1R17A

Crystal structure analysis of s.epidermidis adhesin sdrg binding to fibrinogen (adhesin-ligand complex)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
321
Chain Sequence
b'GSNVNHLIKVTDQSITEGYDDSDGIIKAHDAENLIYDVTFEVDDKVKSGDTMTVNIDKNTVPSDLTDSFAIPKIKDNSGEIIATGTYDNTNKQITYTFTDYVDKYENIKAHLKLTSYIDKSKVPNNNTKLDVEYKTALSSVNKTITVEYQKPNENRTANLQSMFTNIDTKNHTVEQTIYINPLRYSAKETNVNISGNGDEGSTIIDDSTIIKVYKVGDNQNLPDSNRIYDYSEYEDVTNDDYAQLGNNNDVNINFGNIDSPYIIKVISKYDPNKDDYTTIQQTVTMQTTINEYTGEFRTASYDNTIAFSTSSGQGQGDLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fibrinogen-binding protein SdrG
molecule tags Cell adhesion
source organism Staphylococcus epidermidis
publication title A "dock, lock and latch" Structural Model for a Staphylococcal Adhesin Binding to Fibrinogen
pubmed doi rcsb
total genus 83
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A02
1R17A 4F24A 1N67A 5CFAA 4BBWA 4LEBA 3IRPX 3IS1X 3AT0A 3AU0A 4JDZA 2Z1PA 2F6AA 4F20A 4B5ZA 5CF3A 4LE8A 4JE0A 4F1ZA 2VR3A 4MBOA 4B60A 2F68X 2Y7NA 4F27A 2Y7OA 1R19A 2RALA 4MBRA 2YLHA 3V10A 4Q6KA 3IRZA 4FJ6A 5IHWA 4JDZB 4LEEA 4RMBA 3IS0X 2Y7LA 3ASWA 2Y7MA
chains in the Genus database with same CATH superfamily
4CDHA 3FQWA 3NTCL 4PW9A 5J5EA 3VFRA 1VGKB 1BZ9B 1CXIA 1YPZB 5EMYA 2NY6D 4KZDL 1I8KB 1B9ZA 2JKXA 3LNGA 1CBVL 2CJUH 1FFOB 3KYOA 1OGAD 5EU5A 5JIKA 3UJIL 3V52H 1HJCA 3JVFC 4KY1H 3WTVA 1FN4B 4JRXB 1LEGB 4WHYG 4UAOC 5EU3A 1NAKL 2ADGA 3SDYH 4ENZA 4CU8A 1KGIA 1TKWA 2Q2EB 2ZOKA 1VCAA 3E1F1 4DGVL 3M6DA 1FNAA 4KVNH 4NLAA 4ZO7A 5JW3H 2EO1A 1D7DA 3DC0A 1X6NA 2V2XB 5LBSA 2N56A 4XPAL 4PJHF 4ZMYA 1DQDL 4AC4A 5JIHA 5IT2H 3F7LA 3TIEA 3BPLC 3NIFF 1LO2H 2Z1PA 4P46B 5ISZB 5CR8A 3HHSA 3QC5X 4FG2A 5HY9A 1CD1B 3B2DC 3QDME 4JFWA 4P2QD 3J7HA 4K3DL 3UTSE 1SBBA 5J8OA 1S7UA 3BGMA 5LXGL 1ZK5A 4ZFZB 5FYLH 3TO4A 3CLFL 3X17A 2EIDA 4EXKA 3POHA 4Q6YA 3RX7A 4DGYL 5I0WA 3QQXA 1D5ZB 2D3LA 1WWCA 2YKLL 4MMZB 5AL0A 4AG4L 3DV4A 5DI8B 1PZAA 5ILTL 3WIHA 5HDQL 3NJJA 1X5HA 1YAIA 3M45A 2B0SH 3B4NA 3RWCB 3S3DB 4HU2A 4X6CF 1ZANH 2M26A 1EHNA 3D39D 2HTLD 3ZDZB 1FNHA 1Q9OA 3UCRA 4ZFOL 3C8HA 4PJEB 5K9KB 5E00B 2I69A 2CM5A 1RZFH 4AI7A 1GW0A 4EVNB 4OZFA 3TXAA 1MAMH 1RIVH 4RWYL 4S2SB 1RHHB 5I19L 4B95C 4OI9A 5LHDA 4JKNA 1R3IL 3LDBC 2AZUA 5BRZD 2IBZX 4XBEL 4Z3HA 2VN4A 4ODHL 3BOVA 2QSQA 4JDEB 4PRDB 2X9WA 4NNPL 4MHHG 3KWVA 2X1OA 4WI0B 1FNFA 3TZVC 1JZ4A 2OMXA 5CBAA 4X6CE 1I3GL 4ZUVB 5F7EH 3MLRL 2DYRB 2YWZA 4MZIA 3W0WD 4XN9A 2DL2A 3LH2H 2XY1A 1RMFH 3FMGH 1U2HA 4OCWH 3QRBA 3MV7E 4G6JH 4GBXB 3VG0H 4UNVA 5LGKA 2BVPA 4QI3A 4AG4H 1JNHB 1S7VA 5IHUL 1N67A 1UGNA 1ETA1 2Z7YA 5LNDA 2EVJA 1FDLL 4N6QA 4O9HH 2EEXA 4MCZB 4JK0D 1KC5H 5KS9F 1PJ9A 3AU1A 5C09D 3IDXH 2D3NA 2VT0A 3OC5A 4DN3L 4YSSA 4AQOA 1EVUA 2ZAIA 3OZLA 1S6NA 1I85C 3F7YB 5BV7H 5KSBF 4YAQA 5AW2B 4DWHA 3T1WA 2VSCA 3CSYB 5EH1A 3WEXA 1S78C 4L3AA 4KI5F 1PS3A 1HWHB 3LNFA 1IAKB 1XVSA 3U6RA 3X13B 2ITFA 4ZYKA 4KAQL 2P42B 1I1YB 3EOTH 1XIWB 2OR7A 2O5YL 3DX3A 1VESA 2AERT 3A6CL 3QO0A 4IIQC 3MLSH 3UBHA 5FO8B 5EEVA 2VE6B 2FT6A 3FSVA 1AP2A 5DJDB 5A2CA 3BAJA 4OD3H 3E6HB 3ARBC 1G5AA 3KDMA 3WEAA 2AABH 3L3HA 3QJRB 5CIPH 2WUCH 4ESKA 1NC4A 4MNGA 2X6UA 4NIKB 3WNPA 1MG2C 5J57B 3TYGH 5C9JA 3RWIB 5DD6A 3CPLA 4I4WB 5IB3B 1J5CA 1HOEA 1CR9L 2WXNA 3VXRE 1YAZA 1T1YB 3AUWB 4TL4A 2RCSH 3CIAA 3IM1A 3CDFA 2EDFA 2FJHA 3N3EA 5A40E 4R26L 3MACL 4JHUA 3EYUH 5AZEH 3FSZA 4XRCA 3D2TA 4AJ0A 2OJZH 2GAZB 3GSXA 3RDJA 3EFDL 4Y4FB 4O51B 4HUVB 1KXTA 5DJ8B 4K7PY 3DYMA 4N2BA 3D3VE 4FNQA 2H2SD 1E65A 2ZX5A 3GIVB 3IKKA 4JPIB 4KKBC 2R39A 4HT1L 1X5MA 3VFRB 3WKMH 4MASA 2KI6A 4Y19B 2WB7A 5CGYC 4XBGA 2KDYA 2YAQA 3H6JA 1U91A 1AZNA 5DA0B 4ZTPL 1OWRM 4KX9A 4JNXA 1GGTA 2W60B 3P3UA 5E5UB 1FFOA 3KYOB 3HR6A 1U95B 3TC9A 3U9PH 4XZUA 4KK6C 5J6GB 1IU1A 4TSBH 4KY2A 3BDYH 5KN5B 2C9QA 4ONHB 5E1AB 3RY5A 1NOFA 2GIMA 3HZYA 3BQUC 4H5SB 4WO4B 2ADGB 5LCVL 2ZOKB 5EF0A 4HIEB 2GBTA 1I82A 3BKCL 2AEQH 3MGAA 2X6CA 4HWEL 4EDWH 4PWGA 5F7WC 3IGUA 5HDBF 3STZB 5KAQG 1OSPL 5E56A 2VZUA 3CZNA 1TQWA 4N0UA 5DRNA 4YOKA 3DHUA 2WQRA 5KSAB 4JFSA 1HCVA 2ARWA 1K8IB 2NTFA 4QUOA 4XMWA 5GSRB 1J5OH 3EYFB 1ACYL 2B20A 3AGWA 5GPRA 4JO4L 4RDQF 3T0EE 4XN5A 2PXYC 5KANI 3C2AH 2BMKA 2FX7L 4PJFF 3OZ9H 5CLZA 4DPRA 1A7RL 2I27N 2XFGB 1Z9LA 1X4XA 2CPUA 1J0YA 3UPRB 1NGPH 2BLFA 2P8LB 4YR6B 3TU6A 2BIIA 1KCSL 1A7NL 3EH5B 3NCJH 1MFAL 2A74B 5GHWL 5J1TC 3T6QC 2GEEA 2GJZA 4JB9H 3TEYA 1RXLA 1CDJA 1WS7A 3FN3A 3UIYA 4ABUA 3WKML 2YPKA 3ZDZF 3QXAA 3RDTA 2APWA 2BPBA 1Q9OB 1RLWA 4IGBC 1MCFA 1G43A 3WNNA 1EEYB 1AKJB 1ZVNA 3F7KA 3MX0A 4JFHD 4K94C 5SV3A 3W3BA 5E00A 3LXCA 1DUYB 2ZWLT 3IAQA 1XZ0B 3IFPB 1U33A 2XSKA 1UM5L 2JH2A 2HVKB 1Z9OA 1JXJA 1QLEH 3VGDA 1J1OH 2I9LB 3L17A 4EXPX 2ZYSA 2NY0C 4JQVC 2IH9A 3IE4A 1GJIA 5CEZE 3WIAA 2X1PA 3AC0A 1LMKA 3US9A 2HFGL 2WTRA 2VSKB 5EO9A 3I6KA 4JDEA 5SX5K 3RTQC 3W81A 2JKRM 4C47A 3ZLQC 3MBWA 1CYXA 4UTBA 1BBJA 1R6VA 2H2PC 1XH0A 4M3HA 4NRYB 4PJHB 4U4IA 5B38G 5IEHB 1U42A 1DEEA 4ISVA 1F4YL 1LILA 2WUCL 3RHWF 2XN9D 3DWTA 3VYOA 3M1CA 3RB7A 4BFJA 1IVTA 4GBXA 1QPPA 2CH8A 4N2MA 1IQDA 4OZGE 3QPQD 1C5DA 4A7TA 3VFGL 1GKEA 1M7IB 5K9JL 3RPKA 5CO1A 3MOAH 3NJLA 2HG5B 5KVDL 4F9LC 5EF2A 1HHIB 1MFMA 1MUJA 1OTUD 4A7SA 5B39A 5AZ2H 1I8LA 2WSDA 3TCLA 1X5FA 4IMLB 4ORZC 4TXVB 3SJVB 1I8UA 5T3XL 4WW2A 3QORB 1OCWH 1ZHBB 3HW7A 3LRGA 4KNTA 4AV5A 4YAQB 3PWUA 4QKTA 2X4NB 1IZJA 4X4YA 1UM4H 3U6RB 1J8HD 5D55A 4L8SA 1U4EA 3VFPA 4DETA 3S9DB 1I1YA 3MV11 1XIWA 2GTZA 2IAAC 1S8DB 1UZ6E 2G3MA 1JNLL 2HRHA 3G5WA 3SO3C 4UQCA 3BH8B 4GKLA 3OV6A 3ILEA 1UWYA 2ADIA 1H6TA 2XTJC 3P0VH 4YLBA 5GGRB 3Q8CA 5I9QB 2LGNA 1OT2A 2PETA 4EUPB 3S5LG 2CBQA 2WIMA 3L3HB 3BUTA 2GB2A 3WEMA 4KMTL 1YY9D 4DFHA 2QL1A 1KJ2L 2JI1A 4L29B 4N2CA 2ZOLA 4WEBL 4N2EA 5KJ7E 3CC1A 5EA0H 1D6VH 1XCWA 5KG9A 1QBMH 3DBXA 2WXIA 1HH6A 2AGJH 3HE6D 3JWDL 5C08D 3VVVA 2NXZD 1CFNB 4F57H 3QUXB 3LN9A 5D2LB 1WZKA 3CC5A 1N9PA 2WD0A 3SSGA 1CFVH 2H0PA 4ZI8A 4NN7B 5EU7C 2QVIA 3QEGL 5K9QI 1G94A 4PGBB 2GKIA 1RK1A 2IGTA 2GAZA 2H8PB 2Y7LA 2A9AA 3V5HB 1QVOA 5HI3D 4X6BB 1S7QA 4HS6A 4Y0GA 1D9KA 3N1QC 2FYYA 5G4NA 1E9QB 4HG4K 3P4MA 12E8L 2E7BA 5ABZA 4FAAB 4E0RB 2Q7YA 3ETBF 5TH2B 4LCWE 4BQBA 5LWYL 5FK9A 3I9GH 2ZUUA 5ILTH 4YHKH 5BV7B 4POZD 3N85H 3WFHB 4UILH 3TA3B 5I18H 5FYJE 5IREA 2QADC 4PLJD 1FFRA 5HP5A 2D0GA 1A7QH 2FHCA 5D5MF 6FABH 4J27A 4ZS6D 3NH7H 4BCZA 3ULUF 2HTKC 1BMZA 1CDUA 4QOKA 4H1LG 3BH4A 3VG9C 1F5WA 3B2XA 4PJ5E 4UINH 4PRIE 1NEZB 4D9RD 2BHUA 4B97A 2EC9T 2PN5A 3THML 2UYLA 4N0UB 5DRNB 2EUVA 3PWPE 1QFWH 4YHNA 3AWGA 3MQIA 3SGKA 4G6AC 1HL4A 2BINA 3P1VA 3PGDA 4K4KA 4TVUA 4HEME 5D7SL 4CNIB 2PLTA 3TTSA 3L1FA 2NY5L 1F90L 3LHPH 1ORQA 4Z8FL 2ICCA 4I9WD 3UPRA 5IBTL 2G5RA 1L9OA 1CBVH 2VMDA 4TUKH 5IV2A 3ULUE 3L4XA 2ORBL 1J8RA 1J1PH 1ZSHA 2NY6C 3B5GA 4K8RC 4XN4A 1LO3H 1GCYA 3BUYA 4YHLH 1MQKL 2B1HL 2GBAA 4X8JA 1UXWB 5ANHA 4YHOH 3JV5A 5EDXA 4GLRI 4OCLC 1XZ0A 4PG9A 3BN3B 3BSZH 1T5WA 1F8TL 2JKLA 5JPNB 5I6XB 3RL1A 2XOTA 3LPWA 5DZPA 5CU5A 4ZDHA 4UIKH 4OGZA 5JW5B 3UPCA 2FQGA 3ULVC 3D87B 1PG7L 3P9LA 3CDCA 3KJ6H 4PIBA 3BX7C 3GSNL 1DLFH 3OF6D 1VACA 4OZHE 3IFOA 3B9DA 2V4LA 1E5AA 3EOBB 4XPTH 2OSWA 4KDWA 4YUEH 3DA0A 4N0FA 5EU6A 3RAJL 1OP5K 1DEEB 2ZCHL 4Q58C 4FNRA 4ISVB 1WA2X 3U2SA 1DE4B 4IEFB 1KV3A 4HFUH 4WWKC 5KEZA 2IVFC 4L1SA 3AACA 2R0ZL 4EQ2A 3FRPB 4AITA 1NC2A 3UTQB 1K72A 1MCDA 3INOA 1TJHH 2GITA 3ZMNA 1S4IA 2IAMB 5D7HA 3F5WB 3WDHA 5ID1A 2B4CC 2EIKB 2VWEC 3E3QE 3QDMA 4YQXH 3N0AA 1ZTXH 4Y9BA 4IMLA 2MEJB 4S1DC 3FQUA 4K9JA 1JPFA 3QORA 1Z2KA 4TNWF 4JBSA 4PRPB 5CS7A 2WXOA 4YXHL 3SGDH 3H42H 4RIRA 3BSZL 3EFFB 2QADD 4MLSA 3NJHA 3VWJC 3O45A 3UC0L 5IMLA 4DIXA 2V6HA 4RA0C 3U48A 4C58B 3MLRH 3AG2B 3B83A 3BVUA 3GSVA 3TN0C 1I7ZA 2JMRA 2C3GA 5I28A 1S2EA 3BVVA 1E8ZA 1J8KA 3SE8L 3AJ7A 3F84A 4BZ2A 1HCFX 5I0ZA 5ALBL 1FL5B 1B0RB 1F86A 3J07A 2YEZB 3VFTA 4BXVA 1QW9A 2B9AA 2E7DA 4NHUA 1TFPA 4RGNB 3GRWH 4A66A 5B22A 4HVBA 1MIML 2J5WA 5DJAA 2OTWA 3ESVF 3F7VB 2C4FU 4ELDA 3VXSD 3D3VA 4PGEA 4CVXA 3DTUB 1QLRB 4P2OA 2JJSA 1Q1JH 1TOXA 3UDWA 4EI5C 3L3GA 3QEQD 3MA9H 4Z3GA 1HDMA 1IGMH 4ANWA 5ESQB 3FF8A 3IDNB 4AL8L 1UB6A 3L3DB 1VJSA 1H9VA 4WY7L 3IVKA 3MNVB 3CVBA 2B0SL 1J5HA 1G7IA 2R2BB 3LS4L 2A6KA 4MWFB 4CU7A 2JQAA 4RGMC 1KPUB 1MELA 1NKRA 3CK0H 3MNZA 2EXSA 3R06B 3EO0A 3MYJA 2X2HA 4G8IA 4B9JA 2XV2A 5LGHH 4ATWA 1RK1B 1T21B 2H8PA 3CZJA 5CLWA 1RK0A 1D9KC 2PR4H 3IU4L 5C0AB 3UXFA 4HS6B 3LPOA 1KOAA 3RUGF 2DLFH 4XMLL 2EH7L 2AJUH 2Q7YB 2GJ6B 5GGVL 4DSYA 5HHPB 3BO8B 1QLFA 4AUJA 2EVFA 2V2TA 3KYKH 2C7UA 2IGFH 1U2CA 4QTHB 3B9KD 3O9WB 3DPBA 3BESR 3TN0B 2NQ3A 3TO4D 1MIEH 2DICA 1TCMA 5F7FA 3VXUE 5JW4R 5DC2A 3DTDA 1YNKH 5CGBA 1TZGH 4AMXA 4LK4A 4Q0XL 4H88H 2IANA 2QVKA 3GXDA 4M29A 5GS1C 3NPSB 3SOBH 3QEHB 4ZOBA 5IWLC 3FPYA 4BINA 5CEYA 5IMMA 1X9QA 3G5ZA 1X5ZA 3ZR6A 1PX4A 3OG4B 3C6SB 5EORL 4QTIH 4N68A 3RBGA 1GGIH 4XNQB 2A9NL 5DD1L 4Y2DD 3CFEB 2Y23A 5EZLA 1PQZB 1YUHB 3LNDA 3B7UX 4X6CA 1UZGA 4NKDB 1Q38A 1IEBA 4HLJA 4U1IA 1FNEA 5JXAL 3BRDA 4JQVA 2KBGA 3L7FA 4AZ8A 1J87A 1RI8A 1T5XA 4MAUL 3O6FA 5PCYA 4IRJA 3IKCA 4XMKL 3QDJB 1IVLA 2XZAH 4P06A 5CINH 4XZ4A 1FSKC 3H2PA 3RKPA 2E7LA 3Q2NA 3RUGA 2NX5B 4U0RC 5IVXB 5DDHA 3GBNL 5EPMB 4AJYV 1NKGA 4RQQB 5CM1A 2BJML 5F9JA 1RJYB 5DA4A 2P5EA 4HJGA 1FQ9C 1H3TA 1QFWM 3HOGA 4OIAA 4PSRA 4TNVF 4B53A 3HG1D 3V6ZA 5A6MA 5JLZA 3RL1B 3CU1A 4O00A 4ZDHB 5A16A 2X88A 5KVMC 3DJRA 3RX5A 1KIUA 1ZS8A 1IT9H 2H3NA 3ZT6A 5AOLA 3FN0H 2YC1A 3T09A 1S7SA 1AXTH 4OT1H 4XHJD 5HYJE 3FUNA 3OHMB 2Y06H 4TSCL 5ID0A 4PYHA 1VACB 2ICWJ 2A1WL 1XL6A 3EOYG 4OFIA 3FQXA 4OUOA 3AAZA 4UT6L 1C7TA 3OGCA 5GZNC 3W5NA 3VJ6B 2WYHA 2BVEA 1E6OL 3O2WH 4N0FB 4NNYB 3F3HA 4XVUC 5EZOH 1K4DA 3ZHNA 1JRHI 4IEFA 2K3HA 3SE4A 1MLBA 2ZXCA 2EH8L 3O3DB 3R1GH 4B7LA 2XKNA 2NYYC 4LKXB 1JL8A 3HLAB 4XPFL 1GAFH 1AS6A 2ZWKA 1CFVL 2BSCA 4NDMA 2VLJA 1CL7L 2DJUA 1NC2B 3QG7L 3S4SB 4X42A 3M7OA 2Y69B 3ZGIA 3NCYS 2G60L 4RETB 1KGUA 4O4YH 4P2RB 3KLKA 2N59A 1MCOL 2ARJQ 3PWLB 5E0QA 5IR1A 4HWNA 4PJ9D 4ZSOB 4DO6A 2DEWX 2F19H 2E74C 4RX4A 4APXB 1NBVH 4TULL 3UGEA 4RIRB 2IH1B 4DOHE 4OF5A 1G7LB 3PPSA 4K15A 4HFUL 1NMCB 5KYUB 2JTDA 4M3KB 4MX7B 3RJDA 3FTXA 3WMSA 2ERJB 2OLDA 5IMLB 5C3IA 1E2WA 3CJJA 3NACL 1WBZA 1NGZA 4G9FD 4Y1SA 5CZKA 5EN3A 1U8NB 1FYTB 1RURL 4FA7B 2H3KA 1BD2D 1ZVSA 2WQUA 1FRGH 5HYJD 1IBZA 1Q8MA 1F11B 5C3LD 1MCRA 1YYLL 1JGUH 3WNIA 4LF3A 5CN1A 4BZ2H 4GXVL 1SUJA 1FNGA 4KKAD 2Y6SD 4PB9H 2GI0A 5G4MA 3DMMC 4HXBL 2J88L 4NHUB 2XG4A 2MTAA 2E8ZA 3F58H 4GRWF 2OTWB 3MLYL 5I26A 4RGOL 5D6CA 2GPZA 4KQ4H 3TVMA 1IV8A 5DJYB 1JIBA 3N85L 3QGVA 4P2OB 1SJXA 1F3JA 5DC4B 3V6FB 4K9EC 4NQEB 3U7WH 3FQ2A 2VH5H 5I1AA 4PLNC 5J6HB 2R1WA 4LSTL 4UAHA 4ZPTB 3IDNA 4L3CA 1UB6B 1OSZA 1KLUB 5JIIA 4P4KC 1C16B 1Y1UA 4JFVA 1CTNA 3FFOA 4RH4A 1MCPH 1NGXB 3CN0A 1KCVH 2Q8BH 2O5ZH 1YDPA 2A6KB 3AVEA 2OA9A 4YDJB 4U1NA 1KPUA 1XMWA 5H94B 2EKJA 3SCMD 1DVZA 2WC7A 3WSQH 3FULA 2I7SA 1FV1A 1PG7W 4NSKB 3KLSA 1U8QA 1FAKT 4YSPA 4X7TA 4ZMWA 1QSEB 3FFCA 4XO5A 5J12B 1RK0B 1WZ1L 2L8AA 5C0AA 3A3YB 1QEWA 5T33H 5IQLA 2JLPA 3V0JA 3VGHA 5IQ7L 2R29A 1NAML 4NYLA 5HHPA 3GSWA 4JZNB 2JVUA 1ZJAA 5D7LE 5FYLD 5B1JC 3Q2CA 4AX3A 5CLTA 2OTUB 4FA6A 4OIBA 4ZTOH 1MRDL 2BIMA 1EGJA 2B14A 5F0LB 2P47B 2VXUL 4OJFL 4XOEA 1SBSL 3IJ9A 3NQIA 5D1ZA 4WHCA 3ZZ1A 3C5SA 1I4FA 2MQ3A 2BNRA 4G43B 4K9EH 4B9CA 4K8RD 1NMAL 1DBKL 3RGVC 3ULUC 4AV0A 1BZDA 3O4LA 4LSSL 5CFHA 3N1GC 3ARFB 1OTSD 4QRQB 4Q9RL 3KWWA 4LEXH 2WZ0A 4I0PC 1LD9A 1W0WB 3ZQ9A 1EO5A 4XX1E 2LTQB 4WU7B 5CEYB 3PCYA 3RVTD 1G4RA 1NANI 4JFOA 4YFDB 2VITB 4K3HA 3S8WA 5GRJL 4XVTH 2Y06L 2FE0A 2WKOF 2XPGA 3GWJA 3GSRA 4TVPH 4UBDD 5IJKC 1INEH 2NW2A 3Q6FB 3VGEA 4B7IA 4RFOH 3VDCA 4X6CB 3HG3A 4NKDA 5GS0C 4U1IB 5LLIC 4ADGA 3K74B 3LXAA 4BQ9A 1P69B 4XO8A 4LLMA 3QA3A 1O5DT 3SOTA 2DS4A 1LE5A 1JJUA 2DDQL 2LR4A 1EJOH 3S3BB 4WO4C 2X2IA 3CFDB 1S9VA 4DJMA 3SY6A 2D31A 3ROOB 5KVDH 3HNSH 2FD6H 4DN3H 2VLMD 3JBG7 4PJXB 2W9DH 2X4RA 3RUGB 1T4KA 4AIOA 1SLXA 1MCCA 3MRKB 4LO9A 4WIQA 4G1MB 3VH8G 3VW3L 4RQQA 4HCRA 2P5EB 3ZKSD 4GB9A 3FO0H 2X4PB 1MY7A 4KK9D 4YBQC 3SDXE 4G5ZL 3H3BC 5JLZB 4P3WA 1QSFD 1RZQA 4QJ4B 3QIWA 3NACH 1NMAH 3DSFH 1I8IA 3UBXG 1VEOA 2GTWB 3H4HA 1BREA 2NW3B 1MCWW 2E46A 2O6CA 4LVOB 4YWGL 3L3KA 1OAYL 3TIDA 2OK0L 1BQRA 3L2LA 1WIUA 2YUZA 3QISA 3GINA 5D71L 3FOLB 3FQXB 3OGCB 4LIQL 1HZLA 1H8LA 1NFDB 1FORH 4N0CC 1NGWA 1YEFL 4AEIH 1Y18A 2GVYA 5EUOB 4K94H 4J39A 4WI8A 1JZ2A 1AZRA 4HJUA 5I17A 5DMGD 1K4DB 2C3WA 4UYPA 2PCPA 3VWJD 3CXDL 2FYVA 2ZTBA 2WLLA 3Q5TA 3LV3A 3P3TA 1KN2L 2OSYA 1Q1PA 4I2XE 2W65B 1YN7A 4NO0A 4Z0XB 3OVUB 1U9KA 4M93B 5MP6L 1JF1B 2R29H 3CHQA 4NQDE 3VI3E 2UV3A 3T3MF 5FGSA 4HJSA 3DX7B 4P2RA 4JN1H 1C5CL 1JOIA 3GUFA 2QVTA 4WFHE 1ZJBA 3ARBB 5IF0A 1QA9A 3ZE2F 1A5FH 1IGFL 4ZSOA 7FABH 2BOCB 5JQ6H 2BVQA 3L5IA 1HCYA 4YE0A 2ZPKL 1G7LA 4LL9A 1FIEA 4M02A 4PUBL 4LMQE 3CQFA 1X3DA 5AQ0A 3N91A 3ULVE 4GMTL 3HJEA 1W8OA 4J3OH 3ZKMD 2HX7A 5K5YA 3U0WH 1C9SA 2YA1A 4ZZFA 4WI5A 2WN2A 2QSCH 1A1OB 5AVQB 4HSCX 4PGCA 5T3XD 4NQDA 3VI3A 4GRLD 3K3QA 3KYNA 2IFFL 3QH3A 1COBA 3MLTA 4ZUWB 1EXUA 4XNXH 2HJKA 4L37B 2ED7A 3KPQA 4LGPB 4P5TD 4XP4H 1AJ7L 2OSLA 1GL4B 4AUUA 5JW4M 5IQMA 3CZSA 5FW6A 2V17L 4X7FC 1SBSH 1WICA 1Z5LA 4X7CC 3FRUA 2GIYA 4LQFH 5J13B 1KACB 2MCG1 4OZHB 4HKZB 3CSGA 4JR9H 2VLJE 4FABH 4RDQG 1G7MA 3SPJA 2I60L 3D6GA 5CJOH 2AAAA 5I1GL 3WTUA 4KXBA 3DUSB 3BKMH 2E6PA 2CDEA 1M1XB 4N0RA 3EG9B 1AI1H 3ESPA 4N8VB 2VZOA 3ESNA 4HHWA 2CMRL 4JFXB 1MHHA 5DHYB 1AQDB 2HT4D 2XN9E 1CF1A 1QMUA 3APMA 3IJEA 1AQHA 3I75A 3B8YA 3OR7A 4U1NB 4PP2A 2IOIA 1BMWA 1HQRA 3TBYA 5I1KH 1T04B 1F00I 1U8QB 2D2CC 4YBLC 1DQQA 4P2OC 2NLJB 2NY3C 25C8L 1AGCA 1R34A 3RPIA 2FGWH 1EH9A 2DEXX 5DQJA 5KOVC 3UCQA 4C83B 4PJAA 5EUKA 3TNMB 5T3ZH 4BCYA 1FAIH 5C0BB 4NYLB 4XNXL 4FG6C 2EINB 2FHFA 1DQLH 1IC1A 1MW3A 2W91A 4X9BA 2V2WB 4ZNCD 2V33A 5JIQA 2R51A 2OTUA 2B7DT 3EOAB 4PM1A 3T08A 4X6FB 5KBDA 4BCXA 1AE6H 2WBJA 4NCC1 4JKMA 5DMGC 4YX2L 3QQNA 5FEBA 3LKNA 5IESH 5DRWB 3HKFA 1I4FB 3B7SA 4OGAD 2Q9OA 5DS8B 2ERJC 1MI5E 1G7JA 1IGCH 3KPRB 4G3YH 4KKCD 3VA2C 3OXRB 3O0RL 3ZT5A 3MRCA 1LO5A 5DSCA 2XVLA 3BKML 4QRQA 3HI6L 2J6EH 2ICEA 3QUGA 4WU7A 1F4HA 1RZKC 3NIDF 1CE1L 3Q8EA 4Y5YC 3SJVD 5FKAA 5L4IA 2VITA 4HCIA 3EZ8A 4X7EC 3GRBA 2QFPA 4PRAA 3UAAA 3MRLB 3RGBA 1TMQA 4O5LL 1ZLUH 1EV2E 3JUZA 2DJSA 4WWPA 3NRQA 4PWIA 5CJ5A 4R90L 1FO0L 1OF2B 3RG1C 3NK4A 4H40A 4XVSH 3OHXB 1UQSA 2MOGA 3GMQA 4UOQA 1U4FA 4BK5C 4PJGF 3EAKA 1KB5L 1SVBA 3F6JA 1WT5C 3GLZA 1KJ3H 3O3BB 5GZND 2HPTA 4UWQB 4XAKE 3T0WA 1E5BA 1RUQH 1JZ7A 4GUOA 2VN3A 2BIHA 3AZUA 2K6ZA 4AYGA 3P54A 1KGWA 1ES0A 4JFYA 3NABL 3IU3B 5HBBA 2EECA 3ZE1E 4NZUL 1RV6X 4B9GA 5F1OB 4PJXA 4JFDA 3S3PA 2KHAA 4Z7VA 3G5VA 4OZFG 1T83C 2BZCA 4ALAH 4G7YL 2H6PA 5H35B 3M17B 4Y9FA 3L1GA 5AAMA 2AXHA 2ZF8A 5HHMB 3LN4A 3V4LA 4GXVH 4N0YH 2AV1A 1KYAA 3CFJA 1HSBA 2F5BL 3CN2A 4G2AA 4F9PC 1A1MA 3CFIC 3GHBH 3UC2A 1ZDQA 2NW3A 4Y1TA 1BM3L 2GY5A 3HN5A 4XVJH 1N4XL 4PJGE 1OAQH 1QSZA 3AWFA 1FZJB 3QIBA 4XXWC 5EO1A 5D2NC 4QRTB 3FHQA 4UQ9A 1NGWB 2Y9RT 3MRMB 4G6KL 4KAQH 3WNMA 2GSGB 1TO5A 3OAYH 2WCGA 4FEMA 4IKLA 3PL6C 5MI0C 4HKJA 1PZ5B 3B9KA 1L7TH 2CO7B 1RPKA 1CLVA 2PCPB 4AEHL 1G7HB 2WBXA 1TFHA 3QUYA 4PW3A 4TQEH 4JRFA 1AHMA 5CJOL 4R5TA 4D9QE 5TE6H 3DVFA 1BIIA 3ULVH 1SXAA 2HMIC 4JY5H 2JELL 2UZXB 1ZLVH 4WNJA 2F15A 3IFLL 3FUKA 4WUKH 5JA8B 5D71H 2A9BA 3NIFE 5BVPH 3NEXA 3VX0A 3DX7A 4FL4C 2GJPA 1P5VB 1HXYA 1SFDA 3LVEA 2UZPA 5EEWA 4PS4H 4ODUB 4MCMA 5GISH 4RDBA 1EHLL 4HJIA 4ONOA 4QTFA 1CK0L 43CAB 5GGTL 2VZ3A 1HIMH 1RH8A 2XCMC 3OKNB 5GGRY 3RJQB 4Y2OB 5AVRB 3FFCD 3LQZA 4ERSL 4AM0A 3C5ZA 6CGTA 4J4PC 2UZIL 3K8KA 4OCRH 1XGTB 2NOYA 3T1FB 3EJYC 5FCUH 4BKTC 1FAIL 4ZFOB 3AUVA 3KH4A 3H9SD 1RUPH 3X1EA 3PJNA 4L37A 1JYVA 3MLXH 25C8H 32C2A 3FUFA 5JW3L 3EJTA 5EU6E 5KJRL 5FUCC 4JG1L 3BKJL 5TK2A 4HGMA 3WUWA 5IM7A 3CDZB 1U3HA 3NJMA 1AZVA 3DROB 1PDKA 3D18A 4OZHA 4FQJL 4HKZA 3KLHC 5I30L 2CO6A 2XV6B 4CMHC 2ZICA 2JI2A 2ROYA 2D3VA 1M42A 2IOMA 5D93C 1YEJL 5LGJB 4GFTB 2CBTA 5JO5B 3T3MB 5D1QC 3H8NA 4PRHB 3D25A 4DP6X 1SOXA 1AQDA 2V3EA 3TESA 5KVFL 1IM9A 3O2DH 5DR5L 4HWEH 2PTVA 3IJEB 2ADJB 3OR7B 4FQIL 4I0KA 4OM1L 5KSVB 3GTVA 1MRDH 1A7PH 1DJSA 2HZHA 1ADQA 2R4RH 4EJ1C 2F54A 4ZQTA 2J1XA 4FQHA 3Q9QA 2G75B 3KCPB 5BXFA 2EKSB 2FLMA 1LYQA 4M61A 3CDGB 4NNXA 3TA3D 4PR5A 2XXCB 2UUDK 4B9ZA 4R7LA 3GD1C 3V5DB 1KIPB 3Q2WA 3W11C 2WWOA 4GI9A 2X4QA 4Z3TA 3PXLA 3QPXH 4HXAL 1KELH 2YR3A 2WWMC 3GGWA 3MR9A 4G7QB 4J28A 2V2WA 3SYOA 3DKHA 4KK6D 2NUTA 3TYFA 1QHQA 3S5ZA 3IRZA 4X6FA 4UIMB 2J7LA 2WBJB 5LBVA 1AQ8A 4V1DB 1A14H 2MOVA 2ZCZA 2E76C 4H26B 3HUJB 4M8QB 1C8PA 3S5YA 2A9DA 4HIJB 2EIJB 4WNQA 3D4ZA 2X42A 4PHXA 3OKLB 5C2BH 2D7OA 4AMKH 1E8XA 1KYDA 2BP3A 4I3RH 5FHBH 1REIA 2EEDA 1Q94A 4S1SL 4R5VA 5FKAB 5DFVD 3QG7H 3BVNA 4RSYA 4EUPG 3MACH 3BPNB 4GQQA 4LRIC 4AYSA 1DSFH 3RI5K 3LNIA 1CGWA 5SWSD 2QLYA 2EH8H 3D4YA 3FQWB 3HB3B 4N1CA 3VXTA 4RRPG 1UQSB 2R1YA 4ANVA 4EEEA 2WLNA 1BLIA 4WUKL 2XUWA 5F9DC 4CSPA 2Z31C 1ZT1B 1RIUL 2MSPA 3AWEA 1JWMB 1ZK9A 4GUQA 2FIKB 2C9XA 5IVZA 4JFDB 1AOZA 2WW8A 4JLRB 1EPFA 1VIWA 2DIEA 4NGHH 5KS9E 4HLZH 2GK0B 3HMWH 1TKWB 4L18A 2H6PB 3VXOA 3ZMEA 1AKPA 5KTEL 1IX2A 3FQ1A 2QDVA 5EV7A 1CL7I 2DYPD 1CXEA 3LN4B 3L95A 3PJLA 5J1AA 2VDNH 3CMGA 4CMMA 1TJGL 2NY0D 1K2DB 5C0AD 1HZKA 2YXMA 4W6WB 4LSRL 4KI5E 4P46A 2J55A 2JJVA 3SDAA 3HHSB 3RWHA 3DI2B 2IIJA 5AW7B 1WBYB 1NL0H 35C8H 3K8LA 4AM0Q 2VAJA 1S7UB 5FWQA 5FHBL 4YHIB 5T1LA 1Q9WB 3MRMA 5C8JB 3Q8FA 3S7GA 2GSGA 4BFNA 4NN5B 4JFEE 1D5ZA 8PAZA 4FG4A 3D39B 2CO7A 4U6HA 3SKMB 3OC8A 4XMPL 4B27A 3DV4B 5DI8A 3VXSE 4E41A 4KO6A 3UIZA 5E95B 5JIMA 2B39A 4JCMA 1WCBB 1S5IL 1I7TA 5F96H 3N9GH 4N5ED 5L7XH 2QSCL 5FLUA 3S3CB 1JWUA 5K9KA 4XCFL 3QWRA 3GM0A 4X6DA 1ZKAA 4XCNB 3X12A 2V9UA 4WI2A 4XI5D 4CILA 4ODUA 3MV7D 4NC1E 1T83A 3RTQA 4AGLA 5L4JA 5KYYB 1EEZA 3S35X 4HK0A 5SX4I 4W9EC 3MV8A 2PABA 3OKNA 1XH3B 3BVDB 4PJBE 3LKOB 3AS2A 1URIA 3X3FH 4MS8C 2HT2D 4YDLB 5ACZA 4IRSD 3P11L 4WI0A 2WXQA 1O6SA 2N1KA 1D5BB 2VXUH 1B2YA 4NJ9L 2LE9A 4N0CD 4OJFH 1P5UA 5H37G 4NZRL 3ATEA 5I1KL 4OF6A 3MNMA 4XR8C 1FNSH 1VB9A 2FB4H 1ED3B 5I19H 4GRLB 1WFUA 1X4YA 1G9HA 3MKGA 4LLYA 3OKKB 5IM7B 4ZFGH 3PFQA 2R7EB 1U3HB 3K72A 2LTQC 4E5XB 1VSCA 3KXFD 1BZQK 4JB9L 1ZRUA 4KZCA 2Z35B 2DY2A 4PWEA 5DUBB 2G3ZA 1NMBH 3QI9C 4YSTA 5HXMA 2KUTA 3R18A 4NKIH 5A2KH 2PMZA 4ZUUB 3UJJL 1L9SA 5K59E 3BLKA 5JO5A 3K1DA 4JO1L 3RFZC 2YKLH 2Z92A 1KIRB 4NHCH 1PD0A 5IZ7A 1PLGL 5DTFB 3ES6B 1VPOL 3D2UD 1E43A 5CILL 2AXFA 2DI8A 4QYOA 1MJ7L 3CSYA 1V7NH 3O3EB 2ADJA 3MMEB 1XSOA 5KSVA 1MVFA 1WFIA 2AJZA 2W9DL 3DO4A 2FD6L 1LO0H 1DBJL 1GW6A 5H8DA 5JA9A 3OKMA 1A66A 3JVGC 4ZX4A 4OZGF 3LXUX 5FO8A 1W72B 1PF3A 4X5XA 3WOVA 3P11H 1JDAA 2V7NA 1KY7A 2YK1H 2W8CA 1EHLH 4WUUA 4XNZB 3FT2A 2C9RA 3EGDA 3V5DA 2RAMA 4QXGL 4KJQC 1IC4H 4MDRA 1SEQL 3MJWA 4PB0H 4XPGL 1D5MA 3OR6A 5B4MC 5B7FA 1V54B 4I0PB 4JRLA 3SO3B 1U0QA 4UIMA 4M5ZH 4TLTA 5TDPB 5C0IA 3S3SA 3VG9B 4H26A 2P5ED 4P3CL 4LSQL 5I15L 2HA1A 2WQVA 1JZFA 4WEMB 2AJSL 2GY7B 3WGUB 1U92B 2FR4B 2MCPH 4A1RA 4PRIA 3NIFB 1UATA 4NP4H 3II2A 3RVXD 5JOFA 2CGRH 4EE2A 3KPOA 4UV7L 4UIKL 3WUZA 1NDGB 4RFNC 3DYPA 1GSKA 3MNWB 4JFZH 3L81A 3BVNB 4F2EA 4XVJL 4M5YL 2JSFA 1HHHA 4PJ5D 4JG9A 5EN2B 1OARL 3HVNA 3WBDA 1ZIBA 3SDCA 1A6VL 3BHBB 4KX7A 3V7MA 1XXFC 2OL3B 2Q3XA 4FNSA 4YZWA 4XWOC 4P23B 3OJVC 4UOZA 4JPIA 4MA7H 3US0A 1A8JH 4Y19A 4XBGB 1U91B 4QO1B 3FOMB 4HLEA 2ESVA 2G9HA 1TETL 2X1QA 4F8PA 3VXSA 2K4WA 1EFXB 2UZIH 4OB5H 3UAJD 1Z6JT 5IVZB 2OSXA 3MA7A 4PVNA 3HZYB 4ZAKC 1QTPA 5EZPA 4WO4A 1FPTH 3D08A 1YNLH 5F6IB 4MNQB 3HNVH 4OH2A 1KT2A 2Q87A 3L95B 2ICWB 3STZA 1ZTXL 4IOSA 4HJEA 1DQJA 4X80L 2K8MA 4YPJA 1ID5I 1OAKL 1KGCD 3FCSB 3EJQA 1Z9SB 5KVDE 3EYFA 1HOCA 2VRAA 3G6AA 3KW7A 4FTVD 4RWHA 4Z18A 4AGPA 1W0VB 2BHZA 2HFGH 4LCIL 2FTAA 2HKAA 3LS4H 2BMKB 2Z34A 1Q9WA 3BWAB 5D4QA 1L3WA 4TUOB 1KCLA 3AS0A 3DVNA 4OAWA 4U6HB 2AQSA 2XWJA 3BIKA 3SKMA 5I1CL 5AB2A 3E2HB 3LPFA 4YLCA 3VXUB 3ZSTA 2GJZB 1RY7B 3K81A 1E3FA 4PP1C 3PQYB 4KOCA 2FBJH 4GY4A 4IBZA 1BVKA 2CKNA 3SCMB 5FHAH 2YPKB 2BNUB 3UROR 1JGVL 3ROLA 2NNRA 4N8PA 3MU3A 1MFBH 5DT1H 1GHFH 4IJ3C 4MAYB 3FT3A 4KDTA 5BOPA 2F5BH 4KJQD 4XO3A 1CGSH 3IMWA 1CLOL 4M43L 5T3ZL 3RTQB 1E8YA 3N1MC 5KYYA 2RTTA 3TV3L 3CZEA 2X0VA 2OPCA 1TEGA 3FAWA 2ITCB 1YNTF 3MV8B 4OFYD 3GPEA 4IRZL 2G2PA 1EWHA 1Y0LB 4E9RA 5IQNA 3X14B 1VZGA 1AHWB 4XN8A 2YD4A 3WG7B 3SDXA 4G7VH 3MBWB 3M7FB 1AANA 4CDGC 4DQOL 1O6SB 3U1QA 5C0RH 3SGJC 5IEHA 1AIFA 1PZCA 5FKPA 2FLBT 1LP9B 3BKCH 1ZA3B 3BRGC 5A2FA 4DOHB 5EULV 4LHUB 3SD2A 4G9FB 4D94A 4YHYB 3WIFA 2CO3A 1OM9A 2AJUL 2WSPA 1CLCA 2BSRA 4DK5A 2YAEA 2Z35A 5DUBA 1AXIB 5LAXB 3WNOA 1N5AB 1OCRB 3AXIA 4AVHA 3PP4L 4NJAH 4QCIA 4UM8A 3BJ91 3TX4A 4BDVA 5KVGL 4W9DC 2WUBH 2E6QA 5B39B 4DESA 1FF5A 3SJVA 3U30C 4Y5YA 1JVKA 4AKPA 1ZHBA 5EU5B 3ZZSA 1I9IH 2RFXA 1GS6X 3P0YH 5FUZL 1XHHA 1FN4A 1J48A 1SHSA 1J10A 2X4NA 4JRXA 3TT3H 3O3EA 1SEBA 3AXLA 5CEZD 3CGTA 3BT0A 4JDVB 3MMEA 3TZVA 5AKSA 1AH1A 3UP1A 4NP9A 4P5KB 1N2RB 4L8SB 1BOYA 1A4KA 3WLBB 1T7VA 3OKMB 4KKQA 4G70B 3K46A 3BH8A 2V7NB 3GS7A 3MLUH 3L9BA 4Y2LA 2F2HA 4UQ2B 3K6FA 3FT2B 4CJ1A 1KPRB 3ORJA 4XMUA 3FPXA 1VPOH 5C0CA 3V52L 3O6KL 4LPWA 4N2KA 1RZ8B 3QQ9D 5ADOH 3OR6B 1DQTA 2X89A 4C56A 4HQQH 3V9FA 1X5KA 1A4JA 4WI4A 5DVOA 3WFDH 3NCBB 4RVBA 2ZCLH 2QVMA 5TFSL 4OF8A 1IGFH 4B96A 4PLOB 4XB7A 8FABA 1IKFH 1BFVL 2AEWA 4KVPA 2ZNXA 5KG9B 3PP4H 4NJAL 4HT1H 4PTUA 3LPGA 2H45A 1MFEH 2X41A 3ZE0E 3A6BL 4ZFGL 1VKXB 3CC5B 4JQIL 5FYKD 1XGRA 1YEFH 4AEIL 1NDGA 3H9HA 5SWQA 3ARBD 1JI1A 2VZTA 4TULH 4DW2H 4GRWB 4PGBA 5HDWA 5TDOB 1X7QA 1QVOB 3EUUA 5D7JB 1E9QA 4Z7QE 2DYPA 5FO2A 1JGVH 4BJLA 3T2NL 2EUWA 4FI8A 5TH2A 3ZKXC 3EJRA 1MAKA 4YHZH 3WO3B 2OMXB 3VWJB 4JANA 5CBAB 1J8SA 4JZOB 1M3JA 1WHOA 1LNUB 2RIKA 3N1PC 1BF5A 1FBIH 4KOBA 1EFXA 4E2OA 2Y5TA 4I1PA 2XU9A 4JCWA 4PS4L 1WAAE 4HA1A 4RFEB 3IBOA 4MNQA 3SKNA 3FFDA 5DVKA 2HX9A 2R83A 4DEUA 3PV7A 1K4CA 3MYZA 1OAXL 3S34H 3V0DA 5TE7L 2Y3NA 5ICXA 2R0WL 3WE6A 4L1DA 2FJFA 2JKTM 4L4VA 1DJHA 5AAMC 3FQRA 1MH5B 3PWJB 3G6AB 1XTMA 1JMZA 1A9EA 3O3AA 3VFGH 5DFVC 3MBXL 3IN0A 1XF1A 4FFYA 2LHAA 4TUOA 2CBOA 2DWSA 4NKIL 1CU4L 2C3XA 4XVUD 1ORQB 3DOHA 5F2FA 1K8DA 5L6YH 1WAAF 2N0KA 4MRBA 4BM7A 5J06A 1KTLA 2WHVA 4N26A 3PQYA 4DH2A 1KLFB 2EE6A 4ZAKB 2XQBL 4OV5B 3F12A 4K2UH 4Z78A 1FNLA 2G0LA 1CGVA 4KTDH 1CF8L 1OARH 1PBYA 1IQWL 1JPEA 1UXWA 2DWXA 3FT3B 4PN6A 4BFGA 2PO6A 4WJG3 4KXZH 5C6TH 3ISWA 3G3LA 4DCQB 2OFQA 1NGQL 2P8PB 2R0KL 5IHHA 2P28B 5BRZE 5T5FA 2AQTA 2L0DA 5F1SA 4TUUA 4HWBL 5AVSB 4MNGB 5L8KB 2Y7MA 3PHOB 4LVNC 4ZW7A 5SWSA 4UCFA 5L9DL 4LB8A 5BNXD 4WSGA 2NY4B 4B41A 5IJDC 3QXDB 3U0TA 4XNMB 5E70A 2WKGA 2CWRA 3L54A 4UTBH 2Q1EA 1WO2A 4F20A 1FZOB 2G5BB 2WXHA 1A7QL 1M71A 1FI8C 2C9SA 4PGDA 5EU6B 2J25A 1H5BA 5GHWH 3U2SB 1ZTXE 5FIEA 3R0NA 3RUGE 1S7WA 3CHPA 4DO5A 4HPYH 4LSVH 1CLOH 4M43H 1T03L 4ZMPA 2IDTA 3NEEA 1G1CA 3QB7C 2P24B 2XG5B 3WIFB 1CS6A 3MKKA 4Y4FA 4O51A 4NRXB 3VNYA 4PBXA 2OBGA 2E8YA 4JN2B 3ARFD 4AC2A 1CE6B 1UYWH 2VDQB 3DXAD 4JM0A 4N8CH 4PMFA 2KS0A 4K0OA 2W38A 1EDYA 5KZCD 1G9EA 5JDSA 1HTYA 3E9UA 5I1EL 1VFUA 5IB4A 1JPFB 2CDGB 3OG6B 4EDXB 4PRPA 4ADJA 4BFOA 2OMYA 1BM3H 5E94B 4FHJA 2OYPA 4AL8H 2RFXB 2R4SH 4Z7NB 4F92B 1BCIA 5KN5A 4XPGH 4AQ1A 3L9RA 4H5SA 1UJ3A 4QOKE 5D1QA 5E8NA 1NLDL 2B1HH 4F8NA 1MRFH 4Z6AT 2CRYA 4WV1C 3WLBA 3LIZL 5SWZD 5INCB 3BMVA 1NDTA 5DD0H 1SYSA 3JTSB 4MJJA 4QIRA 4LESA 4XH2B 1JN6B 3JWNE 3HNVL 4PGJA 2ZYIA 4QYAA 3MXWL 2KH2B 5I8OL 3VI4F 2M2DA 3CCHB 1NBZA 3TWCH 4DPBX 4F33A 5BZXA 3HCVA 3LXBA 4JHBA 3V4PL 4C56B 4NQQA 5BS0D 1WF5A 4UNIA 2P8LA 4YR6A 5HYSB 2X40A 4XAWL 1OCWL 2A74A 4J8QA 3UJTL 2R29L 1E4WH 3ULUD 3N41B 2IDFA 2YQBA 4WHYH 4ENEC 3GLDA 3UAJA 3VRIB 3CN1A 5BOJA 3UC0H 1AKJA 4QRPD 2R2BA 1TIUA 1XGRB 3OAZH 5GRYA 3AITA 4PCSA 4W4OC 5ABAA 4XCYA 3HZKB 4GP5B 4G8IB 4EAEA 3WS6C 1AOHA 2Z7WA 4HD5A 4Q6IC 1N59A 2I9LA 4FYTA 2VDOB 4XCFH 4XO9A 4LXFA 1P4BH 3BGFC 1JDDA 1AFVH 1KFGA 4LAJH 3L4ZA 1EO7A 2L7EA 1NFAA 3C5JA 4X8GA 5B3JE 5BS0E 1VRSA 3AT0A 3I6KB 3KPNB 1SEQH 2X0WA 4PB0L 4OIIH 5D1QE 2V2TB 5D1ZC 1NCBL 3VWJA 4JZOA 1QNZH 4M5ZL 4QTHA 2BNQD 3O9WA 3H4FA 2XWRA 1X44A 2Y5TB 4FNTA 4FZEL 3TN0A 4LPCA 3QQDA 2R1XB 4ZMOA 2K7PA 4RFEA 2QTVA 5H4YA 4HZLB 5FO7B 3V0AC 4FXGC 1HS6A 5I0DA 2BJMH 1DZ0A 4LQ1A 4R0LB 4NENB 2F8IA 4NN5C 3WHXA 1NAMB 1NC2D 2TRHA 3UYPA 3S48A 4RMSA 4LLAA 2AITA 4JFUA 1HHIA 4LP8A 3ZE1B 4M7JL 4AVIA 1D3CA 3BZ4B 3C6SA 4Y7MA 3TCLB 5DD5H 1A9EB 1T80A 4LLWA 1F45A 3CFEA 4JFEB 2Y1AA 2XN2A 5ESVB 3B37A 5HGDB 4XVTL 4Y16B 2FEEI 1JD9A 1OK8A 3BDBA 4V2BA 3QJFA 2NQCA 2BWDA 4I1RA 1MFEL 1E5ZA 4NO2B 4IU2A 3TTYA 4X4YB 3QCUL 4QRRD 3UTTD 3QDJD 4EIBA 1VADA 2YMXL 5CGTA 3NA9L 1UXMA 3VFPB 3Q1SL 1CDHA 1KLFA 4ZAKA 4P9HL 1TQVA 3ZW3A 1MIEL 3UX9B 3N40F 2UXGA 1J9QA 4H8PA 5HYQB 2YMOA 3KPSB 4FQXC 2WKOA 3R0MA 3UAJC 2BRQA 4WVRA 1TG8A 5DFWH 3D9AL 1FLRH 4H88L 1R3HB 5F9JB 1XMEB 4Y2DB 4CSZA 3HG1B 2PO6B 2EYRB 4L1BA 5EEXA 2EP6A 4TLUA 3N50A 5C0DB 4EUPA 3BQUB 4KJYA 2P8PA 3K1KC 1RK7A 2ZUWA 4R83A 4Q4EA 4Z7UE 1H6FA 5FGBA 4WW1B 1S7SB 5DFTA 2NY3B 4N2AA 7CGTA 3AAZB 3TL5A 1DCLA 4KQ0A 4KKPA 1HH6B 3RY6A 1TVHA 1CICC 2VDMB 4WK0B 2MQCA 5D2LA 4NNYA 2B8OT 5E6SB 4EIUA 4LVEA 3GHEH 1S78D 1I3UA 3HAEA 5LN8A 3SYPA 1ONQB 4UTAL 4GSXA 4XP5H 1UASA 2P7TB 1GOGA 2P24A 3GXPA 1NCJA 1ETZA 1AXSA 4GQZA 3SDXF 1CURA 3V5HA 1E27A 1MJUH 2C34A 3ET9F 2VLJB 4KH2A 1S7QB 4X6BA 3SKOA 5AG9A 2ZUTA 3OD3A 2WMPB 4JN2A 3P4MB 1IAII 4JPQA 4M6NH 1NCWH 3GF8A 4F58L 4LVHB 4ANKA 3BFQG 2ZOUA 4CL7A 3FSOA 1AE6L 5FK9B 1OW0A 4V1DE 4DEPC 3L9EA 1PJWA 1A6ZB 1FLRL 5L4MA 5IVXF 4WAFA 1AR2A 4KRPD 2CDGA 4FJZA 4IRZH 1UOVA 3L3JA 5E4OA 5D9SA 2QQNH 2XQYG 3BXNB 1X5AA 4WGKA 3RFZA 1DZBA 1UJ3B 4P4KA 2A6JA 5L4FA 4QOKB 4RZCB 4ZS6C 3UTZA 4HULB 1NGZB 4KTEL 2OR9H 5KJ4A 3K5SA 1U8NA 2G2RA 1BX2A 3S8GB 2CHDA 1BFVH 2NYZA 3LQAL 3T3ME 3JTSA 2ADFH 4M7LT 3CBKB 3B3IA 4YHNB 2CDFA 1FNGB 3MOQA 1SZNA 3AREC 3FDWA 1JYNA 2AS5M 2FL5B 5A7BA 3EJZD 1AYRA 1E2ZA 4F33B 2YD0A 4GKOA 1A4BA 3A47A 3PNWA 2B4CL 1RP8A 1GS8A 1QD0A 3BUIA 1RJLB 4PS7A 4R2GD 1KPVB 3ULVF 3KM2A 2RACA 2HRLA 1MFDL 1SDYA 1KTRL 3P2TA 5K9JH 1NWOA 5E1QA 2Q6WB 2H2PD 5ETUA 5D70H 4AY0A 4C8XA 2NR6D 4BZ2L 1HAUA 1DBBL 5IMKB 1SXZA 3VRIA 1I3RB 5FYKE 2CGYA 4U6TA 1HILB 3MN8A 4UOJA 2NCMA 2PXYA 4UU9A 2BSTA 4MDJB 1S9KC 1L9NA 2Z31A 3OL2A 4LIQE 4PG9B 1FGNL 4QHUB 1T5WB 1N0XL 2D7QA 4G71B 3K2UL 1NINA 1RZPA 4G59C 1F4AA 1N59B 4AZUA 5FV1L 3SGDI 2C9VA 2IPTL 4NQEE 2A73A 4U6XB 1QFUL 4ZW8A 5CJXC 4ANUA 1P7BA 1HXKA 2VDQL 2D7MA 2VABB 3WMQA 4JKWA 1P1ZB 1J1XL 2ZYHA 5KVEE 4CKQA 4MB3A 1HJBC 1CICD 2NYKA 1DQLL 4ODBD 1HINL 1IKFL 1QTYT 2I32A 4I77L 1E4XH 5AVVB 5LGYA 4NFDA 3WL9A 4QJ3B 3OB8A 1GZHA 4R5XA 5C0RL 4WFGD 5HYSG 3ZE2E 2DTMH 4Z0BH 3FAXA 4HSQA 2KZKA 2IADB 2HVJA 2XWCA 4UB0H 5CINL 1UH2A 3KWWB 4FFZA 5C0GB 5F0PB 1LD9B 3UMNA 4Z3IA 2D7TH 3HA0A 5I16B 1Y6MR 3B7TA 2CKBB 1FG9C 4LHQB 3BKYH 1N26A 5I24A 1YJDC 3PWNA 1WGVA 4FHKA 4L4TE 3CLEH 3QDGD 1BVLA 2P48B 5KYWB 3EZJB 4TL5A 5HGDA 3BFOA 4Y16A 5I1GH 1XSKA 2LLGA 3NN8B 1XR8A 1SYVB 3SPHA 1TZOA 3CXHJ 3WDIA 1UWEL 4EBQH 5I75B 5IROD 2BS8A 2BNRD 2YJLA 2VL5B 3SHSA 4OTXL 4DP2X 3CFDA 3FT9A 3NZ8A 3ZDXB 4GG6B 2DWDA 3CVHA 3PIQA 3Q8BA 1QI3A 3QS2A 3NFSL 3MRKA 1I75A 3NIDE 4G1MA 3OMAB 1R3HA 4GO6B 5CXPA 2EYRA 3T6VA 2C8NA 5BMFH 5TE7H 3WIHL 2F08A 2X4PA 2E3VA 5JHDD 2R8SH 3BQUA 3KPSE 1YLBB 4KJYB 4RMQA 1AAJA 2VM3A 1DSYA 1LO2L 4M7ZB 1ICTA 1TITA 4CVXB 3AY4A 1HHGB 5IJCC 5DMKB 3SPVB 3F05A 3J8F7 5IB2A 3GIZH 5BJTA 1TTUA 2FATL 3D0VB 5H2BB 4AMKL 2FDBP 4E41D 5AW8B 2IG2H 5HHOD 5FR3A 2NT1A 1NFDA 4P3DB 2NR6C 1RJZA 3FB7A 4K5PA 5K9OA 1Y18B 4PW4A 4A7QA 1Z3GH 4KMQA 5DVMA 2WN3A 5DEGB 2ATPA 4OLYL 4QHMB 5IFAL 5JDJA 5LVEA 2O61A 1WJ3A 1IFGA 2DJ4A 4G42B 3V8CA 4KMLB 2HTKD 5IUCA 3R06A 3EO0B 3MYJB 4HUXB 4N28A 4PBDA 5T5FL 2FJUB 2RCSL 3T5WA 1ETZB 1K3IA 1QUNA 4Y88A 5DO2C 4ELKA 1YEHL 1BZEA 3P30L 5DURD 5F9WB 2WNGA 1SHWA 3JWDH 4GW5A 3AROA 2XJLA 4OF7A 4NKMA 3QQ3B 3HZVB 1SHXA 3ARBA 3KGUA 2F53E 2VLRB 1SPDA 2VERA 4G8FB 4FQCL 2HT3C 3DPBB 4ZNEE 5GJTL 5C08B 4UUJB 4FFYL 5D9SB 1YC7A 2D7PA 2ZCKL 3FH8A 3W1ZA 1DYZA 2A74C 3PG2A 2IANB 4NQDB 3VI3B 1BGXH 4L0PB 1BX2B 4ZQKB 1T1ZB 1PCSA 5KWYC 3MLTB 2OTPA 5B1KA 3FW6A 4NO3B 5DK0A 1KNOB 2R0LL 3CXFA 3G5ZB 2FO4A 3B3IB 3JXAA 2OSLB 4R4FH 3RKDD 5T1MA 4XNQA 1H6UA 1AGFA 4KK5D 3RVWD 4OSUL 5IMOA 3DMMA 1S7RA 1U8JA 2PKDA 1QR1B 3LN5B 3FRUB 5EZLB 1JZ5A 3GXIA 3U4AA 1IEHA 3QUMB 1FNEB 2NY0B 1WPCA 4JJOA 3F6LA 2DQMA 2FECL 2WWNA 1KPVA 1KBPA 1F13A 4YHPA 4DTGH 4N3TA 4GAYB 3NJGA 4GRMA 4BWTA 1W15A 4ZW5A 1OPGL 2YD6A 3VTTA 3BDYL 4YPGA 2EZ0D 4ZS7H 1PKQE 4B5ZA 5FLVA 3EG9A 1YUKB 4LRNL 4XMXA 1X9UA 1U6AL 2KQMA 1DVXA 4N8VA 2L04A 5B7MA 4JFDD 5I5RA 1UXLA 4WJ5A 5DS1A 1DDTA 2NX5A 2YPLB 5IVXA 2ZKHH 3I9IA 5EPMA 1OD9A 5MHSD 1D6EB 1LDSA 4J2XA 2BSTB 4Z8FH 2I5YL 4I5BA 2DQFA 4C4BA 3B3BA 1FG2A 3H0TB 3FCBA 3TBYB 1JP5A 2KQNA 2YA0A 1DQQB 4I7ZC 4WFEE 4XBPB 5I71C 1TZHB 1ZS8B 2QQKH 1UT2A 3MXWH 1N0LA 4P8QA 5FYKL 1M4KA 4UQEA 5DS2A 3NIGE 5DZJA 2FK9A 2AW2A 3K2KA 3PQYD 4LCVA 2EICA 4IK7A 4HUWB 3VFMB 2EC8A 1V7MH 2PO6D 1OGTA 2AV7A 3NCMA 3VJ6A 3IXAB 4HK3N 4A37A 2YN5A 3BP4A 1FO0A 4QRBA 3IDIB 4Y1AE 2I9TA 4NQCB 3CHSA 4Z3JA 5L88L 4PS3A 4AL8C 4N2GA 5JIPA 5E5RB 4BSJA 3EYOA 3WFCL 2CXKA 4FTVB 1WV7T 3L1OL 3EF7A 4AQ8C 5JNYB 2GSIA 4QRRA 3MCG1 3W56A 3MRCB 5DSCB 3AB0B 2VN6A 4M8VA 1YEGL 2BFVL 3T2OA 4EKJA 1S9WA 2DQCH 2EYSB 1ZGLB 1IIIA 4WWNA 3HRZC 4YDKH 1ZPUA 1QZNA 1U3YA 4N87A 4B9FA 2XETA 2CIKA 3GHBL 3LY6A 4IRZA 4WV1A 4DVRH 1A4AA 2ZUQC 1UM6L 2RBLA 1E6OH 3O2WL 3PWNB 1EIBA 5DCCA 5I30H 4S10A 1URZA 1MW0A 3IJHB 1QATA 1MCEA 1AZUA 2IG2L 1WC7A 1OF2A 2WB1A 5T1KA 1T7ZA 3TO2B 3HIZA 3HBZA 4BGLA 2A83A 5HJDA 2DQDL 3MRJA 2Q8AL 1WBZB 3HZ3A 1W9XA 5TQ2L 1DBMH 1OAYH 3IYLW 1QZ1A 1RUKL 4QT5B 3ZTNH 1C5BH 3QIUA 5F7YC 4KO5A 1N0XH 1KEGL 4YVNA 5EDSA 1QASA 1XGQA 3L4VA 4CBPA 3DJSA 5JQHC 4FQ1H 3IMVA 1SVCP 2CHNA 1WQVT 4YHMH 1MN4A 1KJ2H 4HEMA 1FL3A 1GS7A 4GMSL 1GSMA 4MMXC 3S0PA 2WXPA 1O9WA 4M1CC 1G0YR 3SE4C 1SOSA 2RA1A 4UTAH 3NAAL 2NT0A 1B0GB 1CFTB 3LKRA 4L5FH 4QXUH 3S97C 1XF2B 5DJYA 2Z93B 3FKUS 3PAYA 4I87A 4A7VA 4H0LC 5FDWA 3MZGB 3KBPA 5DMKA 4NQEA 1QG3A 5J4MA 3KW8A 1R5VA 4NQXA 4JM4L 2PYEE 1OSZB 1FZJA 5EO1B 2CJSA 4WO4D 3MZTA 4E68A 4JN1L 1R5IB 1J9SA 1RJZB 1RSFA 4UDTA 4R4BA 5F9OL 2ENPA 3GB7B 3E0GA 1YDPB 3CD4A 3W5MA 4Q6KA 5H94A 5IG7B 4UB0L 3LQAH 3ZE0B 4XNUH 4NI6A 3V79C 4HUXA 1L0QA 1YG9A 4WI3A 3UJIH 1FV1B 4NSKA 1A6VH 4JREC 2WPGA 4R26H 4J8RB 1KCBA 3UZVB 4EIGB 4FMVA 4LLVB 3W9EB 4Z23A 4ELKB 2X89D 4C56D 2CPCA 4LSDA 2PWHA 2J43A 2VW7A 4OKDA 3T65A 3GSWB 2PPEA 4JZNA 5F89A 3VGAB 2WNXA 3FB5B 3NCWA 1X9RA 3ATBA 2QQLH 3VFNB 1A0QL 3LZQA 4OLXH 1JF6A 4PRID 43CAA 5EZIL 1DVSA 3FUEA 4RMBA 3GBLA 3NJXA 1QPXA 4UUJA 1CFMA 2B5IB 3I9GL 5D1ZB 4XWGL 3C5ZB 2OYKA 4EI5D 5D1XC 3I2CL 4F8TA 1XGTA 3T1FA 4NWTH 1G0DA 2YAPA 5K69A 1DUZA 1WFMA 5E2TH 2VTFA 2HLEB 3WYRA 3KPPA 35C8L 2B2XL 3PP3H 2WZAA 4H20H 2Y07H 3UZQA 4NO3A 1Z1WA 4LCWD 4NZJA 2PR9A 1UT9A 5LG6A 4K7FB 4JFQA 3AADB 1KBBA 3M88A 2OYMA 5HJ3B 5DC0A 1RQ5A 2WZ6A 1S7RB 1U8JB 3GNML 1QR1A 3ARWA 2Q7NA 5GRVL 5BVPL 2IAMC 5F7BA 1HAWA 1BP3B 5C70A 1KTJA 3MROA 4Z7WF 2WXFA 1XTLA 4I2XA 4LLMB 5BV7C 1T89C 1QSFA 3KDPB 4YHPB 2P52A 3IBEA 5TQ0H 4PJIF 4UAOB 4FJYA 5JXEC 4KNSA 1S9VB 4PREA 4NCC2 1CC3A 4R2GB 2R0LH 4IKNA 4DGIL 1YEEH 5HDBE 3D25B 1UURA 3RVXC 4DEWA 3SQRA 2YPLA 3VM5A 3VI4B 1KJ2A 2WIIB 6PCYA 1D6EA 2VXQA 4L3EE 2DRUA 3AM8C 3BWSA 3GS0A 2AXJA 4HOWA 2I07B 2XIBA 1F6AA 3KGSA 4RNRA 1FG2B 3H0TA 4RMVA 3GSOB 2GIXA 4B9PA 2H0JA 2P5WA 3LH2L 1DR9A 2OKMA 4PBVC 1UM6H 3QUXC 1G5GA 2AJVH 4B9IA 5IUSA 3ILPA 1N0LB 2EVIA 1KYUA 4FQCH 4JPWH 4PR5B 3Q6GH 1WUZA 3W11D 1FVDB 4M8RA 5E99L 2X4QB 4Y8DC 1U41A 2MNJB 4XHQA 4Y9CA 2WP3T 4MJ4A 2NY7L 3LKSA 3QE5A 3IJSB 3KPTA 5I17B 4XP6L 1OEZW 4O5LH 5I6PA 2DQ6A 4ZOCA 3CSFA 2WLLB 3VTAA 2ROXA 4FXGB 5MEOA 2PR4L 4FTVA 4N2OA 1YMHA 4XMZA 1BAFH 4DVBA 2XIDA 1R3KB 1YN7B 4IQHA 5IFAH 2ITDA 1JF1A 3HRZA 2EDBA 4PJIA 1CN4A 2AK4E 3C60B 2R56L 3BPOB 1QRKA 5FO9B 4BEIA 3E1ZA 4FG6D 2QMJA 4ONGL 1JPGB 5AYUL 3CH1A 2BOCA 3I02B 1IBDA 2WLKA 5D7IF 3IJHA 4M9OA 4NC1C 5CIPA 5DURB 3P69A 1A14L 2C4FT 3Q8AA 4OY9A 4GS7C 4DP1X 1KBKA 3GO1L 3SBPA 1DJIA 3VXTB 4HJ0C 5DC9B 5JHDE 2YZ1A 2O4EA 3GK8H 3V9CA 2A83B 4L3EA 3VGFA 2WAHA 2NY2B 4XCCL 2GFBB 3O2DL 5DR5H 2NY4C 1ZT1A 2VDML 3FU5A 2RJMA 4Y9GA 2MHAA 1JWMA 1B2WL 3EDFA 1SJEA 1EXUB 4A67A 2OX5B 3QJQB 3RI5F 4ZODA 2UXTA 2QQLL 2VLKA 4OQTA 3H9SE 4YIQB 1ADQH 1KY6A 3E80A 4XT1C 1KWKA 5FM5O 4JPVL 3IETA 4M7LH 3V10A 1TF4A 4MD5B 1OE2A 2ZPKH 4WWKA 1Z5LB 3VXOB 3WTXA 5D7IE 3LZPA 4CMMB 3FFCE 1MJ8L 3QZNA 4U3HA 4AENB 1XF2A 3EBHA 4NPYB 3SDDC 1NBYA 1F41A 1JTTA 2XBDA 4S1RH 5IKCB 3CLEL 3RWHB 3WJJC 5FUOL 4CVUA 3MNDA 4JFHE 1T3FA 4YSCA 2BIOA 4GAFB 4JVUA 1BW8A 3CFBA 4K23H 3MDJA 4V1DD 5T5NF 3ETSA 1ZHNA 2OMTB 1R5IA 4YHIA 1GIGL 5T1LB 2P46B 4EO5A 3V6OC 1OY3B 4NC0B 2ZKWA 3L1OH 3O8XD 2YUVA 4UDTB 2OXGB 5EBMB 3BEVA 4YE4L 4DGUA 4FKKA 4TTDC 5E8PB 5FFOA 4F2FA 1OAUH 4KQ4L 4WDIB 2EYTB 2Y0SA 4X5WB 2L7JA 1HQRB 4YFLF 1U8KB 4APQD 3ARQA 3LD8C 1XCXA 3TV8A 5DMIH 3M1BB 3WTYA 1WCBA 4U3SA 1BXAA 5C1MB 2DV6A 4HXBH 4BE6A 3LKQB 4FE9A 4F7EB 5EBLB 4FLQA 1IC5L 3RVTC 1BWMA 2Y6SC 3NJNA 1OQOA 3T65B 4I48B 4XCNA 2QQKL 4PV1C 2WTOA 3FB5A 3BW9A 3HEIB 2EUZA 4GKSB 4Q9BA 1SF5A 5HHQB 1G6RB 4OCNC 5IJVA 1QLEB 4U1JB 1RUKH 5CLXA 4XPBH 3ETBJ 4HC1A 4H7VA 4S1QH 1CMOA 1KEML 1PG7H 4MTMA 3WY4A 3ZYOA 1DLHB 1O75A 4GKZB 4PJDA 4OGAC 3OXRA 2C3VB 1CZ8L 4EIZC 2I7OA 2AKRB 2HMID 5MEPB 3WN5B 5D7IB 4GIOA 1P5UB 2ICEB 4G8GD 1IFHL 4GP4B 4OJYA 1CICB 5CUSH 4TNVK 4UDUB 3IGAA 5AOKA 1NCAL 4JFQB 4ZX5A 3REWB 5JUEL 2QKIC 4J3OD 4AYMC 3KH3A 3MRLA 3CXDH 3K72B 3NZSA 3QG6B 1NSNL 3EJPA 3RVVD 2A6DA 2H26A 5E99H 2R4RL 3QCTL 3R7RA 4KQ3H 1GY1A 3QI9D 3MFFB 3HG5A 3WTWA 4OLVL 4JGNA 4JG0L 5C7ZA 5HGHB 3O3BA 4BZ1L 3V0HA 4GUCA 1WVZA 5EU4A 3SJVE 1J5OL 3WY1A 2CRIA 3NFNA 2FB4L 5I1IL 5DTFA 3BUQA 4N2LA 2Y1VA 3S8FB 4Z7VB 4L2YA 4NWUH 4YXHH 1KJ2B 2WIIA 4JQXC 4DF9A 4M7KH 3B8SA 3V0EA 2VXQH 1G0XA 1KGXA 1N6UA 1IIKA 1XDTT 3KYMA 1KCSH 2WZ5A 3K7UA 4GYBA 2VDRB 3FXIC 5TE4L 3P73A 3E8UH 1A1MB 4X9YA 4XC1H 2YD5A 4YO0B 5D7JC 3TIEB 4JG1H 4UQDA 5F3HA 2XZCH 2IMNA 5F93C 1WK0A 1E40A 1FH2A 4ONFL 3U6XS 2PTTB 2EDNA 1TLMA 1CU4H 5KAQF 4HFWB 3NABH 3RVWC 2XXMB 4I3RL 1OCCB 2OP4L 1QUPA 3TO4B 1NCWL 5CJXA 3QCVH 5A7EA 1XBRA 4UTCA 5CKGA 2IANE 4HKJB 1PZ5A 3B9KB 2FATH 3IJSA 1OHQA 3D30A 2EDWA 1IE4A 4QRFA 4WQOA 1P4IL 1TXKA 2R27A 2QSTA 4IRJC 3I3BA 5MEOB 2EZ0C 4Z7WB 1PIGA 1TQBB 1BIIB 3OAUL 4GG8B 5E4EB 3BLBA 4D0CB 1UEYA 1E5CA 2NR6A 2X9XA 4MBOA 3AQYA 4Y5XC 4AV4A 3CN3A 3CH1B 2J1WA 1JVOA 3BRFA 5IEKB 4A04A 1T6BX 1QSED 1G1OA 5CFAA 3DVGB 2NZ1A 2FGWL 3NSXA 1VENA 2DMKA 1ZT4B 2ZCKH 2A4EA 1OAUL 4FFYH 2CGRL 2ESVB 4ZUVA 2D73A 3PREA 4IBTA 2X3CA 5DEFB 2XI9A 3VXSB 4KJPD 2RQEA 1RIHH 3PL6D 1RVFL 2VLKB 4L2LA 3UO8B 1Y6NR 4KGLA 3IETB 2DKSA 1RPUA 1WT5A 4OM0L 3P9MB 3CDZA 1A7OH 4FG0A 4MD5A 4CJ0A 3WXWH 1JNHA 3FS9A 2VLLA 4XN1A 4YVUA 3STBA 1S9YB 2CO6B 3CN4A 3ZKND 2G30A 4QTIL 4MCZA 1OE3A 1SDAB 5E5MA 4WTQA 5LGJA 1Z9SA 2N7AA 3L5JA 1IO4C 4W68A 1ITBB 1NCAH 1CWVA 3MLXL 1ZHNB 2OMTA 3P4OA 1GGCH 3K6DA 1WD8A 5AW5B 5GS3A 5ICYA 1JZJA 5EOCJ 1IE5A 4OAWB 3BGAA 1WDAA 5E8PA 1FYTD 4G9DB 5F3BA 2V3FA 1GH7A 1LLAA 4R90H 1JDCA 2F7IA 4PP1D 1U8KA 2O5XL 5A43C 2IV9A 1FH5L 1BVKB 1MJ7H 3Q5YA 5ITFA 2X4TA 3LRMA 4NIYE 4IBVA 3WFEL 4NZTH 4Y16D 3TFBA 2WAQA 4B5EA 4F7EA 1AP2B 3FO9B 1OGAB 4M7ZC 4M48L 4MAYA 1WLHA 3OLGA 3GZPA 2YD8A 2YBGA 2DZEA 3DVIA 4LBEA 3KGTA 5L8LB 1F97A 4Y1AD 1ZLSL 4MA7L 2XZQL 4FZEH 3ZE0F 3TYFB 4WK4B 2CR6A 1BFOB 2OMBA 4YHZL 5HHQA 5IJVB 1IUZA 3TCTA 2WLIA 1CQKA 2FWLB 4UNTA 4V1DA 1CDYA 3VU2A 4FULA 5C9JB 5DD6B 2FVNA 3K71B 1ETB1 3KNBA 4R8WL 4K3EL 4WNQB 4YHYC 12E8H 4KITB 2PPAA 5D4JA 5EEUA 4G6ML 2OULB 2AEPH 1AIFB 3RZWA 2FAUA 4NT6B 3P02A 5FKPB 3V95A 2FJHB 3NDZE 4XPFH 4LHUA 5FFGA 3REWA 4D3CH 1GYWA 1P0SE 2Y36L 4JX0A 4YC2C 1OXYA 4LSUH 3VMPA 4F24A 2H26B 2EEFA 5BRPA 2PCYA 4LP4A 2PW1A 5LAXA 3KXFA 5LG1A 3TA3C 2CCWA 1U3HD 3VRLE 2XTJE 2AAVA 3W9DA 4F7PB 2HKFL 4M48H 2VZSA 3WTSA 2COVD 1RULL 3VVWA 3L4YA 4XTRC 3SE9L 4WKXA 4HGKC 2MIZA 2VR8A 4M1DL 2LOEA 5FW7A 5E1AA 1AZCA 4X4ME 5T1LD 4UOW0 2CGZA 4LLUB 1SEBB 3C09C 2MKLC 1T66C 3UO1L 5SX5H 2VNCA 1N2RA 1U93B 2B59A 5MEQA 3GSQA 5J1AB 5DD5L 1N12A 5C0ND 1F1GA 4NM8L 5KSAA 2DEYX 1OSEA 3FN9A 3ELAT 4G6MH 4PYGA 1GJUA 1K8IA 1U8OA 2JJTC 3FO2B 4WFHD 3VRLF 3IGKA 4OR1A 4HFWA 5BO0D 1I9IL 2BVYA 2QPEB 5BVJB 1CD8A 2VQ1A 2EDTA 3G04A 1RZ8A 3QWRD 3VDBA 3MCKA 1BMGA 3K6NA 5GRJH 3IJYA 3D39A 4JMXA 4NM4L 2MH4A 3DX9B 5K39A 1ZXQA 2HPOA 2XRAH 2ZJSH 4AH2A 3HI5L 1YEWA 2MWCA 3EBGA 2H47C 1R5WA 4Z7WA 1UH4A 2X4SA 1I7TB 1JGEA 4LSVL 3VQMA 5C0FA 5JIDA 1D7FA 3G6JE 1LEKA 4UQ3B 2C4XA 3CMOL 3QR2A 2C3HA 1G9MC 1EEYA 4G6JL 1XWVA 1SMAA 3NYKA 3C8DA 2XYBA 5FA4B 1HZHH 4OB5L 2JE8A 5DJ2B 1DJXA 3X12B 4KKLD 1HYSC 4YK4B 2HVKA 1NIEA 1N4XH 3KVDD 4XI5C 2GC4C 1X7QB 2QQNL 4RBPH 1TT6A 4HK0B 4GXFA 4KV5F 4XP1H 5IEKA 2X5PA 3H3KA 4KUCD 4P5RA 1UEMA 1QSFE 5I74C 4F37F 1EUTA 1BEYL 1Q0XL 1AIZA 2DYPB 3OKDA 2OR9L 4QHNB 3LKOA 4RAVA 1SJVA 3RGVA 5AW6B 3T8VA 4G80B 4KI5D 3IRPX 5LQBH 2J8UB 3ULSA 1HL5A 3HBPA 3MHZA 5CKAA 5ENWA 1QWHA 4JRWA 4NRYA 4PJHA 4J7RA 4HJJH 4YL9A 2BP0B 2ZXEB 1PU0A 2QV4A 2F68X 4LCYB 1CFQA 3B9EA 2VW6A 4DP9X 5DHVB 2V37A 4LLYB 2ESVE 1U8MA 3P9MA 4BUGA 1JXFA 4ETYA 2BW4A 3FFDB 4Z7QB 1NCGA 1C5DB 3L3OC 4N1HB 5JZ7D 4GSQA 5CEZL 3CZFA 3W57A 2X9ZA 5IB5B 3H7BA 3BAWA 3HS0B 1G87A 3I85A 4ODTH 1MUJB 3ARRA 3NP3A 3VFUA 5D6DC 1MH5A 2MNUA 4OD2B 4UQIM 4U1MA 4ZUUA 3P2BA 2FX8L 2IC2A 3VWKD 1TENA 1MPAL 3QDGE 4PH8A 4Z77B 2AXFB 5EU6D 4QYOB 2XIIA 2FX7H 2LLLA 3HHMA 1BYOA 2LVCA 1B0IA 1Q72L 4HX1B 2CUHA 4ZAKD 2LT9A 1JXKA 1T66D 3TP4A 1DQDH 1KTLB 4M1GH 1E67A 5CMAB 4POYA 3A24A 2EXYC 4BK5A 5ITFB 4OV5A 3F12B 3VB8A 5HVHC 4Z78B 5DHXB 3X1BA 5LWYH 1S5HA 1S9XA 1YNLL 1C12B 5ABDE 3ULAB 1DQIA 3C6LA 5E4AA 2YGQA 1DQMH 1YECH 3PV6A 2QDWA 4LBEB 5GGRA 1AFVL 4GP8B 3CZLA 2XZZA 4URKA 3VU1A 3D9AH 1KIQB 4OLVH 1MI5B 3T2NH 4DKAA 1GC1L 1I8AA 2IQ9H 2PYEA 3DRQB 4ILDA 3H7LA 1H3PL 2E6JA 3A4DA 1GMEA 2HKFH 3C87A 4I0PA 1AGEA 1BFOA 5B3NA 4L29A 1CYGA 3VQ2C 1J5DA 2QGBA 5C0IB 1WA0X 3K6SA 2VMEA 3WIIL 3AW5A 2FIRT 3DV6B 4DGWC 2VRKA 5I8KH 3K71A 2D7NA 2RQ8A 4XNMA 1THCA 4NQED 4YDNA 5D96C 2CUAA 3ZDXF 2WV3A 3VX1A 1IM3B 3D4GA 1CFNA 2O30A 3EHBD 4PRIB 3MCLH 3JYCA 2J20A 4HG4J 3BEWA 5B3JF 2FGZA 1SN5A 3O4OB 2ZSWA 3V0FA 3TF4A 3F8UB 1BQHB 4JO3L 2NUPB 3D12B 4W9FC 3MNWA 1QFUH 1WWAX 3PWPB 5LKNA 1A7NH 3AQDA 3IPEA 1GYCA 5TF0A 2FYYB 2V9TA 2Z0UA 4K07A 3GXTA 4CVZA 1DQKA 5F1NB 1CE6A 2QGDA 4P23A 3NBNA 4E0RA 4UT6A 1C1EH 2O5YH 4JGJA 1XXDC 1L0YA 1BVOA 4H8WL 5AWNL 1AZBA 5JDSB 1UKQA 3W9DB 4F7PA 1WEJH 4FTVE 1KENH 3VRJA 1IBGH 4FC3E 4A6YH 2H6OA 1D2OA 3WFHA 1H5BC 4P5TB 2Y2TA 3MUJA 4UINL 3B56A 1O7DE 1GC1H 2J44A 3MA7B 1DSFL 2C9PA 4JY6A 4AQ1B 7TAAA 2NPLX 2WKLA 5JHMA 4U2YA 1L9TA 2YARA 5FF6A 1FFNB 2KLRA 4OJAA 3V6BR 2ZKXA 3Q05A 2ZUQB 3VW3H 3H3PH 3U0WL 1JGDB 1G9NH 2KL6A 5MEQB 4O9HL 5GS2D 2OCFD 1AZZC 4XMKH 2ZG3A 4JFPA 3SDCD 1N68A 4P9ML 3GTNA 1JN6A 3WKPA 2DLTA 1G1KA 2N0MA 3FCSA 4TQIA 5EC2A 4G8EA 5B38B 1FO0H 3MODH 3P9WB 2YXVA 2YXWA 4S1RL 3G04B 3COOA 3B9VA 3STLB 4GG6F 3DJTA 1P7QD 2MPAL 2WANA 2XN1A 5SX4H 4FXLA 3L9YA 3T6ZA 3DVNB 1QR4A 1W80A 5I1LB 1IGJA 2K9FB 4HJJL 3IN2A 3MVSA 2SEBA 4GEJA 1H19A 4CW1A 4IHBA 2A99A 4AH2B 4HCFA 1F4WH 2WTPA 3DGGA 4ODTL 2W9LA 1N19A 2X4SB 3CAFA 4B3EA 4Z7IA 3VD7A 1RZGB 1E5YA 4Z7UF 4D9QD 5C07D 4GS7B 4UQ3A 3EHBB 3GSUA 1IM3D 1GZQA 2BSSB 2GYSA 1BQSA 1QYGL 1JFHA 1FORL 2BP8B 3N5AA 3HZKA 4GH7B 3H42L 5LAPA 3OKOB 2E9JA 1L9QA 1PZ2A 4LSPL 4NUGL 3K8MA 1PMYA 4X5RA 3MCYA 4GIAA 2ITCA 5C6TL 5DQ9B 4N9GB 1JPTL 1Y0LA 5FWRA 1YPZE 3VM7A 3X14A 4RAVB 4G80A 5G4OA 2HH0H 2X70A 4CBZA 2BS71 3DGDA 1OP4A 2K3TA 4RMRA 1IAIH 5ENWB 2R2CA 3BFWA 3TPUA 1TZAA 2OJEB 1SRDA 3QDAA 5LXVA 4FOMA 1T22A 3CFTA 2Z6FA 1ID2A 1YYCA 4G3YL 3NJVA 2J1YA 2R1XA 2VUOA 5FYJU 5E08L 5GZNA 1I1AC 4JDZB 1HWWA 3FB8A 5ELIA 1B90A 4HBQA 2X1XR 2Q8BL 3KVQA 5LUMA 3UTQA 3WKNA 4CUCA 1W8NA 3LKPA 1KEMH 3EYUL 2AVFA 1NAMA 3BIAX 3UYPB 3NGBB 4CSTA 3VWKB 5E8EA 3QDJE 2O6FA 2DQEH 1YPZF 3CVHL 3F5WA 1SY6A 3QDMB 4W9ZA 2IPKA 3V5KA 4B3VA 1UADC 4FABL 3HC3H 4OD2A 3FQUB 3U25A 4MAYD 1CLYL 1S46A 3LQMA 2WYZA 3IDUA 1J5IA 5BZDA 3HUJF 2UXVA 3PL6B 2I26N 3BI9X 2R2HA 1N70A 3EFFA 1TYJA 4FQQB 5DXWA 2BNQA 1YEIH 3O9WD 5LCVH 4WZ9A 3QIWD 3HVDA 3ZR5A 3TEZA 4N2NA 4PLJC 3AXLB 5D2NB 1JZ6A 2GJ6E 4NKOA 4G82A 3B2VL 3IWUA 1ZCRA 2AEIT 3LD8B 3RWEB 3I6GB 2VDNL 4ZMQA 2YEVB 1UD8A 1OF0A 3GSVB 1UWEH 5CMAA 4EBQL 5T3XE 2C1OA 1VCBC 3D33A 2R23A 2ORBH 1IM9D 4JRYE 4PRPE 4YXLL 4FQXD 5E7FA 1SXCA 3UABA 3L45A 3KPSA 3L5HA 2DWEB 1C12A 1FL5A 4UQ2A 1NFIA 3QZWA 5CHNA 2GEQA 1BAFL 4K3JL 3NP4A 2VLRE 3MLSL 3HAEG 4KTGA 2UX7A 3J2PA 3PGFH 1Z3RA 1MZYA 3ZQXA 3BYYA 1KIQA 2X2JA 4OCWL 1MI5A 5LQBL 3QZBA 5TDNB 2KPWA 3R7QA 4PGEB 1AGEB 1A4JB 3APNA 4K7PH 4AGQA 2WBKA 5IFHH 4NUPA 2AJXL 4NQDD 1Z5HA 5L2KD 4AW4A 3D39E 4PTUB 1E4XL 4RGNE 1F56A 5ERWB 2J56A 3IVKB 4IBYA 1ECYA 3R4RA 5EIIG 1VKXA 4I8DA 1G9NL 2EILB 2NZIA 2ZSWB 2P5PA 2DLIA 1YVLA 1UA3A 3PWPA 3C5ZD 5TDOA 3BT2L 4H1LA 3AG4B 3IDGB 2EADA 1KN4L 5LDUA 5I1DA 1L0XA 2Z7UA 2VJXA 1NJ9B 2GJ6A 4F5CE 3BO8A 3FNKA 1FL6A 1IFRA 1CK0H 2J8HA 4PJBB 2QPUA 2XA3A 5HPOA 1ERNA 1AVAA 1DTUA 1KDIA 5I75C 4FFVC 1LNUA 5L9DH 2Y7OA 1K9TA 1F8TH 4P5TA 2HJLA 1I85A 1BBDL 4MB5A 4QXTA 1UT1A 2Q3ZA 2XTLA 4LSPH 2AK4B 2VGLM 4YL4A 3DSNB 1JYXA 4P48A 1QAWA 1HT6A 2BK8A 1JFQL 1FFNA 1TPXB 3SKNB 3UTZB 2F7RA 1NCUA 1UZ8A 1JGDA 4LSRH 3UJTH 1EJOL 5EA0L 3FUMA 4NN6C 1DEDA 3EO9L