3D9AH

High resolution crystal structure structure of hyhel10 fab complexed to hen egg lysozyme
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
210
structure length
210
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Lysozyme C
publication title Light chain somatic mutations change thermodynamics of binding and water coordination in the HyHEL-10 family of antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2008-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d9aH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d9aH02
2E7HA 2BXZA 2VXQL 5IROA 3NFPA 1VCAA 2EDFA 3CC5A 4C56E 5H94B 1QOKA 3TIEB 5HPMB 5IBLD 5EU6D 3VRIB 1GYAA 2FLRT 2L0DA 1NMAH 2VL5A 1ZTXL 4HPOL 4S1SH 3QEGH 4GQ9L 4GRLA 1AO7E 3DX9B 4A2LA 4K2UH 3BP5B 1HHGB 4RGMC 1WAAA 1PD6A 4ZAKC 4WUKH 5FHBL 1I85C 2IAMC 4RFOH 1FJ1A 3DV6A 3RGHA 3CFKA 4NKMB 3LCYA 3SKNA 3HS0A 1MLBA 2GFBB 1BWWA 3HE6D 4HZAA 1DANU 3D9AL 3RQ3A 1T83A 3MV9E 5E8EB 2R2EA 2VKXA 3F7QA 3EIFA 1OP5K 4M1GL 1ZHNB 2HLAB 5EN2A 4ZD3L 1KLUA 4HUKB 4PJ9B 2DYPA 3E6FA 2DS4A 5FA3A 5ID0A 1PBYA 1Q9OA 4XTRD 4UT9L 5SX5K 3LZFH 3TO4A 2HP4A 3PXHA 2Q76B 1VGKB 3OGOE 4HIJA 5B3NA 3JWDC 4AYFA 4NGHH 4IIQA 5GHWH 3H0TB 4P5MB 4U7KA 3RKDC 2CRZA 3L7FB 3EDFA 5F21B 4Q58C 1KJ2A 3BDYH 2QQQA 2WIMA 3HC0B 4A6YL 2GSGA 2B2XH 3NCJL 5JPNB 1WISA 3VXSE 3QR2A 4PR5B 3WO3B 1WGOA 1FO0A 2EYTA 3FT2B 2Y23A 1GGIH 4ZPVB 3CSGA 2FATL 1IAOA 5F7UA 4YHYC 4KK8C 3WEXA 3F6LA 1U3HD 3WD5H 4DJMA 2VZ1A 4Z0XB 2J8HA 1P4LB 2ENYA 4LPXA 4M62H 4P5TC 1CU4H 5FM8A 4PJ5A 3DUUA 5C0CB 1OSPL 3G6JA 4RSVA 4ZOCA 4C58B 1D9KC 3KG5A 5JIIA 2VH5L 5MHSE 5CJQH 3BPLB 1I4FA 3RZWA 4PJHE 5FDYA 4KI5C 3QUMA 4XMLH 4ZS6D 4IMKC 5CBAB 5L2KE 1ITCA 4U6VH 2D7OA 5E6ZA 3RGVC 1B0RA 4PGEB 4GKSA 3IJYA 1ETZA 1G7IB 5DLML 4L4VB 1O0VA 3PNWA 4GBXC 3K8LA 5ETUB 3DSFL 4X6CA 3GMOA 5C8JB 4DUXA 3BUYA 3G5XB 4FG6D 4LAQL 3UJTL 3RRQA 3P3YA 3WS3A 2YS4A 3VMNA 3QUXC 1E6JH 3DV4A 4WTZA 3OAZK 1M6OA 3GGWB 3TIDB 4KVNH 4NCC2 3JTTA 4LCCC 3BP4B 4HBCL 3UTOA 4LSVL 3KLAA 1G9ML 4BFIB 1B2WH 3U6RB 2HT4C 2I60L 1A3RL 4Z5RB 4RX4A 1T1WA 1T7YA 5DHYB 3FB8A 3MLYH 4GG6A 3NFNA 4BZ1L 3L9RB 5FCSH 2NY6C 1UB6A 4HQQL 2Q8BH 4JRYA 4X7CC 3GSQB 2A2QT 3KYKL 5HDQL 1KTLB 4OTXH 3M45A 2QL1A 4QXWA 5FO8A 4HH9A 1AGDB 1QFUH 4L8SA 2HLFD 4X6FB 1J1PL 3OKKA 2IANE 5DC0A 2YWZA 4LSSL 3VFUA 1KN2H 3ZDZF 1K8IB 3IDGA 4E41E 4YXLH 3PV6A 4XCCH 1XCTB 1X4ZA 1LO5B 4I0PC 2LVCA 4DZ8B 4YEFA 2HN7A 4PRHD 3TYFB 1QSZA 4JO2H 3CLEL 5BZDA 4X0KA 3GJFK 3UTSB 5DJYA 5F9JA 3O3UN 2A6DA 5HHQA 5ITBL 5JA8B 2CLRA 3MYZA 1D5BA 3HE7D 5B8CA 1A6TB 1NEZB 1WZ1L 1J7VR 1QSFA 1EXUA 1WBXB 2UVEA 3O9WB 5KSBB 1CICA 4KKLC 3PDOB 3KJ4B 1GXEA 1C08B 4P4KA 1NGZA 1KG0A 1I7TB 4PRIA 3D3VD 2ICEB 1VADB 4TOYL 1OTSC 1A4JA 1T80A 3VH8B 3LKOB 4F2MA 5DD0L 1GGCL 4KPHH 4JR9H 3BO8B 2IH1A 5GRXG 4S1RH 5D1XD 1EAJA 4DKFL 2EE3A 2NY5L 1IGIL 2XWJB 1FFPA 3QZWB 4MS8D 4YHPA 2NY0C 4BH8B 1A1NB 4WRLA 1V7NL 1UM4H 2GJZA 3MACL 3QXAA 4JO4L 3L3DB 2AAVA 1LEGA 3CSYB 2A9NL 5FCUH 5FO7B 2FD6L 5DJCA 5C0JA 1SYSA 1KBGH 1CBVL 4OI7A 5ACZB 3CK0H 3MUGB 4CADA 4GAGH 5KS9A 5GGTL 3P9MB 3EJYC 4PRPB 1WEJL 1JL8A 3GKWH 5JNYA 3DOSA 1T3FA 3MODH 5HDLA 2I07B 1A6PA 5J11B 4LMQE 2QQKL 4LDOB 5F72S 4PGDB 4MAYB 1OWWA 3QWQB 1C1EH 1X4YA 4XP5H 3L3IB 5IJVB 1P7HL 5D9SA 3BGAA 5FAAA 4HMDA 4MX7B 4P2YA 5IB5A 3LKSA 4PJ8A 2MJWA 2NY4C 3CFDA 3GRWA 4J1UB 1ADQH 3TZVC 2CJUL 3JVGC 3PUCA 4OGZA 5GSVB 4LSRH 4P49A 2NY2C 1V7MH 4JVPA 3SJVD 2E27H 1IFHH 3DHJA 3LQZA 4MQTB 1G7MA 3RUGF 4PLKD 3RY6A 5CSZB 3F65A 4ZFGL 2GQHA 1J10A 4RMTA 1NLBH 4PBXA 5ALCH 3WFZA 5C3LD 5E56A 3A67H 3Q1SL 3NA4A 1FN4A 1A0QH 2P5EB 4R4ND 4XMPL 3SKOA 1HHHB 3UTPD 3ZT7A 4D9LH 3MLXH 5FYKE 1NFKA 3DYMA 1KB5A 5FYKU 1MRDL 5HHMD 1ZS8B 3U2SB 4B7IA 3WCYA 4JFDE 2GITA 2ZCHL 5DZNA 4K3HA 1J0KA 3VA6A 4LEXL 1MHHA 5K9KB 1A6WL 5GIRA 3X3FH 5JW4Q 4X99A 1CZ8L 4FQHA 1HIML 2PXYB 3PJSB 5JW4N 1RPQA 5L88H 5FGBA 1ONQB 4MYWB 4NQEA 1JGUL 5HGHA 2HJFA 4YE4L 1XF1A 3MBEB 2WV3A 1YN6A 2CLZB 3P0GB 4YWGH 2ARJB 5J12C 3W2DH 5JIKA 2R0LH 2DI8A 1GOFA 3LEYL 2WUBH 4NQXB 1PKQB 4WDIB 5C0BB 1IJ9A 2VLJD 1BVLB 5LQBH 1I1AB 1TQCC 3CFJB 4PRNA 5BVJB 2WM0A 4QHUA 4AT6A 5CZXD 5D4QA 2R1YB 4POZC 3W39A 3T2OA 1OM3H 3BKYL 4OF6A 3TBWA 3BPCB 1WLHA 5HD8D 4QRRA 4ZTPL 4XH2A 4Y5XA 3OKLB 4OT1L 1S7QB 4NO2B 5IW3A 4XAKD 2DWDB 5I1LB 1G6RB 1X7QA 3TLRA 4JY4A 1A9BA 3CX2A 1AGCB 2C7UA 2O5XH 5DSCB 5E5MB 2V9RA 3KPSB 4OD2B 1MCOL 2VUOA 1LHZA 3DX8A 3KYOB 4XNQB 1HXYA 1BZ9A 2XT1B 2HT2D 1K3IA 3ILPB 1KPUA 1K4CA 1NC4B 5JOPE 4PG2A 2VLRA 5IB2B 4FQPA 3MUZ1 1M7IB 1P4BL 4FFVD 4QXGH 3V4VH 1BWMA 4MJ4A 2DJUA 4HLZH 2VDMH 4K8RC 4L8DB 5IM7B 4CAGA 1GGBH 4U7MA 2A73A 3VG0L 4OCXL 4OZHF 4MHHG 3SQBA 3W9DB 4P48A 5DR5H 5IMMB 5IR1B 1CGSH 1RJZB 4TNWF 1UXWA 5JIHA 1RAMA 4QRTA 3MOAH 1HKFA 3GSVA 3I50L 4TN9A 4ZXBB 2I9LA 1FFQA 4JDTH 3C6SB 1A21A 3ULSA 4AG4L 2YRZA 4LCYB 4RFNC 3H3BC 2PCPA 2KZWA 4N8VA 1N64H 5MEPA 2FGWL 2IQAB 3FB7A 3VXNA 4UMGA 2VDPL 4ODUB 2ESVB 1RZFL 1TZIB 2W92A 3FMGH 2DF3A 1ORSB 1S9VA 3MR9A 5C86A 3I3DA 2VDOL 4RAHA 3BP6A 4XAWH 3I2CL 1R5IB 1RIVH 1LQSR 3RPKA 5DGRA 5I1IL 3G5VB 1TZGL 1IILE 3U46B 3QDJE 4LU5H 4PJEA 4XVTH 4FTVE 4D0DA 1WQVT 3NOIA 1KEMH 4YHZL 1FNSL 2WIIB 4MCYA 3T0BA 2OQJB 4JFZH 2HG5B 5A2FA 4ZNEA 1JZ5A 1Z9OA 5JDSB 32C2A 5C9KA 3SGJA 4FXKB 1FPTH 4HIXH 1QLFB 3KYMB 1AGEA 3BWAA 5DFVC 3JWNC 5DHVB 5IW1B 1CD1A 1T1XB 2VR9A 1CR9H 4S1DC 2F15A 4U49A 3X17A 4JANB 1A7RL 4NKMA 4KRMB 3JWOL 4OM0H 3W0WE 2Z35A 1OD9A 1F2QA 2ZJSL 2D7NA 5I75C 5E8EA 1KJMA 4K71C 4WI5A 1ZHNA 5LGHL 1BD2D 2B0SL 3RL2A 2JELH 1Q72L 4PJ9A 1HKLH 3IJHB 4N8CL 1FNLA 1TVDA 4NRYB 1NMAL 2ZSWB 4P9HL 4S1SL 5DC9B 4ZYKB 4P3DA 4Z8FL 5FYLH 5FM4A 4ZTOH 4K2UL 2OI9B 1OAQH 3MRBA 4LFHG 1UEMA 4UIMB 4F7CA 4KTEH 3DLQR 4POUB 3HI1A 3C6LA 3QRGH 2X4UA 4LCWB 4WUKL 3L5XL 1RVFL 1AIFA 2ITCB 1ND0A 3MRIB 1TCRA 4AH2A 3ESVF 4K55A 4YUEL 2C5DC 4G7VH 4CMMB 1NAML 3LB6D 3LAFA 1WZMA 3QEHA 1H3UA 3CX5J 4ZDHA 4OLUH 1OAXH 1HDMB 3UTTB 2FLBT 4HV8A 3PWJB 3OV6A 1I7RA 4KHTH 1GGUA 3LZFL 3SHSA 5DMGD 5T1MA 5TF1H 4QRPE 2W65A 2ED7A 4JM2A 3QNYA 1A7PH 4TUJA 4YBLC 1LO2L 2DLGA 5F9AC 2IALA 4HZLB 3TP4A 1NFIA 3BDYL 1ZLUK 5CMAA 1CTOA 1OD7A 2DIAA 4KK5D 1WAAF 5IEKB 5K9JL 2F58L 2H8PB 4ENED 2LU3A 4L4VA 1INEL 5CILL 4PG9B 1D6VH 1MWAB 2F53B 4CU7A 4XWOC 2YXFA 5C9JA 3TA3D 1GGIL 3WIFA 3MX0A 5T1KD 4P5KB 1SY6L 3WD5L 5IKCB 3UBXB 1IKFL 3BRDA 2PW2A 4FFYL 3S7GA 1JPSH 3MRPB 2AEQL 4H5SA 2G5BA 5DD3L 5FGSA 3RVTD 1A7NL 4HS6B 3JWDL 3QDGE 4XCNB 3SE8H 5HI4D 1FL3B 2JIXA 2FZ3B 5ADOL 4XMLL 4YC2C 3JV0A 2FEEL 1NCWH 3GKZA 1XGRB 4YQXL 1K8DA 2XQBL 5I1CH 4O4YL 1BZ7A 1KTLA 2VITB 3SOBL 4N0UA 2X6MA 5MEOA 1KN4H 3R06B 1QKZH 4P23B 1OP3H 3TC9A 4WO4C 3KPMA 1S7UB 3ISWA 3PL6C 4QHLB 2GYSA 1T5WB 4OZ4B 3SY0B 1LE9A 4KVNL 4DZ8A 1IQDA 3WIHH 4PJFE 1F4WL 4MWFB 3AROA 5IROC 1CD0A 3FOMA 1B2WL 3FB6B 1FVDB 2QLVB 4NYLB 3HI6L 5EIVA 3N06B 3UC0L 1QBML 2FX8L 4GRLC 1P9MC 1WBXA 1WTGT 2G75A 1AQKH 3DX7A 1P69B 3MRLA 2WP3T 1C08A 2Y25A 3W82A 2QHLA 4S1QH 2OM5A 5I19H 4MXVE 4LLQB 4HH8A 3FAWA 1UWXH 5BXFA 4JZJA 3V2AR 1QFUL 5SWQB 4H8WH 4CN6A 3MA9L 4X6CF 1CFTA 1AFVL 2OP4L 5L0QC 4G6ML 1W72B 1CN4A 1PEZA 4NP4H 4E0RA 1KCVL 1IC5L 4PJXA 5BV7H 1MJUH 4NZJA 4LVOB 2YHGA 2CLVA 4J8RA 3MTRA 1SJVA 3UYRL 3S4SG 4XCEB 3CUPA 3KNBA 5D7JD 4QHMB 3S4SB 5E8PB 2HMID 5T5FH 2UUDH 3RX7A 3TO4C 3KPLA 2BHYA 3L3DA 5C0FA 3ZHKA 5M95B 1GC1H 1S7VA 3DURA 5FO7A 3SGDH 4GG6F 3RPIB 5GJSH 1J18A 1WC7B 3FQTB 3VDCA 5ENWB 3N1MC 2C4XA 5C0BD 2ED8A 4NQCA 4P4RB 3SCMA 5EU3B 5EFIA 5LCVH 4X6DE 4XC1H 1N4XL 4JR9L 5CJOH 1QO3B 1DQDL 3S37H 2MFNA 5CEXB 2G2RB 5CKGA 1DL7H 5DRXB 3IXAB 3L7EB 3WHXB 3OKEA 4XHQA 3B4NA 3E3QC 3U7YL 2ZUSA 4HKBA 2EH7L 2X4RB 3D25B 5A2LH 2AERT 5FA4B 4G43A 1MJJA 4Y4KB 4WWKB 4M1CD 1KBGL 1AI1L 3KPRB 1X6LA 4KQ4H 3MRRA 1KJ2H 4JVUA 1D6EB 5F6HJ 3BGFC 1S5IL 4G9FB 3MODL 4KI5E 2GSIA 1CGUA 2QSTA 4EI5A 2BNQB 2IJ0C 3HTLX 4XP5L 5E03A 4NRZA 4C4KT 2UY6A 1OTUD 4AEEA 1OHQA 1FO0H 2DD8L 3LSOB 1BX2B 2ZCKH 5JOFA 3QIWA 4PV8B 1WFTA 1QEWB 3RP1A 2VN4A 4OZFB 5SWZB 2QBWA 4D3CH 5FFLA 5DD6A 4D0CB 4QKXB 3MLRL 5FYLD 5I2IB 1FNEB 1T22A 4GG8B 3QUMH 5GGVL 5KJRH 5ALCL 1BVLA 1WBYA 3EOYG 3BYTA 4DWHA 5GGSB 1I1RA 1AKJB 1GZPB 4JB9L 3QXWA 4GS7B 1U8HA 5C0RH 2VABB 3RTQC 3BKMH 4UNTA 2VXVL 5IMKA 4DTGL 5F7EH 1C5DB 1YPZE 1L0XA 4XPTH 2BOBA 1MCDA 1SJHA 1G7JB 4RIRA 2X4NA 3U4AA 5TE7H 2X1XR 1KIRB 2HJKB 1QNZH 1BBJA 1OF2B 3PP3H 3RAJH 3NVQA 3VXMD 3X3FL 3HC4H 1U95B 3G5YB 4MAUL 1TJGL 1G6RA 3P11H 5L88L 2X4PA 1OB1A 4G8FA 3TT3H 3MRGA 1YEJH 4X8JA 4G6FB 2HRPL 4KROB 4YWGL 3IU4H 4RMVA 1BHGA 1CFSA 2R0LL 4WEUD 4XNQA 5SX4H 5MEQB 1A4KA 4N0YH 1RU9L 2YD9A 4FQLL 4J4PD 3H9SE 4MQXC 1BIIA 3HCVA 5DMIH 3FFDA 4WUUB 3WSQL 1TETL 2Z92B 4Z7UB 3QH3A 3WXWH 2DQFB 4X6BA 2B8OT 2YN3A 2DDQL 2I27N 5F9DC 1HQRA 1RUPH 4OZFH 2NCMA 4ZSOB 4FQXB 3MGOB 3W9DA 5IR1A 3QI9B 2R2HB 2Z8VC 1CGYA 2BVQB 2UZIH 1NBVL 3L3HA 1BVKB 3HG1D 4AZ8A 4YDLC 5BZWB 4JFQA 3GB7A 4WFHD 2FO4B 1H8NA 2QQLL 4LHUB 3H3PH 2IWGA 4X7DC 4NN5C 2XWBA 2CXKA 1S5HB 1INQB 2I26N 1U92B 4P9MH 2J3SA 2XZAH 3B8YA 4HKXA 3QISA 4HUWA 3VFRB 3OAYK 1DBBL 2WP3O 4HX1A 1TZHA 1VENA 4AY0A 3V4VL 4IS6B 4V2BA 3WJLC 2J1KA 4QOKD 1P2CA 1GH7A 3G5VA 3IU3A 3BMVA 3HNSL 3UTTD 3P30H 2LU7A 3BWUC 5E99L 5GJTL 2W0LA 4LDLB 1SQ2N 1ZSDA 3PP4L 4GW4B 4KGLA 2D7TL 3KYNB 3L5HA 5F93C 3T0AA 4OKVA 1CDIA 2NLJA 4HAGA 4PJ8C 3PWLA 4WCYL 3TF7C 4UINH 2J6EL 5DDHB 3MCKB 3C60B 4FN0A 3V6ZA 3QFJB 1N64L 2C1PB 5BRZE 4OZIA 4GMSL 3U0PB 1Q9LA 2VERN 4BUGA 2BVOB 5DHVA 2X05A 1PEWA 5D7LE 5CFHA 2HH0L 4NUJA 3MNWA 4YLQT 5L8KB 2DQIH 2EC9T 3EOBB 1AR1C 3O2VH 4W6XB 5FIEA 3W11C 1TNNA 1YZZA 1I3RB 5F1IB 4XAWL 3QRFM 2V9QA 2PYEB 4Z7WE 3AY4C 5I1KH 5FGCB 5FECB 1U8QA 4LU5L 5I16A 3GSOB 4K8RL 4Y7MA 1A6ZB 5I8CB 3U9UB 3LKRB 4GO6B 3IJHA 2ZSWA 1CLYL 2A74B 5HYJD 5D1ZB 4KWUA 1LE5A 5CSBA 1NUDA 1R3HB 3N1FC 4XP4L 2HYMA 2JCCB 2WINA 1S7RA 5FHAL 3GRWH 1NCNA 4U33A 3OGCA 3HRZA 3GMPB 1BJMA 4LRNL 3ARDC 3FQRB 4YZFE 5IHUH 5C6TL 4MMXC 4HIXL 3C2SA 4HWNA 4U1GB 1BPVA 4TVPH 5DEGB 3BEWA 1IL1A 3AC0A 5EBLB 4DGIH 1X5KA 1NL0H 4P46B 2DQGH 1DQLL 3RIAF 5DWUH 3ZE1F 3O45B 4PJDB 5IWLA 1F4YL 4P23D 1J86A 3BE1H 3Q48A 1JNLL 1CXIA 2X1QA 2KPNA 4W70A 3EO0A 4R90H 5DRWB 3VXPA 1C12A 2JELL 5D6CB 2MCPL 4RBPK 5I18H 4PJEF 4C57C 4C4KO 1I9EA 4LLUA 3ECBB 4N0FB 4X4XA 2OMBA 4ONFL 3MLWH 5FYLL 4LSPL 3IDJB 3DXAE 4ZTOL 3MV8E 2P8LB 5D96B 1H5BB 5A16A 1ZHBB 4Q97A 2R39A 1DQJA 1IGCH 3QWRA 4O02H 5DS8B 3T4YB 2VDNH 4M8QB 5DUBB 3I75B 2DYPD 1HN1A 3RDTA 1FG9C 5EZIL 4WJ5A 2H2PC 1IGJB 4N5UA 1QFPA 3NAAL 5GQBA 3EJZD 3STZB 1MWAA 5DT1H 5C07B 4LPVA 4ODWB 4Z7OE 1OAXL 1F42A 5J56B 4PREA 2Q8AH 3QP3A 1IEAA 3T2NH 3VFPB 4P5KA 3MGAA 5J9PB 3IVKA 2Z91B 3CZJA 1P4IH 5T3XH 4F8QA 1MCWM 2F19H 1IC4H 5J6GA 3RY4A 1L9NA 1JHKH 4KHTL 2YPKB 5HYIA 4KZEL 5KSUA 2JB5L 3B5TA 2YC1B 2UV3A 3ARGA 8FABA 1N5AA 1PZ5B 1HWHB 2MWCA 4TULH 1QBAA 1HYSC 3MYJA 4LASL 4F7MB 2NX5B 2V7NB 1KGCE 1DVFA 4RGND 2K3TA 5BS0A 1XGRA 1SEQH 3NTCH 4AJ0A 4ESKA 1HOCA 2Z31B 2DQDH 3VXRA 1DDHB 4HCRH 4PJ5D 4Y1AA 4I77H 3VFGH 3I3BA 5FM5M 2HFGL 3AU1B 4MB4A 4AENB 1HNFA 5AD0A 3SGEI 2X4QB 4QHLA 1P7QB 4OZ4A 1KIPA 1X4XA 1IAII 5T5NG 1JPSL 4OCMC 4X4MA 1YNKL 2FL5B 4PRAB 3FB6A 3O3BA 4LF3B 2OS7A 1TJIH 1U9KA 4PUBH 1MQKL 4RCAA 3BSZH 3MV7B 1N5YH 4NYLA 5DFTA 3SE8L 3DX6B 3MXVL 2GK0A 4JM2F 1HI6A 1DSFH 4FS0A 4JO3H 4Y4KD 1NCWL 5F71A 1HSAB 4UILH 2X40A 4G6AC 4AEHL 5I1CL 1MI5E 1CK0L 3QJFA 3TYGL 2HT3D 4YFLI 2O26U 4H88L 4I48B 4L3EB 3JZ7A 3SGJC 3TNNA 3CPLA 1EJOH 4OBRA 5E1AB 3BXNB 3D6GA 1A1MA 5C0DB 5K9QI 1C16A 4RX4D 2LAGB 1WWWX 1EGJL 4OCLC 5HYEA 3BZ4B 5FDWA 1YN7B 3V4UH 2GJ6E 1RULH 1G1YA 4W4NA 5BW7A 5JA9A 3QEQA 3K1DA 4NSKA 4XHJC 3WIHL 1MFDH 3WV0A 1JGLH 1TVHB 4AL8H 2X10A 5INDB 1MIEL 3O3AA 4NZTL 4U2ZA 1DE4A 5D72H 3DO7B 2P8PA 4XCEA 1GAFH 4JFFE 4PJ9C 4N8PA 2FB4H 3RWGB 1JVKA 5SWZD 4PYGA 4W6WB 2ADIA 4R2GB 1U58B 4F7EB 2QADB 3NIDF 4NC2B 2WWMD 3KPPA 3TWCL 1JYNA 3BHBA 1I8IB 5HI5D 5I19L 4OIIH 2YN5A 4U1LB 1BFOA 4HG4J 1GCFA 2BMKA 3V95A 1QSFD 2UYLB 2LQRA 1XGPB 3I6LD 1G7HA 1TNMA 4HK3J 2GI7A 2X1PA 4Z7QF 1CICD 1VFAA 2ZG2A 3LKNA 3QUYB 3QNXB 4NO5B 4ORZC 4PRID 5ESQB 2VDQL 1RV6X 3TT1H 4D8PA 5BV7L 2H6PB 1MCWW 3QEUB 3S3PA 3QXUA 2Z93B 2GTZB 1X5XA 1UKQA 2FWOB 2FYYA 5I1GL 3LMJL 4Y8DC 4WWKA 1N0XL 5AG9A 2OMNA 3EO9H 4JY6A 2Y72A 4X6EA 3PQYA 1D6EA 1Y6KR 5I15L 3OKYA 3VE0B 5IB1B 3DWTA 5CGMA 4I5BA 4PD4K 1JGEA 3MRDB 2V5TA 1S7WB 3ZE0E 3U4EB 4JN2B 2RFXA 5A2JH 1BMGA 2PTTA 2B1AL 1TQBB 1IQWL 5FB8A 1ZA6A 3GI9H 1HE7A 3SKMA 2PO6D 2X7LA 1IEBA 5E2VL 3MRHA 3WNPA 1OVZA 4PJXF 3QI9D 4KJQD 4YJZL 5BJTA 4PV8A 4Y2DB 1H9VA 1AHWB 4NNXB 4PY8I 4DUVA 4IHOA 2AXGB 3S35X 2YA1A 3M1BB 3VFOB 4F58L 1ACZA 4Y4FA 1BZQK 2DTMH 2ZSVB 1F11B 1UM6H 3IDMA 1FVCB 1HCFX 5D7IE 4HIEB 3RVXD 4Z7VB 2VLKA 5C08A 4TVPD 1F3RB 2JLLA 3H7BB 2OL3A 4EOWH 1ZGLB 2BSRB 1C5DA 2XN9B 3EZJB 5TQ2H 4Y8AA 2FJFA 5EIQA 2DM3A 3O4LB 1CE6B 5GS2H 2ZCKL 2BX5A 1R3JB 1HQ4B 1Y0LA 1ZVYA 3EDKA 1ZEAH 5J0BA 1EFXB 3LRHA 1KPVB 4N0CC 4G6KH 3NMEA 1PJ9A 2BVEA 2XFXA 3MXWH 3QQ4A 1G7QA 3WFHB 4D3CL 4F8TA 4ZFOB 5CEZE 1RZ8B 4OAWB 2EDNA 4PBVC 2R0ZL 3LV3A 5MEQA 4P2QA 3QUML 3I9GH 3O9WC 1QSEB 4KHXH 3KJ4C 3OF6A 4QXTB 5IMOB 4OLYH 4OSUH 4WW1A 4P59H 4KRLB 2J88H 5C0RL 4NQED 1EVUA 3BKML 4M03A 2P5WE 5HHPA 5F7EL 3S97C 4DKEH 4L29A 1U8JB 3OR7A 1BQUA 1QNZL 3RAJL 1OW0A 1PDKA 3X14B 4YGAB 5C6PB 5IK3B 2JB6A 4DKDC 2MKLC 5IP4A 3KPNB 4KKNA 1YMMA 5JTWA 4L3AA 1BVKA 4YXHL 5T3XD 2C9AA 3OJDA 3ZKXB 1NFDA 4GAJL 1HILB 1XFPA 3WL9B 5FKPA 5GGRY 3NIFF 43CAB 3VXUD 5J06A 4QNPE 5KG9B 3BT2H 4MJ6A 5HHNB 3AREA 1MCRA 2V2XB 2EDEA 4JHZA 4PJ7B 5D7SH 4HXAH 4ETYA 3H9HB 5E6IB 4Z77A 1EEYB 4NO0A 5EORL 4WIQA 1J0ZA 4V1DE 2NNAA 4NZRH 4Z7NF 1YEDB 4IS6A 4MJIB 3QFDB 3LIZH 3DUSA 1U8LB 1MHCB 1ES0A 1IARB 2AK1H 4JGJA 5MENA 5EC2B 3WFCL 1JF1A 1E28A 4X7FC 1FYHB 5J11C 1RUQL 2AK4A 3SE9L 4MAYC 1JNNH 4X5XB 1RUPL 4H0HB 3ARBB 5F1KC 5BVPL 1YEGH 3BD3A 2UWEF 3GFUA 3WNLA 1RZ7L 4KMTH 5D1QB 4XC3H 4X9IA 2XKNB 3S96B 4KJWD 5DDHA 3MCKA 4L5FL 1H0DA 2C1PA 5D2LE 4Q74A 3FB5A 4P9ML 5ANMA 5AYUH 1T7XA 3HLAA 2D7QA 1XMWA 2D3VA 4LSUH 3G6JE 4ZFZA 5GZOD 4Q7DA 2NXZD 3RZCA 3FO0H 4PJGB 4U1MA 2E9WA 3CJJA 5H2BB 1U8IA 3RU8H 3OAUH 3P30L 4YIQA 4GOSA 4R0LA 1AXTH 1NBZA 4C56A 1HXMB 4XPBH 3FFCB 2NYYD 1KT2A 1AO7A 5C09B 4RA3A 4E9LA 4LPUA 4NOFA 2XZCH 4NCC1 1OQOA 2HFEA 4R96B 5I8OH 5MP6H 1ZV5A 4CKVX 4PB0H 5CEYA 2PXYC 3GMPA 3CDGA 4G8IA 5FOBB 4Y5YB 3BZEA 1KSRA 2R0WH 4UIKL 2BSTA 2I5YH 2H9GA 5DEGA 3T77A 3MBEC 4IM8A 1XGTA 3VJ6A 3L3OA 4JHAH 2DQIL 4UTBH 2K7QA 3L3JB 4J3OC 2DKMA 4OI9A 4JHWL 4PJBE 5DK0A 1YYLH 1PSKH 1K4DB 4HJ0D 4PJDA 4Y2OA 5BMFH 1I1AC 5DQDH 3MV9A 2BVTA 2A6IA 1P7QD 2X4SA 3QIBA 2A9MH 3UJJH 4UV4H 2Y6SC 5D6CA 4XZUB 3GUTA 4FQ1H 3O3DA 3VWKD 3AB0B 3FRPA 2R23B 4QT5A 3TVMB 1F2XK 1BQSA 5EDXA 4JFYB 4PJCE 2HAZA 3V6BR 1MFAL 3GRWL 4R7NB 1EMTL 3VXTB 1P84K 4YHKH 1KJVA 3T4YA 3ZHLA 1B0WA 3D2UA 4M8QA 1N8ZB 3O6FA 5TE4L 4MD5B 2VIRB 4JPVH 5EPMA 4OZIF 2X4OB 1GSMA 2YPLB 1J9CT 4DGIL 1I3UA 2D03L 2D7PA 2VJXA 1VKXA 4ODBD 5E94A 5HY9B 1FZOA 3STZA 4Z0BH 3TV3H 4NQDE 5DWUL 1RZKC 5DJ2B 3BJLA 3HMWH 4YR6A 4JQXA 1MCQA 2VZSA 3BE1L 1SJEA 1H3XA 5J9PA 1TITA 3C6LD 4LMQI 15C8H 3C08H 1KB5L 1MFCH 4Q9BA 2HVJA 4OFYA 5HHOB 3MLWL 1XIWB 3NGBC 5DJDB 3VD7A 3S35L 4F7MA 1D3CA 3GMMA 3SPVB 1IGCL 3MRKB 1MEXL 2VDNL 4ZXBC 3MZGB 3GHBL 1FAKT 1MLCA 5C0GB 3D18B 1G0YR 3D0LB 3VGAB 3K81A 2YD4A 2VZVA 4JM2D 1KXQE 3LS5H 4HJGB 4ISVA 3IXTB 3P4NA 3U1SL 4GRMA 1DUZA 1RJYB 1CLZL 1PQZB 2Z8WC 3QA3A 2Q8AL 1FNHA 1JP5A 3AS3A 1P4IL 5T3XL 1A14L 3NPSB 3MRQB 4GRWB 3GJFA 3T1FA 2FL5A 2CGRL 3EYSH 2ZCLL 5TFSH 3MV7A 2AJUL 1UM5L 4HWBA 1S9YA 1UCTA 3TNMB 5E00B 1HEZA 3VFVA 3KPOB 7FABH 3FQWA 3L1OL 3L3KA 3HPJA 3IFLH 4G80A 2P8MA 2DQDL 4YDVA 2GT9A 4ODHL 4JFEB 1ED3B 1X5YA 4I77L 5A1AA 4BFEA 2C1OA 5E1HB 3D85B 2JIXD 2N7AA 5DD1L 5JMRA 1YN7A 2CXGA 4E41A 1ACYL 1QHPA 4B50A 1VFBA 2CQVA 4XXDA 3B9VA 3D39B 4OCWH 4P2RB 3RL1B 3U83A 3C09B 1QHOA 4DCQB 2E7BA 5INDA 4QF1B 5I1JH 1SBSL 2IBZX 3DO7A 1CT8A 4MJ5B 3VCLA 4PUBL 4HGWB 2OK0L 3BSZL 3DRQA 4KQ3H 1IVLA 2VWEC 1JIBA 3E8UL 3EDJA 5DD5L 1MAMH 4OJFL 5DRZB 4JO3L 4TSBH 4ZS7L 4M9OA 2QSQA 1FYTB 4PBWD 3VGGA 2EIBA 1T21B 1CLCA 2OI9C 4ONHA 4H0GA 4XPHH 1BREA 1I8IA 2OJZH 1P6FA 4OQTA 3ARZA 1A5FL 4XNMB 4CVXA 4YHNB 1EJOL 1L4IA 4KVCH 5DZOA 4IOIB 4U05A 1EA9C 2UVFA 4UV7H 3IDIB 2XRAL 3BEVA 4JLRA 3CFIC 4HKZB 3CMGA 5TDOA 3OX8A 4XXCA 1R3LA 4M3JA 1RURL 4BKLB 1RULL 4HUXB 4HKJB 2MTPA 5JQ6H 3UPAA 1MFDL 1JGLL 1QRNE 3VXQA 4AQ1B 3O4LD 4AL8L 1IGYB 4LSTH 3SGKA 5D72L 1X5AA 3QEUA 5KVFL 3OKOB 1YECL 3MV11 2E6JA 1U8OA 3CAFA 1BP3B 5IFAH 1XF2A 5JW5B 1QBBA 2CDGB 2VB5A 1RFDL 5KTEL 3FQUA 2B1HH 1FNAA 1EH9A 5FOJA 4JJ5B 2JJSC 2K1MA 2YPVL 4ZQKB 4OIIL 1NDMA 4IRJB 1QSED 3WFBH 1YYMH 2H32B 2YMXH 2BC4B 3T08A 3VE0A 3RDTC 2V17L 1BF2A 4OCYH 1MHEB 4RWHA 2BDNL 1MQ8A 1S7WA 3E1F1 2IFFH 3K46A 1RZJC 3EDDA 5SWSB 4NQSA 1FAIL 3DMMB 2XOTA 4U1HA 2NY1D 4K23H 2AKRB 4AK1A 1T1ZB 3SCMD 5HVHB 1DQTA 4Q6IB 1G7LB 3EOTL 4G7YH 1YNLH 2VLRE 2BJML 2XACC 3T4AA 3MZTA 5KSAA 4KGJA 4NFBA 1IE5A 4G42A 2R8SH 2ITDA 4NJ9L 3RWJB 1DBMH 3N0PB 5DFWH 1DN0B 3T3MF 1CXFA 1E4JA 1RZGA 5EH1A 4CNIA 5IG7B 4HHAB 4HS3A 1YNTB 1WT5A 2CO7B 4QY8B 1T5XA 3F12B 2EXWC 4JFDA 5KN5B 1EJ6A 4FABL 3QHTC 1LP9E 2WNGA 4K94H 3X3GH 1WIPA 3FKUS 1ZT1A 4G8GD 5F8QC 1EFXA 2VLJE 4ZUSB 4IOFC 2ZOLB 4TNVF 1FG2B 1EO7A 2V2TB 4K7FB 2EIZA 3P4MB 4OD1L 4UT6H 4EI5D 3DPBA 3EOAB 1T66D 2F8VA 4ZFOA 5HGBB 2BFVH 4Z95L 1L7TL 5DJXA 4C59B 3GI8H 4KZDL 3NCEB 3GSNB 3LH2L 2ICWB 2C3HA 3P9WB 3QIWD 2F54B 3ZDXE 4QXTA 1AXSA 2W0FB 4R3SA 1HZHH 4H25A 4YK4B 5CIPB 4ZNEE 3P0VH 3OKMA 1DFBH 1TVBB 1VDGA 4BA8A 3CFBA 3KPTA 1NAKH 2ATPB 5ADPL 2FRGP 4FQ2H 5FXCH 3RWDB 3WFEL 4NWTL 5GGTA 2CKBH 1MVFA 5JDJA 1AD9B 1ZEAL 4I3GA 5B38G 1FIGL 4E5XB 5C0NC 3U7WH 3X11A 4LBEA 4K9EC 4LVOC 1CGTA 5IIEB 1HH6A 2APBA 1R5WB 1WBZA 3BN9C 1UACH 1INDH 5F96H 2L4OA 1U41A 3U4BH 4I0CC 1DEEB 2WK2A 1IT9H 3WO4B 2DIJA 3GMQB 4XPGL 1J5OL 3I9GL 1CQKA 1LK2A 1BGXH 1T0PB 4OLYL 4OSUL 4P59L 3E6HA 1RHFA 3BD5A 4XI5C 4X4YA 2BNUB 1OGAB 2J88L 3QFDA 1I8KB 1U8LA 1MHCA 3B9KB 2IBZY 4M6AA 4GUPA 5HI3D 2AJYH 4LCIL 3MOBL 4W4OC 3PGFH 4PFEA 2VLME 5IQ9A 1X5HA 5GS1B 1T2XA 1J1XH 1NBQA 2IQ9L 4XBEH 3HNVL 1CQYA 4UDUA 1R6VA 4U6XA 3CMOL 4YXKH 3ZYJA 2AGJH 3K4ZA 4HWZA 2VTFA 1FIEA 4BELD 4APQB 5F3BB 4RGOL 3DGCR 1MRFH 3VMOA 5FK9A 1HINH 5E5RB 3TBVB 1EZVY 4NT6B 3FN9A 3T0EB 1U91A 2CK0L 3BT2L 5CIPH 3QG6B 4WWKC 1QA9B 3UJIL 4BH7A 1IGMH 4ELKB 1CL7I 4HXAL 2ADJB 4U1KB 5C0CE 2NR6D 1OAKH 4EIZC 5B3JF 4OV5B 1HHIA 3RI5K 1HWGB 4OFIA 4PJIB 4FP8H 5JZ7C 4NKOA 3QDJA 4DOHB 4L3CB 1JNNL 4FTVA 2Q1EA 1NGYA 2CDFA 3D69B 1L0YA 3WS6A 2VXSH 2FBJL 1UYWL 4AM0B 4BJLA 5E6YA 1P7KA 1NCCH 5KVEL 4XC3L 4L4VE 1G9NC 3R0NA 5F1SA 2ZUTA 1UWEL 3RVUC 1XIWD 3QUZA 1CDGA 5ISZB 3WFDH 1A7OH 4BQCA 4DN3L 1UC6A 3C5ZB 3BRFA 3TPUB 2ZZUT 1NFDF 5EUOB 2LTQB 3MLUH 1BEYH 5AYUL 1Q0YL 4LLYA 1KEGH 3ARFA 4PGCA 5EUKB 3DVIA 3O2DA 2P44B 5LBSL 1DQQA 3W0WA 1I8LA 4AIZA 1K4DA 3SQOH 2EDKA 4MXQC 5KBNC 4LLVB 4ZO7A 2FX9L 4RZCA 5HPOA 2EC8A 3OZ9H 1U8NB 1AC6A 3RU8L 3OAUL 3UYOD 1AXTL 3VWJA 3MFFA 3WKML 1L9MA 3PWVB 4O58H 3RWIB 1FFNA 3UZVB 5T3ZH 4B5EA 3ZSTA 1Z0MA 2GK2A 4GH7B 3ARVA 3MRFB 2SEBB 1R0AH 2R23A 3OG6B 4XPAL 3TJEH 4XVSL 4P57A 2ZUVA 1W0WA 4YPGA 5I8OL 5MP6L 1EHNA 2V2WA 1YC8A 3QPQD 1UCBH 5DQJB 2QKIA 4NKIH 2I25N 5ICYB 1N8ZA 1MAJA 2VISB 2X4OA 4KROC 1IM9A 3LEXA 4DAGL 2XTJC 4WW2F 3FTGB 1IGFH 2J8UB 3LD8B 1YYLL 1PSKL 3HA0A 2HTKC 4K7PX 3UTSE 4OM1L 4PS4H 1TTGA 2H2SC 5I8KH 3D85D 3VXOB 4LSQL 2FIKB 3SGEH 5B4MC 4JDZB 2A9ML 2FEEI 3UJJL 4UV4L 1T89C 2KKQA 5KSBE 4Y19B 4Z76B 5ECJE 4L8BB 2YD1A 4JCLA 4MB3A 4Q2ZA 1IAIH 4YDKL 4M7LT 1FZMA 5DMJB 1XF4A 4QRPA 3QDMD 1OW0C 3KHOA 5CD3A 3GO1L 4FQXC 5KSVA 1FFOB 5HGAA 1JZ8A 1YEHH 2AQ3A 1KELH 2OZ4A 3SPVA 3I6KA 3MRKA 3RVWD 2JTDA 4OCNC 1BF8A 1FBIH 4JPVL 2YUZA 5DJ6B 5C0GA 4MA7H 2RCSH 3O8XB 4KK6C 3Q2CA 3UXFA 5DEFA 4KY1L 1T2JA 3MCLH 2WW8A 5IVXB 2AJSH 5FYJL 3PWPB 4F9LA 1R3KA 4PYHA 2PTUA 3Q5OA 4NQVB 2XICA 1RJYA 3HMWL 5GGQL 1PQZA 2A83A 5DA4A 3V0WH 4EUPH 3EHBC 1Z5LB 4PJAB 15C8L 3C08L 4OGAC 1F13A 4Y16D 1MFCL 2C3VA 2DQUH 3LPFA 4LOUD 2WUCH 2Q6WA 3MJ9A 1F02I 4ALAH 4PRPE 1KJ3H 3QDGA 1YEEL 4X4ZA 2YEZB 4P2OA 3C5SA 5E00A 12E8L 1G6RL 1JHLH 2Z4QB 2EDJA 4RAUA 1VGEL 3C60C 4DZBA 5IB4A 4KKCD 4H20L 2EZ0C 3ARGD 5IHZB 4LIQH 1JWMB 1J8HB 5JHDB 2P1YA 2YKLH 3DJ9A 4IJ3B 3LN4A 3LS4L 4M43L 1DVFD 2J8OA 5E9DB 1HK6A 5BS0D 3O0RL 1CD9B 2EKJA 4D9QE 4KDTA 5EO9B 4PJFA 4RISH 3VXRD 2GW5A 1NAMA 4Z78B 4H1LB 4QRQB 2IPKB 4JN1L 1GL4B 3EYSL 4R0LC 1TTUA 3B2UC 1I7ZB 2DKSA 5TFSL 4FFWC 1M71B 4LLWB 3NBNA 2P5EE 2XPGA 5D1ZC 3DVNA 2ZG1A 1CIDA 2NZIA 4PJHF 43C9A 5JW3H 1FYTA 1NDGA 5EC1A 3IFLL 1O7SA 1MI5B 3V5KB 4OIAA 2Z8RA 3CH1B 4YHNA 4XNMA 5CAYB 4R26H 4U1GC 2WBWB 1V3KA 3BZFA 3QULA 1EHAA 2ZKHH 1YEKH 1F4HA 1MOEA 4P46C 1AXIB 4ZAKA 2NXYB 4HF5H 4MSWB 5L8JB 2IAMA 2OTUB 4WGVB 2EE6A 3GBML 4B53A 3KS0H 4JDVA 5K93A 1PKQE 5C0BE 1KYOJ 3WLWD 2FJGB 2AP2A 1KCSH 5ACLA 2GCYA 4KQ3L 5T5NF 3OKDA 1DBKH 3AXLB 1JUFA 4DVBB 5LG1A 3GSRA 1HSBA 4JQVC 1T04B 5JW5A 4L4TB 3QEQD 2LAAA 5IVZB 1F4XH 5D96C 4N0RA 1H5BC 4ZPTB 3ZT5A 4KJPD 1CWVA 5EWIH 5ESAB 2Z8SA 1WITA 3C8KA 4KVCL 3OQ3B 5INCB 4ETQB 2OBGA 4RRPG 4X6DA 4LHQB 2EO1A 1JHTB 3HUJB 2P7TB 4NWUH 2OJEB 1EHXA 3ZKND 3Q6FB 2IADB 1NH6A 2OXHA 3PGDA 4H1LH 2W0KA 4JHBA 1DUYB 4WY7L 5SWSA 2EEBA 3ALXA 2PYFB 4TUKH 3KPSE 4LSTL 4NM8H 1B0GB 5F1OB 3V7AG 1Q9KB 4MQSB 5A2KH 4BSVA 1QYGH 1YUHA 2N1KA 1KTKE 3KYAA 1UB5B 4R4FL 3CX5K 1Z3GH 2UZYB 4H26A 4U7SA 3FO2A 4U1NB 5I1DA 1GHFH 4CW1A 1MFBH 4IEFB 4P5TA 5I1AA 1B4JL 2MCG1 1CCZA 4UTAH 1D9KA 1G7PA 5CJ8A 5DUPH 4EI6A 1U42A 1YYML 5EOTB 2EDHA 3P0YL 2XV6B 2Z31C 5GISL 4YHLH 1R24B 1CDHA 3GIZH 3THML 5IEHB 1BBDL 2IFFL 3RGVA 5JMOC 3SDAA 5F7HA 2H3NB 4F9PC 5CINH 1MH5B 2Y36H 4YHMH 1RK1A 3PQYD 5LGKA 5AZEH 2ESVE 1YY9D 1GRWA 2PF6A 5ERWB 4EZMA 1QFHA 1X44A 1S8DA 4ZUSA 3W5NA 4N5ED 1FG2A 3TBSA 1YNLL 5HGDB 3SDDD 4M3KB 2IPUK 3QUXA 1H3GA 1IAKB 1WFOA 1HH9B 4A6YB 2A0LC 2CMRH 2VUYA 4APQD 5T3ZD 4LCCA 2L7UA 4JE4B 3PF2A 2P43B 5ID1A 4KXZI 2VXQH 4Y4HB 1RMFL 3KS0J 5TH2A 1A9EB 1DBML 5CD5C 3T0ED 1LD9A 5EBMA 5L9DH 2AEPH 4K7PL 3CVHA 3EJJX 1ZTXH 4WHYH 3TO2B 4GQ9H 2DQJH 3DROB 2EEAA 2NZ9C 2O61A 2JK5A 3HR5A 2ZPKL 1F45A 1MWAL 1YPZA 3CU1A 3RWDA 5MERB 4JPWL 1FLRL 3C9NB 5D5MB 4MNHA 4XCYA 5B38A 2VLKD 2HKHH 3GJFH 3U0WL 4U6HB 3RJQB 3U36B 4PLJC 2D7MA 3RNQB 4I0PA 2RR3A 4IRSB 4QRSB 1NC2B 2PW1B 3D9AH 3GI8L 4HWBH 1MF2H 5EA0L 5IF0B 4K3DL 3PHOA 3VDAA 3N50A 4M1GH 3O6KL 4WI8A 4R2GC 3H9SA 5IHLB 2A1WH 2VWEE 2MPAH 2QADC 1K85A 1HZHL 1ZHLA 2CIKB 4XMKL 4KV5E 3V0VB 1CXLA 1BQHG 3UP1A 3P0VL 3CFCL 1OGAA 3IJSB 3VI3E 3OJMB 3V4PL 1EAPB 1NAKL 1WWAX 2NY7H 4WFHE 2CRIA 1UJ3B 4PGJA 3IETB 4KJYA 1T0MA 1BVZA 1AQDA 1XR8A 3H7LA 1V05A 3FCTB 4KKBC 1ZLSL 5CJ5A 3QUKA 5GS1A 4LCWE 4OF7A 3OF6D 5DYOB 3FO1B 5C70A 4C55A 3QUYC 3BAEL 3NCJH 4GT7A 4NPYA 5DO2D 1JV5A 1JYWA 3BKCL 1E27B 1U8MA 5IBTL 4LLDB 5EIIA 5F3BA 4M6OL 1UACL 1INDL 4GKZA 4OGXL 3B43A 4U1JB 1I9JL 4OLXL 3U4BL 1UADC 1K2DB 3UTTE 1IT9L 4JRXB 1H3PH 5ICXB 5GS0C 3Q3GA 2QR0A 1BGXL 3EYOA 4D9RE 2A38A 3VI4E 1YMMD 1L6XA 3QIUB 4NFCA 2VH5H 4YBQC 2MSPA 3CLFL 5ELIA 4PJIA 4QWWC 4JRWA 4N68A 2PTVA 3LKPA 2AJYL 3LKQB 5C0AB 3D69A 2YWYA 3K4DA 3ARED 4WU5B 2BY2A 1W72L 1TQBC 5IFJB 1FH5L 3O3EA 4NO0D 1MUJB 3TJHD 4K9EL 1ORQB 1F3JA 2F53E 1LEKA 3HPLA 3SDCB 4LAQH 5MEND 1WFNA 4Y2DC 1MRFL 5BRZA 1AHWC 1B3JA 5J3HC 1VEMA 2AK4D 4BSJA 5KSAC 3VD4A 3RWCA 1KIQB 3JVGA 5D7LA 4EXPX 1Y18A 5EU6B 1LGVA 4HBCH 4LSVH 1G9MH 4M61A 3B5HA 1BQLL 2I60H 4EKXA 4HUVA 4HMEA 5HHXL 1OP3K 4K07A 3GMNB 1NMCB 3SDYL 4FXLA 2EYRB 1J11A 1ZKAA 4R4BB 1PG7W 3F7YB 4MVBC 4BZ1H 4ZFFB 2DN7A 4XBGB 3PWVA 3AS0A 2AS5M 5JOEA 2LABA 4HQQH 1JE6A 5MI0B 1GJIA 4MNGB 3DYOA 3KYKH 4NDMA 5HDQH 3MNZB 4D0BA 1A64A 5DGQA 3SDXB 1OCWH 3VFTA 3RZCD 3HE6B 1J1PH 3DUHA 5JXEC 4RQQA 1EV2E 3G08B 1KXVC 3L3GA 1A2YB 4C56D 1BAFL 1IMHC 4RNRB 1ZWIA 5CZVL 1LK3L 1XF3A 1UWXK 2VKWA 2UY7A 3V6FB 3BN3B 3TCLB 3CLEH 1AO7D 5E2UL 3B3IB 5DTFB 5GGSY 5ITBH 3A6CL 3RHWF 3OR6A 3VXOA 1WZ1H 2FIKA 3D87B 3BH8B 2BRQA 2NY3C 3I02A 5FYKH 3AMKA 4L8BA 4UNVA 1U3ZA 4M7LL 1AY1H 1U8PB 1AGBA 2CSPA 5EO1A 4TOYH 3UMTA 3JV6A 4G5ZL 5FUZL 4MXWL 2UUDK 1KPRB 3DXAA 3MBXH 3MV8A 1FDLL 1FFOA 2VR5A 3HI5H 1XGQA 3MV9D 5DD0H 4ZUUB 4ELMB 3QIBD 5M7QA 1UCBL 4NKIL 1U3HB 3ZKQD 1FL5B 3ZKXC 1N59B 4NNPH 1IGIH 2EIEA 3QT2A 4PS4L 3P2TA 1JGDA 3NA9L 3MRMB 3TN0D 2AABL 3BP7B 4NQVA 1CE1H 5E6IC 1V7NH 3MACH 3UZQA 4BUHA 3GSWB 3O6FD 4QCIA 2X41A 1CBVH 5IVOA 2OL3L 3RWEB 4MA3B 3VXSD 4XRCA 4EN3A 1J1OL 3GMLB 5GGTH 1J12A 3P73B 3ARBC 3DBXA 25C8L 3UDWC 4O9HL 3BKJL 4TTDD 4LEOA 2YSSA 4IRZH 5D1QC 1YEHL 4F15B 3HAEG 2QQKH 2F74B 3IAPA 4DK3A 3FT4B 5DURD 2MHAB 4M5YL 4L9LB 1FBIL 3BQUD 2X42A 5TE6H 4OFYD 5EU4A 5KAQG 1IGTA 1T6VN 3O6LL 3KVQA 2D9CA 4MCZB 3P77B 5CGTA 4OZGB 2R1XB 2AJSL 2CJUH 4UUJA 5I30H 5J57B 1B6DA 5GRJL 4GMTL 4HT1L 1KCUL 5E2TH 5ESVB 5L2KD 4HFWB 3GBNL 3V5HA 4F7PB 2EDYA 1U93A 2IC2A 2XQYK 3VRJA 2DQUL 2ADGA 3KPRE 1JN6A 5T1DH 2DOCA 4I2XB 4J6RL 4ALAL 5F7DB 3PE9A 1EEUA 3Q1SH 3WS6C 4G9FE 5L8LB 1ERNA 1IBGH 1XAUA 4C54A 1KLGA 1MFNA 3BVNB 4XMPH 2YXMA 3PG2A 2DLIA 1ZT7B 5C71A 5GSRB 2BNQE 4HIHA 3GJEB 3QUZC 1MRDH 1UXSB 1VFMA 1MI5A 4PRHB 4E42B 1YDPA 2ZCHH 3WUWG 5HBBA 3D48R 4I3RL 2HTLD 3EYUL 4CVUA 4Y5YC 3QAZB 3L5WA 3KLSA 4LEXH 1I1YB 4EJ1C 1WVZA 1XT5A 4PGZA 1CZ8H 3CZFB 4KKAD 2WANA 3HE7B 4XVUC 2EKSB 2GJ6A 5SWZE 2KUTA 1I8LC 1JGUH 2W38A 2CUMA 4XB7A 3DETD 3PP3K 4RISL 2VZ3A 1F6FB 3D3VB 2WBJA 4ZNCD 3FJTA 3O4OB 5BO1H 1S7XB 2GEEA 3W9EB 1IM3B 4JFFA 5IOPA 2IAND 4UBDD 2DM7A 2ID5A 2AJZA 4E41D 1EK3A 1JRHL 3AB0C 1WCBB 4XT1C 3TVMC 3UPRB 5HYQB 4ZUTA 5D1XB 4G8EA 5JW3L 1TPXC 5KVDH 4OGYH 3BKYH 4MD0A 1OGTA 4ZPTA 5A3ID 2CDEB 4FXGB 5ESAA 4ZTPH 3SO5A 4OT1H 4PPTA 2OJEA 4XBPB 5T1LA 3O2DH 3FT3B 5KANG 1DUYA 5IW6A 5CHNB 2IMMA 1BFSA 3WHE1 3CDFA 5EZLA 1MCOH 1ZLWH 2DBLH 4PJFF 5EZOL 1I3GL 4N1EA 4QGTA 3CDYA 2X1OA 2W9DL 1DBKL 1Q9WA 4X5WB 1BJ1H 4FHBD 3N1PC 3OKNB 1IC1A 1P4BH 3VMPA 3BW9B 5LGJA 4OUUB 4WUUE 4TTGA 3LQAC 4IRSD 4Z7UE 3AGVA 4YBHA 3CFEA 1RZIB 3EUUA 2DQCH 4NHCH 5EOTA 5F89A 2MKWA 4MXVF 4ZSOE 5CP7B 1WSST 3VGAC 4HK0B 1SEBB 5FO9B 3SJVB 4AG4H 5HXMA 4HDIA 3O41A 2ERJB 4WI4A 1N0LA 3IGAB 1I3VA 2FGWH 1N6QL 1GPOL 3QWOB 4NM8L 4YO0A 1S7SB 2VDPH 4PP2B 3EDEA 5J6HB 1ZA3B 1KTDA 5ERWA 2AXFB 1QTYT 3NPSC 2DQTL 3ARYA 1ZVSB 3DHMA 3EFFA 3KWWB 4QTIH 2VDOH 5F3HA 2I24N 3TGXA 1GHFL 2C4FT 4KRPC 1MFBL 3N1GC 3NCBB 5HHMB 5I1IH 1TZGH 2DAVA 3BIKB 2EDQA 3FONB 1BLNA 4KK9C 4UTAL 3ARUA 4XGZB 1A9EA 4X98B 1FORL 5D7IA 2OZ4H 5L6YL 3V5DA 4YHZH 3ZO0A 3GIVB 3QPXL 1YEFL 3EYFA 4PRDB 4U3CA 3T8XB 3OB0H 3QIUD 5DRNB 1AD0A 3GIZL 3DROA 4X6DF 2EXYC 5CKAA 1K5NA 3A6OA 3CIQA 4JY5H 4RFEB 3MUJA 1NGXB 3QFJE 5CINL 3AAZB 1L6ZA 5DHXB 1U36A 5AZEL 5ITFB 3WE6A 1J8KA 2VLJB 3P4OA 3C09C 3FQXB 3GDBA 3SKUD 1A7RH 2V7HB 3G6AA 4JFPB 4WO4A 3JWOH 3MRCA 3PL6A 3LN5B 2CMRL 5FYKD 2ADFL 1A7BA 3EO1B 3RNQA 2FO1A 1JWSB 2ZJSH 2PYEE 3OHXA 4Z9KB 4G9DB 3V6OC 5FGCE 4JFDD 5B39B 1LEIB 4LLMA 2CRYA 2W60A 5LGHH 1PGRB 2B0SH 5J89A 5CLTA 5L9DL 4EVNA 2AEPL 2ZOKA 1Q72H 1XGUB 2CIIB 1ZVHA 3C5JB 1CL7H 4LQFL 3MGTB 4N8CH 2ZUQB 4P9HH 1BJ1J 2DQJL 3L95B 5DQ9B 1P9MA 3ZYIA 3IJSA 4Z8FH 3IFPB 2P5WA 2JCCE 2HFFA 1BQHA 4KI5F 4B0MM 4UDTA 3ULVC 1SMAA 3IETA 4DKAA 2K7PA 4QTHB 4JKPL 3HMXA 3GM0A 3VXUE 4PB9L 1YQVL 3L5XH 1P5UA 1RVFH 1S7TA 4U0QB 3MREA 5C0IA 2HKHL 4YUEH 5F7WC 4GW1B 1NAMH 4YDIL 1HHJB 1PYWB 4KC3B 5E8OA 3RJDA 1BOGB 4PJDE 2VNCA 1ZT4B 1XH3B 4RMQA 2AW2A 3Q5YA 4LVEA 2XNAB 4HWBL 1MF2L 1KCKA 3OXRB 2BVPA 4PTTA 2HVKA 4GXUM 4GW5A 2A1WL 2MPAL 2KBGA 4FQQB 3WBDA 3S8WA 4P3WA 5DJ8B 4F7TA 4IRJC 4V1DA 1ZMYA 4TUOA 2NY7L 1LO2H 5TDNB 4JFXA 5ICZB 3T09A 1YPZF 4UQ2B 3F8UB 1MVUA 5K9JH 2F58H 2R2CA 1S9XB 5JOPD 3DMMC 2AJ3A 4IDLA 1DP0A 5FKAB 1KUMA 4HG4K 4S2SB 1INEH 5CILH 5TDPA 4JPKH 2BSSB 1EX0A 1A6AA 4QHNB 5TQ0L 1QR1B 5HVHC 4Q6IC 5C07E 2FH6A 4JG0H 5D2LA 4LKXA 3X12A 1H3PL 4GBXB 1SY6H 1KIQA 4PIRF 1IKFH 1LO4L 3SE4A 4FFYH 4JZOA 1I1FA 5EBWA 4WNQB 3QHZH 2GKIA 2Y5TB 2AEQH 5J1AB 2E9IA 5DD3H 4OQTL 5DJZA 2XWTB 1UZ6E 1A7NH 3H3KA 1K6QH 3JWDH 3MMEA 2NX5E 2EYRA 4EDXA 4L4JA 5ADOH 5EO0B 4ZFFA 3B83A 3Q0HA 3VFWA 4LP4A 5EB9A 1MIMH 1MFEL 4YQXH 1D5MB 1SJXA 2DLHA 2XQBH 4XPFH 3SDAC 4I4WB 4O4YH 3VFNB 2FEDC 3SOBH 1Z2KA 4BK4A 3SDXA 4KMLB 5GZND 3MJ8A 3QDJD 1XZ0A 4PRBA 1N2RB 1CYGA 4FTVD 3SKJL 1RUAH 1BD2B 3RWHA 2EDBA 2EEDA 3V6FA 2RBLA 4MDJB 1F4WH 2NMSA 5IJKC 1SYVA 1WJ3A 4PJBA 1OSZA 1J05A 4X9BA 5DTFA 3RIAK 3GMRB 3MV7E 3BOVA 3HI6H 4CJ1A 5GRZA 4ODXA 3UC0H 3DTXB 1QBMH 4NUGL 5HVFB 2FX8H 4YK4C 4MNQB 1QVOB 5CGYC 2GY7B 1UH3A 4JFOB 5I17B 1N6VA 3ARFD 3REWA 5KANI 4L3EE 3EYQC 3W0WD 1O5DT 4EEEA 2AJXH 3RTQA 1OCWL 4PJCA 4UQ3A 2FHBA 3P9LB 5HDOA 4U1IA 3C2AL 3MA9H 1RHHA 2PNDA 4ELMA 1AFVH 3VWJD 3RIFK 3QG7L 2OP4H 4G6MH 5CUSL 2HWZH 1N59A 3EGSA 1KCVH 1IC5H 4O2CB 2VZOA 4IMLB 4UU9B 3UYRH 5DC4B 4LVHB 4NQDA 3QYCA 1OLLA 1NEZG 3QHFH 1WV7T 2X4TA 5F1NA 3FOLA 3LHPL 4IDJL 1Q94A 4Y5VB 2OR9L 3CVHH 1ZHKA 3G04A 5F7YC 5F7LB 5C7XL 1MCNA 4Z7WF 1A02N 1OAYL 1T20B 3NN8B 1U8KB 5GGRA 5FYKL 2BOCA 2R9HD 1LO3L 3B9KC 1IM9D 4ZO9A 1RJCA 4F57H 4TVSa 1AY1L 1ULVA 3VH8G 3KLHD 1VFUA 5GS1C 3MBXL 4MDIB 1NCAH 3U7AA 2FX7H 3HI5L 3TA3B 4NKQB 1N4XH 5T1KB 1J87A 4NN6C 1DQDH 3HAEA 2G9HB 3QZWG 4L9LA 4NNPL 5I8EA 4YZFF 1FL6A 4ZFOL 5JLZB 1F6AA 4QRUB 3TFKD 4MCZA 4QRPD 5F9WC 2E9BA 4UI2A 4WFFE 3U7YH 5IMLB 4N90E 1CE1L 4K3EL 4LRIC 2EH7H 4U31A 5EU5A 1HHKB 2BNRB 3BH9A 5GGUB 2R0KH 2NW3B 3RWFB 4LGPB 3IDYB 4XNYH 3TZVB 4Q9CA 4TRPL 5D8JH 1AI1H 1UQSA 3QO0B 2D31A 1T1YA 3HB3D 3MA7B 3WJLA 1S5IH 3TPKA 3QNZA 4IRZL 4MD4A 2GTWA 1PW3A 3U0TB 2ORBL 4O2FB 1MCEA 2DD8H 1XR9B 5TE6L 3C5ZC 5EZJB 3GK8L 3VGFA 1VFOA 2LTQC 3WUWA 5IGXL 5I30L 4WU7B 5B22A 2R69L 3PGCA 3HE7A 4P2OD 5H8DA 2YR3A 5E2TL 1P1ZB 3QCUL 1QQDA 3RBSA 3DGGA 5I1HL 4Z7OF 3NCMA 2YOCA 4JZNA 1J0IA 4JAMA 1CDBA 4OLWL 3D3VA 3MLRH 4O2EB 5T1DL 2HJLB 3GEWB 5GGVH 1S7XA 4K3JH 1RK0A 4Z7VE 5DMKA 3AY4A 4OF0A 5CCKL 1IBGL 2ENSA 1WIUA 4JB9H 2ARJQ 5EBGA 3S5LG 4ZUWA 3UPRA 3ESUF 3S5LB 2VXVH 4DTGH 2XN9E 3BGMB 1WF5A 3FZUC 3O4LE 3TBTA 4R97B 3KHQA 1SMOA 5D7JB 4MAUH 1TJGH 2AQ2A 3ARDA 1B6UA 1FZKA 5F9OL 3LD8C 1WWCA 2HRPH 1U6AL 1T6WA 1W0VB 1QRNA 3FHQA 2BCKB 2APVA 1M05B 4WVRA 1N3NB 4RBPH 1RU9H 5BO1L 1QSEE 2IPTH 3PABA 4FQLH 4QYOA 5JO5A 2GAZA 1AE6H 2XA3A 2X2YA 2Z9TA 3RUGB 4JG1L 4ZAKD 3WSQH 1TETH 1XCQA 4FQCL 2D0HA 5KVDL 2IAMD 4OGYL 4KXZH 2DDQH 1NJ9B 1C5BL 1TDQA 2Q87A 4YPJA 9CGTA 5JPMB 4C83B 2I9TB 1ZGLM 3O8XC 1YMHB 1NBVH 2A6KA 3EYVB 5D93B 3O2DL 3JUZA 4JPIB 5H37G 2W0PA 2W9EL 1FRGL 3ZKMC 4GKNA 5DJAA 2QQLH 5AG8A 1KFAL 3X13A 3FQNA 2IPUG 4LLAA 1S7SA 2DBLL 4KFZC 4PP2A 4CUCA 2AXFA 1DBBH 1DLHB 4PJ7E 3RKDD 3KWWA 4KUCF 3LRSB 3F58L 4EN3C 3BMWA 4MJIE 1K9TA 3JUYA 4NO3B 4OLZH 1T7ZA 5E70A 1FCGA 3HNSH 1UVQA 2OYPA 3FN0L 4X7TA 5E8NB 1JWUB 1C7TA 5E99H 1AGFB 5GJTH 2DQEH 2APTA 3KDMB 4BZYA 2DQCL 4NHCL 1GZQB 3MROA 3PP4H 2D7TH 1H8SA 3T8XA 3DNKA 2Q86B 4KK8D 4LKCA 1JNHA 1CDUA 4WCYH 3M8OL 2J6EH 3T65B 2QQNL 3SE3A 3HZYA 4P5TD 3RVVC 1D9KD 1VACA 1LP9A 4GMSH 2NW2B 2VLJA 3B6SA 2ZG3A 3UTQB 2HH0H 2Q7YA 1YY8B 3FQXA 4QTIL 4KI5D 4PY7B 1N6UA 2VE6B 1ITBB 4LCUA 3EO1A 3IDNA 5I2IA 3A6BL 1JWSA 3RGVD 3STLB 4PJGE 2X70B 3IFOB 3MJ6A 1CS6A 4GBXD 5CWSB 4K8RH 2OZ4L 5FF6B 3VXMB 1JZ4A 5H94A 3KXFB 3TIEA 5HPMA 1JPFB 3FFCE 3VRIA 2B4CC 1CLYH 3QUXD 4GSDH 4HAFA 5C09E 4I9WE 3DX9A 4XP4H 5FHAH 3CCHB 4JY5L 5GPRA 3BP5A 3TESA 1HHGA 2ATKB 3BDBA 3ZE0F 3PHQB 4LRNH 4OZHB 4O51B 4QTHA 4HFUH 4R8WL 2HT4D 5C6TH 2NXYC 1CDJA 3CD4A 5IFHH 2QSCH 5GXBB 5KW9L 2NTFB 2WBJC 1DQLH 2NY6D 2GFBA 3QJHB 3IF1B 3MJ9L 5LAXB 1F4YH 3MRJB 1S78C 4NFDA 5I1EL 3KPQB 4U3HA 1JNLH 1MREH 3OXSB 1CFNB 2HLAA 3OXRA 2MCPH 2FHFA 1CL7L 5A43C 3RX5A 4J23A 5D7IF 3ZYZA 2F9BT 2Q76A 3HG1B 4ONFH 4I0PD 1VGKA 1MSPA 1OTTC 3JTSB 4LSPH 3VU2A 2C4FU 4YHIB 3H0TA 4P5MA 4UT7H 3L7FA 5TDNA 4MNQD 4UQ2A 3HC0A 3QQ9C 3H9SD 4KI1A 1S9XA 4F80A 5EZIH 2YPLE 5JPNA 5FKAA 1OAZL 1S9WB 1X5ZA 4S2SA 3NAAH 3HZMB 4QHNA 2R4RH 4PR5A 1QR1A 4KKLD 4RAVB 2P24B 1KV3A 3B9DA 3FT2A 4QOKB 4YHOH 4ZPVA 3HC3L 2DMCA 3UAJC 1OTSD 1TFHA 3GSUB 4L8CB 4J7RA 4PP1C 4Z0XA 1P4LA 3RKPA 4U6YB 2G5RA 4XNXL 5C0CA 4KZEH 5HHOE 2Y5TA 2JB5H 3MJ7B 1H15B 3MQIA 1A6UL 3D0VB 3T0DA 3HZKB 4LASH 3Q6GL 4HBQA 3MRNB 3QQ3B 4F33B 5CBAA 4AMKH 1D5MA 2NY0D 5EOCH 2H1PL 4PGEA 1G7IA 3ZE2E 5IB3B 4JPKL 2FBOJ 2HKFL 5ETUA 5C8JA 5IBUG 2MQ0A 2HFGH 3G5XA 2VR4A 4LNRB 1A1OB 1HCVA 5IBUB 3F5WB 4JG0L 3UBXG 1FZJB 3OWEA 4NC0B 4R7DB 4M7KL 3GGWA 3EJYD 2AV1B 3TIDA 4DN4L 3GBLA 5FV1L 4GRWE 1W8OA 4NCDA 4YX2L 5JXAL 3BP4A 4Y4HC 2E7LC 3QHZL 2R1WB 5HYJB 1YNKH 2VDRL 3U9PL 4BFIA 3U6RA 5EULV 4CJ0A 2W9LA 3GMRA 4Z5RA 2O5YH 1MQKH 2IGFH 1K6QL 1YJDC 5DHYA 5BV7B 3MXVH 1VEPA 3DTXA 1E4KC 4CRPA 3N9GH 2BNRD 3L9RA 3NFPB 2NY4D 4X8XA 2DIBA 1FV1B 1MIML 1NPUA 2VXUL 3TZVD 3IAQA 5D7LD 4AEHH 3GSQA 1NBYB 4XPFL 1CK0H 4JFEE 3TYGH 4GAFB 2OR8A 4H88H 2NY2D 4GRLB 4AEFA 2DTSA 1PKOA 1T2QH 1AGDA 4X6FA 1EGJH 4NRXB 4OFPA 1K8IA 3JV5A 1XCTA 3KGRA 5DXWA 1RUAL 1LO5A 3D39E 5D2LF 4P2RE 1ZOXA 4IRSC 3TYFA 1FJ1B 3DV6B 1MIEH 4NZTH 3CFKB 4M5ZL 3ZSSA 4Q9RL 4UU9A 3UTSA 1MLBB 3G6JF 4LARL 3V6OE 1A6TA 1DBAL 1NEZA 2R2EB 3PWNB 3O9WA 2DL2A 5KSBA 5EN2B 3NZHH 1KLUB 2E3VA 1OOAA 3PDOA 4KAQH 1FYTE 1AH1A 2VLLB 1UJ3C 2DYPB 3E6FB 4BZ2L 1I7TA 5FA3B 1Q9OB 3TWCH 1G9MC 2ICEA 1VADA 3CXDL 2AJXL 3F7VB 1LNUB 4HIJB 3ULVE 4IIQB 3VH8A 1DQML 3LKOA 3TA3A 3BO8A 1KJ2B 3ILQC 3ARRA 2HWZL 5EOCJ 2L7JA 2XWJA 2VDQH 3QZWA 3G5ZB 1V8HA 3VGDA 4POZD 2E7MA 3GSNL 1AP2B 5FM5O 3QHFL 3DXAD 3MV8D 4BH8A 1FO0B 2EYTB 2XQYG 4PJBF 1CXKA 1A1NA 3CVHL 2QSVA 1CXEA 1IAOB 3SEPA 5CS7A 4MHHI 3WEXB 1Z9MA 4WI7A 3CSYA 3LMJH 5I1GH 4RGNB 1N0XH 3ULUC 4KU1A 4I8DA 2XA8H 3S6CA 5ACZA 4PJ5B 3DUUB 3MUGA 4F57L 4EXKA 4MA8H 3AFLA 2EDDA 3DIFB 3P9MA 4PRPA 5I15H 4O5LL 1NCAL 4UOW0 2N56A 2FX7L 2I07A 4PJCF 1I4FB 4HXBL 3F6IA 3QUMB 4MAYA 4PGDA 5EU7C 3UZEA 3SDCC 3L3IA 5SWSE 5IJVA 2B1AH 1IQWH 1B0RB 4O2FA 4GKSB 1XR9A 3KR3L 5KZCD 4MX7A 1LO0L 5E2VH 3PNWB 2P47B 4J1UA 4X6CB 3SE4C 1KENL 3GMOB 4WU7A 3BUYB 3PHSA 1VPOL 5IBLC 4CVZB 4K8RD 1KGCD 5GSVA 2R0KL 1M6OB 2NY5C 4F58H 4XNYL 3JTTB 5D8JL 5CSZA 1NMCC 4MQ7B 3VFSB 3UTZB 3KLAB 1ZK9A 1EEZB 2W91A 1T1WB 4YNYB 5MI0C 3BPOB 2P5EA 2ZWLT 3FB8B 1HHHA 4GG6B 3NFNB 3VD3A 4GXVL 1UB6B 3LEVL 4M9PA 1ZS8A 3HE6C 4ZODA 3U2SA 1EFQA 3O81A 4F37K 1MNUL 5FO8B 5K9KA 2VZUA 4L8SB 1TTFA 3OKKB 2PXYA 3PJSA 2BHZA 3IDXH 4OZFG 4S11A 4XTRC 3VFUB 3GZKA 3IDGB 1ONQA 3PV6B 4FFZL 4UOJA 3MBEA 1NMBL 2CLZA 2HN7B 2ARJA 4NKDB 2R0ZH 4NQXA 5GRVK 1PKQA 1YQ2A 4WDIA 5C0BA 1OT1A 1WFUA 4X0KB 1N3NA 4OIBA 5DJYB 3DI3B 2F54E 2DJSA 4K3JL 5F9JB 2A6DB 4UNUA 1UH2A 5HHQB 1I1AA 2CLRB 3CFJA 3IB4A 5BVJA 1EIBA 5KS9F 5B8CB 2DKUA 1QSFB 5HHVL 2GJ6D 2R1YA 5DFVD 3RA7H 1IAMA 3MFGB 1CICB 4S1DD 4P4KB 1NGZB 1KG0B 1X5LA 3UO1L 4PRIB 3BPCA 4BSWA 4KUCD 2DWEB 3KXFD 3OKLA 1U3HC 3QDAA 4JFFD 1S7QA 1PFCA 4NO2A 4I3SL 1A4JB 4F2MB 2DWDA 5I1LA 4CDHA 5J13B 1CIUA 1FQ9C 4DFIA 2IH1B 4YXHH 1KLFA 1AGCA 2DMBA 4JPIA 5DSCA 4GAJH 5E5MA 1J0YA 3F62A 3KPSA 4OD2A 1UH4A 1FFPB 1CFVL 3KYOA 4CVWA 1EHLH 4ZS6C 4YDLB 4NJAL 2IPTL 3ILPA 3M17B 4YHPB 1NC4A 1AE6L 4NBZB 5IB2A 1M7IA 5EORH 2EDTA 3HFMH 2GJZB 3QXAB 1UA6H 1OGAE 1LEGB 1ZLVH 1A6VL 5DJCB 4FG6C 3WFCH 1OWRM 3O2WL 5E8NA 1JWUA 4F15C 1RUQH 4L8DA 4CADB 5IM7A 3SE9H 1AGFA 1II4E 2PO6B 4DFHA 1GZQA 3C87A 5BVPH 5JNYB 4L9LC 5IMMA 3UBXI 1T3FB 1GIGH 1RJZA 1RZ7H 2BY0A 4WFGE 1MJ8L 3B5GA 4ZXBA 1QFWH 1FGVL 3C6SA 4LHUG 2ZNXA 3T65A 4LCYA 4XX1E 2VN7A 4AIOA 5D9SB 4L5FH 2IQAA 3OJVC 3CSPA 5IB5B 2F5BL 3LKSB 2ESVA 4ODUA 3T0EE 1TZIA 3CFDB 5HSFA 1WIOA 2M1KA 3WIIL 2ARWA 1ORSA 4TNVK 4LPCA 5JW4R 1NKRA 1R5IA 2RAMA 2XTLA 3LQZB 1E4XL 5J7CC 1G7MB 4OLZL 2HLFC 4PJIE 4M00A 1MHPH 3U46A 1LVEA 4BQBA 4DOHE 3IS1X 4OFDA 2DQEL 1NCBH 4XWOD 4HEME 3S88H 4FQJL 5E7FA 3WJJC 1FN4B 4GXUN 1NCUA 2WIIA 2OQJA 1BFVL 2HG5A 4HWEH 2YRLA 4HLJA 3QAZC 1MCCA 4X5LA 5DJ0B 5ISZE 5JDSA 1KB5B 1P84J 2G60H 4W81A 4L1HA 3QCTL 3PHQA 4OZHA 3HE7C 4FXKA 2GITB 5EUOE 3TH4T 3V52L 1QLFA 3KYMA 5IW1A 4UIKH 1MHHB 1T1XA 3PIQB 4J4PA 4X99B 4LNVA 1IKNA 4JANA 1OPGH 2IBBA 4JHWH 3O4OC 3MLZL 4NQEB 2HJFB 2Y7QB 3HNTL 1YN6B 3AMLA 4TSAL 3NH7L 3KPQA 2ICCA 4DW2L 2V5MA 5J1SC 5D1XC 2VXTL 3V7MA 4HK3N 3KJ6H 2K9UA 4NRYA 4PRNB 4GSDL 4WO4D 3PL6D 2BZDA 3UPCA 4AT6B 5ALBL 4ZYKA 2FH8A 3W39B 3JTSA 1MFAH 1XGYH 4MS8C 1EMTH 1NSNL 5CJXC 4UIMA 4HFUL 3TBWB 3VXUB 4QRRB 3S36X 5IFHL 4LCWA 4XH2B 4Y5XB 2QSCL 5TE4H 2ITCA 1HYRC 2Y07L 1LP9F 3MRIA 1IAIM 2IG2L 2WBKA 2D03H 3O11B 4GRLD 1X7QB 3IFNL 3HZMA 4JY4B 3WNMA 1A9BB 2J8UE 4CMMA 2P5WD 2BERA 1T7WA 2C7UB 4LSDA 2BK8A 3K3QA 5D2NE 1HDMA 1MREL 3UTTA 3DX8B 5FEBA 1HXYB 2P48B 2OSLB 3PWJA 4Y19E 4QXUH 4G3YH 3CNKA 1KB5H 1KPUB 1K4CB 4U6YA 5AAMA 3GSXB 3ZDXF 3D0VA 3BISA 3E2HC 2JJSA 4UT7L 3S35H 2VDLL 3LY6A 4HZLA 1MEXH 4JJHA 3GHBH 5IEKA 4HJJH 2H8PA 4XWGH 1RQ5A 4PLKC 3H9YA 4P9HC 2BY1A 1N26A 2ERJC 4WI6A 1UXWB 3TO4D 5I71B 2AXJA 2YUVA 4QRTB 3CU7A 3KAAA 4V1DD 3NCYP 4PG9A 5D7KE 2R4RL 2F53A 1UFUA 3GSVB 2YUXA 5DVKA 5GS3A 2I9LB 5IVXE 3PWPE 3U1SH 2NXZB 1LDPL 1CLZH 4YHOL 2PCPB 4N8VB 5DUML 5MEPB 3NIGE 1EBPA 4R4NC 3FB7B 5IKCA 3UBXA 4PJAE 2FECI 3ES6B 1A14H 3ME0A 3T1WA 3MRPA 1S9VB 3MR9B 1UWGL 2A77H 1L7IH 1NGPH 2R1WA 5C3TA 2CGRH 2CUHA 3BP6B 3RI5F 3VRLE 2ZCLH 4HS6A 2AJUH 1UM5H 2E9JA 4XCNA 1FL3A 2FZ3A 2BXYA 1KACB 3GNML 4PJEB 4D0DB 1FV1A 4AMKL 3L1OH 3CDCA 5EOCL 3SE3C 1Q38A 1NBYA 4ODHH 4WEBL 5JHLL 1NQBA 4MCYB 2VITA 1J8HE 4XNUL 3INUL 5JHDE 3R06A 5IQ7L 2DI9A 4NRXA 5DD1H 32C2B 3LPWA 4P23A 1ACYH 5E9DE 1S7UA 1FCCA 2X44D 1T5WA 3SY0A 5CZXC 1AGEB 3BWAB 1CD1B 4LVNB 1OY3B 4J3SA 4MWFA 1SBSH 2FCBA 3VWKB 5HD8C 1FVDA 2Z35B 2O5YL 2OK0H 4N1CA 2IGFL 3L5IA 3E8UH 5DD5H 2ZUQC 3PWNA 1KJMB 4OJFH 3N9GL 5E0QA 2Y5EA 4ZS7H 3NFSL 4YDJB 3RL2B 1ODAA 2OTWB 1I8MB 5JQHC 2VLLA 4JFHD 5A2IH 4FRWA 5CSGA 3G6DL 1A5FH 4LLQA 1I9IL 1T2QL 3F7VA 4P3DB 1LNUA 4NHUB 2HT2C 5SWQA 2XRAH 1MJ7L 1FNFA 1RUKH 1JZ7A 2Y06L 1QZ1A 3MRBB 2XZZA 2H26B 4FFVC 1RURH 2X5PA 4F7CB 3HI1B 3C6LB 2X4UB 1W72A 2CR3A 4JRYD 1AIFB 1ND0B 3K2UH 1TCRB 3G5ZA 4AH2B 3RTQD 1AP2A 5KVFH 1MCPH 1Z9LA 1VSCA 3QEHB 4ZDHB 4QHMA 3S4SA 5E8PA 1YECH 1I9RL 1YJDL 3I6GB 2YZ8A 2ZUUA 4KTYA 4L4TE 3NZHL 1RFDH 4HV8B 4KAQL 5KTEH 3RPIA 1I7RB 1WC7A 3FQTA 2YPVH 2O5ZL 5ENWA 5FUOL 3V0AC 1E4WL 3HN3A 2IMNA 5T1MB 4P4RA 3DIFA 2W65B 4NQDD 4JM2B 2Z0BA 5EU3A 1JI2A 3QNYB 4TUJB 2V17H 4B7LA 3HUJE 4MA1B 2YD7A 2ZP0T 5E5UB 2IALB 1JMXA 2BDNH 1QO3A 2LE9A 1NFIB 4W4OA 5CMAB 4X7SL 4MQXD 1FAIH 5CEXA 4UB0L 4P4KD 2G2RA 5CP3A 5DRXA 2JJUA 2YA0A 5CEZL 5AWNL 3IXAA 3L7EA 3WHXA 4DVRH 1RUMH 3V7AE 3EOTH 3F7RA 4U1SB 5C9JB 4CVZA 2BJMH 2X4RA 3D25A 3WIFB 1JRHI 5FA4A 4Y4KA 2XXMB 2PW2B 1MCIA 2YUWA 1NANI 3BIAX 4ZO8A 3BPLC 2XA8L 3KPRA 5KSBF 4J3XA 4MQ7A 3VFSA 4NJ9H 3BDXA 3UTZA 4MA8L 2BRRH 4H5SB 2G5BB 3N85H 3HMXL 1EEZA 4G9FA 4YNYA 1VHPA 4WFEE 4KDVA 3OBAA 4M93B 4XP9L 2JIXB 5I73B 2BNQA 4CN1A 3LN9A 1J88A 2IBGA 1K8DB 3LSOA 1BX2A 1BZ7B 4FABH 3VD5A 4N0UB 3SO3B 5MEOB 1PLGH 4HS8L 4OD1H 4NZUL 1QEWA 3KPMB 4OZFA 5SWZA 5L7XL 2RHEA 1LE9B 4D0CA 3NCYS 1IQDB 3S36L 4Z95H 1L7TH 4NKDA 3ULUL 4KZDH 3IS0X 1CVRA 2EH8L 1FNEA 3LH2H 2R29L 4GG8A 4PJ8D 3FOMB 6FABL 1JZ2A 5GGSA 1TXKA 1AKJA 1GZPA 5JUEL 3ZDYE 2G75B 2VABA 3DX7B 3L5JA 3LB6C 3MRLB 5ADPH 4ZO6A 1RIHL 1DTUA 3WFEH 4NWTH 1AR1D 1G7JA 3W11D 1KIRA 1F6LL 2HJKA 1OF2A 5BXFB 2DWEA 2EO9A 4JZJB 3U79A 5D5ME 1FIGH 1U95A 3G5YA 3IDXL 2YD3A 5JR1H 1CFTB 5DMGC 4LVHC 4E0RB 4Y5VC 1FVEB 4PJXB 3CXHK 4M02A 4XPGH 2CLVB 2CO6B 4J8RB 3QXTA 2WLYA 1J5OH 4M6ML 4KK5C 3CUPB 3M17A 3KNBB 3WXVL 1A8JH 2ZUXA 3ARDD 1AR2A 4ENEC 2APFA 4WUUA 3KPLB 3RA7L 1T89A 5C0FB 2Z92A 1S7VB 3DURB 4Z7UA 4QO1A 2EDWA 1QRND 3NACL 2DQFA 4FZ8L 3TA3C 4CGTA 2NY1B 2AI0H 4LCIH 2PUQT 2PO6A 4NQCB 3SCMB 1R3IL 3MOBH 4NBYB 5EFIB 4ZSOA 1BM3H 4FQXA 3MGOA 1RY7B 3QI9A 2IQ9H 2R2HA 3GM8A 3HNVH 2BVQA 3CMOH 4MLIA 5BZWA 2FO4A 3RVTC 4RGOH 4WGWB 5ILTL 4LHUA 5HI4C 1S5HA 1EHLL 1INQA 1U92A 4JRXE 4QRRD 1JI1A 2CK0H 3OKEB 3VFRA 5IESL 5DK3A 4HPYL 3IDYC 4HKBB 3UJIH 2X09A 5I6XB 3HFML 4ODVL 1UA6L 4G43B 4JGUA 1JF5A 5EOQL 1MJJB 1IC7H 1I75A 3ULUE 2H2PD 3K0WA 7CGTA 4YEEA 1YEIL 3ARSA 3MRRB 2IFGA 5C0AE 1T03L 4NC1C 2DMKA 4G8GB 4OCRL 2FBJH 1UYWH 2WMPA 4GW4A 1GIGL 2VLRD 3KYNA 3MSPA 5KVEH 1M7DB 5KVGL 2GSIB 1RJLB 4ODTH 3QXVA 4DQOH 2YK1H 4FZEH 3H42L 5EU7E 1UWEH 4EI5B 1QFWL 5DJ0A 3DVGB 3C60A 4NRZB 4DN3H 3H9ZA 3QFJA 3TBYB 5HDBE 1C5CL 3U0PA 2VDKH 2BVOA 5JOFB 1C7SA 3B8SA 3QIWB 1Q0YH 3PIQA 1HYSD 3ARQA 1KTRL 4FQIL 1DEDA 1F58L 5EU6E 3EOBA 5LBSH 1I3RA 5F1IA 2PYEA 2FX9H 2Y7QA 5DD6B 1FSKB 2VC2L 3S34H 1MHPL 5FECA 4HGKC 1P53A 3GSOA 4IOSD 1T22B 3WKMH 1A6ZA 1NCBL 5I8CA 3S3SA 3U9UA 3LKRA 3S88L 1WBYB 3RBGA 4HIIB 4TSCH 2A74A 1SHMA 4LPTA 4MNGE 5D1ZA 2V6HA 1U8HB 2CK2A 2EECA 1R3HA 4HWEL 4XPAH 3SDXE 4R97C 4XVSH 2JCCA 5F7FA 5IMKB 2G60L 5D7JC 2BOBB 1SJHB 4O00A 2HMIC 3FQRA 4RIRB 2X4NB 2UWEB 4Q9QH 3VXUA 1BBJB 3IRPX 4BFBD 5C92A 5EBLA 4DAGH 3O11A 4P46A 1OPGL 2X4PB 1OB1B 4G8FB 3WLBB 2AJVL 3MRGB 4G6JH 4OM1H 4X8JB 4G6AD 3O45A 4HCRA 4XVJL 2J4WL 3HRPA 4LSQH 1H3VA 1CFSB 1A4KB 1MCLA 5DRWA 3FAXA 2OSLA 1BIIB 3KJ6L 4YDKH 4J3VA 3HCVB 3ECBA 4N0FA 3GSXA 4JQVA 3FFDB 3SBWC 3ELAT 4XHJD 3GO1H 3IDJA 5ABDE 1XGYL 2C3XA 3UCRA 2P8LA 3QH3B 1B9ZA 1H5BA 1ZHBA 4X6BB 5H35B 5DS8A 4ELME 5D93C 3B2VH 1HQRB 5DUBA 3I75A 3IT8D 4PJ9D 4YH6A 3NGBB 4M1CC 1IGJA 3T04D 4KY1H 3L3HB 5FYJH 4JFQB 5C07A 5BQ7B 3GB7B 4KTDL 4ODWA