1R17A

Crystal structure analysis of s.epidermidis adhesin sdrg binding to fibrinogen (adhesin-ligand complex)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
321
Chain Sequence
GSNVNHLIKVTDQSITEGYDDSDGIIKAHDAENLIYDVTFEVDDKVKSGDTMTVNIDKNTVPSDLTDSFAIPKIKDNSGEIIATGTYDNTNKQITYTFTDYVDKYENIKAHLKLTSYIDKSKVPNNNTKLDVEYKTALSSVNKTITVEYQKPNENRTANLQSMFTNIDTKNHTVEQTIYINPLRYSAKETNVNISGNGDEGSTIIDDSTIIKVYKVGDNQNLPDSNRIYDYSEYEDVTNDDYAQLGNNNDVNINFGNIDSPYIIKVISKYDPNKDDYTTIQQTVTMQTTINEYTGEFRTASYDNTIAFSTSSGQGQGDLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords fibrinogen-binding protein SdrG
publication title A "dock, lock and latch" Structural Model for a Staphylococcal Adhesin Binding to Fibrinogen
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 83
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A02
3IRPX 5CFAA 4JDZB 3AU0A 3V10A 2VR3A 5IHWA 4LE8A 4LEEA 4F1ZA 2Y7LA 4JE0A 1N67A 1R19A 2Y7MA 2Z1PA 4LEBA 2Y7OA 2F68X 3AT0A 4MBRA 4F24A 3ASWA 1R17A 3IS1X 4Q6KA 4F20A 4BBWA 2Y7NA 2F6AA 4JDZA 4B60A 3IRZA 4F27A 5CF3A 2RALA 2YLHA 4FJ6A 3IS0X 4MBOA 4B5ZA 4RMBA
chains in the Genus database with same CATH superfamily
1PS3A 1H6FA 4X6DF 1SVZA 4WF7A 2IPTH 2G3XA 4WWID 1JPST 2XIIA 1MRDH 4Z77B 2AJUL 1FNGB 3L2LA 4MB1A 4NKMA 1MHCB 3UZVA 1NICA 1JGUH 3ZKMD 5IR1B 1EGJA 3AM8A 1RIHL 4Y5VA 3UTSE 4WGWB 2BDNL 1X7QB 4OZ4A 4PQXA 3U79A 3TBVB 2NY7L 5KVFE 4HUKB 4YK4C 1BVLB 4U1IB 4CJ0A 1OPGH 2NZ9C 2P80A 2VLRD 4N9GA 3DUHA 3SYPA 3RVWD 4D8PA 5TGBB 2X87A 1I9JL 2W9DL 3B9AA 3KLHC 3BT2H 4J2XA 1JPTL 2KYIA 3VI3A 1CZ8L 5JIDA 1OTUD 1IC5L 3CIQA 3CZLA 3G9VA 4JJ5A 4KK9C 3Q2CA 4S1RH 2AK4E 4KTDL 9PCYA 5D7JC 5ALBL 1A3RL 1J18A 1AP2A 1K3IA 4FNLH 3X1EA 3MLRH 1BQ5A 1KBPA 5LAXB 4IM8A 3VWJC 1REIA 1WYJA 5C0CB 5FPIA 2QQKH 4JFTA 2ICWA 4OBRA 3Q13A 3GBEA 5D1ZA 2CAKA 3MO1A 3L3IA 3EDJA 2GEQA 2RGSA 3TN0C 1LD9B 1YN6B 3CLEL 1SLVA 4LF3A 1YJDC 4KKCD 4X6BB 3QUXA 2CLZA 4P23D 4LLVA 2R7EB 4TLUA 2AK1H 4G1EB 2PYEA 1THCA 3I9GH 4RRPG 3VYOA 4OCRL 4CADA 7CGTA 5SWSB 1QW9A 4DN4L 4KNUA 4KKQA 5E8OA 3RE0A 3SDDC 3PL6B 3WJJC 3LS5H 4G1MA 2AQSA 2XTJB 4GMTH 3J2PA 2CCVA 2ZKXA 4P5TC 4GRWH 1FGNL 2ZWYA 5I0VA 1G7MB 5DHXB 1WLHA 5I1LB 2DM7A 3F85A 5LNDA 1SXBA 4OI7A 3LMJL 1MW1A 3OLGA 4LLMB 2IDQA 4OFDA 4HVBA 1KC5L 4BXSV 3K0WA 4F15C 4IRZH 2EDFA 2QGEA 4AE0A 4LOVA 1JF6A 1V27A 4M4RB 1B6UA 1QAWA 4P57B 1UACL 4OCNC 5DURD 2J25A 5AEAA 1EZLA 1SEQL 2R0KL 3AS1A 2WQ8A 3HG4A 4ZO8A 1B3JA 1YDPB 2UY6B 1I3RB 1AIFB 3QEUB 5FA3A 3LB6D 3W9DB 1NCHA 2A83A 4Q56A 4E9QA 4NO2B 1QBMH 1I7RB 5LG6A 4F57H 3V5KB 1EEYA 4HEMA 4OD2A 3KH4A 4MX7B 3QI9C 5D96B 3U4EB 5FYKL 3FW6A 3KPSD 4F33A 2D03H 5AALA 4DKTA 1EFXA 3O4LB 4MA1C 1F4XL 5A6LA 3UFIA 4N2CA 1SJMA 1X5LA 1HQRA 4Q2ZA 4FTDA 4F20A 1UWYA 3T0EB 3CMOL 3IM1A 3L7EA 5DFTA 3WI9A 1KIQA 1TQBC 2A6IB 2BOCB 4G11A 3DO4A 3L5WA 4WU5B 4YJZL 3OKMA 3GJFK 1NL0H 1WT5A 5F72S 4F2MA 1NWPA 1WAAF 4KJQD 3OAUH 1YEKL 1FDLL 4AGNA 4K3JH 3BCFA 3CU7A 3LKPB 3OJDA 4Y2DD 2ZX6A 1GS8A 3Q1SL 4G70B 4IMKC 2QSQA 3QUHA 4M02A 1U3NA 4PJHB 4XMKL 3EO0B 3DV6B 3U4BL 5CJ8A 1A2YB 2EDLA 1KGXA 1KTCA 3A0OA 4FI7A 4ORGB 5LBGA 4NZ8A 5EORL 3MGOA 4F37K 1T83A 5KUMA 1KTKE 2AQQA 3TM6A 4AL8L 1DSWA 4PRNB 5IKCB 5IOKA 3OBAA 3TBTB 2Q76B 4N2FA 1UJTA 1J8HD 2DQCH 1DJHA 2FE0A 2X6CA 4G8GA 3ULSB 3B5HA 3PS6A 4GAYA 3SE9L 2CIKB 2VXVH 1I8IB 3KPLA 4WW1A 5I6PA 2H4EA 1RU9H 2HFEA 4YSAA 2AXGB 1BQHG 1E42A 3UJJL 4I0PA 1RZFH 1MF2L 2MPVA 3CDYA 2EICA 2YN3A 3C2SA 5I18L 4ZUWA 4UNIA 1U2HA 1ZSHA 4APQA 3TJHD 4AYEC 4IDLA 4X5XB 2NZ9D 1RJZA 3QC6X 1O7VA 3T2OA 5CCJA 3RWJB 1RL1A 3MHZA 3NFNA 4OZFH 4AYFB 3KLHD 1RJYA 4KQ4L 1UADC 4DSYA 3PWNA 4LOUC 4H0LC 4KK9D 3GLAA 3GSQB 3M86A 3BP5B 5D7JD 2XVGA 5K69A 3NZSA 1QUPA 3EUUA 3HR6A 2IH3B 5EO1A 1RZKC 1X5GA 3VWJD 5CEZL 2C9PA 1HKLL 5DI8B 5JR1H 4U1JA 5F9OL 2B2XL 2X0UA 1W72A 3TEZA 3SE3C 2FBJL 4QXTB 4FA6A 3TN0D 4HUNB 3UTZA 3UG4A 3KPRE 2NDGA 3ISRA 2CJUH 4Y1AD 3L3JB 2HTKC 1Q9KA 1KFAL 2CBTA 5ICUA 4FKEA 4QJ5B 3EF7A 1U95A 1JZ8A 3WTTA 1AQKH 4LLQB 3RWEB 3FOMB 4N1EA 2AQRA 5MENE 1D5MA 2CE6A 3V0VB 3N5AA 5B1BB 1OP3H 3ML8A 1CU4L 2WO4A 4WO0A 1I1YB 3IK2A 4PRBB 1L0XA 4NPYB 1EBPA 2NNRA 1J5DA 1JGDA 4MJIA 2XQYA 1FG2A 1JWMA 3MODL 1PCXA 5F7EH 3ZL4L 3GSVB 2HG0A 3QAZC 1FFNB 1LK2A 2GJ6D 3HTLX 3RVXC 4DP7X 4X4KA 4GRLA 2R4SL 2XN0A 4N0YH 4JO3L 4L3CA 1PIFA 4M62L 4PJ6A 4E0RB 1CD9B 3EYVB 3A3YB 4FX5A 1NCAH 1RUKL 4HAGA 4AENB 4WUUA 5DSCB 3QAQA 5DJXB 4K3EL 4TUJB 4ZO7A 1ERNA 5CJQH 1SYSB 2CSPA 4RMRA 2A77L 2KUTA 2Q7YA 4HUWB 1KEML 1NSNL 3GXDA 5D8JL 3FTYA 3VB9A 4XNQB 1W8NA 1OE3A 1U8LB 2WCPA 2GAZB 2ZXCA 4H25A 1YMHB 5EC1B 5I1IH 1E3XA 3QI9D 1TVBB 4UM9A 5EV7A 1S2EA 4ALAC 1MFAH 3FB7B 4JDTL 3OB0K 1G1CA 1YCSA 3OKDA 2X4RA 3G08B 2VLJE 3H9SD 5BZZA 2LHAA 4O2FB 4XP1L 2FBRA 2ZOOA 3G5ZA 5GSRB 3Q44A 3MBEA 4WWPA 1F86A 4A2EA 3GC3A 4Y9GA 1RJLB 1K9TA 5BRZB 3PWLB 4HGWB 1AO7B 4O2CA 1NIFA 4BKSC 2ZKWA 5C0NC 2KDYA 3AT8A 3RWDA 2R1YB 5DQ9B 3ZDYF 3EFDL 3MRCA 5IW1A 3P3TA 1L3WA 3IU4L 1EK3A 1P6FA 3VD3A 5FW6A 4J6RL 5IBUB 3ZTNL 1MVYA 4HQQL 3V0AC 1JOIA 1WZ1L 4AQ1B 1KN4H 1AZUA 4W6XB 2LTQC 3FU8A 5IT2H 4Q97A 4TF4A 1BLIA 1WISA 1ACXA 5CD3B 4OH2A 3TWYA 1UZ8B 4JDVB 1D6EA 1THAA 4OSUH 3ARQA 3DYMA 1PZ2A 4MASA 4JG1H 3UTTA 2Z8WC 5T1JA 2HFTA 4QY8B 1DBJL 4A6YB 4Q6YA 2VN3A 1J7VR 4MMZA 1S7UB 4OB5H 4JAMB 3KH3A 1A4AA 2YMTA 4QT5A 4GO9A 4D9LL 3AUWB 1DJGA 3BQUC 2WQWA 1OQOA 4YXKL 4LDLB 5HYFA 1EJ6A 5E99H 3FTXA 3DHUA 5G4MA 1OEZW 3QUMB 3HN5A 1AXSB 1BMGA 2A9ML 3KPNB 3D09A 3LN9A 4G6FB 4NIKB 5DEZA 3NIGF 4D7PA 3UEZA 4LOUD 4ZXBA 2OAAA 3EBAA 1A8JH 2JB5H 2QL1A 4JRYB 2GIMA 5GRJL 2DQDL 2WLMA 1HESA 3ZSSA 4OZIE 4OFVA 3ZE2F 2R8SL 3IDMA 5JIKA 1TMQA 1RZIB 3D85A 1KBGL 4Q6IB 5JDSA 1GW0A 3BAEH 2WKOA 4M43L 1BQLL 1VERA 1N3NB 2BIIA 3SGKA 2VWEE 3MRRA 3WD5L 1CE6B 4F8LA 1YY9C 4JCWA 4M6AA 3ELQA 1OAJA 3AT0A 4BK8A 5GJSL 1HTYA 1MREL 1AS7A 4UQBA 2HTKD 2YOCA 4AITA 2MH4A 3WFDH 5I1KL 2P5ED 1P7KA 5LGYA 2WXJA 1MVUB 3W39B 4WHYG 2UYLA 4S2SB 4NQVA 1MY5A 1T03H 3ARGC 2UXGA 4CGTA 2IDUA 3AUVA 3RTLA 1UGNA 1BCIA 3HE7A 3NT0A 4I9XA 2WHVA 3V4PB 2NY2B 5IIEA 4NIYE 5IW6B 4MAYC 4MAUH 4MSWB 2CDEA 3B7YA 5F93C 4WFFD 2WZAA 3FQ2A 5DJCA 5EU6D 1N19A 1TTGA 2W0LA 3EJYD 2MNWA 3IBOA 3MOBH 4M03A 3EKCA 3BI9X 4KQ0A 1K5WA 4L23A 3MNVA 4D2NA 3T2LA 2CHXA 3TO4C 1PD1A 4M5YL 4J3OG 4D9RE 2YD2A 2XZCH 2HVBA 2QHLA 3OR7B 2YS4A 2CRYA 1HNFA 3A4EA 4UV7H 3R0NA 3ZIMA 1SDDB 1T22A 3QPXL 2IMNA 5L0QC 3N0AA 4XHQA 5JHDD 2NNAA 4AEFA 2ZP0T 3QDMA 5D71H 3VSTA 1QVOB 5C7XH 2FJGB 4FLHA 4ONOA 4G7VL 4BZ1L 2ADGA 3U2SB 2GPZA 2IDSA 5KSVA 2VDPL 2FAUA 2XQBH 4Q14A 5DVOA 5IOPA 5CGYD 3U7WH 1J0YA 1NINA 1RUPL 3IJEA 3FCSB 4LMQI 5IQMA 1WFIA 3HR5B 5AKRA 3F7QA 2GTQA 1GSMA 2ROXA 3KG5A 3RY6A 4XB7A 1SYVA 2A6DB 1GHFL 2C9QA 2A6JA 5DO2C 5F8RC 1QATA 2WTRA 1DJYA 2L0DA 2ZOLA 3LZNA 4HC1L 4PLOB 3CPUA 3H9HB 3B8YA 4TULH 3QDJD 4UQ9A 5I82A 4BUQA 3IMSA 2HT4D 1QTPA 3UABA 2X12A 2GJRA 1UURA 4P59L 2XWJA 3QO0B 2R1WB 3BH8B 4G6ML 5I1DB 5JIHA 5C0ND 4WSGA 4OQTL 1HZKA 3AY4A 5H2BB 4J3VA 1YQVL 3QIWA 4HT1H 2HH0L 3VFNA 4P04A 4YPGA 1L9PA 1HVXA 3PP3H 4N2AA 1J0ZA 1E4WH 3FO1A 4RGOL 43C9B 2GSIB 1SY6L 4BH8A 4BZ1A 4PVMA 2KH2B 4E9WA 5DC9B 1UD2A 1NUFA 5I8CB 1S9VB 5A6MA 4WI6A 2EDHA 4UQIM 3FONB 3I75B 1QFWH 4AEEA 4PGDA 3GT6A 4KX8A 3ES6A 2YD6A 3LS4L 3ZHKA 3OV6A 2EJ1A 4JFXB 4LCWA 1G9NL 5IB5A 1NFDB 2O4EA 1BGXL 1OZTG 3FOLB 4QWWC 4B9YA 3L4UA 2FTAA 2NSMA 1ZLWK 4CN1A 3F7VB 5JIMA 4G83A 1CL7L 1JZGA 5DMJB 1K5NB 3AQXA 3ZUCA 1HL9A 3V5HA 5IEHA 1D9KD 3HPLB 1AY1H 3B4NA 3BQUD 5T1LB 5H35B 3EFOB 4WGVB 1BG9A 4XMWA 2XC8A 2G5BB 4MCMA 3SB3A 1IGYB 3SGDI 3H0TB 4UUJB 1ONQB 3Q05A 2DD8L 2IBZX 1KXTB 4XVSH 4N8VA 3RGVC 3GZPA 3MRLA 5HHOB 4F7PB 2IGLA 3TCLB 2VLKD 3LXBA 3OAZK 2MHAB 1JNJA 4K55A 3MYZA 1OSEA 4N5UA 3EFFB 3E7JA 2DBJA 4N0UE 4LT7A 4FNSA 2Q7NA 3BGAA 3TNNA 4IU3B 3K2IA 1T1YB 4FZEH 2J55A 3MVSA 2PPAA 4I1NB 2OJZL 5JO5A 1TQUA 1YY9D 4HWBL 5FYLD 4KUCD 4JJOA 2AITA 3NGBB 3C5SA 3MYJA 5D55A 1KIUA 1RULL 2WBJD 2ZUXA 3VXUD 3ZTJG 5AVVB 5IJVB 4Z23A 4H1LA 1HE7A 2F19H 3IJSA 3VQLA 2BSDA 2HJLA 2BVOB 5DEFA 3OXSB 4YPJA 2R0LL 4Y4FC 3ARGD 4PR5B 5EBMA 4N2IA 4XR8C 4GG6B 2VIRA 2N7BA 4GS7B 4BK4A 1AHWA 3DUUA 1WBYA 1A66A 3MRHA 3HCVB 1CBVL 2OX5A 4FFZA 2DEXX 3BAIA 1IE4A 1PGRB 1W9XA 3V7AE 3O6KL 5DR5L 2BHYA 5CEXB 1T2QL 4AG4H 1BQHB 1XIWB 2SODB 4LDEB 5EG6C 1HDMB 5KYWA 3LPWA 4HG4K 1G9MC 1KB9J 4MD4B 2H8PA 4Q6KA 3BUYA 1M7DA 4N0CC 3TO4D 2VMEA 4YDJA 2XPYA 5CP3H 1XWVA 4GP8B 1WZKA 1JGLH 1CGYA 3N40P 5K9KA 3BEWA 1NDGA 5SWZA 3S35L 3BHBB 5D7EA 4R7NB 3Q9PA 1E6JH 4RFOH 4HWBA 1HXYA 1OAUH 2ED7A 3EGDA 1X5XA 1OGSA 5G4OA 1PQZB 3WUWG 1N70A 4JY6A 3TF4A 4NM4L 4JZOA 3MA7B 4NNXA 1OP9A 3Q3GB 4WEUD 1P5UC 1VF5C 5L7XL 4YXHL 2UZIL 5GIRB 1D6VL 4LLWB 1DVUA 3OZKA 3CTTA 3ZSTA 5L4FA 3DX7B 2DQGL 4GQPH 4OZGA 1E2WA 1E4JA 1R0AL 1G0YR 3KJ4C 4AX3A 2P5WE 3NEEA 4JPWL 1OTTC 1TZGL 3RIFF 4ESKA 3SDXE 4ZX3A 4U6VH 2NTFA 1CMOA 4PJ5E 1HL8A 4RISL 5HDRA 3WU1A 1KLUA 3CN4A 2X3CA 2ZOTA 1MQ8A 1A6WL 4MQSB 35C8L 4Y1SA 1FBIH 1F6FB 3IFOB 3JTSB 3HE6A 1V54B 1ZT1A 1MI5D 4K5OA 4YN3A 1HILB 1OP5H 3RBSA 5GHWL 4RDBA 4BFBD 4Q4IA 3WFHA 1XV8A 5FM8A 3VXTA 3GSXB 3U0PA 4P2RE 2OMNA 1E50A 1AYOA 2H9GB 4NQQA 1J8RA 1T21A 4QRBA 1AQDA 4N6RA 4LPYA 5DJYB 3NIDF 1AR2A 1LJMA 1S7TB 2CXGA 3Q43A 4BE5A 2C3VA 4U7KA 3L54A 3AU1A 3GXNA 2CO7A 3Q6GH 1UXWB 3VXSA 4WK2B 3NIFE 3S96B 2AVFA 2NY4B 3DSFH 3ATAA 4GRWF 4IHOB 5ERWA 4QWWD 2UZYB 1Q9LB 3QQNA 2Z7UA 1PZ3A 3LNGA 3PABA 5CGTA 3SBQA 1L9QA 5LNGA 4OVUA 3PGFL 1TQSA 2WZ5A 4Z7IA 1PLCA 3ASOB 4UOW0 2IPUK 4OCXL 4XCCL 1PTZA 4OLZH 1E9OA 2ESVD 4P49A 1P7QD 1RP8A 3IMBA 2Z8SA 2J6WA 4EI6B 4ZW8A 3ZKXC 5CU5A 2P28B 4WWOA 1LE5A 1QHPA 4PJGB 1EJFA 2X2IA 1Q0XL 3QG7H 1H15B 3MREA 4PI2A 1AR1B 3HG3A 1MCKA 4QOKE 3L2MA 1BBJB 1FYTD 3RGVD 2F58H 4K5NA 4APXB 5IB1A 3TVMC 5F96H 3C6LC 1F8TL 3RHWF 3CVHB 2DL2A 2DMCA 3FTZA 3BFWA 2LAGB 7PCYA 3NSCA 3QDGE 1TJGH 4ODSH 3D30A 1ASPA 4B41A 5I5JA 1A5FL 3GWJA 3W82A 3KDMB 1V3KA 3EH2A 1RP9A 4K23L 4PJIB 1R3KB 5EC2B 3MRFA 5I17B 1LO3H 1MCIA 2RFXA 4KNQA 3VI4F 3FT2A 5DFWH 5FKPB 3FFCE 3ROOA 3SBWC 3T9WA 4X4YB 3RPKA 4KDWA 4MDIB 4CVXB 4Q89A 3KGRA 4ZYKB 1FV1B 4B3EA 1LDSA 4YFEA 4B5EA 1MKFA 3L3GB 3AM8C 4JR9L 2CU9A 4U33A 1JRHL 3JTTA 4X99B 4Y5VC 2CRIA 3Q48A 5DT1H 1DJXA 3UDWA 1EA9C 1M7IB 4PJAE 3OVUB 2XA8H 3PWJB 4PRHE 5JQ6L 1KB3A 1XH1A 1Z7JA 4MJ6A 1DUZB 5T3ZD 3MTXA 4YHIA 2F53A 4R4FL 2KDGA 2IQAB 4PU2A 5HGHA 1NWOA 4N0CD 4QLWA 2JKTM 2ORBH 4YHZL 5E8EA 4EUPA 2X4UA 2DL9A 5F7AA 4LDOB 4L8DA 3U9UA 3QZNA 4RFEB 2NY1C 2FO1A 4ZPVA 3LNHA 1NCGA 4H40A 1FFRA 3UAAA 1ND0A 3UMTA 3VFPA 1JTOA 3BLKA 3OHXA 4WJG3 4LP5A 2VDOL 4LOFA 3JT0A 4DP8X 3B7TA 5D1ZC 5F7BA 3RYMA 3BAWA 5D7HA 4M93B 1OAYL 2H6UA 4N20A 3SDAA 3A6BL 2PCFB 2ZX7A 3FT4B 5EMYA 1QRND 2OZ4L 4OD3H 4OLUH 2V5TA 3F04A 5DD6A 2FBOJ 1M7XA 3QUXC 4W6WB 3B56A 4L2YA 2XNAA 1GAFH 4GIOA 1QI4A 5D1XB 4RIRB 1MUJA 4M6NH 3MXWL 2XWBB 2QVMA 5D2LB 1R5WA 3CVBA 3VA6A 5KBLA 3QUYA 3UBXA 4ZNEE 4Z1PA 3K7UA 3LPFA 1JNLH 2E6JA 4FXGA 4GUPA 2E7CA 1OTTD 4JM2D 4OKVB 4U3XA 1BD2A 3AG2B 1OGAA 3IPBA 3EYUL 1X7SA 3RL2B 2DOCA 4KTYA 5M94B 3DJ9A 2O5XH 3DIFB 3PF2A 4UWQB 1PZUB 1YEJL 3I6KB 4Y9FA 1I1AA 4NFBA 2C3GA 3UADA 3ZL1A 4ZQKB 4NPKA 4YL4A 4XNMB 4MZRA 4ZX5A 8FABA 3ARSA 1A4KA 4HJ1A 5DK2A 3BFOA 5TFSH 2GCYB 2ETWA 3BXNA 3FO9A 4JFFB 4YHKL 2JMRA 1SMAA 4AQOA 1UZ6E 1ECZA 4LRNL 3WKNA 2V7HB 2DJMA 1PZ5A 1E3ZA 1XD1A 5I26A 1FAIH 5L2KB 4P5RA 4DKEL 4UI2A 1R47A 2D0FA 4HWUA 4ODHH 4BUHA 1RFDH 2VC2L 2Z7YA 2JK5A 5BUGA 5J9PA 1NM4A 2KLSA 1BZEA 3J27A 4BQ9A 2QMJA 3TV3H 4PJCF 4F80A 4J3SA 4PHZA 3CGTA 2YPVH 5KYNA 3FMGH 1A14L 3F7YB 4LKCA 4XZUA 5B7EA 3O6LH 1KGJA 5ICYA 3PP4H 2BNQE 4LVHB 4M5TA 1E6OL 1GH7A 5C6PB 3KPOA 1PCSA 3LZFH 2MQGA 1J48A 4JLRA 5E6RB 3EJPA 2GTWA 1AGEB 4YHNB 3MJWA 5DA4A 2PWHA 5FO2A 1GMEA 1FO0B 4LIQH 4R8WH 1UD4A 3BO8B 4DESA 2H32B 2F5BH 3EZJB 1FLRH 1JPFB 1SMOA 2F1BA 4HIEA 1WT5C 1AACA 3NAAH 4JPIA 2AI0L 3C6LD 1F3JB 4PJEB 4UV4H 4XCYB 5D4HA 1K8IA 2HX7A 2VZ1A 2EYTA 1IBBA 2DMBA 3H4HA 5ILTH 3IS1X 5J89A 4YZWA 3Q2WA 2E6QA 4IYKA 2YD1A 2FNBA 1HE8A 4EVNA 3E3QE 1M42A 3DV4A 4WNQA 1NAMA 2PP9A 1WP6A 4RMWA 1DZBA 1T83C 4QTIL 2XCMC 5I8KH 3DDGA 2YD7A 2YGOA 3RNKB 2IPUG 2DM3A 1BFOB 4K3DH 3MUGB 2WY3B 2XV0A 4M1GH 5ANMB 3RQ3A 1I9RH 4EI5A 4YFLF 1HIML 4C56E 1CTNA 3MLSL 2NXZC 3ZDZE 4I0PC 4BFIB 3MV7A 4TXVB 2JELL 3C09B 4DN3L 1RXLA 4TV3A 3ME0A 4APQC 3ZKSD 4QHNB 2OTPA 1HWHB 2H3NA 3QULB 3BPNB 2A74B 3CSYA 4S1SH 2EXYC 1ICTA 2P80D 3EGXB 5FO9A 5DS1A 3VGGA 5IV2B 5LWYH 1I7TB 4AQEA 2QDVA 3HLAB 4PWGA 4TTDC 1ID5I 1F90H 3KCPA 3ECQA 2Z31A 2CMRH 4MXWH 2V3EA 5GGRY 4S0HA 4UANA 3SO5A 1U8IB 1ZJAA 2XN9D 4NM8H 1RK1A 1JZDC 4E9XA 1MNUL 2ADJB 2X7LB 3VMPA 4A66A 1IGFL 3J8F7 3BAYA 2K7PA 4JFOB 4AEHL 1AI1L 5D1ZD 4ZTPL 1RURL 4JHVA 3GNMH 3STZB 1ZHNA 5I8EA 1KTJA 1RMFH 3L5IA 2AJ3B 3UTSB 1RUQL 4P3WA 4EIGB 3QUXD 1KJMA 2XXFA 1ZLUK 2WINA 4HPOL 2K6ZA 4MD0B 1S9WB 3KPQA 1L7IL 3BAXA 5HHXH 5A40E 1FL6B 1WWCA 5T5FL 4HHAA 1K85A 5KSUA 5C0GA 3A6CH 5FFLA 1C16B 4LRIA 1A9BB 5L8JB 3P73B 3VRLF 5CZRA 2VDLB 4BZ2H 3VNZA 2AK4B 4FQCL 1ITBB 1XH3A 2IG2L 2ENPA 3QA3B 3JZYA 4OIAA 4R4BB 4UDTA 2Q6WB 4LGPB 3LN4B 3GHBH 4CJ1A 3C5ZA 5HVHC 1LHZA 1FH5H 2VLME 3KBEA 5AVQB 2ROYA 5FUCE 3PHAA 1CXEA 1E8ZA 1ZSDA 3VXMA 1S7QB 1NDTA 2GHWB 1IAII 2ARJA 5DMIH 2WN2A 5J7CC 3CXDL 4GRLC 1U0QA 4P5KA 3DBXA 3QJOA 3GMQA 2WWKT 1FPTL 3DO7A 2BRQA 5JQHC 2Y7MA 1HXMB 2XG5B 3TO2A 4KTDH 5ALBH 1LWHA 3DBSA 3I84A 1GOHA 2VXTL 3KWXA 3PG2A 4P05A 4XI5C 3WUZA 4ISVB 4TNWF 2HWZH 2V9RA 4IRJA 4G8EB 1WBZA 2GBAA 3BZFB 2GSGB 3ZLQC 4HZLB 4BSWB 4I89A 4PJ9A 4NJ9H 5JYLA 4XH2A 1NGPH 1XHHA 1QD0A 2YLHA 5EBGA 4PVBA 2LVEA 3GHEH 1LLAA 5E2VL 4L8BB 4HIXH 2QMKA 4L1HA 4OF0A 3P0GB 1EO5A 5MI0C 4DKAA 1JYXA 4LSSL 4Z7WA 4YUEH 1CFTA 2QHRH 1SEBA 3IKCA 3OMNB 2O30A 5B3NA 2I07B 1W2KT 4BH7A 5C0JA 2HRLA 1HINL 1R33A 1TJIL 5DQJA 2CA4A 2OCJA 5KBNC 1R5IA 1EFXD 4WTXA 1MHEB 3L6FA 3BE1H 5HDBF 2F7RA 3QFDB 4G9FE 2J71A 3T0XA 1F4WH 1JZ2A 1MLBB 4PB0L 3RFRA 4X6CE 4HFWA 5I1AB 3F12B 4YDZA 4OBSA 1UCBH 5AVRB 4M61B 3MBEC 4NI3A 2J56A 1XD0A 2WXFA 3AS0A 4HDIB 4YHLL 3T3MF 2AXFA 5MHSD 2CKBA 2D3LA 4JKPL 3GQFA 1FVDB 1WIPA 3FYEB 4NOFA 1X5MA 1RZ7H 1XF5B 4WEMB 4UU9B 3NP4A 4Z5RA 3QJVB 3QWQB 4LCCA 3SKUD 1DQDL 3HB3D 4TQPA 3H3PH 3N9GH 3RZCA 2BSCA 4NQDD 1UWEL 1E7VA 1AGFB 1RSFA 2VDRH 5D7IB 3VQ2C 4NHCL 5D7LE 4R97B 3WLBB 1HJBC 3GZOA 1IGML 1Q8MA 3MRBA 3JV6B 3MCG1 1ORQB 3BUBA 4F7EA 3H6JA 2NXYC 1EHNA 4PJDE 1J9CT 2WXHA 3FUNA 2A9NL 2B59A 4G8GD 1JZ7A 4KXCA 4CBPA 2GT9A 3V79C 3DJTA 4IOIB 3WY1A 2BY1A 2NXZD 4MMZC 4H5SB 4ZTOL 1AKJB 3MROB 3FXIC 4I1RA 2O6PA 3FC8A 2DQHH 1BOGA 5AUMA 3QR1A 4OGXL 5INCB 4HPYH 3A24A 4DT2A 4APQD 1JCKA 2IGFH 2VSKB 4OU3A 4DCQA 5IHBA 1KN2L 2EXYD 3DRQB 3ILPA 3O8XA 4JRXE 3T1FA 4ZXBC 1SJEA 3QRGH 3HW7A 4RVBA 1CI5A 1NUNB 1VZHA 2PWGA 4KY2A 2J57A 2HP4A 2J1ZA 5KSAA 1KBBA 4QCIA 5DFAA 3IBEA 2LT9A 2JH2A 1UENA 2IALB 3NFPA 5FUZH 3VFTA 3WS3A 1LDPL 5HYEA 5AW3B 1DL7L 1M3IA 2A7BA 1ADQH 1E30A 3QUKA 2B1HH 3E2HB 4M9OA 4UT6L 3TPUA 2EDDA 3SGKC 5MERA 4QRSB 3C9NA 5EORH 1JHKL 5C08D 4MLIA 3KYKL 1MCQA 5FYJH 3OKOB 1HEJC 4AL8H 5IFJA 4WFHE 5KG9A 4KROC 4BSJA 3RUGA 1K4DB 3CFJA 1AQ8A 2F5AL 2XWTA 3HS0B 5E5RB 1P9MA 4HWZA 3SE9H 2AJSL 4KKNA 1YUHA 2Y36L 2P45B 4L18A 4BM7A 4EIUA 2OL3A 1CLOH 3QRLA 1KEGL 4XP9H 2PR4H 3UJJH 4OJAA 3HE7C 1U41A 1VGKB 1ACYL 2ODHA 4MJID 3VTTA 3DOIA 5KJRH 1R9FA 3FB6A 2X4QA 2EVFA 4RETB 1I8UA 1I75A 3F3HA 3CQFA 4FLOA 2Y5EA 5AW0B 4TKWA 4YDNA 5GS1A 4GRLD 3KYAA 2HVJB 2YPLB 1EZVY 2J44A 4AH2A 4NO5B 3AT9A 5FYJE 3KPRB 1AQMA 5BMFH 2VGLM 1CICB 3VFGL 3EDFA 4IKIA 3IDGB 4XI5D 3SN6N 5CBEB 3Q1EA 4ZK8A 1KCLA 5CEZH 1NCJA 1HKLH 2CO1A 5C86A 3ULUF 1SN5A 3O11A 4GSXA 5LGHL 5KS9A 2B0SL 5MENB 1F11B 2VXUH 4G6AD 1TVHA 3T6XA 3UX9B 1W0WA 2HSIA 3IDUA 5KSBA 4JHAL 1Z3RA 1B4RA 1KTRL 3L1GA 4H8WL 4M5ZL 5AWNL 4X0KB 2WQUA 1Z6JT 1MEXH 2WNKA 1TZIB 4Y7OC 5EBLB 2J4WH 4G6JL 1FQ9C 5I1HH 3MV8D 5CKGA 5C0AE 3S36L 1KFAH 2N7SA 4MKMA 4FERA 4UM9D 2AXWA 3RY6C 5IWLC 1DR9A 1A21A 2WLJA 2WYZA 1KT2B 4XE5B 1B6DA 4ZODA 1SM3H 4W9DC 4A7GF 1CG9B 3X1NA 2LQRA 3DMMB 3M46A 1DQKA 1FNGA 3QFJB 1MHCA 4UT9A 4FTVB 2PXYD 4JG5A 1DSFL 5IR1A 3MBED 5CEZE 3MODH 3VXRE 4E9LA 1UEYA 1IAMA 3HA0A 1X7QA 3S37L 3UTQB 4ADJA 1IGCL 3TBVA 1ML0A 4V2CB 2R4SH 2A38A 1E5BA 2IXQB 4JMXA 2ZG2A 3SDDB 1J05A 3AY4C 4LQFH 4I5BB 5TGBA 1J88A 2N56A 3QIWC 4XN1A 2ZNXA 1F97A 4XNXL 1BOYA 5C1MB 3Q5YA 2LAAA 1A6UL 4V33A 1V3MA 3VXNB 2EQDA 4PJFF 1IT9L 1Z9LA 5KVGL 3HLKA 1P1ZB 5LAXA 1FC2D 3V0FA 2FYYB 1VHPA 5PCYA 5C0CA 1KEMH 1NSNH 3H8NA 5D8JH 2Z0UA 1A6TB 1ZEAL 3QDAA 4HJGB 3CZNA 4Z7OE 2OR9L 3FB5B 5F1IA 3UTTD 1LD9A 1YN6A 3SE4A 2WLNA 4BSVB 7FABL 5T3XD 2A6KA 3P9LB 4X6BA 5EU5A 1C5CL 2B3IA 4WI8A 2R7EA 3SCMB 4F24A 4G1EA 1NAKL 1MRCH 2LU4A 2WCGA 3D4CA 3NJMA 4K8RL 5E70A 3RX8A 5SWSA 3PE9A 4P4KA 2EE2A 4AYMC 4FD0A 3PL6A 2ITFA 2DWYA 1L9TA 1IEAB 4HXBH 3JV5A 5IG7B 1G7MA 4KX7A 1NMAL 4NS0A 1TZHB 2IOIA 3TLRA 4KVCH 1TEGA 1UD3A 4LPUA 3EFDH 1ODAA 5H37G 4DETA 2QKSA 3JV0A 2RCSL 3D85D 4GSUA 4J6RH 2ITEA 4QNPF 1MFNA 1NBCA 1UKSA 4GQ9H 1TO5A 4M4RA 1JNHB 2FWOA 3BVNB 3V4UL 4P57A 4LNVA 3ARBD 2I9LB 4XP6H 2EUVA 5I71C 5D9SB 3PJLA 4GW4A 1Z2KA 1CIDA 1YDPA 4KROD 3TASA 2UY6A 3BKYL 4JGJA 1I3RA 1M05B 1AIFA 1KBWA 3QEUA 2DW5A 3W9DA 1HXKA 3MLWL 4NO2A 3V10A 4IJ3C 4C4KO 1I7RA 3UP1A 3DWTA 3V5KA 3WAKA 2DKUA 3FFOA 3HE7D 5IF0B 2JI2A 1AHWC 1TNMA 3APCA 4MX7A 5A3IC 2IH1B 3O6FD 4YXKH 8CGTA 3FQWA 4HF5L 4PWKA 1DBMH 3T6WA 3IGKA 3FHAA 1X5JA 1BYNA 3O4LA 3R06B 3M17B 4TNVK 4PV8B 2A9MH 3X3GL 1QR4A 1QNZH 4HX1B 5AG8A 1PNDA 5F1OB 2J1YA 4CDGC 4JFUA 5AZEL 2XRAL 1V7MH 1YNKL 1B0GA 1PG7L 2A6IA 2BOCA 2CJTA 5F6IB 3D3VA 2GITB 4HU2A 2R8SH 1OAXL 5KTEH 4ZS6D 4E42B 1UOVA 1VZGA 4GMSL 4ZRGA 4HXAL 1P4BL 3WIHA 4K7PL 4BBWA 2EIDA 4M43H 3S2AA 1FRGH 3G5WA 3LKPA 2E6PA 2QZ5A 2FQGA 2G4EA 4PJHA 3EO0A 3DV6A 2ZWZA 3X11B 4B53A 1A7PH 1A2YA 1JE6A 2HJKB 3CN0A 3L16A 4ORGA 4PIRF 4YR6B 3G5VB 4KY1H 5KVEH 1WUZA 5C6TH 4YHYC 3Q8BA 4QUOA 3RRQA 5IFHL 4PRNA 1O5PA 3CPLB 1EXHA 1U8PA 5IKCA 3TBTA 2ZXAA 3PDOB 1KGWA 2CGRH 1AXTL 3CN1A 2Q76A 3RI5K 3P4MB 5B38B 5D7KD 3ULSA 3JVFC 1KB5H 2CIKA 2O5ZL 2C9VA 2MEJB 4UNVA 1G7PB 3LZOA 1ZLWH 3MV9B 3V4LA 3OSVA 3PQYB 1KMGA 2AXGA 2VJ0A 4DGWC 2Q2LA 1JJUA 5E9AA 1C7SA 1C5BH 3ABGA 4I3SH 2XETA 4POUB 4LVOB 1DANU 4KTEL 1SHMA 4KI1A 3JSSA 4JGMA 5DEGB 4JO5A 4X5XA 4ANUA 1D5RA 1F4HA 4KUZL 4MQ7B 3HE6C 1XGYL 3RWJA 3QIWD 4AYFA 1WA1X 5KVEE 3ALPA 4HJJL 2MFNA 4MZ2A 3GSQA 3BP5A 2E9BA 1QHQA 4HIJA 1XCXA 5HSFA 1QUNB 2NY5L 3BWAB 2FDBP 2IH3A 2UVEA 1O7DE 5DI8A 3I2CH 5EU7E 4TVSa 5BV7L 2ZONA 5D2NE 2FL5B 3BWUF 3K2UL 5ACLA 4LCWD 3EO9H 3ZZQA 4DK6A 3KYOB 5TPWH 4FABH 3NH7H 1WK0A 1FNEB 4IBQA 2EDBA 4AVIA 3T4YB 3L3JA 3FTGB 3L4WA 1XGZA 2D31B 5EHFA 4GG6F 3IXAA 4N2KA 4LLQA 4NAJA 3FOMA 1J8HE 4HUMB 1I3GL 1GPOL 4HC1H 1RSYA 3V0VA 1AMYA 2WMPB 1IZKA 1KPRB 1CURA 1N6UA 2R15A 1I1YA 5CJOL 4PRBA 4P4RB 1K3ZA 1UWXK 1GGCL 3L4TA 4F2FA 3HI1B 4RAUB 3BJLA 3IRPX 1RY7B 1YEGL 1YJDH 3GSVA 2OXHB 1FFNA 1BEXA 4ZMQA 2EH8L 1YQVH 4OD1H 1PSKL 4DEPC 1J9RA 5FHAL 1NIAA 2HH0H 3FCBA 2I26N 2CUIA 1N0XL 5FV2A 1BQUA 3EYVA 2ATPA 4GP4B 4PBVC 1V3JA 2YPKB 1U36A 3JZ7A 4FFWD 4PRPE 4AENA 5EZPA 4DPBX 5DSCA 3PGDB 4HKJB 4TUJA 3ZYZA 1SYSA 3VD4A 3CZEA 2WWOA 5EEVA 3LS4H 3TESA 2AAVA 4HSQA 5AB0A 1ASQA 1G9NH 5HI3C 1UGKA 4FJYA 1BGXH 2QGCA 5ENWB 5JW5A 4I1PA 2LGNA 4OUOA 4XNQA 1JPGB 4KI5C 1U8LA 3ZO0A 2GAZA 2VABB 1YMHA 5M7QA 3C6SA 4Y1AE 3FB8B 5A3ID 1UFUA 3EH4B 3GO1L 2QFPA 1INQB 3L3KB 4K7FB 5E8DH 3NPSB 4U2YA 4AIOA 3DURB 3UDWC 4A6YL 4N0UB 3FB7A 5CLWA 1ZANH 2LLGA 1DVSA 2VXQL 2HVKB 3DX4A 2HCZX 3IE4A 2H5UA 3NFSH 3G08A 5F9WB 5FM4A 4LCYB 1T04B 3IGAB 1Y1UA 1FZJB 4O2FA 2KL6A 4Z3HA 5C3LD 4HCRL 3FSWA 3MRKA 5C0DB 3NMEA 2A73B 5JA8B 1T66D 2DIAA 2D7OA 1HU8A 3OZLA 3AWEA 3Q7JA 1RJLA 4AY0A 5BRZA 3PWLA 4HGWA 4KV5E 2FQEA 4KRMB 2H2PC 4EDWH 5IVXE 5LBVA 4KVNL 1DVFD 1T5XA 2XACC 3GSUB 3OHXC 5DQ9A 5C7ZA 5I0DA 2IF7A 5ITBL 5LBSL 2XQYK 1SDAB 4NGHL 4F91B 1U2YA 2MCAA 2DLGA 4OZHE 3F84A 2OJZH 3SDAC 3ZIYA 1D2OA 4N0FB 3PU7A 4PEEA 1N4XL 1RK0B 3VDBA 1C7TA 4AQ1A 1YPZE 2WD0A 3TL5A 1DSYA 4GFXA 2IH8A 2JKIS 4IBUA 3VAEA 1RZGB 3VFSB 3DOHA 3FT0A 4F3FB 3ISWA 5CD3A 4JFSA 3HIZA 4S0TD 3WSQL 1CD1B 1UZ8A 4DP6X 4JDVA 3WDIA 3TA3B 5KBPA 1QI5A 3LEYL 1JZ3A 2E4FA 4G5ZL 3QUYC 2WP3T 4PJBF 2V0AA 2FR4B 2APFA 1XXDC 3O4OB 3JWNC 4QY8A 4A6YA 4FXGC 4WO4B 1MPAH 2AVGA 1CBVH 4JAMA 1T2QH 2J21A 3IF1A 3NEXA 4FDWA 3E38A 4HJIA 3U9PH 5BXFB 1I1AC 1OE1A 1VDGA 1O75A 5DJ6B 5T33L 3HE6D 3VXMD 3SY0B 4NQTA 4QDGA 4NX0A 4EKXA 1AXSA 3KPNA 1S46A 4NBYB 2PCPB 1P5VB 4JRYA 2V9TA 1M3JA 3QQ4B 1KBKA 4MAYB 4DGYL 3VDCA 4QHPA 2WVTA 1GTNA 2FATH 3HPJB 2XN2A 3C60B 3LVEA 1MFEH 1RZIA 4P3CL 3CH1B 4R4NC 2ADYA 4HGKC 5I15L 4UT7L 3VXSD 4X8JB 2P5WB 5JDJA 3NSJA 2RMNA 5KJ4A 3SDXB 2B4CH 4AJ0A 1CE6A 3QUZD 5GZNA 2C8NA 1BBDL 1XF4A 1P4IL 1ILSA 1FNFA 2FUQA 3F64A 4XWGL 3SKJL 3L13A 1ZDSA 2CRMA 2WUBL 3O3DB 4A55A 5I0WA 2DQ6A 1MVUA 1RZKH 5PAZA 3W39A 1FZKB 5CCHE 4PVLA 4XBEL 4ZW7A 5AG9A 4S2SA 3QWNA 3X13B 4P2RB 1FCCA 3GLEA 3MUUA 4TVPL 4B95C 3RY5A 5ISZE 2Z92B 3DDFA 2HRGA 4LU5H 1INEH 4PV9B 1MCBA 1ZIAA 4MB4A 5IW6A 3L3HB 4EBQH 2DQIL 4MSWA 4TRPL 5IFAH 3FO2B 2J8UE 2DQFB 2K9FB 1X5AA 4QHKI 4XXWA 4DP2X 3NIFB 1CGWA 4B9PA 5GHWH 5CGBA 2FNWA 3NOIA 4F37F 5C09E 5I1JL 3D8MA 1MCDA 5DUPH 5FGSA 3D06A 3OR7A 2HFGH 3QYMA 2AGJL 1SDDA 1CK0L 4NHUB 1ZE3C 4BGLA 3PPSA 5JHAA 3LKRB 5TDOB 4U1SB 4Z3EA 1QVOA 2FJGA 4YZFE 5EO9B 3CN3A 3QH3B 2CK0L 2OKMA 4QRPD 2P43B 1PLBA 4FP8L 5HI3D 4PJDF 5SX4I 2CLVB 4EI5C 4QOKB 5GS0D 5HVWA 4YLCA 4KI5D 3VJ6B 3FCSA 1G1OA 3HR5A 4HAKA 2D9CA 2VLLB 3E0GA 2A6DA 1JCVA 1UB5B 3QDGB 1XDTT 3OMIB 3S5LG 1CGTA 3K4ZA 1NC2D 4DGVH 4YSTA 4TSBH 2F53D 3SSGA 5F97E 3VA2C 3II3A 1X9UA 4CSTA 2Z31C 2NR6A 4LEOA 5I16B 1YSOA 3QO0A 2JB6B 2G4GA 3FFCB 2R1WA 3BH8A 5I1DA 4WFFE 3ESOA 3UO8B 2I24N 2DIJA 4UYPA 5EU6E 3BUPA 1TZOA 1XGUB 4MQXC 4QXWA 2FLBT 3BPLB 5H2BA 5ACMA 2PWFA 4ALAH 5DHMC 3R4DA 4UTAL 1MWAH 3CZJA 1BP3B 3SDAD 1CLYH 43C9A 3CZUB 2W38A 4AGQA 3WG7B 5LGJB 3NZ8B 3Q8AA 4ZT1A 5L9DL 1JYNA 4PB9L 4NLAA 1FCGA 4PJAB 5I8CA 1S9VA 1GA2A 4PRHB 1DQVA 5LXGH 3ESNA 3OQRA 3FONA 2Q86A 3I75A 4OI8A 4LRIC 5EF3A 1N64L 2J8OA 4ODTL 4JFXA 4ECNA 3QUYD 4DKFH 1HN1A 5FCUL 2E59A 32C2B 2YMXL 3BGFB 1NFDA 3PNRB 5JHMA 3CFNA 3TCXA 5I1GL 4LSPH 1AC0A 3F7VA 3UG5A 3C5ZC 4OGZA 4I0CC 4BGDA 1IAKB 3QCVH 4HUXB 4U31A 4XCFH 2VDQL 1ROWA 3I3EA 4C83B 5T1LA 5H35A 3GMOB 3EFOA 4DKDC 2VN6A 2VDKL 4R2GD 2G5BA 2F18A 2XQYG 3QWRA 5BZDB 3SGJA 1IGYA 3H0TA 4LCUB 4UUJA 1ONQA 5BVPL 2FB4L 1AOHA 1A7BA 2IDCA 4N26A 4DP4X 4YAQA 1ECYA 3QEQD 4IRJC 4KHXL 4F7PA 3TCLA 2JIXD 1KJ2B 4OJFL 3P77A 2J43A 2MHAA 1HZHH 4PJ9C 2A4ZA 3FK3A 1EH9A 3RTQA 2R0WH 3EFFA 5K9JL 2CBQA 4DUVA 3LQMA 2IAND 2OI9C 4Y9CA 4IOSA 1DTUA 4NZTL 1QYGL 1NLDH 4BCYA 2PKDA 1A4JA 1ZOXA 4IU3A 3ESPA 1T1YA 2Z93B 4XO5A 3QSKB 1G0XA 3L1OH 4LHUD 5E94B 4S1DC 2ILLA 3ABZA 1J0JA 4DNLA 3OPUA 2YC1B 4LARL 3IDIA 1VGEH 2PETA 5AW2B 3UG3A 4PSPA 5J11B 1U8JB 1CR9L 1TSRA 1UYWH 1BX2B 5IJVA 4TL4A 2OMVB 3VCLB 4P2QE 2MWCA 4JFZH 4A2HA 4OUUB 2Q3AA 2D7PA 2M1KA 4JY4B 3VTMA 2BVOA 3OXSA 3CX5K 3DGGB 4Z7VF 3GPSA 3GUTA 1CE1H 5BRQA 3NJLA 3W9EB 4AYDC 1CIUA 1WRFA 2H26B 2WO2B 1P5UB 5FYLH 2R29A 1CF8H 5CEXA 4NN6C 4O02L 1BQHA 5SWQB 1HDMA 1N9PA 3M8OL 1TUPA 1M6UA 4LCCC 3GMLB 3IE9A 1NIEA 4Z0XB 2Q3ZA 3KLAA 4MD4A 4N2NA 1IO4C 2E7BA 3GRBA 3RZCC 1FIEA 2X1QA 3PXLA 4GW1A 2DJ4A 3CG8A 1Z3GL 5INDB 2R9HC 2DLTA 1JD9A 5L6YH 5L4JA 3BHBA 4LRNH 4R7NA 3NCEB 5D70H 2BNQB 2CHWA 4DQAA 4HCGA 1X5ZA 1A3ZA 3ATDA 1IBGH 1NGZB 3MXVH 4HKBB 2Y1YA 3EJJX 4RGMC 2B1AL 3A23A 5LCVA 2WNGA 3UCQA 4A04A 3QORB 3A47A 3RBGA 3CMGA 1ID2A 4MLSA 4EZMA 1PQZA 5BPPA 1M71B 4EI5D 3HNVL 4GLRH 4X9GA 2VDNB 4YLBA 3SPHA 4Z7OF 5J8OA 3JYCA 3MA7A 1EWHA 4CGUB 4PS4H 2DDQL 3Q3GA 2ARJQ 5T1MA 3W2DL 4IBLT 1FN4A 2EDRA 1HQ4B 5CSBA 2FWLB 4LLWA 3V4VB 3K2KA 4IDJH 2BY3A 4ILDA 1E6OH 3ELAT 1ZA6A 3PWUB 2DWDB 3ILEA 3O8XC 5DQDH 1S5IL 3BUIA 5I5IA 2AV7B 4QR7A 2YHGA 1KYUA 2X53A 2RH0A 3A4DA 3SPVB 2XWXA 1KXHA 2EE0A 3H4FA 5KSAC 1E5AA 1URIA 2NW3B 5JLZB 2IPKB 3WEBA 2BH0A 1L4IA 3RX7A 4OF8A 1FHNA 1D5ZB 4MQXD 1F2XK 2X4OA 3IFOA 3JTSA 3AREA 3ZKXB 2JJVA 2W92A 3DI2B 4H2CA 2WXRA 4TQIA 1HILA 3HAEH 3LNEA 3MRPB 2FD6H 4XBMA 3ZDZB 3EYFB 4WDIB 2H9GA 2A5UA 4PY7B 3VXOA 3JWDC 4YSQA 3LY6A 4V2BA 5DUJA 3ZE0E 4Z7UF 2BCMA 1ZWIA 5I5RA 1YO4A 4ADIA 5DJYA 3S3JA 3P2BA 3S7GA 1YVLA 1S7TA 1P9MC 5I6LA 3F58L 2AP2A 4KKPA 1UXWA 1HIMH 3JVGA 4DVBB 4H20L 2HLAA 5JOFB 3S96A 3OF6A 3ZYOA 3OKLB 4ETQB 3K6SB 2H1XA 1RIUH 1Q9LA 2UZYA 5LDSA 2FEJA 2YMOA 3C5ZD 4DN3H 4DPCX 4UMGA 3GJEB 4FL4B 2WLZA 3WNMA 2ZTBA 4KZDH 3N91A 4QI3A 3U0TB 5JUEH 5GS1C 1DDHB 4PJGA 2VUOA 3GGWA 3KBPA 1K4CA 4JKMA 3G6JF 1YLBB 3UZVB 4Q0XH 4KMTH 1H15A 4Q4EA 3TBCA 2H7WA 4OJEH 3VGDA 4IRJD 1DHKA 4APXA 2JE8A 5E4AA 3GKZA 1IGFH 3CVHA 1KCUL 1AI1H 2QPSA 4MXVE 4AEHH 4NZJA 1IFHL 3ENEA 3GXTA 1JERA 5DUML 3G9AB 3WKMH 1CDJA 3PIQA 4OCSH 2N0MA 4UIMA 3T0WA 2HFFB 3FU9A 3GMRA 3KDMA 3BCDA 2N59A 2NY1B 4W4NA 4PJIA 1AP2B 5EC2A 5I17A 3KDPB 1L7IH 4MS8C 4FQJH 4DH2A 4Y2LA 5T5FH 3S97C 3LN5B 2C9SA 5FKPA 5CZXC 4X4YA 4J2QA 3SBPA 3FU5A 4X50A 3H9YA 4MDIA 1PY0A 3MO1B 3L3IB 5L8LB 1FV1A 2XX1A 1BM3L 1AIZA 2R39A 2B1OA 3H56A 1UM4H 2QELA 3O2DL 1AFVH 2V6HA 1SJHA 3FQ4A 2FHBA 2ERJC 3LD8C 5CFHA 4LLVB 4X99A 3QE5A 2L4OA 3APMA 3CSFA 3HUJE 2AS5M 4JO4H 1M7IA 1XGTB 2ESVE 4L29A 2DYPA 3PWJA 2XICA 3MTRA 4ACPA 2VAJA 3LXUX 1BZ7A 3L9RB 3U2IA 3NBNA 2IQAA 2V5YA 4YFDB 3RWCB 1KWKA 4NKIL 4BE6A 3MCLL 3EOAB 5J56B 1OAKH 2R9HD 1HH9B 4RFEA 1J11A 3PXHA 2FO8A 4LAJH 2QSCL 2MKLC 1DBAL 5DWUH 3WXVH 3CE1A 5D1ZI 4G9FB 1A8ZA 5E2VH 5IB2A 2ISDA 1OF2B 3MLZL 1ZXQA 3QHFH 4X6CB 3CSGA 2C1PB 1RUMH 4F5CA 1HNYA 4F7KA 4LSSH 3FT4A 4NQCE 2JQAA 2JKSA 5BRPA 4QHKJ 1WAPA 2XLLA 3SE4C 4N90D 1UM6L 5I8OL 2P4AB 1IAOB 5D1XA 3B9KD 4RIRA 4JDEB 4DAGL 5C2UB 1I9IH 2X0VA 4LB8A 1IQDB 3FQRB 3O2DA 2XWBA 4P4KC 1A0QL 3K5RA 1IVLA 1H3PL 3WL9A 4U0RB 5D2LA 5ABDE 3VD1A 3PL6C 1T1XB 2F7QA 2XTJC 4R3SB 5ACZB 3O8XD 3D07A 4JKKA 5D7LB 5C3TA 1HS6A 2BOBB 4ES9A 3QG6B 5TE6H 1OK8A 3CC5B 4TTGA 2VSCA 3ASWA 4JFPA 4QTHA 4CU7A 1JTPA 3IKKA 5CSZB 5KSAD 2HTLC 2YEVB 1O7SA 3UP6A 4WI3A 1DQDH 4HIHB 2E27L 1RQ5A 1VACB 1KCVL 4LVNC 1IUZA 4N8VG 4NC0B 4ZQKA 1UWEH 4FYTA 5K1NA 4XNMA 2X0WA 5IQ7H 1QEXA 1GTFA 1MVFA 1KPUB 5FXCH 3ZMRA 1IGMH 2GCYA 2RTTA 1YNTB 3OKMB 5EU4B 2FJUB 1PZCA 4EOWH 1ET5A 4F2MB 4R83A 4XTRC 2XWRA 2V7HA 1E8WA 3QXTA 4HLZH 5L2KA 4MA8L 1F0LA 4JRXB 1ZPLA 5AYQA 4G7YH 3GZQA 1EJOL 1KENL 4OGQC 4EQ3A 1LO2H 4ZTOH 3IXTB 5C2BH 4ZS7H 1P6WA 3TTSA 1F2QA 1I8LA 2YUVA 3MU3A 5D96C 1GCFA 2ZCKH 2BFVL 3KPMB 3F7YA 4OGAC 1KN2H 4Y19A 4O2EB 5HHMD 5DFVC 1E40A 5B4MC 3BSHA 4WW1B 5ADPL 4YHNA 3UBGA 1AGEA 2D4FA 1AZNA 1J1PH 1R75A 2IAAC 3QJXA 3S5LB 1KYOJ 2MRYA 1FO0A 3BO8A 2H32A 1KGYE 3LXCA 1JPFA 1QI3A 3RPIB 4M00A 1JFQH 4ZUWB 1F3JA 4PJEA 2BINA 2NX5E 3AGVA 3O41B 3V9CA 1MCOL 3FQYA 4KPHH 1ZT7B 3NFNB 1MJ8H 3V8CA 5BO1H 1EHLH 3PWNB 3WTVA 1HH6B 1EO8H 3C5JB 2P49B 3BDYH 2F68X 1R46A 2M26A 2PO6B 5FO8B 2Y24A 4MS8D 1AD0B 1GL4B 1NM9A 1YPZF 2ALAA 4F92B 3VSVA 3DHMA 1JZFA 4KDVA 3RJOA 3RGBA 3RNKA 5CZXD 2AJSH 4MJHA 3B8SA 4U1JB 1BFOA 3ZT5A 1A7RH 3MUGA 1WH0A 3QBTB 5KEZA 5C07E 3UTPD 5ANMA 1KEGH 2NNFA 3JV4B 3VACA 1I8MB 1ACYH 4UTBA 2IFFL 2BHUA 4U6YB 4E9YA 4JPVH 4X0NA 4AK2A 3Q8FA 4R7VA 4XT1C 4G6KH 1U95B 4JY5H 3ZGIA 4X5WB 3VRIB 2OLDA 1G6RH 4QHNA 4WV1B 4XB3A 5DRWA 3QULA 2A74A 5DRNA 5HDWA 4OF3A 5F6HI 1D5MB 1J8KA 3EGXA 5IV2A 4G3YH 1I7TA 4Z7NE 2IPTL 5C0AB 1MRDL 1QBLL 4FKHA 2ENJA 1VESA 3HLAA 4AQ8A 1JGDB 1JGUL 3MLTB 4K5PA 4Z95H 3GRGA 3F7KA 4YLQT 3SQBB 1EGJH 1KIRA 1U8IA 4HIPA 3QK0A 2QVTA 1NANI 4FQQB 4K2UL 2ADJA 1EXUB 2X7LA 1E5ZA 5C0CD 1G7LA 3V7MA 1I1RA 2G2NA 4R7XA 4JFOA 3B9DA 1OPGL 5IHHA 3TFKC 3LRLA 2BSTB 3RB5A 3VXRB 4G6JH 2X1PA 1JGIA 3BT2L 3LRHA 1K2DB 2AJ3A 3UTSA 4N9OB 4WUUB 2DJSA 3RX9A 1S9YB 2NLJB 4S1RL 3E9UA 4MD0A 1JXDA 1S9WA 5K39B 4Z76A 3MLRL 2O1AA 5I0YA 2WIMA 1FL6A 4QHUA 3KW8A 4N86A 5SWSD 1NUGA 4W6YB 2ZYIA 2EUWA 3PL6D 1A9BA 2QQKL 3QPKA 2XTJD 4HS3B 4LHQB 1ZY9A 3OKKB 2AK4A 3VSUA 2EDNA 2NSXA 1TETH 3DVFA 3LN4A 4N3TA 1S78D 4PWIA 2FLMA 4JW3A 4ZMLA 2VSDA 3QNYB 1V55B 1N5AA 2HTLD 1S7QA 2G2RA 3VWKA 1JXFA 2AK1L 2NY3B 3I9GL 2J8UF 3AJ7A 1OCCB 2AJXH 4X80H 1CO1A 4ZAKB 3WNNA 4FHBD 3GYRA 1HXMA 2XG5A 3LNDA 4OLXH 3W38A 4ISVA 4G8EA 4KXAA 4WK4B 3BZFA 4NOBA 2XN9E 2GSGA 5HJGA 4HZLA 43CAB 4BSWA 3GXFA 4ENZA 4XTRD 3SGEI 3VM7A 3WFCH 3WNJA 4U1MB 2CLRB 1WA2X 3T4AB 3WO3B 2CO6B 4PJ7E 1L6ZA 1IKFH 2ZKHL 4L8BA 4IRZL 4J23A 3BEVB 2DMGA 2JJTA 4XCEB 1MY7A 1C5CH 3W57A 3VG9B 4F58H 4KK6C 4AJVA 3IMVA 5HYQB 1NAKH 2H6OA 2A4EA 2I07A 5A6IA 4MNQE 3K5SA 2I69A 3QXUA 4MJ4A 4OGAD 1OHQA 1KELH 1ESOA 3LRMA 3VX1A 1MHEA 3O4LD 2F54E 2J72A 2WWNA 3QFDA 4RBPK 1MLBA 2JV6A 1ACCA 3INUH 2YA0A 5I1AA 3F12A 3T0ED 4L48A 5IMMA 1QBML 1P7BA 4DTGH 4M61A 1CDBA 2YZ1A 3M7FB 5F7FA 4D8OA 4HDIA 5AVUB 3GS7A 4HMCA 3SQOL 3WV0A 3H55A 4R5TA 1EERB 3VXPA 1FVDA 4TSCL 1OGTB 4GP5B 3ZKQD 3DJSA 1XF5A 5FOBB 4EUPG 4UU9A 1QSFD 2D03L 1X7TA 4HJSA 4KXZH 5KBMA 4F9PA 4FQIH 2FT6A 4KZEL 4ZXBB 1NZRA 4L4VE 1AGFA 4XX5A 4AQ1C 2ALWA 4L4TE 4KZ0A 3JV6A 4IW4C 3HG2A 1NL0L 4XP4L 4MBRA 3BSZA 3NCMA 4HGMA 3ET9F 5E56A 4K3JL 2YR3A 2QQQA 4OM1H 1A6AB 4FEMA 4IOIA 2IFGA 4O5LH 4G7QB 1W6LA 4IQHA 1QW8A 2D7QA 1AKJA 3S3SA 1QBAA 3MROA 3EHBB 1JSYA 3UBXG 3O3EB 2Y5TB 2Y7QB 3FH7A 5INCA 3JWNG 1Q0EA 4DF9A 1LO0H 2YARA 4TS6A 5BCAA 2OMTA 2BM3A 3X3GH 4A39A 4YSUA 1OSYA 3WGVB 3DRQA 5CJ5A 3ZBMA 2DQCL 3VNYA 1O0VA 5AZEH 4F1SA 1UWXH 5GRYA 2B8OT 2VXVL 4DHLA 4WI9A 3VQ1C 2C4FU 3BX7C 3POCA 1RU9L 2ICES 2FX7L 3SJVE 3D5OF 1OAXH 5J12B 3U83A 1D7FA 2JVUA 3ZY7A 1QA9A 2CDEB 1RZFL 4HETA 4GMSH 5MHSE 2ADIB 5JPMB 1UA6L 1ZTXH 3ZE1F 1ZGLM 3H1ZA 1SXAA 3QGVA 3BISA 2E8YA 3LDBC 2V4LA 4TOYH 3QQ3B 3TFKD 4ONHB 2BNRE 4ATTA 4MMYB 4NQDE 4KFMA 2ZSWB 3I6GB 4QRSA 1YEHH 1A6ZA 5EEWA 3RPBA 4AW7A 5GZNC 2VZTA 3OKOA 1K4DA 4WLCA 1J8SA 1E2VA 1TZ8A 4GRMB 4K9EH 2EUZA 3H2QA 1HZLA 4AGPA 2O5ZH 5JR1L 3FSOA 2ADGB 4Z7QE 3FYIB 3QIBB 4ZJ9A 3SPJA 4U0QB 4K9JA 1Z0MA 4XCNB 2HX9A 5AQ0A 1W72H 1NCWH 1SZNA 2ZXDA 4NQEE 4UQDA 4GAAA 4NZFA 2HRPL 2CJUL 5ELIA 4U1LA 3MGTB 1SYVB 1XGRB 5D2NB 5CR8A 4XXWC 1HHKA 1XGYH 1AQKL 1U3HB 2LR4A 1U92B 5L2JA 2OQJA 2ZOLB 4HJJH 1T5WB 2APWA 3WY3A 3KPRA 4AYSA 2EO7A 5CIPH 2IH9A 5BS0E 1CICA 3GEFA 5J13B 3RWGB 3IDGA 2DIBA 5CBEA 3E6HB 3H2PA 3FHQA 1X5KA 4GSRA 1D2PA 4YSDA 5BV7H 1HYSC 4IBSA 5F7EL 2XN1A 5MENA 2DEYX 5EIQA 2Y1AA 5BOZG 1F11A 1NC4B 3DVGB 1LXMA 2DF3A 2NQCA 2ZAIA 2IOMA 4N0YL 4NAQA 4JZJB 1RHFA 3G7TA 2CWRA 1EVUA 4N8UA 4X0KA 1KNOB 5EBLA 5C08E 5JYMA 1NCAL 3FN0H 1ZT4B 4GKLA 3DX2A 4ZMWA 4WZ9A 2VDPB 4KUCF 4F7MB 1ZD6A 3B83A 2XIDA 4PW3A 3FUHA 5K59E 1I3GH 1GPOH 4M7LL 1KT2A 4FFVC 1DJIA 1X3DA 1CG9A 4FFYH 2G0KA 3KXFE 3DMMA 3UBFA 4FOMA 5CJOH 3VFVB 4ZFGH 4PRPB 2BHZA 3HRZA 1CQKA 4DJMA 1OOAA 4YIQA 1IBDA 4FQXB 2NR6C 3PXJA 1KY6A 5I1IL 3PY9A 4HHGA 5BRZD 3UTQA 3MMEB 1AO7D 2W0PA 4I9WD 4X6EB 1PSKH 5ESQB 5AENA 2IXQA 1MFAL 1U42A 1TOXA 3T2QA 2ZF8A 3KHQA 4WTQA 3TEYA 5EA0L 2FUTA 2JCCE 4FQPA 2ZCZA 4M7KH 3FNKA 3DRTB 2XXGA 3ULUD 3VXNA 4ABQA 3APDA 3B2UC 3P11H 2YD4A 1QWNA 4P9MH 1O9WA 1P1ZA 2YD3A 2FYYA 3MLVH 2VLJA 3OKNB 1GY1A 1MDAA 4XVUC 1A6TA 4HJGA 4KU1A 4LBAA 2X9XA 2CCLA 1MWOA 1KIPB 3FB5A 5I71B 4OLYH 4WTWA 2WKLA 3MRDB 3MV8E 4L3EE 4BSVA 3P9LA 5IVXB 1KN4L 4BFJA 1TDQA 3MYJB 5EIVA 3SCMA 5IT2L 2BWQA 2ZUUA 3ZXAC 2OTUB 5EUOF 4OZHB 4E9RA 4K5LA 4OSUL 1JWUB 4G42A 4OFKA 2WVUA 1IEAA 4PUBH 3SGJC 1AZRA 3OZ9H 5EBMB 4G6FD 4BCXA 2HMIC 4JG1L 5IG7A 2ZYSA 4PLJC 4A67A 4JRYD 4MHHG 2VMDA 2OX5B 1TZHA 4KVNH 3DYPA 5T3XH 4NGHH 3WIIH 5TD4A 2A4CA 2BRRL 3RTQC 1GIGH 4NQXB 4FNPA 3MJ6A 5HXMA 4LKXB 2H8PB 1ZS8B 3BUYB 3FPYA 5E99L 1M7DB 4TUUA 1JNHA 3BVNA 2I9LA 1ASOA 4OGYL 5GZND 5D9SA 1DFXA 4ODBD 2PWDA 3BEWB 2JB5L 5F6HJ 1NDGB 5SWZB 3NGBC 4XMZA 2F1EA 4OCMC 3L9YA 5IB4B 4HK3N 5LAPA 3D18A 5CNHA 3EOTH 2ZE0A 3C5XA 4BHUA 5HY9A 2EIZB 1ZLEA 1F42A 3E6FB 3HNTH 1A7QL 2P48B 2XTLA 3BAEL 4MNHA 3EJSA 4JUSA 4K94L 2BIHA 4JHWL 5IF0A 4OZIA 3A5VA 4KTGA 2FIRT 4GS7C 4RX4A 4XPGL 5DD5H 2NY2D 2ZAHA 4YHYB 2QT6A 2AQTA 3DXAD 3GI8H 3D0VB 2IH1A 3IU3B 1TCRB 4AIXA 4X6DE 2XSKA 3L9EA 3WFDL 2YUXA 4B9IA 3HUJF 2EDKA 3R06A 1M57B 3M17A 4R5VA 4PV8A 2B5IB 2A9DA 4HX1A 2QSVA 2X6VA 4CU6A 4AOFA 1T03L 2YEQA 2BXYA 2XDHA 3DK2A 3P9WB 3IETB 4DGYH 4X4XB 3K6DA 4E41D 2ID5A 2GITA 1LP9F 4ZMZA 1YG9A 1ZLSH 4MAUL 5AW4B 5JPNB 2Z8RA 2WNXA 4E42A 1HYSD 4I3RH 4UT7H 3WJLA 3BRGC 3U82B 3MOBL 5ISZB 5GGUB 3VD2A 3X11A 2HJKA 5IVNA 4N0RA 1S7WA 5E8NB 5F7DA 4WWKB 4YDLB 2XZCL 1CYGA 2DRUA 4QEGA 2WUBH 3CPLA 4IGBA 1T20B 4XBEH 4GW5B 4X6FB 5B38A 2EO9A 3P4MA 2YXVA 5C7XL 2Y23A 4B97A 5MP6L 3AU1B 1RZPA 2CO7B 2LW3A 5GGTA 5C09B 2JI1A 1G7PA 1CQYA 3QXVA 2XQBL 2I9TB 1U58A 1XZ0A 5ERWB 2QV4A 1JUFB 2NR6D 4JPQA 3I6SA 2UWEF 4JQIH 4ETYA 1BZ8A 4JPSA 1MQKH 5CUSH 4EE2A 2KS0A 1ET7A 3VRJA 3P02A 4DK3A 3UPRB 3ATBA 5HI5C 3UJTH 4MQ7A 4PP2B 1R5VB 3AREC 3IFLH 3G6DH 4TULL 1KCRH 3MREB 1I7UB 1MXDA 2AGJH 1DYZA 2G3NA 3OQ3B 1ANUA 3OWRA 5GRVL 3FJTA 3ZDWA 3B2UD 4PRDB 1QUNA 1JIBA 4M8VA 4ABWA 2YAEA 5C92A 3ROLB 4TVPE 2BXZA 4XVUD 4OFYA 1DVXA 1YEIL 1MCHA 3JVGC 5E6SB 5FEBA 1E9QA 4J6IA 5TQ0H 4ELMF 5GGRA 1FNEA 1ZV2A 1Z9PA 1RIVH 4NWUH 5E0QA 2RQ8A 4UAOC 1E4WL 3QJHA 5DXWA 3MRFB 3T4YA 2GQHA 2RFXB 3FTGA 3B9VA 2D31A 2EDTA 1VLXA 4FRWA 3X1GA 4G7SB 2Z4QB 5T1LD 2K3HA 4JHZA 4WW2B 4JQVA 4GNKB 4DPRA 3AS3A 5A2CA 1U6AL 4ODWB 1QFWL 2WMPA 3QWRD 1KPRA 2R4RH 2WTPA 3BP6B 2EDMA 2GEEA 1JZEA 1AR1C 4PLJD 2AAAA 3SKMB 3HI1A 4JM2F 5HHOD 4RAUA 1U3ZA 2VL4A 4DPAX 3NYKA 4QKXB 2APVA 1E0OB 2OXHA 3S4SB 3JUZA 4UTAH 4PW9A 2AERT 2IBGA 3CQPA 3NESA 4MJ6B 5BOJA 1C5DB 1DQMH 4IOSD 4CU8A 1KB9K 4KKBC 1IE5A 4G59C 4EUPB 2X4UB 1R3JB 1JN6B 2X2JA 3U9UB 3PGDA 2ZCLH 1WAAE 4M7JL 4XVSL 5B39B 5EZOL 4JFEE 2X42A 1WFNA 4YNYA 1MWAB 1YYMH 1MCPH 2W9EH 2NW2B 4YMPA 3JT2A 4PGCB 3Q01A 3BKCL 1T89A 2Z7ZA 4PBXA 4IK7A 1KCSL 2H1PH 2FWUA 5ENWA 5I1GH 2C1OA 1PKQE 2Z9TA 1JPGA 1FFPB 3N1MC 4FZEL 4M4PA 5I9QB 4XOCA 4DERA 3FSAA 3FB8A 3BZDA 3L3KA 3R8QA 1INQA 1NKOA 1UATA 4K7FA 3AG3B 1UZGA 1QMUA 4Z18A 1C8PA 4NZDA 2FSEB 4N0UA 3DETC 5GRUH 1XIWD 4WTZA 3X1FA 5IUSA 1BM7A 4B50A 3QZOA 2ZUQB 1T04A 4LCYA 3IGAA 1D7BA 4H1LH 2IDTA 3GK8L 3QJTB 1W80A 2XFXA 3AMLA 2Z4TA 4FXGB 2RBLA 4YHML 2A73A 3E8VA 3NK3A 2NQDA 4A38A 1FJ1B 1OGAB 1T7XA 3WE6B 1WITA 4U1SA 4JBSA 1XL6A 5F7KC 1TTAA 3BFQG 3GSUA 3GXPA 4P2QB 3CFBB 2PPFA 3QQXA 4AG4L 4JM4H 3CDZB 4Y9BA 1I1AB 4U7SA 3O3BB 5DTFA 3ZHDA 1QQDB 5BW7A 4TLTA 4M93C 1PU0A 4WUKH 3DSNB 5C71A 3L81A 3NACH 4N0FA 1RK0A 4FMFA 2VDOB 3GSOB 3MV01 3BXNB 4E36A 1JGLL 5BVJB 3L2NA 1R19A 1RZGA 1JRHI 2R1XA 2Z6FA 4JFYB 5D1XC 3VFSA 4ATWA 4F3FA 5EEUA 3QEGH 5J57B 1E6JL 1CD1A 1YNLH 4RFOL 3UBXI 5I6XB 3TA3A 5DZPA 4A68A 1ETA1 1OAUL 1U8HB 4ZFFA 2P44B 3O3AB 2FR4A 2VJXA 3LQZB 1EMTH 4WO4A 3ULVC 1ZV9A 2WV3A 2BS8A 2QGBA 3JTBA 3MRGB 5GXBB 2CDGB 1IGIH 3VVVA 5FHBH 5A2AA 1TKWA 4FF9A 1CLZH 3SPIA 5HI5D 3SPGA 3TA4D 5BXFA 1J9SA 3SY0A 4HAFA 3KPOB 4P2OA 2IAMB 4O51A 2LU3A 4E5XG 2WXQA 1P5VA 3QQ4A 4K0OA 1UM5H 5BJTB 3VI3F 4HIEB 4JPIB 4U6VL 1SFHA 3HPJA 2F15A 1K8IB 3C60A 2B1AH 1A22B 3CH1A 4ZUTB 4EKJA 5J5EA 4V1DE 5IVOA 1WHPA 1KY7A 2QADB 1FBIL 4X8JA 2P5WA 4ZPTA 5F7UA 3SDXA 2NY4D 3OF6D 4PJ5A 2DDQH 3W2DH 1GYUA 3MUY1 3PV7A 4PLKC 4BV1A 1I8LC 1OCOB 1YEDB 2D4DA 3RURA 4HJTA 2VC2B 5H4YA 4AGOA 1QFOA 2M83A 4TNVF 1FZKA 3L08A 3QJZA 4LVHC 5L88H 5EF2A 3CX5J 3X13A 4P2RA 1QWUA 3KLKA 3Q6GL 2Z92A 3ZE0B 1AR1D 5F1SA 3SZ6A 1QACA 5JZ7C 3KM2A 4PV9A 4OW6A 2VW4A 1WA0X 3KR3H 4O4YH 4JKWA 3FO2A 2DQFA 4OLZL 5LQBH 2DQEH 3CSYB 2HLFC 4KJPC 2WK2A 2CZNA 1RV6X 5EEYA 4KKBD 2WANA 4B9CA 2Z31B 3QG7L 1NBZB 3ZDYE 4NHUA 1NOFA 4P2YA 2EVIA 1NJ9B 3KNBB 2F58L 2XV3A 3LKRA 2V5SA 5TDOA 3RI5F 1JNNH 4PY8I 1FGVL 3BMVA 1UH4A 3HAEB 3F58H 4NEHB 1XF1A 3CSPA 5F96L 4EXPX 1CFBA 2BSEA 2TRYA 5EO9A 2GI7A 2YD9A 3QR0A 3S34H 3QH3A 3C75A 3FCGA 1CFNB 4ODSL 1TJGL 5IEKB 5IMLB 4QOKA 1EBAA 4FYSA 4JE4B 1IBYA 1A02N 1RD6A 1YUKB 3VJ6A 4HOMA 5C0RH 5CCGE 2VAAB 1ITCA 3D0AA 1N10A 3KWWA 1HOCB 1ED3B 3C09C 1LO3L 2VLLA 4XN7A 1M4KA 1M56B 4AT6B 3QDGA 1UB5A 1OW0A 3DETD 4TQHA 2GKIA 4HHAB 4M9PA 5IUCA 5KSUB 3D39E 2VR9A 3BPNC 2A74C 4XBPB 2J5WA 1AJ7H 5C0BE 5TE7H 2M8XA 1UUSA 4AIEA 3T0DA 1XH3B 4WI5A 2VR3A 4JFWA 4UDTB 5HGAB 2UXVA 4AQ8C 5GS0H 2CGZA 5F88A 3K3QA 3QJFB 2ZWNA 2JB6A 3TJPA 4RDQG 3FFCA 3NPZB 5F3HB 2PR9A 3KD4A 4GT7A 1KCUH 3F2LA 5DT1L 4X9BA 1IFHH 1MFMA 1XGUA 1L7TL 2XA8L 3HRPA 3NIGE 4EN3B 4X4ME 5HHNB 3CQQA 1WPCA 4G8IB 2DQMA 4ZBJA 1T7YA 3ZE2E 3QIUB 3OJVC 1DVTA 1SOXA 2ORBL 4LCIL 5LGJA 2EO1A 3NZ8A 2D0HA 4KH9A 1FE8H 3IJ7A 1VZIA 2VTFA 3V52H 4PJAA 4PRHA 4PJ9B 5DJ0B 1OB1A 5D1XD 5DJZB 3VB8A 4XH2B 4Y89A 1ETJA 3GMNB 4W9JC 5ECJE 1QABA 4AVJA 4QRPE 1RZJH 32C2A 3BZEA 5B3SB 4POZC 3QUGA 4Z7QF 3U25A 5I66B 3ULVD 2IC2A 4OD3L 3BH9B 4OLUL 5LLIC 4N1HB 3EADA 4OTXH 2X9WA 3D2UA 3GFUA 3KPTA 1IAKA 1KGCD 3N2JA 1JZIA 3D05A 5C0JB 4BELD 3VWKC 4MA3A 4C83A 1R5IB 2XHNA 2EKJA 2BY2A 3GMOA 3UC0L 3AWFA 4M6NL 3Q2LA 2N4IA 4NQCB 4Y5XB 5BZDA 3F6LA 2UVFA 4UDUA 1I8KB 1ZRUA 3MCLH 4LCUA 3OB8A 2QLVB 3B6SB 5KBKA 1JNLL 4X7CC 1P84K 5EPMB 2P26A 2QSCH 4ODXB 2UX7A 2D7TL 4CSZA 1PLGL 4JFFD 2VXSL 3FU7B 4E9SA 5ESAB 4NN6B 4J3OD 4R90H 3O9WB 2EC9T 2EZ0D 4YXLL 1B2YA 3MLUH 4ZNEA 4ELKB 1FZOB 2Y72A 4LPVA 5CILL 3RZCB 4XC1H 5FF6B 4JG0H 4H8UA 4UOZA 3DX8A 2Z93A 2JJTC 5E94A 2QV2A 3FO0L 1WICA 2O5NA 1PNCA 4PLKD 1PX4A 2YC1A 3MRBB 3EJUA 1ZTMA 4DAGH 3OR6B 1U8JA 4X7FC 2DYRB 4JGUA 5HTSA 5G55A 4RGMB 3SPCA 1IU1A 1MZZA 2DY2A 2OMVA 3VCLA 2TAAA 3KZ8A 4OUUA 2B59B 4DFHA 1N6VA 4JY4A 1QPKA 5D93B 4XMPL 1FAIL 3RWFB 3DGGA 2ZAGA 2MOVA 4ODHL 1RFDL 3IJHB 3O2WH 2H26A 4NCC1 4BFEA 3D33A 2PW1B 4LEXH 4JFDE 4NJAH 1OT4A 2VZ3A 4U1HB 5E00B 2YPVL 1UTDA 2DMHA 4FE9A 5FUOH 3FMGL 2APXA 5SWQA 2PNDA 3O6LL 5IHUL 2O72A 4X98B 2HLFD 3K4DA 3PP4L 3GMLA 4F9PC 3LZLA 4G9DB 5C3IA 3THMH 3N43B 3CVCA 5IBTH 2FEEL 3SDCB 1DCEA 3LZFL 1X5YA 2ICCA 3NA4A 4R97C 5INDA 5EDXA 1EJ8A 5JMOC 3QEQE 2OMWA 4LIQL 1DZ0A 4QCIB 5IBUG 2BNQA 4MJ2A 3NAAL 4UV4L 4PS7A 1EHKB 1NGZA 4HKBA 5ILTL 1C08A 4ZMYA 1NGQH 2IANE 2O6EA 3MRQB 3QORA 5D5MB 3TPUB 1DLFL 1M71A 5I5MA 4F1ZA 1AYRA 3N44F 1NAMH 1S7RB 2DBLL 2NX5B 3IGFA 1WC7B 4BQBA 3LQAL 1CGUA 1Q1JH 2DKMA 2GUOB 3NJNA 3S8WA 1ZE3H 3NJHA 4LLYB 3V4VA 3MN8A 4K3DL 5KVDH 2X38A 3PWUA 2DWDA 5E03A 5HJBA 4M1GL 5J6HB 2OPCA 2NY6C 15C8H 1CDIA 1XGPB 1I9RL 4LSUH 2AV7A 3X17A 2ZF9A 5CD5D 4HUVB 1OHZA 2W65B 3VXQB 3SPVA 2FQFA 3PLYA 4WNSA 5E1AB 4LHJB 5F7LB 2NW3A 5JLZA 3KLQA 2IPKA 3BT0A 2ZUTA 3VDAA 4RGNE 2J8HA 3AC0A 5C07B 5D6CB 1D5ZA 1OLZA 3OLDA 5FC9A 1XQ4A 4S1SL 4MCZB 4C56A 1T1WB 2A2QT 2B77A 3BPCB 1E5CA 5LWYL 4XN5A 4WEBH 1UH3A 3MRPA 1HC1A 3EYFA 4WDIA 4PY7A 2WSPA 3WHXA 2KZBA 3UTSD 4DWHA 1XCTB 2CMRL 2XOTA 2IDFA 4KRLB 4YH6A 4NM8L 5D4QA 4C59B 5KS9B 5KVDE 2VN5A 4XNUH 3HVNA 1MCRA 4Z7NB 1EAJA 1W0WB 2BVQB 3H7BB 4ELDA 1GGIH 4LLAA 5JOFA 2X05A 2AEWA 3W0WD 3KLSA 3OKLA 3GNML 4POZD 5HDOA 4ETQA 3K6SA 3UGUA 1RMFL 5I30H 5H94B 5E7BA 2H0JA 3GJEA 5DGQA 1NCTA 4JEGB 1NGXB 2HXAA 3U0TA 3KYNA 5HHXL 1NCUA 1DDHA 1MW0A 4IEFB 4YBLB 5CSGA 5FYKU 2YAHA 3EYSH 3OAYH 3A6CL 1QBLH 3UEQA 3PUUA 3QZWB 4IBZA 3EXJA 4KDTA 3EDEA 4BZ2L 3F8UB 3LD8B 2ERJB 1CICC 4M8UA 1OCWL 3UZEA 3GHBL 5JOEA 4K2UH 1FH5L 3H7LA 3AQDA 1JPSH 2B15A 3GIZH 4CNIB 4X7SH 1OVZA 2YGVA 2WNWA 1J05B 5DMIL 3L4CA 1XFPA 1CD8A 2Y06H 2E7HA 3IMUA 3S8GB 1K6QL 2YAOA 4KC3B 2HFFA 2WKOF 2X3AA 1NBYB 2MCG1 2LE9A 2HWZL 2MPAH 5LG1A 1T3FB 1QLRB 3LN5A 3R8BB 3QEHA 2HT2D 1COBA 2MOGA 4NJ9L 5J1AB 4QXGH 2Q8AH 1NGPL 5KW9L 1FG9C 4AC4A 1U93B 3GHEL 3DMMC 2V2TB 3EJZC 3ILQC 4S0SD 5F1IB 4HIXL 5C8JB 2XBTA 3HRZC 3F65A 5EUKB 2A6KB 5EU5B 3VQMA 5JW3H 1C8QA 1QFUH 1XR9B 3MCKB 2GJPA 2I5YL 2QHRL 4YUEL 2X4TA 1XGTA 2EUXA 4PJ7B 3CXFA 4P4KB 5C0FA 4G82A 1EEUA 4H13C 4NO0B 2PMZA 3BE1L 3L9RA 1JVOA 4XMLL 3ZW3A 1F4WL 3RWCA 4ZOBA 2AQNA 3PWVB 3AWGA 1UCBL 1GY2A 3EOAA 5E8PB 4KITB 4MNQB 3F83A 1VJSA 1HH9A 2EDOA 3KGUA 2R23B 2AC0A 4E5XB 4ZZKA 2F54B 4I2XE 4G9FA 3P4OB 2CKBH 1OF2A 1TO4A 1RZ7L 2TRHA 2ZKHH 4LVNB 4X6CA 1HL5A 5FA4B 2CH8A 1U9KA 1H8LA 3FU3A 4JO2H 2C1PA 2FWOB 4LL4A 3CLFH 3CFKA 1RAMA 2PTVA 4GEJA 4Z3JA 3QQ9C 2AV1B 3H3PL 3N9GL 3RVVC 5JXAH 4GW4B 1EAOA 4AEIH 1MFCL 2EECA 2VDRL 4OFPA 1AKJD 3NIDE 2DKSA 3S3CB 2Q20A 1IAOA 2X40A 4CVZB 3SCMC 2FIKB 5DJAB 2XXMB 4JDEA 4L8SA 2BZDA 1A64A 1IQDA 3FQRA 1CC3A 1OSPH 4XNZB 4GRWE 1T1XA 4L4VB 4R3SA 5ACZA 1CLCA 5D7LA 4RMQA 2XV6B 2BOBA 4L4TB 4NCDA 3AABA 4PY8J 3PGCB 4QTFA 2F9BT 3QG6A 4YDMA 5T8IA 1B3IA 3CC5A 4H44C 3SO3B 2YA2A 3SQOH 1SMDA 3UYRH 3SOTA 4TSCH 2KPWA 1J1XH 3FQWB 4PJDA 1IC7L 5CSZA 5FKAB 2DQHL 4TVUA 4HPYL 4HIHA 1JBJA 2N3JA 1L6PA 1VACA 2IGFL 4KZEH 1DVZA 3ZX1A 3NCFB 1OV8A 2VISA 5LGKA 5JORB 4P46B 3BIAX 3VFRB 1KPUA 3WYRA 3RNQB 1B0GB 3QRGL 3ZZ1A 1AOZA 1ILUA 1MFUA 3D3VB 1YNTA 4WHCA 5EU4A 4OIFA 2RA1A 3PAYA 4XP4H 2K4AA 2NSQA 2E47A 4MMXB 2XWEA 2NNCA 1AANA 1QLEH 1RHHA 5FUZL 3ESVF 2RQEA 4JRXA 5DF0A 1B0IA 5DLLA 3VFWB 2XKSA 4CMHB 5KUKA 3MRJA 1ADQL 3PWPD 2B1HL 3SJVB 5E95B 2Q5BA 3IXTA 1WUNT 1XXFC 3VI4E 1NGYB 2EEXA 2BIPA 5FYJL 3JWDH 4YDKL 2WSKA 3KPMA 1U8PB 3REVB 5E5MB 5IK3A 4P9HH 1SOSA 4HUCA 4O2EA 1X9RA 1B0RB 2BNRB 2X89D 4GIAA 4K3GA 3VG0H 1U8CB 2YPLD 1QX1A 1ZHKB 2VWEC 3HMWH 1H3WM 1QFPA 2NRDA 3QR2A 5I6OA 3KPRD 1CLOL 2DI8A 2FX7H 3S5LA 2OL3H 4XP9L 1OAQL 2PR4L 5FDYA 3T3PB 5F6IC 2DQUH 1UA6H 4YX2H 5KJRL 3RPIA 3M1CA 3UPAA 2ZICA 2WKGA 2FJSA 1WJ3A 3O41A 5TF1H 2YAFA 1JFHA 5MEND 3WJLC 4H8VA 2FK9A 1ZT7A 1IC0A 2J88H 4RESB 3KW7A 4LCVA 4NQEB 4G8AC 4F8OA 1HH6A 3LEVH 1QSZA 3ZUNC 4ANXA 3C5JA 1AG6A 3HC4L 3WE1A 3LV3B 5BMFL 5HHQB 2CPCA 5FO8A 2PO6A 4HIJB 1AD0A 2WYIA 4GT0A 2MQCA 4D7BA 3OXRB 1ADQA 3CSBA 2BVUA 4IGBC 1XSKA 3HG1D 4K5MA