2I7OA

Structure of re(4,7-dimethyl-phen)(thr124his)(lys122trp)(his83gln)azcu(ii), a rhenium modified azurin mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan-accelerated electron flow through proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i7oA00
1E5ZA 3UADA 1MG3C 1WA0X 3D12B 2FQEA 2A3TA 3HEIB 2J5WA 2DWSA 5I5JA 4DP9X 2YAQA 2VW6A 4N8UA 2DWTA 2UX7A 3MX0B 3OQRA 2RACA 4A2GA 1R1CA 1ZIBA 2IWFA 3JT2A 1L9SA 4NERA 3WG7B 3V9EA 4BWWA 3IN2A 2WO3B 1SFHA 3EH4B 3N55A 3UGEA 4AKOA 3FYIB 1IKOP 1TEFA 1IC0A 1OF0A 2PP8A 3OD3A 5AZUA 2EILB 3V9CA 2YAFA 3T6WA 1EZLA 2IDQA 4A2FA 5TK2A 1J5CA 1AG0A 2XVBA 1IUZA 2ZXWB 2GBAA 2FNWA 1BEXA 4KOBA 2Q5BA 2DYSB 3HB3B 4NB7A 1A4CA 2IH8A 5B3SB 1TKWA 2GIMA 2LLNA 2BW5A 4A2EA 1HAWA 1A8ZA 1ID2A 1RZPA 3NSYA 3S3BB 4A2DA 3X1NA 2JXMA 3FSVA 4E9SA 3TA4D 2W8CA 1JZFA 4HZ1A 1QLEB 1RKRA 2XXGA 3NJHA 4E9RA 3SBQA 2XU9A 3ASOB 4YL4A 1JZGA 1CURA 3TBBA 2VM3A 2YAEA 2OJ1A 3UACA 6PAZA 3PXLA 1J5DA 1I53A 5B1JC 3FU8A 1GR7A 3NSFA 3FU9A 1ZPUA 4DP4X 4HHWA 1JZHA 7PAZA 2QDWA 4AKQA 2BP0B 4Q8BA 1N68A 3EF4A 1GW0A 1PZBA 2UXGA 4KO9A 5FC9A 1WS8A 3DIVA 1OE1A 1J9QA 4YSEA 2XXFA 2XV0A 2TSAA 2CALA 1L9PA 3CG8A 4FA7B 2UXFA 4YSRA 2ZOOA 2PP9A 1L9TA 5E9NA 5B1BB 3PCYA 4G71B 4M3HA 3TASA 3ZX1A 4RH4A 1ASOA 1IBYA 3FU7A 1XB6A 2XV2A 1FFTB 1V55B 2PPDA 2BP8B 3NT0A 2AANA 1OCOB 3H4HA 1SHXA 4AX3A 1PY0A 4AKPA 3FQYA 1PNDA 2CBPA 3KW7A 4GY4A 2W88A 5IY5B 2CCWA 2EINB 2IAAC 1XB3A 1OV8A 4UANA 2IH9A 2QPDB 1HAUA 3T71A 1KV7A 3GDCA 2VN3A 5B1JA 2BZCA 3ABKB 1W6LA 3NJFA 5I6LA 1OOWA 5D4JA 1ET5A 1ET7A 2WO2B 1KGYE 2B08A 3FSAA 1AS7A 1PLAA 4G72B 4A67A 4KNTA 2IDTA 3SBPA 3G5WA 5I6NA 3X2QB 4ENZA 4CSPA 1HFUA 2HX9A 3DKHA 1FA4A 4DP1X 1NTDA 2NRDA 2FQFA 1ZDSA 1BQ5A 2FQGA 2Q9OA 1AG6A 1SF5A 4UAHA 1E5YA 2JFCA 4KOCA 4DP2X 4E9WA 4UF7C 1NIAA 2J57A 5I6MA 2PPEA 1J9SA 2YAPA 3QQXA 2FTAA 2AFNA 3QJQB 4F7KA 1RCYA 2YXVA 4MFHA 1KYAA 1PNCA 3WNJA 1JOIA 1SNRA 4N4YB 3WNIA 2J55A 3T9WA 5B7FA 1BYPA 3ABMB 1TEGA 2DV6A 4GP5B 1GS7A 1NIBA 3CVDA 3NJKA 1JERA 2IDUA 2OCCB 1CYXA 3PLYA 5PAZA 5I5MA 4YSUA 5ANHA 4KO7A 2XWZA 1GS8A 3AY2A 1E30A 3NYKA 1PF3A 1BQRA 3IE9A 4F2EA 1L9OA 2YQBA 4HIPA 4BK5C 1GSKA 4K9JA 4BWTA 4F2FA 3AW5A 3UAAA 4JHUA 1NDTA 3ABGA 1JVOA 2X87A 2AVFA 3L45A 2YAOA 3SQRA 2OV0A 1W6WA 1OE3A 2P80D 1GS6X 3QJUB 2YAHA 5B1AB 1A4BA 1OCZB 2PPAA 5LDUA 4GP4B 4HCIA 2YAMA 2HX7A 1N70A 3GXUB 5B7EA 3H4FA 2BW4A 3SBRA 4GP8B 1E67A 1B3IA 4A68A 3FSZA 3QJRB 5F7BA 3AG4B 4BXVA 1A3ZA 2PPCA 4EF3A 4AZUA 2WSDA 1V54B 5PCYA 5I5IA 1YLBB 5D4HA 2H3XC 1AIZA 1UATA 3S3DB 2UXVA 3KW8A 2GI0A 3FS9A 4PCYA 3X1EA 3ABLB 4YSAA 1JXDA 2I7OA 4YSCA 1E65A 1NIDA 1OCCB 4E9YA 3ASNB 2BO0A 3FT0A 2AZUA 1X9RA 2HLEB 4AI7A 5B1KA 3T6VA 3FPXA 5B7MA 1ZV2A 4HAKA 1NINA 3EH5B 1MDAA 3NJJA 3PAUA 1AS8A 3OMNB 1NWOA 4HCFA 4G7RB 4W9ZA 1KBWA 2GC4C 1W8EA 3FU7B 5AFAA 1BXUA 1MZZA 1M56B 2QT6A 1AACA 2N0MA 3JTBA 5TK4A 1CYWA 3AG2B 1ASQA 1JVLA 3X1BA 2VMJA 3BQVA 4A2HA 2JKWA 2Y1AA 1PZCA 2BWIA 2R7EB 4KNSA 4YVNA 3H56A 4P5RA 2HRGA 2DY2A 2UX6A 1ZIAA 1AZUA 5I6PA 1TU2A 1OE2A 2IWEA 4QKTA 1NPJA 2Y69B 2AZAA 2FT8A 3NJNA 1ASPA 2GSMB 4YSQA 4YSPA 1ZDQA 1NICA 2VW4A 2FWLB 4E9VA 1ETJA 3QJVB 3QJSB 4TXVB 8PAZA 2IDSA 4BDVB 3NSCA 1X9UA 3TBCA 1IBZA 4DP0X 2VW7A 4KO6A 2FJSA 2ZONA 2MRYA 1A4AA 2FT7A 3FQ2A 9PCYA 2BP0A 1V10A 5D4IA 1AZBA 1SDDA 2HZHA 1J9RA 1WAEA 1KCBA 2GB2A 2QDVA 2PPFA 2X88A 3QJTB 2EIMB 2HRHA 4DP8X 1CC3A 1AS6A 3NJLA 1CUOA 3PAZA 1BQKA 1XB8A 4GYBA 3X1GA 2FT6A 2BWDA 2YXWA 1BXAA 1ET8A 2P80A 1DYZA 3FPYA 5I28A 3PAVA 2BP8A 2EIKB 3C75A 4JKNA 4BXSV 1QHQA 1NWPA 1SDDB 4HHGA 1GY1A 4QLWA 2IWKA 3NSDA 2PCYA 3ZIYA 3PPSA 1ILSA 4G7QB 3X1FA 1WA2X 4DP6X 2XLLA 2HX8A 4G70B 1JZEA 4JHVA 1RZQA 5AKRA 2XX1A 2CUAA 1AOZA 4DP7X 1NIEA 3IEAA 3T6ZA 1A65A 2DYRB 3IBOA 2E86A 3IN0A 3S8GB 1ILUA 4YSDA 1AQ8A 4PAZA 2J56A 2H47C 3NJGA 4BWUA 1SHWA 3CVCA 4A66A 4ZK8A 4DP5X 2ZWNA 4WKXA 4DPCX 3BVDB 2PLTA 1JXGA 1PAZA 1XMEB 1ADWA 2B3IA 2YARA 2BZ7A 5I6OA 1JZJA 2XX0A 3GYRA 1KDJA 1NPNA 1NZRA 3UAEA 1GYCA 3OMIB 3AZUA 3WIAA 2GHZA 3EHBB 3TU6A 4E9XA 1T5KA 4BDVA 4NAJA 3WI9A 2XUWA 3N2JA 1BAWA 3FQ1A 4DPAX 1BYOA 3AG1B 1L9QA 3DTUB 4DPBX 3ERXA 3QPKA 2VM4A 2I85A 1KBVA 3FYEB 3AG3B 1M57B 4KO5A 1JXFA 1AZRA 1AZNA 1SFDA 5I6KA 2VSKB 2MTAA 3FSWA 3U25A 1WS7A 4HALA 1M9WA 2GC7C 3MBWB 3NP4A 3T6XA 4YSSA 1NIFA 4L0PB 1PMYA 2EIJB 4YVUA 5I26A 5EHFA 1AANA 4FAAB 1JZIA 1MZYA 3NP3A 2IDFA 1URIA 4YSTA 2TSBA 1L9RA 2FQDA 3CZUB 2CAKA 5A7EA 4E9QA 5F7AA 1WA1X 3ZDWA 1AAJA 3CDZA 4Q89A 2CJ3A 1PCSA 2BHFA 2QPEB 1PLCA 1VLXA 2H5UA 4P5SA 4W1TA 2PP7A 2I7SA 2R7EA 4GXFA 3S8FB 3EH3B 3UABA 4G7SB 4HCGA 3S3CB 2XYBA 1PLBA 1FWXA 1BXVA 1SJMA 3CVBA 1PZAA 4CSZA 3OM3B 1F56A 3RYMA 3CDZB 1GY2A 4WTQA 2XV3A 1KCWA 4E9TA 7PCYA 1QNIA 1KDIA 2PCFA 2VSMB 1AZCA 4KNUA 1SF3A 2HXAA 3ZBMA 3NJMA 4X4KA 1AR1B 3NJIA 2UXTA 4YSOA 3OMAB 3WKQA 3WKPA 4M4RB 1MG2C 6PCYA 1DZ0A 1J9TA 1OCRB 1EHKB
chains in the Genus database with same CATH superfamily
5KUKA 2DEWX 2WZAA 4P2YA 3RRQA 2QR0B 1HZHL 3IXTA 4U1SB 4XPHH 2FQEA 3ARSA 1SOSA 2BXYA 4HFWA 5JOFB 4NJAL 4BFNA 5EBLB 2PR4H 2L0DA 5T8IA 4Y2DA 4XN1A 4P49A 1CE6A 3DX1A 3PUUA 3ZMRA 4Y2LA 3IGAB 2AK4B 2VC2B 3BQUB 1JV2B 2AJUL 2QADC 3BZ4B 1KJ2L 3QFJB 3J07A 4MS8C 4L5FL 4NDMA 4U3SB 3C6LB 3KL0A 3EJYD 3MOQA 4HEMA 2CDEB 5CNHA 2WO3B 5HP5A 4ZXBD 4XN5A 5DHVA 4MAZA 3PJLA 3C8KA 4AKOA 5FECB 1F90H 3DYOA 3MRJB 3VWKB 4EXKA 5MEPB 4KTDH 4L2YA 1DQIA 4YXHL 2HFGH 5D96B 5GGSA 2AEOA 4OI9A 2VLJD 3C08H 4A2FA 4JQIA 4UTAL 4LXFA 4LP5A 4NZJA 2X53A 5D1XA 4U7SA 2I9LA 1PZ3A 2IPUK 3QRFM 1J12A 4ELMB 5LUMA 1A6AB 2UYLB 1MWAB 3H9SD 3OKKA 4APQC 3NZ8B 3CC1A 4XPBL 4F80A 4H25B 4HIJB 1IIIA 2WXPA 4DGUA 1X44A 2XWEA 3MRNA 4FD0A 4PRHE 3G6JF 5C08D 1PDKA 5KS9B 2O5ZL 1A3RL 2W8CA 4OI7A 1NDMA 3TA3D 1GH7A 4A7GF 3HJEA 3NJHA 4LE8A 4LASH 4JAMB 3U7AA 4KKRA 2CHXA 4L3AA 4ETQA 5JIKA 3S2CA 3ARDA 1UWXH 3OKMA 1XGRB 3CFEA 4K8RL 1JNLH 5B1JC 1CDCA 1CLZH 5SV3A 1A1NA 1NCIA 3GSRB 1K2DA 3P4LA 1U2CA 2APBA 1H5BA 4R4FL 1OKEA 4NUPA 2WVUA 1I85A 3DIDA 4WTXA 4OGXH 4AGMA 2GJ6D 4P9HL 3KYAA 2D03H 2HFTA 1PZBA 4DK3A 1J5IA 3BKCH 3W11D 1MVFA 3APCA 5ALCH 1CO1A 4GMTH 2YGNA 2V0AA 2XN9E 3CFJB 4PJ8D 4XVJL 2PO6C 4QRUB 2MPAH 4WVRA 4AQ1B 4FQCL 3T2LA 4RH4A 5FUZH 3G6JE 4F7TA 3FU7A 1XB6A 3FUJA 3A21A 4WU7B 2B7DT 3P3UA 3WUZA 3MFFA 1M6OB 3APFA 1AGBA 1FJ1A 3UZEA 2V7HB 4IMLA 5C7ZA 2X38A 4QXUH 3U6XA 1G6RH 4UBDD 5JDJA 4K3JL 4L3EA 3GMNA 3L2NA 3FFDA 4KDVA 2F53D 1AR2A 2UZIL 4LPYA 2W88A 5J8OA 2EDJA 5SX5K 5TE6L 1Z66A 4M61B 4G43B 4A38A 2FYYB 1HCVA 2YEZB 4MMXB 1YNKH 4LESA 1JD7A 2NUPA 2X41A 3RVXD 3MJGX 3ES6B 1AE6H 3UZVB 4BRVA 1KCVL 1FE8L 3ET9F 1P6WA 4F2MA 1JK9A 3ELAT 5C0BE 3FCTA 2JCWA 3QUXA 1SY6A 2GTQA 4XRCA 1H19A 2Z7WA 5D7KE 4XH2B 1FA4A 1NEZG 2HX9A 1PFOA 4NC1E 2X6VA 2FR4A 1NTDA 4ZMTA 2H0FA 3L3GA 4YE4H 3IPBA 3MLZL 4LOEA 2ZUXA 3K72A 3RP1A 3TCTA 3LS5L 3ZTDC 2W5PA 4DZBB 3GXIA 2Z91B 4PB9H 3V8CA 4GMTL 1VADB 4PG9B 3KJ6H 5CBAA 3LKQB 2WINA 3ZDXF 5EZOL 4PLOB 4AJVA 3UROR 4UOQA 3DXAA 1SYSB 1YJDC 5JXED 4QXTB 1NCUA 3P40A 4IOIB 1XGYH 2GK0B 3FB6A 3QT2A 2NCEA 3D33A 3V4PB 1OAXL 2EE0A 4K4KA 3CVDA 5HDWA 4DFHA 3BXNA 5PAZA 3V6FA 1F4AA 5E6IC 1PJ9A 2EADA 1OCWH 2BVEA 4M93B 2FDBP 1W16A 1T1XA 4ZOBA 4QRRA 2PWHA 4Z7NF 5JHBA 3ULVC 1UG9A 4F2FA 2R69A 3Q7JA 5F96H 2NW2B 4FFWC 1ICTA 4EDXA 5J11B 3QI9D 3KCPB 4L3FA 3FH7A 3G04B 5FIEA 3OXRB 2KZ1B 3F5WA 1G7HA 5DJ8B 7FABL 1E2VA 2PPAA 5D9SA 3O2VL 4KMTH 4MA7H 5D7EA 1ZA3B 4JFEA 3QAZC 1E67A 3LXUX 3RNKB 5E9DA 2D7TL 5JDSB 3FFCD 3ULSB 4B9CA 4YHKL 3ARBC 2FBJH 3MGTB 3MROB 5ANME 3PHOA 1PKQA 4Z7WA 4X83A 2FK9A 5DZNA 1FCGA 4DPRA 4PJXB 3CFIC 3BT2H 1D5BA 2QSCH 2UXVA 2J1WA 3SQBB 3KPRE 4L37A 15C8L 2ZOUA 4PJ8A 3RWCB 2VDOB 3UTPD 4CNIA 1IFHH 4B60A 4Z7NE 2BO0A 2VRQA 2ZCZA 1A02N 3B9KC 1XH2A 1U8NB 2AZUA 2X1PA 1BD2D 2Z1KA 1JK8B 1ZKAA 3M1BB 4JPQA 2VR7A 5C9JA 3QEHB 4HAKA 3NZUA 4Y19B 3QBTB 1YPZB 1BAGA 4Q4IA 4DTGH 3VCLA 4N2IA 3OLIA 4Y2OA 4PJCA 1KB3A 4PCKA 1KBWA 1D6VL 4JHBA 2VZVA 4ZMOA 4HCRL 2IXQA 1XMWA 4W4OC 3EO9L 1MZZA 4AW4A 1A4KB 4OFYD 1SEQH 2VGLM 1CYWA 4Q9RH 5T1LA 4J3XA 5LWYH 3U4KA 3OR7B 1YJDH 4AK1A 4C56B 1PDKB 4KTGA 2FHBA 3IPFA 1JZ6A 4JG9A 3EIFA 3K6FA 3IJYB 2ZAHA 2BRQA 3WFDH 5D72H 4IKIA 4UNVA 2ENYA 3MRQB 2DPKA 1HQRA 2X89D 4FLHA 4WNJA 5IV2B 3INOA 3S96A 1IAOB 1PX3A 1PAMA 5FYKH 4KWUA 4B9PA 3QDAA 1PLGH 1ZXKA 2OMXB 4NXKA 4Z0XA 4NQED 4ZW7A 3BVUA 1DQQA 1UT9A 2GQHA 4Y4KD 2R4SH 1DN2A 1KEGL 4EQ2A 4PREB 4QOKB 2YRLA 5DD5H 5INDB 2EIEA 4HWBH 1TFHA 1N2RB 1MEXL 1A6TA 3AM8A 4PJGA 5ITFB 3N50A 1UOLA 4G8FA 2W9DL 1TENA 2A6IA 4J3UA 1N0LB 1P7QD 2CG9X 2JJUA 4UM8B 5D5MA 1BEYL 1WE5A 3RG1C 1OAQH 2EEDA 1PQZB 2YLKA 1WZKA 3HNSH 1BQKA 1OP5H 3VMNA 1TLKA 2GJPA 2WP3O 1QSFB 4MA3B 4YWGL 1IC7L 4LGPB 1UD8A 4U0QB 1INQB 5B3JF 1MCEA 5KYWA 4MS6A 2OMVB 4PTTB 1GY1A 4N0RA 1INEH 1Z9LA 2V3DA 1OZUA 4OD3H 4P2OB 1DVTA 4G8FB 1BEYH 3HI1B 2ZPKL 2WWKO 5H2BB 4XBEH 3NRQA 3EG9B 2F1EA 32C2B 2IANA 3QIBA 1F3RB 4X0NA 2EDMA 3WMQA 1H3VA 1LEGB 4MCNA 3B4NA 5AW2B 1AOZA 4KBPA 3VFOB 3UG3A 4KK9D 1OSPH 2W38A 3WO4B 5DMGD 2EKJA 2MOGA 3LN9A 3RX7A 4D9LL 1RUMH 1OTUC 3ZR6A 2FL5B 1TSRA 2ICEB 1NEZA 3MRKA 3CFQA 5EO1A 1FZJB 4G6ML 3QFJE 1A0QH 4WUUA 4PJFA 5EU3A 4OCMC 3GI8H 4OB5H 1EZVX 1U3HA 2ESVD 3QDME 3UAJD 1BJMA 1YPZF 4HFUH 4HGWA 3HR6A 4UTBL 4LVNB 4OY9A 5GISL 3D39B 1FSKC 3HC0A 4KK6D 4N0FB 3KPOA 1NPNA 1GYCA 5T1DL 1ZA6A 3WIIH 5SWSE 4EI5D 3GGWB 1BP3B 4J6RH 3T3MF 3TJEH 4J4PD 1QRKA 4Y1AB 4X8XA 1YMHB 2FL5A 2J4WL 4OTXH 3S36X 4ZZKA 4KKBC 1UQSA 12E8H 1HSAA 3PFUA 4ISVB 2GT9A 1ESOA 1GPOL 2ZWZA 3GI9H 3V0WH 2BVUA 3IETB 1L9QA 3QZMA 4GS7B 3TPUB 1F6AB 4W93A 1CXEA 2JKRM 1G43A 1FFQA 2EUZA 1JXFA 1LP9A 1AZRA 4J6RL 3TJEL 4AMWA 1D9KC 3D34A 1H3PL 1IGTB 3PWVA 2MTAA 2DQUL 3AITA 5AYUL 3O3EA 1G6RB 4F27A 1C1EH 3L9YA 3ZRFC 2D7PA 5KN5B 5GHWH 2Z31B 3GIVB 4MJHA 2Z1PA 4FFZH 1AANA 3N0AA 3ISYA 4OM1L 1CVSC 3ALXA 3D3VA 3NP3A 3JQOB 3VFRB 1WZ1L 1P1ZA 2IPKB 4NM8H 4RQQB 1MJUH 2TSBA 4G6KH 1R24B 4NN5C 1IGYA 2CAKA 3SZKC 4MX7A 3HAEA 1KEMH 1JGVL 1MVUB 3F5WB 1IGTA 4IDLA 5HHOE 4XPTH 3VXQA 1M1SA 5GGVH 3WG7B 4HJJL 1G6RA 1L7TL 1H0DA 1MFDL 2FSEB 2YEQA 4FFZL 4N5EC 3CCHA 4LPCA 5L4FA 4G3YH 2AQNA 3JTSA 5KBKA 1SN0A 3SKMA 3WIIL 2UYLA 5DC0A 3II2A 3LMJH 3BVWA 2VE6B 2WCPA 3DOIA 2EICA 5I8CB 3N9GH 5EB9A 4JM2D 3TYFB 2VXSH 1CU4H 2HPTA 5J12C 1C9SA 4AIOA 4LT7A 3LRSB 1ECYA 2JQMA 4P2QB 4XPAH 3BO8B 4RRPM 3ABZA 3CXDH 2GBTA 4H7VA 4KITB 3NJMA 2LR4A 2ENSA 2FVNA 5E8DH 4WO4A 1R4XA 3MBXL 4U3HA 4M4RB 4XGZB 4HWZB 3V6OC 4GG8B 1UWEH 4GBXD 2W95A 3PV6B 4IRSA 3VCLB 1RZ7H 3MNMA 3QZOA 4KKCD 4CN6A 4M02A 3UADA 3E6FB 3LEYL 1R5VB 4TVPH 1CBVH 1DQLH 3DTDA 3VDAA 4DZBA 1X5AA 2PMZA 3MACL 1L9NA 4J3OH 2ZAIA 5CJXC 5DVLA 4ACPA 3ZJAA 1BVOA 4XCFL 4ZTOH 1U8OA 3VVVA 1N3NA 2ED9A 5D96C 3OQRA 4IRZL 3CFJA 4DAGL 4ZPVA 3MRQA 4BH8A 4GG8A 3R06A 3LPFA 5DRXB 4IBWA 3N04A 4IRJB 3IF1A 2QVIA 3DX6A 3O4OC 1SLVA 3TN0C 4Y4FD 5C92A 1AGCA 1CE1H 1XSJA 4GQQA 3EO9H 3FO2B 1FN4A 5I74B 3JWNC 1C8PA 4PW3A 2PP8A 3B2DC 1ZHNB 3BQUC 5AVYB 1T1XB 1Z1WA 1CS6A 5AAMC 1HXYB 1G7QB 1Q1JL 2BNRA 4ODVH 3L95B 1J5CA 3NIDB 4GAGH 2E9IA 5B8CC 1P6FA 1N2RA 1EDHA 5AW5B 3K71B 1ZGLM 3RTQA 2AKRA 3FQXB 5B8CA 4HOMA 1FL6B 1OB0A 2XCMC 1K72A 3KCPA 3KE0A 1HI6A 1MCKA 3NRFA 4HUVA 3GSUB 2XN9B 1OAKH 2GTWB 4K9EC 4ONHA 5H4ZA 4L4VB 1RZPA 5C6WH 3K8MA 3RAJL 4LQ1A 3U1SL 2VUKA 1EAQA 1UUSA 3I2CL 1XV8A 3B3IB 3NFNA 1C08B 5GSRB 4ABWA 1H3XA 4F15B 4QDGA 1X5ZA 3L5XH 3K72B 4NPJA 1Y0LA 5F6HJ 3TH3T 3ARUA 1HQ4B 3HAEG 4FQJL 1CXLA 4ODHL 1G7PB 1QRND 1TQBC 3MV8D 2JLPA 3MV7E 4PJ5D 3H54A 4ONHB 1S2EA 4B50A 5GRVL 1AP2A 1FAIH 3OXSA 3MA7B 1IO4C 1CR9H 5EIIG 2V9RA 8FABB 1AOHA 2OMBA 1KB5B 5EU4B 3ZZSA 3MTXA 1MCNA 3W9EA 1DVQA 4HS8H 3K8LA 2UXGA 1WS8A 3DIVA 1F4HA 1A6ZB 3CWGA 4XOAA 5DJCA 4LCUA 3IS1X 3M1BA 2D3LA 2HFEB 1L9PA 4WEUD 3GXPA 3ZL1A 1I7TA 1ZGLB 3CNKA 2NXZD 4MSWA 3MLXH 1QVOB 1PZ5A 2PP9A 3D39A 4J3SA 5B1BB 1UKTA 3IT8D 3U9UB 4PS7A 4AZ8A 2IG2L 4JR9L 5FYJE 4Z3IA 3KLQA 8FABA 4NENA 4U1GB 3UOAB 1WBZB 3GXMA 2PPDA 1GZPA 2BP8B 2NQ3A 4GW5A 4PRHD 3DRTB 4GXVL 3DOHA 4YPGB 3L1FA 3BC9A 2KERA 4HC1A 5ACLA 3ILPB 3OLDA 1AYRA 1EFXD 1NQBA 1OAYL 2GEQA 5CCGE 3DUUB 3L6FA 1BM3L 2ZF9A 3LTVA 4HK3N 4X99A 3ZE1B 2GSGA 2GY5A 2XPYA 3B9KD 4G8IA 1YEHL 5JPMB 2QPDB 1JGDA 1KV7A 2AQTA 5J4MA 4YXLH 5EZJA 1BYNA 5CSBA 1A2YB 3BWZA 4IOFC 4DKDC 3QJHA 5C7XH 1ET5A 1TCRB 2WO2B 4YE4L 5DK3A 3ULSA 2K6YA 3VXPA 2V9TA 1YC7A 1KNOB 5CFAA 4J6IA 4FXLA 1NCTA 2DJSA 4MNQD 2NMSA 3V7AG 4WCYH 5J56B 3QQNA 2FCBA 3BRFA 4IOSD 5LGYA 1PY9A 3TBWB 3TGXA 3H7LA 4PJFE 3WV0A 2DQDH 3D4CA 1E2WA 3UMTA 4XNQB 4NZRL 4LPXA 5CAYB 1AGFA 2CU9A 5CLTA 2AJXH 5I1KL 4GKLA 2WYZA 3BJ91 2GEEA 2RIKA 2BPBA 4UDTB 3TM6A 1FNLA 2IFFL 4PWHA 5A2FA 4X5RA 3U7WH 2J55A 2PXYD 5E2WH 4W9DC 4G80A 5DQ9B 2IO5A 1QQDB 5I5MA 3ULVD 1SBBA 2A74B 5HYQA 2Y36H 4YH6A 4G6AD 2AITA 4I48A 2Z31D 2Z91A 5DK0B 5JIHA 3FONA 3PGDB 1DBJH 4N2HA 2APFA 4JMXA 5FOBA 1X5LA 1BD2E 3VRJB 2H3NB 2IIJA 4S1SL 5E6ID 3NIFE 1S9WA 5L8LB 4H13C 3I6KB 1JTPA 1MFBH 1YNTF 2I60H 4XB3A 4L8CB 2A9DA 1FZJA 1OD7A 1WFIA 3ULUL 3EYSH 1O5PA 1FSKB 4PJCE 2F54A 2R2HB 1IL1A 3EFDL 4Z3HA 1W6WA 4MHHG 4PRBA 1EJOH 4F8NA 4LHJB 4PI0A 5FK9A 4U1HA 3H9HA 5IQLA 4S1SH 1IBHA 1D5IL 2DH2A 5C08B 2G75A 1RFDL 3F85A 3GSWB 3KDMB 5DRZA 3QJRB 4S1DC 2HMIC 3IS0X 4IDJL 2GI7A 5JPNB 2UWEA 5HYSB 1YEDB 5IHLB 1V54B 3VSUA 4G42A 2HCZX 1FP5A 1TJHL 5IMKA 4KKAC 2PABA 3QFJA 2ZKHH 4N0YH 4L9LA 4OCXL 1JGUH 4IBQA 5KJRH 1BD2B 2UZXA 5EDXA 4P2OC 2F8VA 3IFOB 1KCRH 1E4WH 4J3OC 5DD3L 4OH2A 3MUGB 4X4ME 5HHXH 2AK1L 3I3EA 3NIFF 5E5LA 4P57A 1UD4A 3FQUA 4J39A 4N5UA 4EUPB 1PJWA 5FCSH 1NBCA 1W72H 5EMYA 4PTUA 1BJ1J 2NYKA 1NINA 2WZ6A 4QYOA 3W57A 5HHOA 3UDWA 4YHNB 1F90L 3PXJA 4ZOEA 1KIQA 2ZOWA 4NQQA 3WS3A 3V0HA 1UVQA 4GSDH 5I74C 3FT1A 3WN5C 4ODTL 4CDHA 5BZXA 4LHUA 1P5VB 2WBKA 2Z7UA 3TH4T 4GKSA 3BQVA 4MXQD 4HF5H 4F3FA 4W9EC 4ALAL 2I26N 1GYUA 4A7TA 4B0MM 4D9QE 3UGXA 4WRLA 1DJWA 2DY2A 1KJ3H 3NOIA 4TNVF 3TO4D 4PIBA 1RHHB 3N43F 2F18A 3TT1L 1OTSC 1T21A 1LD9A 3OKMB 4FKEA 4JW3A 1URZA 4G9DA 3IDYB 3D3VE 4X6CE 3TJHD 4MYPA 5F7NC 2NY0C 1R5WB 2YD7A 1PPIA 4FXKC 2HUEA 3O2VH 3MJWA 2BSRB 3NABH 3ZZLA 2F5BH 3AS3A 1F8TL 1FIGL 1ZTXE 3DNKA 3LPOA 4HKXB 1FZKA 4AVIA 2I9LB 1KCBA 4AW7A 1ETZA 1C5CH 1IGMH 2PYED 2NY1C 5IJBC 4M56A 1HCYA 5E4OA 4HIJA 1IC5L 1K4DA 3IMUA 4QRUA 3RJQB 5D1XC 3VXME 3OGOE 1YEEL 3BGMB 4JCWA 3UTOA 1L3NA 1VJSA 3VQLA 1X5HA 5BPPA 1FZMA 5JA9A 4LEOA 1GZPB 2BP8A 2BM3A 4GW5B 3VQ2C 2WAHA 4HKXA 2CCVA 2YHGA 3PPSA 4G7QB 3X1FA 2R56L 5C0BB 1JZ3A 2YUZA 5E99L 2FJUB 4X98A 2XKSA 2V2WA 4UUJA 3NFPB 4L8BA 4XT1C 3FB8A 1JS4A 1M4KA 3VH8G 2XX1A 4BUQA 5JXEC 2TAAA 3BDXA 1ZS8A 3FHAA 1UZ6E 4DP7X 5J3HD 5EU7E 3ULUC 3HCVA 1ILUA 4FMVA 5F7YC 4NYLB 2FX9H 3U4EB 5FO9A 1NOAA 4PV9B 2GKIA 4FNTA 1HXYA 2IAMD 1T2QH 2N56A 1JXGA 3LNGA 1NUNB 5F7DB 1JDAA 5LAPA 1TYEB 2BZ7A 4LQFH 3CFMA 5AUMB 5M7QA 5T1KB 3EYQC 3DI2B 4BSWA 1S7XA 5ESVA 5B22A 1PY4A 3ALPA 2OFQA 1OLZA 3APDA 1E5BA 5HDRA 5JIMA 3RNQB 2P5WD 3GJFH 2NY0B 4NFCA 3UTQA 2IWGA 2YD8A 2H32H 5I1HH 3ZR5A 2OZ4H 2FZ3A 3FO9B 3ZDZF 4UTAH 3D18A 2DTMH 3QPKA 5EORH 3A6CL 1S3KH 3WIHL 3VI4B 4ZUWA 1CF8L 2NUTB 4IRZH 2ODHA 3E6FA 1L4IA 4JZJC 3D07A 4Z3JA 2FGWL 1ONQA 3RB5A 2A73A 5C97A 4MNQB 3U25A 3UBXB 5E51A 4FN0A 1U21A 1NGYA 4JVPA 1S7VA 4LP8A 3E8UH 1OW0C 3SYCA 1EVUA 1OT2A 1KBBA 2GJJA 5F1SA 5K59E 1TJIL 2OYMA 4KTEL 2H45A 1K3IA 2LAAA 1A7PH 4JY6B 4LSSH 3U0TB 4EOWL 4AQ8A 3VFSA 3O6FA 4L8CA 4XPTL 5DDHB 3LRMA 4OD3L 4X5XB 3ILQC 4E9QA 3VGDA 4NLAA 5DRNB 2XIIA 4XCYB 5IB5A 4UM9A 5AKSA 5GS2D 3Q6GH 4L8SC 4X9HA 3HNTL 2PP7A 3OAUH 4P59L 3VB8A 1NM9A 2I69A 1U91A 3CH8A 5FGCE 3WXWL 4NPYA 4Z8FL 2MSPA 1BDYA 3N9GL 1PLBA 5JDSA 2OULB 5CU9A 1ES0B 1Y07A 2ZXBA 3DO3A 3OZKA 4I0PC 5J5EA 1LEKA 4AIXA 1FO0B 1R24A 5IHWA 4PJIA 3QFDB 5JNYB 3W81A 3CDZB 1U36A 4PGCB 1RUPH 3JSSA 4LIQL 4RGOH 5I16B 1KZQA 1TZIB 3ARPA 4JQIL 5TQ0H 1Q0YL 1FF5A 1KWGA 4TVPE 2XBZA 3HTLX 1AZCA 1SLWA 1TIUA 2P5EE 3FSOA 4FCAA 4U4IA 3RU8H 4ODVL 2AJYH 2BCKB 1ACCA 3II1A 1ZLUH 1QEWA 4OTXL 1S9YB 4GSQA 2C9AA 2DKMA 1W0VB 5BW7A 5IB4A 5AYTA 4Z7QE 5J1TC 3CFNA 4NXSA 1YMMA 2V9UA 1O6VA 4XXDB 4Y7OC 3D12B 4M5YH 5F3HA 3JWOH 3HBPA 1VEPA 1P5VA 2N1TE 1X6NA 1CZ8L 1GAFH 2OCJA 2CA4A 2C7UB 3DBSA 4CW1B 1LE5A 1GHFH 3TEZA 1M7UA 2DD8L 2O5XH 3KYKL 4QF1B 4Y5VC 5IEHA 3DARA 1ZIBA 1WJ3A 3MYZA 4FTVA 2HT2D 2NYYC 4YQXH 3GB7A 1HYRC 3D25A 5LO7A 1MI5D 1J10A 1JWSA 2DICA 2Y07L 2D2CC 1FAIL 4MNGB 3GRGA 1XR9B 1IC0A 1D6EB 2ZUVA 1LM8V 3OD3A 2GTZA 4P2RA 3I9AA 1J5HA 1WQVT 3H85A 1BVLB 1FL5B 2UUDK 1NEUA 2XN9D 4NC1C 4H8PA 1R3LA 1E3FA 3QB7C 1IIKA 4OLWH 4JKWA 3L5WA 4Y9GA 4YLBA 2P24A 3KYMA 2FNWA 3IU4H 3O8XC 1PX8A 2AI0L 2F61A 2AJYL 1M71B 2BNUB 3RHWF 3U9PL 2QQQA 2WBWB 1U8HB 3IJEA 3NRPA 35C8H 1PZ2A 1ROWA 1CG9B 5IVXF 3L4VA 3SQOH 4WTWA 4PJHB 2WBJC 5CP7A 2BJMH 4TNWK 4RESB 5T1DH 5E0FA 4AIZA 1SMAA 5I23A 2OJ1A 6PAZA 5FGBA 1IAKB 2R2BB 3HZ3A 3PXLA 1SMDA 2AMGA 2E75C 1B6DA 2C1PA 4HPYH 5KSAD 1KG0A 1JMXA 5INCB 4TQHA 4MA8H 5FAAA 3WNNA 3IJEB 2HG0A 2VL4A 2X10A 4HBCH 1F4YH 1MI5E 1Y6NR 3DMMC 4QOKA 2WKOF 2C4FU 1JNJA 3KYOB 5DD1L 3H6JA 1UM5H 1WFOA 2H1LM 1CBJA 3CQFA 1IJ9A 4C4KO 5HHPA 5JHLH 2XV0A 3H3BC 1JF1A 1OZTG 3L1OL 4YSRA 1DBAH 3GPSA 4MNHB 4JZNB 5GS3A 2XXCB 4HLEA 4K7FB 5EZLB 4NKQB 1WVZA 3P9LB 1NANH 2W60B 4G71B 2OZNA 1I9RH 5KBLA 3EGDB 2XZCL 1FFNA 1U93A 1N5AA 2OLDA 2X44D 4M3KB 1FORL 3PP3H 3RWFA 3T0AA 3VFUB 4F20A 5CEZE 1VFBA 4M6MH 3LCYA 5LGHH 3RVVC 4N25A 2WKOA 2EUWA 3VXTA 4Q6YA 1JPEA 3QQDB 4U4BA 3T5WA 3DUSA 3L1OH 1VRSA 3RIFF 5C0ND 3O4OB 4AX3A 3CHOA 4D0BA 3Q06A 4X6CA 3D0LB 4OLEA 4K7PY 2MCMA 2B2XL 5GZOA 2CCWA 3HR5A 4MNHA 2G3NA 4AMXA 1LHZA 1TVDA 3MRPB 3ZUNC 1XB3A 2ICCA 4YE0A 1RZGB 4PJXE 3OTTA 4ZSOB 4LMQI 5EZPA 5B1JA 3K6DA 3MV9D 4ORGB 4PY8I 3THML 2DWDA 4BINA 2VDLL 3T3PE 3CN4A 4JFQB 3KNBA 4MZIA 3N85L 2ZT9C 1ODUA 1AS7A 1T5WB 4A67A 5F7KC 1UD3A 4NP9A 4Y16A 4ZO6A 3L4ZA 1JGLH 4XP1H 1DQKA 1SLUA 1UM4H 3DUUA 4HJIA 3O6FB 1ZE3H 2XOTA 3MRPA 4TUOB 4MMZB 1XD0A 4JKMA 4LLQA 2EACA 3UFIA 3GHEL 3BPLC 1W2KT 2VH5L 3MJ8B 4L4TD 2PXYB 3INUH 3WN5B 2R39A 3BP5B 5IW1A 1IJNA 3ECQA 1U8CB 1YECH 4A7UA 3E8UL 5DR5L 4IBSA 1I4FA 3U46A 1JV2A 4KK5D 3BAWA 3B2VH 3B6SA 3EJQA 5C09D 5L0QC 2ZXEB 1KPUB 2AXGB 2FEDC 3FOMA 3WFCH 1ZTXL 4JREB 1IFRA 2LU3A 3UCQA 2FBRA 1UVQB 4IRJD 2QPFA 3V10A 1X5JA 5EU6D 4XN9A 5I1DA 5EEXA 3EDDA 1GS8A 1XGYL 4AOFA 3L08A 3GS0A 3T0WA 4F3FB 5IVXB 5GGSY 2ICWJ 1MCOL 3L4TA 2XBTA 4K0OA 4Z7OE 5JORB 4R3SA 1UH2A 1VSCA 3G5XB 5E5MA 4E36A 4X6BB 1MQKL 5EC1A 2XFXB 2KHAA 5HI5D 2EDRA 2DTSA 2ARJQ 1QSZA 2OMTA 3LHPL 1PG7H 3FT4B 2WVVB 5KVDH 1NC4A 5JR1H 4I4WB 2P43B 3BH8A 3O41A 3GMNB 2ADIB 3D50A 4UB0H 1E4XH 1GGBH 1YNTA 2OV0A 3ARWA 4ZMAT 1JGEA 2CO7A 1RJLA 1KIPB 1OM3L 3EZ8A 2YRBA 3DJRA 3FFOA 3JWOL 5FFLA 4TOYL 1QSFD 4UBDC 3QZWG 3PJSA 4HSAC 4PMFA 1WFNA 5JHDA 4A2LA 5A1AA 3D85B 3BHBB 5IESL 2EH8H 3ARZA 3NIGF 5LCVA 5I8EB 2G9HA 3TOPA 4DO5A 2IBZX 3U48A 1XGRA 4P2OD 2WV3A 4HK0A 1IM3A 2H2SC 5T1MB 4RAVA 3SDYL 5IT2L 3SPVA 3TT1H 3GSNL 4FQ2L 4DZ8B 3L54A 4CVZB 2H2PD 3FS9A 4K3HA 3QUMA 4TNEA 3MU3A 5DWPA 1NFAA 4GT0A 4Y5XA 3ABLB 2VSCA 4KXAA 1TTGA 1F1GA 2MIZA 3HG1E 4Q6IB 2HLAB 2G75B 3OKEB 3SE3A 4AUYA 1RUAL 3QRGH 5L88L 3KLHC 1OCCB 3BD4A 5I0WA 1G9MH 1QSEA 1D6EA 4XC1L 1RULH 1JG9A 4YHZL 5KVFH 3U36A 3PQYD 1XHHA 4BKLA 4GSDL 1NOFA 4KJPC 4B7LA 2YQ2A 2JKTM 5FGSA 2QQKH 3PG2A 3GJEB 3PAUA 3MRHB 3I3BA 1NWOA 4W9ZA 4P9MH 1PG7W 2H2PC 4F7TB 4PVLA 3PDGA 3RL1A 1YDPB 2G3MA 3VWJC 1KFGA 3JTBA 1H3PH 1M7DA 4HU2A 1H9VA 1CL7L 4NEHB 1QACA 4TQEH 1ASQA 3PWNA 4GLRI 5D1ZB 4L4VA 3KM2A 1ERNA 2Y1AA 3QRLA 5SWSB 1RURL 2GK2A 3MRLB 1DQTA 3I75B 5E1GA 2Y72A 4WWID 1U3JA 4HISA 4KNSA 5C07B 5DFVC 1YRKA 3UMNA 2QGEA 3WMPA 1CPUA 2G4EA 4B9IA 2VR5A 3T77B 3D05A 1AGCB 5AZEL 2WB1A 3DHUA 3H2WA 4E9VA 3LZNA 3VD5A 4BK8A 4Z7VA 1JSYA 3RDTC 5I8OL 1I3VA 1CFTB 3KPLB 2QBWA 4PRPE 5FYKL 4NNXB 1QLFA 5HI5C 1I8LA 2ESVE 1KELH 5E9AA 5D2NB 5CJBA 4Z8FH 5CJXA 3VRIA 2C9VA 4MQTB 2VABB 5HI3C 1MCOH 3B1TA 4HLZH 4WI3A 1L7IL 2NY6D 1PKQB 4MA7L 3HNVL 3C5ZB 5E94A 3GBMH 4OCSL 2R0KL 3V6ZB 2FWSA 3S35X 3RWEB 5EF0A 4D0DA 1BXAA 3FK3A 3SCMA 1J8HB 4QHLB 3HLKA 5IHUH 3RI5K 3QDJE 3PAVA 3PDOA 1QHQA 4HHGA 5ANMB 1FZKB 4ELME 3GQFA 1KN4H 1R19A 2L7UA 5DO8A 3C6SB 3ULUD 4MXQC 4HUKB 2EQDA 3LS4H 4JM2F 4OBRA 4B9ZA 4OJDH 3BISA 2ATPA 1ZVSB 2R0ZH 4X99B 4TVSa 1OF2A 4KX9A 3ESPA 4NKMA 3VU2A 1BZ9B 2EIBA 2I27N 2I9TB 2HVKB 2IBGA 2QLVB 3B37A 3E38A 3VXUD 1IBBA 1XR8A 3O6MH 1NBZB 2CK0L 1O6SA 5A6LA 1L5GB 3CVCA 4PJDE 1FNGB 3WHXB 3UPAA 2OMYA 4WLCA 2XPZA 1NMBL 3AJ7A 4G8GE 4JCLA 1YAIA 3CLWA 5E1AB 5G5DB 4MJ5A 5GRYA 1KFAH 2XA8H 2D9CA 2BSED 1A6UH 3LKNB 3EKCA 4PRID 3WIAA 2A99A 3K80A 2BS9A 1Y6MR 1GTNA 5FA4A 1AGBB 1FJ1B 4NAJA 5GJSL 1HL8A 4TSAL 5LAXA 1CDIA 1K5WA 1ZT7A 4ILDA 3X14B 4JM2A 3ZTEA 2GJZB 4GAYA 4U1MB 5IGXL 4I8DA 5FUZL 1G0DA 3D2UD 2IPTL 4KO5A 4L37B 5CS7A 4YX2H 1AZNA 1S7QA 4LLWB 3R19A 3MFGB 1JD9A 1HKFA 2EABA 3X11A 1WAAA 2FECI 4JRFA 2XI9A 5FA4B 3FU0A 4ZS7L 1UA3A 1QKZH 1JK9B 3TYGH 2GC7C 4AYEC 2YO3A 2XG5B 5ALBH 1DUZA 3U0WL 4Y4HA 2N0KA 4R7XA 5EC1B 2W1NA 1NJ9B 3FQWB 5KYWB 1XSOA 5I26A 1AZZC 3DWTA 3GJFK 4LBEB 4PGDA 5IF0B 4IS6A 4YX2L 1INDH 3NIDE 3O6ML 1CT8A 1QBLL 2NYZA 4I0PB 4MAYB 4N6RA 2DLGA 4X4ZA 3VNYA 2D3VA 4KK8D 3WKMH 3ARGC 2OZ4A 4JG1H 4FX5A 5HGGS 2CZNA 4LEEA 4PVBA 1DBKH 3HE7C 3F7VA 1CDYA 5C0RL 2ARWA 4ZMXA 1PCSA 2BVPA 4FQHA 4YFLF 3IKKA 1CR9L 5TPWL 3WXVH 1YEJH 3SYAA 1FFNB 3MLZH 1MLBB 3FB5B 4Y4FA 5IT2H 3GBML 1JZ4A 4LAQL 3CPLA 1FWXA 2C1OB 4LCWA 1M05B 2P5PA 3ATEA 1T83A 3LN5B 3P9WB 5IHUL 2O26U 2VRKA 4MJID 3NACL 3QZLA 5BZDA 4P3DB 4WTQA 2N3JA 1JCVA 3QJZA 1IAIL 3X13A 3NESA 1KDIA 4K5OA 5C0CD 4A6YB 2NR6C 3US9A 3BUIA 4MJ2A 4UOW1 4X6DA 4F37F 3SGDI 4AIZB 4P5MB 4FQIL 1RJZA 2GT9B 4XNZB 3WCYA 2I25N 3L7EA 4GKZA 3P69A 4XCNA 3UBHA 4ODSH 3EOTH 4KROC 3MOAH 5SWZD 3QS2A 4WUUD 1G7HB 1MCHA 5DJ8A 2IMMA 1MNUL 1SYVB 4AEEA 4LVEA 4QT5B 1JUFA 3CSTA 4NQEA 3MI6A 4ZO7A 1A14H 4ESKA 5KYXB 4X9GA 1OAZH 3IPEA 4R7DB 3WE6A 4OGZA 2LQRA 4PB0H 3FL7A 1KYFA 3WELA 4EI5A 5B38G 5HGDB 3BIAX 4N87A 1OAJA 4MDIB 4JFYA 2VNCA 4GXUN 5IZ7A 3GO1L 5FKPB 5GZNA 5GGRY 5CHNB 1CGSL 1GGIH 2BSDA 4S1RH 4XAKE 2WXRA 3BAEH 1F45A 1HH6B 5EIIB 5BRZB 3U1QA 3VYOA 2B16A 3VWJB 1DQDL 4G7VH 2OMWB 4ZO9A 3EH4B 2BC4B 5L2KB 2WOBA 4YDVA 3S34L 3BEWB 4ZSOE 2AQ3A 1LMIA 2H1PL 4OZFA 2ID5A 1JTTA 1H0DB 3G5XA 3QEQE 4OVVA 1UGNA 5C0NC 1I7UA 4XHJD 4Y5YA 3RZCA 1U8LB 4Y9FA 4BFKA 1A6WL 3UCRA 3QA3A 4GOSA 2ZSWB 4O02L 1NAKH 1BEXA 4FFYH 4NIKB 3FUHA 1FYTA 3HB3B 3MN8A 5CLYA 3DECA 1DSWA 3KXFD 3V6OA 4Z7OB 3PNWB 1LWJA 1SY6H 1TVHB 5HYIA 4LSDA 5C2UB 4NAMA 4Z76B 4I1RA 3DTXB 4A2DA 3X1NA 5KBMA 1J0JA 3U7YH 1QLEB 4K73A 2G2RA 2P5WB 3AY4A 5DFWH 5AG9A 4QRRE 4KKCC 4B53A 3AT8A 1T83C 1CURA 1N26A 2Y7QB 3G08B 1QBBA 5MEQA 4X98B 4OCLC 4I1NB 3ZSTA 1MHHB 1J5DA 1I53A 4L1DA 1WCQA 3CXHK 4YO0B 4OB5L 5KYYB 1IILE 2YK1H 3N1FC 4LVOC 1OF2B 2BDNL 4WW1B 3ZT5A 1CD0A 1L0YA 1MFAH 3GC3A 4OQTL 2JB5L 3FO1A 4KY2A 5TH2A 4DK6A 5BJTA 4P23A 4FEMA 1GW0A 4NQTA 4UQ3A 2DI8A 3PU7A 3QYMA 1R3IL 1MQKH 3VM7A 3BDYH 3MCKA 2YRZA 2J1ZA 3UDWC 5IOKA 4HIXH 4BSWB 1NKGA 4D3CL 3TASA 3EXLA 5CMAB 1XAUA 4NWUL 3IGLA 4R3SB 5E5MB 3QXDA 3OWEA 2XV2A 1K9TA 3TLRA 2CQVA 5CGTA 1FN4B 4JO4H 2X4UB 4LLVB 4PTTA 3JWDC 2WWMC 1YY9D 4PFEA 4C83A 4AENB 2ZUUA 1MOEA 2G2NA 1XCQA 1QLEH 2WUCL 3CTTA 2D3NA 4K7FA 4ZTPL 3QO0A 5DMJB 3APNA 4M7KL 3EGSB 4QRFA 4UANA 1Y6KR 4XOBA 1HAUA 3AWEA 5DYFA 3IRPX 2AI0H 5HVGB 1F4WH 3U6RB 3AVEA 3UBXA 1TVBA 4WV1C 1N6VA 2LFGA 4PR5B 1Q0XL 2WINB 2AQQA 1U8JA 1DEDA 2JIXD 3EJUA 3NVQA 3D8MA 3SBPA 5L8KB 3N6YA 3FFCB 1V8HA 4HWZA 3X2QB 1O7DC 4KPHH 1G5AA 4OJFL 5AUMA 4JG1L 4ZW6A 2DWXA 3K2IA 3RY5A 5JW4Q 3VXRA 2VMCA 3UC0H 4M03A 1ZA6B 4IKLA 1OARH 2VDRH 5J57B 2FX8H 3LMJL 4F2ME 2CLVA 4B9KC 5I8OH 3QIBC 3G3LA 2WXFA 3KPSA 3V6ZA 1EFXA 4UMSA 1HOCB 2J44A 4FQLL 3RFRA 5KYUB 3KYNA 1ACZA 4AV4A 3OR6A 4KUCD 5E9DE 5D1QA 4H0HB 4ZFFA 4KXZH 3QUYC 3T0EB 4QPEA 1MLBA 3FB5A 3O6LL 1AXTL 1IC1A 3F8UB 1JI2A 3CZSA 1T7VA 1S9XB 5KANG 3GMMB 5C0AE 3VA2C 1TITA 4UZSA 1E30A 3L5HA 4XP6H 3UTSA 1C5BL 5DMGC 4XP4H 4NX0A 4YK4B 4BWTA 3MV9E 4E42B 3DURB 2CCLA 3EHBC 2VDNB 3NGBB 4R96A 5AW3B 3U4BH 1WBYB 2D7TH 1FNEB 4OJCA 4YGVA 1YEIL 1F97A 2YAOA 3VD1A 3GM8A 4LZKA 4PLKD 3KPTA 4YMPA 2W92A 4PB0L 1KT2B 5ESAA 3IB4A 3DVNB 1H6EA 4KXDA 2K70A 3WIHA 4GP8B 4PH8A 1P7KA 2XFXA 3E6HA 1S3RA 2QTEA 3K2KA 2B77A 4NQCE 4JFPB 3TN0B 5DEGA 2H8PA 2OMTB 4JRYE 1HXMB 4K5PA 4G9FE 4XPGL 4NM4L 4F1ZA 4MVBC 4ORZC 5BMFH 1VKXB 1JPSH 1GYVA 1YLBB 3GT6A 1T89A 2F53A 35C8L 4YPJA 4JJHA 5LQBL 2ZCLH 3X1EA 2XQYK 2WGNB 2VISA 4ZAKB 3KH4A 3QQ4A 4APQB 4WUKH 4GUOA 4Q9QH 2DWYA 4JFHE 1VCAA 2UY7B 4LLUA 4MQXD 2FAUA 5LGJA 4JFVA 4NIYE 3N06B 2HFEA 3BPNC 2Q3ZA 5I1JL 5IB1B 2CO4A 1DFBL 3MBEA 2F53B 4PJDB 2VLKE 2DLFH 5F3FA 2OSWA 3KWWB 4KZ0A 3O2DA 5IF0A 1BZ9A 5F6IB 2DEYX 1Z5YD 4ODWB 4OZIA 1BXUA 1OB1B 1UM6L 4XVSH 1NGZA 5JW3L 4CVWA 2VDMB 5F89B 4Z77A 2Z6FA 2JK5B 1QFWI 2IAMC 4E2OA 4P5RA 1S9WB 1ZE3C 3RDTB 3CFKB 5I6PA 4K55A 1NPJA 5GJSH 2PWEA 3DV6B 3NJNA 1RVFH 2XZAL 3NJVA 3OKYA 4M6AA 2YZ1A 5J6HB 3DPDA 3LKNA 1BVKB 5T5FL 3VFPA 2MH4A 4HKBA 4K5MA 5HHQA 5HPMA 4TXVB 2CXGA 4K7PX 2Y1ZA 5FWRA 4NWTH 3KJ4B 2VXTL 3SKUD 1JXKA 2LW3A 5FUCE 4AQAA 3PL6A 4LOUD 4TNGA 2HZHA 2X4SB 1WAEA 4RWHA 1PSKL 4H88H 2OTUB 1UENA 5E9DB 1ANUA 5IQNA 3CZJA 2PN5A 4HWUA 1JRHI 1WFJA 1UWFA 2NTFA 3E3QE 2R29H 4ZYKA 4PD4J 3HS0B 1BJ1H 1YUHB 4JE0A 3HE6A 2F54D 5CMAA 3GMLB 5F7WC 3RPKA 4RMUA 1IBDA 4OZGE 4K15A 3FPYA 3BKYH 3PL6B 5JOFA 3LS4L 4UDUB 2EIKB 5CZKA 4O5LH 1DUYB 1RUAH 1S7TB 3QRGL 2DL2A 2OP4H 3D2TA 3ARFB 5FEBA 4Q9RL 1QQDA 2IALB 3OF6A 1A0QL 1HQ4A 3QI9C 4HKZB 4P9HH 2J1YA 4HGWB 3SKNB 4FFWD 2CK0H 4OKVB 5A6MA 2AK1H 4HHAA 3VXNB 3JV4B 1BWMA 2V5TA 5D8JH 1EGJH 1NCHA 1OAZL 2EEAA 4RA3A 1MQ8A 5IESH 5CGMA 3SDDD 1N64H 2AK4E 3GMOB 3BP7A 4MJ6A 4EBQH 2E4TA 4LL9A 5AAWA 2X6MA 1CZ8H 1GAFL 4J3WA 4R4BA 5F6IC 2VDPL 2ADGA 4YDIL 1O5DT 4PJBF 3LKPA 3Q9QA 1JPGB 2W65A 3ZGIA 2YQGA 2NNCA 4HSCX 3QIBB 5JTWA 1H8OA 2PO6D 5BS0E 4UIKH 3U9UA 2PYEE 1LD9B 2BOBA 3SBWC 1SJXA 4FQXB 3KGUA 5E2UH 3LHPH 5AZEH 2GHZA 3S8WA 4RZKA 3S34H 3VRLF 1VFAB 4BA0A 5EEZA 3LIZL 2P8LA 3HKZA 3FT3B 2VWEC 3AT0A 2OI9C 1UZGA 1BAWA 5GGUA 5J1SC 2D0HA 4GB9A 2DDQH 2DQMA 2ZUSA 4LDCA 5LHDA 3J7HA 3BP6B 4PJAB 1E8WA 2P46B 4O58H 3HC4H 3L6FB 4PSPA 3H0TB 1OSZA 4FRWA 5L4MA 1U3NA 2A6IB 5E2UL 2FB4L 3T2NL 1SFDA 2WJ5A 1ZWIB 2EXSA 2Y3AA 5KS9E 5I1IH 3EGXA 5DS2A 4Y1AA 4KZCA 1OK8A 2VSKB 1I8MB 1KC5L 4AG4L 4WW2F 4GRMA 5IMMB 5F96L 1RH8A 3NSXA 2CJUL 4ETYA 2XRAH 1HHJB 4UWQB 3BZFA 5TH2B 1GVIA 5CHNA 2YOAA 2PWFA 4AYMC 2LLGA 3FQRA 3HBZA 4NN6B 1I7ZA 1A6PA 3D39E 1EZVY 1MZYA 4QHKI 3SKOB 1KACB 2AJSH 4IW4C 1PL3A 2CDEA 5ELIA 2KYIA 5DJ0B 3NFPA 4L8BB 3HE6D 3BAXA 3H8NA 3TBTB 4EUPH 2WQWA 3BP5A 4GRLB 4UOZA 4ZX3A 1AKJB 4L3CB 5D7IE 3QCTL 4ZRGA 5BZWB 2Q8AH 3VRLE 1PLCA 2Q20A 2PR4L 4PRIE 2MKWA 2WD0A 2J6EH 5SWSD 4FA6A 2H0EA 4P9ML 4HKJB 3KH3A 3TVMB 4NRZA 5DD3H 4OF6A 5FGBC 1MJ8H 1HJCA 3CFDB 2ODIA 1CFSA 5CSZA 1L9MA 5TE4L 5B38A 4NO0D 4F9LC 3SPVB 1GIGH 5CILL 3W82A 4DKFH 1M1XA 3RI5F 1EHAA 2V5YA 2XICA 3HC0B 3VXQB 3J8F7 2OJZH 3VFMB 1KCWA 3ARBD 2VQ4A 5LCVL 4QHNB 2NY6C 5AW1B 1IQDB 1BAFL 3ZKND 1IV8A 4YFDB 3BVVA 2R0WL 4NQXA 3O3BA 1AZVA 2C1OA 2HG5B 4MKMA 3BWUF 1LO0L 2JJTC 1I7RB 5IW6A 1YYLL 2CKNA 4XCCH 4EDWL 1A8JH 2YD3A 4ZDHB 3ZUCA 1K8IB 1BM7A 2ETWA 3G5VB 3TN0D 4R0LC 3ESVF 2P44B 3MV8B 3A5VA 1WFMA 1T0PB 3C12A 2QVFB 2RB8A 4UQDA 3CDFA 1QI3A 4XNXH 3FRUB 1ZY9A 4CAGA 5I1CH 3FOLB 1ZJBA 4N8UA 5C0JB 1XIWD 2MEJB 3JYBA 2P45B 4AM0Q 4N2DA 3OL2A 2CBOA 3G5YA 3JT2A 2F58H 1HS6A 3NCXA 4NERA 1J5OH 2WZ5A 3DX7A 4APXA 5FYLE 5KYNA 5BUAA 4LOFA 1FNSH 4W9CC 3ATBA 2E0PA 3UGEA 3N1MC 3ZTNL 3R0NA 4LLVA 4R26H 1WHOA 5GZNC 3X17A 1IKOP 3BGFB 5JZ7C 2ZICA 5FW6A 1T2XA 2ZUQB 4JKPL 4TSBL 5CEZL 4HXAL 3SDXF 2NZ9D 4OCRH 4AYDC 4EZLA 3IGKA 5AOIA 5JIIA 4L3EB 4ANXA 2CBMA 2AK4A 1TZGL 4FG6D 4YNYB 1A7NH 4XVTL 5J11C 5D7JB 1D9KB 5I1GH 3GINA 1QTYT 4IGBD 4MD0B 1TQCC 3SE9H 1CGTA 4Q52A 2XRAL 4J2QA 4ADIA 1JZ5A 2JCCF 4YR6A 3TTYA 3DJTA 1N59A 4GW1B 5FECA 3IRCA 4C57C 1YO4A 5ESAB 2VMEA 1E90A 1ZA3A 2Q76A 4XH2A 2WXJA 1UURA 3SBQA 2MQ3A 5HPOA 1NLBL 3HOGA 4HOZA 3ROOA 1MI5A 1S7UA 5H35B 3F01A 5GRJL 4ODTH 3ULVF 2VM3A 1X6LA 5KVDL 2GSIB 5CEXB 3FH5A 3H1ZA 1HI6B 1GXEA 4WNQA 2IH1B 1EH9A 1G4MA 1NCAH 1ZK5A 3D08A 3FUEA 3MO1A 4J8QA 3SYQA 2MPVA 3PAYA 4B9YA 4M6NH 1MIEL 2QZ5A 4TUKH 3UTSD 1G1OA 5D1QB 5DMIL 4AKQA 2X70A 3QUKB 2HFGL 5HXMA 1HJBC 2O6EA 2QQKL 1VEOA 3BIKB 3K5RA 1KGUA 4ZNCD 1KUMA 3WIFA 4JO3H 3UAFA 2MNUA 1TZHA 3VXRE 1NGWB 1S7WA 4PLJD 2Y06H 4BSJA 3ZQ9A 3IF1B 1JHTB 3MXVL 3HMXH 3RWEA 2G60L 5GRZA 3TT3H 3H3PH 1J0KA 5DD6B 1FL3B 4I2XA 5DQJA 2X1XR 3L48A 2W0KA 5D2NE 1NGQL 1JHKH 3C87A 4ODBD 2VDQB 4PJGF 4B9GA 3BIKA 3NCFB 4IQHA 1VHPA 1KN2H 4ONFH 3S3JA 2RFXA 2JVUA 2XHNA 4Z0BH 2EDBA 1U30A 2F68X 4J1UA 5IY5B 4TLKA 3H0TA 4WI8A 2BP5M 2KLSA 4HD5A 5D9SB 5CBEA 4LEXL 5IHHA 4OZFG 4AJYV 3BCDA 5E95B 3NZHL 2OCFD 3OKLA 1FO0L 3NZSA 4OCNC 3R7RA 2B2XH 4PW4A 2FGZA 1OSEA 5D4JA 4BFRA 4ZS6C 1JNNH 1ET7A 2R59A 1OGTA 5LKNA 1U8HA 3GPEA 1S9YA 1TQCB 4JFXB 4JN1H 4XNMB 2IDTA 2TRHA 3DRQB 1MUJA 2DZEA 1AQKL 1QZNA 2VT0A 3KPPA 1HFUA 1TTFA 2I07A 3MV01 5E1AA 2O1AA 5G5DA 1IBGL 1IGFH 4L8SA 4MGXA 2KMWA 3VFWA 4HZLB 3U82B 3VGFA 3QQ4B 4RFOH 4HJJH 3SDCC 2BVYA 4FEIA 4MYWB 1W72A 3FQTA 4PJIF 4M7ZB 1IM9A 4GBXC 4XP9L 3FONB 3PGDA 4TVPL 1CBVL 1P2CA 4H8HA 1Q94B 1IMHC 2VDKB 1PNCA 1A22B 5B39A 4H8QA 1P5UB 4GAYB 5DJYB 2VQ1B 2UWEE 1C5DB 4LSRL 4XNAA 1LDSA 4BHUI 5IUCA 1K5NA 3R1GL 2H26A 2C9XA 4U0RB 1J1OL 4KUZL 3QORB 2HH0H 3KPRD 1M05A 3O0LA 1DO5A 3WYRA 2G0LA 1MHEB 2IALA 1QSED 2IDUA 4PJ7B 4PY8J 3UTPE 3EBIA 4YSUA 1TYRA 1W72B 2WWOA 3FN0H 3PQYA 3O45A 4PJ5A 3GHPA 3IMTA 4XNQA 4ADJA 4E41A 1PF3A 2W91A 3QPXH 3AT9A 2ITDA 4GLRH 3W2DH 4F2EA 2QELA 1OALA 4NP4H 1U93B 3GSWA 2Y23A 3BZEB 3LAFA 4JY6A 4WV1B 2DQ6A 4AWJC 4X7TB 4YXLL 1DFBH 1RZ7L 4J3VA 2Z3FA 3VGAC 4ZTEA 3BZ5A 4JPSA 1GHFL 2CD0A 1NCCL 1ZS2A 1GJWA 3QHTC 5IMKB 1G4RA 2BDNH 3O45B 4PJ5B 1RUPL 2RH0A 3EJTA 1QZ1A 3QYNA 2JXMB 1PKQE 5GRXG 2NXYD 3GEFA 1O6TA 2BOBB 1GMEA 4PREA 4BFGA 3NDYE 4X6EA 5EZJB 3LZLA 4ATTA 5K9QG 3BZEA 2XN1A 4MNGE 2BNQE 3HC3L 3CPLB 1E40A 4HG4J 2MJWA 5ID0A 1O7SA 1HYSD 4AQEB 2MCPH 3HHSB 3QXTA 4HQQL 3LIZA 3RZCD 3QEQB 3L4XA 1RZKH 2IJ0C 5JXAL 4AM0B 2CH8A 1A1MA 3OC8A 3NK3A 4LLMB 3ARFC 5BS0A 3OKOB 5C0AD 1E65A 1SJVA 4KHXH 2IMNA 4E9YA 2WBJA 3MRJA 1RUKL 5JPNA 1GCFA 3HI1A 5H2BA 5TF0A 5CD5D 5KSBF 3IDIA 4MCMA 2WXNA 1M6UA 2WNWA 4Z23A 3GXDA 3RUGA 25C8H 4G7RB 1DBMH 3P11H 1LP9E 3NQIA 4JPKH 3ZE1E 1QFPA 4YWGH 1HKLH 3E2HB 2FECL 4R7DA 3WE6B 4OGAC 2OW7A 4CU7A 2QVMA 4HP5A 4U2ZA 4R4BB 2V2XB 4L9LC 2WZPD 5D71H 4YVNA 1ZV9A 4KPHL 1VACB 1F4YL 4FHBD 1SY6L 4J8RB 3SOTA 2Y69B 1ETZB 3PWPB 1T66C 4Y2OB 4WU5A 3VYPA 1KIQB 2WVVA 1ZDQA 2A5UA 3NACH 4LPUA 3SEPA 4ZXBA 2EE3A 2ZX6A 4UV7H 4AEIL 1S5IH 2YBRA 1MCQA 2X4OA 3DVIA 1EA9C 3QULB 2IDSA 1O0VA 3UTTA 2FATH 2X3BA 1X9UA 3NA9H 5D1QC 2GBUA 5C6TL 2ZONA 3QR0A 4Y16B 2FT7A 1N6UA 2ED8A 1KYOK 1MRDH 3F05A 5KSBE 1SDDA 1KY7A 4FG4A 4P23B 4XMWA 3SZ6A 2LVEA 2CWRA 3D4GA 3PWPA 4Z5RA 3IDXH 1G1CA 1W0WA 3QAZB 5DJXB 2X88A 4HFUL 4Y2NA 3AREC 3C8HA 3SDDA 5A43C 3EYFB 4JFFA 3GSOB 4DF9A 2AW2A 2VLKD 3RIFK 5C9KA 5JHAA 5T5NF 4YHML 2FIKB 2HJLB 1J05B 4JDZB 3QUMB 3BLBA 4TN9A 4O00A 3RWGB 3BEVA 4UZGA 1C8QA 4TL4A 4X5WA 2AC0A 5FHAL 25C8L 3TIDA 3BKJH 1DDHB 1HCFX 1UXLA 2EUVA 5H4YA 3O0RH 4I1PA 1GGIL 4FMKA 4A2MA 4ETQB 3D06A 4PHZA 5TQ2L 4P4KB 3PUCA 5CD3B 3IGAA 4WU5B 1DBAL 1PQZA 4XN4A 2FIKA 5TDOA 2X4QB 1NDGA 4M1GH 4CC1A 1NIEA 3WTWA 3NPSB 3VXOA 2J21A 5FUOL 1L0PA 2FSEA 1XF3A 3BKJL 2DQHL 1DJZA 3AGVA 4LEOB 5AYUH 2GITB 4E41E 2W59A 1AQKH 1T66D 2DM7A 1E9PB 3GBNH 4UQ3B 3F65A 5D1ZA 4CN1A 3SBWA 3CH1A 4A66A 4PR5A 3AAZA 3BSZA 4KQ4L 5KVMC 2BK8A 1JF5A 1MEXH 2VLRD 3WL9B 2ZWNA 3BVDB 4Z7WE 3TBSA 4XMXA 4DO6A 3I9GH 1ZLWK 5IJKA 3L3GB 2OZ4L 5E4EB 5TGBA 1ADQA 4FNUA 4HZLA 4OF0A 1Q0XH 4F57H 3MAWA 4WHTA 4EDWH 4I9WE 2D8KA 1J48A 4HX1A 5IHZA 3S88L 1G0XA 3KVPA 3QNFA 3ZK0A 4PHXA 4TLUA 4C83B 4BFIA 3N2JA 2EZ0D 3KGSA 3S5ZA 1UB5B 4OZ4A 3L8QA 3LNFA 3FUNA 5CCKH 2Y36L 1W91A 4HF5L 4N0FA 3DO4A 3EO1B 1R3KB 2ZOLB 3RGVA 5DMYA 4PJ8C 3V6OE 4HX1B 4YUEL 5IVNA 1YMHA 2PW1B 4XBPA 3RZCC 4WJ5B 3T6XA 3ZMEA 1DVUA 3P0VL 4OF7A 4NBXB 4XB8A 4LL1A 5K5YA 2K3TA 4RCAA 2FZ3B 3FO9A 3RTQC 3CUPA 5JQ6H 5F0PB 4KRLB 4Z7WF 3BPCB 4JFDA 1JZIA 4IOSA 1YYLH 3M88A 2PWDA 1EDQA 2R0KH 1IFGA 2OSLA 3HB3D 4BEIA 4XWOD 2YWYA 4M3JA 4OZHA 3W0WA 1C7TA 1REIA 1JNHB 2WVTA 1RZFH 5E00A 5SWQB 1S7VB 4JO5A 2EIZA 3WN6A 1MVYA 3MZTA 1WBZA 3ZKSD 1CK0L 1JPTL 2ZKMX 3CC5A 2XYBA 2J1XA 2YEVB 4M4PA 1QHOA 3VFVB 3I50H 4N0UB 1SJMA 2JJVA 1IAMA 4PV9A 4KXZI 3KS0H 4BQ9A 1CF1A 3ZSSA 2R8SL 4GSXA 3MNZB 1KF9B 3RKDC 1F6FB 2AQPA 1YMMB 3NEXA 2QVTA 3ZYOA 3OF6D 4C55A 3FUDA 1RJYA 3KPLA 1P4LB 5C3LD 1ORQB 2VISB 4ZAKA 4P3CL 9CGTA 3OKLB 2PCFA 2VSMB 3OHXA 3FUKA 3B2MA 4F7EA 2ZXDA 5IK3A 4ONGH 3N44B 1ES0A 4N22A 1PLGL 3UBXG 2NR6A 3HZKB 4MMZC 1MPAL 2A9NH 4LF3B 1KN2L 4ONFL 3WKQA 5EOTA 1V3LA 1G7PA 5C07E 5TD4A 4XMLH 5I8CA 1OCRB 1KPVA 1JYWA 3EJYC 5KSAB 3F7YB 1IGCH 1MG3C 3CZKA 1QMUA 4KHTL 5DT1H 4NT6B 3H9SA 1RPUA 1A7RH 1TG8A 4HS8L 2DLTA 2Y06L 4FL4C 5K9KA 3PL6D 1QPKA 2XJLA 4HEPG 4QXGH 1DQVA 4QRSA 2ROYA 5MI0C 1SOQA 1I1CA 3RURA 3WIFB 5ICZB 4GO8A 1HINL 4PCSA 4B27A 2IWFA 4LCCA 4ANWA 2W9EH 3U9WA 4CVZA 1L9SA 5DQ9A 4B95C 4AZ8B 2VLRA 1D5XB 3NCCB 1YG9A 1MLCB 4PVNA 1T03L 4WK0B 4CA4A 1UC6A 4JB9H 4LIQE 3HG0A 1H3UA 1MIEH 1WISA 1QPPA 4TUKL 2AEIT 1T20B 5BVJB 4XWOC 1A9BA 4IU3B 2OMNA 1KTDA 4AT6A 3DHMA 2ZPKH 4XC3L 1N10A 1QBAA 2OSXA 1G7LB 2MHAB 5KG9A 2A83B 3FRPG 4GBXB 2OMYB 4PW9A 3WMSA 4WGVB 2E47A 4PJBA 1E50A 4JQVA 1AG0A 3BP4B 4IGBC 5ADOH 1CD1A 2Q7YB 3FMGH 1BIIB 1M2VA 4JN1L 3CU7A 5HJBA 4WDIB 3DX6B 4KK8C 4X4YA 1JGDB 4FABL 1W8NA 5J6SA 4EI0A 1NGPL 4U1IB 4MNGA 3T4AC 4R97B 1OT1A 1ZT4A 4EXPX 2F9BT 3P0YL 4CRPA 5JW5B 2FEEL 4QTHA 3MRFA 4IBYA 4QJ4B 2DRUA 5GS0C 4XN2A 2X0VA 3ASOB 1S7TA 4WFHE 5IFJB 3MYJB 1WUZA 3NDZE 5AW8B 1XBDA 3WNLA 2EDQA 5KVDE 3P1VA 2XN9A 1FBIL 2AABH 4O5LL 5F6HI 3HRZB 4QT5A 2ATKB 3BH9A 2QDWA 1ZSHA 3SHSA 4U7MA 3FTXA 3ETBF 1N68A 1MCFA 1DQLL 2V3FA 3L9RA 1OE1A 3DOSB 1B0GA 3HUJF 4U3CA 2XXFA 2HUHA 1S4IA 1G1KA 1FAKT 4HJ0C 4M93C 4QYOB 2F0CA 4S11A 5E9NA 4FFYA 4RRPA 4C4BA 3CFTA 1ID5I 1LK3H 5DK2B 2YA0A 2FBJL 2IV9A 3F84A 3L9EA 4XX5A 2ATKA 1KCRL 3BH9B 4N8CL 1EHNA 3GGWA 3I84A 4LNRB 5FGRA 1ZVHA 2BS8A 2OMVA 2AV1B 3CXDL 3KYOA 3K6SB 4G59C 4JFQA 3MOBL 1ZLSH 3QWRA 4M1DH 1LO0H 1AXSB 2VSDA 1QUPA 1M9SA 4OV6F 1DR9A 4NOFA 4X0KA 5FYLL 1UCTA 1TZHB 1BF8A 3FQNB 4FQ1L 1X9LA 4J23A 4TPRL 5DK2A 4IBLT 1RFDH 1IU1A 1LTXA 1UOWA 4KX8A 3QDJB 3GDCA 4G8AC 5JIDA 5EOCL 3ABKB 4JG0H 3Q2CA 4OIIH 3V8OA 3A6OA 2ILLA 2Y3NA 2Z0UA 3NJFA 3NPSC 4KKLD 3HE6C 2W07B 3FSAA 5D2LF 3NEOA 4NUJB 4JCMA 3FDWA 4X6FB 5GRWA 1OL0A 1TZ8A 3GMPA 1KPUA 2XSKA 4U1KA 2CRYA 5EZIH 1ZDSA 1TQTA 8CGTA 4O02A 3OJVC 1CMOA 2DJUA 3D6GA 1CQKA 4N0CD 2G30A 1EAOA 5E8EB 3TFBA 1PW3A 1WK0A 2ZUQC 3F7KA 3N91A 3QUZA 1CGXA 1HKLL 4NCC2 1FZMB 4HSQA 3STLA 1G6RL 3RDTD 1SNRA 2EAEA 2LU7A 4XO8A 3ILEA 5GS0H 5B7FA 2HN7B 2FX9L 2WQXA 4C47A 4Y9BA 1V7NL 4TULL 4M48H 2OCCB 1EGJL 3DIFA 3PGCB 4NHUA 3C6EA 1JGEB 3P54A 3ARGD 3FCUB 4FYSA 3GLAA 4FYTA 4WEBL 1RU9H 2OYLA 1V27A 2B14A 2ZWYA 4X7SH 4FXGC 3AWFA 3V4UL 1BQRA 4EN3B 2JCCA 4KVPA 3ZHNA 1P2CB 1JF6A 3IBEA 3QNZA 3CZEA 4F9PC 5AL8A 1MPAH 2A9NL 4JZJA 4P99A 2NW3B 4N6QA 2WQAA 3DX8A 2EH8L 2NXYB 1T21B 2X87A 3UO1L 1CLVA 2ENPA 2K6WA 3MREB 4LF3A 2L4OA 1RI8A 2HWZH 1CDHA 4XGZA 4Y88A 1BAFH 4Y8AA 3VX1A 1UXMA 2P80D 2FWUA 5BO1H 1MCIA 4NSKA 4FXTA 1BA9A 4K5NA 1RAMA 1QBML 3M7FB 2YAMA 5BZWA 2FX7L 2XWTB 5DTFA 5HHVL 3MSPA 1NKRA 1XT5A 4GG6E 1Q8MA 4OZFH 4Y4FB 2RTTA 1NUGA 3PE9A 5I66A 3ULUF 2X7LA 4MB4A 1S8DB 3UJTH 1CFBA 1XTLA 1JPFB 4XRCB 1AO7A 4LDLB 4ZUTA 4YZWA 1BQSA 1J8RA 3W56A 1MREH 3KLAA 1AIZA 4KZDL 2KS0A 4WGKA 1A7PL 4LSSL 4PCYA 2WSKA 4IBTA 4XCEB 1A7OL 3Q43A 4Y1AE 1DLFH 1Q72H 3P4OA 4E5XA 1R3JA 1RK1A 2B9BA 4D8PA 1YNLH 3PWNB 1KENH 3A3YB 2EXYD 1AD0A 1MHPL 3F62A 4FHKA 3WEBA 4XNDA 1HOCA 1MH5A 1FNSL 4NO2B 2X09A 2J71A 1E4JA 1BIIA 4B5EA 3V4PH 3QIBD 1IGJA 3CSYA 3OMNB 3QIWB 5LNEA 2ZYHA 4Y5XB 4UU9B 3CK0H 2QLYA 1AACA 1KJ2B 4X5XA 4NYLA 3GBDA 2VDKH 3PWPD 5CJQL 2VC2L 2VMJA 3ZE2B 1BOYA 5EU7C 3C60B 5L9DH 3ULUE 2JB6A 4JDVA 1XH1A 4JHWH 1I1AB 2D7NA 1EEYB 1CDGA 1WF5A 1T5XB 2IWEA 3IMSA 2FT8A 3SE4C 4YSPA 1J88A 5DO2C 5DWUL 4NJAH 1NICA 5DR5H 1CU4L 3LY6A 4G2AA 3V2AR 1TTRA 2WP3T 1M7DB 8PAZA 1U8MA 2AK4D 3C09C 3GXFA 3BAYA 1AGDB 2VW7A 4EI6B 3U4BL 3IDXL 4IJTA 1S9KC 3TURA 2MRYA 2I5YH 1BREA 4NWUH 3ZO0A 1DCEA 1CK0H 1JPTH 1WSST 1U8LA 4KQ4H 5C09B 4G11A 1QNZH 2QDVA 3SGKA 4ELMA 5C8JA 4Y4FC 1OVZA 3ATAA 3RTQB 5GGVL 4I2XE 2HRHA 3A6BL 3L3OA 4I9WD 2OTWA 4KY1H 4RFEB 4Z7WB 3WEMA 1A47A 1R6VA 4R0LA 4X8GA 5KOVC 2VLJB 5BCAA 1VADA 2FHCA 1EFXB 5H37H 3Q2VA 5LGHL 3CN1A 1WZMA 3F6JA 3OAZK 2E6QA 3QUYD 2W0LA 1G1YA 4TLSA 1RXLA 4G5AA 3FXIC 4U6VL 3R0MA 3LN4A 3QH3A 3RVWD 3TVMD 2WLIA 3GUFA 1ILSA 3MXVH 3RIAK 4YHYB 5F3BB 3CN2A 1CXFA 3WHXA 3ZE0E 2QQNH 3MLRL 1JV5B 4DN3H 4NS0A 4UINH 2MMXA 3I02B 2X2YA 3MO1B 1IC7H 4Z7QF 4CMHB 4JDZA 3OXSB 2A74C 2VLRB 3AQDA 2EIZB 2Y6TE 5FX3A 4FXGA 1BG1A 3GTVA 2JLLA 1A4KA 3D3VD 4YFEA 3W9EB 4F8LA 4JO1L 4JJ5B 2EEFA 2PR9A 4Z77B 3VYNA 4HETA 4WKXA 1Y18A 4I18B 5AZ2L 2B3IA 4YZFF 1ZT1B 3CV5A 3V7MA 2FRGP 4GKNA 2IADB 3VXOB 5FYJL 3QG7L 1QA9B 3F12A 1PD1A 4YOKA 1F4XL 4OLUH 2OYPA 4HUVB 1KLGB 3DJZA 4LHUG 1I8KB 4WFGD 4E9XA 3MLWL 3D48R 3I2CH 1ETA1 5E8EA 5HVWA 4N85A 3T3ME 4UIMA 1CE1L 3P4NB 3F04A 3V0AC 1NAMB 2VQ1A 4KROB 3Q8FA 1ZT1A 3CPUA 3ERXA 2I85A 4PEEA 4JNXA 1KCUL 5CU5A 3F6LA 5DHYB 1P4BH 2IANE 1FUNA 4WNSA 1PEWA 3FBQA 2YFOA 5IHZB 1FG2B 3MLRH 1UYWL 1MF2L 2EUXA 1KIUB 1B9ZA 1DFXA 1P84K 5BOZG 3GS7A 4Z9KB 2AJ3A 3CX5J 1YUKB 1HC1A 2WTRB 1YEJL 1JGUL 4LCYA 4PRDB 2ISDA 4PGEA 3PXHA 3D18B 2DIAA 5EC2A 2ZG1A 1OTTC 2FWOB 3EBAA 3ZQXA 4L4JA 2DQCL 3VFGH 1IL1B 4O9HH 2H0JA 4G6JH 3TF7C 2H3KA 3BT0A 2R1XB 3IFPB 2J73A 4JY4B 3WUWB 4LLYB 4N2KA 1LK2B 3JV4A 4W1TA 1VLXA 2ZCLL 5K39B 1EEUA 1IARB 1TETH 4ZODA 4S10A 3P2DA 1F8TH 1FIGH 1I9JL 2FUQA 1MRFL 4HCGA 4E68A 4ENEC 3CHQA 3BP7B 1JCKA 4MJ6B 4ZAKC 5GGTA 3QUXC 3WSQL 4YPGA 3NTCH 4OFQA 4PJEE 1AXSA 2QZQA 3SE4A 4L8DA 4DWHA 2VN4A 4V2CB 3D0LA 1OANA 1F56A 1NFDE 4HWNA 3B34A 3EDFA 1AMYA 4XVUD 2B1HL 3O3DB 5C0DA 3TC9A 3UTSB 1UM4L 3W39B 1RZGA 3K4AA 1UTDA 3FU6A 2AXHA 1LDPL 5DZVA 4S1QL 5E4AA 1RK1B 1F58H 1W8OA 1H8SA 2A9BA 1JE6A 1JHKL 3DURA 4C4UA 2VDQL 1BPVA 1D7DA 3GXTA 4R5XA 1MG2C 1BMZA 5B21A 1QATA 1DLHA 2XVLA 1YUHA 3FF7A 4LSPL 4BD4A 3RUGB 4FC3E 4R2GB 2LABA 3STBA 3TEYA 1WA0X 2CO2A 2DQHH 4UQ9A 1LNUB 3WJMA 2NNFA 4N9GA 1ZWIA 5AB2A 4NNYB 4BHUA 2WIMA 1F11A 3AM8C 4M00A 1TFPA 4GKOA 1MFDH 1CXKA 2VDNH 3VTMA 4YHOL 1AC6A 4AQEA 1HWWA 2DAVA 1HHHA 4M5ZH 5I1AA 1R1CA 1IGIH 4PJEF 4M7JH 1TJIH 2CPCA 4KTEH 2V37A 3HN8A 3N5AA 1A1MB 3JUZA 1ND0A 4HHAB 1MWAA 1VDGA 3UTSE 1I9JH 3VXNA 2ZP9A 1FH5H 3TZVC 3ZRSA 4MCZB 3FUFA 4LNRA 3QPXL 4RFOL 2CHZA 1ODAA 4QJ3B 1FHNA 5DEJA 5DVOA 5HYQB 5BNXD 3UTTB 1E4KC 5E23A 4JQXC 1AGDA 2R2EA 4QNPF 1XF5A 1NSNH 5AZUA 4EN3A 1CI3M 3QNXA 5DD1H 4DAGH 3QHZL 2IDQA 3HFML 4OFPA 1E4KA 2W65B 5ICUA 2QSCL 3MBEB 1KWKA 4X7CC 3VXSE 1DN0A 2P5ED 4NRYA 5IMLB 1A4JB 4NAQA 2JELL 2YSTA 4LCIL 1CFSB 3KWVA 5HJDA 4ZUUB 5GS0D 1A4CA 5HYJB 3QQ9C 4XAWH 5KSAC 1A9BB 4IU3A 3IVKA 4XX1E 3S3BB 2X4PB 2GTZB 3E9TA 5TTRA 3HHRB 4U1HB 5T33H 1G7MB 4E9SA 3PJSB 1TJMA 2F53E 1RKRA 4MKTA 1PYWB 2E7DA 1CQYA 4OFVA 3BVXA 3AQZA 4YL4A 3RDJA 5F3BA 3Q44A 1FLTX 3BAIA 1I3GH 4MMZA 2YAEA 3GF8A 2VR9A 4N2OA 3O9WA 3PP4L 5EUKA 4W6XB 4HKBB 4PG2A 3B9DA 3BUPA 5A3IC 5JW5A 1AE6L 5E56A 2X4PA 3LQAC 3O3EB 1D7FA 2ZXCA 4QRPE 4YC2B 1G7JB 1KBGL 5HGBA 1T7XA 3OAUL 4XMPL 4Q6IA 4WU7A 5K1NA 4NQDD 3PHAA 4YFLI 4Q8BA 2AAVA 4M5SA 3M17A 4PM1A 1CL7H 2XTSA 4RQQA 4MA1C 4RAUA 2VN5A 1VIWA 1Y18B 1U8IB 1UJ3A 4I18A 4KMLB 5BRZD 5IOPA 5I1DB 3FU3A 2YA1A 4KZDH 5E08L 1EDYA 5AB0A 1CN4A 4R7LA 3RWDA 2VOTA 1ZEAH 4M3HA 4OSUH 3RWGA 1IC5H 4J3BA 5D1ZC 1V55B 1PD6A 1AC0A 4FQLH 4HA1A 1O9VA 3VD4A 3HG5A 4MDJA 2MCAA 1YZZA 4BZ1A 1OCOB 4XC1H 4TSCL 4XP5H 4QTIH 5L0QB 3H4HA 5SV4A 4OZFB 2L04A 3C5JB 3LH8A 1E6OH 1PNDA 3RZCB 3CVIH 4PS4H 3NCEB 2EINB 3MJ7A 4OKVA 2A77H 3GSQB 2DB8A 1OV8A 3KXFB 2WYIA 5HJ3B 3T77A 1GCYA 1UT2A 3MNWB 1FYTB 1MREL 5T5FA 3T1FA 4M5TA 2JE8A 1Y1DA 4YBLB 4F8TA 1XF2A 1M6OA 3LIZH 1BBDH 4HUXA 1N59B 4KQ3L 5IQOA 3DJ9A 5EZIL 5FO9B 4G72B 1FPTL 4QCIA 4WW2B 1IT9H 1H3GA 4DVBB 3MRIA 1GPOH 4UT6L 3ZKXC 2NSQA 3FFDB 1QFHA 3HVNA 3L4CA 3DXAB 5D1XD 1KCKA 4LPTA 4DP1X 4QI3A 5T1KA 3NIGB 2VMDA 5DSCA 4NQUA 1EHLL 1X4ZA 2D73A 2ZOKB 1T04B 3LZFH 3P4OB 3QDGA 4L1TA 2KBGA 5TPWH 3MJ9L 4FJ6A 4TRPL 3AROA 3JWDL 3NFSH 5DRNA 2ESVB 1CICC 3WY3A 1ZANH 2CJUH 5T3XE 4X6FA 3O2DH 4GI6A 1OAXH 1T89C 4LPWA 3IETA 4WFFE 4FHJA 2WM0A 1DZBA 5LWYL 3OZ9H 5IP4A 4GNKB 3LSOA 1VGEH 3DYPA 3VFVA 2K4AA 2CJTA 1I75A 1TEGA 2EDYA 1PCXA 2LGNA 4O2EB 4X7SL 4UU9A 5DJCB 5HHXL 1U58B 3U0WH 2DBLL 5E8DL 3PLYA 3QFDA 4Z6AT 3FO0H 3FCSA 4N2BA 2A73B 2CLVB 4PYHA 5C3TA 1VFOA 1A9VA 5HYJE 2X2IA 3NN8A 4HV8B 5ES4B 2HVKA 2F7OA 2B5IB 4BK5C 4G6FD 4CSTA 5JLZA 1D9KA 4UAOC 1I7ZB<