2I7OA

Structure of re(4,7-dimethyl-phen)(thr124his)(lys122trp)(his83gln)azcu(ii), a rhenium modified azurin mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Tryptophan-accelerated electron flow through proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i7oA00
5D4JA 5PCYA 2FT6A 1A65A 2HLEB 2BP0B 2VW7A 1BXAA 1ZDQA 3PAZA 5TK4A 4DP7X 2E86A 5B7MA 3GXUB 2AZAA 4DPBX 1J9RA 1E30A 4KO6A 2DWSA 6PCYA 2FQGA 1ID2A 3ERXA 3JT2A 3QJVB 3FSWA 3QJSB 2QDWA 1JZGA 1QNIA 2J5WA 4UANA 2MTAA 2RACA 1AQ8A 4M4RB 4DPCX 4G71B 2UXTA 2ZWNA 2IDTA 4ENZA 4NERA 3ABMB 2AFNA 3EH5B 1I53A 2UXGA 2HRGA 1SNRA 3BVDB 2J55A 4DP4X 2IH9A 5I6LA 1NZRA 2YQBA 1ET8A 2EINB 1TKWA 1BAWA 2PP8A 2IDUA 2IDSA 4AKPA 3UAAA 3FQ1A 3FQ2A 4DP5X 2TSAA 1ASQA 3DTUB 2P80A 2XV2A 2YAOA 3PCYA 5I28A 2J57A 1NPNA 4F7KA 5B1KA 4L0PB 3NP3A 1JZJA 1V55B 1BQKA 2IDFA 2YAHA 3CVDA 4KNTA 4JKNA 1OF0A 1IBYA 2GC7C 3PAVA 1R1CA 5AFAA 2XV0A 3FU7A 4F2EA 1WS8A 2CJ3A 4KNSA 4A2EA 2B3IA 2XU9A 5B3SB 4NB7A 1EHKB 4CSPA 2XX1A 1OCZB 2BW5A 3ZIYA 3TASA 1ZIAA 5A7EA 1IUZA 2YAEA 5D4IA 1PZAA 2XYBA 4X4KA 5I6OA 1NIEA 2QT6A 3OMAB 4K9JA 1PZCA 3ZBMA 3WNIA 1DYZA 2DY2A 4GYBA 3T6VA 1MG2C 3WI9A 3X1NA 4G7QB 4EF3A 5B1JC 2PCFA 2CUAA 1MG3C 1RKRA 4WTQA 3FYIB 1MDAA 1AZUA 1N70A 1PLBA 2DWTA 5AKRA 3UADA 2FQDA 3OM3B 2BWIA 2HX9A 1GY1A 4HIPA 3WIAA 3AY2A 3FU9A 1J5CA 3CDZA 3IN2A 1NINA 2OJ1A 3EH3B 2GI0A 6PAZA 1AS8A 3CG8A 2BP8B 3X1EA 3WNJA 4AZUA 4E9XA 2QDVA 1M9WA 4KO7A 4A2DA 2GC4C 4BXVA 1A8ZA 1JOIA 4NAJA 2FQFA 2FWLB 3MX0B 4DP2X 1JZIA 4GP8B 1IKOP 4BDVB 3MBWB 1A4CA 1W6LA 2FQEA 1KBVA 2XWZA 3JTBA 2QPEB 1CYXA 3UACA 1BEXA 1E67A 2UXFA 2XLLA 4HZ1A 3WG7B 3UAEA 1CURA 5B1AB 3AG2B 1ILUA 1E65A 3BQVA 2ZXWB 4N4YB 4A67A 3NSFA 1HFUA 2XXGA 1AZNA 1PAZA 2XV3A 1JVOA 4HCIA 4E9VA 2CALA 4MFHA 3NT0A 3QPKA 3IE9A 1ZV2A 5I26A 4KO9A 2FNWA 4A2GA 4E9QA 1AIZA 2ZOOA 4E9TA 3X1FA 2GIMA 2IAAC 2PPEA 4DP0X 2H3XC 1IC0A 4A2HA 5E9NA 1PLCA 4A2FA 4KNUA 2BHFA 4AKOA 1PLAA 2BZ7A 3IN0A 1SDDA 3SQRA 3QJRB 4N8UA 2YAMA 1V54B 1RZPA 1AZBA 1JVLA 3OQRA 3T71A 1L9PA 1AZCA 3CVCA 2W8CA 2HZHA 1SFDA 2GHZA 2YXWA 3NJFA 3AW5A 3S8GB 1NTDA 4HAKA 4G72B 1ET7A 5TK2A 2FTAA 2WO2B 3PLYA 3QJTB 3FPYA 4HCFA 5I6KA 5D4HA 2UXVA 3ABKB 1NWOA 1EZLA 4AX3A 1AG0A 3FSVA 3G5WA 1SF5A 3DKHA 3HB3B 2JFCA 3NSDA 2JXMA 3QJUB 1TEFA 1URIA 1YLBB 2XVBA 1SHXA 1J9TA 1BYOA 1MZZA 3QQXA 3TU6A 2GBAA 3GDCA 4DP1X 2GSMB 5AZUA 4BWTA 2Q9OA 2R7EA 4PCYA 3NJMA 3TA4D 1OE1A 4BK5C 2H47C 1MZYA 3T6ZA 3T6WA 3PPSA 1BQ5A 2YXVA 2DYSB 2VW6A 4QLWA 3NJKA 2BW4A 4AI7A 5I5IA 5B7FA 4YSTA 3S3DB 1BXUA 4UAHA 4JHVA 2X88A 1PF3A 2IDQA 5IY5B 1XB3A 3FU7B 4HHWA 1OV8A 1OCOB 4AKQA 1AZRA 4E9SA 5B7EA 1JXGA 4GP5B 3OMIB 1NICA 1F56A 1NIAA 4FAAB 3NJIA 3FS9A 1PZBA 4W9ZA 3FU8A 2PP7A 3IBOA 2JKWA 3L45A 1CYWA 1XMEB 4YVNA 3TBBA 1CC3A 1ADWA 3T6XA 1GR7A 3AG1B 3AZUA 5I6NA 4GXFA 1NPJA 5B1JA 3HEIB 1KBWA 2UX6A 5FC9A 1KGYE 3ABGA 4BWUA 2IWFA 3QJQB 1AG6A 3GYRA 1XB6A 1B3IA 1V10A 3ZX1A 1KCBA 2BP0A 1N68A 1SF3A 3FYEB 5B1BB 2X87A 1AOZA 3PAUA 2IH8A 1CUOA 1NIBA 2EIJB 1PNCA 2VSMB 3SBRA 3TBCA 1OCRB 4QKTA 2PPDA 4YSPA 4KO5A 4F2FA 2NRDA 3IEAA 1J5DA 1JERA 4A68A 1WA2X 1BYPA 1X9UA 2FT8A 2VN3A 1M56B 3CDZB 3NJGA 5I6MA 4E9WA 1BXVA 1RZQA 3NSYA 1WA0X 3DIVA 2VSKB 3NYKA 2DYRB 2VM3A 2FT7A 1JXFA 1A4BA 1J9SA 1ETJA 2QPDB 3NJHA 4YSCA 1JZEA 1J9QA 1SFHA 4DPAX 3WKQA 4YSAA 2HX8A 5I5MA 3PXLA 2I85A 1ILSA 3H4FA 1FA4A 3NJJA 2XUWA 1AR1B 4YSEA 1AAJA 1DZ0A 5I5JA 4Q89A 2UX7A 3AG3B 2PPCA 1JZFA 3H4HA 4HHGA 2VMJA 2EIMB 1GS7A 1GS6X 4KOBA 2YAQA 1TU2A 1L9TA 4WKXA 1FFTB 1ASPA 1ZIBA 2EIKB 3C75A 4ZK8A 4YSUA 2A3TA 3N55A 4G7RB 1JZHA 1QHQA 1HAUA 1W8EA 4CSZA 2CCWA 7PAZA 3D12B 1KV7A 3FSZA 3SBPA 1OE2A 2BZCA 2CBPA 2VM4A 1PMYA 4UF7C 1NWPA 2TSBA 1PY0A 4E9YA 1IBZA 2N0MA 3FSAA 5LDUA 3ASOB 1SDDB 4JHUA 1GY2A 2H5UA 1RCYA 3NP4A 4DP9X 3FQYA 1SHWA 1OE3A 2AANA 2I7SA 1GW0A 4YL4A 7PCYA 2VW4A 3FT0A 1FWXA 4W1TA 2LLNA 2J56A 3S3CB 3X1GA 2FJSA 3ABLB 3V9EA 8PAZA 1JXDA 2GB2A 3NSCA 1AANA 3CZUB 1M57B 1PCSA 9PCYA 1AACA 4KOCA 5PAZA 3SBQA 2Q5BA 3S3BB 1KDJA 1OOWA 2PPFA 2PP9A 5I6PA 4BXSV 2PCYA 2B08A 3RYMA 4RH4A 4GP4B 1ZPUA 2WSDA 2OV0A 2BWDA 1GYCA 2BO0A 1X9RA 1E5YA 2AVFA 4PAZA 1UATA 5F7AA 2BP8A 2AZUA 3KW7A 1NDTA 1T5KA 4E9RA 1ASOA 4HALA 4YSDA 4YSSA 1QLEB 4P5SA 2YAFA 2HX7A 3OMNB 4P5RA 2ZONA 5EHFA 3H56A 2IWEA 2YAPA 2W88A 4A66A 1E5ZA 1BQRA 2EILB 2HXAA 4BDVA 2MRYA 1WAEA 1ZDSA 2R7EB 2Y69B 4GY4A 3N2JA 3S8FB 3U25A 1AS6A 3NJNA 2YARA 3CVBA 3FPXA 3ZDWA 3X2QB 3KW8A 3ASNB 1TEGA 4TXVB 4Q8BA 2P80D 2HRHA 2WO3B 1L9QA 1L9OA 3WKPA 1A3ZA 4FA7B 3EH4B 3NJLA 1GSKA 4G7SB 4YSOA 1SJMA 3UGEA 1WS7A 3OD3A 1OCCB 1HAWA 2Y1AA 4HCGA 3UABA 2IWKA 3EHBB 1KYAA 1KCWA 1W6WA 1WA1X 1VLXA 3AG4B 3EF4A 3X1BA 5ANHA 1KDIA 4DP6X 1L9RA 4YVUA 5F7BA 3T9WA 2XXFA 2I7OA 1PNDA 4YSRA 3V9CA 1GS8A 2PPAA 4DP8X 2XX0A 1A4AA 2PLTA 2OCCB 2CAKA 4G70B 4BWWA 2DV6A 1NIDA 1NIFA 4M3HA 4YSQA 1XB8A 1AS7A 1ET5A 1L9SA
chains in the Genus database with same CATH superfamily
3BGMB 2XWJA 3VGHA 5HHXL 4FG2A 3IFPB 1A25A 4UM9D 5E4AA 1YNLH 3CUPA 1MKFA 2E86A 3V4UH 4AQZA 4PQXA 4PJEB 4KTEL 5M95B 4YDKL 5CJXA 1I1AB 1QZ1A 2A6IB 5CUSL 3HJ0A 1YHPA 4YXKL 5I9QB 3VXPA 3NUKA 5DJAA 1TUPA 1BFSA 3MTRA 4FQ2L 1CXKA 3Q1SL 2J5WA 4OY9A 1JPTL 1SJEB 1J1OH 4R90H 3FFDA 3C5ZA 1X4ZA 1LWJA 4TVSa 4DQAA 2Y7SA 3SKUD 5KVGH 1JG9A 4FTVA 1KYFA 4OCWL 4FZEL 3SDCC 1SNRA 1KJVB 3PJSB 2ZF9A 3EZJB 1K2DB 4KJPC 4KKLC 1NZRA 5BVJA 3O6FA 3BZ4A 3Q9PA 1O6VA 3IAQA 2YPLB 2J1ZA 3RGHA 4X6FB 3D7PA 1N5YH 4J2XA 1K8DA 4R84A 3MU3A 4E5XA 3OAWA 3DTUB 1Q0YL 5E2JA 4QOKE 5LGJB 2ZYRA 2ROYA 1ZE3H 1KEML 2NY3D 2KZBA 3TX4A 1YPZA 4KNTA 3D18B 5E1GA 2A5UA 2HJFA 1SN0A 3AGVA 4HUVB 3PAVA 4NNPL 3RRQA 1P7KB 2XV0A 2EYRB 2Y7NA 4BRJA 2VT0A 3PIQB 4PJXA 5E8DH 3U1SL 3EDKA 4OZHF 4NM4H 5GRYA 1E6OH 2IFGA 4NZ8A 5D5MB 1GIGL 4DVBB 2YRLA 1RJYA 2EICA 3B7YA 4PJ5D 3JV4A 4I18A 1EGJH 4BSJA 2VR5A 1X5LA 3KNBB 4ZO6A 4HUWB 2ESVD 1HHIA 3O3EB 4OFIA 5IOPA 2OL3L 3HMWH 4RX4A 2JMRA 4WI0A 3CXHJ 1GHFH 1FZJA 2WNKA 2PCFA 3QQ4B 1RU9H 3OLGA 3EJYD 3R1GH 4NN7B 5HPOA 3NTCH 1KYOK 1WZ1L 1TENA 4OGQC 5HI4D 4FQXA 1V3KA 4NNYB 1V3MA 3S98A 2B5IC 1KCLA 2HKHL 2BWIA 3OM3B 4L3EA 4U1KA 2Z93A 3HS9A 3FN9A 2HG5B 1G0XA 1OT2A 4FC3E 1SLUA 4KXZI 4F9PA 1X9LA 1MVUB 2WNWA 3OKLB 3F6LA 2XTLA 3HHRB 1CI3M 3RL2B 1A6VL 3D39B 4XP5H 3VW3L 3WIFB 4ZFGH 4EQ2A 5IBUB 4OR1A 4MQ7A 4GBXA 1T7VA 2G4EA 4Z7UA 4IKJA 4RQQA 2BRRH 4HDIB 4NHUB 3N42F 1YEDB 1FFOB 2C9SA 4P2RB 2I60L 5FYKH 4MJJA 2ZOLA 1UTDA 2WBJB 1MVYA 4MA7L 1IGFL 2HKFL 3BSZL 4Y4HC 5CP7A 2DQIH 4IEFA 1KIPB 4WV1A 5F7HA 4D9LH 1VHPA 4LSRL 2BFVL 1MJUL 5L4MA 4UM8B 3VGAC 5B1AB 1MW0A 4IHOA 4DCQB 5D1ZD 4Z0XA 5HHNB 1ZANH 2CRZA 3IWVA 2YOCA 2V17L 2DMKA 2X1WL 4RZKA 1I82A 2A9CA 4HCIA 2BOCB 2Z4QA 3EF7A 2W0KA 4LEXL 4L2YA 2M2DA 3LKPB 2QZQA 1G7IA 2WUCH 4L4JA 1GGIH 1PKQE 1BW8A 4PS8A 2W5PA 5IW6A 2CKBH 2DLFL 2PPEA 5JDSB 2VDRB 1IJNA 3SKJH 1IC4H 4YK4C 4L8DA 4CMMB 4JBSA 5ADPH 5C0BB 3VD3A 3TCLB 2E75C 2WTRA 4EI5C 3M88A 3IFNL 1QRNB 1KZYA 3DIFB 4H88L 4EUPG 3VXMB 3H9HB 1ND0A 4GAYB 2IPUG 2AJVH 1QUPA 5FO7B 1NH6A 1DVUA 1A02N 3RVTC 1MWAL 4ZMZA 3T8XA 4Y89A 4DZBB 3RZCA 5GGTA 1A3LL 2A1WH 2JTYA 3UJJH 3QHTC 3E3QE 3L1EA 4F92B 4RAVB 5HY9B 1B4RA 1A1OA 2UWEF 3QUML 3RPKA 5JIIA 3NJFA 4J6RL 3NFPB 5EZLA 4GIAA 5JPNA 2J6EA 1LK3H 2YBRA 4JN2B 1EWHA 4G9FB 4R2GB 2WO2B 1Q72H 3PABA 3PG2A 4GUCA 2F54A 4JPVH 3QUHA 4R0LA 4HC1H 4YHOH 1NWOA 2G30A 3H3KA 2WXLA 3P30H 1NAKL 4BQ6A 2B1AL 5I0XA 1IB5A 3G5WA 5B8CA 4V1DB 3PNWB 1NGXA 4OLVH 2EYTA 5I5RA 1IC5L 1U8HB 1KY6A 1HU8A 3WUZA 5KVFL 3CDCA 1MFAH 4G9DB 4MXVE 2CUMA 2VLJE 2CUHA 3FZUC 3MUGA 4W9GC 1UD5A 5EWIL 1X5YA 4P2YA 4RISL 1ZXQA 4X6DF 3B2UD 1HQ4B 2IFFL 1SBBA 1U8QB 3K0YA 3NJMA 1IMHC 1HCFX 2E4FA 1HSBA 1IKFL 2J6WA 2NYKA 4YHPB 2GEQA 3MA9H 3IVKA 4X8XA 1UM5L 3SDDA 1H8SA 4L8SC 1BQ5A 4QRRB 3DJSA 2R2EA 3BVTA 2Y7OA 3PHQB 1GZPB 3KXFE 4PRDB 4JRXD 1HHKB 2EABA 4WI9A 3B43A 3DHPA 3VG9C 3DPDA 2OQJB 2C1PA 4Y19D 3EBHA 1UWEH 3QA3A 2X6AA 3OG4B 4LCYA 5J4MA 4KDVA 3W37A 3CN0A 4KV5F 3QORA 5DJ0A 3AWEA 1R24B 4LL4A 1FV1B 3AITA 5E1HB 2O6FA 3CSYA 5HD8C 4ZFFA 5I1IL 3K46A 1GYVA 3BSGA 3DRTB 1AQDA 4WTZA 5I30H 2YXMA 1MRDH 1CS6A 2RA1A 4LEBA 5DURB 4FABH 4LDOB 3B9EA 4ZI8A 5F1NA 3CFJA 1ZA6B 5A40E 3BO8A 2CGZA 1CC3A 2HVKB 1RHHA 1GC1L 3BP5A 1CLOL 4PJBF 2G75A 4AIEA 1WBZB 5FC9A 1OLLA 1LEGB 4J4PC 4KVCH 2RIKA 1X5GA 1P69B 1XSOA 1KTBA 5EOQH 5AB0A 4JQXA 1YZZA 1BVNT 3N04A 1NAMB 1SXBA 5CEZD 1SJHA 3X11B 4FE9A 4AVJA 3MFGB 1FDLH 1XGYH 2OI9B 1N8ZB 3QUZC 3QDAA 5HGBB 4N0YL 2HTLC 5CEYB 3S97C 5DEGB 3CFIC 1FGVH 1KGWA 3RP1A 3K6OA 3IEAA 3PWUB 5AOLA 5EF2A 1UYWH 4U3CA 2HJLB 4PRIA 5I19H 4J3VA 4Y4KC 1EJ6A 4FKEA 4A1RA 3NYKA 2YGNA 3HI1A 1CU4H 2FT7A 4KWUA 4AVHA 3W1ZA 4X7DC 3ALXA 1N6UA 3DECA 3QG6B 1IEBA 1UXWB 3RUGA 3SCMB 4MA3B 3MBXH 4NQDE 3I9GL 1FN4B 2EDHA 1ILSA 1XH2A 4N0UE 3TN0A 4LSVL 1LTXA 3GK8H 3OWRA 2JJTC 3QUKB 5DGRA 1V7ML 1G4MA 2Z9TA 2P48B 4R5VA 5BQDA 1G6RB 1UXSB 2NY5H 1S7VA 5KBMA 1QLFB 4WNSA 1K5WA 4LHUB 4F7EA 5T1LD 2E5EA 3BXNB 4ZTOL 4Q9QH 5CHNB 1XCXA 2V9QA 1XAKA 3DSFL 4X4ME 5HGDA 4XNMB 3RGBA 1B9ZA 3SGKC 4HWEH 4MA8L 1SBSH 1PZ5A 1Z9NA 1CTNA 1ASPA 4PRBA 5JO5A 5CS7A 1NA8A 4WNQB 4GOSA 5FGBC 1M2VB 1VJSA 4HJ1A 4JHWH 4XO5A 3ULVL 1WVZA 1ITCA 4Y5VC 4TULL 2VDLB 5A6IA 4ABQA 1H15A 2P8PB 5BRQA 5LNGA 2PYEB 4X8CA 5DFVC 5A16B 1CR9L 1K6QH 3GBEA 1AXTL 3TBYA 2AEPL 1CT8B 2X89D 3MKKA 2J5LB 5ERWB 1MCSA 4G83A 1THAA 5IB2A 3SD5A 2K6YA 3ML9A 1M3JA 1LVEA 3BZEB 4UIKL 5T33H 5L6YL 2NTSP 4Z7WA 1E5UI 3VFGH 3M6DA 1HXMB 2D2CC 2IDCA 2DI9A 4Z7IA 3RX5A 3WL9B 4PGZA 2EH7L 3KYNB 3S3BB 4JG1L 3B34A 4IDJL 1VPOL 1XTLA 2QHRH 3MBED 4AQAB 3BUYB 4K7PX 4G1EB 4ZXBA 3GXPA 3PPEA 3VWJB 3DV4B 2NR6C 4L0YA 3U7AA 5DJDA 1NBQA 1ASOA 3UTQB 4YSDA 3TO4D 2RMNA 4GRLB 2GAZB 4HIHA 4P5RA 2ZONA 1QSZA 5B3JE 3QAZB 1CFNA 1AFVH 1NCDL 5GGSA 5TPWL 2DTSA 4ADGA 2K3HA 4GKLA 5TH2B 2W91A 2VTFA 4PI0A 3QUGA 5AVVB 2EAEA 5K1JA 1I1RA 1UCBH 2NY0B 4B9GA 3SQBA 4OV6F 3DTXB 1NCNA 2K1MA 3RWFA 5IV2B 5E8EB 2JI1A 3IDNA 3A6CL 2P5WE 1H6EA 4JFEA 4P23B 3ZMNA 3P40A 4Y4FB 5CGYC 1WISA 5DI8B 1I9EA 4OZIE 4MX7B 5C9KA 1A7PL 2XBTA 2D7QA 4YJZL 1FP5A 3BPCB 3MLZH 1JPST 2W65A 2CHXA 5IM7B 5EH1A 1KYUA 2WKGA 4L8BB 5ID1B 1F58L 4JMXA 2GUOA 3EHBB 5IG7A 3DRQB 3TVMA 1KV3A 2ZCLH 4JQVC 4UU9B 3U48A 5HHQA 2YQ2A 3FQNB 1XBRA 1IM3A 3IKKA 4QXTB 5FKAA 3WNKA 4ONGH 4PJDA 2AXGB 2XN9D 2IV8A 3PWPA 2R15A 3OGCA 3V4PH 5FM5M 4F7CA 1JIBA 2MFNA 4GO9A 1DQDL 2DBLL 2NT0A 2APWA 4A7UA 5I1DB 2ZNWA 4FXGC 5FV1L 2WVVB 1UA6H 1NIDA 5IQ9B 1JGVH 3SSGA 3B37A 1VACB 3H55A 4OLXH 5FOBA 1O9ZA 4KROB 3B3IA 3RI5F 2DKMA 3D4GA 4QHUB 3TT3L 2VW7A 3LD8B 3Q8CA 5I8KH 1QSFB 4N2FA 3LNHA 4UOW1 3F05A 1ZVHA 4YHIB 2WYTA 3NCXA 3FT4B 2ATKA 5EO9A 5A2IH 4YEFA 2EDNA 1V8HA 4Z3JA 4WI7A 1CICC 2BY1A 3IDYC 4A04A 4PS7A 3DTDA 4XCCH 3D9AH 4PV8B 2ARJA 1KLUA 1AMXA 2QFRA 4ABUA 4WVRA 1X3DA 2EEXA 4D2NA 3QC6X 4JG0L 5CU9A 1KJ2A 4XCNA 3IMWA 5LBSL 4FF9A 5E03A 4ENZA 3FUDA 5ISZE 1WZLA 3L5WB 5I1CL 3EYOA 3NIGF 4PJ8A 3WEOA 3T3PB 1SOKA 2NYYC 4EN3A 1AR1D 4UMGA 1ONQB 4ZMPA 2HSIA 4V11A 1JE6A 3KL5A 5JHDD 1KXQA 1E6JL 1UB6B 1N59B 2EKSB 4W6XB 1NGPL 3H54A 2KLRA 4NFDA 1ZSDB 1QBAA 1O6TA 3KHOA 3QDGA 1TZHA 5EU6B 3VX0A 1D6VH 2PR4L 3UTTA 3J2PA 3BRDA 1OGTB 2CLRA 3S37H 2B20A 3GS0A 1I9RH 4AT6B 2IDFA 3MRLA 5GXBB 1U93A 3BCFA 3EDJA 3BE1L 1XD0A 2F7QA 3GHEH 1QFWH 2PWEA 3H3PL 1RZ8B 4EPSA 1B4TA 2PWHA 3MLWL 4ZX6A 4LIQL 4IRJB 2ZUVA 3O2DL 4ZJ9A 4CSPA 5C8JA 4JO4H 3PQYE 2PO6C 4OGXH 1GGCH 3ULUL 1Y6KR 1B2WL 1JF1B 1WCBB 4OZGE 1L9NA 3W2DL 3APCA 4X4KA 1HIML 3SYAA 5BCAA 3FT3B 1NGWB 2FYYB 2XETA 3TWCL 4I85A 3VI3E 5BUPA 1R47A 4ZW8A 4TLKA 5C07B 5C0GA 4D9QE 5F7FA 3WNIA 3CLWA 4LF3B 4AL8H 3VYOA 4PWIA 1UUNA 3B5GA 4DTGH 3VU2A 3CXHK 4KAQH 5I1AB 4LLDB 4ZX3A 1T21A 4FLSA 2XKNA 1NANI 1GAFH 5C2UB 3QEGH 1LEKA 3X3FL 4DSYA 1NJ9A 3ZZ1A 3UO1L 1RZKL 3LQAC 4XP1L 5I18H 4OAWB 5GGVY 4MJIB 4W6YB 2HX9A 3BUDA 2WMPA 2NOYA 2AJ3B 5F88B 3ZE0E 1ZS8A 5ENWA 3QRGL 4YH6A 4XB7A 2F0CA 4ZTPH 1WICA 1NINA 2PYFA 4HXAH 4MNHA 3M7FB 4ANXA 2MPVA 4WI6A 4AZUA 2R9HD 3PV6B 5LG1A 3GMPB 4NO5A 1A14H 4X99B 4ZD3L 3BVNA 3UZEC 1S7TB 4W9CC 2D9CA 2X4SA 2K78A 32C2A 2VABA 3MRPB 4BXVA 5CZKA 2HUEA 3RKDD 3V6OA 5KANI 4AQ1B 3ULVD 4WEBH 3RVVD 5FGCB 2OA9A 4R5TA 3HE7B 2WTPA 1EMTH 3L3GA 2EIEA 4KK6C 1TYEB 4PJHA 1TITA 4Q6IA 4BSVA 1H3PH 5IMKB 4OLYL 4RAUA 3DDFA 3POCA 2F53D 1BIIB 4J3OD 3EDFA 2D0GA 3DVNA 2OS7A 4JM4H 1KGJA 5HJ3B 2CA4A 1JP5A 4PG2A 1NGYB 1NOLA 3ZDZE 1XZ0B 2ZQKA 3Q3GB 3GBNL 1H5BB 1ZVSA 2V7NA 3WJJA 4HKXA 3T0XA 3OXRB 5D7JA 4XC1L 1ADQH 2QMJA 4XO4A 3U1QA 5BQ7B 1XCQA 1X5AA 2YFOA 3QO1A 1Z3RA 5D7SH 3TT1H 3AMKA 2FNWA 4FG6C 1IAOB 2EUVA 4G3YL 4NAMA 3FO9A 4RGNB 3VXOA 3WE1A 1XIWC 3MV9B 4WTXA 5JQ6H 2F5BL 2W07A 4P4KA 4JAMA 5E9DE 4KRPC 1O9WA 1KUMA 4G42B 2PR9A 1RERA 4QJ4B 3LEYL 1NL0L 2F08A 1V54B 1JGEA 1JNHB 1E4XL 2HB0A 4F2MB 1F18A 1DLHB 2IAMB 3RVXD 3MOQA 3QZWB 3ME0B 3LKQB 2JVUA 3HBGA 3LHAA 4X6DA 1FO0B 4X4XA 1C5BH 2VO8A 3H42H 4TSBH 2YXWA 3DJRA 1UACH 1M4KA 2WXOA 3ZKQD 4JPWL 5D8JL 1SMDA 4NBYB 3VFSB 3QXAA 4Z78B 1MXGA 2JLPA 2P49B 1D7CA 5CSBA 2AJYH 4MASA 1C5DA 4YXHH 1T5WA 2X41A 5ACMA 5I1GL 2DQEL 5FUZH 3ATBA 3PREA 1KB5A 5EO1B 3LAFA 4UINH 3LQZB 3FB5A 1OSYA 3T6QC 1FF5A 4HUUA 3OG6B 4XNXL 1F5WA 5C86A 1NMCC 1S5IH 1ZAGA 3NSDA 4NM8H 3O0RL 3LPWA 1JCVA 3MOBL 2OMWA 4BUHA 3LKNA 4AWJC 3F7QA 4NO2A 3RNKB 5I8CA 4Y9GA 3QFJE 5D7IE 4HBCL 4PJAF 2GCYB 1YMHB 2HJKB 3A4FA 1NFIA 3VB9A 5F89A 4OI8A 2CPCA 2GITA 4OT1H 4K5PA 3PYCA 3G6AA 3OPZL 1J5OL 1P4UA 5GGVH 4RBPH 1KIRB 2VW6A 3BYTA 3NJKA 1IGJB 4I1RA 4ZMTA 4PJ7E 4HIJA 4AEEA 4LCCB 3LMJL 4WZ9A 4BFEA 1KIQB 3DJ9A 6FABL 1M1XB 1S7SA 1ZTMA 1AHWB 1JPSH 4PJ9D 3J7HA 3LKSA 2N1TE 1OV8A 3L3HA 2VO5A 5D7LA 2EC9T 3ARBA 3KYKL 3QZPA 4N8CL 3IPFA 3VTMA 3U0PA 3MNDA 4IW4C 4WQOA 3HG5A 5A2KH 5E5UB 3NCEB 3KPLA 4W93A 3B2VL 1K4CB 1PPIA 3HN8A 4PS4H 4OF7A 4N8VB 3IBOA 3OX8B 4BFFA 5CXPA 5SWQA 1OT1A 1MRCL 5L2JA 1C5CL 1JPEA 3P3SA 1EO8H 2AJZB 1E40A 4Q4EA 1HH9B 5T1DH 3U36A 3UTSB 4ZYKB 3ABGA 2RBLA 2UYLA 4F7PB 2KBGA 5ITFA 1P1ZB 1TCRA 3OKEA 1MLCA 4HJ0C 2ZOKB 4NQED 4RBPK 5D71H 4UDUB 3U9UA 3JTTB 2Q2LA 4NN5C 5H37A 2XJLA 3CFUA 1HWHB 3CPLB 1D5XA 1QUNA 3TJHC 5I1KH 4BCXA 4HFWA 4G5AA 4CU8A 4JJ5B 4O2EA 4OJAA 4M6MH 4XZUB 3WMSA 4AM0B 4A68A 2VAJA 1D5ZA 4KUZH 4W4OA 1BXVA 1MPAH 1DCEA 1YEGH 2E6JA 1LK2A 1VFUA 3SQOL 1TJMA 1CDBA 5DQDL 4XCFL 2IADA 2E47A 3UTOA 2YD3A 2AS5M 1JZEA 1SFHA 2AQTA 4L4VE 5BS0A 2Z92A 5E2VH 3WO4B 2OZ4L 3QEQA 3VFTA 3DSNA 2VDNB 2J3SA 25C8H 2BLFA 4JFPA 4PJGA 5E5MA 5DS8B 3G04B 5KVDE 3ULUD 3TNMA 2EXTA 3H2QA 1MFBH 4YLBA 1NFKA 4UNTA 2VC2H 4JZJB 1X5MA 4NOBA 4Y9CA 3ZTNH 1J05B 5F9DC 2C7UA 2BXYA 3VA2C 1CK0L 2Z0UA 1T04A 3GSWA 5EO0B 2XWRA 3BGAA 4OCMC 4LOUC 3FTSA 1FFTB 1NGQH 3IFLH 1G9ML 3W82A 4PJEE 5KJ4A 1MFEL 3DXAD 5J7CC 5D1XB 4O2CB 5AVTB 5BZDB 5FYJU 3CFMA 4OJDH 1LQBC 4DH2A 2VKXA 5L2KA 3NCJL 2I9TA 2VXQA 1Z9SA 2FJHB 5A2BA 2VDRH 4AGQA 1A21A 4Q6YA 4LVOB 4XMPL 2EXYD 2X4QB 4LLQA 4AJ0A 1TR7A 4W70A 4OZHB 3FULA 4JFFA 2GK2A 5AD0A 2OK0L 1KLGB 1WSST 1X5IA 2IXQA 4AMKH 4YDVB 4CU7A 4V2CB 4YL4A 2VW4A 3ZKMC 3QP3A 1S3KL 2BY0A 4AYGA 4XC3H 3X13B 2YPLE 4ZOAA 5I71B 2EDWA 2YD1A 3NSCA 1FYTB 2LU3A 2VOTA 9PCYA 1DUYB 1R17A 2O5YH 5PAZA 1JL8A 3UTTB 2VDOL 3AUWB 3NRFA 4E68A 4Z3TA 3IETB 4RH4A 4PRPA 5J13B 1CVRA 1KCVH 2X9ZA 4KHTH 1BZ9A 3GMMB 5E00A 2X9YA 2V5SA 3IJYB 5AZ2H 4AYFA 2F2HA 5F7AA 5C09A 5CGTA 4QTHB 2H1LM 3KBPA 3FTGB 3MNZB 4UNUA 2OMVB 1OIOA 1ADQA 4HHAB 3K8KA 4YDMA 5D5ME 2EE3A 2O5ZL 3MX0A 1IAMA 1OPOA 2A6DA 3BI9X 4JUSA 4EDWL 1IO4C 3CN2A 4YGVA 2JIXD 3O11A 1P6AB 2Y2TA 3QIBB 4FYQA 4JDTH 2W59A 4KPHL 3L3JB 2MRYA 4X5XA 4NKMA 4JO5A 3ZE2E 2G9KA 4NQCB 1P4LB 2YARA 1FFPB 2QSCL 3QNYB 1HEZA 5I6XC 3N42B 4TTDD 3UJTH 4MNGA 1S7WB 1WFJA 2Y3NA 2PW2A 4GINA 5FECA 2R4SH 4IGBB 3S96A 1S8DB 3R8BB 1S7UA 2AGJL 5AQ0A 5C08B 5DC9B 4WWPA 3L1OL 5BJTB 4Q7DA 4NPYB 4URKA 3O3DA 1NC4B 4EO5A 3HPJB 4G8EA 3UROR 3I3DA 2E27L 3FTZA 5E0FA 4HOMA 4L3CA 1TF4A 1SLXA 3VNZA 1GMIA 5J3HD 1M7UA 1P5VA 2XN2A 3F58H 2FJGB 2PYFB 4K73A 4PP1C 2A73A 1KF9B 1QSVA 1QYGL 4FFYA 1ERNA 2Q7AA 4TTGA 1T89C 3VX1A 1EXGA 3B9KA 5CR1A 3O3AA 4E41E 2V8LA 4S1QH 2XN0A 5J5EA 3V5KB 5T5FA 3C5ZC 4Q0XL 1PZ2A 3P3YA 4HJEA 5IFAH 1XB8A 3V4VB 2WKOA 4NRYA 2WINA 3LIZA 3GMNB 4JQIA 1M1SA 4P2QB 1FL6B 5CSGA 1NAMH 2FZ3A 3MLTA 1VEMA 1DBAL 2AXHA 3BUPA 3O6FC 4JKPL 3DO4A 4Q14A 4OZFA 1AGBB 2WQRA 4LQ1A 3M07A 3Q8FA 4HJIA 2BSSA 3HIZA 2EXWC 2FQGA 5E99H 1YECH 3C08H 4GAJH 1TTBA 4K94H 2W94A 3UBFA 1QFPA 2UWEB 4DHLA 1P2CA 3D0LB 3MRDA 5DHEA 3GNMH 2P42B 2WUBH 3NMEA 5DHXB 1J0IA 1J0KA 2V2WA 3RU8H 2YSTA 2OJEB 2DWEA 3FCTB 2CR3A 2UZIL 3F65A 4NERA 3L7FA 4NXSA 4O02A 4G8IA 2QKIB 4WWID 3E1F1 4R8WL 1G94A 2IANB 2K9UA 5FB8B 5B4MD 1D5MA 2RR3A 3L7EB 2WAQA 1QRNE 2YRZA 3CDGA 1F0LA 4WI2A 1J48A 2V3EA 3VXME 5F44A 1EVUA 1J8SA 4XP4L 1G6RH 1FSKB 4M6NH 1HH6B 2HA1A 1Q9LB 2X2UA 3U4KA 2EZ0C 2DWXA 5GISH 2FX9L 4PBWD 2YAOA 5KOVC 3CMGA 4W6WB 3DOIA 4L0PB 3NP3A 4KX9A 1LDPL 4PB9H 1V55B 3ES6A 5E2UL 2ZX7A 3NESA 4LNRA 5CSZA 3P69A 3ZQXA 3HFMH 5CCKH 1OF0A 5KYXB 5LAXB 5FFLA 1FIEA 2C9XA 2V5YA 4LSUH 3CVHL 4OQTL 2ZYSA 1A7QL 1L0YA 2I32A 3O4OB 4G9FE 5B3SB 2I9LB 3HLKA 2VDLH 4FQXC 5BOJA 3BUIA 3LRGA 3VGFA 4AENA 4S0HA 2YLHA 4ZSOB 2XZCH 4OGYL 4WTWA 5GGRB 4ZUVA 3L2MA 5D4IA 2ISDA 2Y6TE 3ROLB 2FO4B 4V1DE 3L95A 4F9PC 2NNAB 1ESOA 2FD6H 1M6OB 3SPIA 3TYFA 2WXKA 5EBMB 3MOAL 2Y06H 1DQVA 5IJKC 1LEIA 5MEND 3MJ7A 5CLYA 1B0GA 5EOCJ 5B39B 4GBXC 4P59L 1AH1A 3ZLQC 5HDLA 3FRUB 1MCHA 1SEBA 1ZHNA 5DSCA 4ODVL 4ZT1A 2OTWB 4X5LA 1JFQH 1QX1A 2N0KA 4UILH 4MJ4A 4AEFA 1LQSR 1X4XA 3QQ3A 1RULH 4PJBB 4QWWD 4QRRE 4KJQD 2DWTA 3UADA 2ZPKL 2XVLA 2M8XA 3L48A 3LNFA 4RETB 1GY1A 4FHJA 5AZ2L 1NLDL 2EADA 2ZKXA 5TGBB 1Q0XH 3VE0B 1T80A 2MIZA 4WW2A 3WN6A 3VI4F 2BP8B 1I8KB 3ZUCA 4YHKH 4X80H 4RDBA 5F3FA 1A9BA 2GJ6D 5I0WA 2VDPB 5KSVB 5MERA 2WZ5A 4CVXB 1FLTX 4BFIA 4L1HA 3DURA 4RRPM 3QDMD 4GP8B 4HD5A 4BZ1A 3HZMA 4UT9A 4XMTA 1WG3A 2R8SH 3T8MA 1P7QA 3QUYB 2ZKYA 1V05A 4Z0BL 4XGZA 4JS7A 5KTEH 3EYQC 4XPGL 2BS9A 3QFDB 2Y1ZA 4FQLL 4TL4A 4NRZB 2D0FA 5CO1A 3W5NA 5GZOC 2J44A 2K9FB 2DKUA 2O5XL 1X7TA 1DN0B 5B38B 5HHPB 1WPCA 4FFZH 2Y72A 4JGMA 2BSEA 4WUUB 4JGJA 3RZCC 5BRZB 4B60A 1XCWA 1BZEA 2TRHA 1VADB 4KO9A 4FQ1H 1ZMYA 4X6CA 1KGUA 4FEIA 3QHZL 2Z64C 3N06B 3VD7A 5JPNC 5JTWA 3TNNA 1BZQK 3U1PA 3KM2A 4IRJC 2H3XC 4X5PA 1IAIH 2QZ5A 1LDSA 3EGSB 1IAKB 4KNUA 3RIFF 1A9VA 4R0LC 2IQAB 1G7HA 2ZP8A 4ESKA 3KWWB 3ET9F 2JJUA 1YMMD 1K8IB 3DMMA 3QDJA 4PGDA 3THMH 3BDYL 3TLRA 1Q9OB 1T1WA 2V6HA 5EBWA 4ZS7L 5ESQA 4HMDA 1SY6H 1T6VN 2Q87A 5CLZA 3IMSA 3LV3A 4GI6A 5IVZA 3LRLA 2NY3B 3HRZB 4QHKJ 4GG6F 4I3SL 4FDWA 1KIUA 4N5EC 3VH8B 1U8LB 3RTQD 1S9WB 4KKRA 3MLVL 1AD0B 3KPSD 3SDDC 4QRSA 4X9IA 3QEUB 1P0SE 2I07B 1G9EA 4ODUA 1VEPA 3EJQA 4FNRA 3BKJH 2HFTA 3H8NA 2CSPA 5I76B 3GRGA 4AX3A 1WFMA 2YK1H 1OAQH 2AEQH 4S1DC 3UG5A 4DFIA 3ARRA 4PRHD 1F1DA 1BZ7A 1XT5A 5DVNA 3TZVD 1YNLL 2PYEE 5CWSB 3HMXA 2HVJB 1PX8A 5HYJA 4ZO8A 5EUKB 5HHVH 4APQA 5J0BA 3QQXA 1Q9WA 2WIMA 4KITB 2VMFA 3D50A 1QLRB 3OPUA 4WJ5A 5GS1B 1TG8A 4P04A 2FDBP 3ARGA 3HCVA 4IIQB 2GK0B 2ZCZA 5C2BH 1N0LB 3HG1A 3T6WA 2HUHA 4MS8C 2DWDB 4KGJA 4J1UA 1U8IB 4LSSL 5GJTH 3MA7A 3SJVB 5B7FA 5ID0A 3VFUA 1KWGA 3ZTCC 4YSTA 3DROB 4R90L 5DMYA 4J3WA 4TNWF 5F97E 5I8EA 2ED6A 2IDQA 3SO3B 2V4LA 3KYMB 2X1XR 1J8HA 5IY5B 3LH8A 4JQXC 4GW4A 2J20A 1J9CT 4X5WB 5E70A 4WSJA 1JXGA 4OGZA 1TTCA 2V5MA 4M7ZB 2WXGA 4N6RA 3NDYE 3T2LA 3ATEA 4NZJA 4B41A 3QI9A 2Z7UA 1A6ZA 4UQEA 2VZSA 2PP7A 4KHXH 4Y2OB 1KNOB 1UM4L 1KZQA 2QEJA 4MXWH 4PJXE 1T6BX 2GTZB 2WXRA 4N85A 4RGNC 1LE5A 1ETA1 4G5ZH 4YZWA 4AJWA 5D70L 1NPJA 3ZRSA 1OAJA 4WHDA 2EDLA 3EYVB 1T1ZB 3KBFA 2DOCA 4FJYA 1AG6A 4N9GB 4RZCB 5LGYA 1F3JA 4YGVB 5C9JB 5D72H 3MRFB 4NKMB 1XO8A 3L5HA 5C70A 3VCLA 1SF3A 1BJMA 4RA3A 1AGFA 2J8UF 4NM4L 4FZ8H 1A7BA 2NNCA 2IH8A 3MV7A 4UIMB 3I9IA 3R18A 3ZGHA 3IGUA 3IDGA 1EGJL 4AJYV 3T4YA 5FV2A 3ILQC 3V0FA 2BP3A 4RGOL 3SYPA 1WA0X 2OSXA 4X5QA 4OQ1A 5JPMB 4V33A 5JA9A 2JKRM 2YGPA 4YHYB 3MLXL 2JK5A 1RU9L 4YSCA 2X4PA 4OB5H 3WKQA 4DGVH 3FUHA 3NTCL 5DK0A 3C5JA 4XMXA 2EDOA 1UG9A 1RIVL 4IMLB 3S35X 5AVQB 1DBBL 5DS2A 5EIIG 4X50A 5F7KC 1HL4A 1MI5A 2X53A 1W72B 2I69A 2QQNH 3HZKB 3MRBB 4ZUWA 6TAAA 1RVFL 1TSHA 4P9ML 3TYGL 1KJMB 1V3JA 4PVLA 4WJG3 3NIGB 4MD5B 4ZOBA 4X7CC 1MW2A 1JYVA 3FQRB 3EDDA 1GGYA 2YAQA 4FKHA 1JRHL 1CFTA 4XP5L 1S4IA 4HT1H 4ZFGL 2NX5A 4L0ZA 5JXED 3MXWH 2P5EA 2X4TA 1IV8A 1E4WH 2H2SC 1NBVH 3HNSH 2OXGB 1GKOA 4LCCC 2BRRL 3I6KA 4JG9A 5IBLC 4TOYL 5JXAH 3FO2B 4UDTB 5FYKL 4CSZA 3ARZA 7PAZA 5C0FA 2ICEB 4FQHA 1I1FB 1U58B 2BZCA 1F4XH 3R06B 3CHPA 1K85A 4XBPB 4ZXBC 1KULA 3PJNA 3FQXA 4JR9L 4GO6B 1M7XA 1Q94B 3EFOB 2NY4C 1MHPH 2B16A 2YD9A 3D25B 3VSQA 1AOHA 4HH9A 1OGPA 1EQWA 4U0QB 4FFVC 4OCSH 2VDQB 4UTCA 4OJCA 1ACYL 5MEQB 5FPIA 3G7TA 2G3XA 3L3KB 1DVXA 1SHWA 1FFNA 4QRPB 3T3PE 1GW0A 4FXKB 5L88H 2P8LA 3T3MB 2D3JA 1FO0H 4QOKD 5AOMA 4CNIA 3LN5A 4YLCA 2QFPA 3ABLB 4BFNA 2EUWA 1B6DA 3HW7A 4WFGE 2EDTA 1ES0B 5AB2A 1WF5A 5IR1B 4QDGA 1TXKA 4KUCD 1JPGB 2CKBL 2VL4A 4PRNB 2PPFA 4TV3A 5TDNA 4X9HA 3SKJL 3RYMA 4WO4B 1BBJB 4M7LH 2P8MB 1WIUA 5BVPL 4EOWH 3VFOA 5EDSA 2BO0A 4GFXA 5MI0B 4BH7B 5I1JH 1CL7H 2OSYA 3K4AA 2AJVL 3P4LA 1CE1L 1QLEB 1U21A 4ZODA 1DQKA 1T6WA 1A4JA 4G43B 2F54E 1XGQA 2ZKHH 4XVTL 1PIFA 3VRLF 4JLRB 4WU5A 2VJ0A 4Y2NA 4ORGB 3TVMC 2FSEA 2HYMA 1VGKB 5JORA 4H8PA 3S8FB 5J57B 3CVBA 3H7BB 5C07E 1BG9A 4JM2B 4Y1SA 5SX4H 3JVGA 1Q72L 4U4BA 3L2NA 1IVTA 3CSTA 4NGHL 3WFHA 4YHOL 1RUQH 3PHOA 1O7VA 4O58H 3WKPA 1CO1A 3OKNA 3NJLA 1GSKA 2ADGA 4PJFA 4N25A 4R7DA 4YOKA 3FTYA 4OLVL 4XR8C 4U6YA 1FAIL 4W9LC 4ZPTB 5LBVA 3H9SA 3IJ8A 1D9KD 3A47A 2C9VA 4MJIE 1MFAL 2OX5A 2X70A 2YSSB 4H26B 4PH8A 4PY7B 3BWSA 3S4SA 1M7DB 2CO7A 4KVPA 2H26B 1H9VA 3QPXH 3T0EA 3MA9L 2VQTA 2X2YA 3RIAF 4HKZA 4LCUB 4ZUTA 1HWGB 3T09A 3V9CA 1QFUH 3SE4A 3GI8H 1BF2A 2DJMA 4HUMB 3SDYH 1MWOA 1U3HD 3EJZD 1A7OH 3H53A 1X7QB 2NUTB 4U3HA 2OYLA 4M3HA 5DD5L 3UCRA 1UWEL 2Q1EA 4XO3A 5FGCE 1HXKA 2B15A 1EO7A 4KU1A 1BIHA 4Y5YA 3V2AR 5CLWA 2BDNL 5KSUA 4MLSA 1JGLH 4EN3C 3MR9A 1D5IL 3Q6GH 1CXIA 4CMHC 5I30L 2XPZA 2VMCA 4FNPA 4K8RC 5DA0B 1C7TA 1I3RA 1R3LA 4UT6L 3APMA 3WS6A 2WIIA 5C0RH 4UOQA 6PCYA 5K9QI 1RHFA 3CXDH 2DQTL 3FQUA 4UB0L 3VMNA 2DWYA 4ODWB 1JWMA 1YNTA 2XA8H 3FSWA 3LXAA 4NZUH 3QJSB 4U1GB 2Z0BA 3O9WA 5LVEA 3STZA 2NY7H 3ARUA 2CR0A 3GXNA 1UB5B 4FLQA 4HMEA 3GBMH 2XWTA 4KVCL 3MJGX 3QIUA 1EEYB 1S9YB 1Y1DA 4MJ5A 4XMKH 3ETBF 5EOQL 5TE6H 4RGNE 3MV9E 1N67A 4NCC2 2A4ZA 1KXVC 3I50H 4XCYB 1URLA 1DFBH 4HUCA 3Q6FB 4HIXH 2ZYHA 4E0RA 1FDLL 1X5XA 4RESB 3MJWA 3RUGE 1PZSA 2PCPA 1K5NA 1TKWA 1FGVL 2B9AA 3WY4A 5EOCH 4NDMA 4F2ME 1HZKA 4OCYL 4GQZA 3BLPX 2BNUB 5I19L 3NIDE 1F90H 3P9LA 3PGFH 1CBVL 1T5XA 4LLUA 5I0VA 4PJAB 3FFCD 4XWOD 2K6ZA 5IESH 2F19H 4ELKA 3NCCB 4LKXA 5TF1L 3KJ6H 4F3FB 3I84A 4MAUL 3K8MA 3S5ZA 1I8MB 3C87A 1VF5C 5CIPA 4IGBC 1U41A 4LEOA 3EXJA 3GGWB 1KELH 2EVFA 2DEXX 1WS8A 2FB4H 5FCSH 3D4CA 5C0CB 4A2EA 3B83A 1AXSB 1XTMA 4KTDL 1S7QB 3IKCB 3ZRFC 3GK8L 3L4UA 3BIKB 4JPSA 1OCZB 4WSGA 1DQLH 4XXCA 4YN3A 4J3XA 2VLJD 3EAKA 2YAEA 1TYJA 2OXHA 2NY5L 3EH1A 3P3RA 3ULSB 3GQFA 5AKVA 5D2LF 1USZA 4O9HH 1AD9B 1B6UA 4M62H 1F6LL 4U0RB 5TQ0H 2A0LC 4HWEL 3OKDB 4HD9A 1G5GA 5CBAA 1ODUA 2OMUB 5G4NA 2DY2A 3G5ZB 3IU4H 3SYQA 1IM9A 2IBZX 2W9DH 2DIAA 3KXFD 4HJGA 1DLFL 5FF6A 1FNGB 4AIZA 3BVUA 2H4EA 1UEYA 2VUKA 3S7GA 4GT7A 2VZ1A 5EB9A 4HLZG 1F4YH 5IK3A 3F8UB 4JFUA 3N9GH 3LNEA 2NY6D 4IU3A 4JY4A 1UHVA 3K6SA 3TF7C 3O4LA 1K6QL 4MVBC 4OZ4A 5T3XH 3SZKC 3QNZA 2LE9A 2OMBA 4U1MA 2FLMA 4PG2C 4HK0B 1PKOA 3JSSA 2LQRA 3D0VA 4PGBB 2XN9B 3WJJC 4PRAA 4WTZG 2F8OA 2PWGA 4HWZB 3KR3H 5CZXD 1HWWA 3VFGL 3KPNB 4GQ9H 1LHZA 3O2VL 4JPKH 5FYKD 2BSCA 2QKIC 4LCWA 1F86A 3MBWB 2AJXH 2D03H 3L4TA 4NN6B 5DJCB 3CX5K 5FDYA 5I17B 5LJYH 4P05A 4FNUA 3UTSE 4YWGH 1BA9A 3Q43A 5AAMA 4P4KC 3B2PA 2APXA 3RGVA 2DQGH 1TEYA 5K9OB 3UAEA 4JNXA 2X42A 3I75A 3II1A 1S7RB 4UQ3A 1EHLH 3LH9A 2DKSA 1DBMH 4JFEE 3K71B 1ZT7A 3QR1A 2QELA 4ELMA 2CALA 3PAYA 4IKIA 1MJ8H 3NT0A 2ZAIA 4LPVA 4Z7VA 3Q44A 3TFKC 2XIIA 4RFOH 1UCBL 4NQDD 1SXSA 4BBWA 4ZMQA 2O61A 1L0XA 1MFVA 2VXUH 4MHHI 1U36A 5E9NA 2R0WH 4LHJB 1PQZB 3PL6B 4G59C 3I6SA 5A2LH 3BOVA 1A1NB 1R5IA 2V8MA 1OTSD 3JT0A 1RPQA 2J4WL 1FUNA 2WLNA 2XWEA 2WWOA 4B9FA 4XNZC 3NPZB 2AK4D 1OP4A 1BDYA 1MCBA 3V4VH 3ZKXC 1QR1B 5DHYB 3TBVB 1QTPA 1RFDH 1W0WB 2Y7LA 3IDXH 4QRFA 3EOBA 1AZCA 2EIZB 1NCBL 5H94B 5INDA 4WFFE 1DL7H 3RVWC 5HYSA 2BSTB 4G8GA 4XVUC 3HG3A 5DVOA 5HHOB 3EBIA 3HOGA 3LEVH 5C3TA 3AROA 2HT3D 3Q13A 2MJWA 4KJWC 2XTJB 1XX9C 2FTAA 1F6AA 4X0KA 4K07A 4ERSL 2VISA 4N2HA 3PLYA 5E95B 1J0JA 1SYSB 1T1XB 3GMOB 4XOCA 3MRGB 4KMTL 2WBKA 3MTXA 3ZTDC 5EIVA 3VDAA 3V52H 3CFEA 1JGVL 3OZKA 4PGEB 4OLXL 1G7JB 4J3TA 4M7JH 5JOEA 1YLBB 2ZCHL 4FQHB 2YMOA 1A6UH 2GJZB 4WWKD 3OL2A 1RIHL 2FO1A 1SUJA 4OZHE 4EDXB 4Z3GA 1QRKA 4NZRH 2EO1A 5CGBA 3D2TA 4NQVB 3F64A 1SHMA 1BZOA 4XCCL 5SWZA 1O9VA 3QRLA 2V9RA 2BVQA 3D9AL 3QUYC 4DGIH 4YHNA 1OANA 4QLWA 1XAUA 4FN0A 3KGTA 3ZO9A 2X2JA 1BFOB 5DD3H 4GAFB 1HEHC 3F7VA 3VRIB 3TL5A 2Q3AA 3G5XA 2J8UA 4OVUA 2G5UA 3QDGE 3UTTE 2KT6A 1MCPH 3NGBB 4I77H 4ONFL 4PLJD 4ZAKD 4JDVB 4KNQA 1OD7A 1PSKL 2RJMA 3C12A 4Z7AA 4NC1C 2BSRB 1XF3A 5HI3C 1INEH 2X9XA 2ZX5A 1E5AA 4LGRB 1PCXA 1ZWIB 3RNQB 4W9ZA 1OKEA 3CBKB 3A6BH 5IHZB 2JKWA 4G7YH 4W4OC 1D6VL 3D06A 4IOSA 1KEGL 3PWNB 1T3FB 2MCAA 2VRKA 3RVTD 1EEZB 4GXFA 5LQBH 3E9TA 2P5WD 3U2SA 3JWOC 1KBWA 3DX4A 5F7MC 4HSQA 3E7JA 4P5TB 2CIIB 3GYRA 3U0WH 5KYYA 1RIUH 5LN4A 5D1QB 2X4OB 4NQCE 2NW3A 3ZX1A 4U1JA 1BD2A 3EGDB 3G5VA 4ZX5A 1XGRA 1FVCB 2OPCA 5F70A 3I85A 4OGXL 1G84A 1CD8A 5CZVL 4LSTH 1T83A 2Y7QA 4JDEB 3TBCA 4HWUA 5BUGA 3CZSA 4TYUA 4F2FA 3OKNB 2P24B 2OAAA 5C08E 2DQCH 1BYPA 2ADYA 4WK2B 5GSVA 3NJGA 5I6MA 3VU1A 4Q9BA 1AKPA 4TUOB 3HE6D 1I85A 3NSYA 2IF7A 4NBZB 3C60D 1ZGLA 1W9XA 2VDPH 3KCWA 4M4RA 1YDPA 3UBXA 3CHRA 3S4SB 3V10A 3OWEA 3JV5A 1JHKL 1KFAL 1GAFL 1R5VB 4P46D 3D52A 3QEGL 3L3DB 3CC5B 2XUWA 3WLWC 4Y1AB 3QUXD 4IBUA 3ZTJH 4N1CA 2UX7A 5DZNA 1R3JA 2IMNA 4HHGA 4MCMA 4IIQC 5DT1L 1PG7X 2VZVA 4HPOH 1BLIA 4P2QE 2N7AA 2NXYB 5F9JA 2E7LA 3S88H 5HD8D 3CK0H 1VCBC 2YEQA 1KN4L 2ZWZA 4D9RE 1WBYB 4ZK8A 1WCQA 3LS5L 1JZHA 2ADIB 2GSIA 2JB6A 3BPNC 4HUNB 1ZV5A 1HAUA 4NX0A 1IBDA 1BZDA 1A2YB 1F1AA 3WEXB 4WEBL 1Q8MA 3ARDA 3LN4B 4K7PH 2EYSB 2JJWA 2UWEE 3UZQA 3VFMA 5ISZD 1H3PL 5DUPL 4BKTC 3RY5A 3V0DA 2X38A 1UXMA 1LMIA 3DGGB 2CG9X 5I16A 2APTA 4Q2ZA 4J4PD 4X9BA 1SDDB 5H35A 2OSLA 4O4YH 1GY2A 2AQ2A 5GHWH 4Y1TA 4HGWB 3EIFA 4JDZB 4UV7L 4R4BB 1UJTA 2G3ZA 1FWXA 2LT9A 1UWXH 2FJSA 2HTLD 1NEZA 3TT1L 4MNQA 1AKJD 4CC0A 1FNLA 4GJTB 4P3CH 1T7YA 4K3EH 4KOCA 3FCGA 4BD4A 2YD5A 2ZUXA 3CCHB 4X6DE 1OOWA 5FHBH 4LLUB 1YEKH 4LLYA 2FJFB 1BPLB 2PP9A 4Y4KD 2B08A 2D8KA 3R4RA 5KUKA 1Z0MA 3QULB 1CGSH 3PQYD 1ZHBB 4QXWA 2EO7A 5KVDL 5SWSB 3OKOA 4LKXB 2QTEA 4RLDA 5DMGD 4BCYA 3AXLB 5T1KD 4M02A 1QTYT 1GZQB 1U2HA 1BQSA 1JHTA 1A5FH 4E9RA 5CEXB 3GWJA 3FCSB 2XWBA 4YSSA 3LIUA 2R56H 3IDJA 3RL1A 3VGBA 3INUL 1XGZA 4ZSOE 1A6WH 5JPMC 4D9QD 1GGBH 4H8WH 4NNXA 4KV5E 3L3IB 4LPTA 1Q9KB 1ZT1B 3SPVB 3VI4B 2NNFA 1L4IA 8FABB 1AP2B 3G5YB 4BDVA 3M46A 3IGKA 2XXMB 4H8HA 4YXHL 4D3CH 4JFDA 4LLMA 4XMWA 3O6LL 2CMRH 4ODHL 5FUZL 1VGEL 5C0IA 5I0DA 2BNQB 2R69H 4KKNA 3B9KC 5IHBA 2Z31D 4UINL 4YX2H 2MOQA 3ETSA 2DZEA 1ZV9A 3TEZA 1MH5A 4XCEA 9CGTA 3VXSA 5GGUA 4G7SB 2VLRB 4IOFD 1JPFB 3TF4A 4JKMA 4PJBE 3RWEA 2QV2A 1QG3A 4TN9A 3BH8B 3CDFA 5F7DB 1SYVB 2WWKT 3OD3A 3P2TA 3SGJC 2D4DA 3UC0H 2I24N 4DO4A 4HZAA 1U3NA 4L3FA 4H1LH 4MJHA 4M03A 4QHPA 2HH0L 5DFVD 3DYPA 4ANVA 2OMYA 2PW1B 4P2OB 1FH5L 4M1CD 2XXFA 3PGDB 5JOFA 3L9RB 3U7YL 5KSAB 3D69A 4WY7L 1AO7B 3MNWA 3K1DA 2AXFB 2F7RA 2AJSL 4WDIA 3ARVA 3GMLA 1DQML 1JK9A 4XPTH 5GS3A 3EUUA 3BUBA 2BCKB 4IM8A 4MD0A 3O8XD 1LE9A 3DX9A 4GKNB 4XRCA 4KI5C 1BBDH 4M00A 2KQMA 3M86A 4MAYA 1BQHG 4FXKC 1EUUA 2EDMA 1RQ5A 1ZLSH 2GBVA 2HLAB 5D96B 3HAEB 2FL5A 3FQWA 3MYJA 5FM4A 3LCYA 1G1YA 2NR6D 2OMTA 4TMPA 4F37K 1QKZH 4JZOB 3BVXA 5IMMB 4PS4L 3FRPG 1QSEB 4ZQKB 1GCFA 2A83B 3IF1A 1LLAA 4PY8J 4GG6B 3IS1X 1TQSA 4RIRA 1EXUA 5BRZE 1QNIA 5DO2D 1IGYB 2XOTA 3TA3A 5IVXB 1YQVL 4JFZH 1OAZH 4XBGA 4Q58C 2ZWNA 4LE8A 5ITBH 3MJ6A 2Z7WA 1QEWB 2EE9A 2YOAA 4P3WA 1AGDA 4RFEA 1N6QH 4LGSB 4ODTH 3KLHC 1RJZB 4CUCA 1RUAH 1JV2B 4QO1B 5L7XH 3AAZB 3WAJA 1W72H 1PD0A 5CGYD 3KPRA 3BP7A 5E8PB 1LO5B 3KDMB 5BS0E 3FOMB 5IJBC 3OC8A 1T7WA 3QEQE 4Y9BA 4KUZL 3HHSB 1MJ7H 3MRMA 2P52A 4P06A 1MPAL 2NZ9C 3N91A 1Y6MR 4JFOB 4XTRC 4F7KA 2JSFA 2BMKA 3IJHB 1L6XA 2YAHA 3GSNB 1NCUA 3RY6A 1YYML 1TJIH 1TJHH 1Y18A 4PD4K 1PAMA 5E2VL 2VN6A 4KNSA 4L4TB 3TEXA 3D3VA 3O6KL 3T65A 4DZ8B 3W0WB 1BAFH 25C8L 4NJAH 2BW5A 4BQ8A 2F1EA 3LDBB 1QD0A 5BV7B 4DKEH 2BIHA 3C6LA 3QFJD 5E6ID 1I7RA 3LSOA 4HS8H 3ZTNL 4XH2A 1MJJA 3E9UA 4WW2C 5JMOC 5IVOA 4F20A 1KPVB 4ZFZB 4I0PD 2VDQH 4L48A 2Q6WA 1FIGH 5KAQG 4HEMA 1MG2C 2LABA 1FE8H 3IFLL 3MREB 1WHPA 3JWNC 4QXUH 2EIDA 5EZJB 4K23H 1H0DB 2OW7A 3UGUA 1UWGL 2CUAA 4JFFE 1ZSHA 4OJEH 3RBGA 2WXJA 1INDL 4HFUH 3RAJH 3P73A 1JZ8A 3OAUH 4OJYA 1AY1H 3FYIB 4UM9A 4XNUL 1JZ5A 1B0RB 2WJ5A 2D7TL 3GSRB 2EDDA 4NT6B 4X6BB 1HDMA 5HHXH 4JFWA 2VDRL 3ENEA 3SJVE 4HLEA 2Y0SA 4GUPB 4HEPA 4KTEH 4NO3B 5D4QA 1J1XH 5DWUL 1UD3A 2LR4A 5FIEA 1G9HA 5D6CB 4I2XA 5KSBB 5CILL 5CUSH 4Y8AA 4YXKH 2B2XH 3WD5L 3KH4A 1U30A 4KDTA 1E9QB 4G1MB 4U1GC 5ESAA 4PRPE 1HXYA 4IKNA 3FW6A 4XC3L 3B9DA 4DT2A 1PG7W 4IS6A 5FK9A 3S6CA 1JZIA 1PFOA 4N5UA 2IH1B 1KG0B 1A4CA 1R3KA 3CH8A 4JM0A 1KBVA 1XV8A 3RQ3A 2H3NB 2AV7B 1T0NB 3UYRH 1I7TA 3A4EA 4P3DA 3NABH 1KCVL 2X10A 3CN3A 1HQRA 2XLLA 4NYLB 3OHXB 2CIKA 4YPJA 3DMMC 4BA8A 4AM0Q 3S3SA 4D7BA 4F24A 1PYWB 3EFFB 5E9AA 4MZRA 4UAOB 4B9ZA 1T4KA 2BSDA 2DS4A 2HKAA 4IBSA 4C4UA 3M17B 3RDTB 1Q0YH 4D0DB 2PO6D 4XPAL 3R8QA 1XH3A 5F1IA 1G7LB 5FCUL 2DLEA 2YGQA 3PFQA 4NNPH 2R2HB 4EUPA 3RWIB 3X1FA 4JCLA 2GIMA 2WLHA 3GIZL 4A2HA 3U1SH 4PJ5A 1WBXA 2OP4L 1UGNA 4WW1A 3UJTL 5BO0D 3HNTL 1GIGH 2ERJC 2NY1D 3EJUA 3FN0H 3NJVA 1LNUB 2WAHA 4UTBH 5HI5D 2ESVA 4Z7QF 4N8UA 4JPIB 2X28A 4EIZC 5MP6L 4MAZA 2J72A 4PLOB 1PBYA 3FBQA 4PGJA 3GMRA 2YUWA 4Q52A 1IJ9A 5KYNA 1F3DJ 3NIGE 4HV8B 1IGIL 3A0OA 5DRWA 4NS0A 3P77A 1I1AD 3ARGC 3GB7A 4HAKA 5K9KA 2CLVA 1UWYA 1QA9B 2DIJA 5KBNC 4EI6B 2A4CA 4N90E 4ZOCA 3TEWA 3CLFH 2AW2A 2GFBA 4KVNL 2HKHH 3OKKB 5AW8B 4S1QL 2ETWA 4UI2A 1A9EB 3FMGL 1ZHKA 4WKZB 5IFAL 3KYOA 1WLHA 1U2CA 1MLBA 3CFBB 1VB9A 5E8NB 4L1TA 2J2ZA 3TM6A 4H1LA 3VVVA 1CVSC 2AEOA 2BNRA 2E7MA 4DUVA 1SHXA 2X7LA 1BVLB 3WDIA 1MCFA 3VW3H 1BYOA 2LU4A 3SKOB 4DP1X 5AZUA 4BWTA 2YPLD 2AQQA 2R7EA 4IKLA 3QI9C 4N24A 4TL5A 4J23A 3TA4D 2Z35B 2D0HA 1OE1A 4GAAA 4APXB 5T1JA 1XHHA 1JNNL 2VLKA 3C08L 3K6IA 2I60H 3L4VA 4K94L 4LESA 2GT9A 4QRPE 5AVUB 3H6AA 4XMUA 4MA7H 1ICTA 2FIRT 2HKFH 1K4DA 2VN4A 3ZZLA 4C8XA 1M7IA 3AFLA 3S3PA 1IL1B 4R4FL 2BC4B 1X5KA 4IRSB 2G2RA 2BFVH 1MJUH 5D1ZA 4RMBA 1XSIA 2DLHA 3II3A 4PWKA 2V17H 1BM3H 4MDIB 2UZYA 3AU1B 1UZ8A 1NDGA 1NIAA 2A6JB 2ADJB 3GF8A 4LBEA 4NIYE 2IPKB 5DUML 1G6RL 2D31A 4FLOA 4LEXH 4M6NL 2GW5A 1QABA 3QDMB 3L45A 2CQVA 5GISL 5AB9A 4HWBA 1T4WA 1VEOA 3T6XA 1ZK5A 3V4LA 1NKRA 3AZUA 2DLFH 3AUVA 1RZJH 1IILE 3ATFA 3G08B 5JNYA 4ZMNA 1P5UB 1MHEA 2IVFC 3UG4A 3HFML 3IFNH 4H88H 5D9SB 5CCKL 4YHML 5FS5A 1KCBA 3DARA 2FECI 2G5RA 1OSEA 1H8OA 3F04A 3GJEB 3IGAA 1XF2A 2ODIA 3WHXB 1U8MB 1A6TA 2VSMB 4HK3J 4KKPA 1B0WA 2ZSVA 1Q1JL 1LO2L 1BEYL 1FHNA 4KO5A 2OTUA 4TUUA 2QR0B 3QZNA 3C09B 3CDZB 4J6RH 1EH9A 1ZT4B 2J8HA 3V5DB 4GQPH 2F61A 3DBXA 2Y06L 2NQDA 4QY8B 3D39D 4AK1A 1GGTA 4HIIB 5A43C 1TLKA 4KK5C 1EERB 3FUNA 2BM3A 1JGUL 4H40A 4I4WA 4E41D 2YRPA 1NAKH 1MIML 1JFQL 1PL3A 4FNQA 2KL6A 2P7TA 4P2RD 2B1OA 3NJJA 5HVGB 2BVYA 2WBJD 1DR9A 4RSVA 3JWNE 1T66C 5EWIH 2PXYA 1BVNP 3FK3A 3STLB 3HR5B 3QISA 5LXGL 1LMKA 5DZVA 3JV0A 3QCUH 3SBWA 4FQCL 4KTYA 5JOPE 5ETUA 3QIWB 4JRXA 4YHKL 1NC2A 3VACA 1UM5H 4DEPC 4M5ZL 3PF2A 4POYA 4Y19A 1L6PA 3OJDB 3ZKNC 5ICYB 5EEWA 3IMTA 5KYWB 2GIXA 4JY5H 4KH9A 2CCWA 3FSZA 5GS2D 2YWZA 5CBEA 2VSCA 5CMAA 3S5LB 4E9YA 2CRMA 1QRND 2D7NA 1JMZA 3VXMD 3FHEA 1WGVA 1YN7A 4KK9D 4KMLB 3TBSA 3RFZA 4N87A 4HJ0D 2WQAA 2B4CC 3UERA 5IJDC 5IMLA 2NXZB 3NCMA 3SE3C 4FFZL 3ZN6A 4M6OL 3GUTA 2VH5L 3QSKB 1GC1H 1KSRA 5CR8A 3PNRB 5H8DA 1CLOH 3V8OA 2DQFB 2ICWA 2VLLB 5D2LB 1NDMA 1R6VA 1WZKA 5ADOH 3FTVA 4AEIH 1MY7A 2R1WA 1D7FA 2R29A 5D1QC 2ROXA 2VAAA 5F72S 4PJAE 3DUSB 4G9FD 1EFXB 4R2GD 5J1SC 1IBBA 2VITA 1ZY9A 3BRFA 2BWDA 2Q7YB 1UATA 3ESNA 4V1DD 5C0CE 4QRTA 1WQVT 1GVIA 1SY6L 2Y9RT 3BKYH 4G6AD 4ZTEA 4NENA 5KUMA 3W39A 3VDCA 2O6CA 3OZLA 3K72B 3BUTA 5FX3A 1OB1A 1AC0A 3LVTA 1E5ZA 2C1OB 1UVQB 2DQJH 4NO0B 2WWMC 4BFGA 2QL1A 2HFEA 5IBUG 1MCIA 2A9DA 2AK1H 5GS0C 2YKLL 3FH7A 3FPXA 3QQDB 5IQ7H 3BPLC 1IEHA 3ASNB 4QRRD 2NLJB 2K7QA 1TEGA 2DBJA 4LSVH 3SE4C 3WJMB 2WO3B 3O41B 1V7MH 5DK2A 5EBLB 4K55A 4OUUB 5T1LA 1DVZA 4LGPB 2YK1L 2OL3A 3UGEA 5L8JB 2AEQL 4MA1B 2NXYC 5E23A 5LGKA 4Y5YC 3DO3A 4Z7NF 4OI7A 4KKCD 5FYJH 1KTKE 1AHKA 1UUSA 3DSFH 1JD7A 4UOZA 4MA8H 2IWKA 1JNJA 4F7TA 2H8PB 2XFXB 5HHVL 1Z1WA 1JNLL 2CLZB 5GJSH 2WLIB 4MCZB 2QLVB 3WS6C 4L9LA 1CDCA 1J8HE 3MJ8B 5H4YA 4DGYH 5C2BL 4H5SA 3FAXA 4TULH 3IDIB 1KTDB 1ZOXA 4MQXD 5L9DH 1J86A 3O9WC 4GKZB 4ZUSA 3W38A 2X89A 4J3OH 3C8KA 3PU7A 2CAKA 3ALWA 4TSCH 1NIFA 1AXTH 1TZOA 4LVNB 1DSYA 1TZ8A 2DQDH 3I6GA 2FIKA 5SX4I 4ZMAT 3BVVA 4JRFA 4CRPA 3MRHB 2EDXA 3WELA 4ZFOB 1OQOA 2AZAA 3TS8A 2F74B 4FXTA 4XVJH 2PCXA 3HLAA 1MHHA 1NCTA 3BSZA 4AGLA 3QEHB 4AC4A 1M42A 5TFSH 3MBEA 4DW2L 4HG4J 1WZMA 2QDWA 2BY2A 1J8RA 3C5SA 3ZO0A 3C8HA 3JWDC 2L7JA 1HI6A 1ECYA 3OKMB 2X1OA 1LXMA 1YY8B 3SCMD 5D72L 3TO4A 3UTZA 3TOPA 5DJ8B 2CHDA 4CU6A 1CFMA 2IV9A 2VQ1A 4FZ8L 5KYUB 3VXRB 2CUIA 4AG4H 5DZ9A 3VMPA 4RWYH 3QW9A 2G5BB 4F80A 4LHUD 4JE0A 3BCDA 2WTOA 2N4IA 3BT0A 4CILA 3FQ1A 4DP5X 3H9YA 4BH8B 3T8VA 1R5WB 2HN7A 4DO6A 1TU2B 3A6CH 5HHOE 2Q76B 2EEAA 4R3SA 4XN2A 3U4AA 3AWFA 3FQTB 4FFWD 1R1CA 4DF9A 4W9JC 1Z9LA 3FU7A 1CDHA 1HNFA 1A7PH 3DA0A 3PDOB 2WXPA 4DGVL 1MWAA 1LGVA 2XTJE 4BKLB 1XR8A 1EAPB 4MMYB 1NCIA 2ZKMX 1T2XA 4HX1A 3QUMA 4OVVA 4OFKA 1F58H 2IBBA 2PYED 4O51B 3U6RB 2YD4A 3A24A 5DFWH 1TQUA 3TIDA 5IB4B 4P2OC 3DX1A 3HUJF 5DZPA 3WY1A 5J6GA 4UWQB 1NEUA 1NBYA 4K71C 5HJBA 1JI1A 4HT1L 3ETBJ 3WI9A 1SXAA 3A4AA 1E28A 4DPRA 3LY6A 3HNSL 2DBLH 1KMGA 4PTTB 1NCCL 1G4RA 1FZMB 3O3BB 2FUTA 1FJ1A 1G7MA 3TT3H 5AKRA 5F0LB 2BHUA 3P11H 3NIFF 1F4XL 5DJXB 5IEHB 5AAMC 3N41F 5IFJA 2O6PA 2XYCA 4S11A 1IQDA 4J3BA 3RGVC 4Y16B 5GRVL 1WFNA 3VWJD 2X2HA 1FI8C 4DQOL 2V2TA 1J5CA 4KDWA 2GBUA 1NFDA 3V79C 1OF2A 3LZFL 5DDHA 4RCAA 1MCDA 3QCVL 4MMXA 4X8GA 5FYJE 3HI6H 5EEYA 1UOLA 4EMZA 3C6SB 3WN5B 2FH8A 1FO0L 4OLUL 3WIIL 4D8PA 1JOIA 4NJ9H 3CFDB 3IDMB 2DTMH 4JG0H 4HJUA 2WC7A 2E7CA 3GEFA 3CH1B 2NY0D 4LKCB 2ATAA 3T0BA 2GSGB 1AZVA 5JLZA 3GBDA 4XVSL 5JHDA 4P23D 4M7LL 1T1YA 1FPTL 3PWLB 4JY6B 4TUJB 4P2CG 3UACA 4Y4FD 3CXFA 1U8PA 3CQQA 5D1QE 3W81A 4AQEA 3BQUB 1E6JH 4Y9FA 4ZDHA 5I1JL 1NGPH 1IZJA 4M7KL 2ZXWB 3EOAA 3QPQC 1F3DH 5CLTA 1KCUL 4Z5RA 5KJRL 1P6FA 2XPGA 3QQ9D 4G80A 1ULVA 4XXWA 4FQXD 4LHUG 5FW6A 5I1LA 3EHBD 2ZKHL 4KXBA 5DJ2A 4B27A 1TVBA 1MIEL 2J1KA 3GJFK 4Y9EA 2H6UA 4UBDD 3BE1H 5C0DA 3ECWA 3EO1A 2NTFB 3EO0A 3H3PH 2BHZA 2DRUA 3O81A 3MLWH 3UAJD 2HPTA 4LIQH 12E8L 5IMOA 4N2KA 1QQDB 3O2DH 3QWOB 1WC7A 3I02A 1PLAA 3ULUH 1B2WH 2DICA 2J88L 2R1YB 4MCYA 5D6DA 3W2DH 2B59A 3MLPA 3QJXA 3ZPDA 3QBTB 4KROD 2AQSA 4L1SA 2ZAHA 4Y1AE 1I8IB 3TWCH 3W11C 1QSFD 3WTTA 1R3HA 2H6PA 4QTIL 1FFQA 3HAEH 3DO7B 3FC8A 4WGWB 3CZFB 3HG4A 5TF0A 4AE1A 3REVA 3NN8B 5T3ZD 2ITCB 3MPCA 4Y2DB 2XY1A 3BPOB 1R9FA 5TK2A 5AVSB 2X3CA 5IVNA 2BIPA 4JREB 4FQQB 2KMWA 5TJWK 1RZKH 5D4HA 3GI8L 5KS9A 2WWKO 3V5HB 3SDYL 1X9QA 3EOTL 1B3JA 1E27A 1QFOA 4N2MA 1YNKL 3QRGH 2JI2A 5IB5A 1TQBC 1TSRA 2F6AA 1Z5LA 1ITBB 4RSYA 3LNIA 1J11A 1AIFA 1J9TA 5HYQB 4AZ8A 5ICZB 1JV5B 4ZD3H 3EYQD 4YHZL 3OLEA 3V55A 3RWGB 3PHSA 2GSMB 2Q9OA 3ISWA 2HT2C 3VFNB 5GZOD 1HHGA 1MNNA 4AGOA 5DF0A 1U4FA 2CDGB 2NW2A 4WFGD 5C0RL 1I1YA 4KGLA 1MZYA 1AGCA 2H1XA 1XR9A 3B1TA 2F53A 3MRRB 2OJZL 2CO6B 2BS71 3GSUA 5BXFB 2BW4A 3KPOB 1IC7L 2NY7L 3CZEA 1GJUA 1KWKA 1EAJA 5IWLA 3GBML 4UQ2B 3MGOA 3OHXC 2DMCA 2W0PA 4X6EA 5AAPA 4UAOC 3L6FA 3CMOL 3I50L 4IRJD 2VDNL 3GBNH 3RDTC 3OVUB 3SDCB 4HIXL 3ELQA 2VN5A 2WZ0A 4JANB 2R27A 4PMFA 5SWSE 1FFRA 1NICA 1D6EA 5BV7H 5D7HA 2ZF8A 4UTAH 4OF5A 5EOCL 1LO0H 4NKOA 1XL4A 1F90L 2JWYA 3PGFL 5GIRB 1I85C 5C07D 4I5BB 1Q38A 1XXFC 4DESA 3BP6B 2HTKD 5D2NA 5IESL 2F19L 5B1JA 2F5BH 3QJFA 4OD1L 5DLMH 3VI4E 5EUOF 5F0PB 5C6PB 3G6JA 1KTLA 4QI3A 4MZIA 4FLRA 4IMKC 3S35H 5HYFA 2FATH 1NL0H 5AUMA 3PGCA 2FX8L 5C1MB 4ZS6C 4QRQA 3IJEB 2BNQE 3GTVA 3U83A 3HPLB 3KCPA 4O5LL 5J11C 1HOCB 4MJID 5MEOB 1USQA 4JRYB 2PPDA 3NQIA 1BMGA 2NRDA 1KJ2L 3KG5A 3F2LA 4JPWH 5D8JH 4YNYA 5DRXA 4EZMA 4O9HL 1CXLA 4E9WA 4P9HC 5TQ0L 2E7LC 2F7IA 3D4ZA 2YMXL 1TVHA 2X4NB 5AKTA 1BXXA 3LPOA 5CJ8A 3IU4L 3BHBA 3O4LE 4AW7A 3M1BB 4G6KH 4RAHA 3GD1C 2V9TA 1KBGL 4P4RB 1KT2B 1G7PB 1YA5A 4MKTA 5IHHA 5K9JL 4RMVA 3PXLA 3ARDC 1DVFB 2ZT9C 3HE7D 3N9GL 3O0RH 2Q20A 4YSEA 5C0EB 4B3VA 5ESVA 4U3SA 3A21A 3MGTA 4Q89A 3RVUC 3WDHA 2I5YH 1O5DT 2PPCA 4LPWA 1INQA 5J1AA 1QOKA 1F02I 4MMZA 1ZHLB 2GJPA 4HYTB 4ZW3A 1YEFL 3V0HA 3OPZH 1J5OH 1EDQA 5EDXA 4NSKB 3ARWA 1AQHA 1HC1A 1E2VA 1ZIBA 2ZZUT 1FL3A 2P9RA 2FBJH 5ALBH 4IRSC 3BP4A 4P57B 3L5JA 3HS0A 4GQ9L 3GXMA 4PJ9A 3LMJH 4JPKL 1QSEE 3VXQA 5D7EA 4YR6B 1PJ9A 4C58B 2D03L 3N1PC 5IB3A 4GG6E 2Y24A 2VZUA 4PFEA 1B4LA 4RGND 3SBPA 5C0JA 3MV9D 2CM6A 4XX1E 3KYKH 4Y4HB 4N8CH 3GJFA 1L9MA 4CVZA 4Z7VE 4H25B 2QJDA 3FSAA 5LDUA 1SMAA 4IRZA 1HK6A 1I7UB 2XWXA 3FTUA 4MJ6B 4RDQG 2IAMD 1RY7B 2SEBA 4NRXB 1H3TA 1U8JA 5DD6B 5G55A 3R7QA 1C5CH 1DBML 2X09A 5HYIA 4M4PA 1PLGL 1XGUA 4NCC1 5LBSA 1QFWM 3F62A 1P5UC 3X1GA 3REWB 1BMZA 4MYWB 4NQEA 1G7QA 3MRJB 4MXQD 4Y5XB 2F8VA 3HZYA 3U46A 2UY7A 1AACA 2CBQA 4GT0A 3SPCA 2YLKA 4FHKA 5TE4L 1G6VK 2QSQA 4YXLL 2JCCA 4A2MA 4EI5B 1GYCA 4L1DA 1KCKA 3QB7C 3ZYIA 3C09C 3MRCB 3V4VL 2NDFA 3QWNA 2B0SH 5F3HB 3W0WE 2BVOB 4NKDB 1AI1L 1PU0A 4CAGA 1CLCA 3SQOH 1XGTA 3CPUA 5DMKA 4QGTA 5DQDH 1N4XH 5B1CA 4XCFH 1CDUA 1KLFA 4BK5A 2XIBA 2HXAA 1AHMA 2E74C 2Y69B 3NFNA 3O2DA 5AVXB 1AS6A 2VJ8A 1YPZF 2OZ4H 2Y6SD 2L3BA 3II2A 1JYXA 4WU7A 4AK2A 2Z8SA 2P80D 4F33A 2J7LA 4PPTA 2NSXA 2XNAB 4ISVB 4GUQA 2H2SD 2F58L 3EH4B 3V52L 4YSOA 1EK3A 1SJMA 1WS7A 3VXUA 4JKLA 3BW9A 1CK0H 2E7HA 4YBHA 3Q2CA 4NFBA 4B7LA 4MAYC 5DVMA 3VM7A 1E9PB 3DXAA 3BAWA 3TPUA 2UY6B 4AQ8A 1KCWA 1W6WA 4Y7MA 4L37B 4ZBJA 2AV1A 5IF0A 5FUCE 2J8UE 1MFEH 5F96L 4Z3HA 3OLIA 3HKZA 1SVCP 1KDIA 3DOHA 1OTTC 4J8RA 3MRKA 4GLRH 3NCJH 1S9XA 1HILB 2WOBA 4F58H 5FHAL 1PDKA 1QVOB 4L8SB 4CVUA 1JF5A 3HC3L 2H2PC 5DD3L 3UTSD 4ATTA 3TA3C 2P45B 4R7NB 3MCKA 4XMPH 3VG9B 3UPRA 3SE9L 1BOGB 3CFKA 2W0FA 1AS7A 2OK0H 3VVWA 1FYHB 1SM3H 2BP0B 4YZFF 2NXZC 1W0VB 1BXAA 3N50A 4XN7A 3T4AB 1GTNA 2YPKB 2VDKB 3HG0A 4BM7A 1KB5L 1S3KH 3GXUB 3UZVB 3LZRA 1J9RA 2MQCA 4J27A 4I89A 1E4KC 3LZQA 3GSQB 4N68A 2OR9L 4S10A 4G7YL 1ID2A 5FO8A 3SKNA 4Z7UF 4R4NC 4IDLA 1YVLA 5I66B 5AW1B 3KJ4B 4HG4K 2AKRB 5JHLL 1E7VA 3F83A 3RY6C 1XEUA 1ZRUA 3FB7A 5EU3A 1RIUL 3VXTB 3ZHKA 3HZVA 5TTRA 2ED9A 4K7FB 4CJ1A 3EH5B 4DKFH 4JFXB 4OIIL 2HRGA 1MCWM 4P5MB 2AQRA 1JF6A 2OMZB 4ZPVA 3KWTA 2JIXA 4RNRA 4OW6A 2O5ZH 3C6LC 2A9AA 3QUZB 4QF1A 2YC1B 4J28A 5DD0L 1TYRA 3ARTA 3T1FA 2DQCL 2QMKA 5K69A 4KFZC 2F68X 1N0XH 2NNRA 5D1ZI 4KUCF 5HYSG 2QSCH 4Y4KB 4PCTA 5K39A 2VDPL 3MFFA 2AITA 4LOEA 4KRNA 3PQYB 4YPGB 4R83A 4A7SA 3V9FA 5FEBA 5D1XD 1T20B 5T5NG 3VFPB 1EIBA 1VKXA 3W9EB 3AY4A 4KKBC 2B3IA 3KZ8A 2AGJH 5E1AB 1J5HA 3GXFA 2XX1A 4S0SD 4H0LC 3U0TA 5HJDA 3TASA 3QO0A 3J07A 1BLNB 1IUZA 1T22A 2WLZA 2L7EA 2E27H 3RG1C 5I6OA 2BRQA 1WTGT 2WQXA 2LTQC 1VFAB 2EVJA 4I9XA 3KLAA 1WAAA 5EOTB 3ZZSA 2A9MH 3L4YA 4WWNA 3FT9A 3BUQA 5AW7B 4JO1H 3W3BA 3CK0L 4EN3D 3MO1A 4LLWA 3W9DA 2YEZA 2DMBA 1XD1A 2EH8L 3ARQA 2R1XA 4HU2A 2W60A 1FYTD 2HFFB 3N44F 4HKJB 4Q0XH 3JTSB 4CW1A 1MDAA 3L1FA 3QDGD 2WW8A 3VXNA 1CDYA 4IOIA 3VRLE 3UTTD 4K7PL 3IM1A 5JUEH 4Y5VB 5KG9A 5JW5B 3F7YA 3DVGB 4N2DA 2R0LL 1WEJL 5A3ID 1DBAH 5DHVB 3IU3B 3SN6N 5BMFH 4BK8A 5GHWL 3WNJA 1N3NA 4PJCA 1C08B 1KY7A 5C0AB 2CWRA 5ICXB 7CGTA 3N1GC 1F1GA 1N5AA 5ICUA 1H6FA 4ZUUB 3UYPA 3QIBD 2VXTH 4QCIB 4ETQA 1E50A 3SY0A 3WE6A 3N40P 3V6FA 1DDTA 2UZIH 1DE4B 3X3GL 4NQCD 1FHGA 4PJIA 1A6AA 1Z9OA 2FQEA 3LEXB 1IBHA 4D0BA 3QR0A 1I8UA 2WV3A 3CZLA 4M61B 1ZA3A 4WFHE 4HCRH 4XXDA 2AQ3A 5FKPB 5BPPA 1CZ8L 1T0MA 1U9KA 1MUJA 4XP4H 3TBWA 3WFDL 4IGBD 3TXAA 1A5FL 3B6SB 1GPOH 5C08D 4A67A 3BWAA 1U8CA 1ZPLA 3TH2T 1FVEA 1U8KA 2JB5L 5AKSA 1NC4D 1CFVL 5B21A 1GGBL 4H8WL 3WEBA 3Q48A 2R2BB 7FABL 5E9DB 1JK8B 3IWUA 3JYBA 3TIEA 2K4AA 3VFWA 3RPIB 5HI4C 5J56B 2X6CA 5ABDE 5EFIB 3ALPA 4D3CL 1CIUA 4OQTH 2FWOB 2IAAC 5A2JH 5TDOA 3FO1B 3WS3B 4D0CA 2WQ8A 3UBXG 4Y88A 4LVEA 3P0YL 4AYEC 5FXCH 4OGYH 4WCYL 3QJRB 3AQXA 1IEAA 2ICWI 1PFCA 1WT5A 2RQ8A 4YE4L 4E42A 5DEFB 4N0FB 3ZHNA 5MENA 1G9NH 4P2QD 4WNJA 3MOAH 3UC0L 2VYRE 4L5FH 4QRBA 3U79A 2W8CA 1OB0A 1K72A 4L8CB 3WUWA 2JKXA 3CU1A 4JCWA 4G8FB 3HRPA 4P59H 2CRIA 4ODVH 4EQ3A 4P5KB 1G87A 4GH7B