2I7OA

Structure of re(4,7-dimethyl-phen)(thr124his)(lys122trp)(his83gln)azcu(ii), a rhenium modified azurin mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Tryptophan-accelerated electron flow through proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i7oA00
4GP5B 1OE1A 1KV7A 1OCZB 1I53A 2IWEA 3OQRA 4P5SA 5I5MA 1KDJA 2QPEB 5B7EA 2YAFA 1SF5A 3KW8A 2HX9A 3WIAA 3C75A 1N70A 4ENZA 2FNWA 1CUOA 1IBZA 2HZHA 2XX0A 3X1GA 2BW5A 6PCYA 3ABLB 1A4CA 1PLBA 3H4HA 3DKHA 3PAUA 4YSOA 3PLYA 2VSKB 1QHQA 1DYZA 4E9WA 4AX3A 1ETJA 4A68A 3IN2A 1ADWA 3NJMA 3OM3B 2FQEA 4DPAX 2Y69B 3NJGA 4E9RA 2VSMB 1JZFA 1NDTA 1PY0A 3AG4B 3FQ1A 1BYPA 1OF0A 3ASOB 4DP6X 1A3ZA 2PP8A 5IY5B 1JERA 3ERXA 5B1BB 5F7BA 1QLEB 4AZUA 5AFAA 1AACA 1HAUA 1AZCA 2PPEA 3U25A 2R7EA 2I7OA 1OE2A 4KNTA 2HXAA 3TBCA 3NJHA 1SHXA 4CSZA 2HLEB 4E9QA 1XB3A 2HRGA 9PCYA 2XYBA 1L9PA 1PZAA 4KO6A 4E9VA 1JOIA 1OOWA 2P80A 4GP4B 4ZK8A 4F2EA 2XXGA 1SFDA 3IN0A 4YSRA 1ILSA 4X4KA 2J5WA 2EIMB 4HAKA 3CG8A 3QJRB 4PCYA 4AKOA 1NIEA 3FU8A 8PAZA 2UX6A 3MBWB 6PAZA 4KOBA 4BK5C 2IDQA 4KO9A 1CYXA 1RZQA 2CJ3A 2VW6A 4DP1X 2UXTA 1ET5A 2YXWA 4DP5X 1AOZA 3HB3B 3ABGA 1NIAA 2BW4A 2EIJB 1A4BA 1IC0A 1BEXA 5B1AB 5I5JA 4HALA 2Q5BA 3QQXA 2FQDA 2XU9A 1J9TA 3OMIB 1M56B 1XB6A 4AI7A 5D4HA 1PNDA 3FT0A 5I6OA 2XXFA 5I6NA 2BHFA 4NB7A 3QJUB 2IDSA 3T6VA 1BQ5A 2BWDA 4QKTA 2A3TA 4EF3A 2XX1A 1AS6A 7PCYA 2FT7A 4YSEA 1GSKA 3TASA 1ZIAA 4N8UA 2GC4C 3ZBMA 4KO7A 2Y1AA 1OE3A 2IDUA 2W88A 3NYKA 2ZXWB 2XV2A 4M4RB 2UX7A 4HHGA 4NERA 2YARA 3FSZA 2GB2A 2PCFA 4E9TA 1NPNA 2DYSB 1JXDA 1NWOA 2GIMA 2QDWA 1ASOA 2B08A 3EH4B 3TU6A 1PZCA 1ZDQA 2QPDB 1A4AA 2GSMB 3FU7A 5I28A 3PAZA 2ZONA 3CDZB 4NAJA 3WI9A 2JKWA 1ET8A 1SFHA 2OCCB 4A2HA 2XV3A 1EZLA 3S3DB 2WO2B 1NPJA 2VMJA 4KOCA 1J5DA 3TA4D 1KYAA 1IKOP 1AIZA 3SQRA 1NICA 3GYRA 4HHWA 2BP8B 2UXGA 3DTUB 1GR7A 1WA2X 2Q9OA 2UXVA 2AZAA 5AKRA 1IBYA 2VW4A 1GW0A 3OMAB 1NTDA 1FA4A 1BXVA 5A7EA 4BWTA 4A2DA 1L9TA 1M57B 2CBPA 2YAHA 3TBBA 3QJQB 2MRYA 3HEIB 4E9SA 1ZPUA 1AG6A 1JZHA 2QT6A 3QJSB 2W8CA 4G7RB 1KCWA 4A2FA 1J9QA 3FPYA 3KW7A 2YAMA 3AW5A 1JZJA 3JTBA 2FQFA 2FJSA 5PCYA 3N2JA 3PPSA 3UGEA 1W6WA 4BWWA 2VM4A 1QNIA 3OD3A 2PLTA 1PLCA 3X1EA 1WA0X 2CCWA 4GXFA 1PCSA 2XWZA 5I6PA 4P5RA 4G72B 3FQYA 5I6LA 3QPKA 2IDFA 1W6LA 2JFCA 4KNUA 3AY2A 4UF7C 3QJTB 2H5UA 3FQ2A 1WS8A 1J5CA 2HX7A 2UXFA 3DIVA 4WTQA 1KCBA 1SF3A 1CYWA 3CDZA 4F7KA 4YSSA 2X87A 1KGYE 2WO3B 4YL4A 1DZ0A 1NINA 1GS8A 2EINB 3ABMB 4N4YB 3FU7B 4YSDA 1L9RA 2BP8A 1MDAA 1AZNA 3BVDB 2YXVA 3WNJA 3FU9A 4HIPA 3OMNB 2X88A 2PP9A 3ASNB 4UAHA 1KDIA 2BP0B 1NWPA 4GP8B 5B1JA 1NIFA 4Q8BA 1E67A 3PAVA 4PAZA 4YSAA 3SBQA 1ASQA 4G7SB 1T5KA 2GC7C 1E65A 5I6KA 2GI0A 1JZIA 2E86A 2FTAA 1EHKB 2RACA 2BO0A 3CVBA 2J57A 2XUWA 1N68A 3V9EA 2XV0A 4HCIA 4FAAB 3NJFA 1TEFA 4W1TA 2DV6A 2J55A 4M3HA 1V54B 1L9OA 1MZZA 3NT0A 3N55A 2HRHA 3FYIB 1R1CA 3SBPA 2VW7A 2AVFA 1X9UA 3X1BA 1HFUA 3BQVA 4YSCA 3UAAA 3NP3A 2ZWNA 3S8GB 4BWUA 1YLBB 1HAWA 2BZCA 4E9YA 3X1FA 3CZUB 1PZBA 3CVCA 3NJLA 4AKQA 1UATA 4YSUA 2PPFA 1FWXA 1URIA 2DWSA 3QJVB 4YSPA 4BXVA 2AANA 3FYEB 4G7QB 2ZOOA 3H56A 5LDUA 3NJNA 2PPCA 4A66A 4MFHA 1KBVA 4F2FA 4G70B 1PLAA 4KO5A 4KNSA 1AS7A 4FA7B 5I6MA 1PF3A 3IBOA 1W8EA 3GDCA 2YAQA 2YAEA 1NIBA 2BP0A 3ZDWA 1GY2A 4A2EA 2YAPA 1TU2A 4TXVB 1V10A 4AKPA 2EILB 1GS6X 5B7MA 1F56A 1WS7A 1AG0A 4GYBA 4YVNA 3EH3B 4YVUA 1NIDA 2WSDA 2TSAA 2XVBA 2DYRB 1AQ8A 4YSQA 2EIKB 2BWIA 2FT6A 4W9ZA 1E5ZA 3WNIA 1AR1B 3NP4A 2FT8A 2IDTA 3NSCA 3PXLA 3MX0B 2YQBA 3FSWA 5B3SB 4CSPA 1SHWA 2J56A 3T71A 4G71B 2IWFA 5B1JC 2GBAA 4DP0X 4DP7X 1RZPA 3NJIA 1BAWA 4GY4A 4WKXA 3CVDA 1ZIBA 5I5IA 4HZ1A 4DP8X 3L45A 3X1NA 1OCRB 1JXFA 3GXUB 4UANA 1ET7A 5AZUA 5F7AA 3FPXA 1GYCA 1TKWA 1VLXA 1BXUA 1A8ZA 3JT2A 1SDDB 4JHVA 4YSTA 3IE9A 5PAZA 1ILUA 2QDVA 1SNRA 1JVOA 1BXAA 5FC9A 2IH8A 4JHUA 4DPBX 3WKQA 4HCGA 3FS9A 4A67A 2VM3A 1JZGA 2FWLB 3UADA 1PMYA 1AAJA 1V55B 2XLLA 4QLWA 5TK4A 2AFNA 3NSDA 1L9QA 2B3IA 4DP9X 5E9NA 2PPAA 3WG7B 4JKNA 4DP2X 2IH9A 1J9SA 2P80D 1IUZA 1FFTB 3G5WA 1CURA 1AANA 2NRDA 3NJKA 1TEGA 3UAEA 3ZIYA 3SBRA 3AG2B 5ANHA 1CC3A 1BQKA 2DY2A 2CAKA 2IWKA 4BDVB 7PAZA 1BQRA 3EH5B 1OCOB 2HX8A 3FSVA 2TSBA 2I85A 2FQGA 1A65A 4K9JA 4BXSV 4HCFA 2GHZA 1B3IA 5D4JA 1MG3C 1PAZA 5I26A 1WA1X 1MG2C 1RKRA 1GS7A 1BYOA 2N0MA 4DPCX 4RH4A 3RYMA 3T6XA 2AZUA 3NSFA 1OCCB 2PP7A 1NZRA 3FSAA 1SDDA 1X9RA 3T6WA 3V9CA 3UACA 3X2QB 2MTAA 3EHBB 1OV8A 1E30A 1JVLA 3NSYA 3EF4A 1PNCA 2PPDA 1SJMA 2CUAA 3T6ZA 2OV0A 1ID2A 1JXGA 1ZDSA 3AZUA 3PCYA 2JXMA 2VN3A 1J9RA 2DWTA 5B7FA 3S8FB 2LLNA 5TK2A 3AG3B 3H4FA 1GY1A 4L0PB 1AZRA 3UABA 5B1KA 2H47C 2H3XC 3ABKB 4A2GA 1E5YA 1M9WA 4DP4X 3T9WA 3ZX1A 2PCYA 4Q89A 3S3CB 3NJJA 3D12B 1KBWA 1JZEA 2R7EB 2YAOA 2OJ1A 2CALA 2I7SA 2IAAC 1MZYA 1XMEB 3AG1B 1RCYA 5D4IA 1AZBA 4BDVA 1L9SA 1AS8A 1WAEA 4E9XA 3IEAA 1XB8A 5EHFA 3WKPA 1ZV2A 1ASPA 2BZ7A 1AZUA 3S3BB
chains in the Genus database with same CATH superfamily
1CD0A 3TS8A 1OCZB 1UD8A 2WXPA 4JCWA 1EZUA 5FO9B 1HHIB 1FH2A 4RSVA 3QA3B 3O6ML 1DVXA 2COVD 2XZQL 4I48A 4K3EL 3FO0H 4PW9A 2B77A 2VERA 4PR5A 4HHAB 3A47A 3V5DA 2PN5A 4OV6F 1FSKC 4U1LA 3VXMD 4CDGC 2NQCA 3A6BL 2XX0A 3B9VA 2D4DA 1D5IH 1ANUA 1ZHNA 3M6DA 1KLFB 3X17A 3C5SA 1U8IA 5FECA 1RZGA 5GS1C 5F1IB 1QG3A 4YHNB 4LSRH 4XRCA 5K1VA 1BZDA 2CIIB 1Z9PA 2ZXCA 4UAOC 4P23D 8FABA 3AACA 4CVXB 5IBTH 2FWSA 3DO7B 2P8LB 1U8HA 3OM3B 4K9EC 3CE1A 2P5EA 1VACB 2IANE 4KVNH 3MR9A 5EMYA 5FHAH 1ZSDA 5LN4A 2XQBL 3DX1A 4HJJL 1BYPA 1IL1A 2P4AB 4NGHH 3LEVH 1UURA 3LRGA 5IY5B 4GQ9H 1I7RB 3OAYH 4JANB 4PYHA 4LAQH 1UH3A 2YPLB 2YFNA 1QI3A 3QYCA 4LKCA 3CFUA 3SPCA 1Q90A 5KSAC 3M88A 3WD5L 5DJ6B 1XIWB 3CUPA 3QWNA 3U9UB 1ZD6A 3ATAA 3F6IA 3COOA 2EDOA 2CDGA 4NQXA 1TTFA 3Q8FA 4D7BA 1KMGA 5EB9A 5KVEL 1U33A 3TO4B 4XO9A 3INUH 2FSEB 3CN2A 4HISA 3RFRA 1D5XA 3O6KH 2AXGA 1EHLH 4ELMA 2BY1A 4NJAL 3MGTB 1J7VR 4QHLA 3AGVA 2XN0A 3NESA 3TV3H 1A6VL 3W2DH 4DVRL 2YOAA 2EP6A 3CSGA 2F53E 3ZE2F 5HYFA 1H8NA 3QUXC 3K8KA 4JFOA 3PG2A 5EU6B 3TA3C 3P3TA 2E76C 1NIEA 2VQ1A 3MRLA 4ERSL 5TDPB 1SHMA 3QI9B 3GZKA 3NH7L 3U0PB 3FB8A 4GPVA 2VW6A 2XA3A 1B6UA 4GSRA 4TS6A 3UBXB 4HZAA 4BFIA 1AQMA 2OTUA 4ETYA 2EEXA 1OSZA 1CD1B 2G60L 2DJMA 3ABGA 3I9AA 2GJZA 4D8PA 3Q9PA 2EKSB 3IFLL 5LGYA 3NCWA 4M1DH 5D7IF 5H8DA 2HKFL 3ET9F 3KXFE 2IALB 1IGIL 3Q48A 5B3NA 5I5JA 5IVXB 5C07B 4MRBA 2ZWSA 2DLFL 3WN5A 3ZO0A 5I6XB 5JR1H 15C8H 5T3XH 4LMQE 1KB9J 3IDJB 2Q0ZX 2WJ7A 3ATBA 1DVTA 1B4JH 3APFA 4PPTA 4DN3L 5I6OA 4X5PA 4F92B 3AU1B 3SBWA 4I13B 1FYTA 3P02A 1KCVH 1F2QA 1XT5A 4J1UB 1BQ5A 3T3MB 1K5WA 5JOEA 3N44B 3FFCB 5E5MB 5MI0C 1UB6B 2VDML 4JO4L 2AJXH 1WBYA 2J8UE 2NQDA 4LARH 4U6TA 3Q3GA 4Z3HA 5DZAA 2I24N 2PYEE 2VDLH 3BAEH 4WI4A 4PWKA 5HVWA 2YARA 2DL2A 3R1GH 4OZ4A 4LBEB 3T1FB 1JYVA 4E9TA 2BIPA 2OJEA 2XA8L 3QEQE 3VI4B 1TTUA 3Q5TA 1JDCA 1N18A 1ACYL 2GIMA 1HC1A 3FBQA 1HZLA 2V9QA 2A6IB 5CZRA 4OFYD 1NC2A 3BAJA 4LT7A 4H5SB 1T21A 4RNRB 5IIEB 4Y1SA 2XV3A 1ZT7B 4JZJB 5AWNL 1F13A 3ARRA 2E7LC 3QEGH 2P44B 1GRWA 3UAFA 1MCPH 2I60H 3RUGE 3WS3A 3WUZA 4N2OA 1H5BB 1PX8A 4UOQA 3CDCA 1NCJA 2Q9OA 5IB2A 4DKEH 1A9BB 4PJ5A 3VGFA 2CZNA 4JFXB 5C6TH 3C6SA 4GEJA 1P7QB 1YYCA 5IHZA 4M6NH 4HWEL 1WZKA 4L37A 3RTLA 1RJZA 3W56A 5IUSA 3ZTNL 3MA7A 4F20A 1XTLA 5C6PB 2WWKT 4GW4B 2H32H 1GIGH 1O6SA 3D6GA 1OPOA 1OGPA 2RR3A 1CFMA 2DWXA 3O6MH 3K7UA 3OAWA 2XZQH 4MCZA 1WBXB 3SDXE 1B3JA 3IS1X 2YQ2A 1SJEA 3DGGB 3VFUA 3CSYB 2OK0L 4LSUL 1SVCP 4X8JA 1VESA 2EKJA 2RQEA 3EHBD 3VWJA 4WTZA 3D06A 4JZNA 1Q9OB 3BPCB 3RWHB 3D4GA 3QNZB 1EA9C 1TTCA 4S1DD 4HJIA 4I2XE 1TQSA 3SDAD 5D7JB 3U7WH 5IB4B 3SCMB 1F4WL 3JWNG 3FB5B 5C08E 4LLQB 5I6LA 1OAQH 2XQBH 4HJJH 3KL5A 3MKKA 3J2PA 4XBGB 4G3YL 3QARA 3ZTJG 2VISA 3P9MB 1VGKA 3KNBB 5AVWB 1KCBA 5DVOA 3V0GA 2PO6D 2Z64C 3WD5H 3JUYA 1G7MA 3KLAA 2AQPA 3APNA 3OKMA 4ODUA 1X5JA 3P4OA 1GS8A 3Q43A 4NO0A 2Y25A 2WKOA 2VDRL 2ARJQ 2ICCA 1IC7H 5FYKD 5CJXC 4PRBA 3AFLA 3LN5A 2Q6WA 1QI5A 2DI8A 1LP9F 2EH8L 4TYUA 2H41A 1NGWB 2IPTL 2XZZA 4WFHE 4PJDE 1JV5B 3Q2CA 5E51A 3ULVF 4ANKA 2V5TA 4GP8B 1XTMA 4OLVL 4PJEB 4PY7B 3QPQD 4I4WA 4KPHL 4NLAA 4QRRE 5JORB 3B6SA 3GINA 4XVSH 3NH7H 5MERB 2HG5B 4NT6B 1ASQA 2BSSB 2AGJH 5HHQB 1AC6A 1VADB 3WS6C 1S5IL 3DXAA 4G7SB 1SXCA 4OUUA 4HCRL 1AXTH 3TN0A 3V6OE 2GCYA 2VR3A 5DJ8A 1I8IA 2R4SL 4WJKB 5FOJA 1LO2L 2CHDA 2Y5EA 1PVHA 5I1CL 1F90L 3NACL 1VEPA 2DLFH 4ZW7A 2NNXA 1R3LA 3QC6X 2QGEA 3WIIH 1ITCA 4PB9L 4RRPG 3GSUB 2ICWI 4QO1A 2YLHA 1OGAA 4HZLA 1PLGL 5ACLA 1DBBH 2HRHA 2F58H 2UUDK 4PJIE 2WZPA 3SBPA 1PKQE 5AVTB 3PE9A 3MSPA 2DQDL 5CN2A 3AMKA 4NHUB 2Q76B 4Y5XA 3RE0A 3BYYA 2ILLA 3L4YA 4X98B 2AP2A 2FVNA 5ANME 2VDMH 3LPGA 4QHMA 1D9KC 1Z9OA 4WV1B 5DD3L 5T1KD 4NZRL 3DYPA 2HKAA 3CFJB 3LKOB 2EC9U 1FYHB 2XSKA 3KYNB 1GOFA 3C5ZB 4P8QA 4KKAD 1JPFB 4MFHA 2Q1EA 4P2QE 1OXYA 4AITA 2XA8H 3IXAA 3IJHB 4EAEA 3LQAL 3IGKA 1WZLA 1YEGH 3QZBA 3SDAC 1PDKB 1NOFA 3LSOB 2I9TB 2Z3FA 2YEZA 5AWNH 5BV7L 2HH0L 3GZOA 4U1GB 3IETA 2CM6A 1AG0A 4Y2DB 5B22A 3P3RA 4OLXL 4QUOA 4Y4FA 1BJ1H 3X14A 5GSVB 1NCNA 2CNYA 2WKLA 4YLCA 2BWIA 1Z32X 1E5ZA 3CFTA 4RRPA 2VGLM 4HSAC 3EO1B 3V6ZA 3ZTNH 1BEYH 4LVOB 3C8KA 3W3BA 1TTGA 1MUJB 1NC4B 3IRZA 1JV2B 5E0QA 4YAQB 4TVPL 3D85D 4X4ME 4FLHA 4JN1L 4UWQB 5I71C 3PY9A 3EYQD 1QSFE 1JHKL 4JHWH 4P2YA 3BE1L 2HB0A 3DYMA 1UXWB 4FFVD 2X3BA 4BV1A 5AB9A 1AR2A 2X38A 3GKWH 5IVNA 3GM8A 2WN2A 4K8RL 4J3BA 4FADA 2ATKA 5IJVB 4R4BA 4JDVB 1B4RA 4X4ZA 1LILA 1RVFL 3BPLB 4L1SA 5GRYA 4A67A 1J5OH 2Q2EB 5EO1B 4NX0A 4GQZA 1QFWL 2VUOA 1TTBA 3MRGB 1NGXA 3GDBA 4NRXB 5AW2B 3DSFL 2KLSA 3G5WA 3C60B 2VDRH 4HJGA 2BVQB 2A9MH 2J1XA 5F7YC 3BH4A 2CRYA 4CNIA 2JVUA 4ORGB 3ZTJH 1S9XA 4TNFA 1QSEE 3IGUA 1C08A 4FQJL 5TE6L 4KITB 1IFRA 1B88A 1J8HD 2VAAB 5SWZA 1S7WB 2EH8H 4WHYG 3L5XL 4NPJA 3N6YA 3FN9A 1YNTF 2IPTH 3FSVA 4Y4HB 5EZJA 4U1HB 1NCCH 3ARDA 3UC0H 4NKMB 2K70A 1TENA 2Y1VA 4MB3A 3L6FB 2HMID 3FKUS 2GEQA 1BZ8A 3CFDB 4GNKB 3IJYA 4UQDA 1U9KA 3TWCL 1F6LL 2P24B 5I17B 2P26A 3O2DL 2V37A 5BW7C 2C3VB 2X89D 5D1QE 1AKPA 2A4EA 3FN0L 3TBTA 4DUXA 1AZZC 1C5CL 1EJOL 2GJ6B 1ZHBB 3QJFA 4TL5A 2P48B 4AQEA 2R4SH 5IBLD 3REWA 4YQXH 3MFFA 4Q6KA 5IMMA 3NACH 3MLUH 1GMEA 4KZ0A 5E5LA 4PB9H 3B2VL 3T6ZA 1N6VA 2EDFA 5IP4A 2XKUA 4RWYL 1E8WA 4M5SA 2C9AA 4PEEA 1IM9D 3C8HA 3O3UN 3TCLA 1AQDA 4WEMB 5DFAA 3FFOA 5B1KA 1P5UB 4OJYA 4U6VH 4PRPD 1JWUB 3GHPA 5IKCA 4E0RA 3ZYZA 1KTRL 1S3KL 2VXQH 3V4VA 4MCYB 3US1A 4GG6F 1A02N 4TUKL 4V1DB 4I8DA 4GW5B 2DEXX 5DI8B 3VG9B 3TYFA 2CALA 2UWEB 3GJFK 3QIBB 3CD4A 3T0EA 4Z95H 4FFVC 3K6NA 3WEOA 3HLAA 1I9RL 3DX9A 1ZXQA 1GH7A 2KQMA 4N68A 3CIQA 3GSNH 2BSBA 2OYLA 3I3DA 5CN1A 4MQXC 3BKYH 4LP5A 1EJFA 3F12A 4YDVA 3VYNA 3WGVB 2IQAB 4RZCB 4QCIB 3O4LA 4WRLA 4TQPA 2WVSA 4J3OD 5BV7H 4NC2B 1BVLB 3ZHKA 1NH6A 2N59A 1A5FL 3JTSB 2FEEI 1CXFA 4LPUA 4OLXH 1IBGL 3QDGA 1EPFA 1W0YT 4F57L 3FJTA 2LU5A 3D05A 5SWSE 4UQ3A 5IT2L 3EG9A 4Q6YA 4F24A 4MXWL 3C8DA 3IJ9A 1JF1A 5CJ5A 3FU3A 2CLZB 1M7XA 3GO1H 4OZHF 4OV5A 1PZSA 3FQTB 4RMRA 4FFYH 3BIBX 4XI5C 4YSOA 2DN7A 2X4OA 1TJXA 4ZUTA 2K8QA 3OJMB 4OAWA 2O5ZL 3L3KB 2R56L 4GW1A 4HV8A 3ASWA 4DTGH 3MV9E 4JN1H 2EC9T 4X6EA 4B7IA 3GMNB 2HT2D 1JHKH 3KXFD 4IDJL 2AJ3B 3ESNA 4Z7WA 4AXWB 5I0YA 5F7DA 1O5PA 2V2XB 3SQOH 4ZNEE 3QH3A 5D5ME 5GZOD 3ALXA 4W9GC 3C5XA 4MWFA 3IMWA 4X9YA 2HXAA 1IC4L 1WD8A 4PJGF 3HNSL 3U9WA 5IBLC 2E0PA 1PYWA 1BBDL 1QFWH 2LQRA 4KUCF 4NO5A 2XYCA 4GXVL 1ZAGA 2X2YA 4Y5YB 4Y16D 5HBBA 1HOCA 4PS3A 4HFUL 1ZLSH 1NAML 1XCQA 1YYLL 4XZUB 2NXZB 4RFNC 4YSRA 1ZJBA 3DSFH 3MREB 1AIFB 1CBVL 3QEUB 1L9NA 2B4CC 2X12A 4CVZB 4H13C 1DJWA 2LE9A 1FI8C 1SJHA 1NCTA 2V2TB 2Y6SD 5AD0B 5GGRB 3EYUL 2HKHL 2H9GB 2BNUB 2RJMA 2YPKA 1A4BA 1F58L 3LKNA 3ZE2B 4APXA 3KWVA 3GJFB 1N8ZB 1U8NA 2ED6A 3RDTD 1D7FA 4MMXC 3L95A 5D2LA 4AM0B 4LLUA 4EKXA 1J9TA 1X7TA 1KBGL 4WHYH 5AYUL 3HE7D 2A83A 5I6NA 5FYJH 2BHFA 2JTDA 3A0OA 1EJOH 3SE8L 4WWID 5D7IB 4TNVF 4YDIL 3W11C 1ZHKA 4J3OC 3VSVA 1V3KA 5F9DC 1E8ZA 1CF8H 4GXUM 3I9PA 3MVSA 1NBYA 2B39A 2OL3A 2L4OA 3HVNA 1A3LL 3HW7A 4FLQA 1OAJA 5A40E 1TQBB 4BSWB 3SE6A 4EI5D 4JO5A 4PP2A 3WTXA 2XV2A 5C2BH 3BEWB 4RWYH 2E8ZA 2N7BA 4MLIA 4YR6B 4GEIA 1MFDL 3ZYIA 3EF7A 3DK0A 3QWOB 3WCYA 4EI6A 2JJTC 4AYEC 1OY3B 4YOKA 1BG1A 3FQRB 3QIWB 4XMLL 3O9WB 5D1ZB 5KSBF 2QSCL 2QQLL 1LEGA 1BZ7A 4G11A 3WI9A 1IFHL 3AQZA 4W9CC 3CFQA 2EECA 5HI4C 3W0WB 4X6CE 3HFML 3SJVD 1JNHA 2EXSA 2NSQA 2WSKA 4PJ9A 5BRZD 5IW6A 2NXYD 2MCMA 1IAOB 1IFGA 4FQXC 1WG3A 3WHXA 3S3JA 2BP8B 4QF1A 2ZZUT 4IGBA 4RWHA 2X4QB 2H3NA 4MD5A 2IAMC 4MNGA 5I1GL 2DMBA 3ARZA 4TTDC 4F3FA 4JFHE 2VMFA 4LSPH 3ETBF 1EUTA 4M62H 1CVSC 3KBFA 1FRGL 12E8H 4MAYD 4RAHA 5IHLB 1LNUA 2ZSWB 3FO1B 3A67L 4YDLB 3LH2H 1PZ2A 4GRWH 5IQ9B 3S3PA 1IBGH 4A6YL 3VXMA 3LNEA 4R4FL 4X0KB 2LAAA 3IDNB 4LB8A 1ECYA 1H3XA 4Y1AB 3EJYD 4MXWH 1HN1A 1KB5H 1OAZL 1CDJA 2Z9TA 3H85A 4HC1L 2OZ4L 1KCUL 1VZGA 4QXTB 4X5QA 4ATTA 1CDGA 5A6LA 2YGVA 2NY0D 2YSSB 4UZUA 1HE8A 3AB0B 3H2WA 1FFPB 4WI5A 5CAYB 1NCWH 1JTOA 3UG3A 1JPSH 4P23A 5EOQH 3GLDA 4YE0A 4NKQB 4E41E 3MRPA 4XXDB 4OKVA 2Y1ZA 2WQUA 3X1EA 1HSAA 4GXFA 1KCLA 2DQTL 5IVZB 3Q6GL 4WJ5B 4F7EA 3IU4H 4CKVX 3WTYA 1M2OA 2VDKH 3RZCD 2E7LA 2ADFH 4AL8H 5F1NA 4IDJH 1YY8A 3B8YA 4B9JA 4OF0A 3WUWB 3R06A 4I3GA 2EDJA 2BY3A 2VR7A 2BP5M 2Q20A 4E36A 3HE7C 4APQC 1T1YB 3ABMB 1M7DB 3WTTA 4XPHL 1IC4H 3UYRL 2X7LB 1K85A 1S7QA 1FC2D 5IB1B 2VJXA 1R34A 1A7QL 1BBDH 4FCAA 1MI5A 4YHLL 2NY2C 1RUML 4JKPH 4QRTA 4P2RE 4AMKH 2XBZA 4EI5C 4DUVA 5L9DL 1ZOXA 4DCQB 1EBAA 3ZDZE 1CBVH 2AJZA 4JFDE 3DRQB 2H1XA 4P2QD 3SBQA 3WXVL 3GSWA 5EZLA 1H15A 1OHZA 4QJ4B 1LP9B 1U36A 1Z5LA 5DSCA 1OQOA 3WOVA 5F9JB 4PJ8C 3VWKB 2HKHH 4F8PA 5DC2A 1S7VA 3PS6A 2FJGA 4DO6A 1F58H 4ZFOA 3WLWC 5JOFA 2ITEA 2X44D 4MA7H 2DBLL 2PTUA 4F7TB 4FQCH 3N1QC 3CHSA 1NBCA 5IHHA 3H0TA 3DTXA 4OD2A 1KBGH 2B9AA 4QHNB 4TF4A 4WUUD 4CW1B 3M46A 4O51A 5AYUH 3K71B 3G5VA 2WTRB 4R90H 4X4XA 3TXAA 2CKNA 1I9EA 2R29L 4PJAE 3BP5B 1Q9WB 3NA9L 4YDIH 3CQPA 4MAYC 1QKZH 1VKXB 3S8GB 3PHOA 2BZCA 3ULUE 3VD4A 1E6OL 2BVPA 1A7NH 1ES0A 3X1FA 1M71B 4U6YB 1CICD 1A3LH 3LPFA 1QBML 2V5RA 4Z78A 2I32A 2EUXA 2KL6A 3MCKB 3N42B 5AW4B 4G6FD 2O5NA 3KPTA 1ED3A 2VRKA 3QXTA 3TVMB 5LDUA 3UBHA 4ZQTA 3ZO9A 2K6YA 3CFKA 5JIQA 3MQIA 2EVJA 2DQFA 4G5AA 1W72A 2WW8A 3QQ4A 1BQLL 2QR0B 2XN9B 4GINA 4JFPB 4MA1B 5A2FA 4M7LH 4KK8D 1PF3A 2W80C 3G6AB 3WS6A 4OFYA 3MBEB 3LPWA 2Y2TA 2CO3A 1UD5A 4XMLH 1Q94B 2QSCH 3ZDWA 4PJ7A 5B39A 1F45A 1IFHH 4BZ2L 4P04A 3F7PC 1TU2A 2APTA 4XWGL 3OBAA 4LVHB 4YLBA 4YBQC 3TIEB 2X10A 1TQCC 3Q44A 5JW4N 3C09C 1DBML 2BIHA 4X2UA 3BH8B 1XQ4A 1BSIA 3ATFA 2EIKB 3MNZB 3CZJA 5JW3H 1JNJA 4GS7B 5I1GH 3E8UL 4X50A 2VQUA 2DM7A 1YNLH 1L0PA 1BGXH 1MCBA 1VFUA 3ZKND 5FUCE 4K71B 2C7UA 4H1LA 3V0FA 5CP3A 1VZIA 3VD1A 3VRLF 1JGDA 1S7SB 1E9QA 1KPVB 4A6YH 4PG9B 4D0CB 3V4PA 4L8DB 4R4FH 5I5IA 2F7OA 2Y22A 4MJHA 2OMUB 5DEJA 4ZQKB 2AQ2A 3L45A 1J1XL 1G7JB 5ID0B 3QO0A 5CJ8A 4PD4J 4HC1H 3EJJX 4LLDB 1GYCA 2J1WA 1VLXA 2P46B 5C3TA 4ONHB 2YC1B 1U8JA 4WW1A 2F19L 3VXPA 1FFNB 3IE9A 1JFHA 4ZSOA 1S7TA 5PAZA 3SDAA 1K4DB 5FX3A 4ODXA 4Z3FA 2DQTH 1TOXA 2WINB 5E8PA 4BSVB 4J8RA 5BZZA 3HRPA 3DTDA 1JZGA 4F5CA 4G7VH 4Y89A 3P9LA 1KELL 4IYKA 2Z8WC 5B3JF 1XR8B 2PO6A 2V9UA 4MJIB 4NO3A 3OKEB 2VLKD 2MKLC 4HW6A 3TFBA 4R7NA 4NJ9H 1MY7A 1FZMA 3GSRB 3IDXL 4WJG3 4XPHH 4XNBA 3VTAA 3UYRH 3MJ8A 4ZMOA 1HINH 5F6HI 3GUTA 2CBQA 1AI1L 4J3VA 2EXYD 2Z7YA 3HG0A 4QHUB 5CEZL 4WO4B 5TTRA 4MDRA 1IM3D 1FNFA 1OSEA 1D2OA 1UWGH 4NUGL 4QJ3B 2IPKA 1OD9A 4YHLH 3ZQWA 5GGUB 5FO8B 3AQXA 2AXHA 4W70A 2EAEA 5L9DH 3S5LG 3B34A 1J48A 4I9WE 4G8FB 4PJHF 4CSTA 2UZYA 3DV4B 1BZQK 3HZYA 3GFUA 4BFKA 3QNXA 2G3MA 3CVHA 4JREB 3RL1A 4KK8C 3WXVH 1MG3C 1KN4H 4OZIF 3WIHL 4BFOA 1MFBL 3BUYB 3EW3B 1MG2C 1RKRA 35C8L 1KG0B 2HT4C 5H35B 1YNTB 4QXGL 3EADA 4TSAH 5J1TC 1I1YB 3FSAA 3IFOA 2DBLH 4AK1A 3LZFH 5DK3A 3GB7A 1ZLUH 3HUJE 1RIVL 2DQMA 2L7UA 2DMCA 5D70L 2QZ5A 3AZUA 3C9NB 5SWSD 2VN3A 4TLKA 1MCDA 4EN3D 2AK4E 2GTZB 1GA2A 2PETA 1MJJA 4KNQA 5TK2A 5F0LB 2XXCB 3NA9H 3ZKNC 3PWPB 2EIZA 1JYXA 2LV4A 2MQGA 4PS4L 4ZO6A 3BP4B 1DE4A 1E6OH 5T1KA 1EERB 3UO8B 2I07A 3NCBB 1CTOA 4Q89A 4X6DA 3FUFA 1F3JA 2AKRB 2IH3A 4IU2B 4CBZA 5ETUA 2R8SL 4BK5A 4MJ6A 1HZHL 2QVTA 3S5LA 3MU3A 1INEL 1KFGA 2JQAA 3FT1A 4V33A 3RVTD 3FCBA 3ARFD 3NIGF 1FV1A 5FHBL 4YMPA 4PTUB 3RWIB 4GG6B 1G9NL 1CDYA 1DANT 4BZ2H 1T7WA 4P2AA 4YHOL 2ICEB 4GP5B 3TEWA 3DOSA 4IKKA 4LASL 2JKNA 2DLHA 5F3HB 4ZYKB 1U92A 3EGXB 1RUAL 3TEUA 1L3WA 4DERA 5SV3A 1E28A 3ARQA 5HYSA 4CGTA 4M43H 3RFZC 4NKDB 1RIHL 3EFFA 4MCMA 4U49A 4O2CA 3W9EA 4PV9A 4R84A 4TSBL 4G1EA 2XTJD 6PCYA 2CGYA 1FL5B 3MDJA 4TNVK 4R7DB 4U1MA 4RRPM 3DKHA 4XNYH 5IHUL 4PRIE 1WAPA 2X4SA 4R26L 3D85A 4E9WA 2VE6A 3GRWA 5F0PB 3WMPA 2WXRA 3NEOA 4K2UL 1N3NA 3VNZA 1J1XH 4JZOA 4XN4A 3G5YB 5C0DB 2XWBB 1EHAA 4OZHB 5EZOL 4QMEA 4KDVA 5AL0A 2VQTA 1CFBA 3VXRD 3DROB 5B8CC 2OJZL 5GZNC 3TYGH 3PDGA 3K0YA 5EU4A 1D2PA 1T89C 2G0KA 4ODVL 2F5AH 3QXWA 1TZHA 4NQDB 1WISA 4N2IA 3QXAA 4YDJA 3GEFA 3HZVB 5AW9B 5I1DA 5C07E 4PGEA 3F6LA 3MRBA 5ABDE 5C0IB 1UOWA 1F4YL 1ORQA 4PLOB 1BZEA 3KGSA 4KKBC 1GSMA 3FQNB 1SFDA 1BD2B 4WFEE 4EN3C 5AVQB 3DBXB 4BUGA 4PCYA 3DGCR 4BH7B 4PJGB 3U6XS 1M1SA 5IG7A 1AI1H 4NN6C 2YPVA 3MYZA 4NQUA 4PTTA 4Z3IA 4ZMPA 1J8HA 4IRSD 5C0AB 3UAJC 1MQKL 5FKAA 1HYSD 4ZNCD 4LZKA 2J6EL 3HB3B 2C3GA 3P77B 3K4ZA 2Q2LA 3QZOA 2WXJA 2B1AH 1Q38A 2BW4A 2WGXA 1MREH 2VZUA 3K3QA 2PYFA 2WLIA 2B8OT 1MRFL 3MLYH 1NDMB 2Q5BA 2UZIH 1SOQA 2EC8A 4PLKD 2ITCA 5JTWA 4H88H 1FN4A 1U58B 2X89A 1XGZA 3RVTC 3WIHH 4ZD3H 35C8H 3AXLB 3FF8A 3PWLB 4QXGH 4PJ6A 1NGZB 2HRPL 4JRXB 4JFHD 1X5IA 3D0VA 3T6VA 3GLZA 4BZ1A 5CBAB 1U2CA 3LQAC 4ADIA 4XMTA 2FT7A 4KY1L 3FONA 43C9A 5MEQB 2HN7A 5FYJD 4ZXBD 2VXVL 4WDIA 4IMLA 1IGYA 1RIVH 1IGJA 4ZOAA 5JUEH 5D70H 1DDHA 3NN8A 4I0CC 2W88A 4L9LA 4L2LA 4R8WL 4DJMA 3GPSA 2VC2B 5BV7C 4ZFQA 1IM9A 5CUSL 5GJSH 4NERA 1KC5H 1NAKL 1OB0A 4DT2A 4PRPA 2ZPKL 1R5VA 4P5TC 3HNVH 1H6UA 2ADGA 4FZEL 4NRZA 1FL6A 4PS4H 1X5XA 4EZLA 3EH4B 2DM2A 3VE0B 2DTML 3OAZK 3QRFM 2CPUA 3T8MA 1HESA 4GBXD 3MRCB 4P2OD 5HXMA 3BPNC 3PV7A 5IBUB 2R8SH 5DYOA 5ADPL 2Z93B 1NPJA 2BVUA 1CFTA 2CK2A 1HZHH 2NCEA 4MMXA 5DUBB 5HHNA 3ZDYE 4CMHC 1GCFA 4JFFA 1INEH 1RZFL 2K9FB 1O7DE 4XAWL 1UVQB 5DTFA 5F7FA 4D0BA 4I0KA 5CGMA 2WLNA 1JZ5A 1EAPB 5FHBH 2FCBA 2NX5D 3K72A 4ZDHA 5KSBB 4LRIC 2W81C 4S0SD 1YEEL 1VFBB 3JTTA 4MXVE 3OZLA 4I89A 3NABL 4OCMC 3U6RB 4LSTL 1MFMA 4W68A 4K8RC 3UH8A 2E56A 5E7FA 4IM8A 4B0MM 1RUAH 5J56B 3L9BA 2NW3A 1EO8L 1R3KA 4N0RA 4NUJB 3L3HB 2G75A 1HHKB 5DMYA 5FW8A 3VM5A 2CHXA 4M00A 1FNSL 1M7IA 2KC0A 3WDIA 3OQ3B 5C0EA 4TSBH 4MNHA 1YRKA 1MH5B 1MVUA 2BSDA 2GG1A 3RX5A 4JFDD 3PPSA 4NFDA 4OZFG 3MZGB 4NKIL 4X6BA 4R26H 1EDHA 3OWEA 1NCGA 2N7AA 3QXDA 4IRSC 4L4VE 4AVIA 5I16A 3C5JA 4DOHE 1KJ2A 2FAUA 1HYSC 1WV7T 2V2WA 3SO3B 2FH6A 2VMDA 5TE4L 4YGVB 3C6LD 2W65B 3MUGB 2JI1A 2WYIA 4ZUWA 5IFJB 1NCBL 3KXFA 2WLZA 3H2QA 1I1FB 2WY3B 3H55A 5IGXL 5L2JA 1ZVSA 2W60B 1J5CA 1A6PA 4XNDA 1UA7A 1CMOA 5GZOA 2BZDA 3MMEA 1HHHB 2CJUL 4J6RL 2DLIA 1XGQA 2I9LB 1J05A 3VXSB 2RBLA 3CIAA 2VXTH 1S8DB 2HTKC 3DX7B 2NZ9C 1SEBB 1XZWA 4QYOB 5DMIL 1SBBA 4HUXA 5EIVA 4ELDA 3H7BA 3T8XA 3QDMB 2EUZA 3B9EA 5K9QG 3D39D 3PWNB 4ZW8A 5INCB 4Y16A 5D2NB 3ULUD 4WNQA 2JV6A 5ERWB 1F4YH 4ZXBC 2WBJC 3S88H 2QTVA 2VN7A 2X88A 4H26A 2PP9A 2DQCL 1BFVH 1JCKA 4P0DA 1TZGL 2VJ0A 1JG9A 1WGVA 4KV5F 3X12B 4AJVA 4K94H 3PAVA 4BKTC 1P7HL 1IGTA 4FQHA 4L4TB 3P54A 1KCRL 1A4JA 2XVKA 3I6GB 3KLHD 2P42B 2IPUG 4HEME 2R0ZH 4F91B 3DX8A 3D4ZA 4P2OC 3HS0C 1X7QA 1LO3H 2PCPA 1EDYA 2UY6A 1FZJA 2YMTA 5L0QC 3RDTA 1J1PH 1QNZL 5H37H 3RUGA 1MRFH 2JKTM 2RIKA 4HCIA 1QO3A 4PBWD 2NW2B 4PS7A 4HS8L 3HE7A 1IX2A 3UZVB 5CEYB 4LSDA 3LS4H 3NT0A 2B1HL 4UNUA 4UMSA 4UQCA 2XRAL 1BYNA 1YEKL 4NNYB 5KYUA 2K6ZA 2UUDH 2CIKB 3CZUB 4KY1H 1UATA 2OTPA 3BP6A 3SDXA 2F15A 4EI5A 5DD6A 3TH2T 3H56A 4EIUA 1DJZA 3RWJB 1PIFA 5CUSH 4Y2LA 3MNVB 1E2WA 4F80A 1FVEB 4KNSA 5FDWB 1GYUA 2ZPKH 1N9PA 3HIZA 4XB3A 4EDXA 2GI7A 2P8MB 3TIDB 4FZEH 1NFDF 2I25N 4MMZB 4EDWL 3E7JA 1M42A 3PIQA 3WDJA 2Z1PA 4I2XA 1QRND 4K4KA 2Y24A 4Z5RB 2F8IA 3P2DA 1L6PA 3C6LC 4A2EA 1S9WB 3SJVA 5IR1B 5BRZA 1T2QL 5ADPH 3IRCA 2DL9A 5JIIA 5DR5L 3VCLA 5J8OA 1HJCA 3RY5A 1H3UA 4NQCE 2K0RA 4YVNA 4KXDA 4NFCA 1GGCL 1F42A 1NIDA 4NZJA 2GITA 4XVJL 1AR1B 2FHFA 3HBPA 3RGVB 4U6HB 3FOLB 4ALAL 4U7MA 4Y5VB 4MAYA 3PAYA 3NABH 1VFMA 4CSPA 1MDTA 2VXUL 3IRPX 2FK9A 4ELKB 5FS5A 3OPZL 4JFUA 3K5SA 2MQCA 4JW3A 4Z7AA 3QFJB 1GCYA 5EBMB 1MIEH 3L2NA 1GKOA 1V3JA 1FNSH 2QVKA 3CFCL 3X1NA 4LLYB 4HPYL 2A7BA 3E2HB 1ET7A 4A38A 2I27N 4I9WD 5DJ0A 2W0FB 5DJZB 1G7PA 3DX4A 1INQA 5JPNC 5I8KL 1QR1A 4R0LB 3HRZA 2FECI 1SZNA 1BLNB 2ALWA 3NZ8B 4ICWA 3U2SA 4PGJA 5FGCE 2NOYA 3UZEC 5CSBA 4X8XA 4MYPA 3RZCA 4GAGL 3NPZB 3QW9A 4FL4C 2MQ3A 4H0LC 4MA3A 5A2KH 3GEWB 4OW6A 1PQZA 5IGXH 3KEDA 2VLRD 1L9QA 3QSKB 1THCA 3N41F 1KLUB 1KJ3L 3O41B 5EIQA 1QMUA 4J6RH 1J9SA 4YL9A 4GRLB 4JFWA 1F6AA 1UOVA 2X4TB 3NFNA 4NCC1 1CFSB 3MROA 1K8IA 1PKQA 2BSRB 4X5LA 1AANA 2X3AA 2AQQA 2P8PB 1Z9LA 4IOFD 5A3ID 3MOQA 4R3SA 5DMIH 3W57A 1R3JB 3KPOA 3ZIYA 3U46A 2QV4A 5ANHA 1XR9A 3DX6A 3FTGA 1M05A 1BQRA 2JELL 3LN9A 3O3BA 1A64A 4UOW1 2HX8A 5EO9A 2VZTA 2DQCH 1U8MB 1TZGH 4WW2F 2IOIA 3WXWH 2CE6A 2WVUA 4C56A 3L9YA 4AVKA 5EU3A 3FUNA 1AOHA 4PQXA 2BS8A 4EUPB 1ESOA 4NO2B 3SQBA 3FT9A 3MV7B 1PAZA 2QPUA 1KCRH 2OMWB 4X9FA 5KANI 5E4AA 2DKUA 3LKSA 4NM4L 3QYMA 4G8IA 3TLRA 4Y8DC 1UWXK 5DQ9A 4JKMA 4NBXB 1TDQA 4Z0BH 2CU9A 4LEBA 4XCEA 1LE5A 1UJ3C 4PJCE 5EU7E 3FQ4A 2HSIA 4HXBL 1T1WB 4OJAA 2YPLD 1NBZB 1JIBA 3DJSA 4WUUA 4JFVA 1JAEA 4PWFA 2OV0A 4TNWF 1XIWD 3PCYA 1Z5YD 3H7LA 5E6SB 2B1HH 4QXWA 1A7OL 1YEKH 4L0PB 3MRKB 1RZJL 3TO4D 1UEYA 4PRID 1CICA 3U82B 3CDGB 2ZG2A 4HH9B 1M9WA 3IGAB 5GXBB 4X4MA 5MEOB 3OC5A 1B0WA 3CPLB 4IHOB 1DQQA 4KI5C 1D5MA 2OI9B 5EU6D 5HI3C 4LSQL 1TCRA 4AV4A 4QRPE 1UD4A 4IJ3C 3GJFH 1UKQA 1H19A 3BGFB 1WTGT 1CVRA 1I8MB 4EDWH 3VXQB 1C5DA 4N6RA 3QQ9D 2FGWH 3V0EA 4JAMB 1MLCB 2HT3C 4OLZH 1OK0A 2LT9A 4BQ8A 1NDGA 1R6VA 4UILL 5C07D 5DR5H 3CPUA 1GZHA 2DWDB 5GGTL 4BE6A 4DKAA 4GUQA 1KB3A 1GGCH 2J2ZA 3KW8A 2HX9A 1VPOL 3NIGB 1C12A 4XVJH 3NFSL 2ZKWA 5F8RC 1T4WA 3QJOA 2A74B 2EDTA 3BFOA 4P9MH 4ALAH 5A3IC 4IOFC 1UJTA 4WTWA 2DH3A 3FFCD 3PAUA 4DF9A 1WF5A 1J8SA 3O11A 4F2MB 5DD5H 5JIHA 3ZR6A 4B96A 4A39A 4DPAX 4MD4A 4URKA 3BVXA 4W81A 1B0GA 4G5ZL 4HPYH 1AVAA 4Q9RL 1NCHA 1J18A 1PY4A 4L5FE 5D1XC 4KZEH 3O3DB 2DOCA 2AEWA 2XWTB 5I8KH 1V7ML 5T1DL 3L1EA 1CT8A 3QG6B 5DUML 5ESAB 2IADA 4MJ5A 2V9TA 3W37A 4QRQA 4YHML 4CSZA 5JHAA 2WVTA 5KJ7E 1UM5L 1IKNA 3FO2B 3Q5YA 2Y06L 3RFZA 1OW0C 3SE9H 7TAAA 2W1NA 5E00B 1DR9A 1YQVL 2VLKA 3HBZA 1MOEA 4P07A 4ZK8A 5BRQA 3IJSB 4FQQA 2XKSA 4OGXH 5D7IE 1P7QD 3F00A 1X5MA 2AQ1A 1DVFB 3MBWB 4OF7A 5KUMA 3TO4C 4AMXA 5JHLL 1XSJA 1HQRB 4KDWA 5I1AB 1WITA 2H1PL 1IM3A 2X41A 4WWNA 2A6DB 3QXVA 3VXTB 3UCQA 2BRQA 5MENB 3ZMEA 1G6VK 1YN7B 3VGAB 1E4KC 3P4MB 2J21A 2GBUA 3UIYA 2R1XB 3VFSA 3QI9C 1A25A 2G9HB 4FABH 4LSSL 3L4TA 1ZA6B 3LVEA 4NM4H 5D7JD 4OLYH 3QQ9C 5DEFB 3QCUL 1IC5L 4Z3JA 3JV6A 4KJWD 4LEOB 4PY8J 1J0HA 4K3DL 4FE9A 4XOCA 3SDYL 2ORBH 4FNLL 3VFRB 1XF3B 3QISA 4K73A 1BPLB 2ZSVA 4Q9QL 5B38A 1GJWA 4L3EB 3U4AA 3ZLQC 4KO7A 5TQ0H 4U6XA 2WV3A 5SWSA 4EN3A 1T03H 1MCRA 3ME0B 3FQXB 2PXYB 3RDJA 5KTEH 4XN5A 4FQPA 3M8OL 1DEEA 1KGIA 1PD6A 3FFDB 2HLAB 5BZDB 1RUPL 1QQDB 5T1MA 1RZJH 1TETH 1HQ4B 4RISH 1CG9A 1JXDA 2H45A 2X70B 3VI3E 3RG1C 5I15L 1ASOA 1MPAL 4QRSA 4DKFH 2CJSA 4U1IA 2WHVA 1EFXD 1JNLH 3CDZB 1GGBH 4JVWA 3A24A 1FG2A 3IAPA 4KX7A 5JXAL 4JHZA 1IU1A 4KHXH 5LNEA 1AGCA 4ZMQA 1KULA 4LSQH 2VXQA 1FCGA 1HHJB 3ULVH 5E2WH 2NY7L 3KPSE 1HEZB 3ARFA 3PHQB 1RIUH 2FIKA 4RFOL 4ZNEA 1U8PA 5EU5B 2ZYSA 3I6KA 1KFAH 3LRSB 1GW0A 1SJXA 5HYJB 3FCTB 4J5VA 3KPMA 2X1OA 4JZJC 5INDA 4J4PD 5I30L 3QJQB 4UILH 3GSNA 2VDPB 3B56A 4K7FA 4OIAA 1AG6A 1UH4A 4HKBA 3O45A 1DSYA 5LGJA 4P3CL 3H1ZA 4JN2B 1E2VA 5I8CB 4JG1L 2AQTA 2IXQB 3NDZE 1KCWA 3WIFB 3F6JA 3I50L 4CSSA 1EFQA 4YZWA 1G7LB 3QQ3B 1KWKA 3S0PA 1HSBB 3VX0A 2O5YL 4YBHA 1DQJA 3BWAA 5ECJE 5IROD 5JQ6H 1IAIH 4H0HB 1AHWC 3CTTA 1CFNA 4K3HA 1VFAB 4O02B 4NC1E 3UTZB 5HI5C 1B2WL 4UDUB 4BH8A 4G8EA 4HKXB 1BVNT 1M7UA 4LOUD 4NBZB 2J8HA 4H20H 3AADB 3AXHA 3VM7A 4FFYA 3R7QA 1LK3L 3DLQR 3AAZB 3GUFA 3NCEB 4OCNC 1JRHL 4XP5L 3KDPB 2WZ6A 4D9RE 4UTAH 2P1YA 4W6YB 1Z3RA 3VXRA 4P4KD 4ABUA 4EEEA 1BZ9A 5BPPA 4PJXA 4H8WL 1AD0B 2JKXA 4XVUC 4LIQE 3UJIH 2UVFA 2FO4B 2DYPB 5FA3A 4G42A 1FVDA 2XC8A 4LRIA 3SCMC 1ZKAA 3WY2A 5DUMH 2BMKA 2EH7H 4GQPH 3FHEA 5BUPA 5C2UB 3NIDF 3QFDB 1M9SA 1UM5H 4Y2DD 3VDBA 1KTKE 1I8KB 4CADB 1XH1A 5KWYC 3BVWA 2O5XL 3HPLA 2NCMA 3UL4A 1KF9B 4EKJA 3FUKA 3P4NA 3QULA 1AGFA 2OMBA 3SPVA 4MTMA 4L8BA 3U4BH 3G6JF 1CE6A 1ROCA 1TNNA 1UCTA 3MRNB 4M9OA 4IRSA 4PJBF 5JHLH 1NC4D 1OOAA 4XOBA 4UIMA 2JCCB 4S1RL 4QAMB 3FK3A 2HFGL 3KR3L 3CHQA 4LPWA 2GI0A 3HE6B 3CFNA 3TT1H 4MNQE 2NY4C 3FTWA 4IRJB 4X6CA 4LHUB 3SKJL 3E3QC 3V0WL 5FCUH 2K3HA 2XUWA 3OKDA 1U3HD 5DCCA 3IFNL 2H6OA 1TEFA 5CSZA 4BQBA 2RD0A 1M1XA 3DOHA 3DUSA 4N22A 2BHYA 3T4AA 1UACL 2EZ0D 2YIHA 3K74B 3DUUB 3QCUH 4KC3B 1N2RB 1X9UA 3L5HA 1WZMA 3SDYH 3PV6A 2BDNL 1JVKA 2DKSA 3P4LA 4JY4A 2GPZA 1FDLH 5E1HB 4IOIB 4AKQA 4AV5A 5GRXG 4ZXBA 5DRNA 3X3FH 3WFHB 3WLBA 1G9NC 1QYGH 4L3AA 3KH3A 4JQIH 3I3EA 3G04A 3O3EA 3MLXL 1KBBA 4X7FC 3HI1A 3C60D 5EPMB 3F85A 1FPTH 6TAAA 4XH2A 5I6MA 1RUPH 1VIWA 3DVIA 1MFCL 4H4NA 3MGAA 4DVBB 5I15H 1N5YL 1XF2A 2O61A 4WV1C 1MPAH 3SOBL 3L4WA 1U4FA 1YEJH 3BEVA 4NN5B 4WI8A 4F58L 4JRYE 1NIBA 4GBXA 4LOUC 4P2OA 4Y4HD 5AEAA 3HS0A 3L2LA 1CLOL 1NM4A 1FFQA 1G0DA 4AVJA 3C5ZC 1PJWA 2Z7UA 3L5JA 4ACPA 1A1NA 1V10A 3WBDA 5EF3A 1WS7A 4HUKB 3F58L 1S4IA 4LKXA 2ZUQB 4YVUA 4E5XA 1NFDB 1OAYL 2R2EB 1A6ZA 2NX5A 2BOBB 2D73A 2DQIH 3CH1B 3Q7JA 5BO1H 1M4KA 3MRFA 3NP4A 2FT8A 1MLBA 1PG7L 5LWYL 4NSKA 3VD9A 1NPUA 4FNSA 5GS1B 2VC2L 3K2MC 4U1GC 1SY6L 4G6KH 4EXKA 4UAOB 5B3SB 1A7PL 2WSPA 4Y2DC 4DP0X 2DI9A 4ZFZB 5KBKA 3Q6FA 3LRKA 2F7IA 3PU7A 4ZT1A 1QW9A 1DUZA 1E8XA 3GXNA 4HT1H 3IKCA 4F7PB 4L8SA 3DMMD 4TNWK 2ZYIA 3I50H 1U8LB 1V3MA 3V10A 3HC0B 4NPKA 4Z76A 5I5RA 1RZKL 1MN4A 4YIQA 2R2BB 4JFDA 2YGQA 4LVOC 1YSOA 1JGEA 3NCJH 4KQ4H 1F02I 1A4KA 4YSTA 1CR9L 2KI6A 5G4NA 1B2WH 1KB5A 4DUWA 1A14H 4OLUL 4AV0A 4YZFE 2XVLA 3C6LA 4CMMA 1R5IB 4JHUA 1T5XB 1XV8A 4GAAA 4V1DD 4YFLF 4WFFE 5KSVA 3BFQG 2H1LM 5E6ZA 4K94C 1E4XL 4JDZA 4WENB 5EBLB 4QT5A 1FL3A 3QIBD 4XP5H 4AENB 4WI2A 3NSDA 5KUKA 3IXTA 4GQRA 2WNXA 4XOEA 2VKWA 5BZWB 2WQ8A 1QBLL 3QUXB 3LZQA 1KTLB 2CDEB 2MH4A 4HIJA 4Y19B 3BPLC 4PJAA 4WI0B 4OGAD 2A77L 3D39A 2OYKA 4CC0A 4HJEA 4XMVA 5L7XL 4HKZB 5JIMA 2X4UA 3P3SA 3N41B 4U1SB 1WWBX 5J89A 4XPFH 3NCMA 4CUCA 3EH5B 3HPJB 2OMZB 2O5XH 1OLLA 3VTTA 4HUVB 2I85A 3PGCA 4QWWD 2PW2A 2WVVA 3NFPA 2GAZB 1HNYA 1G1YA 1XH3A 1T1ZB 5FEBA 5J6HB 5JPNA 2H4EA 3RU8H 5E8EB 5C0JB 4M5YL 5HHXL 4QRPD 5B4MC 4AT6B 1VGEH 1AD9B 1UWEL 4NNXA 3UZEA 1T7XA 4ZUVA 5DDHB 2HFGH 3KR3H 1FAKT 3Q13A 2N0MA 5C0BE 3MLSH 3ZPDA 5FGBA 1KYFA 3LHPH 3SKJH 3L7FB 3V0WH 4K23H 4WW2B 2LLLA 1EBPA 1H6TA 4U7KA 1E9PB 3MV01 3BOVA 2VL4A 2DH2A 1K8DA 3D25B 4KTYA 2PW1B 5HVGB 2UZXA 2EVFA 2CO4A 4LRNL 2OBGA 2XG4B 2R23A 3KJ4B 4YDKL 1UKTA 3HHSB 5A1AA 3T1WA 2MHAA 5FB8A 4HIIA 4YHPA 5D7KE 2LVEA 4KBPA 2CO1A 4HSQA 2BDNH 1I82A 1KGWA 3LXCA 1KJMA 3KVQA 1WK0A 5HY9A 3MRDB 4DP4X 1KN2L 2PCYA 2AEPH 3GBNL 2NXZD 2XWRA 2EYSA 3PDOA 3GMPB 3MLXH 1TVHA 4NWUH 5BQ7B 2R7EB 2BVOB 5FAAA 4XP6L 2XDHA 4G80B 1DBJL 1P5UC 2IAAC 2Y7LA 5J6GA 3V5KB 2QPFA 5C7XH 4XAKE 1WZ1H 4CKQA 1QRNA 2H6PB 5C9JA 3SOBH 3ZL4H 1I3GL 2BJMH 1JUFA 4F58H 2AEIT 1QFUL 3NVQA 3WFEL 3WN6A 5FO2A 3VG9C 1JFQL 3F7VA 2QMKA 4P5KA 1CIUA 3TZVC 2AXFB 2FJUB 3GMMA 5H94B 1UJ3A 3NOIA 3QIBC 1J0YA 5C0ND 1O7VA 3LAFA 3E9UA 3SY0A 4XC3L 1OF2A 3UBFA 4P5SA 5F2FA 3FZUD 4GKOA 5HP5A 4X8CA 3D07A 1OAYH 4NQDE 2K6WA 3S9DB 5LWYH 1PG7H 1K4CB 1OGSA 1JPGB 3ABLB 3I3BA 5HYEA 3NCYP 2VC2H 1SY6H 1KJVB 2ENYA 4WK4B 1QHQA 1WEJL 2RA1A 2BCKB 4WEUD 4OM0L 1SRDA 4PWJA 3OXRA 3L3DB 4MDJB 1QUPA 3PWVB 1WAAE 2HFTA 4OH2A 4PJGE 1RZKH 5GISL 3EFDL 4MZ3A 4GI6A 4A6YA 5CMAA 3QHTC 3HG1E 1ZS8B 5IHBA 5C0CE 2W07B 3RTQB 1CR9H 3BP7A 2R2HB 3DYOA 3QIWD 4AZUA 3O9WD 5D1ZD 4DGIL 4JKLA 2FGZA 3NZSA 4KXBA 4PW3A 3U25A 5KBPA 5K9OB 5L4JA 3L4XA 3P73A 3NJHA 3V7MA 3UTQB 2JJWA 2VLRA 4FYSA 4JFSA 2X28A 2XYBA 4MLSA 2N56A 1PIGA 4XCCH 1M6UA 3TEXA 1QFWI 2DS4A 2L7QA 3MRQB 5C8JB 1NL0L 4AY0A 1JE6A 5C09E 5D9SA 2D3JA 4EVNB 4F2EA 1EZVY 2P43B 1QBLH 3QR1A 5E2VL 4KMQA 5FK9A 1M6OB 4CN6A 4B5EA 3NDYE 3EJCA 3FU8A 1RZ7L 3JV5A 2HPOA 3L7EB 3QA3A 3HC4L 4Y5YC 5L7XH 1JPST 1RZQA 3ARWA 1FE8H 4HHAA 2WZ5A 2OSWA 1EEZB 1SBSL 1OK8A 3V0VB 1X5AA 4WQOA 1IAKB 4Y1AD 4JDEB 1QACA 1YPZE 4ZTPH 3BVUA 4XTRD 2EIJB 1KLFA 1FP5A 4O5LL 3CK0L 4YHNA 3EH1A 5F1IA 1EXUB 3K5RA 2CIIA 4ZS6C 2M26A 3CN3A 2X6VA 4QXUL 2XU9A 4LQ1A 4CVXA 3DO7A 2P8LA 3UTPD 4JLRA 1M56B 2WQSA 1VACA 3ZSSA 3RGHA 3BCDA 5HD8C 4FKEA 1QTSA 1SEQL 1E27B 5KVDH 2DKMA 4MAUH 4OY9A 5EFIA 4JANA 2CXKA 2YPLA 1CTNA 3QR2A 4M7JH 4J28A 3HZ3A 5E6UB 4Z7OB 3FZUC 2R0WL 2MEJB 3D69A 4N8UA 5TF0A 4XWOC 1XIWA 4KKLD 4NQEE 3IFPB 1SN5A 2NY6B 3U9UA 3GSXB 5DHDA 4AE0A 3ARED 2Y3AA 4OZGE 2VLJE 3BZEB 2HTLC 2X6UA 2DB8A 1G9HA 3TO4A 2FSEA 1IZJA 1QLRA 5J12C 3V6OC 3IWUA 5CEXA 2B08A 1TYRA 4IBVA 3MGTA 2QPDB 3SOTA 4ALAC 1TQBC 3H9ZA 3PAZA 3HAEB 4NZFA 3VGDA 1EXHA 2PF6A 3TF7C 2AQRA 2BXZA 2J44A 2CO6B 1E4KA 1LEIB 2Z65C 5EU6A 1RURL 1U95B 4MS8D 3MAWA 2WO2B 4XNXL 5TDPA 1IGCH 4G59C 4NRYA 3TA4D 2V5MA 3U0PA 3UBXA 2UXGA 3DTUB 2VJ8A 5ALCL 2H8PA 1CD1A 4N20A 4P5MB 4TSCH 5KBMA 1T5WB 2EKSA 5EG6C 2L3BA 4D7PA 4LL9A 1QFUH 3QUHA 2DD8L 3MJ6A 2IALA 3VG0L 3ULVD 1JFQH 5IVXA 1G87A 1TZIB 5C07A 3TBBA 4MVBD 4KTGA 4UB0L 3QCTH 2BY0A 4AEIH 5GGVH 2QT6A 2B1OA 5IK3A 4WI6A 4N0CD 3ENEA 4AH2B 3VXSE 3H3PL 5CCJA 2CK0H 1ZLDA 1DFBL 3AU1A 2QJDA 4FQIH 2EACA 3SGJC 3II1A 3CU7A 4JL1A 2V7HB 2XN2A 2Z8RA 2FJSA 1S9VB 3FFCA 4J39A 4P05A 1UB6A 2CUMA 3UGEA 1AO7E 2YEQA 4M7LT 4AGQA 1WEJH 4NYLB 4M1GL 4XCYB 3M7OA 4OM0H 3S4SG 1UENA 4PWEA 3TVMD 1PEWA 1L3NA 4E42B 2IDFA 3AWEA 3F83A 3HR5B 3OZ9L 2MNWA 4LBEA 4LLVB 1WFJA 4MNQD 3T1FA 4XBMA 1UHVA 4UF7C 4AUYA 3AB0C 1I9IH 5IW1B 5CIPA 2GUYA 2XETA 5JDJA 3NTCL 2A6IA 3MBED 2FLRT 3I02A 4H5SA 4HJSA 4RNRA 3SPIA 4RDQG 4XGZB 4DGIH 2WO3B 1RJYB 1JGUL 1NINA 1ZT7A 1CDIA 5EA0L 5A6IA 4UZGA 4ZMAT 1K6QH 2LHAA 3D18B 5FUOL 1N0XH 4GRMA 2R15A 4MX7B 1J1OL 1H5BA 4N8VG 4PSPA 2KUTA 4RAUB 1A9BA 4QNPF 5E9DB 1ETB1 1NL0H 4ZODA 4KKLC 3ECWA 5LXGL 1P7QA 1BMWA 2R0LL 4JM2F 2BP0B 2YMXL 3N0PB 2ZCKL 1OTUC 5HDWA 2C9UA 4I3RL 1KY6A 1RZ7H 3HG5A 4NP9A 4UNTA 4ODHL 3QDJB 5BXFB 1AHMA 1WBXA 2P5EE 1SBSH 3DGGA 3MACL 3CSYA 1JZIA 4OD1H 3S4SA 1ZA3B 3A6CL 3MODL 1RZJC 1ZCRA 2JNZA 4O5LH 3EYVB 4ISVB 1VF5C 1UB5B 3MXWH 4R4ND 1Q9OA 3BPCA 5AL8A 3RWHA 3QNZA 3NJFA 5TDOB 4PJBB 4QXUH 2YRBA 3K6DA 1E7UA 4M5ZL 1JYNA 2PTTB 4GT7A 4M56A 5EUOF 4FNQA 5D7JA 3TBYB 5FFLA 1WIUA 3VWKC 1CJYA 5IMKB 4LLQA 3NQKA 2CR3A 3LNGA 2Y36H 5DWUL 3ULVC 1SEQH 4XBGA 4HMCA 5GJTL 2XJKA 5KG9B 3P9MA 1RU9H 1TKWB 1HAWA 1VCBC 2ERJB 1HHGB 3VQ1C 3IT8D 3BRGC 4ONGH 3AS2A 1MCOL 3MBXL 4FTVE 3FUMA 3QJVB 4HX1A 4YSPA 4GUPB 2AJYL 4UT7L 4KK6D 3V0DA 3BKJL 1E4HA 2R1WB 4QHKJ 4WNSA 4GIAA 4AWJC 1WWAX 1AGEA 3WFCH 1YAIA 5CSGA 1XFPA 5LBSL 2XQYK 3JZ7A 1MCSA 3A22A 3NIFB 3GM0A 3KJ6L 4ODTH 4WO4D 2AF2A 1NGWA 5FUZL 1EFXA 4LHJB 4EUPH 1IGMH 4ZMNA 3TVMC 4WIQA 1UGKA 5J9PB 3QIUC 4ZRGA 2HCZX 5JORA 5E99H 3BZ4A 4D0DB 2HG5A 4MA1C 2WP3O 1NCUA 3QUZB 2BSSA 5HHQA 3EH3B 3VRLE 5E1GA 2XVBA 5L88L 3CZKA 4YSQA 2BX5A 4L3CB 1FYTE 3K2UL 5JLZA 3Q2LA 3Q9QA 5ISZE 1XGRB 3TBWB 2GIXA 4J4PA 4CC1A 4N0YL 5EEZA 1UD6A 4M8QB 2AI0L 1MWAA 3HI6H 3RBSA 2D7NA 3GSUA 3QNFA 1T04B 5DHEA 3O3AB 3UEZA 1NEZB 2ID5A 1LO0H 3CVDA 3H3PH 3DURA 1FNLA 4GS7C 4XCFL 4HZ1A 3X11B 1OCRB 1ITBB 3CLFH 1JXFA 4F9LC 1NFAA 5EEUA 2AS5M 5IROA 4V11A 2Q76A 4K71C 4TQEL 3S97C 4X98A 3CN0A 5KJRH 3DX3A 3H8NA 3WFDL 3ESVF 4WV1A 2C1PB 5E94B 5IM7B 4NP4L 3WGUB 3GI8L 3CFJA 1SUHA 4M1GH 2CMRL 3LKOA 3KYNA 3CV5A 4R2GB 2VR9A 2XPGB 3ZW3A 1DO5A 1JPFA 5BOPA 4HU2A 2ZUWA 5KVGE 2F1EA 3DRTB 5E1QA 2MKWA 5BZXA 1X4XA 4NAQA 5TK4A 1Z3GH 4P4KA 4R4NC 4YH6A 3IJHA 1NOLA 1P4BL 1Z5HA 4AYID 2VDPL 5ITFB 3WG7B 3VD3A 1GZPB 1SOXA 3U30C 3QFGA 2J1YA 3LSOA 4GMTH 2A9CA 3DO3A 2I9TA 1FJ1B 2ZQKA 5KVFL 4PJHE 1DQLL 1GAFL 1G0YR 1ZK9A 5D7KD 5DEGB 3MV8B 5FUOH 2E7HA 1J1OH 1U3YA 4Y2DA 3BDYH 2ZUUA 3D2UD 5GSVA 1RMFH 4OZIE 2JI2A 3IKKA 4O00A 4EMZA 3ARTA 3WAJA 5DRZB 2CLVB 4N3UA 3KMDA 2LFGA 4E9LA 1BX2B 3DHPA 2K78A 1DO6A 3TO2B 2Y72A 4BXSV 2YMXH 4O58L 3MGOB 3OX8B 3PABB 1MUJA 2WUCH 1NC4A 1LMIA 2GHZA 3FHAA 4GG8B 1JV2A 1S78D 4HDIB 4PVLA 5HGGS 1E43A 4PJFF 5E2UL 1ML0A 4XAKD 3ULAB 3KEHA 3DGDA 2DF3A 1F0LA 4G9FB 5JW5B 3QORC 4FXTA 3DJRA 1PG7X 1C8PA 3A6CH 1OQXA 3IDIA 3TNMA 4MASA 5I2IA 1UWXH 1UXWA 1U3HA 1DFXA 1CZ8H 1M3JA 4DN4L 4JREC 1H0DB 4JO1L 3E9TA 4IKJA 1UXMA 3QUML 2JH2A 3AS1A 5T5FL 5IJVA 1KUMA 4M5ZH 3EOBB 3LMJL 5E2JA 4JDVA 2JXMA 4DFIA 4ONFL 1AQKH 4NQDD 5H37A 1U8QA 1PD0A 3GGWB 3OWRA 1E6JL 4PVBA 1EVUA 1KIRB 2LLNA 3DI3B 5DWUH 3VNYA 1S9YB 5CKGA 5LG6A 2CHWA 3ECVA 3LDBB 3TT3L 4C54A 2ADIB 2H3XC 3H9SB 3MRGA 3MHZA 4A2GA 1E5YA 4J23A 4U3SB 3NIGE 4NRXA 3H9HB 3T9WA 5IQOA 1EO5A 1MCOH 2YK1L 3MBXH 3UBXI 1BD2D 4NZUH 4M5TA 4WWKC 4PRHB 5GSRB 3C60A 3EDFA 1U91B 4Q2ZB 4FQXB 3MV11 1UWFA 3FN3A 4ORGA 4PUBL 1KXVA 2OKMA 3IU3B 4M4PA 5CU9A 1CGTA 2C4FU 3DXAE 4MD0A 5LBSH 2VAAA 5C0AD 1S7WA 4KUCD 3RPBA 3KJ6H 5DD1L 3B9DA 5C0CD 5DT1L 3U0WH 5FUZH 3HB3D 4Y4HA 4U1HA 3IEAA 1XB8A 3LEYL 2Y7NA 1O9VA 4NKMA 5FW7A 5L4IA 2HJLB 3L6FA 4PLNC 3CFDA 3SKOA 3RVWC 4PB0L 2D7PA 5EIIG 3STLA 3TFKC 4Z6AT 3L9EA 1I53A 4FFWC 2N4IA 4LCWB 5I17A 4AOFA 1GGIL 5IMLB 1FZOB 4JQXC 2QPEB 2C3VA 1I1AD 3BIAX 5F8QC 5FLVA 4Z18A 5F9AC 4ENZA 1ZHBA 5CXPA 4JRXD 1N67A 4KXCA 2ICEC 4U33A 3WJJC 3FH5A 3P2TA 4N0YH 5FYLE 4Z7NE 1R3IL 2MPVA 4H8WC 3SY6A 3B1UA 4DKTA 1ETJA 4A68A 3DMMA 5DFVC 2BNRB 2Y69B 3FQWB 2CG9X 3F3HA 2O6EA 1BWWA 3O6LH 5D7SL 1URLA 3FU6A 5ACZB 1P5UA 1WJ3A 1OWWA 2AITA 5AOZA 1JWUA 3CZFB 4F27A 2PP8A 4TQEH 2J20A 2Q7AA 4NQVA 2CDFB 1S78C 5T3ZL 4XXCC 1QATA 3PJSA 4IK6A 4EXPX 3VVWA 1QLEB 3FT2A 3GI8H 2ICWB 1OTTD 4APQB 2CMRH 3OKOA 4V1DA 3DWTA 3UYPA 5DI8A 3KPPA 5DJXB 5LAXB 1OE2A 3QIBA 3TBCA 4N2AA 4NENB 4LCUB 2JLPA 5SX5K 1Y0LB 2X6CA 1IJ9A 3VXOB 4YWGL 1RV6X 2VDPH 2J72A 2OS7A 1J5HA 3RAJH 4NQED 2IQAA 4RZCA 4QCIA 3HKZA 1JI2A 1UUSA 2FYYB 5KVFH 4UTBH 1BVLA 1DQLH 1GAFH 4KKRA 3JTSA 1I8LC 1T6VN 2IOOA 5LGHH 1E3FA 3MUZ1 4OBSA 4O02H 5F9WB 3CSPA 2R51A 3T08A 2CLZA 4PR5B 2J5LC 3FQTA 1QFPA 3KYOB 3QCVH 4KX9A 4AQ1B 5F21B 1G1OA 4K3JL 2VDOB 4M02A 1D5BB 1F1GA 2VR4A 1ZY9A 3QPXL 1U8IB 2EDLA 1RZGB 3DPBB 2MTPA 3N06B 5E2UH 1GJIA 1KY7A 4QTHA 3HB3C 3WSQL 3ROOB 1KEML 2XXFA 4FN0A 1R19A 3GMNA 4L5FL 3OMZA 4H8UA 3LS5L 2AJ3A 4WHDA 4AXWA 3MR9B 2AC0A 2FX7H 4PRNA 4DN4H 4EF3A 5M94B 3FOMB 3ZDXE 3TC9A 4YSEA 2OR9L 1ZIAA 2GC4C 2L7EA 3K6FA 1EMTH 1PTZA 1MCWW 3BVVA 4KHTH 5F7EL 4L8CB 4WI3A 3VXSD 1Y07A 1OE3A 5E03A 3BPOC 4LEXL 1IBHA 4M4RB 4DGUA 2UY7B 5BOZG 4Y5YA 3TT3H 1CGVA 2ZT9C 4HFWA 1LGVA 3TU6A 3QJHB 1LDPH 3RVVD 4XZUA 1X6LA 3OKNB 5DHMC 1N5AB 2YK1H 3RY6C 4KJYA 1WLHA 4RMBA 3MREA 1AIFA 2OCCB 2ZKHL 4XNQB 4ELMB 3QEUA 3B2PA 4L1TA 4JBSA 1CLZL 1TQCB 1WUNT 3C09B 3DECA 1MW1A 2VN5A 2MCPH 2V2TA 4L4TD 5AD0A 4JFOB 1GR7A 1SOSA 2IVFC 2WXHA 4XN8A 5K9KB 5KZCB 2UXVA 4B50A 4A63A 3ESOA 2VW4A 2H9GA 1C7TA 5DT1H 4A7SA 3FB8B 4BFIB 3I6LE 1RZKC 1AH1A 4BWTA 3GJFA 1N8ZA 3GI9H 1X5FA 4F8LA 4GUOA 3G08B 2GFBA 4AM0A 1FFOA 4YXKH 2R9HD 1HCFX 4GKNB 2EUWA 4B9PA 1VCAA 3EGDA 4GLRH 2KHAA 4JR9L 2A9NL 4FYQA 5D7IA 1DQDL 4L48A 3GNML 4Q74A 3BUTA 2FYVA 4XNMA 2X09A 4H7VA 1JF5A 3N1FC 4BWWA 3OPUA 4JFZH 4BYHA 4KZDH 1QNIA 5DVKA 5EO0B 5CILH 1N64L 3U4EB 2GTQA 2IGLA 3EXLA 1AMXA 5T8IA 3BEWA 1UM6L 1J10A 1GC1L 4RGNB 2R39A 3PWUA 4U1JA 5I0DA 4YR6A 3CWGA 4KNUA 3T0EE 2V7NA 2ZAGA 4XPTL 4FFTA 2AV1B 3QWOA 4TULL 4W9DC 1GPOL 4AJ0A 1IQDB 4HKJB 2PUQT 2HPTA 1CQKA 3DIVA 3FQRA 3QIWA 4I18B 4UT6H 5T3ZH 1H9DA 3VW3L 2X4RA 3O9WA 5D1ZA 2OJEB 5KS9F 4YE4H 1QW8A 3SO3C 1X5ZA 4F7KA 1BAFL 1ZE3H 4B27A 1DZ0A 5SX4H 3UP6A 1PZ5B 3OZKA 5ICYB 3SGDH 2WLJA 4KV5E 4EZMA 1IAOA 5TFSL 5D7LB 4M93B 2BP8A 3P9WB 3QDGE 4LLMB 5IHWA 3RVUD 2X4QA 3OAUL 3KBPA 4ECNA 2FHCA 2ZJSH 3WS3B 4QJ5B 3FRPG 4N90D 4Z7VF 4FTVD 3SGJA 1HXYA 5IB2B 5JOPD 3RGVD 1ZGLP 2DLEA 2Q3ZA 1F41A 1NBQA 1E67A 3C08L 4PAZA 5IHZB 4FJYA 3RIKA 4POZD 5IQ9A 1NUFA 3EOTH 3ZRCC 5D2NC 3MA7B 3QFJD 2E7CA 4LCCC 3L3OC 4X0KA 4HAGA 3RVVC 3IDNA 1O6SB 4Y1AA 5I6KA 2X9YA 4LQFL 2KQNA 3D30A 4QXTA 2ZAIA 2H0FA 2X1XR 4JM2B 5IF0B 5C0RL 1JWSB 4Z7WE 2X0VA 4N2DA 1UM4H 3VFUB 3NBNA 1FFPA 5GS0L 3N43F 1EXGA 1WE5A 3A6OA 4XXDA 3QPXH 5IVZA 1YY9C 2VLME 4JZNB 3GBML 4WJ5A 4KI5F 1BVKA 1MZZA 3LZLA 5E1IA 5KYWA 1FYTD 4S0TD 4O2FB 1KEMH 1EO7A 5A2AA 3TJHD 3GMQA 1HFUA 5ISZD 5DGQA 1TIUA 2VMEA 2BOLA 4AYFB 4A04A 4XMPL 3GK8H 2FL5B 3MLZL 2DW5A 1G7QA 3FULA 4LIQL 1TFHA 2VH5L 2R9HC 4KH9A 3SDDD 2VISB 2WQRA 1XWVA 1VFOA 2ADJA 2VITB 1WDAA 3AREA 1T1YA 1YEFL 4GRLD 4HS6B 5F7EH 1M7DA 3FYEB 5KBLA 2WQXA 5LBGA 3PP4L 4LEXH 2X7LA 1GOHA 4IRZH 4F2FA 1G7MB 5IB1A 3VVVA 1FNEB 2DLGA 4KO5A 3CBKB 2H2SD 5D6DA 3BN3B 1DZBA 3QZNA 3IBOA 1EJ8A 1MXDA 1DQML 1A7RL 5AG8A 5FV2A 1SXSA 2ZKHH 1CLZH 3V52L 3PL6D 2KZKA 1XBRA 4GYBA 1LP9A 4MMZC 3G9VA 3MV7D 5F9JA 1BG9A 3B7YA 4MJ4A 2YZ8A 1L6XA 3GS7A 4GKSB 1GVIA 1BV8A 1W91A 2NY3D 2ICWJ 3TEYA 2ZUSA 3L13A 4NQQA 3VFPB 1S46A 4Z7QB 1F4XL 4F7TA 1ZRUA 3LXAA 4KJQD 4QHNA 2ZX5A 2B5IB 5LVEA 4ODWA 5KJ4A 1O9WA 3K71A 1AR1C 2WTRA 3L5IA 2OTWB 3RGVC 1KYDA 1Q9WA 2VDNB 2WZ0A 3BP5A 1BLIA 1I7TB 2ZNWA 3GNMH 4QO1B 4UANA 4XNZB 4Y5VC 3ZTDC 3B3IB 4IBUA 4HH8A 1J11A 4OVUA 5B8CB 1RZ8B 1SQ2N 3S48A 2Q3AA 4NQSA 4N0UE 1M71A 2ZXQA 4POZC 4RQQB 4U6YA 1I1CA 2EDYA 2P47B 5LCVL 1JK8B 5GRZA 3MCKA 1N64H 3CH8A 2ESVE 1CK0L 5ITBL 3TVMA 2IH8A 4H25B 3T3PE 1GHFL 3B9KB 4MNQA 1RPUA 1MCEA 5DS8B 3E2HC 1NCIA 1NEPA 2VM3A 5DJ2A 5FPIA 2XN9A 4JFPA 5B21A 4I1PA 4CN4A 3V4UL 3MBEA 4ZX4A 4R0LC 4WU5B 4MNGE 3IF1A 3OR7B 4UZSA 1Q94A 3IXAB 1IJNA 4JFEB 4JPVL 4UTAA 4X4YB 1BAFH 5E23A 1HXKA 4JM4H 1MHHB 2BCMA 4P4RA 4AK2A 5J4MA 3TIEA 1AHKA 4NN6B 4CRPA 3LN4B 4X5WB 2EXWC 2Z91A 3WKMH 4CJ0A 1ETA1 3BH8A 3OAUH 3IETB 4AZ8A 1OB1B 3MNZA 43CAB 4N2LA 1XGPA 2E3VA 4GRLC 4Y4FB 1W9XA 3UC2A 1F3DH 1OSPL 4K9JA 3CX2A 4MKTA 4GQQA 4NM8L 4N2GA 4OSUH 4UT9H 2ZX7A 2H2SC 3ZKMC 2Z8SA 4H0GA 4N6QA 3QZWG 4HQQL 1KPVA 5GHWL 4PG9A 3ROLB 4D0CA 4L8DA 1BZOA 2OMUA 1TCMA 1G7JA 2EDKA 4Z7UF 2GK2A 4JQVC 5ID0A 3T3MF 2FLMA 1UXSB 5JHLA 4LLDA 1ETZB 1G0XA 2LTQB 1NZRA 2DQUL 1DHKA 3HZMA 1FIGL 4ONHA 2YC1A 2XNAA 5DHXB 4NUPA 2CHNA 1E30A 2A0LD 1B4TA 1I9JH 1K4DA 3LPPA 4PJFB 4XR8C 32C2B 2WINA 5D71L 1JDDA 1WD9A 2VMCA 3OJVC 1RFDL 2VABB 2WZPD 4BSVA 3VI4F 1YO4A 4P5TB 3AWFA 4NNPH 5DD0L 2P5PA 1AZRA 3GTNA 3UABA 4MKMA 2K8MA 3N50A 1MI5E 3EUUA 4IKLA 4XMPH 5FYLD 1XR8A 2Z7WA 3OKEA 3BPNB 4S0HA 1YEFH 1QASA 1I7UA 3O4OB 4M8UA 3PP4H 3B7RL 1YA5A 4J2QA 4CMHB 2D9CA 1YQ2A 1MZYA 1DBKL 1RCYA 3BKMH 1B9KA 1WT5C 2A38A 4HJGB 4OQ1A 4JQIA 4QHUA 4WO4A 2Y7SA 5D72L 5FR3A 5DO2D 1AS8A 1CU4H 2HFEB 5GGUA 3ZE1F 5FO8A 3QZWA 4XP1H 3T4YB 5IJCC 4OQTL 5SWZB 4G8FA 2Z4QB 2FJFA 3DV4A 3ILQC 1E7VA 3MUY1 4CGUB 1KV7A 4KTEL 1ZT1B 5D7EA 2IG2H 5EZJB 4CVWA 4WGKA 1UYWL 1W0VB 3TL5A 4HLZH 4FG6C 3FNKA 3T65B 1DDTA 1KG0A 1WGOA 5H35A 1YNTA 1FO0B 1N70A 4FXKB 4N9GB 3D7PA 5IQLA 4LFHD 1EIBA 1JMZA 1I1YA 1HEHC 3X1GA 2V8MA 4TVSa 2VXSL 1UGNA 3JVGC 1JTPA 3WELA 3REWB 4L3ED 1XGTB 1XZ0A 1LWRA 5IMMB 3C9NA 4Y7MA 2XXMB 2GTZA 2A74C 4FQ2L 2ZUVA 4BUQA 4N28A 1WFNA 4OD3H 4PH8A 5D1ZI 3HAEH 4X99B 3B3BA 1FBIH 1FAIL 5DRWB 1A3ZA 1ZWIB 2JJSA 4LDLB 5GGQL 5IEKB 3BP4A 5C0GB 5C92A 3TCLB 3L1OL 1GMIA 1RH8A 4PJ7E 3ZVVA 2AKRA 2EDRA 4IU2A 1UUNA 3IVKB 1KCSL 4IEFB 1RERA 1NLDL 2H0EA 4OFIA 3A5VA 4W4OA 2E9GA 3B2UC 4KO6A 2WBJB 4MAZA 5K39B 2A0LC 3W1ZA 4JUTA 2YD5A 3RWIA 2L7JA 3AROA 1EEYB 1Q0YL 3BGMB 2G2RB 2QMJA 4PJEF 3RX8A 1AQHA 1TQUA 4KKCC 3JV0A 4GG6A 5HYJD 1Q72H 1HIML 2J5WA 1BMGA 2ZAHA 5F3HA 4EZKA 1HL8A 3D2UA 3EGXA 3O4LB 5IB3B 4RMSA 2GJPA 4KOBA 3V95A 4NKDA 1HXMB 3S8WA 4P06A 2EYRB 2BVEA 4Q0XL 5KSUB 1F8TL 2J88H 4UUJA 5HVFB 3T8VA 1FL5A 3QR0A 1OSPH 4R7DA 5FXCH 3NZHH 4WVRA 3GHEH 1BREA 3HNTH 1DVFC 5EF2A 4HJUA 2WXKA 2CR6A 4ZSOE 4OV5B 1E5CA 1Z1WA 2AJVH 5DO2C 4YGAB 3KPRB 3OMIB 4YXLH 1PNDA 1MCWM 3OHXB 2ZOTA 4F5CE 2XICA 3G5YA 4OAWB 2DWEB 5C0DA 3O0LA 1YMMB 2H26B 5SWQB 3F04A 4OZHA 3VGAC 4ADJA 5JQHC 2RAMA 4X6EB 4KKPA 1FIGH 3DROA 4UMGA 7PCYA 1IGFL 2O93L 1ZTXE 4FFZH 4AGOA 1ONQB 2ZWKA 3VYPA 4NQDA 3EJSA 2DYPD 1YUHB 2QKIC 3JWDH 2OSXA 1AY1H 2BRRL 5DD0H 5BMFL 1VJSA 4F1SA 5C0IA 5J57B 1JZ6A 2V3EA 5F0MB 2Q10A 3FHQA 3ZL1A 4AIZB 3NCFB 1BD2A 4H44C 1G5GA 4R5TA 2PXYC 4AEHL 4WCYL 3DBXA 3SKNA 3UDWC 3HLKA 2NTFB 1XCQB 4C59B 4BH7A 4GSQA 4PJGA 4KWUA 4RAVA 3CMOL 1SMDA 4HHWA 5C0AA 5F7HA 3D87B 4YNYB 4AVHA 2E9IA 5C0CA 3P77A 5AKRA 1BOYA 4XMKL 4I0PB 1BF2A 2G5UA 2Y7MA 3HE6D 4Q14A 4IRJD 4LHUD 2D7TH 4Y9GA 3KLDA 1NDMA 1LLAA 5T1LB 4EJ1C 1NM9A 3HEIB 1UYWH 1MKFA 1L0XA 3ZZLA 1SN0A 1C9SA 1U58A 2WLLB 1I1AA 3ZIMA 2W8CA 3AXLA 2QELA 1XAUA 5D2LB 3VRIA 1NGZA 3WFBL 4JRXA 2NMSA 5L2KE 2E7DA 4D94A 3JTBA 3P0VL