3D9AH

High resolution crystal structure structure of hyhel10 fab complexed to hen egg lysozyme
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
210
structure length
210
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light chain somatic mutations change thermodynamics of binding and water coordination in the HyHEL-10 family of antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/immune system
molecule keywords Lysozyme C
total genus 44
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2008-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d9aH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3d9aH02
4KROB 2BNRE 3WUZA 3DHMA 3MV9E 4OD3L 1UENA 2QKIA 4I48A 4OZHF 4K3DH 3TV3L 1R3LA 4HHAA 1BAFH 5DRZA 2F5BH 2G9HA 4E0RA 3KHQA 4OKDA 1G9MH 3RDTA 3ARFA 3OKDB 5IOPB 4ZS6C 2BC4B 5TQ2L 5AD0B 2KPNA 5A2LH 4WV1B 1H8SA 3INUL 5AYUH 3ULVF 2ZSVA 3PQYD 4K94H 4X6CB 3VWJA 1N2RA 3KHOA 4Y5VA 1FAIL 4OIBA 3LOWA 3HG1A 5DYOB 3NCCB 3MACL 3DRQB 3MMEB 3P0GB 4P5TD 2HJFB 1RURH 2DJUA 1YN7B 3R0MA 1J0YA 4OLWH 1LP9E 5DJYA 3AS1A 3B8YA 2NY6B 4TOYH 5DMKA 3WUWB 3P30H 3KPQB 5GS1C 4G3YL 3NGBB 1INDL 3BP4B 4AIZA 4D3CH 3BH8A 5C0RH 4JAMB 5D1XA 1YEFH 4HF5L 4AH2A 1I4FB 4ELKA 4HIXH 2R0ZL 4P5TA 2PW1A 3QWRD 4KTEH 1TTGA 4M48L 4FG6D 1RMFH 2AGJL 1XGTA 2ZSWA 2QQQA 4CRPA 3O4LB 2HVJA 4M7ZB 4YO0B 4X6FB 3VFOA 5IBUB 2QR0A 3VXRA 4XCFL 1Q9OB 2ARJA 2R9HC 1FZMA 5F8QC 2B1HH 1L7IL 3LEYH 2VDMH 1T03H 3K80A 4KQ3L 1CG9B 3IS1X 3EZ8A 3RTQC 1S9KC 4Y0GA 3HN3A 3NH7H 5GXBB 4XCNB 4Q97A 1YY9C 2PR4H 3ZDYE 4C83A 5EOTB 4KHXL 4Y16A 3MOQA 2O26U 4X6FA 2UWEF 1N8ZA 2FZ3A 2IBBA 4UI2A 5C6TH 1BZ9A 1WAAF 3EYSL 4RAUA 1XAUA 4MJIB 2W0PA 5AZEL 2JELH 3I6LE 1K85A 4P4RB 2B0SH 2Q1EA 3ZE1F 4P3DA 4X9HA 2MQ0A 4LCCA 3QEQA 4DGYH 1R5VA 4OZGF 5E2WH 5JOEA 3BVNA 5B8CC 3T8XB 2UVEA 2R1WB 3ZDXE 4IRZL 4IRSD 3U83A 2P24B 3BX7C 1DDHA 3C6LB 2OR8A 2FGZA 1EV2E 5H94A 1XR9A 1UC6A 1OT1A 3O3EA 1F4YL 1HDMB 4PJCB 4OI7A 2VISB 1K4DB 1A7OH 3ILQC 1HQ4A 2X4RA 5JPMA 4POZD 4P3CH 4GXUN 4KHTL 1T0MB 1P9MC 2JF1A 4NKDA 5TQ0H 4F7CA 4L8DA 2NY1D 4Z77A 4PJIF 3CC5B 4R7DB 4M7JL 3RGVA 4RQQA 2YPKA 4X6DB 4BSWA 3SO3B 4OQTL 5C08D 1RK0B 4CMHB 4YK4C 4J6RH 1IEBA 4P9HC 3L6FA 1JWSA 4JFHD 1YPZB 2BSTA 4KGJA 5LJYH 4QTIL 2B4CH 4TSCL 3GJFK 2W59A 2XQYG 3OAUL 2BSSA 4RQQB 3OKLA 3IDMA 3MLUL 2NQCA 4XX1G 5I8EA 2VR5A 4QNPF 2HTKD 4UIMA 3MFGB 4LHJB 3RTQA 2MCPL 2BJMH 4GAGH 3P3YA 1HXYB 4N0UA 3TH3T 2EE2A 5FA4B 1BM3H 4OV5B 1TZIB 3BZFA 3KG5A 4PJ7A 1IKFH 3V5KB 1OTUC 4NRYA 4HIEA 2DLIA 4A2LA 3RVXD 1G0YR 5L6YL 3CH8A 2ZCLL 5DI8B 1IC4L 3RNKA 5C2BH 4YUEH 2WWMC 1BQHB 2Z4QB 3ZYOA 5F9DC 2A77L 4QCIB 1A6AA 3MGAA 3KDMA 5F9JB 5GGRA 4ZUTA 3VH8G 3K4ZA 2EIEA 1KPVA 3WS3A 2OBGA 3QEQD 1N4XH 1QSEA 1S3KH 4YX2H 1X9QA 5E8OB 4EKXA 4MQXC 1UM4H 3MNWB 3BQUC 2I9LB 2GSGA 4X5WB 2IFFL 5J3HD 1IEAA 3O6KH 3SDAC 5CD3B 2YPLA 2ARJQ 4NM8H 1NFIA 1P7QB 4TNWF 3FQRA 5CINL 1DFBH 3VWKD 3H0TB 5DK2A 1WICA 3Q5YA 1VKXB 5FHBH 1OARL 1U95B 3LN5A 5SWZE 1BFSA 2IMNA 4M93B 3JSSA 5LCVL 4DEPC 4K2UH 5JNYB 4LARH 2K7PA 5IEKA 4RCAA 1HNFA 5KSAA 4G9DA 4Y4FD 2YK1L 5F44A 5CEYB 5JR1H 4PUBL 3OKOA 3RKPA 4HK3J 4M5ZL 2ITCB 1ZS8A 2R0ZH 1G9NL 5C0JA 4KRLB 1YEFL 1T1YB 3HI1B 4PBXA 5D9SA 4F3FA 5IWLA 3QPQD 5L0QB 1AE6H 1GOFA 3T3MF 4HEME 3EFDH 5SWZA 2DLGA 4HULB 1HE7A 3D9AL 5F1KC 2AEQL 5ESVB 4E41B 3TO2B 4F8TA 1T83A 4PGZA 4O4YH 3P9LA 4G9DB 2YZ8A 3WN5B 3ILPB 1FVDB 3NAAH 1ROWA 5A16B 2VIRB 3IDJA 4X7FC 4XMLH 5EC1A 5D5MB 4MD5B 3HNVL 4QXTA 5I1DB 3HG1B 1X7QA 4UUJA 2F19L 1MI5E 3H0TA 2H2PC 2C7UA 5EZOL 2Z8SA 3V0AC 4Y4KC 2NTSP 1G0DA 4JPWH 3GUTA 3QNXA 1JPSL 4K8RL 2APWA 4DGVH 3E8UL 3CFBA 3O81A 3VD9A 4N0YL 3MNWA 4JQVA 2F5BL 5ESAA 2OTWB 1R3IL 5DS8A 3BEVB 1A1MB 4DEPB 5CSZA 5DVLA 2Z8RA 3DI3B 4XMPH 3IETB 4JJ5A 4L4TD 3RIAK 2VDKH 2VQTA 5DK3A 3N9GL 4U6YA 3V79C 3H3PL 4K3EH 5C0AA 2ZG1A 4OF3A 2NYYD 3FMGH 5IFJB 4UV4H 2BNQD 4JEGB 3OKEB 4OCNC 1XT5A 4Q6IB 1B9ZA 1IBGH 4PJHE 2GAZB 4JKKA 5JW4M 3V5KA 2BY0A 5IIEB 1XF2A 4L4TA 1EJOH 1I7ZA 3QFJA 1JYXA 4UNTA 2IG2L 1B4RA 2VXUL 1I1YB 4LAJH 4L9DA 4NUJB 1WITA 4FG6C 4XP1L 3BAEH 3SE3A 4OKVA 1UB6A 3X13B 1A6VH 3T2NL 5D1QA 4R4FH 4JM4L 3E6FA 4ELMB 2WQRA 1LEGB 4CNIA 4LHUB 5D2NB 1LDPH 5IHUH 4C57C 3MRJB 4Z7UE 5IEKB 1CLYH 1A9EA 4Y5XC 3H9YA 1EVTC 1FL5B 2A6JA 5IT2H 3DSNA 3JXAA 4TNWK 2J7LA 3EOAA 5I1EH 3U36A 4DFIA 5I19L 3LZFL 4O58H 4I8DA 1S7RA 2HT4C 4OFPA 1DLFH 5ILTH 1IFHH 4O02H 1ZVHA 2FJFA 1FFQA 3ILPA 4HJGA 5FYLL 4GRLA 4Z76A 1BIIA 3QXVA 2AK4B 1UXSA 2EO9A 3QEGL 5ADOL 2DQIL 1IZJA 2WQ8A 1SY6H 4R4FL 3TT3H 3ARBA 2CRYA 1JYWA 1G7LB 1M7XA 2Y25A 5DJ6B 5INDB 1HHGB 1ZMYA 3FO0L 4QRQB 1JMXA 2E27H 4I18B 3ZT6A 2R9HD 3OAZK 3VCLB 1U8KA 3D3VD 3TVMC 5T5FH 1N26A 4MNQB 1LK2B 3KAAA 3CGTA 2GITA 5GGVY 1NJ9B 3T0WA 2OZ4A 1RJZB 1UT9A 2UUDK 3RZCD 2JLLA 2WM0A 2ZOLB 2DQUL 1LEKB 2OJZL 2Y9RT 5ACMA 4AIOA 5IJVA 3QJHA 4CADB 2C1OB 1FNAA 3ARBD 3QAZC 3EW3B 4UV4L 4YEFA 1I1AA 1HI6B 4ODSL 3L3KA 2YD8A 4KUZL 3HZYA 3ULUE 5D2NC 2OL3B 1T0PB 2WUCH 4K3EL 3H3PH 3BIAX 1TZIA 3BPOC 2ZOKA 3L7FA 1IARB 4PYGA 4IIQC 3V6ZA 5DK0A 3QG6B 4HT1L 4TSAH 1FN4A 2LE9A 3C2AL 1PD6A 5D6DA 4G6ML 4NSKB 1YMME 5JOPD 2AXGB 1CVRA 2JIXB 1R3IH 4XP5H 1B0GB 3CVHH 4TUJB 1FNFA 4AK1A 4N0YH 1F97A 3V6OC 4UNVA 2ICEA 4L4JA 5IV2B 1E4KC 4XWGL 2ITDB 2WBJC 3VFPB 5AAMA 4NO0A 3TJEL 4G6FD 4GXVL 3QRGH 1FZJB 3KPNB 1QSFE 4LOUD 4ONFL 3ZTJG 1JGEA 2R2CA 3WHE1 1X4XA 3ZMRA 1XCQB 4KUCD 4WRLA 4KXZH 3VXSD 1KJVA 1OB1B 4L29B 3QCVL 3TYGL 1MHCB 1WIPA 1BJMA 2HAZA 2H26A 4HIEB 1WGOA 3D25B 4JGUA 3FRPG 4C4KO 5IB3A 2XRAL 5ALCL 1ZANH 1NQBA 2YRPA 2NY4D 3D9AH 4JZOA 3EFDL 4MVBC 1A64A 4YR6B 4N9GA 5TGBA 1NGWA 4MAYB 5D6DC 1CGYA 3O2VL 5BZDA 5C71A 1PYWA 5GGQH 4KDTA 5DA0B 4OLXL 3BPOB 4ZDHB 2VR9A 5D7LA 3MCKA 4Q0XL 5FUOL 2B20A 2HTLD 3NCYS 1QLRB 3L3KB 5BXFA 2VL5A 3EYFB 4FFVD 2E8YA 4HMCA 4EDWL 5MERA 4KV5E 4ZFZA 1WWWX 1RZIB 4U7SA 3UP1A 1U2HA 4HIJA 5JW5A 4YFLI 1I7UA 1KN4L 2HT2D 1MSPA 2YUXA 4PRBB 1AQKH 1FQ9C 2VAAA 1VFBB 2BNUB 5T1KA 4LVHB 5KVGL 4PJCA 3FN0L 1KIPB 1QLFA 2X4PA 2NY5C 4WV1C 2GYSA 3BYTA 4PRID 4QRQA 4M6ML 5EIQA 4HKXA 3SEPA 5FIEA 1T0NA 1UM4L 1Q9OA 4KRPC 3SKMB 2XPGB 1CICD 4GBXA 1OAUH 2HLFC 4YX2L 3DETD 3O3AB 4Y16C 3WNLA 2ICWI 1PBYA 1NC4A 2A6DB 4X7TA 3KJ4B 1D3CA 1T7VA 5HVGB 1KACB 1JYNA 2XA3A 3BOVA 5IB2B 4HPYH 4RRPA 4CBPA 4OBSA 3VFUB 4LSQH 3MLZH 3NIGF 2Y36L 3FQTA 2C4FT 3PWPD 5DMGD 2P45B 1A3QA 2XT1B 1NGZA 2Z4QA 2X10A 2WUBH 1P1ZA 2DWDA 4TUOA 4DKEH 3P9MB 4S2SA 4MAYC 3VXQA 3SPVA 3CAFA 3SKMA 4NZDA 1MCBA 3F7PC 3V5HA 4GKNB 4MMZC 1ZT1A 3T08A 4QY8B 5E2TH 3IXAA 5KS9B 1MLBA 1SYSB 4P9HL 3BZEA 1JTOA 3VXTA 3RPIA 5KVFL 2IH3A 3MMEA 5I1IL 3KNBB 2OP4L 1EUTA 1PYWB 4GMSH 1YEJL 1TMCB 4P23D 3SKNB 2BDNL 3HRZB 5FECB 3VD7A 3KLAB 4QHMA 2VAJA 4S1RH 5M94B 1T5WA 2B4CL 3RVXC 1VERA 2AKRB 4Z6AT 1AHWA 5J13C 4N90E 3LKRA 3MO1A 1FE8H 1GGYA 2ICWA 3K8KA 2OXGA 4OCSH 4OZGB 5ACZB 2NZ9C 3IFPA 4Z7NE 1HILA 3WLBA 1N6QH 5HVHC 4M7JH 4ZNEA 4FNLH 3S37L 4ODXB 2E5EA 4IS6A 4P3CL 3FRUA 3S5LA 1P7HL 3GGWB 5ESQB 3VG0L 2ADJA 4XPGH 3I75A 3QJFB 2V9RA 3HI6H 1FZJA 4S0SD 1MIML 4GRWF 3RNQA 4P5MA 4P4KA 5E00A 1KCLA 3QFJB 1I7ZB 3GRWH 1OLZA 1UWXH 4MB4A 4GAYA 4PFEA 3ZT5A 2RFXA 2WZPD 2R2EA 3JV5A 4KC3B 4ETQB 4JDZA 1YNKL 4ZO7A 1EEZB 4M00A 5BJTA 2BRRL 3ULUC 3UDWC 1PJ9A 3VW3L 5GIRB 4JY5H 1FL3A 2O5ZL 1YUHB 4OGZA 2VH5L 5CHNA 4LP5A 4KRMB 5ABDE 3HMWL 5E5UB 3W9EA 3WIHH 4X4XB 4HWBL 3MBXH 2J8UE 4PJ5D 4PREA 2X6MA 2NXZC 3FN9A 3TYFA 3C5JA 3W11C 3HE7D 2HN7B 2PXYD 3PWNA 4GRLD 4N0FB 4MXQC 3MLYH 2DLFH 4DGIH 5DRZB 1I75A 2OK0L 3E6HA 4KKBD 5I66A 3CPLA 4QXUL 1XGUB 4YHIB 3QIBC 5JMRA 3OGCA 1U8JA 1MCLA 4QXWA 3WFZA 3LS4L 3DX8B 3PV6B 4M6AA 1E28B 3GSVB 3CFJB 1FZKA 1T03L 4DOHE 3KWWA 4ZFOA 4QHKI 5C70A 4FQIH 4Z7QE 3CVHB 1BOGB 2PYEE 3BDYH 5I1DA 5EFIA 4PJCE 2BOCB 5ISZA 3RWIB 1VGEL 4CDGC 1J0IA 4XCFH 3FZUC 4CN1A 5SV4A 2R1YA 4Y5XA 1B0WA 4YDLB 3SE9H 3GMOA 4JQIL 1NCWH 2AGJH 4MGXA 3D18B 3MV8D 3TO2A 3CDGB 4MHHI 4NN5C 4OF7A 4P2RA 1UCBH 1IT9H 4EQ3A 3TWCH 1LP9F 3QUMH 2ENSA 3EJZC 3BGMB 1U3HA 3QHFL 2WBKA 4S1QH 5EU6D 5IB4B 4J23A 4D3CL 4AZ8A 4LEOB 1INDH 5KAQG 2H8PA 4G7YL 1T83C 4MJ6A 1F45A 3OGCB 2PTTA 2FATL 3BFOA 3SPVB 4U3CA 3ZHKA 4AL8L 1WAAE 3QFJD 4LLDB 4HUMB 2AI0H 3FFCA 4P9ML 4YBLC 4NUGL 4Y16D 4XPBL 1KLGB 2HLAA 5GGSB 1TPXB 1AXTL 4M7LH 5EBWB 3V6OE 1CFVH 4NCDA 5DO2C 3ZSSA 5HHOB 2FIRT 4HCRA 3QI9A 3KXFE 3LHPL 4KQ4H 1XF4A 3U82B 2ZUYA 3WFHA 2V2XA 5B38B 3BRGC 2ZUTA 3HAEB 4U6VH 2W92A 2OTPA 4PTTB 4H0GA 4NQTA 4U2YA 3QIUD 4OD3H 3ARTA 1A7RL 4ZXBA 1U93B 2WINA 4ZFOB 4NQDD 4QWWD 3SGJA 2BK8A 2F54D 3VFMA 5GGTL 2XTJD 5I15L 5F89B 2V7HA 4HUXB 4Q9BA 1ZT4A 1KBGH 2UWEB 1F11B 1T1XA 1TJIL 3D3VE 5DRWB 5IHZA 4DN4L 5FYJL 4HUVA 2QQLH 4Y89A 4OLZH 2NTFB 1FFNB 5I66B 3ZE1E 3AU1B 2CDEA 4PJ9B 2GJ6E 1NFDA 5CJOL 1NDGA 1FYTA 2R4RH 4UOW1 1A2YB 2AQ2A 5IBTL 5JPNB 4NC0B 2Q20A 3JZ7A 1E6JH 1EEYA 2W38A 5I16A 3JV6A 3GNMH 5DUBB 5BS0E 3MRCB 1BFOB 2W60A 4WWKB 4HUWA 4OF0A 1FRGH 4KFZC 3W2DH 5C8JB 1CDHA 4DUXA 1MF2L 2XXCB 3T1WA 3QAZB 1D5BB 1P4BL 4PV8B 3DV6B 2RFXB 4NHCH 4YXHH 1A3LL 3PQYB 5CLWA 3BHBA 1H3XA 2N7AA 3IXAB 1LE9B 3LDBB 4IMLB 4L29A 5J4MA 4YDJA 5SWQA 5F88B 2A83A 4LLWB 2CIIA 3QXAA 2KKQA 2R69L 5IB4A 3JV4A 3TBSB 1KB5B 4X7EC 3BVNB 3EUUA 2LV4A 4NO2B 3FHQA 4M7KL 2VZOA 3K4AA 2ADIB 1H3UA 2NY6D 3S4SA 1DUYB 2MWCA 4TNVK 5CZXD 3LQZB 3PWVB 4PP1D 3T0EA 2D9CA 3LN4A 1A47A 1I9RL 1F90H 3RWCA 3WSQL 5HYJB 2J8UF 5CEYA 1CR9H 1HKLL 4G5ZH 2XTJE 2P44B 2CRIA 1X6NA 2ARWA 4JKWA 4ZUSB 4APQA 1UH2A 2F54E 4Y1AA 4WENB 1E4XL 2RBLA 5BCAA 3ARBC 1FDLH 1VEMA 4N8VB 5KBNC 1U0QA 5E94A 1MHHB 4M8QB 4NQSA 4OI9A 1MAKA 1MAMH 1UKSA 2P8MB 2RCSH 1FZKB 2G60L 3OTTA 1EBPA 3VXSA 2GJ6D 3U1SH 4NQDB 1BGXL 4DFHA 2RHEA 4U1JA 4UDUB 1JJUA 3HB3D 5GRUL 4RGNE 3IJHB 5MI0B 2Z31C 1KYOK 3BSZL 4XCNA 1YNTB 3RHWF 4XBGB 4K9EL 3GMNB 3N1GC 1SVCP 1WJ3A 3WIFB 1JI2A 4P5KB 1NGQH 4OZFG 4ZTOL 5AZ2H 1PSKL 3BXNB 1QSED 2DJ4A 3V6OA 4XTRC 1FFOB 1MFDL 4M1GH 4AH2B 3WDHA 1JTTA 2MPAH 2DBJA 5CAYB 4YHKH 1YUHA 5KZCB 3QUXB 1KFAH 4ZQKA 1RFDL 4YHML 3GKWH 2ZSWB 4LCIH 4XCYB 3U7WH 5L88L 4JFFE 4NNPH 2BXZA 4MA3A 3K8LA 1XGQB 1ACYL 1UACL 4Y8DC 4L9LB 2HKFH 3CSYA 4JG1H 1MY5A 3HNSH 2Q6WB 5L2JA 1GAFH 4N0UE 3QHTC 3QO1A 2DBLL 3WFDH 4KK5D 3O41B 5I2IA 4NGHH 3T65B 1FNEA 4RGMB 3DRTB 1WC7A 2Z93A 4KMTL 1UJ3B 3AS3A 3GRWA 1A4KA 1QYGH 5DFVC 1RK0A 1R3KB 3K4DA 4E5XA 6FABH 4FXLA 4XXDB 4KTDL 3PGDB 1HSAB 1ZHBA 3B9VA 5T5NG 3TIDA 4OB5L 2R0LH 3MXVH 3BESR 3GI9L 5FYLE 1G7HB 2YZ1A 3QG7H 5CEXA 1CN4A 2NY3D 5E2UH 1HQ4B 3MJ9L 1ZLUK 5JHLH 1YEGH 1TCRA 3HC3L 4HCRL 3DURB 4YC2B 3M17A 1HDMA 3CLFH 5C07D 2CDFB 3O8XB 1A6UL 4JO1H 1NL0L 3IDIA 2OTUB 5F70A 4BSWB 4XT1C 3DBXA 2ZUWA 1CGSH 2CDEB 4PJEF 2IAMA 1S7VA 5DEGB 1ZHLA 4H0IA 1NBYA 1NCCL 2H9GA 4O5LL 2B2XL 1EZVY 1E6OH 1PKOA 2JE8A 3DX9A 4QRSB 3N85H 4XNXL 1OY3B 3AC0A 4NFCA 1KPRA 3RWEA 5HD8C 1T21A 5CJXC 5ID0B 2DMBA 3VFMB 4NQCA 1XGQA 3QEQE 5E8DL 1QTYT 2JJTC 4AQ1B 4DVBB 2V17L 5IB2A 3QB7C 2V7NA 4W4NA 1A6ZA 1B90A 4M1CC 4XBGA 3TBVA 3SDXB 4GG6E 3GB7B 4PJHA 4WI6A 3MROA 5E70A 4B0MM 4M3KB 4PJ5E 4OJFH 4U7MA 1XF5A 2PUQT 5DEFA 1BBJB 1YMHA 1J88A 2FWOB 1XF4B 2IALB 5D70H 5DMGC 1PVHA 2NY5H 5GS1B 4NBXB 1D9KD 3UXFA 4Y4KA 5DD1H 4UIKL 2VOTA 3WIFA 4JY4B 4DTGH 4KI5F 1J1PL 4FQQB 1U36A 2YUWA 4Y7MA 1DBMH 4RISL 3JWDC 3L3HA 1ZEAL 4Q9RL 5FKAA 2P42B 5HI5D 4WUKH 4LVOB 3CVIL 1H3GA 1CD0A 4MDJA 12E8L 4R97B 2AQ3A 5HYJA 4K3HA 5GGUA 4KK6D 4PRPD 1WZMA 3THML 2XWBB 5J11B 1GZPB 1OHQA 2FECI 4S1SL 2ZJSH 4YBQD 4YEEA 4I0CC 1KB5A 2HJLB 4Y2DC 3WNOA 1S7XB 3WCYA 3L5WA 4F9PC 4LLQA 3UO1L 1UXSB 4OLVL 1I1FB 1MCQA 3WUWA 5DMKB 4LGRB 4UB0L 5SWSE 3SDAB 4JVUA 3GK8H 4ZFFA 3WS6C 4PV8A 3WLWC 1MH5B 1N64L 4H5SA 3E6HB 4WU5B 4JLRB 5HHMD 3EO9L 4LASL 3BJLA 1CFSB 3QZWB 3AVEA 1FC1A 3TF7C 3PWJB 3AXLA 4OAWB 2BMKB 4HLZH 2W07A 4GQ9H 1E28A 4WUUB 2VYRE 2BY1A 5F1NB 2AK4E 1TQCB 4NQCD 3HG1D 1BZ7A 4Q6YA 4EJ1C 3WKML 5T1LB 3UTTD 3NCMA 4P57A 5E8OA 4Z78A 1NBZB 5KG9A 2QSCH 1DE4B 4OTXH 3C6LC 5F1SA 3TC9A 1W72A 3V6ZB 3MRFA 1PY4A 2YPVH 5I1CH 2UZIH 2IADA 3QIBA 1AHWC 1SYVB 1X6LA 4U6HB 2EDOA 4WU7A 3GSNA 1GL4B 1I9JL 3AY4A 5IVXE 2YOCA 4XB8A 3ULUH 4UV7L 4HFUH 1RHHA 1FNSL 1KELH 3C8KB 3MUHL 3MV7D 2FSEA 3SOBH 4LLUB 1EUUA 1UEMA 4PTUB 3O8XA 1MFEH 1EO8L 1KIRB 3MC0A 4FA8A 4IHOB 3P4OA 1I1FA 1I9IH 4U3XA 5A1AA 4GRMB 3S96B 4L5FL 3MV9B 3VCLA 2OYPA 5GGSY 1U58B 3PE9A 2DL2A 1RJCA 5E5MB 5I9QC 5KSBA 4Y8AA 3VWKC 3S6CA 1I8LA 4ENED 1K2DA 4QHUB 5I76A 1R3KA 3MTRA 1LNUB 1JWSB 3DX6A 2YWYA 3FB7A 3GMQB 4OIIL 5F7LB 3WFHB 5F9WB 1A6WH 1NSNH 4OFYD 1QEWA 1N5AB 4Z8FH 1FIEA 2GIYA 3WYRA 2O61A 4WJ5B 4R8WL 4N5ED 3VH8B 1MCWW 32C2B 4LHUD 1NC4D 2WANA 3QQ9C 1FFPA 3VI4E 1WCBB 4PRDA 2FO4A 1IM9B 4P2OC 3E3QE 3CCHA 2XTLA 3CZJA 3UYRL 4ALAL 5IMKB 3O0RH 3KPRE 2IQ9L 5T1MA 4G80A 4XC3H 1MHEA 4Z0XA 2YXFA 3QUYA 4LPWA 2UZXB 1S5HA 2A1WH 1IAII 1MCPH 1QKZL 3QIWC 1SM3L 4QHKJ 3KJ6L 4XVSL 5GISH 2HMID 3WNKA 3NN8B 1JGDB 1MI5B 2NLJB 5HJ3A 2NY0B 4ZUVB 4TULL 2V7NB 3RJDA 1LO0H 1EIBA 3DI2B 3RL1B 3VGAB 2XWBA 1BD2A 4OCMC 3MGOA 5TF1H 1YJDC 4LGPB 4X80H 5ANME 4PB9H 1K8IA 4JB9H 2FZ3B 3T0EE 4XWOD 1LP9B 4X9GA 1KLUB 2OI9C 1LMKA 5JW3L 1KCKA 3AREB 1F6FB 3MLWL 1TLKA 3DO3A 1UXWB 3CVHA 2JB6A 1VADA 3M17B 3R1GH 2YD7A 2J6EL 1IAIM 4NZTH 1TTFA 4Y4FA 3KS0H 4WHYG 3VFWB 3K1DA 4M4PA 2MQCA 5F7EL 1RIHL 3UZQA 1MLCA 1RULH 4ZD3H 2XNAB 4M3JA 3JWDL 4ZPVA 1FGVH 1EEZA 3X11A 1UM6L 3SDYL 4F37K 2CLZB 1ZVSA 4FQJL 3GMMB 3C5ZC 4Y1AD 1OTSD 3HE6A 4K23H 1JWUA 3CC5A 1KJVB 1OB1A 1UH3A 4R7DA 5IUSA 4GOSA 4UT6L 3HZKB 3QNYA 5J6HA 5D1XC 5CP7B 2H9GB 3QCUH 1NCBH 1X7QB 4UUJB 2UVFA 4BFBD 4ODVL 2VZVA 5E99L 3U46A 1IRAY 5GRXG 1R3HB 1FL6A 8FABB 2K9UA 5DRNA 5BZWB 5GJSL 4M43H 2VDRL 1ZVSB 4POYA 3S88L 3EGSB 3LD8C 4MDIA 4YGVB 2Q7YA 3ESUF 2APBA 3U4BH 3FOMA 1BEYH 3L1OH 1MCCA 2B5IB 4HS6B 1GHFL 3VI3F 2VUYA 4HJJH 5HDQH 2EDDA 5A2IH 2HFGL 2EDHA 1GZQB 1SBSH 5BVJB 5CJQH 3IDNB 3VFVA 4HC1A 3SQBA 5F3HA 1QP1A 1QFWH 1IEHA 4LVNC 5LQBL 4NJAH 3W0WD 1OGTA 3MODH 4YXLH 3AMLA 1OTTC 2X5PA 4MAYD 5IGXL 4PJBF 4CADA 3AM8A 4YPGA 1AC6A 1MJUL 5HI5C 1OAXH 4NKDB 4F7CB 4BSVB 4OFIA 3PXJA 5GS0C 1BQLL 1FVEB 2JJSA 3HR5B 1JHKH 4K3JH 1V7MH 2ZOKB 3C5ZB 3O6LH 4HZAA 3ARED 1U8PA 3CDYA 3MBEA 3IAQA 2K3TA 1QSZA 4QY8A 5KS9A 2R15A 1YNLH 1KF9B 5D7LE 5B21A 4FQLL 2EYSB 3UMTA 3OAZH 3VD4A 4FP8L 4ODUA 3ARRA 4GW5A 3VRJA 1YYML 4Z7QF 3IU4L 3RZCC 1PAMA 1KB9K 1A6ZB 4HUNB 3WFBL 5GGVL 1F4AA 5F71A 1KPUA 4C56A 5F6HJ 4PGCA 3TZVC 2J8UB 3EBAA 3T0EB 3NFSL 3RWFA 1B2WL 1ZHKB 2QHRL 2HT2C 4HC1L 1FIGH 5C9JA 4DKAA 3LV3B 1EXUB 2DM7A 4IJ3C 1RZFL 2J8OA 5CIPA 5IESL 3S35L 4R9HA 2KZ1B 5EU6A 2MQ3A 4YQXL 4JG0H 1V5JA 2BERA 2BOBA 4ZAKB 2KL6A 4UT9H 1QLRA 4LSVH 1NCAL 4NKIL 4Z7WB 1MPAH 4N0CC 1MIEH 3N1QC 2CDFA 2X4PB 1YN7A 2XN9D 2G5BA 4OV5A 4NT6B 2YEZB 5E9DB 3RAJL 2ADGA 4CAGA 5FYKD 4EDXB 5DJ0A 1KLFA 1HHHB 1MREL 3R8QA 4YDKL 5BVJA 2IH1B 2CD0A 3OKYA 1J7VR 1K4CA 3LKNB 3BUYB 4PJ8B 4WEBH 3FN3A 4P3WA 5BRZE 1IAOA 4ONGL 2APTA 2Q7NA 1ND0B 2K1MA 4XBEH 2F74B 2EEBA 4XNZB 1JHLH 3QISA 3B9KD 4QRPA 3O6ML 4WTZA 1T4KB 3RU8H 3IDGB 4AENB 4F7TA 2DYPB 4UINL 5K93A 4D8PB 4U2ZA 1X5LA 3OR6B 5MEND 1BQSA 1H5BC 2EDBA 3SJVE 5DHYA 1DBAL 5I1GH 3QIUA 1M7DB 5FHAH 4XCCH 4GAJL 3EO1A 4CVXB 2QQNH 1QO3A 2A6KA 2X89A 4U1SA 3C87A 1F3RB 1L4IA 4RWYL 5D1QD 4AEEA 1RU9L 2GCYB 1NLDH 5TE7L 4AMKH 3OKEA 4XP4L 1I3GL 1PX3A 2NY1B 4QOKA 2V5YA 2YHGA 4N1EA 4WO4B 2WBWB 4JPIA 1T66C 2HLFD 5T1LA 3C5JB 1V3MA 1WFNA 2J5LC 3EYQD 1WWBX 3EDJA 5HGAA 4TNVF 4WI8A 2VLJB 4Z95H 1KIUA 4OLYL 4EUPG 4HQQL 1MCIA 3ARFB 5DHVH 4WO4A 3H9SB 5HHMB 3WFCL 2R29L 4PJ8C 5JHDD 1RVFL 4J3SA 5EIIA 1CCZA 1OGAB 5D1QC 4PJ5B 4JDZB 1Q94A 1MCEA 3DMMA 4L8SC 4WFGE 5I6XB 1IGFL 3V0VB 5DJXB 5DHXB 3FFDA 3SY0A 4G8GD 5BVPL 3LEVH 5HHOE 1WWAX 2I25N 4PJEB 1ZHNB 2PCPB 4G8FB 2XICA 3L5IA 3FT3A 3FAXA 3OR6A 4I3SL 4LEXL 1N7ML 5C08E 3MCLL 3ZSTA 2FX9L 4X5LA 2P5WD 3MRKB 4FFZL 2ZUUA 4J7RA 4UQ3A 5BO1L 5I1JL 2FB4L 3AROA 5DURB 4FFWC 4JANA 4MNGB 1HZHH 1MWAH 3M8OL 2CKNA 5EU4A 1AGEA 3VDCA 4NQUA 5JNYA 1C16B 3IJYB 3LKNA 1IJ9A 4N8CH 1NMCB 4OUUB 5INDA 5C0CE 3RA7H 3U4EB 3VD5A 4TPRL 3SE8L 3MJ7B 1KENL 5IROC 2O61B 4KDVA 3RVTC 2EYTB 3GMPB 1OM3H 5LAXB 2WBJA 3QNZA 3RBGA 3FB5B 2Z92B 1ED3A 5FUCC 5D6CB 3OQ3B 6CGTA 4JHWL 1J1OH 5EU6B 3CIQA 4DAGL 4HK3N 2B1AL 3T0VA 4EOWL 3K81A 1JF6A 3QXWA 3MQIA 1NMBH 4FQQA 5D1QB 3U0PA 4WHYH 3P11L 1Q38A 2D4FA 3UYPA 3S97C 5TDNA 3Q6GL 4FQCL 5HPMB 1A6AB 1NC2D 3KPMA 1LDSA 4L8SA 3MJ6A 3LRGA 1F4WL 2H45A 1G9MC 1EHLL 3CDFA 3OKMA 2EYSA 3WXWL 2YMXL 4HS8L 5IMMA 5CBEA 5C0CD 3QUMA 2CKBH 5HHME 3GIZL 4YBHA 5IMOB 3FQUB 2CLRA 4C56E 3VFRA 4G8FA 4N90D 5DR5L 5BW7C 1Z3GH 5IW3A 2DLEA 1BWMA 2ZCHL 4U1LA 5DD5L 3QIUB 2JCCB 1NGXB 4JJ5B 4HXAH 1QNZH 1OGAA 4F80A 1DSFL 1U8OA 2HH0L 5JIHA 4H1LB 5D7KD 1S7UA 2DWEB 2HN7A 5H2BB 3CFBB 5F3HB 1FNGB 2CGRH 2W9DH 2KUTA 3MO1B 4PG2A 3MRLB 5ITFB 2AXJA 1AIFA 1RIUH 1ND0A 4Q9CA 4EI5B 3F58L 2R4SH 1XF3A 3LIZL 3CMGA 4MQ7B 1K4CB 2DQFB 1ADQL 3U0PB 4HDIB 4KMQA 1UG9A 5I74C 4I5BA 2NX5D 4OGXL 2VL4A 5IEHA 4L4VE 1ORQA 2AJVH 4UU9B 4EUPA 4P49A 3IDUA 5K9OB 4L8DB 4K55A 1Z0MA 2ADJB 4HIIB 5SWSB 4LKXB 1RZ7H 1AGFB 2D3VA 3QA3A 2IJ0C 4LK4A 3V52H 1JYVA 4UQ2B 1R5VB 1OF2B 1QVOB 4G6JL 1J12A 3T4YA 2X1PA 3EHBC 3WNPA 1CFQB 3BJ91 3FJTA 5MP6H 3CUPA 3IFPB 2VDOL 1CGWA 2Z91A 2XZAL 3TFKC 1DEEB 2VITB 3Q6FA 2ZG2A 4GMTH 3MOBH 1DDHB 3C6LA 1DQQA 1TETH 5C0BD 4LRNL 3MRKA 2HTKC 1G7PB 2KQNA 3L5XL 4PP2B 4DN3H 3BMVA 3DGGA 4F3FB 4U4BA 1J8HB 4E42A 1DL7L 2I24N 5MENE 2EZ0D 5HYJD 5TE4H 1QBMH 1P4LA 4XVJL 5T33H 2EIZA 5T1KB 4YDIL 1A0QH 3JBG7 4NQSB 3GSVA 2IALA 5HHPA 3RZCA 2VLLA 3O4LE 1FVEA 4Y4KD 4EI5C 1L0QA 2AEIT 2OM5A 4WDIA 4YHIA 1WUNT 5DMIH 2Y6SD 5T3ZL 2DQDL 3ARGC 2X70A 3VXQB 3V5DB 3SE3C 3K74B 2DIJA 1OCWH 2FLBT 4CU7A 3FRPA 4CMHC 5IFHL 2DRUA 5F9WC 4ZFGH 3TA3B 1RV6X 3ZKXC 3A6CH 1FO0A 4LVNB 4D9RD 3T4YB 5J06A 2PNDA 3Q3GA 4G6AC 4D0BA 1BLNB 5ERWB 1G7LA 4OT1L 1F6LL 1XZ0A 3WUWG 4G7VH 3ARPA 3D0VA 3CSPA 2CH8A 4NDMA 4QOKD 3NCJH 4Z76B 3LKQB 3QP3A 4NO5A 3VGBA 1AXSB 1MRDH 1JV5A 4M5YH 3QUKA 4FTVA 1T21B 5ID0A 1D5BA 3KLHD 1IAIL 5JOPE 1OAKH 2DQFA 1EDQA 1L9MA 3JV4B 4MVBD 1INQA 5A3ID 4DKFH 4ZUUA 4K94C 3O6FB 2ZSVB 4O2CA 3EO0A 1T04B 2J88H 5C09A 4QT5A 3I6KB 3A67L 4E5XB 4PLKD 3QIBD 15C8L 1YPZA 2BSTB 3CXDL 3KPPA 3TO4C 3CH1B 2AABL 4FQ1L 2VABB 1DBJL 3ROOA 5IR1B 2G9HB 2I5YL 3IAGC 4IOIA 1RUPL 1U3ZA 3ZDXF 5JZ7C 2JIXD 2DQEH 3VXME 2EKJA 4JO2H 1GOGA 4LCWB 3W11D 2BCKA 1S7SB 1WZ1L 2AXFA 3T2PA 4NZUL 3PGDA 1HWHB 3F7YB 5K9KB 2H2SC 5L2KE 1G6RH 2DMCA 2FHBA 4EDXA 5C0IB 2QBWA 5CEZL 1F58H 3EFFB 4KAQH 4J3XA 4NN7B 4NZRL 4X99B 4G43A 4QRPE 4FQ2H 4ACPA 2PW2A 4ZO6A 4HUVB 4KV5F 1YMMB 1CLOH 3MOAL 4X9BA 3O3BA 3RI5F 3QNYB 1P1ZB 4J8RA 3WIIL 1KSRA 3F6LA 3R8BB 2VQUA 2O5XH 1BLNA 3CSYB 1UEYA 1ZAGA 2OXHA 1R3JB 1MQ8A 5K59F 2LVCA 1SEBB 2DYPD 5DLML 4ZTPL 4RAUB 4M9PA 3O11B 4U49A 1KOAA 2NY2D 2OR9H 3VG9C 4K7PH 3BRDA 1DN0A 4GG8B 5T1DH 4MJ6B 2X09A 5HVFB 3VFNA 1FPTH 1FO0B 5JDJA 3CFDB 4Q2ZB 2DQJH 1JGUH 3I9GL 2B5IC 3ES6A 4U3HA 3U0WL 4ETYA 1MHPH 5GZNC 4JFEA 4UOJA 4A6YB 1KCVL 4IDJL 3H2WA 4HIHB 4Y5YC 3WN5A 3QQ4A 4YWGL 1DJSA 2I60L 3GSNL 5DSCB 3FT4B 4WI3A 5ESVA 5IFAH 4JO3L 2VDQL 5I18L 1QBLL 4FQXB 3IVKA 1K6QL 1FCGA 4XNQB 2D7TL 2P5WA 3VRLE 4XCEA 2XACC 3GBNH 1IC5L 1WT5A 1MQKH 5KSBF 3C8HA 2FBOJ 2Y72A 1XGTB 1QFUL 4ZOBA 2Z91B 3PHSA 4RMQA 2XKNA 5D4QA 4YAQA 7FABH 3PWPB 2GK2A 4OM1L 4KROD 3PNWA 3CMOH 3DRQA 3RWIA 4QOKE 2GT9A 3RX5A 3BPLB 1CXKA 5J1AA 1C08A 2NY4C 1W0WA 1QA9A 2EEDA 1HINL 5FCUL 5DURD 5E1AA 1QLEL 3GO1L 4FABL 3FONB 3MRCA 2ZNXA 1EO7A 3AMKA 3HI5L 3OSKA 3U0TA 4MWFB 1A8JH 2GSGB 3B83A 4MA7L 2OZ4L 3LS5L 3TBYA 3IFLH 1QQDA 3ARWA 3PABA 3SDXA 2DL9A 5IK3A 2YBRA 3FHAA 4NBYB 5D72H 1CF8H 4ZYKB 4A6YL 1NMCC 2R1XA 3B3IA 4GKSB 3HMXL 4ETQA 3QFJE 3D39E 1F11A 1AIFB 1Q72H 4EIGB 3UTTB 4KVNH 1P4IL 4M8VA 3O45B 4F15C 5IOPA 5I8OL 5CHNB 2EDTA 1Y0LA 5EU3A 3VFRB 5C92A 2R56H 4I0KA 3S5LB 3QDAA 3RWHA 1RUAH 4JO4H 5TE6H 1A9BB 4GG6B 4D8PA 3DBXB 2ORBL 1FBIH 2FBJH 5FYKL 4HUKB 4WTWA 5KJRH 1EMTL 3EFFA 4RFOL 2CK0H 5JUEL 1U8MA 2KBGA 2FL5B 1Z9MA 1YQVH 4MD4B 3TVMA 3G6JE 5FM5M 3G5VB 4JDTH 4X4ZA 2F74A 5CEXB 5HHNA 4Z7VF 2VXVL 2VXSL 3LQMA 4I18A 4KK9C 5EBLA 2DDQL 3O4LD 3FCTB 2IPKB 4FQXD 4PTTA 1MFAL 2NXYB 2UZYB 3KR3H 3IDGA 4AENA 4F7TB 2BVPB 2ADGB 4LAQH 1K5NB 5IMLB 3BE1L 2MTPA 4JR9L 4WTXA 2EICA 1XGYL 3G6AB 4P2RD 1JFQH 1NAMA 4LOUC 4GRLB 4POUB 2L7UA 1IAOB 2DN7A 1J1XH 1IM9A 4G6AD 3RY6C 1SEQH 3PWJA 2FCBA 1OQXA 1ZLWK 2Q8AH 4WO4C 4BH8A 4NHUB 1KC5H 4OCYL 5C9JB 4QRRA 3VH8A 4YBQC 4OCWH 4LU5L 4NO5B 4KY1L 4XTRD 2YPLB 4NFBA 1U8IA 3MRDB 4KROC 5JO5B 2BOBB 1BVLA 2IWGA 3C09B 3TBTB 5ITBL 3QDME 4F33B 5GS2H 1HXMA 1IM9D 3P4MA 1A7PL 4XZUB 5C7XL 4PBWD 1WBXA 3OB0K 3BKCH 3MUZ1 2WNGA 3TJHC 4EN3C 1I1CA 4AG4H 1PX4A 5GGRB 3X12B 3SE4A 3BP5A 1R3JA 3Q48A 4AEFA 4P46C 5IF0B 5EOQL 2J4WH 4HUUA 3EYOA 1GXEA 1HH9B 5SWSD 5E8NA 4G6KH 4Z18A 4HIJB 3CFKB 4LSRL 1CDUA 1BPVA 3VRJB 1E4XI 3KVQA 4LSPL 2VDPH 5D7JD 5FDYA 2OMBA 3OKNA 1N6VA 5FK9A 1UWGH 5KOVC 3KXFB 3FB6A 4JKLA 1OP3H 1MEXH 1OPGH 1J11A 1C1EH 3MXWH 4YHPA 5GJTL 2HT4D 1KJ3L 3FQRB 4JVPA 4L3AA 2IFGA 3VXRD 4K7PX 3KLDA 2C3XA 5GSRB 1D6VL 1MFCL 5EBMA 5KSBE 3LMJL 3CNKA 5JIKA 4APQB 4HJ0D 3WNNA 3O4LA 4YO0A 1FL3B 5KVDL 3VFOB 3G5YB 5KW9H 4YPJA 1S8DB 4PJDB 4ENEC 1W72H 5IJKA 2AEPH 4NWTL 1JBJA 1S9YB 3SDDC 1I8IB 2JJSC 2D7MA 4X4YA 4P5MB 2O5YH 3OJ2C 2IANB 2A9NL 4BZ1L 2Z35A 3IDYC 4O2FA 3TPUB 5J6GB 4FQHA 2MHAB 5DXWA 5LGJB 3LN9A 1BFVL 3EDDA 4JZOB 3L95A 2WW8A 3PHOA 4FMKA 3R0NA 5DC4B 1RSFA 2FEEI 1F3JB 1Q9WA 3NABL 1MJJA 2VO5A 1AJ7H 5T3XL 4CDHA 3T4AA 2ICEB 5F1IA 4JRYB 1MJ7L 4HGWA 1AXIB 3HUJE 4ZOEA 1FO0H 1YEKL 3BIKA 1SJHB 4IMKA 1I9EA 3HCVB 3S35X 4R4BB 4FFYH 4M61A 2IAMC 1CIUA 2XNAA 3KYNA 1JGEB 4PJFE 3FQWB 2XZZA 1BBDL 3T8XA 2P5WE 3OV6A 5F93C 3SJVB 2X1WL 2V5RA 5BRZB 4IOIB 4XAWH 2AJYH 3VXPA 1D5ZA 3IF1B 1IEBB 4JPKH 2EH7H 2XA8L 4RFNB 4Z7WA 1IGMH 3HZYB 1JF1B 1UA6L 5JXEC 4J4PC 1FV1A 5FKAB 2NTFA 3MUGB 4F57H 1CD9B 5ACLA 2DIBA 3T0XA 3U7YH 4U1LB 1R0AH 1CGXA 2ADFH 1MFBH 3MLVH 3LV3A 1VKXA 1HHIA 4LPYA 4LQFH 3WD5L 1S5IH 1T89C 1JV5B 5TFSH 2GTZA 1Z9LA 2IQAA 3S36H 1J5OL 1A21A 3G6DL 1DBKL 1QHOA 5I1KH 3QHZL 1I1AB 1G6RB 4X6BB 3V5HB 1D5MA 1UVQB 4X5WA 5GGTA 4PJXB 5CILH 5SX5K 1TJHL 4OLUH 3SDXE 1RJZA 4LIQL 3AS2A 3SO3C 2NY2C 2VXTH 1BVLB 4HAFA 2EE3A 1OAYL 2HRLA 4K7FA 4IRJB 1DZBA 5CMAB 1F8TH 3QI9B 3O9WD 3IFNH 4OCXH 2EH8H 1C5DB 1D5IH 5D71H 5DD0H 5FUZL 1NFDF 4G42A 2VLME 1KPUB 1WCBA 4M1DH 2XZQL 3B2UC 1C7TA 1YMMD 4DK6A 5EOCL 5DJCA 1UWEL 1JGLH 1ZLSH 3FTGB 1MHEB 1N5AA 3ROLA 4O2EA 1AFVL 3HE7A 1QSFD 4NWUH 4LNRB 1HSBA 5JQ6L 1REIA 1JRHH 1WISA 1A3RH 5D8JL 4B7LA 3H42H 3EOAB 3FZUD 1RZJL 1VHPA 5C0CA 3D5OF 3UCRA 1KJ2H 1M4KA 2UUDH 4TN9A 1FLRL 3CFCH 2Y07L 4KWUA 1YEIL 2UY6A 3FOMB 1ITCA 4OZ4B 4S11A 1ZE3C 2OL3L 5KANI 1PFCA 3TIEB 1LILA 4OSUL 1ZKAA 4R26L 4TVPH 3LN4B 1NGPH 4PJ8D 3IAPA 1GC1H 4PV9B 4YE4L 3N50A 3DPBA 1LHZA 3RWHB 2A38A 3UJJH 1VEOA 4QHLA 2QHLA 35C8L 3QDGB 2IANA 4MDIB 1SBBA 2NXZD 2OCFD 4LMQI 3BHBB 5MENB 2WSKA 2GAZA 4FQXC 1CZ8L 4TUJA 5DUPH 4NC2B 4N0FA 4POZC 4AM0B 1I1AD 3HFMH 1YEEH 5I75C 1DEDA 5EZIL 5I8CA 3FO2B 4XP9H 3ARDD 4CVZA 4BKLA 3PP3H 4JN1H 3NTCH 4TVSa 3DNKA 1U2CA 4MX7A 4I77H 3HFML 4JFDE 4IRJD 1N5YL 5I8KH 3BEVA 3U30B 3I6GB 5L0QC 3ARGA 1DQMH 3WV0A 3DGCR 2HG5A 2XIDA 3BKMH 5AEAA 5FM5O 2E3VA 2Q8BL 1Y6NR 2F58L 2A6KB 2DD8H 2JCCF 5C07B 4LLQB 2J8HA 5HHQA 3CU7A 1AO7B 5FB8B 3KYOA 3LD8B 4YHPB 3WDIA 3OXSB 5IW6B 4LSUH 1P4LB 4AYFA 5IMOA 1BF2A 3ULSA 5EBGA 1TPXC 3LKSA 4UTBH 3B5TA 1HILB 3WLBB 1YDPB 3RVTD 3MR9B 3UPCA 3MBEC 2VRAA 3N06B 2P5EB 3B6SA 5TPWL 2DM3A 4LVEA 2HWZL 1QZ1A 1VPOH 2Y07H 1S7RB 4CW1B 3MYJA 4LPVA 2EEAA 3W0WE 3NN8A 1JGDA 1MI5A 2AJXL 2NLJA 5DWUL 3BUTA 3DUSA 3ARBB 4U1NB 4Q9QL 5KVEH 4WW1B 3ZL4H 1JRHL 1LE5B 1JL8A 4I4WA 1IM3B 4X7SL 4HXBL 5CJXA 2VC2H 1AFVH 4ZODA 3B9KC 1T6WA 3SKJL 2YA0A 1AI1H 4JFYB 3P40A 5C0GB 1RUKH 1WBYB 3LKPB 3TBVB 1SMOA 4MLSA 3BT2L 1PEZA 3NOIA 3UJIH 1XF3B 5F21B 3TP4A 1MCOH 4WJ5A 4M1DL 1KEML 5D7JA 4L3CB 3T3PF 1DTUA 3PG2A 1IEAB 5CD3A 4NQXA 4ODWA 2BRQA 4AEHH 4KDTC 4OGAD 2H6PB 5CUSL 4YBLB 1OSZA 4LLAA 1WK0A 3BKJL 5KSBB 3B2VL 3EAKA 1FFNA 5CBAA 3EYVA 1SEBA 3QHZH 4NRYB 4JM2C 2C3HA 1T2XA 2ILLA 5E8EB 2PTUA 1J5OH 1Q9KB 4MXVE 4JKPL 3KYKH 1YYLL 5D1ZD 1LO4L 1S5IL 1E4WL 2VSCA 5ADPL 3GHBH 3GSOB 2GJJA 2GW5A 3C09C 1AO7D 4ODXA 3O4OC 1F4XL 1DQTA 4G43B 1RJLB 1OP5H 4OLEA 3A6BH 4BH7B 3GSNB 4RGMC 2LAAA 2P43B 3DVGA 1BZ7B 5I1LB 1N0XL 1FG9C 1AR1D 5B39A 5T1LD 3MRGB 1ZVYA 2NR6D 3KPOB 5D7JB 4LP4A 3HA0A 4YHOH 3LB6D 1QFOA 3GIVA 1FZOA 1MVUB 5HVWA 5HPOA 3QZWA 1CGVA 2LVEA 1CK0L 1CS6A 1JPGB 4HX1B 1YJDL 3MBED 1CFTB 3NFNA 4MD5A 1FO0L 2ZPKH 1IGCL 3GJFH 4M6NH 3O3DA 5EOCJ 2Z9TA 1ZA6A 3SDCB 4TSBL 3LKQA 1R3HA 3S34L 3PGFH 4MJ4A 3Q1SH 5C0FB 3O3UN 3A6OA 5FM4A 3SQOL 1FORH 4OV6F 4P2YA 5KSAD 5DT1L 4L4VD 2P8PA 4J4PA 5L2KA 2AJZA 5D5ME 4BM7A 1ZHKA 1ZS8B 2ZUQB 1T4KA 4KJPC 4NDMB 5DGRA 2AEPL 2CMRL 4XX1E 4JANB 4MNGA 2CPCA 3QCTH 2JIXA 4R3SA 3GMOB 2I07A 4XWOC 3ME0A 3G5ZB 4GW5B 4PGDA 5LKNA 4U1JB 2BSRA 1KB5H 2X9XA 2FHCA 5E08H 1Q0XL 1YEHH 5HHPB 3BXNA 1JZ6A 3I50L 4JREB 3SBWA 4W6WB 3QXDB 5ALBL 1TVBA 1HSBB 5CCKH 3ECBB 2DQHH 2P48B 4RBPH 2QADC 1BZ9B 4O00A 5IQ7L 2COQA 1HI6A 2PXYA 3IFOB 4LRIC 1TJGH 2QLVB 2FX8H 3VDBA 3LSOA 5JIPA 4QXGL 4ZUSA 1DN2A 4YXKL 1OAQH 4YHZL 4UTAL 1XEDA 1DQQB 4LSRH 3VXUB 1IGTB 4PLOB 1OL0A 3MLTB 3E3QC 3VFUA 3BP5B 1ES0B 4H26A 4Y88A 3RBSA 3H7BB 1M6OA 4PGCB 4UT7H 2ATPB 4XPTL 1C5BH 5L2KB 2Y4SA 3H9ZA 1YEHL 3GSWA 5E08L 3OX8B 4YHYB 4M62H 4OF8A 1T7ZA 3U79A 3C6SB 3T77A 2DKMA 5BOZG 4YDJB 2QSQA 5DRXB 1H0DA 5EUOB 5J13B 2P7TB 4BUGA 2FJGA 4MXWH 3MV8A 2F5AH 3PDGA 5F9JA 4NQEE 2CUMA 4OCWL 2O93L 1CICA 5EO1A 5IG7B 2AK1H 1BP3B 4OCYH 5B38G 3PL6C 2DQTH 2ATKB 1OD9A 5DFTA 2D03L 2XV6B 3Q5TA 3IDXH 2DICA 5ITFA 4J4PD 3ZTNL 4HH9A 5I73C 1SQ2N 4IRJC 1D5ZB 1CFNB 4R90L 2FX7L 3ZKXB 4N0UB 2G75A 4HHAB 5H8DA 5BZDB 4W4OC 4BK4A 3OZ9L 5KSVA 3NIFF 4PJDF 1YN6B 1UZ6F 4J3WA 1QACA 2MKLC 3KPSE 2DQGL 4R96B 5GGRY 4GUPA 2BC4A 4WW2C 2B4CC 3NMEA 4ZS7L 4URTB 5ANMA 5JPNA 4JRYA 3VFGL 1ZTXL 1AXSA 1ACZA 3TH4T 4EUPH 4BQ9A 4H1LA 5CBAB 5JUEH 4HSQA 4LNVA 3A6BL 4QT5B 2H1PL 1KTDB 1ZOXA 4L1HA 2G5RA 4YHYC 2ORBH 1F4XH 3MLSH 1KCRH 3QWOB 4Y19B 2MHAA 1KJ2A 4U6HA 2R56L 3D6GA 2C9AA 1JNNH 4R97C 3VXMA 5HGHB 1E4WH 1LO4H 4JKMA 2AS5M 3H6JA 5DVNA 4MNHB 1KEGH 1AD0B 3V6BR 3MV8B 5DJZA 1GOHA 4PB0H 3BPCB 1XCTA 4MAUH 1AGDB 3GMNA 3B2VH 1RZKC 5IK3B 4A6YH 5D72L 1N8ZB 5IVNA 4JPVH 3VWKB 4XC1L 3HLAA 4J12A 5CUSH 2Z0BA 3QDGD 3RWJA 4DK3A 4JQVC 2VLJE 3IJSB 3GUTB 3VE0B 1RUQH 1A14H 2QJDA 5FKPA 3F12A 4LLMA 3AXLB 3TGXA 3DSFH 4P5KA 2X4TA 1F13A 5FCUH 3ZDZE 1VFUA 3DUSB 4OGYL 1HINH 1FGNL 4U1NA 4X7CC 5E94B 5B3JE 4ODTL 5F9OH 4PJBA 2E8ZA 2FH8A 3GKZA 5EU5B 3HAEG 5F8RC 2ICCA 1WIUA 5EC1B 2BNRD 4OCRH 5JOFB 4Y16B 1NC2A 1AI1L 2PTTB 3N1MC 3ALXA 4KJYB 4UBDC 3FB5A 1DQDL 2WWMD 3U9UA 2EDXA 3P0VH 4PS4L 2EC9U 3GJFB 4M7LT 1G1YA 3ZL4L 3GBNL 5KVEL 1P84K 4B53A 4F7PB 1T2JA 4HGMA 4KJWD 4NIKB 4Q9QH 3V7AE 3B9KA 1VPOL 5GHWL 3GBML 3H9HB 5CJBA 1CICC 2X4SA 1AO7A 2CXGA 5IVZB 2WK2A 4Y4FC 5LGHL 5JO5A 3MA9H 3D39D 1WEJH 2Q3ZA 2V2WB 3GSNH 4PRHA 1A5FH 2H32B 4NNXB 3STLA 2IC2A 3DYPA 1INEL 3HC4L 3PWUA 1MHCA 3ARGB 4IDJH 3CJJA 4JFFD 4JFEB 1MCNA 4D0CA 1I8LC 1L0XA 4TYUA 5IFJA 3NA9H 2Y7QA 4MB3A 1G9NC 2VDNL 3TPUA 5JHDA 1SYVA 3CFJA 5JXAH 4IMLA 1CTOA 1J0ZA 5DQJB 1NUDA 3IXTB 1W72B 5MEOB 2ZWLT 1CL7L 5C09E 3HE7C 3GMMA 2Q8BH 1QSEE 1GPOH 1OP5K 1LO2L 1DQJB 3RQ3A 5B4MD 3S36X 3WJJA 5HI4D 5CKAA 3D2UB 5EUKA 1QQDB 3PABB 5E5RB 1IGIH 1P7KA 4WUUE 3MRGA 5F96H 2V7HB 5HY9A 4JZNB 4EXKA 3MRLA 3WS6A 5I1AA 1L7TL 3P4OB 3I75B 2D0FA 4ERSH 5E1AB 4JFZL 3O3BB 1Z2KA 4LKCB 5E7BA 3MNVB 3SCMD 3WE6A 3H3BC 3C8KA 2GT9B 1YECH 3BKYL 1R3LB 1CLZL 3MRHA 1AP2B 1W8NA 3QDMB 4LLYB 4G8GA 4WNQB 4B7IA 4LHQB 4YAQB 3GI8H 1EX0A 3GSXA 4ODWB 5LXGH 1F58L 3RNQB 3ZHLA 2C5DC 1OOAA 3KPMB 4JQXC 1HN1A 3BN3B 4YHLL 4MNQA 1KXTB 3MLXH 2WBJD 3NVQA 1RZ8B 35C8H 1S78D 2VLKE 4OD1H 3BGFC 5EBWA 25C8L 2AV7A 2GJZB 3C9NB 3NPSB 4PV9A 4TRPH 3P4NA 4PGBA 2E7MA 4YE4H 5FA3A 1GC1L 1T6VN 1T7YA 4F33A 4Y2DD 2AJSL 2BHUA 3BKYH 4AY0A 1IL1B 15C8H 4M6OL 4F2MA 2OL3H 1TVHB 4S10A 2C1PA 3DVIA 3G6JF 4BUHA 2X4UB 4FXKA 1NMAH 3X3FH 4LEOA 1S9WB 2C3VB 1W0WB 4P46D 1X5GA 4PRAB 1OP9A 2XZCH 5CGYC 2HLAB 2WMPA 4JFPB 5F96L 2PETA 3O4OB 2R0KH 1A3RL 2W9LA 3JWOL 1IAIH 5D8JH 5DUMH 4QRTA 4JFED 4FXKB 1MRDL 3QO0B 3BH9B 3T1FB 5F7YC 3H8NA 4RAVB 3WHXB 2QQKL 4P4KC 4E9LA 3T3PE 4TUOB 2GSIA 3VWKA 1X44A 3MRQA 3MRRB 2ZCKH 2P5WB 1QSFA 3SDDD 2BY2A 1GZPA 2VXQH 4RX4A 5EO0A 5FYJE 2YUZA 4G9FA 4ONOA 1D5IL 2VLRD 3ZE0E 3CDGA 3GEWB 3HC4H 3PV6A 3DX8A 4KMLB 3GHEL 5FM8A 1E0OB 2EIBA 1A5FL 2Y06H 3BGFB 5AAWA 3L3HB 1FJ1B 5JOFA 5E2VH 3MUGA 1EEQA 4WDIB 3NPSC 1HCFX 4NJ9L 5EZLA 4PJXE 5F7DB 4JN2B 4XI5D 5DMIL 3OG6B 2L0DA 5CWSB 1CL7I 5FO8B 5I1KL 2N56A 4DKDC 3ZO0A 2CXKA 5JMOC 4U6YB 3MV11 3SGDI 3OAYK 3LRSA 1GZQA 5TE4L 2EKSB 4R7NA 1BMGA 2JJUA 3C2SA 3MLVL 1LO5B 2ARJB 4RMWA 4FZEL 2I9LA 3KXFD 4PS4H 4PP2A 3ULVH 4MMXC 4RMVA 3V6FA 2FRGP 5KSVB 1DQDH 2F53A 4H88H 5CKGA 4F7EA 1RZGB 4D2NA 4Z5RB 2DIAA 1U8LB 1IGML 4GMTL 3MRPA 4Z7UF 4KVCL 3KPPB 5EN2A 2VDOH 2VLJA 2X05A 4JFQA 3DTXA 1T04A 3ZE2E 2L4OA 4XPFH 4BSJA 5EC2A 2Q86A 4U1GB 4AIZB 3PJSB 5HI3C 1HYSD 4OZIE 4JFQB 3DV4B 3QDJE 4KZEH 2IAND 5L9DL 4NJ9H 4ZFFB 4HBQA 5HYEA 4KJPD 1TCRB 4HWZA 1HWGB 5MI0C 5J56B 4Y5VB 3ULVD 5D7IB 1KEGL 4RBPK 1BFVH 2NY1C 3O2WH 4FHBD 3RY6A 3E2HB 4ZS6D 5DK0B 4JM2B 5JDSB 1T1YA 2G75B 2A9NH 2VLKA 2VN7A 1BF8A 1IQDB 2BNRA 3H7BA 2Q87A 5CD5D 1UJ3A 1B6UA 3MLSL 1XFPA 1MCWM 1HOCB 4NWTH 5KS9E 3SDDB 1UXWA 3C60C 1Z0NA 1MOEA 4HIHA 2HH0H 5K9JH 1RK1A 2D7OA 4PJGE 1LK3H 2Z31D 5IB5A 5C0DB 2EYRA 3ELAT 3NCFB 5JPMB 3QR2A 5DD5H 1MFCH 2DQGH 1EGJL 3UBXG 3TO4A 2X4TB 5IVOA 1AQDA 4ZNCD 1HHKB 4NPYA 3TNMB 1M1SA 4PJBE 3U48A 1R5WB 3MXWL 5DD3H 1MLBB 1NMAL 3BO8B 2CIKA 3GIZH 4PD4K 5FXCH 4R90H 5EZLB 5F7DA 3QJHB 4HS8H 43C9A 4PGDB 1WWCA 5H37G 3V4PH 3KPRB 4HPOH 3CX5J 1LP9A 1U8NA 2D7QA 1V05A 3CZFB 3EIFA 4NM4H 4HUUB 4W81A 3QEHB 2CIKB 4MLIA 1XH3A 2YC1A 2NX5E 1HH6B 1GGCL 5IMKA 1CBVL 3OJVC 2X1OA 4DVBA 4OD1L 4QHNA 1FH5H 2HRPL 3BKCL 4P2OA 3PXHA 5GS0H 1NFKA 4MXWL 1PG7X 2RJMA 1J8HD 4DAGH 3RNKB 3EYFA 2DKUA 5T1MB 4HK0A 4XRCB 5KN5A 2HFTA 1CLZH 3TZVB 1B3JA 2R0WH 3BEWB 3JTTB 1WVZA 1YECL 2IQAB 3HB3C 3HNTL 5D7KE 4IIQB 1QG3A 4ZXBC 4OFYA 4WFFE 4H25B 3VFVB 5DYOA 2W0KA 4PRPA 3P0YH 2PYEB 3SJVA 2A9ML 5IB5B 4B41A 3EOTL 4JREC 4PJIA 5E56A 4GRMA 4KH2A 4YGVA 3GJEA 1AR2A 4X6CF 3V4PL 4NO0D 1RI8A 1TJGL 4RNRB 4I0PD 1FL6B 4R2GC 5BO1H 4FFZH 5IQ7H 1JPTL 5C09B 2DQHL 4XP6L 1KJMA 2A6IA 5EFIB 2QKIB 2WIMA 1F4HA 4PRPE 5L7XH 5JXAL 1XCQA 1ZHNA 2PCPA 5FYKU 1I1YA 2VXSH 1XIWD 2ZUXA 3BZ4B 5L2JB 3NCYP 5EZJA 4PG2C 4LBEB 1SJVA 1G7MB 1XF2B 3PWPE 4FMFA 1UJTA 3IU3A 3O3EB 1P7QD 1IGFH 4KK5C 2JTDA 4RFOH 4Z7OE 3U46B 2CMRH 3UEZA 4GG6A 3OJDA 3V7MA 2BVQB 5LGHH 3V4VL 5ENWA 1HYRC 4RGOL 2FD6H 5GHWH 4HQQH 3QIBB 4PJFA 1EHXA 2PYFA 3D39B 3MV01 4HMDA 4LSSH 4V1DD 3O2WL 5A2JH 1P4IH 1G6VK 4Y4FB 1X3DA 1I8IA 3QPXH 3Q1SL 1Q9LA 4MCYB 5FAAA 3PGFL 1U8LA 2AJUL 1KCSL 5KG9B 3P0VL 4RDQF 3ZKNC 5GZND 1I3GH 3K3QA 4H5SB 5L9DH 3LEXB 2E6PA 5EOTA 1BECA 1EAPB 5FO9B 1A7QL 4JFXB 5MEOA 4RIRB 2UV3A 3FFCE 5I73B 2YRLA 1J0HA 2X4OA 4RWYH 5MEPB 4E41D 2CLVA 3VI3E 3TBWA 4RMSA 4WW1A 4QHLB 4GKZA 1BD2E 4KPHL 4Y2DA 1NAKL 4HS3B 4NNYA 4L8BB 5ID1A 1UB5A 4F9LA 4DUWA 4WFHE 1NGYA 4OM1H 1A7QH 3WJLA 3V0WH 3TIEA 4I3GA 2CRMA 1B0RA 5IQ9B 3F62A 4EVNB 1IGYB 3RL2B 5E4EC 5D93C 4FZEH 1KCSH 2YD4A 3M1BA 4TUKH 1MQKL 4NCC1 2AAVA 4ONGH 2BVTA 5HYSG 2NCMA 4PRNA 5EU5A 2NZIA 3KYKL 5F3BB 3U30C 4LLVB 4LSSL 4OBRA 5ICYA 4H25A 1U8HA 5LBSL 5I71C 5INCB 3SCMA 4RGOH 4G80B 4AEIH 3V4VH 2FR4B 5DC9B 1I7RA 4RRPG 2AK4A 2X4NB 5E2VL 1KCRL 3ROLB 4I4WB 1XIWB 3L7EA 3ULVE 3QEUB 3GHEH 4YQXH 2W0FA 2GK0A 3O11A 3VFGH 3KYAA 2J2ZA 1J86A 1FZOB 2W65A 1GGTA 1Q9LB 2GHWB 1B2WH 1DUZB 4K7FB 3VXSE 5L7XL 4XP6H 5GGVH 4FFWD 5D2NA 1PLGH 1N3NB 1BVZA 5EA0L 3Q2CA 4UMGA 2DJSA 2XTJB 5DF0A 1YYMH 43C9B 1W8OA 3BW9A 2EXYC 2XWJA 5ID1B 4LPXA 4HH8A 3ZTNH 4ZTPH 3AS0A 1XCTB 3L3JB 1D7FA 2LU3A 4D9QE 3EOTH 4WU7B 3GSOA 4PJ9D 2D03H 5C0IA 2AJXH 2A9MH 1NAML 5DWUH 2XZCL 4W6XB 3WMSA 2ICWJ 3P0YL 2IAMD 2O5XL 2OQJA 3WIIH 4M6OH 5IROA 2PW2B 2HJKB 3OB8A 2F5AL 5EUKB 1A1MA 1EZVX 3KPLB 5IGXH 3TEUA 4YIQA 1I7TB 4MJ5A 2FLRT 3QULB 3T3ME 3L5JA 1ZLVK 4MWFA 2NZ9D 3WO4C 4ZDHA 4UZGA 3QIUC 3MLXL 4IRSB 1C5BL 4HFWB 4KK8D 3BUYA 1OQOA 1WZ1H 4PJ8A 5EH1A 3SDXF 2VLRA 2DD8L 1CBVH 1GHFH 5LXGL 1U3HD 5TH2A 4FTVB 1WQVT 4CMMA 4CU6A 3VXTB 4X4MA 5EUOE 5IB3B 3S88H 4FQ1H 4M43L 4HPOL 1MJJB 3C5ZD 1H8OA 3G5XB 3CXDH 1EFXB 3AAZB 5J8OA 1FNEB 4DWHA 5KN5B 5GRWA 3A67H 3RGVB 3QT2A 3CXHJ 1LD9B 4L1DA 3L5WB 5LVEA 1A02N 2R23A 4NRXA 1L7TH 5DD3L 1TITA 2EDWA 4YFEA 5ICYB 5ALBH 4H8WL 2Z35B 3HI1A 4PJHF 3BPNC 5HSFA 1OAKL 1CDGA 1KGCD 4JFEE 4PJEE 1CT8B 2CSPA 3VMPA 3UC0L 2VIRA 3RPKA 1LK3L 2CLZA 5EUOA 1F6AA 3RVUC 3TN0A 1CZ8H 2DMKA 1E27B 5HYSB 3VI4F 4I9WE 4Z7VA 5KSAB 2YKLL 3RY4A 1ERNA 1FGVL 4PJXA 4PLJD 3JWDH 1UM5L 5SV3A 1MCRA 3UTSD 5F72S 3PL6A 5F6IB 2C3WA 2VDNH 3TN0C 4ZXBD 1Y18B 4PJEA 5D5MF 3G6JB 3MFFA 1OVZA 5GRJL 3BEWA 3JTTA 1EO5A 2FGWH 4XPAH 2XN9B 3NZ8B 4NO3B 3AREA 4OZIF 4ZAKA 1NGPL 4G6FB 1U8JB 1GCFA 4WY7H 1T1ZB 5BQ7A 3W82A 3HC0B 3S34H 1G7PA 1FV1B 5TDPB 4ELME 1U95A 3TFKD 1BJ1J 2MKWA 2YD5A 5GSVB 2HYMA 3VXSB 4MZ3A 4PB9L 1YJDH 3BQUD 3CFCL 4TQEH 4LLMB 2EDRA 3IF1A 1NCNA 1AD0A 4XVJH 5I30L 1A1NB 2VKXA 1IMHC 5JQ6H 4DUVA 2KZWA 1R6VA 3KJ6H 4DN3L 4NWUL 4PJAB 1MCPL 4X6BA 4LRNH 5K9OA 4XC3L 1HYSC 4HG4K 4OCRL 4H88L 1D5XB 1UWEH 4ORZC 5MEQA 3S8WA 3D25A 3ULVL 4P5TB 1QVOA 4QF1A 4G6JH 3RVVC 5D71L 5DD0L 5B8CA 2EDLA 3ISWA 2FHFA 2ED8A 4LLWA 3D3VA 1S7VB 1E4JA 2VXTL 3C60D 1KTDA 1AY1H 1DBBH 4XXDA 3FB8B 1NFDE 5EN2B 4JPVL 2CO7B 2VABA 5HYIA 4OZGA 2NY3B 3BN9D 3RVWD 4ELMF 1AY1L 1DBBL 1VFAA 1Z5LB 2Y06L 1JPGA 4HX1A 2RR3A 3G5YA 3S36L 1P5UA 1BIHA 2AXFB 3DHJA 3GMLA 1JTPA 1UH4A 3UTQA 4I9WD 4ZUUB 4CKVX 3HRZA 4KUCF 1KEMH 3OKLB 1JGVL 5D96B 1BHGA 2ZCKL 5C08A 2EDJA 1Q9KA 3B43A 1RUML 4XHJD 1EO8H 3R06B 4ZXBB 5C2UB 2PYED 1ZV5A 2QQKH 2EH7L 3L95B 3PHOB 2LU7A 4X7SH 5CP7A 1QNZL 4HXAL 2F8VA 5DFVD 5M7QA 3K1KC 2QTEA 4W6YB 1CD1B 2GITB 3FQTB 4AIXA 5EO1B 4NO0B 1BBDH 2YR3A 4L9LC 4F8QA 4TQEL 4WHDA 2HWZH 3X3FL 4ODHL 2FJHB 3MLTA 4ZUVA 3AB0B 4OTXL 8CGTA 5TDPA 1D9KB 4V1DA 4WY7L 4ODUB 5TJWK 2VKWA 3UJTL 5GS3A 1OW0A 4J1UB 4TRPL 3ZHDA 1KYOJ 1I3RA 2FEDC 2FR4A 4HJGB 2R2HB 3QPQC 4JFDB 3RIFK 4P2CG 4OQTA 5F7NC 1YY8A 4BZ1H 2AK1L 1MVFA 3VXNB 3P11H 4Y5VC 4QXTB 3WHE0 4YJZL 5GZOC 1YEDB 2G2RA 1UM5H 3MNZA 2W0FB 4Q7DA 1NMBL 2C3VA 3RIAF 4BSVA 3DGGB 1W72L 4YDVA 5CZXC 4NNXA 3MJGX 3STLB 5CEZE 3GI8L 4U1HB 4R3SB 3F7VB 3HMXA 4NO3A 3HZVA 3WIHA 4XBPA 1TCMA 2EYTA 5HHXH 4D9QD 1U8KB 5I8KL 2E7LA 3HUJA 3UC0H 3X12A 3C60B 2QSVA 5E8PA 2BNRB 3U4EA 4DVRH 2A73A 2P8PB 2P8LA 3CLEL 4H8WH 3RA7L 1BOGA 4XP9L 1JMZA 5ICXA 1OPGL 3KYNB 1MEXL 5E7FA 2V5SA 1UWGL 1IGIL 3O9WB 4UTAH 4LPTA 4YHZH 3WHXA 1HZHL 5JORA 4YXKH 2VITA 3Q6FB 2HT3C 4LSPH 2D31A 3PV7A 3AB0C 1PKQB 2C4FU 1LO2H 3ARDA 4KGLA 4TVPD 2X1XR 5EOQH 2ADIA 3S4SB 5CCKL 3HAEH 3IT8D 43CAA 5J89A 2AK4D 1PGRB 5FKPB 4XNZC 2X4UA 4JY6A 3DXAD 3LEVL 2BHZA 1I3RB 5CS7A 5C7XH 3V8OA 1A7PH 1J87A 5BVPH 5ITBH 3B5GA 5E4EB 3CPLB 4JPIB 3LH2H 4YIQB 3PHQB 5CP3H 1WEJL 3QXTA 4NQED 3MA9L 4LU5H 1WBZB 4C58B 5EBMB 3GBMH 4Z9KB 2V17H 2N4IA 4OFVA 5DUBA 5E00B 3SQOH 1NAMH 3KPSA 1DANT 1EPFA 4NZJA 1QOKA 3M07A 3QWOA 1QA9B 3IDYB 4X5XA 4XMKH 4ZPTA 3WO3B 3ORJA 2F53E 3OWEA 5HDOA 4RA0C 5IMMB 4PJ9A 4TSBH 5EU7E 3V8CA 4HKJA 4M6NL 5I74B 1NL0H 1RU9H 3E0GA 1F2QA 3KR3L 3L3OA 5EPMA 2V2XB 3FFCD 3LKOA 4FTVE 5JORB 4NQXB 5CSGA 5EOCH 2QL1A 4ODTH 4ZSOE 1FVCB 3MJ8A 5BS0A 4PJIB 5JHLL 4X6DF 5HHVL 4YHOL 4DQOH 1S7SA 3GMLB 5HDLA 1HSAA 4OCXL 1RUQL 1N0XH 1F8TL 5DS8B 1VFAB 3T04D 4M4RA 4UINH 3VA2C 2Z8VC 4LIQH 1QYGL 4RSVA 4X9IA 5DMJB 4G8IA 5HHOD 4AEIL 3JV0A 3QQ4B 4RFNC 4H1LH 5SX4H 1A7BA 4CJ0A 3KLAA 4QHMB 1DBKH 4N0CD 3MJ7A 4NN6B 4PBVC 1OP3K 5KS9F 5DJCB 2DBLH 4JKPH 2VWEC 5ETUB 4LQFL 5DTFA 4U7KA 2YEZA 5E9DA 3KPTA 4TUKL 3IDJB 3K7UA 1YC7A 1R0AL 4HKZA 2PO6C 4LNRA 2X7LB 3L3GB 1A6TB 3U7YL 2XQYK 2LAGB 1N0LA 3TA3D 3QNZB 1J10A 1L6XA 1HQRA 4LSVL 1CDYA 4LCIL 2CKBB 4X4ME 4ZQKB 5FO7B 4GLRH 3T77B 1URLA 2Y5EA 3RKDD 1F02I 2Y5TB 1U3HB 2XY1A 3WDJA 4ZS7H 4L8BA 4KPHH 2MPAL 3AREC 1S7TA 4XAWL 5HHVH 4DQOL 2Q76B 3UJIL 4QRUB 3ZYJA 1CGTA 3RGVD 4NKQB 3WFBH 1W2KT 1WF5A 4L4TB 5DJAB 4PGJA 1F42A 3PQYE 7FABL 5FYJU 3L9RB 2EXWD 4P2OD 3IJHA 4LLUA 4PTUA 4WWKD 1RK1B 3RWDB 1NANI 4LGSB 1MELA 3I6GA 1YNLL 4XMKL 2GQHA 3MNVA 3HS0A 3BPNB 3QBTB 3W81A 2BNQB 3IDXL 1AQDB 4Q2ZA 4U0RC 3D1MC 3J7HA 2D7TH 2FD6L 3UTTA 5FDWB 5F7KC 5DJXA 1FDLL 4Y1AB 3UAJC 1UWXK 1R24A 2VDQH 5TPWH 3F8UB 3VJ6A 5CEZD 3SKUD 1S9VA 2ESVE 4XH2A 3LH2L 2X1QA 4WFED 3TBYB 1IGJA 1QUNA 1J9CT 3MCKB 4NJAL 5FYKE 4M62L 5HTSA 3QH3B 2PW1B 3BZDA 3UTSA 3FQNA 2PYFB 3D39A 4BFIB 1SBSL 4O2CB 1FC2D 3BP6A 4UT7L 1X5JA 3QO1B 4NRXB 3MREA 2ATKA 1KJ3H 1VA9A 2A0LC 1SJHA 2CIIB 2D0HA 1NBYB 2F58H 3R4DA 4D0CB 1JPTH 2HTLC 4WIQA 4UU9A 3QYCA 3HE6B 5T1DL 5JXEA 2YD1A 4N1HB 3R06A 3DUHA 5A16A 2OR9L 1OAQL 1DQML 5CSBA 2XKNB 3BZFB 4YXHL 2VDPL 4QXGH 5SX5H 4PJGA 1OW0C 2EDYA 1N5YH 3KYMA 1CFTA 3NFNB 3QDGA 2YPLE 4ODVH 3BQUA 4PJAA 3GBLA 1ZA3B 2V9QA 4FQHB 1FRGL 3VRIB 2NY2B 4AG4L 3CLEH 4DVRL 1YEEL 4LCCB 2E9BA 1JF5A 2AJ3B 5HHXL 3HUJB 5DUPL 1ES0A 3ARYA 1WC7B 2Z93B 2OL3A 3TZVA 4NZRH 1ETZB 1VCAA 3QDJA 4O2EB 1RZGA 3L5HA 3D3VB 1CFBA 1VB9A 3O41A 2VMFA 1M71B 3UTPE 5HGBA 5GS0L 3ALPA 4UDUA 1TJIH 1NJ9A 2HRPH 3QUXD 3N1PC 4P2OB 3RZCB 3MZGB 3HZMA 4ZG1A 1TIUA 2YD6A 1GGCH 1X5XA 3MJ9A 3F12B 5E8EA 1P7QA 5J9PA 2FJGB 3C5SA 2EC9T 2BNQE 3UJTH 2C26A 2I5YH 3OMZA 3CZFA 3MLWH 2AABH 4R26H 4TVPL 1UZ6E 4K8RC 1AKJA 3AY4C 2J88L 4KJWC 1HQRB 4ODHH 3VGAC 4JB9L 1MCFA 4U31A 1MFAH 1CK0H 4I2XA 3CUPB 4MA1C 3EHBD 2GTZB 3LDBC 3PWVA 1KNOA 4HZLB 4QCIA 1TDQA 4BH8B 4TULH 5IW1B 5FEBA 4NO2A 3VGEA 1XGPA 4LLDA 1O5DT 1QR1A 2X9YA 5C0DA 4LKXA 3NCJL 4ZFZB 5F7UA 1J05A 3P4LA 3N0PB 1EMTH 1TVHA 3KPQA 3MRDA 5DZNA 1FBIL 5E6ID 1RUMH 2SEBB 4RAHA 3MYZA 2EIZB 2Y6SC 1RUAL 2HJFA 1JPST 1PZ5B 4Y1AE 1JGVH 1FFPB 1TFHA 3HR5A 1Q8MA 3U36B 5F3BA 2GJZA 3W39A 2HP4A 5DVKA 4ZFGL 1T20A 3TWCL 1YYLH 1C16A 5CZKA 3VXUD 2NY4B 1NDMA 4PY7A 3RFZC 4I18C 1DVFC 1ETZA 3QDJB 3PIQA 3OBAA 1VSCA 1HNGA 3SDDA 3SBWC 3OKDA 4MNGE 3RWCB 4N5UA 1U8MB 3IFLL 1FYTB 1NGYB 2FSEB 4MA7H 1F2XK 3I85A 3G6DH 3WKNA 4YDIH 3HI5H 5T33L 1MCJA 5J6HB 4XPFL 5IW6A 5M95B 3HCVA 2ZNWA 1QLEH 2GKIA 1DL7H 2IMMA 2OLDA 3GO1H 3I3DA 4P23C 3T0EC 3BT2H 2VISA 4Q74A 2JJVA 2BZDA 3L5XH 4KVCH 5T5NF 5DRNB 4ONHA 1D5XA 1EAPA 1O7VA 4OF6A 3U2SA 1AD9B 3SKJH 4U0QB 2R1XB 5GRYA 5CJ8A 1KGCE 4HDIA 1NBZA 2VC2L 3C6SA 4UV7H 5C8JA 1KUMA 4I0PC 3RX8A 2CO6B 1IC5H 5I30H 3KPNA 3MRFB 1DUZA 2YPVL 3DROB 4PJFB 4FFYL 5C0BA 5IB1B 1L6ZA 4JHZA 4DZ8B 1PG7W 5K59E 3TNNA 4Z5RA 2AJVL 4UAOC 1HHJB 3VW3H 4P57B 3PNWB 3UDWA 1PZUB 4OGXH 3WBDA 3GM8A 1MH5A 4WEMB 3DXAB 5BOPA 4DZBA 2WWKO 2F54A 4XPAL 2NNAB 3MV8E 2FGWL 2WWKT 4UTBL 1HH9A 5DQJA 2FO1A 5GRJH 4GT7A 1ORSA 4L8CA 3TVMD 2VXQL 3FQXA 4WEUD 1Y18A 1RIUL 3L3JA 3W0WA 3WJJC 4H0HB 4PRHD 4X6EB 1FPTL 3Q5OA 1LEKA 1N64H 2YKLH 4XAKD 3M1BB 3TBTA 4P23B 2ED7A 5DSCA 4WUUD 4OLVH 5DUML 1CLCA 3JWOH 4FFVC 2ZCHH 4XXCC 5DFWH 3UBXI 3DO7B 1I8KA 1S7TB 3MRRA 3T0DA 4TTDD 3QUXC 1YEJH 5C0GA 4N8PA 1JNHB 1NUFA 1CWVA 4IIQA 4JRXE 3THMH 4EN3B 4YZFE 4XBPB 3T0AA 1CLOL 3MRJA 2AJSH 3G6AA 4DZBB 4JFFA 3LEXA 1ZEAH 4Q9RH 3GB7A 2A74B 4KAQL 4PJHB 4V2BA 2J4WL 4QHUA 4DKEL 5I76B 4FQCH 1HHJA 1O0VA 5IBLC 2IPKA 1S9WA 2E6QA 5TDOA 1FL5A 2A6JB 2ESVD 1KPVB 4UIKH 4K7PY 4NZUH 2R39A 4YHLH 1CDJA 2XYCA 4NQCE 2B1AH 5JQHC 4U1KA 5H2BA 3DX6B 4UQ3B 4AM0A 2NW2A 4OJFL 1H5BB 2I9TB 3G08A 3P77A 2FEEL 2VWEE 3LCYA 4CVWA 5K9QG 1BWWA 1TZHB 2GJ6B 4JFZH 3RY5A 2QSTA 3SE8H 4HUXA 5E8DH 5ANMB 2Q8AL 1MWAA 1KJ2L 3G5VA 1QO3B 1RZJH 1U42A 4J3VA 1AQKL 1ZLUH 3GFUA 1II4E 4RIRA 4J8RB 3N85L 1NEZA 4OGAC 5ICZB 1XGYH 3L3IB 4ESKA 2VTFA 3EOYG 1NCUA 3P2TA 4QYOA 4JR9H 1DE4A 1NKOA 4P48A 4WI9A 3OHXA 5EA0H 3TNNB 1PLGL 1CL7H 2ID5A 4MNQD 4QRPB 1N7MH 1ZLSL 5KOMC 4LVHC 1JGLL 4I3SH 3GJEB 3LPWA 3FB8A 4LEXH 4HCRH 3IB4A 4F15B 1HXYA 4OT1H 4WUUA 3O2VH 3BP7B 1OTSC 5D7IA 4JDTL 4N9GB 2MSPA 4ZYKA 5GRVL 2VE6A 4Z78B 1INEH 1OAYH 5ESAB 2G5BB 1ZANL 1TJHH 1XIWA 4OLUL 5CILL 2AW2A 5TE6L 3CSBA 4OFDA 4W68A 3I6KA 4LBEA 5LBSH 5INCA 3SCMB 1QBAA 3PP3K 5I8OH 2C7UB 4GRWB 5LGJA 1QR1B 1XGRA 5B8CB 5D7IE 1GSMA 3G9AB 2X4QA 3WD5H 5DA4A 3W9DB 4UDTA 2ADFL 3HMXH 4GXVH 3MGTB 5DMYA 4LVOC 1CIDA 5ACZA 2P1YA 3QI9D 4F57L 3X11B 5DRXA 3U7WL 2P24A 4MXQD 3V0WL 1KULA 1B0GA 5T1KD 5FOJA 1KFAL 3ZKQD 3NFPA 5F9OL 1D5MB 4FQPA 3EKCA 3HE6D 1NAKH 1A1NA 4OGYH 3GMRA 3GSQB 2ATPA 3DSFL 4Y2DB 2GI7A 4GW1A 3L7FB 1TVBB 1A14L 2P47B 3OXSA 4FQXA 5F6HI 5AZ2L 1QPXA 5SX4I 1BOYA 5C07E 1MHHA 5E6ZA 1CQKA 1YEKH 3HRPA 5JXED 1YNTA 2F54B 1BVKA 1QBBA 4XC1H 5I9QB 5FO9A 5DJ8B 3RI5K 3BSZH 3G5ZA 4HWUA 2HG5B 5T3XH 4Q58C 3LQAC 2AJUH 2GY7B 1OTTD 4P2QA 4MAUL 4LDEB 3QPXL 3QQ9D 4PB0L 3U1SL 3WS3B 4WFFD 2CQVA 2J8UA 3TYFB 3F58H 2OMNA 3IDNA 4YDKH 3VFNB 2EE6A 4Z7OF 4GBXD 4MS8C 5DEZA 1YMHB 2O5YL 4JO3H 3O3AA 1MIEL 1XGRB 4DJMA 1S5HB 3TT3L 1YMMA 4LL9A 2R2BA 2A83B 2I60H 4YWGH 5I71B 2QV2A 2HMIC 1EFXA 3AAZA 3S35H 1ZTXH 4YNYB 3T4AB 1IAKA 2EDFA 4U1SB 3U0WH 5IP4A 1JGUL 2X4QB 1D6VH 1Z3GL 1JZ2A 3DX9B 2R69H 4IS6B 5IT2L 4PRIA 3IDMB 2FX7H 3DTXB 3IU4H 4RDQG 2BSED 4M02A 2CKBL 1ORQB 2PXYC 2YMXH 1CFNA 1I85A 4Z7WE 2GFBA 3V2AR 4HJ0C 4RFEA 2LTQB