1AY1L 4IIQA 3IPFA 2IH1A 1Q8MA 4ZOAA 1LILA 3QHTC 4P4KD 1F6LL 1MVYA 1ZS8A 2DL9A 4LCCC 3ASWA 2X4QB 1XGRB 1JNLH 1JZ2A 3CMGA 4LEOB 2VDLL 3BFQG 3LRHA 4Q4EA 3X1NA 2GSMB 2A6DA 5I24A 3MV11 3KBFA 3HKFA 3EOTH 1ZVSA 1S7VA 2E9BA 4N2LA 4AYBA 4AEFA 1KTCA 2CNZA 1MHPL 2BOBA 3AFLA 1LE9A 1CC3A 4UOW0 1FG9C 3A21A 3QIUC 5ACZA 1I8IB 3OKEB 5IB2A 3ES6A 1H8NA 2CKBL 4TRPH 3WU1A 1JK9A 2GQHA 5AB1A 3DC0A 4Z7QB 1I4FB 1DVUA 5KEZA 3QFJB 3RFZA 1DUYB 4XN7A 5L7XL 5D7LA 3TPUA 1AFVL 1EO8H 1K6QL 1VPOH 4D3CH 5IHUL 3E8VA 4J7RA 1UCBL 2DQHH 4K8RL 1XGZA 4HJGB 4Y2OA 2WO4A 3H54A 3QS3A 2BIIA 1S7UA 1DJGA 3FCBA 1LE5A 1CS6A 1GC1H 5A7EA 3P0VH 4Z23A 1Q94A 1PYWA 4PTUB 5AOKA 3LKQA 1DQLH 5GRJH 3RKDD 3IAQA 5E94A 4MXWH 3QPXL 4PLJD 3OZ9H 4U6VL 5E6SB 3FT0A 1K3IA 2WAQA 1TO4A 3CMOH 1RP9A 1HC1A 4KGLA 4L4TB 4KX7A 4UIKL 5JHLH 3FCSA 4QXUH 4LPXA 4ZX4A 3OSVA 4ZSOB 2G4GA 2IPKA 1ZA3A 1C08A 3VGBA 5KJ4A 1T1YB 4HPYL 1JHKH 4LSUH 5I6XC 3CVHL 1T1ZA 4NZJA 4BGDA 1KIRA 1BXVA 3WFBH 4JFOB 4JQXC 4OZIF 3WAJA 1NEZB 3ZQXA 1T04A 2R0LL 5CMAA 3WO4B 2FNBA 4DZBA 5KYWA 2W88A 1OP9A 4JRXE 2DV6A 2EIKB 4YSUA 1L9SA 2Z7ZA 4L1SA 5MEQA 3VYOA 4X8CA 3FBQA 1OCWH 3IJHB 2OMTB 3MACL 2B77A 1ZLSH 2GYSA 5JA8B 3BDXA 3AVEA 2C7UA 3NT0A 1FFRA 2RB8A 4HH9A 2JF1A 1J87A 3F84A 4GO9A 4PRDB 4ZW5A 3V7AE 2V9QA 5FKAB 4JRYA 2IWKA 3NACH 2J1WA 5BZZA 3NESA 4JM4H 1GYWA 3MRDA 4QRPA 4BSVA 5JDSB 3RFZB 1WBXA 2IAMD 3HS0B 2XBZA 5I1CH 4Y4HA 4H8WL 1WGOA 4QWWD 5C07B 1YMHA 4QT5B 4R4FH 5IY5B 2WSPA 4LLYB 3VRIB 4X6CE 1YY8A 3TP4A 2DICA 3LH2L 2DJUA 4ELKA 5C8JA 4QHLA 3I84A 4XI5D 2Z93A 1MIEH 3M7OA 4JQVA 5PAZA 3DHJA 4S2SB 1FAKT 1D7CA 4XCYB 5DFVC 5F1OB 4JCMA 5KYXA 4UAHA 5HVWA 5E8NA 5JPNA 3G5WA 4GPVA 2X1OA 2Q3AA 3W81A 4XPGL 4WNSA 3DYMA 4CC4C 2F19L 1ZWIB 1T66D 1N67A 1ZT4A 2WANA 3CQPA 3FSWA 4UI2A 3WYRA 2A9DA 3V95A 5IW6A 5HGDB 5IMMB 3L7EA 1CLCA 5SWSB 2Q20A 3GMQA 1HWGB 2VDRL 4YR6A 2R69L 2ENQA 2NW3B 1T89C 3US0A 1KJVA 4PFEA 3IETA 1TYJA 3S2CA 3VQLA 1FYTB 5EORL 3PWUB 2F8VA 5J9PB 2CGRH 4J3OC 4PJ9C 4QIRA 1U42A 4PJXE 1EHNA 4XVTH 2IV9A 4Q6IC 2OULB 2VCOA 2NYYD 4HXAH 4ZUUB 1T3FA 4RWHA 5TE7L 1WAEA 4GRLD 3BVUA 3LRSB 5HYSB 5IP4A 2Q1EA 1A7RH 2KLTA 1JNJA 4GKLA 1IC5L 4XVOA 3LZNA 3KCPB 4CSPA 1AKPA 2FJHB 3W0WD 3QIBA 2A1WH 2LAAA 1ZLUK 3FJTA 4BZ1H 5EU3A 7CGTA 4HXAL 4ISVB 5EC1B 4KUZL 1QRNE 4HUWA 4XVTL 5IMOB 4M48L 5F9JA 3JV4A 4G8IB 5BV7L 2VLJB 1EEZA 1BXAA 1TVBB 4BFRA 1B6UA 3EUDA 2K9FB 2HFFB 4LCVA 4IBUA 2WCSA 4YPGA 3UTZA 4L48A 5D5MF 2X4UB 1UYWL 1ML0A 1U8NB 1IT9L 2CR6A 5E95B 1UATA 4LE8A 1XV8A 3MBWB 1DQIA 3HE6B 2CM6A 1M53A 4N4YB 1FO0A 4L1HA 3EFOA 4R0LC 3GXPA 2EIMB 4KI5D 3QEQA 4P23A 1AXIB 1QI3A 3C6LD 3KPMB 4Y2NA 4JREC 3NCYS 4N2MA 3IRZA 3U9WA 4E0RB 1W0WA 2YD9A 4XMXA 1ULVA 4LF3A 4PIBA 4A66A 3CBJB 2H3KA 3BDBA 2JCCA 4OQ1A 4HS6A 1YNTF 1D5MA 4KU1A 3JWOL 4F15B 5LBSL 1AHMA 2R2BB 5AW6B 5EF0A 5AALA 2Y06H 4AZ8B 5F93C 3UPRA 4XO3A 1W8OA 5DRNB 5BZWA 4AMKH 3GF8A 4QWWC 5E4EB 1KJMA 4M8UA 4M56A 4RAHA 1YNKH 3K6FA 5ERWA 3MOAH 1RZ7H 4QRRD 2ICEB 2WZ0A 3CZNA 2VQ1A 4X6BA 3ULAB 2CPUA 4NN7B 4JUTA 4M61B 4WWKB 5A16A 2HTLD 1HNFA 2AFNA 2ILLA 3C6EA 3ILDA 4NO5A 1G0DA 3OGCB 4D9QD 1DJWA 2ENSA 3U82B 1CLZH 2LTQC 1BVZA 4NIKB 5TQ0H 4BXVA 5L9DL 2EKSB 4TUKL 3VFWA 4HBCL 3T0EA 3WFHA 2PXYB 5AW1B 4ZX3A 1KLFA 3GBMH 5EBGA 2AHIA 2G9KA 2J8UA 3SDDC 1D5BA 5H94A 1Y6NR 1EHKB 1RJYB 1DANU 3ZO0A 15C8H 5CCKL 1U2HA 3MLSH 4K4KA 2EVHA 3P4NB 4W4OA 1CT8A 3T3MB 4K8RH 1YEGH 2MCMA 1B3JA 1PKQB 4AY0A 4JKMA 4F7MB 2DY2A 1OTSD 4YSAA 3H0TB 1KDIA 5FO7B 1A14H 1NFIB 2VXSL 1RULH 4YGVB 4NQXA 1MRDH 4JFWA 4EI6B 2Y22A 2Y5EA 2CKBH 4K8RD 4TRPL 4H4NA 5EZOL 1EHLH 2D3NA 1NCBL 5BMFH 3O6KH 1OGPA 4QNPF 3L3KA 5BNXD 2PYFB 2BZ7A 3B2XA 4M6MH 3TF7C 4G5AA 3EOTL 3ZDYB 1UD4A 5H2BB 4IRJC 5CO1A 3BP7A 4RESB 2GAZA 3EJSA 5LAXB 1QEWB 3ZHNA 1NC2A 2VDLH 1CB4A 1SJMA 3C9NA 1P84K 4P9HC 5DUPL 5D6CA 5CNHA 1Q9WB 3WG7B 2EC8A 2Y23A 5KYYA 1I7UA 3PWNB 4JGMA 2D31B 5KS9A 3HNSH 2QQKH 3TIDA 5IHWA 2WJ7A 3VU1A 1MEXH 1TZIB 1MHHB 3VXOB 5KSBF 1BBJA 4XB8A 5I30H 3IDGB 4PJCF 3CN0A 3V0JA 3O3DB 1FL3A 3WO4C 4PJAE 4XP5H 1R5WA 1QP1A 3DV4B 4UUJA 1FDLH 3OKKB 3P30H 2FBOJ 3BAEH 4ZMXA 1UB6B 3ULSB 4L8CB 1P5UB 2N1TE 4B96A 4ZUVB 4LLWB 5AOLA 1Y7VA 3QHFH 5IVXA 4EZLA 3FT1A 3NSFA 1Q90A 2OTUA 3LPOA 3CFCH 3LKSB 1JD9A 4G8GD 4LXFA 1U6AL 3GD1C 1FE8H 1AS7A 4Z1PA 2MH4A 2JK5A 5TQ2L 4OLUH 2P52A 2X2UA 2PMZA 4X42A 2WXJA 4JM2F 5C09B 4KXZI 5K9JH 2AANA 1PEWA 2F7IA 1GCFA 4KX9A 2DTMH 3BW9B 5DUJA 4AH2A 3ULUL 3V0HA 5CZRA 2ID5A 2CLVA 3KBPA 3M1BA 5FGCE 4DN4H 3AUVA 2FWUA 1BYNA 4NNPL 4F3FB 1OOWA 3L5XL 1CTNA 3S7GA 3FQYA 5KVMC 3JV6A 1NC2B 1MCWW 3C9NB 1P84J 2QL1A 1O9WA 4LLAA 4PCKA 4TVPL 5D1XD 3DX1A 4FFZA 3G6AB 2R29L 4H5SA 4AQAB 5KN5B 5GRXG 5LBGA 1DQVA 1RZ8B 1YN7A 4HK3J 4YJZL 2CO1A 3ZE1B 3U0TB 2EIEA 3MJ7A 3NMEA 5TE6L 3IDYB 4QRRA 4ODXB 1KF9B 5I0VA 3LEVL 4KROC 3S4SG 3MKKA 2IALA 3ZDXB 4PQXA 3ZTCC 4GO6B 2VXQH 3OHMB 3FW6A 1OK0A 4BSWA 43C9B 1GA2A 4ZO7A 5ILTL 2ZUVA 1FVDA 1YAIA 5HHXH 1QLFB 2QADC 2GHWB 5KJ7E 2X4OA 3KGTA 1WZAA 3WUWG 2DKMA 4HWEL 3BQUB 5DC9B 4IBVA 2FQEA 2FEDD 2OTUB 2YR3A 1ZEAH 4QD2E 1MXDA 3EO0B 2VL5A 1NCAH 2CRZA 5SWZA 4ZMTA 1S9YB 4H2CA 4QJ5B 1F41A 3QIUB 5T3XD 3P0YH 1EEQA 3CXDL 5KTEL 1UCTA 3LEVH 3CZLA 3AY4C 4I9WD 4TF4A 5GIRB 5IQOA 2IPUK 1OAZL 3QDGD 2Z8RA 4N9OB 4JY6A 3ARBB 3SGEH 3AACA 3DSNB 3RZCA 3ZHFA 3BSZL 4D7PA 5IWLA 3O9WC 4N8CH 3DVFA 4FQXC 4ZMOA 3RVXD 1IFRA 2CRIA 2VT0A 1NOFA 3KHOA 5IEKB 2WXMA 4HKZB 1BD2A 3FQUB 1CCZA 1T2XA 4XNQA 1AHWB 1NLDH 1MCFA 2EDRA 3I9AA 1ND0A 1THCA 1H3TA 3WMSA 4WUUD 2NY7L 4XVUD 2PO6A 4GS7C 3LZFH 5FWRA 2A9BA 5K9KB 3DXAE 4KJWC 1EZSA 1DBBH 4OZIA 4G7YL 5JHDB 2BOCB 2Q2EB 1CFTB 3IMUA 3K81A 3KYAA 1NCWL 2NLJA 4J2XA 4X9HA 5I9QB 3CN3A 4BEIA 1XX9C 3QH3B 1BM3H 3PNWB 2CLRB 4JO4L 2IAMA 5DWUH 4KZCA 2W07A 3KPOA 3DYOA 2KH2B 2CHZA 4F5CE 4BFIA 2P8MB 1V3LA 1I8MB 5AYQA 1CLYH 3GIVA 2ADIB 1A1MB 5KSUA 3KYKL 5E9NA 1EO5A 4BCXA 4C56D 5B3JE 1TDQA 3QWOB 1T0PB 4J28A 2P5WD 5DJ2A 3E2HC 4JO2L 2VMDA 1GCYA 4P2YA 4AM0A 3UJJH 1NCAL 4L1BA 2MKLC 5G4OA 3X13B 1IC4L 3GSNB 3WFEH 3LEXB 5J13B 5IJKA 3RNQB 3KPSA 2QTVA 3K6IA 4JFFE 3HNVH 2CJUH 2E9IA 4K3JH 3VX0A 3IU4H 4AVHA 2HMID 1WISA 3C2AH 3PPEA 4Q52A 4H40A 3E9TA 4GAAA 1S9WB 5BRZA 4A7GA 2V17H 1I9EA 2F1AA 4L9LB 3D0LA 1MFUA 1TTBA 4TVPE 4XC1L 5C0BB 3K8LA 4FMFA 3R19A 3OJDA 5J1TC 4MMZC 2EE0A 2CLZB 2JJTA 1BJ1J 4XOAA 1A2YA 4UF7C 4TQIA 1EGJL 5L4MA 1JV5B 5BO1L 3RJQB 4MHHG 1WUZA 4QRTB 1JYWA 1FNEB 7FABL 2OYMA 2AI0L 5E08H 4G8EA 1S9VB 1PAZA 4ODTH 2PTTA 2H1PL 1H3VA 1KLUA 3FQNB 3EYSH 2E5EA 3I2CH 4QGTA 5DR5L 1A3QA 4L8SB 5D70L 4P46B 5C6TL 1OD7A 1OAXL 3CFJA 5FF6B 4IOFD 4TLSA 5LGJA 2AGJH 1RULL 3DSFL 4XBPA 2YD1A 4A39A 4MMYB 4OZFG 3JVGA 3MREB 2LE9A 3P40A 3G9AB 1CBJA 4EQ2A 1ZT7A 1KEGL 3MUJA 3NIDB 1ZGLP 5C08A 3BZ4B 5E6ID 2IOOA 4YBLC 3A67H 3MFFA 4ZTEA 3VACA 2Y36H 1WV7T 2O5NA 3QVAA 5B3SB 3OG4B 5DJ2B 1OM9A 2NZ9C 1EAJA 1Z1WA 4O2CA 5F1IB 5FYKH 4UTAA 5TQ0L 2NX5D 4N8UA 1JN6A 3T09A 1TZ8A 2O6DA 5ACZB 3U4KA 4TVSa 5J5EA 5IJVB 3VXMD 3X3GL 2YWZA 3H6AA 3ZSSA 1UURA 2EDKA 5DJCB 1K5NB 2Q76A 4M4RA 4BUHA 2B20A 1FP5A 5B7FA 4L9LA 5L6YH 1BIIA 3WJJC 4KHTH 3MOAL 2YN5A 4JUSA 1VEOA 4NP4L 1YNKL 5CU5A 5TJWK 1QFWM 1DE4A 4PVBA 5HY9B 4KDTA 4CMMB 4PWFA 3G5ZB 5MHSD 2FWLB 2VLME 2X9XA 4J8QA 4AKOA 4Z76B 3WY4A 4FTVA 1VFUA 3TYFB 3EBAA 3NG5A 3THML 1QR1A 1I8KB 5DUPH 1H19A 2OX5A 1MQKH 1WAPA 3FKUS 4NKOA 3R7RA 4Z3IA 1F4WL 1I7ZB 2WXQA 1C9SA 4FKEA 5KVDE 3OF6A 4CKVX 4HZAA 3ZTNL 2B9BA 1QSEB 3ZZQA 3NEOA 1AHWC 2VR9A 3VXSB 3AU1B 4IIQB 4ZFGL 4FG6C 3NPSC 3MV7B 4WHYH 2X2YA 2SEBB 3SKUD 2NX5B 3GNMH 1Q9KA 4H88L 2LFGA 4NT6B 2F54E 5MEQB 3EBIA 3D25B 4FYQA 3ARQA 4UTCA 3RIFF 3UABA 4GT7A 4WUKL 1XEUA 1B0GB 4I9XA 3DVGA 4J3UA 4LGSB 3R7QA 3MLXH 2OMNA 3IN0A 2H1XA 3WE6B 4POZC 2JJWA 1Z2KA 3AXHA 1E4WL 1CXHA 3VVVA 5IQ9B 5HHNB 2OAAA 4Y4FA 1NM4A 1P9MC 3CX5J 1PVHA 4Y9EA 4OD1L 4BZ1L 3BRFA 2A1WL 4HULB 3ARUA 4NAJA 4PJBE 2QVMA 3GO1L 3MRJB 1O6VA 2V0AA 4P5SA 4WO4A 3CLEL 1QZ1A 5LDUA 2DQJH 1NIFA 5F3HB 3TBVB 4Y5VC 4W9IC 3SDCC 1I7TA 1UB5A 1MUJB 1R3LA 3T9WA 5B1CA 1HOCB 1AD9B 5D5MA 4E41B 3HMWL 1XMWA 3K74B 4KKNA 5F3BA 1BG9A 1TZHB 2XWJB 3DA0A 1P4LA 4M8QB 4YZFE 4XH2B 4XWGH 4RWYH 3TGXA 4WFGE 5ICXB 4A6YL 4L37B 1TUPA 3ZTDC 3HAEH 5CLTA 1NCHA 4HLZG 1RFDL 2C3HA 3LRLA 2A6JB 3VG0H 5CR1A 1BJ8A 4P2QE 3IDNA 4NQSA 2W0FA 1RUQL 2BLFA 3LH8A 2NQDA 2BJML 1HXMA 2X1QA 1OAKH 2KUTA 3EKCA 3C75A 1CFNB 1BOGA 1MCQA 2AK4A 4JN2B 3Q8AA 1GZPB 2HKHL 3FTSA 2WMPB 5IROA 5FA3B 4AYMC 1GZHC 5IVOA 1Z9MA 4C56A 1QW9A 3O8XA 3VJ6A 4U1HA 1WJ3A 3DGCR 5ANMA 3AADB 3DUUA 2BO0A 4O51A 5IVXF 3TBTA 3GSUB 4LRIA 5HPMA 3WE6A 2Z92A 3MSPA 2NZ1A 5GJTH 4PJEB 1ZHNA 2OA9A 1DDHB 1QNZL 3VFSA 1RU9H 2ARJQ 2JELH 1W72A 4LAQH 4PRPB 1KXHA 4F5CA 1RZPA 1ITBB 3A22A 1CGYA 2JI2A 4YHNA 4PPTA 2M83A 2NY0D 4IMKA 3F7VB 3MNWA 4X6CB 1DEDA 1FO0B 3CSGA 3QIWA 1I9IL 4Z7VF 1YY8B 4MZIA 3WIFB 4FQLL 2R8SL 4A38A 1NAMB 4X5PA 3CVHH 2XWDA 1KN4H 3SKMA 5BCAA 5GGTA 2VLRB 3RWHB 3CPLA 3ESPA 5EUOA 5KVDL 4U1NA 3B9KC 1C12A 5I8KH 2GIXA 1W0WB 2OM5A 4X2UA 4N8VA 1ZWIA 2ZCHL 3D85B 4H1LA 3FOMA 4KVPA 5BVJB 2DYPD 2CIKB 3O2VH 2AABH 5JOPE 2WBXA 3ZDZF 2C3VB 1DUZB 1M71A 2BIHA 1BOYA 3V2AR 3VXUD 4QCIA 3QQ9D 3NZ8B 3PWUA 1SHSA 4S1RH 5J9PA 4J8RB 1D5IH 2IPTH 3BO8B 3NIDE 3S35H 5ES4B 2ZYSA 4YFDB 3RNKB 1IZKA 1R1CA 5I66A 1Z3GL 4JM2B 5IQMA 2DH2A 4NCC2 5F1KC 2Q8BH 3WSQH 4R8WL 5JIPA 3K2KA 3KGSA 4KXBA 4P99A 4ZK8A 3HFMH 2EEXA 3TWCL 5D7IB 1DEEA 3OGCA 4LCWB 5EF2A 5A6LA 4KAQH 4HW6A 2CDEB 5F9JB 3Q2WA 5HDQH 2QSQA 3LKRA 4H8WH 3ZZ1A 4AQOA 1UA6L 4XCEA 3RGBA 3T0EB 2NR6A 3KPRE 3WY1A 3RY4A 2FAUA 1OHQA 3K0WA 1DP0A 2F18A 2FUQA 1ZE3C 5CN3A 1KB9J 1F02I 3BKML 2CE6A 3GSWB 1YQVL 1LEIB 4BRVA 2DD8L 3DPBB 4N87A 3NZHL 3I74A 1YEJH 1UXWA 1CT8B 5CN2A 3BD4A 2XV0A 3GS4A 1JYXA 3N5AA 2MHAB 1TOXA 1MRFH 1OSEA 5E4AA 4UOW1 1I85C 4D0DB 1TKWB 3U2IA 2ENPA 1YEIL 5FA4A 1KOAA 5LG6A 2RCSH 4HSQA 2K3TA 2XXCB 2EUWA 2CBTA 2QPDB 1FL5A 3FOMB 4NRYA 4L0ZA 4KZDL 3CVHA 2E6QA 5DJXA 5GZOD 2B4CH 3BAJA 2B2XL 2GB2A 3DX6A 3HG4A 1TLKA 4PGDA 5ESQA 4QXUL 3LKNA 1FPTL 2A77H 1DBJL 4UIKH 4ZW3A 3LQAL 1N8ZB 3H9SA 4Q9QH 2Y69B 3OZ9L 3QUZD 2P5ED 3ALXA 3PAVA 4U6VH 3SDAD 4MXWL 2V2XA 3MR9B 1KFAL 3S48A 4JM2A 1ET7A 2YHGA 2G4EA 1NOAA 3VWKC 5J8OA 3RA7H 1AXSA 5E23A 1T2JA 4WU7B 5DJDA 1E42A 4PRHB 5FS5A 4A2HA 1SEQH 2IG2L 2YPLD 3QK0A 1PIGA 5ESAB 1UZ8A 2RACA 1JZJA 4LZKA 4NO5B 5I15L 2XTSA 1YUKB 4N68A 2Z4TA 2FJUB 3BQUC 3QI9C 3O8XD 3V55A 2Y6TE 2YFOA 2EEBA 1DBMH 4N2FA 5DS1A 2PPEA 3WJLA 3QXAA 5HI3C 1OHZA 2NY5H 4X6FB 3LRKA 4KJQC 1EDHA 1A1NA 5MENE 2EYRA 2DLFL 1AGCA 2WLLA 4XPAH 3NDYE 1KYFA 1OF2A 2X1PA 3MA9L 1TJMA 4Z7NF 5LXGH 1J5OL 2K8QA 1ORQB 5M7QA 4Q2ZB 2GJ6E 3KYMB 2D7TH 3N41B 3F12A 4G6MH 1JNLL 5JMRA 2YXVA 4PEEA 4K94L 3U25A 5D71L 3D12B 1NCOA 2K6YA 3BW9A 4YDIL 1FH5H 2CDGB 2XZAL 4KZEL 4G7QB 4J3OG 1B6DA 1G4MA 1HVXA 1M7XA 2R83A 1H3UA 3R1GL 5GISL 4APQA 3H8NA 1H6FA 2FECL 4JO1L 3BUDA 3RILA 1KC5H 1N8ZA 3H9SB 2JWYA 3N9GH 4HX1B 1DFXA 3CFTA 3MLVL 4F9PA 2OSLB 3QWRA 4ODWB 3ARED 4EI5C 3B7UX 1F58H 2XC8A 2NNAB 4WJG3 3TIEA 4OQTH 5T1LB 4DK6A 5HHQA 3C6LA 5K9OB 1RHFA 3X1GA 4MCNA 3CZEA 3JWNC 5FDWB 3IJYA 4CGTA 1UG9A 4FLRA 3SE4C 1XXDC 3NAAL 2YPKA 5CIPB 3U4BH 5IR1A 1HCFX 3ZKND 3B2PA 4ENED 3I50L 1F1GA 2CXKA 4Y1TA 4PRPD 3RX5A 1QSEE 2EXSA 4WEBL 4GAFB 1RZGB 4M8RA 1AP2A 3FT4B 4PD4J 1HZHL 2FLBT 4ONHA 3RPBA 3K4DA 2YQBA 2KMWA 3BEWA 1G9ML 2DB8A 3FO1A 4BM7A 3GLEA 4HCRL 4JVPA 4AIOA 3DMMA 2BHYA 4U3XA 2WLJA 4S0HA 4FLOA 4M1DH 1YEKL 1IL1B 4LHUD 2AXFA 1N0LA 1IEBB 1SGKA 1WEJL 4K5NA 4JFDD 4OSUL 3ZDWA 3GSNH 2GPZA 2OJEB 3QUKA 3SD5A 3RHWF 3U6XA 2WXOA 3PDGA 4MMZB 4NZRH 3AB0C 4ZFZA 1QBBA 3VD1A 5JPMA 2P8LB 2GFBA 2CIIB 3ZDXE 1N2RA 1S78D 2PYED 2JQMA 3O2VL 5J11C 2X4SA 5I82A 2M26A 4NQCD 1JZHA 3KM2A 3IDMB 4GAYA 5IEKA 5F6HJ 3UAJA 4WW2A 3P2BA 4BFBD 3HI1B 4XMUA 2ADYA 2ARJA 2XKNA 3KVDD 4F8QA 2BS9A 4JFPA 1UACH 4PB0H 1TO5A 1S7RA 1FFNB 5LCVH 4L1TA 2ADGA 2HP4A 3T3ME 4FAAB 1YEFH 2EDHA 4LU5H 1QVOB 3EH1A 4UINH 4UMSA 2KERA 4LL4A 2ADFH 4L2LA 2YPKB 1YPZB 5F8RC 3W5NA 4N28A 2WPGA 3T0VA 4TSAH 4EPSA 1KULA 2B39A 2OXHA 1BLNB 3BYTA 3WEBA 3ABZA 3QEUB 1U8MA 4CNIB 3J2PA 3ZDYE 3OXRB 3JWNG 5T33H 5DD5L 5E03A 3PL6B 4KKRA 4QDGA 4AM0B 5DJAA 4HS3B 1Z6JT 3S5LG 3S2AA 2Z8WC 3EO0A 2WUBL 1BAGA 4K94C 4ZI8A 4OLVL 5D1QC 1AG0A 4PI2A 3VB8A 3GBLA 1TZOA 3BWUC 2H3NB 2V5SA 2MTAA 3GHBL 4JDTH 3KPRD 3O4LB 1FG2A 5FEBA 5LJYH 3QDME 4PREA 3TO2A 4UANA 5KJRH 3HZYB 5F70A 3BLPX 4YHML 3KLSA 4FKHA 5JHMA 4WIQA 1KV7A 2EE3A 2R23B 4GJTB 4AKPA 1S7XA 2P8LA 1M9SA 1MJ7H 2WWMD 1JWSB 3EGSB 4HKBA 3ZT7A 4PJAB 5IBUG 4ATTA 4M1GH 4X8JB 3SPGA 1CE1L 1DSFL 4ZXBB 1ZDQA 4HWZB 3X17A 4FD0A 4D0BA 5FV1L 3EDFA 3K46A 3LNIA 3DX9A 1WRFA 1XF5B 2EYSB 3EJTA 5I8OH 1U8KA 1S9VA 4N2IA 3EGXB 1DBKL 1MJ7L 4NN5B 4OCXH 2OZ4H 4XBEL 3WELA 3C8DA 1DQTA 4DEPB 4LLQA 4W9JC 4FQXB 4M5ZH 1MIML 4YPJA 5DO2D 2ZUUA 5BRPA 1Y0LB 2AQRA 1E6JL 4TUJB 1PLGL 1T21B 4OJFL 3U7AA 3AREA 3KS0J 4BK8A 5D72H 2NLJB 3FO2A 1HQRB 3ZE0B 4K9EH 1GS6X 1XZ0A 3FFCD 5TPWL 1BEXA 3MCLH 4ODHH 4Z3JA 3MX0B 5CBEB 3EUUA 1DL7H 1OARH 2W07B 1VLXA 2WVTA 1NH6A 3T0DA 4ZD3H 2NXZB 4NC1C 3L54A 2ADIA 4JZOA 1A6VL 2AQNA 4M4PA 3QQ4B 1MOEA 1X4ZA 4HSAC 3RAJH 2CMRL 3FFCA 3QG7H 4KDVA 5E24E 3OZKA 3LAFA 1Q1JL 2WNGA 2NY2B 5JLZB 2ADFL 5JR1L 1EA9C 1NGYB 2ZF8A 3OXSB 2A83B 4GP5B 4DP0X 4C4BA 5HHOB 1ET8A 1J8HA 3O4LA 1ZOXA 2MEJB 1S8DB 2CRMA 2G2PA 2IGFL 2WCPA 5ACLA 4Z7UB 3T8MA 2MQ0A 1Q0EA 2IFGA 5EU5B 2PWFA 1H0DB 5HGHB 1E50A 1T0MA 4LDOB 2J8OA 2ZPKH 2FSEA 3MUY1 1Q0YL 3TPUB 1O9VA 1GPOH 4I2XA 5C9JA 3SBWA 2WWMC 3LNEA 1J8HD 5C0BA 3NCCB 4NX0A 1I4FA 4QPEA 5DI8B 4Z5RA 3V6OE 4E5XG 1T20B 1N5AA 3MRNA 3LV3A 1CG9B 5I74C 3RAJL 4UIMA 2Q7AA 4HJSA 3G04A 1GOGA 1ZV2A 2LLGA 1J9TA 3VD3A 2JCCF 3D05A 2PCXA 2D9CA 1HZLA 4JRLA 2YOAA 2CBOA 1KB3A 4G8EB 3B2VL 3HB3D 4RETB 3F6LA 3MXVH 4NP4H 1PZUB 4PGCB 4LVHB 4QHNA 5C2BH 1ZSDB 2HTKC 3Q48A 4U3HA 4N6QA 2JKTM 1T4WA 1BPLB 2CDFA 1DVQA 3GXNA 5D5ME 4OSUH 1CO1A 4XNYH 2AEWA 4WV1C 2VW7A 3ECWA 5JHLA 1A9BA 2X0UA 4O58L 4HCRH 4IM8A 4CU7A 3Q8EA 2P26A 4BQ8A 5J6SA 3EDDA 3BUBA 2IPKB 4HD9A 4YXLL 3POCA 1BFTA 1NAKH 1NZRA 3ATDA 5FHBL 2VDQL 5CEXB 3GJFK 3HUJA 4L18A 2L8AA 3FQTA 3OKYA 4U49A 2GSGB 1UM6H 4AV4A 4DZBB 4FXGB 2WINA 4QRBA 4U05A 2GKIA 4IBLT 2ZUQC 1R0AL 4ZG1A 5IJDC 4UTAH 3KPSE 3Q06A 1KIPA 3GSOB 2NY4C 2UZYB 4CSTA 5KVGL 3QXVA 1VGEL 2DBJA 1OTTD 2WK2A 3DURB 2AJXL 1HN1A 1CTOA 3CBKB 3QFJE 4YHKL 2GK0B 3ELAT 4GUOA 5C6TH 3F8UB 3IS0X 1VZGA 1DVFA 4O02H 4ONGH 5AVYB 5DR5H 5FFOA 1HI6A 1HSBB 1BIIB 4W68A 3CU7A 5HDOA 2QDWA 4PJ6A 2BRRH 2DWYA 2AQSA 1HS6A 1U0QA 4DUXA 2YXWA 2QKIB 3LCYA 2PP8A 4P2RE 4U6XA 5HYJB 5KBMA 4PJAF 1JD7A 1A25A 4QT5A 3ETTA 5BO1H 4KZEH 2HLAA 4LVOC 4JL1A 2A0LC 5C0CB 3W39A 3CHRA 4U31A 1XR8B 4RZKA 4S2SA 1AZBA 4TM9A 4F57H 1RZKL 5DMGD 1NCDL 5ICXA 1YPZE 2XXGA 2EDOA 4JDVA 2JI1A 4ZOEA 1ES0A 1BVLA 1BWWA 3IDNB 4NQSB 3CLFL 5T1MA 1RIHL 2DQEH 1AZVA 3HNVL 1MNUL 2AJUH 2EO1A 4HJTA 4ODHL 3L1OL 4AITA 5E4OA 2H8PA 3EDKA 5I1DA 3QZNA 3TJEL 3TNMB 4ANUA 3N44B 4MNQB 2APFA 5CU9A 1IQWL 3PUCA 4N3TA 5FA3A 4EKJA 5LWYL 4YK4C 4N9GA 1E6JH 4P2RA 3FBKA 4URTB 1CQKA 3IF1A 3KYKH 2NY3D 1HZKA 2A74C 2WLHA 1E3FA 3BOVA 4QRQA 4YHLH 4XPTL 1IVLA 1TF4A 4BZ1A 4L5FE 4KTGA 2OCJA 1JE6A 5CP7B 3WHE1 4BUGA 1EEZB 3PHQA 5I75C 4LSSL 5E1GA 4HUWB 1CLOL 3KYOB 4NQTA 5IMOA 4LGPB 2NSXA 2GEQA 4GBXB 4X98B 1ZANL 2DEWX 4BK5A 2YKKA 4LSRH 4Y19B 1I7RA 3K8MA 1MCPL 3PHSA 3D9AH 1BQHG 4XN2A 4YDKL 3TESA 3PIQB 4JANA 1KWKA 4QF1A 3ZE0E 4G8GA 5TDOB 3DBSA 2OR7A 4GG6E 1HINL 2OMXA 1L7TL 3D69A 3O2WL 1F6AA 4NQQA 4Z7WE 3GMNB 3PXHA 4ONFH 3TBVA 5JZ7D 3SN6N 1JWMA 4FYRA 3LIZA 1P6WA 4H2AA 1IC7L 1PZCA 2E74C 1AKJB 3UACA 4JZNA 3ZDYF 4XCFL 4B9ZA 2WIIA 3U0PA 2XWJA 1EHXA 5FM5M 2HJLB 1YEIH 3HG1D 2IGLA 4Q9BA 4IQHA 3OJMB 1KY7A 2VMCA 3ZK0A 2FQDA 5T1MB 2Y6SD 5IMKB 3BKYH 1ED3A 3MXWL 1HKFA 4KMLB 4Z7NE 2W95A 5D2NB 4OQTL 5CEZH 1CICA 3MZTA 3ERXA 4LHUA 3MA7B 1H9VA 5KSBB 3CHQA 1KZQA 4IBYA 4PJCB 2A7BA 3MLVH 2QMKA 1PLCA 4JN2A 2YAQA 1GZPA 4LU5L 3S88H 5FK9A 2VMEA 1QASA 2ESVD 1QRNB 4POYA 5A2JH 2BVEA 1UZGA 2VNCA 3AT9A 4PRNB 2WD0A 1EAOA 2YD7A 2CGYA 4J4PA 2GBVA 4U1HB 4UDUA 5CSZB 1MJUL 3MJWA 1P69B 5MP6H 5JORA 4BFNA 3TA3A 5DYFA 1FO0L 3GBNH 3CVCA 5BW7C 2ICWJ 3FUKA 3ARFC 5JOEA 4DK3A 5DRZB 5DMYA 1V8HA 5C0JA 3VFWB 5CFHA 1JGDA 4K8RC 3WSQL 2D7TL 1P7KB 2XXMB 1KJ2L 1U4EA 2NY6C 4ZDHB 3H2QA 2BPBA 3VFPB 2XQBH 1HT6A 1XCQA 1E3ZA 1B0IA 2NXYD 5MEND 4S1RL 2LOEA 2VWEC 2MWCA 1HJBC 1FGNH 4KTDL 2OI9C 3V0IA 5AFAA 1JK8B 3GSNL 4U1GB 2YAPA 4YUEL 1SXSA 3WEMA 1AKJA 4JW3A 6PCYA 3ECBB 2H0FA 35C8H 2NW2B 4R90H 3OMNB 5EA0L 2A6IB 4OCWH 4M3KB 1OAUH 1OSYA 2WUCH 4M5YL 3HZVB 3L3KB 1EEYA 1WZ1H 1D5XB 3WUWA 4L1LA 1OAQL 3EYVA 1BMGA 2ZYRA 3LRMA 3GUTA 2AEPL 3D0VA 4OU3A 1CUOA 4WU5A<