2I7OA

Structure of re(4,7-dimethyl-phen)(thr124his)(lys122trp)(his83gln)azcu(ii), a rhenium modified azurin mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Tryptophan-accelerated electron flow through proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i7oA00
2IDTA 4YSOA 1NWOA 5B7MA 2Y1AA 2JXMA 3NT0A 4GP4B 4BDVA 4L0PB 1KDJA 1GS8A 1E65A 1GR7A 2EIJB 3T71A 3ZIYA 1BQRA 4DP8X 4P5RA 4Q89A 2YAQA 1PY0A 4W1TA 4YSTA 3TBBA 1SNRA 2YQBA 2GBAA 2PPFA 2J55A 4AKPA 3WG7B 2UXVA 3FSVA 1A4CA 3AG3B 1VLXA 1IBZA 2FT8A 9PCYA 4UANA 1J9TA 2YXWA 1I53A 1GS7A 4GP8B 4YSDA 2WSDA 1CC3A 3DTUB 4A2FA 4AI7A 1AR1B 2ZWNA 1GY2A 2X88A 2H5UA 2CUAA 2PPDA 4GP5B 2XWZA 1TEFA 3MBWB 3GYRA 3TU6A 2WO2B 3ABKB 2VSKB 2IH8A 2AANA 2MTAA 4A68A 2AZAA 1SDDA 3BQVA 1JERA 1MG3C 4Q8BA 3NSYA 3AG1B 4N8UA 2XVBA 4G7RB 1ASPA 3V9EA 2FT6A 4YSAA 3WNJA 1EHKB 3FU7B 1WS7A 2PPAA 2BZ7A 3T6ZA 2HX9A 5I6MA 1JXDA 1AIZA 2I7OA 2YARA 3FU7A 1EZLA 4JHUA 2FQEA 1PZAA 1E5YA 4FA7B 3FQ2A 4A2DA 7PCYA 2GB2A 1JZFA 3ASOB 1JXGA 2FQDA 3S8FB 1CUOA 1HAWA 3EH4B 3OQRA 1MZZA 3WIAA 1OE2A 4E9XA 4HCGA 5B7EA 1ZDSA 3NJIA 1X9RA 1AZCA 3NJGA 1ASQA 2CJ3A 1A4AA 1BYPA 1MG2C 3CVCA 1MZYA 1TKWA 2VW6A 2IDFA 2Y69B 2IWKA 2YAHA 1CURA 1NPJA 4DP0X 4K9JA 4EF3A 1JVOA 1BXAA 1J9QA 4RH4A 3JTBA 4CSPA 4YSPA 1IBYA 1GYCA 1KDIA 3X2QB 2B08A 3BVDB 4A2EA 5IY5B 1BAWA 4KOBA 4DP9X 1IKOP 2ZONA 3NJNA 5PAZA 1NIFA 4DP4X 2PP9A 1A4BA 2UXGA 2X87A 3WKPA 1XB8A 3N2JA 1SHXA 2BP8B 1L9QA 1BQ5A 1ET5A 1KBWA 2B3IA 2EINB 2BP8A 1J5CA 3IEAA 1GS6X 4TXVB 3AG4B 4JKNA 5B1JA 2CBPA 2FQGA 5TK4A 3FPYA 2HX8A 4KO6A 3X1EA 1OOWA 1XMEB 3EF4A 3PPSA 4F2EA 2ZOOA 2HRGA 4BWWA 1AOZA 6PAZA 1L9PA 2UX6A 3NJJA 2BZCA 1ZDQA 4NERA 2UXTA 2CCWA 4NB7A 4PCYA 1AZRA 1IUZA 1A3ZA 5B1BB 3S3DB 2RACA 2DV6A 4HALA 1ZIBA 1NIEA 1URIA 2EIKB 2W88A 3PAVA 4G70B 2W8CA 1AAJA 3OM3B 5EHFA 2TSBA 3ABLB 1ID2A 1NIAA 1XB6A 2IDQA 1JZEA 2YXVA 4BDVB 4E9VA 1HFUA 3ZX1A 3DKHA 3PXLA 5I6KA 2CALA 1BQKA 1GW0A 5PCYA 2HLEB 1NWPA 2VM3A 1AACA 2VMJA 1AG6A 2YAEA 3FYIB 2BWIA 1FWXA 2A3TA 3DIVA 1PAZA 2H3XC 2UX7A 4MFHA 5B1KA 2FTAA 2XLLA 3EH5B 4E9TA 2WO3B 1PZCA 3FU8A 3IN0A 1B3IA 1JZIA 2YAFA 4KO9A 3S3CB 1WA2X 1OCRB 5AKRA 2PLTA 3CDZB 2I85A 4KNSA 4HHGA 3L45A 1PNCA 3CDZA 1XB3A 3CZUB 4YL4A 2BW5A 3PAZA 4G7QB 5I6LA 3CVDA 4KO7A 1AZNA 2IH9A 4HCFA 1JXFA 2PCFA 1OF0A 4GXFA 4DP6X 3H56A 3FS9A 3OMAB 1L9OA 4X4KA 1MDAA 4G72B 1PLAA 1L9TA 1ZV2A 5FC9A 1JVLA 2AZUA 1JZGA 3QJTB 1PF3A 5D4IA 1SDDB 3OMIB 2QT6A 3IE9A 1SF5A 1PCSA 3H4HA 3S3BB 4BXVA 1QHQA 1OCCB 1OE3A 2IDSA 1R1CA 1ILUA 2HXAA 2OCCB 3T6XA 3AY2A 3FSAA 4DP1X 4F2FA 4NAJA 4YSRA 1ILSA 1PLBA 1ASOA 2HZHA 2VSMB 1SF3A 4WTQA 2Q5BA 1M57B 3C75A 3FYEB 1M56B 2XUWA 3AZUA 5E9NA 3NJLA 7PAZA 4P5SA 5TK2A 4BWUA 1HAUA 1BXUA 3ABMB 5I6OA 2BO0A 2FT7A 1UATA 1PMYA 4GYBA 1NPNA 1KGYE 3UAEA 5I6NA 2YAMA 3D12B 1OE1A 2GSMB 1AZUA 2J5WA 1X9UA 1NZRA 2DY2A 1NICA 4G7SB 3NJKA 3X1FA 2UXFA 2QDVA 4M3HA 1NTDA 1PNDA 3NJFA 4E9WA 3G5WA 3NYKA 4BK5C 4CSZA 4PAZA 5I28A 2FNWA 1J9SA 2XX1A 2XV2A 5I6PA 1ET7A 1RKRA 4FAAB 8PAZA 3PAUA 3EH3B 3QJSB 2IAAC 1T5KA 1TU2A 2MRYA 3FQYA 2YAPA 5AZUA 3CVBA 4ZK8A 3SBPA 3PLYA 2GIMA 3WI9A 1JZJA 5B7FA 1DYZA 2VM4A 3T9WA 1TEGA 3ASNB 3UABA 1KV7A 2IDUA 4DP2X 5B1AB 2FWLB 3SBRA 3NSDA 1E30A 3UAAA 2BP0B 1N68A 1J5DA 5LDUA 1KCBA 1RZQA 1ZIAA 4E9SA 4E9QA 2BP0A 2GC7C 1WAEA 1WA0X 4UF7C 2XX0A 4DPAX 4YVNA 4A67A 1SFHA 3X1BA 4DP7X 4W9ZA 2OV0A 2AVFA 2I7SA 2VW7A 3N55A 1V54B 2ZXWB 3T6WA 4DPBX 2P80D 1CYXA 1ADWA 3WNIA 3QJQB 1GSKA 4QKTA 4YSEA 5I5IA 1L9SA 1E67A 1YLBB 3KW8A 2QDWA 1BYOA 5D4HA 4WKXA 4E9YA 3GDCA 3HEIB 4KOCA 3GXUB 5ANHA 2GHZA 1BXVA 2JFCA 4GY4A 4AZUA 1SJMA 2VN3A 2YAOA 1V10A 3AW5A 1RCYA 2E86A 4HHWA 3CG8A 1FA4A 3FT0A 3KW7A 4HZ1A 3NSCA 1JOIA 4KO5A 4G71B 1E5ZA 3X1GA 3TA4D 1M9WA 2NRDA 2LLNA 2XXGA 2GI0A 2DYSB 3FQ1A 1WS8A 3NJHA 1AZBA 4YSSA 3AG2B 2EIMB 2R7EB 2XV3A 3UGEA 5AFAA 4AKOA 1NIDA 2BW4A 1NDTA 2R7EA 5I5MA 1W8EA 2JKWA 2DWTA 4DP5X 2HX7A 2FQFA 2IWEA 1ZPUA 2IWFA 2XXFA 3TBCA 2GC4C 3FPXA 3H4FA 3V9CA 4M4RB 1GY1A 4F7KA 4A2GA 3QJRB 1NINA 5B3SB 1ET8A 2TSAA 6PCYA 3MX0B 4KNTA 4KNUA 3FSZA 1SFDA 3QJVB 4YSUA 2P80A 1AS6A 4DPCX 4A66A 3SQRA 3T6VA 1F56A 2PP8A 2BHFA 2H47C 4HCIA 1A8ZA 1WA1X 5I26A 3ZBMA 1V55B 1NIBA 4ENZA 1AS8A 2EILB 3ZDWA 1OV8A 3U25A 4BWTA 2PPCA 3NP4A 2PCYA 5I5JA 2PPEA 2N0MA 1JZHA 1A65A 2XYBA 2VW4A 1KBVA 2OJ1A 3JT2A 1AANA 5F7AA 2QPDB 3QJUB 2Q9OA 5B1JC 3WKQA 2HRHA 1DZ0A 4E9RA 1KYAA 3NSFA 3RYMA 1QLEB 1J9RA 3NJMA 3OD3A 3UADA 1ETJA 3HB3B 3TASA 1RZPA 2J56A 3OMNB 1OCOB 3QPKA 3IBOA 1W6LA 4JHVA 4YVUA 1L9RA 2BWDA 4QLWA 4HIPA 3X1NA 3ERXA 2J57A 5A7EA 3FSWA 3EHBB 4UAHA 1AG0A 2AFNA 2DYRB 2XV0A 1FFTB 4AX3A 2XU9A 2FJSA 3QQXA 1N70A 2QPEB 1QNIA 3PCYA 4N4YB 1PZBA 3UACA 4A2HA 3FU9A 4YSQA 1OCZB 4HAKA 1AS7A 3NP3A 4YSCA 1BEXA 1AQ8A 3SBQA 2DWSA 5D4JA 3S8GB 5F7BA 4AKQA 1KCWA 4BXSV 1W6WA 2PP7A 3ABGA 1SHWA 1PLCA 1CYWA 3IN2A 1IC0A 2CAKA
chains in the Genus database with same CATH superfamily
1YYCA 3HKFA 1IBHA 2CGYA 2BZDA 1DLFH 4FQ2L 1GS8A 2R1XB 3B56A 3MLZL 4PHZA 3VX0A 5BV7B 3KPQA 5CKAA 1KGCD 5JOEA 4I4WA 1G9NH 4XPHL 1NFDF 3IXAB 4LE8A 4EBQH 5IV2B 1PY0A 4NZUL 1K8DA 4R6UA 1R17A 5C70A 3QXAA 1QQDA 3QCTH 3QWQB 2AEOA 4MRCA 4ZDHA 1VLXA 3MKKA 4OCWL 5IHUL 2P7TB 4X9HA 4BA0A 2C5DC 2Z91B 4J8RB 5CSZA 4DEWA 2G3MA 2ITFA 3OJDA 3OZKA 4I0CC 5HPMB 2D03H 4FCAA 4S2SB 2EVHA 1I53A 2VN6A 2AQQA 4FS0A 2COVD 1KIQB 3F7LA 3CHXA 1LL1A 3IRPX 3MFGB 2OSLA 4QXWA 2PCXA 4YSDA 4AUUA 4YX2H 4P4KC 5EG6C 2GK2A 1NOLA 3PV6B 5E1AA 4ES8A 1ZA6B 2H5UA 2ZP8A 4AGNA 2FEEI 3AAZA 1RP9A 4NQXA 1WV7T 3TU6A 2Z65C 3STLB 2WO2B 2EC9U 2V5TA 4DO5A 1TUPA 4BH8A 1YPZF 1A0QH 3MBWA 1FGVL 5HGBA 2CKBB 1OTTC 2Y6TE 4NBZB 3L9EA 4WW1B 2CMRL 4KKBD 4ZTOL 3C8KA 1MI5D 1ASPA 1E9PB 3RGVD 5LGKA 3VMOA 1DL7H 1H5BA 2BRRH 5I2IA 1F4HA 1IC1A 1WS7A 3DX4A 1MJUH 1DQJB 3D5OF 5C92A 3BHBB 3GSRB 1VRSA 2ROXA 3RIAK 1UVQB 3R0MA 3C60A 3V6ZB 2VXQL 2JJSA 2GSIA 4HG4K 4QUOA 1FNGB 4MD5B 1VACB 1BM3H 2YMXL 5JQIB 2A74B 1QBLL 3C5JB 2KQMA 4IJ3C 4UQDA 3L16A 3LS4H 4WSGA 5DFAA 4DVBA 4J3TA 3O9WD 1FORL 3AT8A 3TLRA 3DUUA 4KKQA 3TBTB 4NQED 4KK9C 1IFHH 2IWKA 1LMKA 2R2CA 3A0OA 5EUOF 4HLEA 4JG0H 4K9JA 4QRRD 2VZSA 1FP5A 5I18H 1BXAA 4LVNB 3WGUB 3O4LE 3AT9A 1WWCA 2ZPKH 3PJSA 4WTXA 3I9GL 5EIIA 3PF2A 3SKMB 3WNOA 4YGVB 4EDWH 2BY2A 3B2XA 3B43A 1QW8A 4AW4A 1BAWA 1U8MA 3SPVB 5I15L 5I8KL 2Y06H 3HE6A 3MLWL 2X1QA 4FJ6A 5HBBA 2PP9A 5DJAB 4WJ5B 2C9QA 1XB8A 5EU6D 1QVOA 4O2FA 3SOTA 5CD5C 1Q94B 2GT9A 1JFQL 4O02B 3SE4C 2MSPA 4Q6KA 4OT1L 1A6ZA 1UH3A 4NFCA 4EQ3A 1E27A 3D25B 4GSRA 4OLXL 2EABA 2WZ0A 4OB5L 1V8HA 2CCWA 1PG7X 3WSQL 5LAXB 1P4BH 1BD2E 3S3DB 1KSRA 1NIEA 3CZEA 5AKVA 3E7JA 1YAZA 5LGJB 5LGHL 1K4CA 5T33H 1JN6A 5DEFB 4M5ZL 5C3LD 1CL7H 4W4OC 1I7RA 4NCDA 1AXTL 1AZVA 4X9IA 1R19A 5HHOB 5JIDA 3BVTA 1FBIL 2FZ3B 4QJ4B 3F12A 5ITBH 2KC0A 1KIRA 4H8PA 2WTOA 2G60H 2CGRH 1BFTA 1J1PL 4X42A 5PCYA 1P0SE 1JNNH 2ALWA 4GG6B 4RGMC 4W9HC 5EO9B 5JW4Q 2XWBA 2ZYSA 2VDPL 2H26A 3GFUA 2H3XC 2UX7A 2IFFL 4PG2C 1F1GA 1RZIA 4S1RL 1QNZL 1NEPA 5T1MA 3VFWA 1DCLA 1Q0XL 3FONA 5CN3A 5E5MA 4HH9A 4YL4A 4M8QB 3H9ZA 2LTQC 4KO7A 3QDJB 3K46A 1A6UH 3EYVA 2R59A 1JSYA 1WD9A 3JVGA 5AKTA 5D6CB 2ZOLA 4OJAA 3HG5A 3PWVA 1P5VB 1DCEA 4U1LA 3B1UA 2WLKA 3N43F 5IVXE 3UTOA 4QHNB 4W6XB 3J7HA 3LXUX 4XP1H 1C08A 1KBBA 3CN2A 3KBPA 1CXFA 3TBSA 2C26A 1XIWC 1LO0H 1A7BA 4F2FA 1ORSB 1BZ9B 1DVUA 4E0RB 1P7QB 2FO1A 5T5FH 5I1HL 2FBJH 1BEYL 3BJ91 3LKNB 4M7JL 3K4ZA 1SF3A 4PW3A 1LWRA 4XCFH 3BMWA 3D0AA 1UA3A 2GJ6B 3D2UD 3FW6A 4H8QA 1JMXA 4KVNL 4J6RL 1HILA 5KW9H 3QDMD 3ZQWA 1KFAH 2JIXD 4JG5A 3UYRH 2C7FA 5CD3A 1AZUA 1PDKB 2YJLA 4FFYL 2E3VA 2CBOA 2DZEA 4A2LA 4U49A 4LDCA 4EZJA 1EVUA 1I1FB 4L1SA 3EJQA 3QXTA 4L8DA 3H0TA 5J89A 4PJIB 2IBZX 4AV4A 2GEEA 3SY0A 5BZDA 1G9MC 1K9TA 3VX1A 4CSZA 3TWYA 5E6IC 4IRJA 3EJYC 4MGXA 4CNIA 2XQYK 3HI5H 4MAUH 4IGBA 4X7TA 2UUDK 3H9HB 4DK5A 4GSDL 1BM7A 4U1JB 1ET7A 4RWYL 3UJIL 1N0XH 3FOMA 4MCYB 2AEPL 2HB0A 4DKDC 4U6HB 4YDIL 2WZ6A 3C6LB 1Y18B 2VIRB 4MCNA 1TU2A 3S9DB 4KXZI 1I7UB 2LAGB 5A1AA 1EAJA 4RZKA 4DAGL 3MACL 3FOLA 3P3TA 1FYTE 2AK4A 2DD8H 6FABH 2O26U 1BIIA 1URLA 3ME0A 1OP5H 2AEQH 4KJQD 1KV7A 3SGKC 2YD3A 1LEKA 4BSWA 1VAHA 4ZTPL 4ISVA 4QYAA 4G8GA 5HHPB 2B1HH 3DX3A 5ADOH 4L8BA 4J8QA 1E30A 1V3KA 3MZGB 1OSYA 4OKDA 4F8OA 4XN4A 3F62A 1VERA 3HAEH 4NJAL 3DC0A 4E9SA 2R1YA 3G6JA 1AHKA 1KY7A 4EDXA 1ED3B 2AKRB 3BIBX 4X6DB 4JZJA 3HS0A 4GSUA 4P5MB 4XPFL 3L4CA 4JFEB 3BO8A 4I5BA 2AVFA 3HZMB 3OV6A 3QULA 3UZEA 1BWMA 1KPUB 3LRKA 1XGTB 5KANG 4APQD 1L4IA 1ADWA 2HRPH 4FZ8H 4HFUH 4J28A 4MMZC 1FNFA 4DGUA 2VDMH 3EYOA 3TN0C 1WZLA 2P46B 3Q9QA 5HHME 4Z7QF 3D39B 2IH3A 1T0PB 4QT5A 3WN5C 1N59A 1ROCA 1SN5A 3LD8C 4PY7A 5T5NG 3NH7L 3HEIB 5T1KA 3L6FA 2P26A 4C4BA 4LIQE 1R0AH 2GHZA 3HN3A 1ND0B 3HLKA 4Y89A 2JFCA 4QMEA 3X13A 4BGDA 4HIXH 1V10A 4WSJA 2VISA 4F8QA 1U6AH 1JIBA 1WAAF 5D1XA 2V7HB 4PSPA 1RK0B 2QADC 5KYWB 3O6LH 1HHGB 3KW7A 3MRDA 4U1IA 1NC2D 4F2MA 1TQBC 1UZ8B 2YD0A 4PJDF 1L0XA 2Q76A 3X1GA 2X4PA 3RHWF 3OPUA 3ILDA 4QRQB 3LKRB 4XBEH 1SEQH 5D6DA 3HS9A 2L4OA 4KY1H 5DD5H 1AZBA 4Z0XB 4YFDB 4Z3HA 4GG8B 3UGEA 2IPTH 2R56H 1FSKB 5FUOL 1NDTA 1CXEA 3EBAA 5DHYB 1BA9A 2R2EA 5D1QE 4IU3B 4DP5X 2L7JA 2E46A 2WVUA 4NX0A 2CDFA 1D7BA 3S3PA 3CFMA 5HYSA 4HEMA 3CZNA 1IC7L 2Y7NA 1EH9A 4P9HC 3PXJA 2MQ3A 2VDLL 3QJRB 4PRNA 5IZ7A 4HC1H 3MLPA 1MLCB 2NXZC 3QO0A 4N8VB 3U6XS 4IS6A 4UILL 3VRJB 2VDOH 2HT3C 3T8MA 3MA7A 2YFOA 4XP9L 4AG4H 2RB8A 1DUZA 1QFWL 3I6KB 4JGUA 3VFUA 3CXDH 4K15A 3AC0A 5FGCB 3NIFB 3D7PA 3QIUD 5L7XL 4AEIL 4DZBA 4UAOB 2X38A 4Y2DC 3N91A 4AENA 5T3ZE 3LX9A 3IF1A 2WQAA 4FYTA 3V6OE 2D0GA 2O6EA 3A24A 1NIBA 3LPGA 1AS8A 5EIVA 2FWUA 4GSQA 1IAIH 4EZLA 4Y2OA 1IM3A 3KLDA 3MRCA 1Z5LA 5IB3A 1JGLH 2VN4A 4AQAA 4QAWA 4N2EA 1A65A 1CF8H 3P11H 5GS1C 1EUTA 3LN5B 1WFIA 4H25B 2CO7A 4PJAA 2F61A 1IGIL 2P1YA 2R0WL 1D6VH 3TO2B 5CWSA 4UOW1 5BS0D 1T21A 2ZUSA 2VDKL 2BXYA 4J7RA 3C09B 5DJ0A 1HVXA 1E5BA 3QDJD 3UC2A 2GEQA 3BVXA 1SM3H 1E8XA 4JO3L 4MD0B 1UA7A 1AP2B 3C5SB 3D09A 1NMAL 3ZQ9A 2WJ7A 4XVSL 1UB5B 3NCBB 4O4YL 1CG9A 4NQCA 2YC1A 3DX6A 5C3TA 1DJIA 3UTPD 4RETB 1QLEH 5ALCL 4JHVA 3UEQA 2C8NA 1L9RA 2ZD0A 4HAFA 2CR0A 4Q9QH 1DN0B 1FHGA 1JNLH 3MU3A 3INUL 4UAHA 2AFNA 4S0SD 1OSZB 5CGTA 1C8QA 4DKAA 2OI9C 1A7PH 5GS0L 3P0VH 5IHZB 1ZA3B 3CVHA 1P7QD 3MN8A 4LLQB 4UV7L 1NCAL 3EJSA 3IT8D 5CGYD 1QSEB 4HDIB 4YDKH 4G3YL 1AR2A 2YPLE 2VLLA 3EFFA 1RERA 3FU9A 4F58L 2Z92A 3NESA 4HIHB 4ONHA 1FNAA 4F8PA 1JWUA 3X3GH 4WWKC 1NLBH 4BKTC 5GXBB 3GO1H 5KSBA 4Z76A 2AERT 5EO0A 2H1XA 3FRPG 4L0YA 1UENA 1FDLL 3AITA 5AEAA 3RUGE 5C1MB 4E5XG 5B4MC 3KPQB 5CILL 3O4OC 4I4WB 2ICWJ 4HT1L 5LXGH 1QRNE 5GS2D 1K8DB 3MV9A 3QXAB 3BLPX 1QQDB 5AAMC 1O6SA 3P40A 3EJJX 4ZDHB 4PJ9C 4JZOA 3CCHA 1KELH 4LIQH 1KXTA 1KNOA 2MNUA 1F4WH 3OJDB 2KZBA 1V05A 2IF7A 4QO1A 1LE9B 3JT0A 2BVTA 4NP9A 2Y6SD 3D4ZA 1BQHG 1PY4A 1DR9A 4J27A 3C6LD 3UC0L 3RIAF 4Q56A 1CC3A 4PSRA 2WXLA 1OSEA 2VYRE 5E1AB 1XF5B 4LLUA 2EVJA 3AAZB 5BRZB 4NQXB 4IK7A 4ALAH 1XHHA 1OALA 4AVIA 1E2WA 4BH8B 1XD0A 5HGBB 2HJKB 3MBWB 3V8CA 2VJ0A 1EFQA 2MKLC 3CQQA 1CS6A 3C8KB 2ADGA 4X4MA 2WIIA 5AB1A 2Y23A 2GABA 1RXLA 1WIUA 1HWWA 3NFSH 4OF0A 1KLGA 3ASWA 1MCEA 3BT2L 2ROYA 3LRSA 4HXBL 2UZIL 2XVBA 4CA4A 1H5BB 3F2LA 3FUFA 5FV1L 5I2IB 2RMNA 2A9NH 1G6RL 3H85A 1INDH 1CFVH 3BGMA 4A63A 3U9WA 3R1GH 2BVYA 5D7LE 4FLRA 4RGND 5IBLC 2A9ML 2ZT9C 2BHYA 4FFWC 4HIQA 1R24A 4LF3A 3BXNA 4PBWD 5IB1A 4N26A 3IGAA 5FXCH 3DGGA 3QDGD 5GQBA 4XN9A 5D2NC 1FE8H 1S4IA 1MHPH 3LJ3A 4DVBB 4BFKA 3WNMA 3PIQA 2G5BA 2X1OA 3OHXA 4LCIL 3DUUB 5A2JH 5I9QC 4S0HA 5E2VL 1WGOA 2PN5A 1BYPA 2IEPA 3MQIA 4GAGL 4PLJC 5F7DA 2H0JA 1UOVA 5KVFL 4OZFG 1KEGL 5GS3A 5T3ZH 3PJSB 3V4VL 3QJFA 5EIIB 2LFGA 1LO5A 5FFGA 6CGTA 3ZE2B 1T2QL 1JRHI 4WI8A 2CDEB 2DM4A 4HWBL 1U8MB 4M6AA 5F7LB 3HE6B 2WOBA 1L6XA 2B08A 3KAAA 3PS6A 4YHLH 1DVXA 1GVIA 3MOBL 4UV4L 1NIFA 1TQCC 1SYSB 1YN6B 2GT9B 1RZFL 4JO1L 1WBXA 4N90D 2EACA 1ET5A 1WITA 2B4CH 2B8OT 2PETA 1LO2L 3J07A 3VGBA 1A6ZB 1INEH 1E27B 3EDEA 5IQLA 5TQ2L 3V4PL 4MDRA 3FPYA 4PCTA 4ATTA 1GRWA 2UX6A 3SE9H 3U4EA 2JJTA 3HHRB 5EORH 3JYCA 4FL4C 3RB5A 2YA1A 4OCSH 4K7PY 2EZ0D 5D7IF 1ZIBA 3KXFE 5F1OB 4MKMA 1F5WA 3QRGH 1JN6B 5CFAA 1L6PA 4JO4H 4MXWH 2W8CA 4QHPA 4UTBA 4EZKA 3H42H 2BS8A 2VZVA 3GIZL 3RIFK 3CXFA 1ZEAH 4XT1C 2M8XA 2XN2A 5FUZL 3Q8AA 1KIRB 1USQA 4OUUA 3GHBL 5HJBA 4U6VH 1EGJA 1T7VA 3DKHA 1MLBA 2DLTA 1CTOA 1ACXA 3HUJA 4JFZL 2CALA 2R0KL 1BQKA 2XWBB 3SQOH 2H26B 2YAEA 4NP4L 3LXBA 4B9YA 2ZCHL 1JD9A 4JPWL 1FL5B 1MJ7L 1MWAH 1S9YA 4MZ3A 2DF3A 4N0CD 3BJLA 4AWJC 1RZIB 3GMPA 4KI5E 3IMVA 1A1NA 3WDHA 4POUB 2WKOA 1N18A 1B3IA 3S3CB 4ABWA 3I9PA 3FONB 1G7LA 3FCGA 3P73A 5E5MB 4HH9B 1S3KL 2OA9A 3OXSA 3ZE0E 4JB9L 1B88A 2X3AA 3BDXA 3SB3A 1PLGH 3Q2CA 3M1CA 4DEPB 4F15C 3EYVB 4Y4HD 3VWKA 1OPOA 3BD5A 3E3QC 3PAZA 5D72H 4ZRGA 1OAUH 4Z7NB 1LK3H 3TV8A 2C3WA 4B9IA 2ZOLB 3VWJC 3PWVB 4U1LB 2WWKT 2AJYH 1MRDL 1QI5A 4LLYA 4S0TD 4HCRL 2DQFA 3T0WA 1I75A 2ZAIA 5JORB 1C08B 1SDDB 3MCKA 4XGZA 2HKFH 4FKKA 5SX5K 1X5HA 2PW2A 4BFRA 3TBSB 2ITCA 4H1LA 4NO3A 2FEDC 2IAND 4MB1A 1OE3A 5KOVC 2EDOA 4ODVL 3V6BR 4RRPA 4ZFGL 3RTQC 4OFPA 4X6CF 1PEWA 4MAYC 3LEYH 3QHFH 1G43A 4YSRA 2AXJA 1GOHA 3S35X 1ACZA 2VR6A 1ZLVK 2G9HA 2QKIC 2NY6B 3FCSA 4P2AA 1PS3A 4GLRH 1BMWA 2L8AA 1HILB 3N40P 3NJLA 5B38A 1HOEA 4N5ED 1Q72L 4LAQH 5DJ8A 1UWEL 5CD3B 1OAKH 1UATA 2ENPA 3CFTA 3VACA 5T1JA 3DRQA 4QPEA 3DETD 3MROA 1L5GB 2FLMA 3BIKB 3WCYA 1JL8A 3RY6C 1A25A 1G6RA 3QDAA 4M7KL 1YMHA 5TPWL 1KJ2H 1UKTA 4L8DB 3H0TB 3A6OA 4GXUM 2Y5EA 3KBFA 3HG1E 3SY0B 4NOBA 2V8MA 1P7HL 4YE4H 2ZOKA 2FJFB 4CNIB 5K9OA 4G1MA 4IGBB 1WYJA 3NSJA 5A2KH 3RWJA 2ZUYA 4OGXL 4KITB 2CM5A 1EDQA 3VD9A 3FOMB 4PJFA 3SDXE 4CU7A 1SBSH 1WIPA 2WLZA 4WK2B 3H2WA 2X2JA 3G6DL 3N1GC 4FFZL 5SWSA 5CF3A 3DJ9A 2ZX9A 2OP4L 4WCYH 1TU2B 4FAAB 2FSEA 1AH1A 3KLHD 1MW0A 1VPOL 1VZGA 1PZDA 4TQIA 5K5YA 3FOLB 3MJ8A 2AK4B 2LFEA 1BIIB 5TF0A 1JZJA 3ME0B 5J9PA 2O93L 2HFFA 1LEKB 4BSWB 3U48A 4ISVB 4G8GB 1PG7H 2XWTA 2WN2A 4L8BB 2IDUA 5I0DA 1I3RA 2YLKA 4HWBA 4EUPA 1ZV9A 4G7VH 5BRZD 4FG6D 3ARVA 3B1TA 5ALBH 1AFVH 2ADFH 4IW4C 2R1YB 3G6JB 3ZUCA 5AAPA 3S6CA 4ZFQA 3QAQA 2CDGA 2KBGA 3UJJH 4OGYL 4R26L 2P43B 3HS0B 4JZJB 3TGXA 5CEZD 2EUVA 1RPKA 1CE6A 5F6IC 3BO8B 4I5BB 4S1DC 2OL3L 3QULB 3ZDZF 3SE4A 1UT9A 2I27N 4TLTA 5DWUH 2NX5A 1C7TA 1MFUA 3EO0A 4NGHH 4DPBX 2P80D 1DBBL 1X5JA 3EYOB 3RX7A 4IIQC 5EZLA 5C0EB 2IH3B 2KYIA 4WRLA 4QT5B 4P2QD 1NH6A 2Q87A 1N59B 1L9SA 3BDYH 3PHOA 1FFOA 1WJ3A 3L6FB 2NY0D 4ZMZA 4K07A 5J13B 3X13B 4ZAKD 5DTFA 5EWIH 2BJML 2J1ZA 2EDQA 3ES6B 1JPTH 3Q5OA 5DJCA 4KMLB 4LCUA 2VISB 3FTSA 5D1XB 3ULAB 4U1IB 1T4WA 1ZVHA 4F2MB 3M6DA 4HZ1A 1R5IB 3JWNE 2XTJB 2YZ8A 2QQQA 4KO5A 4FNTA 3VFOA 3TURA 4ZMQA 3AU1A 4HUUA 3GJEA 1YNLH 4L4TB 1T7XA 2VZ3A 5DHDA 3IVKA 4KJWC 4OIIH 3L17A 5I82A 1SZNA 4H0IA 2JQAA 1T5XA 1UWGH 2YUVA 4FYQA 2YGVA 1CD9B 2R2EB 3RGHA 1FC1A 4KVPA 3D3VD 4E42A 4DUXA 1CTNA 2CDFB 5HYSB 3JWOH 1MRFH 1A6WL 3L95A 1JDCA 2H45A 5EOCJ 3H4FA 1GY1A 3QO0B 5AYUL 5IB2A 4IS6B 3MA7B 2WZAA 4J23A 5L2KD 2P24B 4BFFA 1DUZB 2JKJA 4FFTA 4PHXA 4DVRH 5LUMA 2R2BA 2TSAA 1CCZA 3D4YA 1XIWA 4KX9A 1NGQH 3VGHA 2WXJA 1SVZA 1IEHA 4DZBB 1DLHA 3QEUA 4ZUTB 4AENB 2G0KA 3SHSA 3S5LG 5DXWA 2K4WA 3EOAB 2QJDA 5I8EA 3IF1B 2DEYX 2NUTA 5AVQB 5GRWA 1AGDA 1GMIA 5A6IA 2YD5A 2YA2A 4Y2OB 1IM3B 3MRCB 5I26A 1Z5LB 4S1QL 5IB3B 3VSTA 2IOMA 2Z31C 5T8IA 4OKVA 4X8XA 12E8L 1T3FA 4G8EA 4X0KA 1ZJBA 1DBMH 2CO7B 2VZ1A 4PJAB 4XN7A 3EO9L 2IQ9L 3CN1A 4IBTA 2C4FU 1GPOH 5JQ6L 4NI3A 3VXTA 3JT2A 1T21B 1HK6A 1AANA 4WEMB 5F96H 5DJ0B 4ECNA 4IDJL 5K9JH 5F6HJ 3MJ9A 4JFFA 2OAAA 2CD0A 4JVPA 2EKSA 4J3SA 4OLUH 1HHHA 5GRZA 4XMLH 1SMAA 3TF4A 5E6IA 3TNNA 1KYAA 3JWDH 4GQPH 2Y07L 3AACA 4AITA 1CG9B 2SEBA 4TF4A 2B20A 2YC1B 4NQCB 1UQSA 2C9VA 5F9OH 5K93A 5GIRA 3TJHD 5I75B 2C3HA 1XWVA 4NDMA 4Z7WA 2OZ4L 3VI3F 3TA3C 1KPRA 4FQCH 5ISZA 4YEEA 1SMDA 3OLIA 3K2MC 1GKEA 3KYOA 4AV5A 7FABL 2DW5A 4Y16C 4MHHI 3DDFA 3CVHB 3V5HA 5EOCH 1JV2A 5F7KC 2B16A 1H8SA 5IEKA 4UOJA 4QNPF 3NTCL 2JB5H 3PCYA 3EFFB 1FGNL 1G7QB 3DI2B 2Z92B 4ONHB 1JWUB 2R4RH 1HH9A 4K9EH 4F9LC 1L3NA 5KSBB 1TTBA 5CCKH 4MJIE 4MD4B 1A7OH 5EO0B 2VLME 3KLQA 5F1IA 1JPSH 2X09A 3Q05A 1ZHBA 3IJEA 3OAYH 2OSYA 1J86A 3C6SB 3TTSA 3QWOA 5KS9B 5MI0C 4HD9A 1IGJA 3TFKC 4FNLH 1XH0A 5DFTA 3POHA 1RZ8B 3DOIA 5EB9A 2E9WA 4XTRD 2IBBA 5E5UB 1NFAA 1S7WA 2O5XL 4NPJA 4KRPD 5E00A 4PM1A 4JZOB 3MNVA 3CCHB 3PG2A 1SNRA 3WN5A 4JL1A 1KNOB 1E7VA 1OTUD 2NXYC 4POZC 4BEIA 4QO1B 2EXYC 2FRGP 1BZEA 3QI9A 2Z8WC 2K6ZA 2HTKD 2VUKA 4H26B 2XJLA 4XNXL 1E6OH 3DIDA 5F93C 2E7CA 1WWBX 4LOUD 2YXWA 1JDDA 4LLUB 1QHOA 2OTPA 2Y7LA 3JWNH 2OQJA 1QP1A 1KYDA 1B2WL 5F0MB 2IBZY 3SDDD 2R69A 1MCNA 3CXHJ 2EICA 2ADGB 3K5SA 2WIIB 3IU3B 4E41D 3V7MA 1MIEH 2E7BA 3EAKA 4WFGD 2Y25A 15C8L 2JELH 4XCEB 3O8XC 1AJ7H 1A2YA 1U3HC 3QT2A 3OJVC 4Q8BA 3OF6D 4XN1A 1BMGA 2HT4C 5HVWA 1N5YL 3BGMB 3NA9H 4M00A 2GHWB 3QIBA 2YKLH 5CR1A 4EPSA 2GQHA 2CKBH 3AADB 1QABA 4YXKL 2VSDA 1QMUA 3FU7A 2YARA 2W95A 5CMAA 4ODSL 1R24B 4LF3B 4AC4A 3BXNB 5IB1B 1M6UA 5DD3H 3IGAB 3UPRB 3HE7D 1QBBA 1UCTA 3QAZB 4YDNA 5DEGA 3RA7L 4XAKE 4LQFH 3AU0A 3PDDA 4M5YL 1U33A 4MA8L 1E8ZA 2EO9A 3PIQB 2G5BB 1BOYA 1YEJH 3OHXB 4F5CE 4PJIE 2YSSA 4QRAA 5F7DB 5D1ZI 5E8DL 1BDYA 5AVXB 2PYFA 1GGUA 5MENA 1TSRA 2VDNH 3GSNA 2IDFA 3QJFB 2NY7L 3EXJA 3UFIA 3TVMD 5ICZA 3AUVA 5SWQA 1BECA 3BZDA 4GBXD 3DXAA 5MP6L 1XH3A 1FL3B 4DKTA 4HULB 3KYKH 3BAKA 3K0WA 4NWTL 4XXCC 1GAFL 3KVQA 5GPRA 4C83A 2Y5QA 5M7QA 2X2HA 3ZKMC 1WBXB 5E8OA 3RIFF 3EUUA 2UXGA 5GS1A 4BUGA 3LKQA 4RMSA 4L4TD 3ZTNL 1KBWA 1CGSH 4YEFA 4NBYB 1PZSA 1GS6X 3BSZL 5D1QD 3ECUA 2WOYA 1XMWA 3RFZC 3C5XA 4X6BB 3VTAA 4HJ0C 4RSVA 4NN5C 5I71B 1L9PA 3LZFH 3QUZC 3IMUA 3DX0A 1HWGB 4KFZC 4L5FL 3LEVL 5HTSA 4O02H 1FO0A 2VMCA 2C9SA 2WSKA 4D9QD 4JFDA 2NNAA 4M8RA 4I1RA 3N9GH 2VAAA 2GTQA 4W9IC 2X89A 3I9IA 1BXXA 3WUWB 4W9LC 4L0ZA 1ID2A 1TPXB 1B2YA 2WD0A 3L1EA 5IW3A 2IDQA 1MLBB 3HUJB 3WNNA 5MEOA 3WTTA 4P2OD 5AOIA 4OM0L 4RVBA 2IAMA 3N50A 4ZMNA 5F3BA 2ADIA 4PJ8A 1I9IL 3FYIB 3GMPB 4LSSH 4JHAL 4QHUA 2XA8L 1A1NB 2W92A 4M62L 3N1QC 4HUCA 3BKCH 5I19L 3CN0A 3ZJAA 4Y7OC 1P84J 1G7LB 3P73B 1F8TH 4RA0C 3S2AA 4Y1AE 2WQVA 2Z64C 3ZKND 1RUPH 3S37L 4YUEL 1X5FA 4G6ML 3CZUB 3M7OA 4G7QB 5TF1H 2Y1VA 4LCWA 1HSBA 4LPTA 1RIHL 2X4NA 2V3FA 3CMOL 4JM2F 2DQFB 3RWDA 3V79C 3DV4B 1CFBA 4HV8B 4NI6A 4TSAL 3MCKB 4EOWL 3IDMA 1PLAA 5AAMA 2JB6A 1ADQL 4QCIB 4ZOEA 2PW2B 4Q7DA 2ITCB 5EBLA 4H1LB 3VGAC 4NO3B 3N5AA 2WB1A 1PZ5A 1SXAA 3VRLE 1KBGH 3GXFA 2XWDA 3KPMA 2CO6A 5E99L 1JHLL 3GNML 1COBA 2NY2B 1OCCB 4GIPD 2D7NA 1IAMA 2NDGA 2OCCB 4OGAC 4ZFZA 1KCSL 1B4JH 4DP1X 2G9HB 4OLWH 1UG9A 2YHGA 5TE7L 2YPLD 4BQCA 5B38B 3VI4E 5DJ8B 3UBGA 5CNHA 5TK2A 4GMTL 5IBUG 3ARBD 3DIFA 3DRQB 1FG9C 2OTUA 3NIFE 5FGCE 2VR7A 1AHWC 4KROD 3MROB 4TN9A 1ODAA 2YWYA 2VSCA 1YMHB 4QRPE 5IJKA 2A83A 1J0YA 4HS6A 4PGEA 4K5MA 5E56A 5B39A 5EF0A 1HC1A 2MCMA 1TVHA 4Z7VF 2ZOKB 1QRND 5K9OB 4G1MB 3O0LA 5FA3A 3S88H 2LW3A 5AOZA 3EJZD 4FQXC 1JGUL 3RWJB 1X5KA 3A4FA 3FBQA 2ZSVA 4PJFB 3QIWD 4J3OD 3MVSA 5SWSB 3QZNA 3TZVC 1J9SA 3ARUA 1TJGL 1S9KC 1LP9A 2FSEB 2YGPA 2VN7A 1SJHA 4FERA 3BAWA 4ONFL 3LNHA 4BZ1H 2WUCH 3MJ8B 1RULH 5J9PB 1RUAH 3P3YA 2HFFB 4GW4A 3VG9C 1F6FB 3HG3A 3QWRD 2XWTB 3DX8A 4G8FA 3ZOAA 1I3RB 2WBXA 3O2DL 4EUPB 1CDUA 2WPGA 5HHVH 3I6GB 1KEMH 3L4WA 2DBJA 2WYTA 4HKJA 5JUEL 5GS0C 5CS7A 3QA3A 3G5XA 4F1ZA 2CDGB 5HYIA 1LE5A 5IJCC 3M88A 3RPKA 2W07A 4WI3A 4R8WL 3F83A 5ACMA 1CE6B 1HL5A 3OLDA 1BAFH 3TT3L 3L13A 3KLSA 5L6YH 3RNKA 1QSEE 5HDQL 1OIOA 1CLVA 4G6AD 4JGMA 4Q52A 3WFEL 1EV2E 2Q0ZX 4Z8FH 3EO0B 1OB1A 3KLAA 1JCKA 4R7DA 3ZDYF 1Q1JH 2K9FB 1JTPA 2VQ4A 3T6WA 2I24N 4LSQH 4N2CA 3PHOB 3THMH 5IBTH 5IT2L 1IT9H 2V5SA 3FH7A 3KW8A 2VABA 5HI4D 2QSCL 4N2AA 5DTFB 1UCBH 1CLOH 5DJCB 3QNZA 2WWNA 1PD0A 2EVIA 4QGTA 4NO0D 3UBXA 2N1KA 4AYSA 2MQCA 4LEBA 2D0HA 1A3RH 3ATDA 1A8JH 4HISA 2Q86A 4K94L 3FN0H 3R06A 4CSSA 1VCBC 4AH2A 5TD4A 1QWUA 3HIZA 3VFOB 5FO9A 4ZZFA 1G4MA 1QR1A 3AU1B 4HUUB 2X9WA 3GJEB 2X0VA 5C07A 3MLRH 3TA4D 3B8SA 1OHZA 1GC1H 3RWHA 3IVKB 3WV0A 2F5AL 3SKJL 2SODB 3HCVB 3K8LA 3LRHA 1IAII 4Y4KC 1T5XB 3QEHA 4OD2A 3ZUNC 1J1XL 2LTQB 4Y7MA 4C47A 1F4YL 5A2CA 5J3HD 4E42B 3DO3A 3HG4A 4LPVA 3L5HA 1TITA 4Z95H 4NM8L 1FJ1A 1P9MC 1TR7A 3ULUE 2V5YA 3L95B 2NNFA 3EHBD 4IKIA 3Q2NA 1QSFE 5I1EH 4ZW8A 2XXFA 2H6OA 1JXKA 4GKNA 1CFNA 2J1YA 5AG9A 4F7KA 1CDIA 1P4IH 2R2BB 2X6BA 4UQCA 5D71L 1LJMA 1XIWB 2I60L 4C58B 1WP6A 2B14A 3UTZA 4UZGA 2WZ5A 3QEUB 3IM1A 3ARDC 3LRMA 2NQ3A 5CJOL 1PZ3A 3H2PA 4MAYA 2Q8AH 1RPUA 4KNTA 3QJVB 3BE1L 3QUXA 2NUTB 3OKMA 1AGDB 1AS6A 4MQ7A 5HP5A 2PP8A 1UACL 3T2NH 4JR9L 4OKVB 3ZBMA 1V55B 1FQ9C 1T3FB 4G8EB 3DVIA 4X0KB 5K59F 4XN5A 3NDYE 3T0EC 1L0PA 2NNXA 2ID5A 3FFDA 5H37H 3VXTB 3BYTA 3WE1A 3RY6A 2XWRA 2F58L 4P46A 5EU4A 1RZJL 3DSNA 3NN8A 3ULVE 1DTUA 2H41A 4JFFB 4WK4B 4I1PA 2EKSB 4JN2A 1HHHB 4KJYA 2V9QA 5E6IB 3WKQA 4ZMLA 2MOQA 3AS3A 3KWWA 3QUMA 4AGLA 5GRVL 3WEXA 5CU5A 4E9RA 1T0OA 3CFEA 2Q7YA 5IF0A 3MLSH 4XP6H 1KCLA 1B6DA 3U6XA 1UQSB 5I1LA 3FHAA 5IFAL 5LKNA 1XSIA 1YMME 5GIRB 4Z3JA 4HH8A 2X0UA 1BVZA 2W9DH 3QJZA 4NDMB 3UADA 3ZT6A 4Z3FA 4Z7WB 1RZPA 4D7PA 1KPRB 2CIKA 3VD3A 1A4KA 1U4FA 2UY7A 4Q9RH 3OHMB 2FGWL 3IBOA 4IBZA 2ZP0T 1ZSHA 4Y4FC 2HMIC 3EDKA 1JZ7A 1C5CL 2D4FA 4HJIA 3X1NA 1NLDL 1NM9A 3WKML 2ZAGA 5IEKB 2HCZX 2APSA 1OP5K 4P4KD 4PH8A 5D9SA 5ERWA 2A77L 3L4ZA 4NHCH 1T7YA 5C3IA 1A4JA 4H2AA 1H8NA 2BNQE 2M1KA 1HH9B 2MOGA 2UVEA 3B2VL 1A5FL 4DGIH 2E9JA 3DLQR 4AQ8C 1OTTD 1QI3A 2NW3A 4Z7IA 4AKQA 3S8GB 5IOKA 5F1IB 3HG1D 1HHJA 1YECL 1ZHBB 3IJEB 1ETB1 3ABGA 3QWOB 1IGJB 3ALPA 2DKMA 3HC0A 2JXMA 3D8MA 4TL4A 3U1SL 3RX8A 1XZWA 1B0WA 1MPAH 3UTSA 5E00B 3E2HC 3FU3A 3HNSL 1N26A 2L7EA 3MNVB 3AMLA 4M1GL 3WN5B 1GJWA 3FBKA 3ZIYA 1UFUA 1BQRA 1M2VA 3B2UC 3BWAA 1IKFL 1XAUA 1RQ5A 1T6VN 2CJSA 2ICCA 1N8ZA 2GBAA 3QI9B 4Z7NE 2OMXA 4PIRF 2RAMA 1RJYA 3BH9A 3Q6GL 4IMLA 2DOCA 1LMIA 3MJGX 2EIEA 3T8VA 4A38A 2ITEA 2MMXA 2QADB 4KK9D 2OQJB 4WQOA 3GDBA 2NQCA 4J3XA 1DBKL 2ICWI 1LO3L 2JCCF 3ZE1F 2HPOA 1I3VA 3GB7B 3MV11 4U05A 2X88A 4PJ5A 3VG0H 4GQQA 4F7PA 3GRWL 4KVCH 1ZT4A 1ZJAA 2NYYD 2GK0A 2J4WL 4KFMA 5DGRA 2XZQL 1A2YB 1QTSA 4KXDA 3CIAA 2ZX5A 3SKOA 4ZUWB 3BQVA 2AJXL 3QIBB 5D7JC 4N8UA 4RZCB 5CD5D 5I76A 1YEIH 4UOW0 3NIDF 4IRSC 3PP4L 1Q1PA 4M43L 1ZS8A 3FU7B 4KAQH 5CMAB 5F88B 4ANXA 3ZHFA 3ULUH 4OF8A 1N19A 3FHEA 4LVHC 1LDPL 3VXRD 5JIPA 1WSST 5DEGB 3FB6B 4A39A 4F27A 4U1SA 5DZPA 2PWDA 1ONQA 5SWZA 1SEBA 3GXNA 2NXZB 1VCAA 3WEBA 3X3FH 1M2OA 4EMZA 1OAJA 1MZZA 1L7TH 5B3JF 3MXWH 2NT1A 5EOTA 1YQVH 2PYFB 2BNRB 2ISDA 3NJIA 5MENB 3CFDA 3GSNB 4HW6A 5FO2A 5F70A 3DTDA 5ICZB 5SWQB 4HJTA 4KH9A 4QHMA 4OBSA 2A9BA 4KK8C 3DXAB 2RCSH 4X4ZA 4LFHD 5K1NA 4OFKA 1JVOA 1OAZH 3HBZA 4AIOA 2DLFH 3F58L 1SYVA 4MB5A 5DD0L 4M61A 3SDAC 4C83B 1GYCA 5ACZA 5E8OB 3GQFA 1R9FA 5GS1B 5CLTA 4QTIL 2C7UA 3LKQB 4X0NA 5PAZA 3RU8L 4HJUA 4G8GE 3WKPA 2HFEA 3ULVH 3ETBF 4ZFOL 3H55A 3LZNA 4KZDL 1KJ3L 2DTML 5D70H 1UT2A 3UG3A 5FYJL 4I9XA 1I7ZA 1KJMB 4JKNA 3G6JE 3KG5A 2A38A 1PEZA 3WMSA 1BF5A 1FO0B 1ZAGA 3MREA 4JFDB 2FHBA 1U91A 2VAAB 1U2CA 3GM8A 3Q13A 3VFGH 5ILTL 1SLUA 1CI5A 4P5KA 1N2RA 1ZWIA 3MOAL 4GAFB 3US9A 1GHFH 5JW5A 2CUHA 5HVFB 3IDNA 5MEOB 1ZHNA 2OI9B 4PJCE 4TSBH 1TO4A 2IAMB 5AW8B 3H9SB 5F3BB 1NEZA 3ZX1A 1EJOL 2EDDA 4HKXA 4PJ8B 4AVHA 4QOKE 2GUYA 2HLEB 2WBWB 1PPIA 3FZUC 3O3DA 2Z1PA 3WY2A 5J6GA 1NAMA 2K7QA 4XMXA 4WWKB 5D1XE 1EZVX 1GGIH 3W9DA 2G4GA 4GLRI 4FYSA 4F9LA 3C2AH 3QEQD 4J4PD 4F2ME 1EO7A 2YAFA 3INOA 3IKKA 4Y5YA 4A7SA 4FLQA 5C71A 4LCWB 1HJBC 4NC1E 4YX2L 1HSBB 4RSYA 2X4NB 4DNLA 4ETQA 3RWDB 1WTLA 2F7RA 1OP3H 3IDMB 3FS9A 3EJYD 1A0QL 2VAJA 3CX5J 1GTFA 4G72B 4FQ2H 3MLZH 5EBLB 4P2RA 5FC9A 5H8DA 5KWYC 1JZGA 4KBPA 4PRPD 4G7YH 1PZ5B 4XPHH 2W60B 2QT6A 2X41A 4AEEA 3H3BC 2P4AB 3KPMB 2CO6B 4N2BA 1DL7L 1FG2A 1QFUH 2NZ9D 3PHSA 5DQJA 3SDCA 1H6TA 3VAEA 4ZFZB 1YNTA 4HEME 1MJUL 5GJSL 1H6UA 2IDSA 3CDYA 2GITB 1PIGA 3TO4A 4OCWH 3BKYL 3VCLB 1K6QH 3NZUA 3L2NA 4KI1A 4PJXF 1BM3L 2EECA 1ZMYA 3DIFB 4NN7C 3QHZH 5E5RB 1JAEA 3TEZA 1HINL 4MJID 1C1EL 1D7DA 1U3HA 3CZJA 2A83B 2FT7A 4PGEB 2CK2A 4PI0A 2YD8A 5HJDA 1FGVH 4R2GC 5B39B 3QZBA 1X9UA 1TVHB 1F58L 2YQ3A 3K2UH 1NICA 5CSBA 4HGMA 5FA3B 1H19A 2ZWKA 2NMSA 4L1TA 1I31A 1JCVA 2ZPKL 2ZSVB 3QZWG 3VMNA 5C7ZA 3V8OA 5DT1H 2HVBA 5H94A 4G1EB 4EDWL 4Y8AA 4Q0XL 5D2NB 3TN0D 1CR9H 5KYWA 1LP9B 2VXQH 5IESL 2P5WB 4GRWE 1SJHB 1MXDA 1WFOA 4OD1H 32C2B 5EPMB 2YMXH 4OLVH 4JKPL 3UL4A 1G1KA 3IAQA 3RQ3A 3CDFA 1O9WA 1QBLH 2IVFC 2OX5A 2QMJA 4GW4B 1HIML 3U82B 3DX8B 3VFRA 4G8FB 4OV6F 1S8DA 1RSYA 5B7FA 4HKJB 1EPFA 3VD7A 4I3SL 3QA3B 1XSKA 1TZHA 2CWRA 3G5XB 1P4BL 2F7QA 2AF2A 5E4AA 1JJUA 4JJHA 4OCYL 4XODA 1S78C 1LE5B 1ZRUA 4K7FA 5HD8C 5KYXA 3EYQC 1TQCB 2W07B 3KPRE 5AQ0A 4KKCC 5FCSH 2D3NA 2B3RA 4TL5A 5T33L 2EIZA 1KCBA 1LQSR 1ZIAA 4E9QA 2E27L 1WVZA 5I15H 3BDBA 4OAWA 3MLWH 4AE0A 1OB1B 2YEVB 3IDIB 3KLAB 5DVPA 1DJYA 3MV8D 4R7DB 1NBZA 2CGRL 2OV0A 1BZDA 4PVMA 1JFQH 1KACB 4F7EA 1FC2D 4XAKD 2QELA 4DJMA 3QUZA 3GMMA 4ZPTA 1VEPA 1UJ3C 2VABB 3PL6C 3S36H 4HWNA 5IMLA 4OB5H 4H8UA 3I75A 1FVEA 3WSQH 4OUOA 1HKLL 3MODH 4AYMC 1Y0LA 2UVFA 2HT3D 1VJSA 4KU1A 4I0PC 3UBXB 3MV9E 2ZTBA 1HJCA 2IG2H 5ANHA 3ARFC 5EC2A 3OC5A 3QVAA 1A6UL 3HAEG 2BNRD 4OJYA 5LGHH 3L4TA 3R06B 2GVYA 4M5ZH 1A3LL 4RFOH 4X9GA 4AH2B 1AXTH 3F85A 43CAA 5FO9B 4Y2DD 5F7FA 5IR1A 2X6UA 4J12A 4NAMA 5ESVA 1FBIH 4G42A 2JTYA 5FYKU 5C07B 3NSCA 5JZ7D 4NO5A 1J1PH 5H4YA 2MEJB 1A7NH 4W93A 3QEGL 3BVVA 3PU7A 2NRDA 3EFOB 4OSUL 5D7SL 1ZT1B 4OD2B 4PJDE 3RY5A 2KI6A 1DVFD 1TQWA 2FEJA 6TAAA 1LO0L 1D5RA 1FZKA 4S1RH 1QNZH 1AD0B 1T2JA 1RUML 4KJPC 2BC4A 1FJ1B 2FBJL 1Q0XH 4XC1H 3VWJB 3A47A 2WKLA 1LEGA 3FUJA 3JUYA 2V7NA 1QEWA 2X1XR 2LU4A 4KQ0A 4GKNB 4X9BA 1I8UA 2IWEA 3U4BL 2A0LD 1CFNB 1KFAL 4BFGA 2NY5C 4PRHE 4GPVA 3UYRL 1W91A 3PWJA 2Y7OA 5BQ7A 3UTZB 1S6NA 2HTLD 3ARTA 4JG9A 3RTQB 1RH8A 4JVWA 5FO7A 3VE0A 3KEHA 4MAYB 3WLBA 1KTLA 2VDRB 3BUYA 1JZ4A 3QFJA 5IB4A 3QUXB 3OKMB 4F9PC 1JDAA 2QKIB 4MQ7B 4V11A 3L2LA 2VXTL 3SQRA 3HI5L 1KENL 3T6VA 3H9SD 4FQHB 4MSWA 1BEYH 1F4AA 3CV5A 5KZCB 1WA1X 5KVEL 1N0XL 1TVDA 2GJZA 3S3JA 3OAZH 1H8LA 2CHWA 4Y1AD 3FFDB 4ZXBD 2Y2TA 4K5NA 4KVNH 4J6RH 4WWKD 4P46B 5DC0A 3KWUA 3KWTA 3DSNB 3NN8B 1BP3B 1KBVA 4U1KA 2X6CA 4JN2B 4KJYB 4J3UA 4OLEA 3W82A 2DD8L 4RX4A 3KWWB 3QUMB 3WEXB 4NQVA 5IF0B 4BZ2A 3CFEB 5B4MD 4QXGH 2Q7YB 2PUQT 3VFPA 2XACC 4FQXA 3UZVA 5FF6A 1E8WA 4J5VA 1W72A 4TOYL 4GUQA 5MHSD 1CDCA 4GRWH 1KCVH 3FL7A 5AVWB 1AR1D 3ESVF 2CIKB 4D0BA 3Q5YA 2UY7B 3WHXA 3TZVA 4LP4A 4NC2B 1XF4A 4PJ9D 4WTWA 3RWIA 1E3ZA 3LPPA 4Y5XA 3C9NA 2EH7L 3VXMA 1RK7A 3Q2VA 2CPCA 4RWYH 3UJIH 4ZNEA 2AEPH 3MDJA 2P5PA 4PJEA 4XAWH 1GOGA 3BPCA 4YDIH 5F6HI 1AG0A 5D9SB 1UM4L 1NCTA 5ERWB 1L7IL 4OCMC 1U42A 2JJUA 1WBZB 2J7LA 2VDML 3BFQG 4P2YA 3RWGA 4AJVA 4DAGH 2RH0A 3MACH 3WEMA 3QJHA 2D0FA 2XG4B 1D5ZA 3VXQA 1JPGB 4ZTPH 1DVZA 5DRZA 4AQ1C 5C2BL 2NW3B 4QRPD 4AIZA 1AKJD 3HUJE 1MFNA 4HUNB 5F6IB 3GI8L 1HHJB 4MJ4A 1R0AL 3CC1A 4P23A 5F7BA 4OFVA 4BXSV 4Y5VC 4MJ5B 4NKOA 1D5MA 5CBAA 3O9WC 3HC0B 2BIMA 1IM9D 1U6AL 1IC0A 2DMHA 2JXMB 3WD5L 4FEMA 1BQUA 3UTSB 1DZBA 3BWAB 1BJ1J 1M2VB 4GQ9L 2IDCA 1AI1H 1KZYA 4JM2C 2VXUL 1N8ZB 2OW6A 2VZOA 1N6VA 2OMXB 4XBEL 2CK0L 3Q01A 1SEQL 1RJYB 3BH9B 3WTXA 2PPFA 2CUIA 4IMLB 4KY1L 4AKPA 4URTB 3NACH 2P5WD 3CSPA 1S46A 1GH7A 1IBZA 4CW1A 5EEXA 3S4SA 1X5AA 3NH7H 4PLJD 1T20A 3O0RL 3GSQA 5EU3A 4K8RH 4AI7A 2C3VA 2WSDA 3BPOC 4B9FA 1PBYA 4B5ZA 4PJ5B 3S96A 4RLDA 5JOFA 5IVXF 4GW5A 1ZT4B 1TENA 4KV5E 3ZHKA 4DQAA 2VO5A 3DJRA 4XI5D 4OTXL 1YPZB 1A1MA 3SKOB 3AM8A 1YEEL 2VSKB 5AUMB 1I9JH 5A6MA 2VDOL 2FBOJ 2ESVA 2MTAA 3MXVL 3K4DA 3ZTCC 3HPJB 1IC4H 4AG4L 5LNDA 2Y72A 4BV1A 2MH4A 3JTTA 3PQYE 1ZS8B 1HDMA 2ARJA 3C12A 3IDGA 3WEAA 2PPAA 4XE5B 4U1SB 2VC2L 5JXED 4L05A 1RJCA 4LL4A 1ONQB 3EO1A 1SEBB 4QF1A 5SWZB 3FQ2A 7PCYA 1IAIL 1JGLL 3X17A 3QG6A 4ANWA 5EOTB 2WAHA 4AUYA 1HS6A 1CF8L 3P11L 3WIAA 2YRBA 1IC7H 2CRYA 4OR1A 1C5DA 4RDBA 2VDLH 1BPVA 1KYOJ 3E6HB 2VN5A 4I13B 2EYSA 1A4AA 3ARDA 4QHMB 1E7UA 1QBMH 4PJFE 1BJ1H 3MJWA 3TONA 3QISA 5DF0A 4WHYH 1ETA1 3CLEH 2VLJE 2VW6A 3TL5A 2PTTA 2F5BL 1QFWH 1NPJA 2UYLA 5I1KH 2KZKA 1SYVB 1A47A 2AEIT 3L5JA 2BVPA 2WMPA 4M61B 4HUWA 1T1ZA 5L7XH 2CO4A 1SRDA 5ACZB 3SKUD 4N25A 5DJXA 3APNA 4Y9GA 4AEIH 2Z31B 1RHHA 5ITFA 1ZANH 1JPEA 4IOIA 5F0PB 2C7UB 5C07D 4OU3A 1NCNA 4KOBA 1QLEL 2HFEB 4B7IA 4CC4C 1KXQA 4HVBA 3BPLC 2ZCZA 4X5XA 3QUKB 3SGDI 2ALAA 1ZLWH 4E5XA 1SHXA 1TOXA 1XQ4A 1UUNA 1I7ZB 3ULUD 1JWMA 3OKNA 3FCUB 3FUIA 3EOYG 3P0VL 4XMZA 1QSFD 1C12B 3MREB 1IGIH 2Z35A 3QS2A 2J43A 4Z7UA 1AO7D 3F7VA 3VWJD 1U91B 5FKPA 3DVNB 4AE1A 3QZPA 2VDKH 1R5VB 5D96B 3BQUA 1KTKE 4JPKL 4NB7A 4P5KB 3N04A 1AZRA 1N2RB 1ZWIB 2X12A 3TA3B 2NX5E 3C5ZA 3FJTA 2G3XA 4JO3H 3ZZSA 5I6XB 5BXFA 3GO1L 1NMAH 5JW5B 5FYLE 4WDIA 1W8NA 4WEBL 4XVSH 4HG4J 3IDNB 2H1PL 4O4YH 3SD2A 1ZHNB 1Z0MA 1MH5A 1AGFA 4Y16B 3RTQD 3FHQA 5BOPA 3DGCR 4PBDA 5ALCH 4H8WC 2A9DA 4HKXB 4F92B 1F3JB 3WTWA 5JOPD 1D6EB 5LXGL 1ZHLB 3O3DB 3GS7A 5H2BA 4G5AA 5J6GB 1X5XA 1NAMB 4CVZB 4HF5L 1JF5A 2DPKA 3W9DB 4XNZC 2P49B 4H0LC 4UV7H 4LIQL 1GJUA 4G3YH 3SGEH 4Y5YB 1PZUB 4GW1A 3MNZA 3WL9B 4F58H 4NPKA 5E6ZA 5LQBL 2JJVA 2Y24A 1TMQA 5D5ME 4G11A 2B39A 4ETQB 1QLRA 3OAYK 3QUYC 3LZPA 1BSIA 4ALAL 1YMMD 5JPMC 1OF0A 1CT8A 1FDLH 1MAMH 4KJQC 4YH6A 4P2RB 3PGCB 4YDLC 4X4KA 3M1BA 2NXYB 3B8YA 5CILH 4HT1H 3N43B 3Q8EA 5D4IA 3SDCB 1AGCA 5DQJB 2FCBA 3ZY7A 2D2CC 1YNTB 1KYUA 4OZFA 2MCPL 1I1AC 2A9NL 1N4XL 3DOHA 5DHMC 3UTQA 3LN9A 1INDL 2DQ6A 1JI1A 1UWXH 1D9KC 2XFXA 3IFNH 1I9EA 4LHUD 5I1JH 5IWLC 4ORZC 1MFCL 4OM1L 4N2MA 1GGCL 1OEZW 2HP4A 3HW7A 3KBEA 4LARH 4JO8A 2BNQD 2WK2A 2QMKA 1T66D 1CB4A 4HFWA 3O8XB 1U3HB 1BXUA 4JW3A 4CMHC 5JDSA 3UTTA 2W91A 3CFBA 5I6NA 3HLAA 4WHTA 4S1DD 3BT2H 5T3ZL 4HXBH 3ZLQC 2UZIH 1OAXH 4L3EE 1RZJC 4P48A 4OZIA 1G6RH 5H94B 1NTDA 1MELA 1UHVA 3NJFA 5J8OA 4E9WA 3Q2LA 2FECI 3CTTA 3TBWA 5DZOA 1E42A 1HHKA 5TFSL 4DO6A 3GZKA 2XNAA 5DYFA 4EO5A 3WMPA 3REWA 2XV2A 4R4FL 2OX5B 1HHIA 4M48H 2G3ZA 3NSXA 3V7AE 3HS8A 3VFRB 1LEIA 3SCMC 3QORC 4Z23A 3KR3L 1OF2A 1S8DB 4YHOL 4LCIH 4BXVA 3PGFL 2YAPA 3OKKA 4GRLC 4Z7WE 5E2VH 1MCFA 1YJDL 2FB4L 3IMBA 4GAGH 5FYKL 1TZHB 3SE9L 1HE8A 5ISZE 1P6FA 2HSIA 4WNJA 3WGVB 2E76C 2H1LM 4Y9CA 3LEXA 3VYNA 1KEGH 4K7FB 2ZCKL 1DEEA 1FIGH 1XZ0B 4DP2X 1HZLA 2WWOA 1KULA 1T2QH 5LBSL 5D93C 3P77A 1MCDA 4JO4L 2EIZB 4HWBH 4EUPH 2F7IA 3V2AR 3CAFA 1VEOA 5AVTB 4PJ6A 3AFLA 4PS4L 4KJWD 3PHQA 1WAEA 4MNQA 1EAOA 3MOBH 1QG3A 1P7BA 4KMTL 1NBZB 4UV4H 2NDFA 5BVJB 2R29A 1RZFH 1SFHA 3GBDA 4JO1H 4XMKH 4F7EB 4S1SL 3QIUC 5GZOC 1LO2H 3QUZB 3ZTDC 4HMDA 3GMMB 2V2TA 4ZPTB 1U8CA 5TQ2H 5F3FA 1CYXA 4U33A 4B9ZA 3I75B 4GKOA 3R4RA 4QKTA 2Q2LA 1FVEB 4KNQA 4XB8A 4DCQA 5FYLH 4ATWA 3NRFA 4TQHA 1Y0LB 4NWUH 5IUCA 1KC5H 1PLGL 5EC2B 3RUGF 5DMYA 1BHGA 4KRLB 3V0FA 2MIZA 3U7WL 2BIHA 1U8PA 1TYRA 1E4KC 2CQVA 4DKFL 4N2LA 3GIZH 2BRQA 43CAB 4PWHA 4TUUA 2APXA 4YPGA 4G42B 1RLBA 5ESVB 5FUZH 1XCTA 3GHBH 4FG2A 4NO5B 5C2UB 1MREH 4JFZH 1F18A 5DK0A 4CL7A 2R0KH 5E95B 2WTPA 4OF7A 3IDXL 2G0LA 4NP4H 4G71B 2Z31D 1MJ7H 4ZMWA 5CJQH 5JHBA 1J0ZA 3KPLA 1FZKB 4M6NL 3S2CA 1BGXL 1I8LC 4HGWA 2BC4B 2C4FT 3KPOA 3ZRFC 1LM8V 1YDPA 1P7KA 7CGTA 1LEGB 2EDRA 3ISWA 3WHE1 2V7NB 1QEWB 1YEGH 4JB9H 4V1DD 5FUCE 3VXNA 4EIZC 2B5IC 1UT1A 1BPLB 1FNEA 3NZHL 4L8SA 4CUCA 2FQFA 3PWJB 5CGYC 3PWLA 4PWJA 5GSRA 5IW6A 5BQ7B 4OZHA 1OAKL 3KJ6H 4IJTA 2LT9A 1MRDH 5FM5O 2FHCA 4A2GA 3VE0B 5FO7B 2DLHA 1LTXA 3WLBB 3A22A 1KTLB 3TA3D 2ZXCA 3QFJB 5IB4B 2DIJA 5FCUL 4UT6L 3N85H 1JZ3A 4JAMA 2AQ2A 3TNMA 4EXPX 4YE4L 3DI3B 3FRUA 4QOKD 3G3LA 4Y16D 3T0BA 1NCGA 1KWKA 4ZFGH 4P99A 3LN4A 5JPNC 2GTZA 4MSWB 1MNUL 4YLQT 2HKAA 2IO5A 5MENE 1ZLUH 2GJZB 5B1CA 3T65A 1IGTB 3CX2A 4B97A 2YRPA 2UUDH 4RGOH 4EIUA 2CNZA 3DXAE 3IMTA 2QV4A 3SY6A 4Q2ZB 2EE9A 4U1KB 3HB3C 2IXQB 3LCYA 5LWYH 2XN9D 1ZD6A 3BSGA 4TSCH 4NQVB 2W1NA 4MS8D 2APBA 3BP4A 3VFPB 4FQXB 3UZVB 2OCJA 1Z9LA 3CPUA 1W72B 3L9BA 3LPOA 3L7EA 4OZGA 5TPWH 1HU8A 2HRHA 1P84K 5J11C 4G7VL 2Y36L 3V0IA 3IJ9A 4D0BB 1SQMA 1AFVL 3WHXB 3O6ML 3TZVB 1KB9K 3MJ9H 4J3BA 4EIBA 5ES4B 3WS6C 1XF4B 3RWIB 3OD3A 4Y5XB 3EADA 4BQ9A 3C9NB 3VXMB 1J12A 4POZD 3T0DA 4OGXH 4DESA 3ESOA 5ID0A 1OCOB 5DUPL 4PJEB 4JFTA 3AB0C 5FA4A 3K91A 3G6DH 4QI3A 4YFLI 1NMCC 2A6IA 2OP4H 5CLZA 1M1SA 3PP3H 3GSVA 1GZHA 2ADJA 3QJHB 3V0AC 2DQEL 4YHPA 2XU9A 3VXQB 1G9NC 5DRZB 2QFPA 4AIZB 3WTVA 1C16A 4M8UA 5E1HB 4HHAA 2XN1A 3GUTA 3VVWA 4P23B 1Z9NA 4YSQA 3O8XD 4UU9A 2E7LC 4NKOB 5EWIL 1HZKA 4EI5A 1D5MB 2DWSA 5CBAB 4FLHA 5JW3L 3CZFB 3FB8A 2XWJA 5BRPA 4OLZH 4OGYH 3RZCC 5C9JA 3BH8A 2K6WA 4K5LA 4AYGA 1DP0A 2OL3H 1XSOA 2Y1AA 4GJTB 1MHCA 4GP4B 4KI5F 4L0PB 4X6EA 4ZMPA 1UJ3A 5C6WH 1IEAA 1REIA 2NZ1A 4JFQA 3ZVVA 3W0WA 2J5LC 3IK2A 1OGAB 3TCLA 1TJMA 1CQYA 1RIVH 2CR6A 2DLEA 5A16A 2Y3NA 4CW1B 3BZEA 3BLKA 2NY4B 2VE6A 3KM1A 3S5LA 1T20B 3AG3B 1GXEA 4Y19E 1E6JL 3GSQB 5DQ9A 3VGDA 5EU3B 2C3VB 1J5IA 1X5YA 3S96B 2BJMH 5JOFB 5KEZA 3GPEA 4XXWC 1CWVA 1TTCA 4GW5B 1MRFL 5D2LE 1XV8A 4GI6A 3OR7A 4OD3L 2F54A 3KPRD 3EG9A 1A1MB 3WJMA 4BRVA 2PPDA 2WSPA 4JJ5A 3NGBB 2ESVB 2P52A 3K7UA 3TEXA 4RMBA 5ICYA 2IH8A 5SX4H 1D5IL 2EZ0C 1IQDB 3F7YA 3JTTB 4Y4KB 5G4NA 3WAKA 4ILDA 1RY7B 5AG8A 1DVTA 1HDMB 1RK1A 1TNMA 3DX7A 2EDFA 4ACPA 2ARJB 4KQ4H 1IO4C 4G7RB 3IDGB 3MRGA 1XTMA 4PP2A 1WZ1L 2K7PA 4IYKA 3ZHNA 4U1NA 4QF1B 3HZYA 3ZPDA 5I66A 1N6UA 3QUGA 1SXZA 4HJ0D 2RTTA 1UD4A 2F1AA 2F53E 3RZWA 4DN3L 3QG6B 1AC6A 3JWNG 3H3PH 4TPRH 4LFHG 2H3KA 1SJXA 3JQOB 3FKUS 3OVUB 1C5DB 1HAWA 1KCUH 1EO8L 4B27A 3BYYA 1GPOL 1U3NA 1OE2A 2EYSB 3ARDB 3LQAL 3KDPB 4MMYA 5AYUH 5C0AA 4OCRL 1K3ZA 2XPZA 4JS7A 1RP8A 1UGNA 3IDJA 4LSPL 5JIKA 4UTAL 5K9JL 5DURD 3JSSA 2UYLB 3CVCA 4F9PA 1LP9E 4WHCA 4OLUL 5E7BA 3V4VB 3PWUA 2WMPB 4KHTL 4LPXA 1T1ZB 3ALWA 5JHDD 3D85D 1YC8A 3EZJB 2UZYA 5DJXB 3SDXF 1IARB 2ARJQ 1RHHB 5ITFB 3NCCB 3CNKA 4IOIB 5DMKA 2WHVA 4QKXB 3SPJA 2A73A 1IBYA 3T0EB 1KDIA 3X2QB 4X98A 3K8KA 4X7SL 1MEXL 3FAXA 4FQCL 4E5XB 2ZONA 1F3RB 4S1QH 1BOGA 2WXHA 3PRZA 2VLRE 5IIEA 1QACA 12E8H 3KDMA 5CJ8A 3ZMNA 1JWMB 3Q8BA 1ZK9A 5DS8A 4ICWA 5EOCL 2Z35B 2NLJB 3F7VB 5JQ6H 3P2TA 2VXSH 4FG0A 5FKPB 2JB5L 3HJEA 4PRHD 3MRJA 2EDHA 2DQHH 3BQUB 1CXIA 5MERA 3VO0A 4K9EL 4I2XA 5D7IB 5BXFB 5CEYA 4WDIB 5CCKL 2ZJSL 1VENA 2WYHA 2YOAA 5DCCA 1S9VA 5B1BB 3L7FA 1FO0H 1MH5B 4WO4C 2HUHA 1MI5A 1IAKA 1KUMA 3IE4A 2KZ1B 2QQLH 3DETC 3IJHB 4OY9A 5C0BE 3RGVA 3RJOA 5FPIA 3L5XL 4OGAD 1FLTX 4JFHE 4FNLL 4LRNL 2ILLA 5H2BB 1HFUA 1I8MA 3T2QA 2VMDA 4HPHA 1CXHA 1A6AA 7FABH 4PJGA 3AJ7A 3OMZA 5DR5H 3U4KA 4C4UA 2YUZA 3RIKA 3N6YA 4W9GC 5J6HA 1MVFA 2BCKA 3OL2A 4GW1B 4IOSD 2KT6A 3MNZB 1FGNH 4JQXC 3O2VH 2WO3B 1I1YB 1S7UA 2P9RA 5JW4R 1E6OL 4KXZH 3UIYA 1OCRB 4Y5VA 4NQQA 1QLRB 3O9WA 3OLEA 4N20A 1HXKA 3MUUA 4F7MA 1CYGA 4NQEA 1R3IL 3BRFA 4R5XA 3WIIL 4RX4D 3E2HB 1CT8B 4QRRA 5LBGA 2IH9A 3LIZL 1G7JA 4UINH 3M1BB 4X4XA 3IMSA 4PD4J 1MIEL 5BW7C 2R0ZL 5E6YA 5DJ2B 4HUMB 1AGCB 2VDQB 2ZUQC 1L6ZA 5LBVA 1ZV2A 4Z7OE 5BVPL 4OZFB 4H13C 2I9TA 3UTQB 4LKCA 4TVUA 4EQ2A 5LLIC 4U7SA 2AJZA 4GO6B 2EUXA 5EU6A 4B60A 4AL8H 5L0QC 4JEGB 2VR4A 2CKBL 3VDBA 3QXDA 4LVEA 2P8LA 3WO4C 4X6CB 5FW7A 3TJPA 4HWZA 4DOHE 2A9AA 4XNXH 2PR9A 1B0RA 4UYPA 1ASOA 2I9LA 3QYNA 2XTLA 1BVNP 3EFDL 4Q6IC 4D9RD 1JGEB 4I88A 2H2PC 5GS0D 4RCAA 3T2LA 3UG5A 5I30H 4JANA 2I69A 5DSCA 2MHAA 3AZUA 4A7GF 4FXGA 4LGPB 3FFCE 5CJ5A 3UTTB 3CFBB 5EIQA 2HLAA 3HLAB 4WHTB 2RGSA 5EO1A 15C8H 4FCHA 2EDBA 4ZAKC 3AQDA 4OZIB 4LVHB 5CCHE 3GKWL 3KL5A 3BZFB 3ZW3A 2XY1A 3RPIA 3TBWB 4PP1C 5F7MC 3IS0X 4X7DC 3MTRA 2XXCB 3TV3H 1HHKB 3ETTA 3KYKL 1Q9OB 2XNAB 4ODSH 4L37A 1ZVSA 3W38A 1U2HA 3REWB 1HKFA 2KL6A 2ED9A 3CHSA 1HHIB 2FNWA 5GZND 2NYZA 4WGKA 3RA7H 4XCNA 1LEIB 5JA9A 3F84A 8FABA 1R3LA 2JKXA 1OGAD 4MA8H 1OF2B 4KUCF 1CGSL 4GO8A 4R96A 3KD4A 3OKKB 4UTAA 3ZDXE 3QJSB 4NRZA 3V4UL 3TJEH 3CVBA 5E8DH 4TULH 3LEXB 3LZFL 2VRKA 2VM4A 3FH5A 5EH1A 1DEEB 4JHWH 2H32H 4O02L 5E9DB 1V7NL 3GSUA 1CZ8H 3P77B 3HA0A 2G4EA 1LO4L 4XB7A 2XIBA 5MP6H 2ZXDA 4MCZB 1FH5H 1TCRA 4L3CA 5GGQL 5IQOA 5L9DH 4JDVA 2B7DT 5T1LA 3ILPA 3MA9L 4MNQB 1UXMA 4U1GB 4NWTH 1GAFH 1Q8MA 4Y4KD 4RQQA 1FL6B 4R7XA 4JQIA 4UMSA 2V2TB 2J8HA 1S9WA 1TTRA 1U8CB 4KUZH 1D2PA 1JI2A 1VFOA 3RVXD 3PPEA 4LSSL 1DO5A 5HI3C 2WNGA 3BKCL 3D2UA 1KBKA 2JK5A 3HHSB 3HBPA 5IFJA 1F8TL 2XKSA 1W0VA 2J25A 3QDMA 4L5FH 2JIXA 1Y7VA 3LEVH 1XF1A 3U9PH 3UTSE 4LASL 3HJ0A 1U8PB 4ZMTA 5FKAA 4W70A 2VLJD 2VUOA 5TF1L 3GXUB 4HOZA 4R9HA 4WFFE 4YPGB 3OGOE 3HC2A 2IGFH 2YBGA 4BFEA 5LCVL 4GAJL 2YAOA 1XCTB 5GRJH 3AMKA 3N0PB 3KE0A 2ZOTA 5LAPA 4YBLC 2PXYD 4HSCX 1PJWA 4U3SB 3KPLB 4F3FA 4JHAH 4MMXC 3T0ED 2YA0A 1M9WA 5C08B 2XV6B 4M62H 1TJIH 4HGWB 3KPOB 2H7WA 1A3QA 1YDPB 4PJ5E 1FAIH 1QZ1A 4FTDA 4XWGH 1P7KB 1H3GA 3VNZA 5EC1A 4UNIA 3VXNB 4OLWL 3HBGA 1GIGL 3AG2B 2XDHA 1XVSA 3S37H 1FNEB 4G6MH 1OP3K 5GSRB 4OZHB 5C0IA 1NDMA 1OZTG 3NEEA 1RIHH 3BH4A 4RBPK 3UYPB 4KKAD 1KN2L 2WKGA 2CIIA 3MRLA 4EOWH 4CDHA 3STLA 4JY6A 4YOKA 1VKXA 1WIOA 2F15A 2WYIA 4UQ2A 1KYFA 4FQPA 4JAMB 5ACLA 3TNMB 5SWZE 2YUWA 4Y4FD 3RI5K 3LV3A 5BOZG 5C09E 3FRUB 2W94A 1W0YT 3S88L 4IRZA 5E99H 1JHLH 3GNMH 3LN4B 1X4ZA 4ODBD 1Z9SA 2GTZB 1QASA 3HHMA 3T0XA 4NUGH 4NN7B 1ETZB 4APQA 2VDRH 4N24A 1UVQA 3AQZA 5HDWA 4PJIF 2ZNWA 3MLXH 2H47C 2A2QT 5TE7H 3V6ZA 1H6EA 1F2QA 1OTUC 3ARED 1CDJA 4HQQH 4BZ1L 1FH2A 3CPLA 4FC3E 4GMTH 4ELME 3BX7C 2ZKYA 3RL2A 1FNHA 2Z34A 4JPQA 2HTKC 2DM3A 3WLWC 3H7LA 4FNQA 4LGSB 1OWRM 3L7EB 4FGMA 4LOUC 3QZOA 7TAAA 1MCWW 1CIUA 3TBTA 3UGUA 2VL4A 3PE9A 3GMLA 2J2ZA 1NC2A 3SDDC 1IVTA 1AVAA 3B2UD 4U7MA 3SKMA 1RZ7L 5ID0B 5MEQA 4YGVA 1OARL 1A66A 2VLKD 3V0HA 4MLSA 4PI2A 1WF5A 5GHWH 5FA4B 1XR9A 3RLSA 1ESOA 4XWOC 1TJGH 1A6TA 4P5TC 4XPGL 5E6UB 2NW2A 3H3KA 1BZ7A 3D6GA 3ZHDA 3GSVB 1C5BL 1VHPA 4IK6A 4ONFH 5H37G 2ADJB 1Q1JL 1Q94A 4DIXA 1JZ6A 4YHPB 2F7OA 3V0WL 1DJHA 2CLRA 3THML 5IBTL 1IT9L 3ILQD 3HE7C 3WIHA 4HHAB 4O9HL 3GUTB 4JRYB 5HGDA 4KXAA 4UCFA 3OAUL 4UQEA 4UU9B 3TX4A 5JUEH 4FTVE 4HD5A 3DVFA 4EI5B 1OD7A 5LAXA 3FB8B 4HAKA 1MUJA 1AQ8A 2XWJB 4EN3C 3ZXAC 3BESR 5D7JD 3TM6A 4L3ED 4XPTL 5C9JB 1NKGA 5HJ3A 4WFED 3BH8B 4IRSD 4X7EC 3FN0L 3TT3H 3QIUA 1MHCB 2XXMB 4PRIB 4X6EB 5C0CA 4JRXB 1CU4L 1UJ3B 4DSYA 1IEAB 4JFQB 1DE4A 2ZCLL 3P2BA 4AV0A 4W9KC 3W0WB 4Z7AA 3FT3A 2I5YL 3UH8A 2ZX8A 5F89A 4ALAC 5KSVA 4WENB 3T71A 2JVUA 4R0LA 5A16B 4Q89A 1U58A 3IAGC 5IT2H 2VE6B 3SBWC 3S5LB 1P6AB 4KK6D 1MRCL 1JZ8A 4S11A 3BFOA 5H4ZA 5DQ9B 3HMXA 5F9DC 4DF9A 5JIMA 2AVGA 4FABL 2JKNA 2QSCH 4PCSA 1E4KA 4P2RE 5CKGA 4GH7B 4KDVA 3BOVA 5AVVB 5TE6L 2CRMA 3UAJC 4A6YB 2FT8A 2V2XB 4S10A 4N6RA 4KK8D 1IAIM 3FCTA 2F54B 5D1QC 5BS0A 3EG9B 4G6FD 2FAUA 4M8QA 1LNUA 2JCCA 3QDJA 4JJ5B 3HBQA 1FUNA 1QFWI 4K94H 5ICYB 3SDAD 3VRLF 3F7YB 5E9DD 1P6WA 4GXVL 4G6KL 2OMWA 3ABKB 3DX7B 3ZE1E 3TBVA 4FE9A 3MSPA 1I8LA 3MRGB 1MG3C 2WIMA 1DDHA 4J39A 4PP2B 5CZVL 4PS8A 2F5AH 5AW5B 4ZW6A 4P05A 3SKJH 4U1NB 3HZYB 4B9JA 4N9GA 3ZK0A 5I66B 3VI4F 1J1XH 1SPDA 4OCNC 4ZFFB 5CJXA 4KPHL 1XGYL 2DQUH 3V6OC 1BZ9A 1QKZL 3NIDE 4DW2L 3NIFF 1P7QA 1A6VL 3V6FB 4NM8H 1AYOA 1JE6A 2QFRA 1Z7JA 3SN6N 1CICD 4H2CA 4HJGA 3S8FB 3EH4B 4OIFA 3OQRA 4AQEA 1NSNL 4JFPA 4J6IA 4EVNB 4TUKL 3IDJB 2OJZL 2B4CC 1X9RA 5D71H 3PWUB 1FCCA 2I60H 1O7VA 3A6CL 4LOVA 3FO9A 2UZYB 3SJVD 4OI9A 1FYHB 4JM4L 1L9MA 5CJOH 1F42A 5DMKB 5HYJB 4XPAH 4OV5A 4IBVA 2A73B 1CBJA 3BE1H 5DFVD 3FZUD 3LNFA 2YGNA 2D8KA 4ZOAA 3VJ6A 1J0JA 1R47A 2WY3B 3GGWB 3NJXA 5CU9A 4Q9RL 2F2HA 1P5UA 2O6FA 1UACH 3OAZK 3OX8A 1BOGB 2C4XA 4OQTL 4YHIA 4XMVA 1QSZA 4PGCA 5IIEB 4JR9H 4CN4A 3KDMB 5TDPA 3DK0A 2QQKH 5DS8B 4MJHA 5C08D 4QDGA 3SGEI 1NBCA 3VNYA 4I3RL 5DRXA 2F58H 2HVJB 3C6LA 3IEAA 1Y18A 4M5SA 3MRJB 4XNBA 4NHCL 3X1EA 2HX8A 4F2EA 1PYWB 4BWWA 3J8F7 5ECJE 2WXGA 2DWXA 5CEYB 2BZCA 2N1TE 4JO2L 1Q0EA 5IFAH 4Z3IA 2WXQA 1B6UA 3WYRA 1IAKB 3VQLA 4D8PA 2BSTA 2YPVA 3GC3A 5IKCA 3QFDA 2JLPA 5DUBA 2FGWH 4H40A 1XB6A 4X7FC 1ED3A 3R7RA 4X6DA 1I8MB 2DJMA 1TMCB 4NUJA 1MPAL 4QAMB 4TNGA 5FWRA 1SY6A 4FQLL 4ZUVA 3PXLA 2AQTA 3EJZC 3HFFA 3WKMH 2BNUA 2BCKB 1HL8A 2E9IA 5I74C 2VMJA 1X5LA 4B0MB 4LP5A 4YHZL 3D33A 4XH2A 2LV4A 4ZOBA 4YFLF 4DQOL 2A77H 3QDGA 1S7UB 3DIVA 3MUY1 4UMGA 5C0GA 3TYFB 1EHNA 3QARA 4Y5VB 2PCPA 5JTWA 1HNGA 1PX4A 2E7LA 2EAEA 3O9WB 2VQ1B 3B2VH 1A5FH 1WA2X 5AKRA 4NQEB 3AY4C 4QWWD 1Q4NX 4MZIA 4R2GD 3T09A 1TFHA 4J2QA 3U2SB 3MUHL 3VDCA 3APFA 4QRRB 4FRWA 5ENWB 1PNCA 1G7JB 2BSSA 2IQAA 3DV6A 4LB8A 3CGTA 4X4XB 1AZNA 1EAPA 1EEYA 5FO8A 3VG0L 2V2WA 3QG7L 3GKZA 3OKYA 4LHUG 2DJSA 3P0YL 2I9TB 2DLGA 4NUQA 1BBJA 3HNSH 1HZHH 1L9TA 4OZ4A 2AJZB 5LNGA 3OMIB 3VA6A 5I0XA 3SYCA 1NGZA 4WAFA 4AEHL 1WZMA 4CJ1A 3QXDB 2P8LB 1KGWA 4KAQL 4HWZB 4WI0A 4WZ9A 4DN4L 2QVFB 3ULUF 4K3GA 1B0RB 3BPOB 5DI8A 3KPTA 1FVDA 1JTOA 2I9LB 4FI8A 5C6PB 4XXWA 2FJUB 4ODUA 2TAAA 4ZQKB 1MW1A 2AI0L 4JANB 2MHAB 3C75A 2CBQA 3FYEB 4PJXA 1LO3H 5CIPH 1R3JA 1ML0A 1S78D 3G04A 5CZXC 4APXA 4IU3A 5HD8D 2HLAB 7PAZA 4KKCD 3D0LA 4YO0A 1YQVL 4BWUA 2X9XA 3L1FA 3OG4B 4JRYD 2VWEE 5EO1B 1FVCA 3GRWH 2BO0A 2XZQH 3ZKXC 1NPNA