1R17A

Crystal structure analysis of s.epidermidis adhesin sdrg binding to fibrinogen (adhesin-ligand complex)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
321
Chain Sequence
GSNVNHLIKVTDQSITEGYDDSDGIIKAHDAENLIYDVTFEVDDKVKSGDTMTVNIDKNTVPSDLTDSFAIPKIKDNSGEIIATGTYDNTNKQITYTFTDYVDKYENIKAHLKLTSYIDKSKVPNNNTKLDVEYKTALSSVNKTITVEYQKPNENRTANLQSMFTNIDTKNHTVEQTIYINPLRYSAKETNVNISGNGDEGSTIIDDSTIIKVYKVGDNQNLPDSNRIYDYSEYEDVTNDDYAQLGNNNDVNINFGNIDSPYIIKVISKYDPNKDDYTTIQQTVTMQTTINEYTGEFRTASYDNTIAFSTSSGQGQGDLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fibrinogen-binding protein SdrG
publication title A "dock, lock and latch" Structural Model for a Staphylococcal Adhesin Binding to Fibrinogen
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Cell adhesion
total genus 83
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A02
3V10A 4MBRA 2YLHA 4LEEA 2Z1PA 4MBOA 4B5ZA 4JE0A 4BBWA 4FJ6A 1N67A 3IS1X 4Q6KA 4F20A 4B60A 5IHWA 1R17A 2VR3A 4F24A 4F1ZA 2F68X 4F27A 5CFAA 4LE8A 1R19A 3AU0A 3ASWA 4RMBA 4JDZA 2Y7OA 4JDZB 3IRZA 2RALA 2Y7MA 3IRPX 3AT0A 3IS0X 4LEBA 5CF3A 2F6AA 2Y7LA 2Y7NA
chains in the Genus database with same CATH superfamily
4W9DC 5AAMA 2CNZA 4HCRL 3FNKA 3DOSA 4K71C 5PCYA 1E5AA 3L95B 2W91A 1KIPA 3W2DH 2DQDH 2VLRD 4HOXA 3CAFA 3P40A 4Q2ZA 1TJHH 3H4FA 1XF4A 2AF2A 4HEME 1KYAA 2Z1KA 3R1GL 1A7OH 1OW0A 3C12A 4G43A 4WNQB 5FO2A 5CCKH 2UVFA 2Y6SC 4PJGF 5GGSY 2DYSB 1J7VR 2HG0A 1V10A 3H7LA 1A6TB 1EJOH 4ODXB 2BY3A 3O8XA 4JFEB 5ENWB 2EE0A 2FH6A 4PLNC 3QW9A 4UT9A 5HHOE 4YS4A 1EEUA 4I1RA 1YEJH 1B4JL 1O7DC 1YHPA 4JFPB 4IU3B 1IIKA 1J0JA 2E9GA 4H2CA 1I8KB 3LKSB 5AAWA 2UX7A 4KQ3H 2AJSH 3WXVH 3QZLA 5T3ZL 4FFZA 1NCTA 3D25A 1WYJA 5TDOB 3LKRB 5IWLC 4NJ9L 4HSAC 2FEDD 4F7CB 1BVNT 1IM9B 1OB0A 4HJ0D 1W2KT 2BDNH 2X7LA 3A22A 3L5IA 2L8AA 3FU7A 3EBGA 5LGJB 4X4XA 4G7YL 5H37A 2BM3A 1F4AA 5IESL 5JNYA 5DD6B 1RFDL 4PRID 4QUOA 1E6OL 1NL0H 3UJIL 4AE1A 4IYKA 5IFJB 4XO8A 5ICYA 5T1DL 1GS8A 4JJOA 2Y07L 3VQ2C 1WWWX 4OZIA 5B4MC 1QQDA 1JWUB 2HLFD 1BBDH 3QORD 3LDBC 2CO6A 1JYVA 1MWAL 5DDHA 1TNNA 4WGWB 5J7CC 1BJ1J 3O6LH 3GSOB 2A1WL 1IZJA 3OMNB 4AIZA 1I7RB 2DRUA 3WIHA 2EKJA 3LB6D 3WS6C 1A65A 3WCYA 1Q72L 1HOCB 4HCFA 4YDNA 5FUOH 4B9KC 2VAAA 1I3UA 1RHHB 4IJ3B 2VO8A 4WO4D 3TBWB 4NBYB 1MF2L 1NZRA 4KTEL 3SGDI 3I74A 3R0MA 3B9DA 3J07A 4KDTA 1NM9A 5FA4A 5JHDE 4JDVA 5DLMH 5BRZD 3ZDXE 5C2UB 1IGCL 3MV8E 5TDPA 3T04D 2VZVA 3RG1C 2ITDA 1SOKA 1GZHC 1A2YB 3LHAA 5IREA 2APSA 4X98B 4P3CL 1OQOA 2B16A 1WPCA 3AQDA 4XGZB 5IEHB 3P3SA 2Y7LA 3RWIA 4OJFL 1T83C 5L8JB 5I0VA 1A6PA 2WUCL 3O2VH 3IF1A 4LLAA 4YSEA 4E9LA 1UJ3A 1URZA 2HWZL 4EUPB 1O5PA 2VZUA 5CBAA 3BPNB 5GGVL 1T3FB 3MJ9A 3Q9PA 5C0CD 3PYCA 5HI3C 3L9RB 3QO1B 3GDCA 4H5SB 4NSKA 4MQ7B 2IDCA 1TTGA 4JO3L 4S0HA 2R69A 3RZCC 1Z0NA 4F33A 4PJFA 1MLBA 1HX0A 1BZ7A 1JWMA 1B2WL 1IB5A 1QYGH 2HKFL 4GQ9L 3RGVC 3LKQB 2ODIA 1U8OB 3AT9A 2Z8RA 3MRFA 2WLLB 5D6DC 5CILL 5A6IA 5ILTH 4AQ8C 5DMYA 1T2JA 4U6HB 1XSOA 4XX5A 3PWPD 3L4WA 3G5YA 4TRPH 4C56E 4UQDA 4KOCA 3VG0H 4NUJA 3CUPA 3ILEA 4JHZA 1M3JA 3WN5A 2AK1H 3RIFK 3U1PA 3UYPA 5C1MB 3CIQA 3RPIA 5IVXE 2DKMA 5JW5A 5IW6B 1J05A 1DUZB 4X4YA 2FIKA 5F9JB 2C9VA 2J7LA 2WQ8A 3HMXH 4HC1H 1SYVA 1TT6A 2AQTA 3O6FB 2CMRH 3ZT6A 5F7NC 2H0FA 1NFAA 1MJ8H 3FC8A 4N26A 4TL5A 2LVCA 4AMKH 1T89A 1DQDH 1F6AA 5F88A 3HAEG 3VQLA 4QXUL 2YFOA 2EZ0C 5D93B 2FWOB 1OWWA 4Q6YA 3EFOB 2NXZB 2ZX6A 2Y2YA 1P1VA 3N43B 1SXCA 3HZVA 5CZXD 1MNUH 4HLJA 3SQRA 1M7IA 3AAZA 4QCIA 4UOW1 3U2SA 1HQ4A 1FCGA 2AVFA 4HU8A 2OP4H 1PQZA 1PD0A 3NJNA 5DJYB 1T5WB 4H8WH 3VXTA 4E9XA 1OT4A 5EU7C 3SJVA 3T4YB 4YHZL 5IQ9B 1KEGH 4W6XB 1RZFL 3KPMA 3NFPB 2ED8A 2XZAL 3ROOB 3G04B 2FYYB 4WLCA 4Z3JA 1U3HD 2OYKA 2X4RB 3CDCA 4NPJA 3ZZQA 3WO4B 4Z7QE 4MA7L 1ULVA 2KLRA 4E41B 4ZFZB 3APFA 1MHHB 1VZIA 4CVXB 3IJHA 1AGBA 2Y24A 3H2PA 3QI9B 4MD0A 1BQUA 2Z4QA 4TLTA 3RDTD 4Z7NB 1RCYA 1SJMA 1ITCA 1V27A 3GUTA 4FQQA 4APXA 2FR4B 4RGNE 4LESA 3B2MA 5B1CA 3WFEH 1R47A 2YD8A 4R2GB 5AYTA 4QEGA 3EOAB 3P3TA 1T7WA 2AABH 2BMKA 1LGVA 1DJSA 1RUPL 2GJ6B 3VGFA 3VD9A 3LKOA 4H8QA 1MEXL 4BKLB 1TEYA 5ESAB 3IJYA 4PG9A 4X7SH 3MUZ1 1KCKA 2VLKA 4B3EA 2IH8A 5IUCA 4WU7B 2EUVA 1LK3L 1S7SB 2UZYB 4X6DA 4FZEL 2B39A 4EDXA 2D7TL 2YMOA 1AHWB 2J8UB 2AV1B 4NAJA 4U1JA 4K8RH 3SGDH 2VWEE 4GSDH 4ACPA 3UGXA 3N3EA 1AXSA 1OOWA 4IOSD 5CD5D 5JIPA 1Z7JA 4MMXB 5DEZA 4M7JH 5MEPB 4P5TC 1ZGLM 3K0WA 1DLHA 4XBMA 4PRBB 4DAGL 1KWGA 2NSMA 2Q7YB 4XCYB 3WTUA 3QRGL 3NCMA 3HR5A 2ADYA 2IV8A 2MOGA 2WQSA 1DCLA 3QDMB 4GXVL 4PJ7E 4PGBA 4UV4H 3TN0B 3FRUB 3NA9H 1XH3B 4M43H 4PP1C 4M1CC 4UIKL 1JFHA 1F4WH 3DRTB 1V3KA 3FTUA 2LAGB 2QKIC 4NO3B 4JVPA 2F2HA 4OM1H 1FN4A 4Q9QL 5DVOA 4OLYH 5CJ5A 2FH8A 2HT2D 4KY1H 3BVDB 5D1ZA 3ZTJH 1ANUA 4PVLA 3Q0HA 4AH2B 1FL6A 3L3IB 1WS7A 4UQ9A 3FFCE 2F1BA 2MTPA 4ZQKB 3BPCB 4ELMF 3WN6A 1OAZL 4DPAX 1IEAB 4FNSA 2BCKA 1FV1A 1RU9L 5IEKB 1OP3K 3BDYH 5I1AA 2VXTH 1HU8A 5HI5D 3CFIC 3H42H 1E4JA 4U4BA 3LNGA 4I3RH 4U0RB 3U9WA 3S96B 5K5YA 4H1LB 1O7DE 4XZUA 2P48B 3W82A 4JO5A 3S35H 2EIDA 2HVJB 1DR9A 1PLAA 4R3SA 5HHVL 3GQFA 3W0WA 3UIZA 1S7VB 4KRLB 3MLXL 3VXOA 3VD0A 4MYWB 2N01B 5L88H 3FSOA 5B1KA 2X9ZA 1P5VA 1OGAB 3VH8B 4L5FE 3RL1B 1T5KA 1MVYA 3Q6FB 3TEYA 4AM0Q 3X1GA 1W16A 1U8JA 2IANE 3MBEC 5K1VA 5J56B 3OXSB 4U49A 1DQVA 5CEZL 1CE1L 2KPWA 5T5FL 2QT6A 1Q0EA 2WZ0A 4JO4L 1U33A 3S37H 1OOAA 4GSUA 3HC3L 4PJDB 1H3VA 5I1HH 2XWJA 5DO2C 3GI8L 1BG9A 4XCEB 3W9DA 4QF1A 3HEIB 2WXRA 1U2HA 4UT7L 3KYOB 2J20A 2WXKA 3OXRA 4FQJH 4QXGL 5DVLA 4HUMB 2G9HA 3RHWF 4XPGH 2BW4A 3F7VB 2XXCB 1CLOH 4U6XB 4Q9RH 3QQ9D 2K7QA 2F5BL 4L4VB 1TJGH 4KKPA 2XV2A 5CJ8A 1NTDA 3X3GH 3PWLA 3GDBA 2F1EA 2J5WA 4YBHA 4XCFL 1I7TA 1FZKB 2EE9A 2NNXA 5DYOA 1A22B 1UACH 3G5XA 1PF3A 2O6CA 1IBFA 2R1WB 5CGYC 3N9GL 2NQ3A 1B9KA 4K5OA 4PVNA 5GSRB 3RTQA 4NO5B 1TLKA 2ZXCA 2E5EA 1CXHA 4H7VA 5EOCL 4AQAB 4IW4C 2YKKA 2E76C 1WK0A 3L6FA 5D7SL 3OKMB 3TT1H 2WBJD 1SOSA 1OAQL 5DS8A 6FABH 4JPKH 3PG2A 1J18A 3HZYA 3KLSA 4NI3A 3RWFA 2CD0A 4JZNB 3TOPA 1S9YB 4TNFA 4J4PA 2BNQA 2HPOA 3JQOB 3EOBB 4YUEL 1PJWA 5FUCC 5LGHL 3DJ9A 2AV7B 2BVQA 1AOZA 4YGAB 4YZFE 4YXKH 3WNMA 4JJ5B 4OGQC 1I8LA 2I5YL 2VDOH 4ELKA 1JXDA 3SDXB 3RP1A 1KC5L 4XC1L 2FJUB 3B2VH 1P4UA 4GRLA 1ET7A 3KCPB 5BS0A 1YPZB 3B9KC 2AEQH 4E5XA 1KTCA 4I0PA 1DL7H 4KO6A 4F15C 4Q9CA 3CZUB 4MAUH 3FS9A 3N42B 5CBEA 2HX9A 2WNGA 3I9GH 3TJPA 3UAJD 3ARGA 3OD3A 4LSPH 4OCXL 1I3GH 4EJ1C 1R46A 5JR1H 2O5XH 4N2IA 3RX7A 2I9LA 1FL3B 4RCAA 4P9HH 3KJ4B 4J23A 2NY4C 1C8QA 4KQ4L 2XFXA 3GMRA 1ZA3B 4Y4KD 1VKXA 2X0UA 3KWWB 2JTDA 4ABQA 4O2EA 3BP7B 1YY8B 4RMVA 4BQ9A 5EV7A 1KWKA 1HN1A 1WBXA 3E8UL 4UUJB 5E6ID 3S48A 3UYOD 4AEFA 5M94B 2Y5TA 4Z95H 4JPWL 1ZDQA 3KJ6L 1YEHL 2ZUUA 3EYFB 1U8CA 3WV0A 1JZHA 2HTKD 4CVZB 2WAQA 3KGSA 4G83A 1JNNH 4CADA 3NEEA 1QEWB 1L7IL 3MLTB 1HHIB 2XTLA 3NG5A 3RX9A 4LQFH 4K7FA 4QYOA 2BSSB 4M00A 4K23L 3NP4A 3LRGA 1HYSD 1GMEA 3KLDA 4B5EA 1ZHLB 4B9PA 3DI2B 1V8HA 3Q2WA 3GI9H 5EUOF 1TR7A 1SZNA 2F5AH 2IBBA 3LPWA 4GMSL 3P3YA 4ZOBA 3SYOA 3NCYP 4MNGA 4RRPA 4G5ZH 2ADIB 3IPBA 1EAOA 2CRZA 4K7PH 1IGIH 4NJAL 2NXZC 4NO0B 2VKXA 4OZGA 4ERSL 3JWNG 1ZSDA 1E9PB 1GY1A 1MHEB 2JJSC 1NICA 1MCEA 1R5IA 3E6FB 2VDOB 2A4CA 4ETQA 1KELL 2J1WA 2AJ3A 5EF2A 3BEVA 1I8MB 1Q0XL 2PTUA 3FQXA 5T1LD 5DMIL 4A7SA 1NBCA 1HFUA 3UTZB 4XTRC 1FYTE 4YSRA 4M6OH 3P9MB 4PJEA 4HCRA 5FGBA 4AYGA 2VLKD 1ERNA 2VZ3A 3PWNB 5TGBB 3U48A 4OAWB 4JN1H 4XMTA 2J1ZA 3CDGA 4FF9A 5LAXB 3O9WD 3U0TB 1A66A 1MCPL 3T2OA 4PJHB 2FJGB 5KYWA 4AQEA 3WO4C 2CO3A 3O0LA 4UM8A 1YYCA 1OCWL 3X17A 4Y9BA 2GSIA 2BP0B 3BP5A 4P2QB 2AZAA 3MRGB 2JI1A 5CAYB 3QI9C 2ZKWA 4WO0A 3C6LD 1RK1B 1D5IL 1UVQB 4G2AA 1S7UB 5F1IA 2B1OA 1GOHA 2FZ3B 1P4LA 1PG7L 2OL3A 5KN5A 2DM4A 2RR3A 2CLVB 2F19L 1WFMA 1ETZA 3RTLA 4TULL 3V9FA 2N3JA 1OZUA 1B9ZA 1FZMA 2MIZA 4R2GC 4UB0H 4YHLH 4G8FB 3UO1L 4WU5A 1UOWA 5F0PB 1GSKA 1PD6A 1XAUA 4LBEB 4Z77B 4LZKA 1CICD 1EZSA 2R29H 1XMWA 2CKBA 4FFWC 1GC1L 2VXQL 2WKLA 3LEVH 5EPMA 3MQIA 3ILDA 5E9DD 2GBVA 5C2BL 1MH5A 5HHMB 5I1EL 1UZGA 3MRMA 4NQDB 5I6NA 1JZ8A 1K8IB 2K7PA 4PRPB 3TBTB 1B0IA 3GSVA 3EJZD 3D3VD 3L81A 1U2YA 2IQ9L 3EGXB 2ZKHH 1PPIA 1X5ZA 2CAKA 3NP3A 3DGCR 3O45B 1BDYA 1UM5H 1MFDH 3ZL4H 1FO0H 3DYMA 3LXAA 5F7FA 2DN7A 2EUXA 1AACA 4MMXC 5ICUA 1L5GA 2YA2A 3D7PA 5DD0H 5ADPH 2XVGA 4R8WL 4X6CF 3MREB 5H8DA 3JTTA 5GS1A 4JY6B 4X50A 4HSQA 4LL4A 5D4JA 5ESVA 4PJIB 1QLEH 3V0IA 4XAKE 3WAJA 1UC6A 4GXUN 1NPJA 5KBMA 4HUUB 2C9XA 3X1NA 5A7BA 4KH2A 3JWOL 1MLCB 2UXTA 4KROD 2Q2LA 2DTMH 4YK4B 5EC2A 4Y8DC 4ANUA 3NCEB 3PJSB 4UU9A 5FECB 1PZSA 4CAGA 35C8H 3CSPA 3MOQA 5DMGD 4ZUUA 1XCTA 4B97A 4I89A 5DJAB 4Z7OF 1P7QA 4B9FA 1S7WA 3CTTA 1U3YA 1XH2A 3GINA 1INDL 2MJWA 4XI5D 4ZS6C 5EHFA 1F90H 2YQ2A 4NT6B 1TVHA 3TO4A 4E9VA 2WOBA 4KK8D 5EU4A 5I66B 2XHNA 4O02L 5F70A 5DGRA 1OGTA 2MH4A 4ES9A 2YD0A 1G7QA 3FO0L 5C70A 2X4PA 4U0RC 4ABWA 3UACA 4AKPA 4K5LA 5K39B 2IBZY 5E0QA 3WYRA 1TUPA 3QP3A 3ULUD 1SUHA 4GKZA 5FA3A 2ZWYA 1J1OL 3UERA 3C6EA 2L3BA 4NWTL 4ZFFB 1EHKB 1ZPUA 3B6SA 1N7MH 4GAAA 4K5MA 3N04A 3VE0B 2OFQA 2BLFA 2NY0D 1IARB 1R5WB 4KKLC 4HFWB 1OXYA 3PQYA 1DSYA 1NGZB 3CHRA 5IMKB 3F7YB 1X7TA 2BFVL 3I3BA 1BM3L 2G2NA 4BA0A 2HZHA 3HI6H 4Z76A 1CIDA 5GZND 1EHLH 5B8CB 3QRLA 2TAAA 2DDQH 4UOQA 1FO0B 2N7AA 5IB3B 2Z8WC 3RTQD 1YNLL 4LHUB 4LIQE 3QIWA 5IR1B 3TIEA 1LWJA 3WEAA 4ORGB 5I71B 2OBGA 4G8GD 3B7YA 1ZHBA 3BESR 1TKWA 4PJCF 2WNKA 3TP4A 3DROA 3CZFA 2WIIA 1QLEB 2MCPH 3NSCA 4JKMA 4HIHA 1E9OA 4F8TA 3IGAB 1NCBL 1ZE3C 4YVNA 2D3NA 3A47A 5D7JA 1LO4H 2BNQD 4X0KB 1E2WA 1EAPB 4W9CC 2NCEA 5EZOL 1I9JL 2XKNA 3F5WB 3JZ7A 3LQAL 2VZOA 4Y9GA 5A40E 4J3SA 5E8EB 3G6JA 4DKFL 1E5CA 2ICES 2BIMA 5HYJB 2AXWA 1ZEAL 5I1LB 2FUQA 5CO1A 2MPAL 3OAZH 4S0SD 1VLXA 4PCKA 4QRPB 3VD7A 1A4CA 5D70L 4L48A 1ZCRA 1NDTA 2H26A 3WEXA 4U1MB 3WNJA 3IBEA 1ZLEA 3D69A 1MCKA 2Y72A 3FUJA 1NOAA 1NLDL 5I2IB 5KOVC 2ZYHA 4FMVA 3HZ3A 5EEYA 1LDPH 4UT6H 1Q94B 2UY6B 1IVLA 2OSLB 3ARGD 4HXBH 4RFOH 3C8KA 1DO6A 1V7NL 3ETTA 1QOKA 1VZHA 3CN1A 3D4YA 4IOIB 4XNMB 3MA9H 4PP2A 2B2XL 5DTFB 5ALBH 3UROR 1FE8H 1NLBL 4X6EB 3UZQA 2AK4A 2CK2A 5I6OA 3GO1L 4R26H 1O6SA 1P9MA 4NGHL 2OR7A 1T03H 5L9DH 1S7XA 4Y16A 4JE0A 1Q9OA 4X42A 5I18L 1CD1B 3E3QE 5EF1A 1D6EA 1KFGA 1LLAA 4L4TE 1ZPLA 1BOGA 4Z8FH 3NIGE 3SE8H 1QLRA 4E68A 4KMLB 3ARDB 3NSDA 1EDYA 5EB9A 1Z9SA 3IPFA 2W95A 1AFVL 2IH1A 1MN4A 4KTDH 4IRJB 5J1AA 4KUZL 2E7MA 3BCFA 4IGBA 1JHKH 1L9RA 2N0KA 4RBPH 4NNPL 4JFFA 4MQTB 1S3RA 5DSCA 2E4TA 1ZV5A 2AXGB 1WUZA 3MRKB 4YZWA 5AVYB 4AZ8A 4GO6B 1IE5A 5A1AA 1MJJA 1I75A 2WVVB 3E1F1 1NMAH 4PB9L 1RZJC 1JGLH 3OQ3B 4GKLA 4R5VA 3SKNB 1OAXL 4JM2D 5JQHC 1BFOB 5ACZA 3QEGH 1OGPA 1UYWH 3P0YH 5ID1B 1HHKB 1XR9B 2MMXA 4JRFA 5C0RL 5I19L 4FJZA 3BPLB 2IJ0C 5HPMB 5DJZA 3QUYC 3AMKA 5DJ2A 4W93A 2YZ1A 4Z7VF 1R3LB 3BDXA 2VABB 3H9SD 1ZLDA 1MUJB 4N5EC 2HJKA 3FUFA 1WAAF 1O6VA 1BJMA 1WHPA 3RUGA 4CKVX 3ZKND 1R3JA 3F58L 4L8DA 1N67A 4WY7H 1AO7A 4HWEH 4KK5D 1FGNL 1TETH 2Y5QA 3ZZSA 3AXIA 1NMBH 2E6PA 3OHXB 4PG2C 4X9HA 4AENB 4MDIB 1DQKA 1NGPL 5KBPA 4PLKC 3AU0A 3O4LB 5H35B 3LNHA 2PO6B 3K71B 1I3VA 2EXYC 4NFDA 4JO2L 3P73B 3ENEA 4Z3TA 5F6IB 1R0AL 1J5CA 4F57H 4ANWA 4LKXB 4PS4H 2YPLE 2JXMB 3MRPA 3L08A 4GJTB 4ZSOE 4LPTA 4JZJB 1JF1A 5BO0D 2K70A 1JP5A 4JFOA 2EDNA 4NZFA 1BD2A 4NKOB 1GMIA 4AWJC 3KVQA 4N8VG 3ES6B 3HFMH 3PDGA 3MO1A 4YO0A 4U6YB 3SQBB 1M7UA 2XBTA 4BZ2L 2ORBL 2F8XC 2H4EA 5T3ZD 2EC9T 4DN3L 4YLQT 2P49B 4NCC1 5EU3B 4UQCA 5FHAH 2GTWB 3ULVL 3D2UB 4ODHL 1HHJB 1U8MA 1AE6H 5JOPE 3FQNB 3KLLA 5D7EA 3ME0A 4U3HA 1YMMD 5F3BA 1H3PH 3DRQA 3KPSB 5AYQA 1I8IA 1ZS8A 3JV4B 1IBBA 4HDIA 1CFQA 4UAOC 3ILQD 2FWUA 3N5AA 3BP6A 4ILDA 2OXGA 2Y36H 3GSNA 4LHJB 4P9HC 5DUBB 5B3JE 3VFUB 1XF2A 1VESA 4OFVA 1SDYA 2DI7A 1I7ZB 2B1HL 1PKQB 5E2TH 4ATWA 4ZTPH 5D1XB 4RSVA 3DJRA 4ODBD 4PRNB 4PUBH 5C71A 1MQ8A 3WFCL 3HBGA 4OD2B 2ALWA 1LJMA 2F54D 3RVVC 4CU6A 4JQIA 2EEFA 2WN2A 4F7EB 5EFIB 4ANVA 2VMEA 1CF8H 1FG2A 3MI6A 4LRNH 3VWKB 4PJ5B 4A7GA 3UTSD 2O61A 2YMXH 4L9LC 5IROD 1E27A 4P23D 5EC1A 5AEAA 4DETA 3TF7C 2VL5A 3AU1B 4CDGC 2W94A 3MRBA 5KTEL 3U6XS 4C58B 1B88A 1AI1H 5D7HA 2CGZA 3MUGA 4KJYB 1ZVSB 5E5MB 5HGDA 3GRGA 2Z34A 4WHTA 3TO4D 2E46A 2NNCA 3DVIA 2UUDH 2XTJD 4JM4L 4HUVA 2EVFA 3WE1A 4XNUL 2EABA 5GIRB 2WZAA 4RWYL 2VQ1A 1MXGA 1YDPA 4UDUB 3RLSA 1JYNA 3UDWC 4AKOA 2R23B 2P5WD 1F58L 4D0BA 1TVBA 2CLZA 4NHCH 4KKNA 2AJUL 4HBCL 3U30B 5F3FA 2I7SA 3SE3A 2R8SL 3GRBA 3LNEA 5EIVA 4HCGA 5FYKU 2DLHA 2YKLL 4EOWL 1KJ2L 3RWDA 3KPTA 3TO2A 5IZ7A 1OM3L 4KMTH 1U21A 3JV6B 1QSED 4CMMB 1O7VA 1ZY9A 2FRGP 3ARVA 1FORL 1XGQB 2QFPA 3OMIB 5I0WA 2NR6A 2BNUB 3HG1A 3TYFB 1JCKA 3VFSA 3FU6A 3PPEA 3HR6A 4EI5A 1NGXB 4KHXH 4M5ZL 1H15A 1WVZA 3AREC 5E1AB 3QWNA 4IKKA 4XPTL 5DJ8A 4ATTA 4WJKB 1A4KA 1JL8A 3D51A 4WCYL 1CU4H 2NPLX 1FFQA 4PD4K 5L2KE 1HCVA 1R5VA 4OUOA 2Z3FA 4WW2A 1P4BH 4XVUD 4OQ1A 5BUGA 3WGUB 1DEDA 2VMJA 1DTUA 4JB9L 3IU3B 2D03L 4N3TA 1HINL 2R4RL 3QWOB 1NPUA 3N0AA 4OU3A 3BVXA 1YMHB 1U92A 1BYPA 4HHGA 3FO1B 4XC3H 3N50A 4J3XA 3QIUB 1M56B 4QRRA 2OMVA 2PR4L 5BCAA 4I9WD 1JPEA 3PGFH 4LU5L 3KWUA 1QRNA 4LCUA 1XCQA 5HY9B 5EU6A 1ROWA 4TLUA 4Y88A 4KBPA 4YWGH 4AM0B 2DWXA 4PREB 1FHGA 4OI8A 5B8CC 5EBMB 3VD4A 3VFMB 4F9PC 1G43A 4NHUB 4U3XA 3FN0H 5JW3L 3UBXA 5KYXB 1BZDA 3K6OA 3IETB 2VT0A 1CK0L 5HDLA 3QDJE 5D6CB 4LKCB 3CQPA 2EDYA 2ICEC 5HVHB 2VDML 3C87A 5EIIA 3BH9A 2RIKA 3OLGA 1SLXA 2X41A 2OX5A 4KVPA 3KPQA 2ZUSA 2XACC 5ITFB 5GQBA 4LLMB 2GHWB 4PRHB 4B95C 3H0TB 2D31B 5J5EA 3S34L 1BVLA 4PPTA 2OSWA 4KRPD 2DQGH 5GGSB 5JHMA 4Y16D 1CDGA 3Q3GA 4TVPH 1AP2A 2FYVA 3GKZA 1YEEH 2WW8A 2D3LA 3TA3B 3GK8H 5JHBA 2DJSA 4YDIH 5CJOL 4G9FD 4G59C 4R4ND 1I1FA 3CSYB 4POUB 1RIUL 4Z7UB 2I32A 4NM8L 2QADC 3RU8L 1G7IA 2IV9A 1RVFL 4APQC 4IGBD 4G6AD 4K0OA 4XR8C 1NC2A 3QUXD 5DZ9A 5HDQH 4U3SA 4YFDB 2JIXA 2YAEA 5CCHE 3EOYG 4F58H 2IPKB 3DI3B 3FTGB 1O5DT 1ASPA 3NK4A 4EZLA 4OLXH 3F64A 4DIXA 1BBJB 5T3XL 1P7BA 4PJXF 1KGWA 1T20A 4L9DA 3DX1A 4D9RD 4E9TA 2OQJB 2IWEA 2NY6D 1ACZA 1GGYA 3QR2A 5EN3A 4BSJA 1A4JA 3T2NH 4A55A 4TXVB 2X2IA 3Q1SL 3OM3B 4ZO7A 4HMDA 5A3ID 3K8MA 4Z7WE 2C9SA 3I02B 4LAJH 4XNAA 5HGGS 1TOXA 4GBXD 3ARDC 5IQMA 4LLYA 2VGLM 1DYZA 2DWEA 3QWRA 4IRJC 5FO8B 1DFBL 1AO7D 5SWSD 1K8DB 2PTVA 4NKMA 4NUGL 1A25A 1CT8A 2B20A 1DVFA 2CM5A 4HWBH 7TAAA 5CR1A 5BQ7A 4YSAA 4KPHH 1ICTA 3N06B 2NY3B 1UURA 1UXMA 1YQVH 2CJUL 2FJSA 2O6EA 1IAKB 1OHQA 3MUJA 3M88A 1Y6NR 2OTPA 5CD3A 5KVFH 4OCRL 1HH6B 4OM0L 5AVZB 2ITFA 1YEGL 2PXYC 2XKSA 4NQED 3WXWL 4JHWH 1H19A 1SBSH 2F0CA 3OJDA 3UG4A 4I87A 1TU2A 1TQTA 2AJXL 1A6UL 5FO9A 4P5KB 1FFOB 4MA3B 5DUML 4Y19D 1INQB 4HUWB 2E7BA 3A67L 1N3NB 3QQ4B 3VI3E 4ZPTB 1NFKA 3KHOA 3VFTB 2EUZA 2B0SH 5TQ0L 4BDVB 1U3HB 1F3JB 4ZD3H 4F7MA 5FYLL 2MNUA 2PWFA 4UT9H 3QFDB 2RAMA 1H6EA 3FT0A 3LZFH 3QG6A 4TQIA 4Q7DA 3OHXC 5FDYA 3S3CB 4BH8A 4LOUC 4V33A 3SDAB 5LBGA 4MXQD 3B8YA 4FFZH 3NYKA 5ESQA 2O26U 1A14L 2PO6C 4KX8A 1AGCB 3T1FB 3RVXD 2GUOB 3EDKA 4I0KA 4P2RB 1ORQA 1JWSB 2J57A 1MCWW 2Q76B 2V5SA 3RWGA 4RGOH 3LHPL 1PYWB 1R34A 1EFXA 3THMH 5H37H 5CP3A 3EBAA 4YXHL 4A7UA 5I6PA 2JKSA 4R90H 3O41A 5HPOA 3TBVA 3U4EA 3UTQA 2NDFA 3BZEA 3D6GA 4YIQB 1LEKA 4OQTH 5BJTB 5CEZD 4BM7A 4O02A 1DVSA 4PBWD 2XVBA 3EGSB 2O5ZH 3MRIB 2JK5A 1DJXA 1F0LA 1DVZA 3QEUB 3VFNA 2ENQA 1SF3A 1OP3H 1C1EH 4LE8A 4UNIA 2JF1A 2X3CA 1H3TA 4QR7A 5FB8B 3WIHH 2CO7A 2D73A 1DBML 4RAUA 5F21B 3K6IA 2QSCL 3V6OA 1BQ5A 1N64L 3MNVA 1BMWA 2XNAA 4JKLA 3EDJA 3NJGA 5IOPA 2YGPA 4M7KH 4KAQL 2KLTA 2ZXQA 5DZPA 3DOSB 5GRZA 3D30A 1KIPB 2C4FT 3KMDA 3ZW3A 2DMCA 3MXVL 4Q2ZB 3C60A 1QZNA 1XF4B 4Z3IA 5MP6L 3BSHA 5IMLA 1L7TH 1AZVA 2YRZA 4G43B 4MLSA 5K9OA 4HHWA 1LEIA 2NYYD 3WKMH 1SJHA 1KYOJ 4YHIA 3G5ZA 4DEWA 1MJ7H 3STLA 4TNVF 4ZNCD 3U7WL 3O8XB 4MTMA 1F86A 2MKWA 3NZ8A 1Z6JT 3PPSA 5GGRY 3TJHD 1U8NA 4MNQD 3ZRCC 1DHKA 5GJSH 3MJWA 1J8HA 5FFLA 3ZSTA 4KKZA 3FQ4A 1OTUC 5FYJU 3D25B 4K9EL 4LCIH 2FAUA 2UWEE 2R0ZL 4LSTH 4OIIL 3SYCA 5AYUH 1GXEA 2IXQA 1J10A 1MIML 2X7LB 5D1ZI 2EKSA 3FU7B 3B8SA 4PVBA 1HSAA 1CGYA 2R69H 2X4TA 4X4XB 5JNYB 1EX0A 1C5DA 3ETSA 4EN3A 1JZ4A 3U30C 2DPKA 5ICYB 3HRZC 2NY1D 3ILPA 3H6JA 3SCMA 3A21A 1JZ6A 1DN0A 3VXSA 4OZIB 1QQDB 3MMEA 1KCRH 2CO6B 3UBHA 2CBPA 5DDHB 2WO3B 3NGBB 5LWYH 5C07E 4G3YL 3TPKA 2XIIA 4AIZB 4U6TA 1QRND 3MA7A 2I27N 3VU1A 2ICWA 1UD3A 3T0ED 1PEZA 2F9BT 3D05A 2J72A 2VAAB 4UMGA 3BWUC 1MRCL 2FEDC 4FQ2L 4HJ0C 5AL0A 5F7MC 1QKZL 2PCYA 2LT9A 4V2BA 3SE9L 4OB5H 5FA4B 1FGVH 4N0UE 4JDVB 3EFFA 4OF0A 3VXUE 5TDPB 2A77L 1TZ8A 1JTOA 5AOIA 5KW9H 1QD0A 2ITDB 2XPGA 1NANI 2NYZA 1F4XH 2HLFC 2DJMA 3QORC 2H0JA 4WZ9A 1F6FB 3O2DA 3D4ZA 3PHQA 1G9EA 4OSUL 3RWIB 1U8HA 3ZYOA 5IFHH 2W9EL 3IF1B 3O6MH 1UJ3B 2DQCH 5E99H 3FTZA 5CCJA 3OLIA 2A9BA 1WG3A 3QRBA 4WTXA 5CBAB 3AY2A 1BFVL 4WO4C 2NUTA 4DUWA 3IDNA 2Z31A 1NFDF 3O81A 4NSKB 1XBRA 5IB5A 3MCYA 4WWKA 1OSZA 3HS0A 3FCGA 1OLLA 1NC2D 1G9MH 1N70A 4F33B 4PJFB 1MLBB 2JIXD 1BZ7B 1JWMB 3GS4A 3HAEH 1EEZA 2ZKYA 3DXAE 3MRFB 5HVHC 4TLKA 2V2WA 3A6OA 4QLWA 2FEEI 2QPDB 5BXFA 1UKQA 3WFBL 1DANT 5FW8A 3UIYA 2VLJD 3G5YB 3I6LE 3SGEI 4ECNA 4NUJB 2FHCA 3CUPB 5F93C 4IBUA 3WN5B 2DMGA 3UYPB 1M1XA 1JSYA 2XX1A 3RPIB 4S1DD 5JW5B 1RUAL 4Z7AA 1BQHA 1J05B 2X28A 4X4YB 3L3JA 3EH2A 2FIKB 2JKLA 4EZKA 4ZI8A 1SYVB 3CXFA 1JNLH 1FCCA 5E00A 3S7GA 2JELL 3PAVA 1LILA 2VR9A 1T2XA 1B0RA 4HJEA 2VIRA 4BZ2A 2N0MA 2RMNA 1F6AB 5F88B 1CYGA 2BX5A 4W4OC 7CGTA 5SWZD 4R4BA 5ABDE 1A21A 1AR1B 3BN9D 2B1AL 1K72A 5JMRA 4BCXA 5CLXA 3HZVB 4GG6F 1M7IB 3AAZB 1SJVA 4QCIB 3LYRA 1HQ4B 4BA8A 3BW9A 4HKXA 4MCYA 4PWGA 4XHJD 4ZUTA 2P4AB 3I3EA 1KGYE 1PQZB 3WEMA 3CZLA 2DEYX 4WK0B 3BRDA 3VXTB 4YGVA 4Y1AD 1HNYA 3SJVB 3NMEA 4R7LA 2AAVA 2JCCF 5LGYA 5BOJA 3KPMB 2H1PL 1XB6A 4P2OA 5DS2A 4MJIE 3JWDL 4DO4A 5DWUL 3NJJA 4N0CD 4JFDD 1DBJH 4JR9H 5J11B 3GBNH 5AZUA 2ESVD 5IVZA 1DBKH 1KGCE 2ZOOA 4IKNA 2PCFA 1KN4L 4FTVD 3ZE2F 3IJHB 1AGBB 4OR1A 4MD0B 1CBVL 3HLAA 2Z4QB 3NSFA 4KH9A 3GUTB 3VXME 2D7NA 2QQNL 4FQQB 4APXB 1EXHA 2CHXA 3T2LA 1DLFH 1OSEA 2DD8L 3S5LG 2BZ7A 4J3OD 5CZXC 1DQTA 3ZDZB 1G87A 2ATAA 5L4JA 2BMKB 2IC2A 1EFXD 2WOYA 4DUXA 3P3UA 3LKOB 3U4BL 3CC5A 2WM0A 4RMRA 4PJ9D 1E40A 3K3QA 4FA8A 3JTSA 3IJYB 4KFZC 1J88A 1CZ8L 4PG9B 2VLKB 4WEBL 2FX7L 2JCWA 4JO1H 4X6DB 4F9LA 1P4IL 1U3HC 3N2JA 4EDXB 2GHZA 1E4WL 3Q01A 1QACA 4U1JB 3S88L 1CB4A 4QTHA 4C59B 3FTVA 5AW6B 1KJ3H 3WY4A 1AXSB 2OR9L 4PW9A 3B9EA 3RDTC 4XBEL 5D5ME 2YRBA 1DLHB 1XZWA 1VGEH 4G8IA 1BMZA 1MAJA 1S9WA 1UT9A 3UTTA 3G5VA 3VD5A 4DO6A 1NANH 2DM7A 1ADQL 2ZNWA 1E5BA 5CZKA 3RI5K 3GFUA 4WWNA 1C12A 2H9GA 4MYPA 4ZAKA 4NZTH 3MLVL 3HR5B 3BE1H 2CBMA 3JBG7 3C60D 2ZXBA 3NBNA 1IC5H 4PGBB 5HYSG 3FTXA 1CQKA 5TPWH 1G1CA 4ONOA 3ZTEA 3MCG1 2V33A 5IHLB 1MCBA 4MBOA 1S8DA 2WVTA 1N59A 3MGOA 1FN4B 4Z3EA 1WLHA 4AG4H 2C8NA 3RA7L 3WTXA 5EEZA 5D1ZB 1FL6B 2F53E 5CD5C 1MI5E 3PL6A 4L8BA 1J8HD 3HNVL 4P59H 1VFOA 1QTSA 2EXTA 2LE9A 2BCKB 1FV1B 1I1CA 2BRRL 3GKWH 5I1AB 4YDJA 3MNZA 5AAMC 2YQGA 2HCZX 3DK2A 1NIFA 2J8HA 3BVNA 4I1PA 4AVIA 4B50A 4F8OA 1MAML 3SGEH 3UO8B 4XZUB 3EOTL 4N0FA 1B2YA 3LN9A 3CFCH 4NS0A 2OYMA 1OW0C 4PR5A 5J12C 4FLQA 3EFDH 3SBRA 4R3SB 3W0WB 4E0RA 2NNFA 4TUKL 2KDGA 2XU9A 3D34A 3VXOB 3VXSD 3INUL 1MIEH 4L3EA 1A3LH 2QELA 1P5VB 5CUSH 5TE4L 1O9WA 1E50A 2VLRE 2D2CC 1EEYA 2HT2C 1CVRA 4MDJA 1U8JB 4QRRE 4GYBA 1CFSA 5AAWC 3IGLA 5DURD 2IEPA 1UWGH 4GRWE 1B0GA 4F7PA 3W2DL 2HSIA 1PEWA 4RMQA 1TCMA 2DQDL 1NAKH 1TJHL 2DQ6A 4W9LC 4F1SA 5HI5C 1AY1H 5AOKA 2ZZUT 2XWJB 1WZKA 3HUJA 2VZ1A 1A7OL 1O6TA 4DH2A 4GS7B 3W9DB 4QF1B 3ZDXF 5CCKL 3S97C 3LXBA 4YPJA 3OXRB 1D7FA 4JHVA 3FFDA 4KKRA 2JFCA 2VM9A 1EJOL 2G9HB 1GGUA 4WI3A 4ZOCA 4GUQA 2GTZA 4FERA 5GRXG 1DBBH 1YEJL 5KJ4A 5TTRA 3PWLB 4KQ3L 2AJSL 3WXVL 1I7TB 3F84A 3NGBC 4XHQA 1MCOH 5DYOB 2YR3A 2MQ0A 2OI9B 4LBAA 3G5XB 3SIKA 5E6UB 1PIFA 4PRIE 3RTQB 4DKAA 1E43A 4OCWH 4HJUA 4Y5VA 2YUVA 5A2IH 3VSQA 5LDUA 5I5JA 3X12A 2BDNL 3V5HA 1OIOA 2E8ZA 3HNSH 2YZ8A 2ZAIA 3D85A 5FDWB 2FWLB 3L6FB 2F61A 5CIPA 1F5WA 2Y7MA 5DS8B 3KHQA 4K94H 5CF3A 4HKJA 2Z31D 3HZYB 2LLLA 3RWFB 1NL0L 2WLYA 4WWKD 3WLBA 4M03A 2BNQB 1IGYA 3FXIC 4B5ZA 3KGTA 5A2BA 2BVQB 3BUDA 3GHPA 3TTYA 4NB7A 4ABVA 3L3OA 3F85A 1BBDL 2ZCLH 2VR4A 3TVMD 3GSRA 5TQ2H 4ELKB 2J44A 3LEXA 4ZQTA 1IT9H 3O6LL 4F2MA 1RL1A 1L6PA 1CN4A 5LKNA 5DQDH 4GRLB 4RLDA 5IVXF 4K5PA 5BS0B 1A8ZA 4NNXA 4TLSA 4DQOH 5FUOL 3BVVA 4FXGA 1QPKA 5BRZE 4E5XB 1VDGA 2PW1A 4I0PB 4HXAH 3HS8A 3ZE0E 3RX5A 2AAAA 2VC2H 3SGJC 2OZ4A 5CBEB 3BDBA 1BFTA 4DFIA 1U41A 3ARGB 4FI7A 5BRQA 3VGGA 3H3PH 2WBJC 3FQYA 1G1KA 1T6VN 5DLML 4EBQH 2I9LB 4R7NA 4FKKA 4IEFA 5JW4R 1NCDL 3NPSB 5EUOA 4RMWA 2BVYA 2APTA 2XFXB 3GMRB 1SHSA 1OALA 5EH1A 1VKXB 3T65A 1SEBA 3KNBA 4ICXA 2BW5A 5JHAA 4O2EB 2OL3H 3L1EA 5JPMC 3ULVD 2VM4A 1KB5A 5C86A 1WBXB 2H6UA 1ZLSH 4JFYA 4GP5B 2Y5TB 5E1IA 1NDMA 4BELD 3JWNH 5F7AA 1U8CB 1PTZA 4JY4A 5GS3A 5C0CE 2CKBH 4RZKA 3WN5C 3PAUA 5FV2A 1OY3B 3OC8A 4CADB 4C4KO 2ZX5A 5C7XH 4DKEH 5HHXH 3MSPA 4H0GA 4K7FB 4QYOB 3WY2A 1BEYH 4ODSH 3UAJC 4Z7QF 4F8PA 1ASOA 3LPOA 2E7LA 3PWPE 1QYGL 3CLEH 2V5YA 3P02A 1QP1A 2XXGA 3X2QB 3M6DA 4ESKA 5T1DH 1T66D 1UM4H 4NP9A 3TYGH 1IM3A 5IQOA 3QUMA 4MNGB 4DJMA 3RFZC 1GHFH 4Y4KC 5ILTL 1QHPA 2X4OA 1WCBA 1AR1C 2P5EA 4C83A 3L7EA 1BFSA 2IAMA 4OZGB 3GMOA 4QY8A 4TRPL 1ZSDB 5E6IC 3VG0L 5I17A 3V2AR 3UAFA 4ETQB 1R5IB 2AK1L 5CN2A 4FCAA 3OGCA 1X7QA 2AJ3B 3V7AG 3BEVB 4B9JA 3FQXB 3NRFA 4MVBD 2Y23A 4H44C 5I9QB 4OI9A 3HMXL 4HC1L 4PJEB 2ITEA 3TBYA 3ZT7A 3CV5A 2CMRL 1HIMH 4Z78A 2H3XC 1MJ8L 2DI8A 2VC2B 2X6AA 4LASH 4WFED 1HYSC 3EJRA 3CDGB 4AMKL 2AXFA 1DQDL 4UQ3B 3VFVA 3PV6A 4IMKC 2I7OA 1BJ8A 1XCWA 4OD3H 4AQEB 5KYWB 2KLSA 4UM8B 4PJGE 2GSIB 1WD9A 3BEWA 1RULH 2FBRA 3BP5B 3P2BA 2CIIA 5DLLA 4ODUA 4P3CH 1MNUL 2FLMA 5F1IB 1P4LB 3NUKA 2OL3B 2V9UA 4YPGA 3ZBMA 5KN5B 3HCVA 2OP4L 1GYWA 2ZOWA 3Q43A 5E8PA 1ETZB 3SB3A 4KITB 5JZ7D 3WNNA 4OJFH 2V7NA 1FZMB 2E75C 5T1KA 4H8WL 5ICZA 4WU5B 1FSKB 4B9YA 4ZAKD 1KEGL 4PJ7F 4U6VH 2CKBB 5AALA 3VI4F 1FJ1A 2W92A 4KZEH 2W88A 4N68A 2OMXA 5EPMB 1A7NH 5DUJA 4LVOB 4PHXA 1MH5B 2I9TA 3MRMB 2DQJH 3C5ZA 1QEXA 2F15A 2GT9A 2VQUA 3GSVB 3O9WC 4P4KA 4KK6D 5E4AA 2UXVA 3PLYA 2WP3O 1TTAA 1ZWIA 3HS9A 5KSBE 2OZNA 5D72H 5INCA 5LDSA 5SV4A 3WTTA 3B2UD 3BCDA 3LNIA 4NX0A 1PAMA 3WJJC 2ETWA 4YSCA 3C6LC 3WFEL 1L5GB 4DO5A 4FL4B 2X38A 4ZJ9A 1IKNA 4OCSH 3JTTB 4OFKA 2AABL 5GS1B 1M53A 5J1TC 1W15A 5ESVB 5C0EA 3U0WH 4DEPB 1VB9A 2AKRA 5GGTA 4X7SL 1CICC 4NC0B 4FE9A 1IILE 4BWWA 2VW4A 3ULSA 5EC2B 3NJMA 4UU9B 4A6YA 1UHVA 3RVWC 4QXUH 4K8RL 1IFRA 4ZUUB 2JB5H 1KZYA 1XCTB 2DQTH 1G6RH 3EJZC 1G5GA 3P9LA 1NBZA 4GSDL 4I2XA 4JNXA 1P7QB 3V0DA 1MY5A 4OD1H 1S7WB 4Y9EA 4M7JL 1LHZA 4FA7B 1E65A 2Y1AA 2P80A 3ESUF 4PJBA 6PCYA 1TVHB 3TO4B 3L3KA 1CUOA 4X4ME 4BQCA 2Q5BA 5EU4B 3QYMA 2EO9A 3NTCH 1IBGH 1KENH 4URTB 3INOA 4EO5A 2LU4A 1OGTB 1WWBX 3WKYA 2TSBA 2RACA 1G7QB 1FG9C 3NA9L 2X4PB 3V4LA 2BSEA 4PJ8A 2Q1EA 4M43L 2HLEB 3M7FB 4UM9A 1V3JA 4AQ1A 1F4WL 3NIDB 4GKZB 5FA3B 5FGCB 1JZ7A 4U2ZA 5DVKA 1WTGT 1K2DA 4MA7H 2XN9A 4HWUA 3B6SB 2L7EA 3QDHA 4OLYL 3LH8A 5DMGC 3K91A 4KY1L 2PMZA 3PQYB 3DX9A 1ZD6A 5I73B 3N44B 1X5GA 4XI5C 4LPXA 3KBPA 1G7MA 4KX7A 3L4CA 3HKZA 3IKCA 2VE6A 1A7RH 1RSYA 5T3XD 1F1GA 1AZBA 3BDYL 3QIWB 2VXTL 1AYOA 4KK8C 3SDDA 3TIEB 1N8ZA 3H42L 1ZHBB 1IBHA 3F65A 4I3RL 1MEXH 1NC4D 1TKWB 3D85D 4OCNC 2LR4A 5EEVA 1BWMA 3DROB 3CZFB 2WIIB 3L1GA 4HIHB 1E9OB 4MAZA 1G7JA 2AEPH 4GO9A 3S35L 3DPBA 4QRQA 1YNKH 1MXDA 4XCCH 5D7JB 1U8KA 3ULUC 2CRMA 1U3NA 3F00A 1NUNB 4XMXA 1NKGA 2XKNB 2EDKA 4IBZA 3VXRE 1E8WA 3G6JB 4PCTA 2VRQA 4TNEA 4TQEH 4EKXA 4Q56A 5L88L 1UXWA 1CJYA 2WZ5A 1NCWH 2NX5E 2NY0C 2ERJB 1NUGA 3LQZA 4WUUD 5DC4B 1MW2A 3DO3A 2WXPA 4JHAH 2H26B 3DIFA 4Y4HD 4FQXA 3WEXB 3KPLA 1LD9A 3QXUA 2BNRD 3D69B 3MYJA 2DI9A 2OI9C 4D8OA 1FFTB 3QFJD 2Y06H 4OF6A 3RTQC 2WANA 4BKTC 3PDOA 3II1A 3S37L 5IJCC 5JXED 5I1HL 4LGRB 2OJZH 2LLGA 2R1YA 4X5WA 2NYKA 3GPSA 2QVIA 3C8KB 4R5TA 1LP9E 4O58H 1AKJD 5MENA 4FQJL 4PP2B 3SGKA 1XEDA 3T6XA 4OLUH 2VLMD 3N1QC 5TH2A 4XPGL 3UBXI 3UZQB 2AK4B 43CAA 1CLOL 3IRCA 3TV3H 3JVGA 4Q9RL 1O6SB 1N19A 4W9HC 2C3HA 1TJGL 3FCUB 4H0LC 5FYLD 1ZXKA 5C0DA 4KRPB 1S7XB 1YEIH 4Y16B 4CILA 1FVCA 1Q9OB 4XMUA 4CBPA 5T1JA 4KVCH 1I8LC 3P4NA 4HV8A 2COVD 4B7LA 2V17H 2VH5H 4FEIA 1D6EB 4MA1B 1CLCA 4MD5A 2I60H 1BOGB 4Z7VA 1QLRB 2YUWA 3CFNA 3DKHA 4Z0BH 4D94A 1Z9SB 2GABA 3X13A 2IH1B 4I0PC 5EULV 5J1AB 1YY9D 6FABL 4IGBB 3UAAA 3V52H 5B38A 4JPKL 3MN8A 4JFFB 1AVAA 4FHJA 3ARGC 4Q9BA 3QEQD 4UYPA 3C8HA 3FO9A 5DSCB 2E9WA 3QJHA 4WEEA 4IU2A 4AZ8B 2N7BA 2CHZA 3GSNH 1MJJB 5F1NA 3AWEA 4N2GA 4YXKL 1PAZA 3MV7E 1BCIA 4PMFA 1IL1A 2A74A 4JFWA 1WFNA 4PI2A 5ACZB 4G6MH 2F1AA 2VDOL 3EYQD 4ZXBA 2CHDA 4WJ5A 2X3BA 3QHTC 5DJZB 3B2VL 4XVSH 4CRPA 5J89A 4G42A 5DJ2B 2AEQL 1NH6A 2XLLA 1YNTF 3SPCA 3CVBA 1XH0A 4JQIH 1DL7L 1KG0A 2WTPA 3DBSA 1J1XH 4XPBH 4MAUL 2ZOKA 1WDAA 2NUPA 2OM5A 4KUCD 2HJKB 2RTTA 3I9GL 3RUGB 1R3JB 4L8DB 5ISZA 4LSPL 3FCTA 1I3GL 1UM6H 4UTCA 3VRIA 1AO7B 4B53A 5JR1L 2O5XL 4F20A 3NIFE 2V5MA 2OXHA 4EDWH 2QLVB 5JW4M 1UOKA 3FUIA 2EXSA 2FSDA 3MJGX 5L8KB 2ADFH 3FOMA 1KB9K 4K94C 4KO9A 2SEBA 1UB6A 4YDZA 3FN3A 4JM2C 2EVHA 1EIBA 1OF2A 3L4YA 5DD5H 2OMTA 4Z95L 4YQXL 5CU9A 4L1HA 4LSQH 4QOKA 4YFLI 3MRPB 5AVXB 1S3KH 3KPRE 4BUHA 2UX6A 3OB8A 1JF1B 3QQNA 4G6JL 4ELME 3UZVA 4JFOB 4JRYE 1OCZB 4L8CA 1BD2B 3HE6D 2EEAA 1JNNL 4G9DA 2IF7A 3CFEA 4M48H 4YO0B 3MO1B 5GRJH 1UKTA 2KBGA 2ZXAA 1CGUA 4LQFL 4S1QH 3ECBA 4PQXA 3GMLA 4HEPG 2VR7A 5FGBC 3ZKNC 1U8MB 2E86A 1IGMH 1YA5A 2C1OA 4KK5C 2APBA 3GI9L 3ME0B 1OK8A 2JB6A 2W65A 5F3BB 2F5AL 3C5ZD 3DRQB 1T5XA 1I8IB 1ZS8B 4HDIB 1RPUA 1CFQB 3L9EA 4G5ZL 1A3RH 1YEFH 2H7WA 2YHGA 2Z0BA 3BP6B 3GMNA 2OXGB 3H3KA 3GSNB 1IGIL 4K7PL 1ZLWH 1XF2B 1G0DA 2H47C 1EBAA 2HT3D 2C9UA 2R4SH 2FBJH 3QC6X 5KWYC 4XC1H 5C0BA 3N1MC 3RVTD 2ILLA 4JCLA 5HYEA 5E9NA 3P1VA 4JQXC 1Q9KA 4IRSA 1BSIA 1TYEB 4JFUA 1F97A 2VDLH 1JZ2A 1PX4A 4ENED 4FXKA 4M6OL 1FSKC 4Z7IA 4NRXA 4AIEA 2VSMB 4EIBA 2L4OA 3P0VH 5FYKH 5HI3D 3AY4A 1KACB 4NFCA 1ILSA 4JN1L 1V3MA 5DFVC 1FG2B 2GUYA 4GW4A 3ZHDA 2FBOJ 2O61B 1Q1PA 2OPCA 1CD0A 1E27B 1ZVNA 2AFNA 3DWTA 2OJEA 4NCDA 5EC1B 4HKZA 5F3HA 4OGXH 1SNRA 1WAPA 2GJRA 2VL5B 4FC3E 3S4SG 1XL4A 1JDCA 1HXMA 3MRBB 2YJQA 1F13A 2KQMA 3BX7C 3OL2A 4WV1A 32C2A 1AZCA 3ASWA 5DZNA 3MUGB 3JV5A 5HGDB 3D18A 3CJJA 4WHTB 1K5WA 3PU7A 4HUVB 1YEHH 4MJ6A 5E9DE 5E6ZA 2MCMA 4YHLL 1T2QH 2VQ1B 1YDPB 1CI5A 2R29L 3KPOA 2Y1ZA 4D0BB 1TVBB 2P7TA 2CLZB 3D3VE 3T08A 1W72A 3LEVL 4A7VA 1X6NA 4PJ8D 3FFOA 2FT8A 4N9GA 3NJVA 1XZ0A 1ED3A 4MX7A 3RWDB 3TO2B 4AYDC 1B4RA 4BSWA 5CJXA 2Z9TA 3GRWA 5EZPA 5IROC 2ZKHL 3QDGA 4P23C 3HG1B 5C0AA 3R7RA 3V6BR 3GXDA 3VFSB 4EI5B 1UM5L 1MFDL 3ZL4L 1FO0L 4Y5XA 1H15B 4P8QA 3OKEA 1MDTA 2R7EA 1WA1X 5DJ8B 5DD0L 1RERA 1A4KB 4J27A 3S4SA 4ZO6A 3TO4C 4NQCD 4NBZB 2XTJC 1QLEL 4N2CA 1R5VB 3PS6A 4WW2B 5EDSA 2IPUK 3I84A 4D9LH 4M02A 2CZNA 3GXPA 3HB3B 5CZRA 2OYLA 5EO9A 1SQ2N 4DP9X 1CDIA 2VDLB 4IBTA 1UEYA 2DTML 2VKWA 4TSCH 5JIDA 3CZEA 2IADA 5E23A 1BECA 3BQUD 5LQBH 2P9RA 3IJ9A 3L2NA 1U92B 3E2HB 2DTSA 35C8L 4HIPA 3KPPA 3BSGA 4L1DA 2VZSA 4M9PA 3JUYA 5JLZA 4AQZA 2OMVB 1UUSA 2ZYIA 1SEQH 1QRNB 1Z2KA 2F74A 3KEHA 1XCQB 1F90L 4LCUB 5EU6B 4TVSa 2AQRA 3MVSA 5FW7A 4TUUA 2F19H 1SLVA 3CFDA 3ULUE 2EEDA 3ABLB 3UBXB 3SO5A 5C0FA 2YUXA 2K1MA 2EDHA 3CLFH 4FNTA 1DSWA 4XVUC 3DHUA 2ICWI 1KPVA 4LEOA 3HI1A 3T2QA 3ZDYE 3NH7H 5HTSA 2V9QA 4R0LC 5F9WB 4ZK8A 3D48R 5EIIB 1DJYA 3BH9B 2OX5B 2UVEA 3PF2A 1WISA 3HE7D 3KPQB 3ZKMD 1N7ML 5EBLA 4FP8H 5EUOE 3ROLA 4R4FH 4ALAH 2FNBA 1HXYA 4LF3A 1BVLB 4U7KA 2VN4A 4P5TD 4G8GE 3Q3GB 1PL3A 1AP2B 3SDCD 3HI6L 1WT5C 3BGMA 2AQSA 1EHLL 1CTNA 1D2OA 2WXQA 2DDQL 3NEOA 2DY2A 1NCUA 1I1FB 3BJLA 3QO0A 4Q4IA 5B7EA 2A9NH 3M1OA 4MASA 1XB8A 4UDTA 4GQQA 1MCQA 4G6FD 3CFKA 3HZKA 3ZVVA 1G7IB 2V2TA 3ZE1B 3VW3L 2MCPL 2ARJQ 2DJUA 1ZRUA 3D5OF 4LCWD 4M61A 5ETUA 3ABMB 1NC2B 4YEFA 2FLRT 4UTBA 2E56A 4U3SB 1THAA 1F4HA 2JIXB 1E42A 1LO4L 4J8QA 4S1RH 3U4AA 5MEQA 3GLEA 1BZ9A 4R83A 3QPXH 2QBWA 2LOEA 3NESA 3I6GA 4JUSA 4AL8H 1T20B 2AXHA 1L0YA 5CP3H 4ZXBD 4ZW7A 4KRPC 1DSFH 3NJFA 4Y16C 2GIYA 3JVFC 3DUSA 5E4EC 1A4JB 1OARH 2YXWA 1F2XK 2WXLA 2YAFA 4R4NC 1BVNP 1LDSA 3UOAB 4O02H 1WUNT 4LCCA 2EDXA 1YAIA 4LLYB 3WO3B 1LDPL 4UT6L 1PX3A 4HXBL 4F37F 2DWEB 3FO0H 5IJKA 1E6JH 1T1XA 4RFOL 4L29A 5D1QA 4WFGD 4IGBC 4G6AC 4NKMB 1UGKA 3QUXC 3MA9L 1DVFB 3B2DC 5ALBL 3L4UA 3NCCB 4CC4A 5BQ7B 1FE8L 1ZTXE 2DQHH 5C0JA 2HPTA 2PNDA 4NKQB 4R26L 5KVGH 1BW8A 2DH3A 2HRGA 4JFED 1OPGH 3OB0K 3VGEA 5L9DL 2G9KA 5CD3B 3F01A 4WVRA 4LLQA 2GG1A 3OJDB 2NY6C 1A1NA 1TU2B 4PAZA 5FO9B 1NKOA 4MA8H 2MSPA 4Z8FL 2QTEA 4X6CE 4NLHA 1LQBC 3HI5H 2DMHA 4WI7A 5AZEH 1L6XA 5F7EH 2L04A 5AW4B 3RPBA 3O3DA 5A3IC 5IHBA 4KTDL 2B3IA 2QMJA 4CL7A 2CKNA 5CSGA 1FIGH 5E24E 5I5RA 3VB8A 1JHKL 4GBXC 4Z7NF 4F7MB 1MKFA 5GJTH 4POYA 1RZ8A 3QG6B 3V7AE 3GGWA 1FNGA 2ADGA 4BH8B 4FADA 4O2CA 1NMAL 2KERA 4KK9D 3AITA 1JGLL 3QCUH 4A66A 1ZHKA 2B5IB 5B3JF 1QWUA 2NZIA 5ESQB 3FBKA 3QEGL 1UYWL 4DKFH 3P0YL 1KBBA 3VSVA 3H9SE 3MR9A 3WUWA 3QCVH 1ORQB 1VACA 5KSVA 1XCXA 4ZFOA 4LPYA 3RWGB 1HILA 1M6OA 2EE3A 1HL5A 1EFXB 3VNZA 4K3DH 5CJQL 1BF5A 2PYEA 2QKSA 4J3OG 3O41B 3GIZH 4BZ1A 1KXQA 1MCJA 2J8UF 5AB1A 3FO2A 3TBVB 3U4EB 2ZCZA 3NCXA 3UTQB 5I30H 3BZEB 2J5LC 1LEKB 4O51A 1JERA 1JPSH 4Q97A 1RKRA 4O02B 1FNAA 2BERA 4UANA 4BFJA 4HWEL 2WZPD 1TETL 2KI6A 3P30H 2ZUQB 1NMBL 2JK5B 3VFNB 1XIWA 5F9DC 4DKTA 1EDQA 3LZOA 1UA3A 3CZJA 1BXVA 2CO7B 1CDYA 4RAUB 3GO1H 5FM4A 3MNVB 1HL9A 5FYJH 4MXQC 2FO4A 2XNAB 1Q4NX 4F57L 4X99A 5IOPB 3KLAA 3EADA 4PS4L 5IB4A 5TK4A 3RVXC 4JVWA 5T3ZE 2HG5A 4CN4A 1J5OH 3T8XA 1KJMA 3BFQG 1BQSA 2WMPA 3P4OA 2Q8AH 5TFSH 3TJEH 3C60B 3HFML 1FFNA 1CGSL 1J0YA 1YMME 2L7JA 3II3A 5CGMA 5IMLB 1HAWA 1NEZA 2XQYK 3F62A 5K9OB 1OEZW 1ZANH 1E4KC 1LEIB 3PWVA 2V37A 5FHAL 1SJHB 1W8NA 4YHIB 3G5ZB 4PJCE 3JYCA 1AE6L 3STLB 1CE6A 1AIFA 2EDFA 2XA8H 3PP3K 3QZWG 1Y6KR 4F2FA 3EGDA 5GS0H 1H3PL 4NN7B 1U42A 4OBRA 3O2DH 2E0PA 3NZ8B 5I1CH 3O2WH 1U8NB 3BT0A 4LSRH 1DP0A 2Y36L 2FECL 2W1NA 1J8HB 2F54E 4WQOA 3OBAA 1J5HA 4R5XA 2Y1VA 5E2TL 4ZTPL 3TFBA 5LUMA 5E51A 2IXQB 3C75A 2ITCA 4PUBL 1MAKA 2EKSB 3ALXA 1HSAB 6CGTA 3UTSE 3POCA 2X4TB 1GS6X 1R24A 2HVBA 2Y9RT 3HHRB 2VDRH 2C3XA 3QBTB 4HALA 4NENA 5G4NA 1UWEH 5ICXA 1C5DB 2FDBP 1Z3RA 4EN3B 4A2FA 3O6FD 2Q7AA 5B1JA 2NYYC 2YD1A 4LRNL 1CF8L 1CXKA 4MMZA 3ILPB 1G1YA 5KAQG 2DM2A 2YMXL 3SCMB 5D8JH 1DN0B 3VXSB 5GZOA 3RWJA 3MMEB 1GY2A 1JV5A 3DX8A 4XNDA 4AW7A 2XTJE 1II4E 5LBVA 4HUXA 4V1DA 3TJHC 1PW3A 2P5WE 1AI1L 3MA7B 4PJDF 4EI5C 3FT2A 3U2IA 5DURB 2YGNA 2ICWB 5T33H 3I50H 2H1LM 2G60H 4KJWD 4DTGH 1OT2A 1M2VA 4AY0A 1OTTD 4BZ2H 3APCA 2K6YA 2BS9A 4HLZG 4NHCL 3TX4A 2LV4A 2O6DA 3EFFB 1A4AA 4PIBA 3FK3A 3VGHA 3MLWH 1D6VH 4KMTL 2XPGB 2NY1C 2Z7UA 1MOEA 2Z8VC 1YVLA 2K0RA 3NSYA 3VACA 5IMMA 2ICWJ 3VWJA 4FCHA 3QI9D 2VXSH 2MFNA 3KL5A 2B8OT 4K4KA 3PHQB 4KHXL 3WNIA 1U8HB 4JRXA 2A9DA 4DEUA 3VM5A 3PFUA 2VUKA 1KTDA 1CU4L 3O3EA 1TQCB 1T0PB 2XPYA 2ZP0T 4FXLA 5F7WC 3SODB 3T0EC 1A6AA 4RMUA 1HE8A 4WGKA 1H9DA 3K74B 3QEHA 1P4BL 3CXHJ 2NUTB 1JGDA 3ZKSD 4ZMVA 5LGKA 3IDNB 4TN9A 2Z31B 3QZPA 4P48A 2MWCA 5IB5B 2X2JA 4HETA 4WWKB 1OSZB 3HS0B 1RAMA 1WAAE 3SDXF 2VDRB 2P46B 3LX9A 4UZGA 1QWHA 5F9WC 1EEZB 3FQ1A 2EDEA 3FCSA 4HLEA 4FHKA 4XMZA 1A7QH 4XC3L 2YN3A 2V2WB 3X1BA 5BXFB 1ZVYA 3CNKA 2WVUA 4IBWA 3A4FA 3LZPA 1E5UI 1ACYH 3ET9F 3PGFL 3OKLA 3WFHA 3N42F 4N9OB 3K6DA 2GSMB 3BFOA 3VFPA 1VEMA 1I85A 1M1XB 3BUIA 2YK1H 5HXMA 4YWGL 4HIXH 2B59A 1BQHB 3CK0H 4Z7WF 4OI7A 3BD3A 3L3JB 4JCWA 5DA0B 5IQ7H 2EVJA 3RZWA 2YFNA 4RISH 2CGRH 1NSNH 5E00B 5AVWB 3T6VA 1TFHA 3QDMD 4FQLH 1B0RB 3TN0D 4AEHH 2VIRB 5D1QD 3EUDA 2ZICA 3N1GC 3DECA 2AJVL 4X5XA 4R4BB 1KDJA 4X4KA 2GB2A 3TFKD 3QZOA 4G9FE 3ISWA 3T77A 3VGAC 5C3LD 4MB4A 4GIOA 3T6QC 2GQHA 2DQGL 2H6PA 3BW9B 4HKXB 4MCYB 4TVPL 1G7HA 4ZUTB 1YEEL 3MROA 4NCC2 3GK8L 4YDIL 4YGVB 3KH4A 2FQGA 3VI3F 4MD4A 1OAKH 3H2WA 3KXFE 4P2OB 1U8IA 4AIOA 1IGJA 2R1XA 4C4KT 5HDQL 2Z7ZA 4XZ4A 4D9RE 2UZXA 5IVZB 4F58L 3NFSH 4XN4A 3QWQB 2PCFB 4KTGA 1NCJA 1GC1C 3VXNA 1QSFA 3HLAB 4OLXL 5DHDA 2C9RA 2ZOTA 1Q8MA 3BN9C 4N2FA 1XQ4A 2GBTA 1DQLH 2CO2A 1OGAD 1GPOH 1GL4B 3VSTA 7PAZA 1WGOA 1ZXQA 4K8RD 2QPFA 3HBZA 1GW0A 1JI2A 2LU3A 4TSBH 3T2NL 3QR0A 4YVUA 1O0VA 1JMXA 4HEMA 2C9QA 3CC5B 4RX4D 5SWSE 3KS0H 1AMXA 3JTSB 5L0QB 4BIKA 4PJHF 4I4WA 5C08E 5JIQA 3WJLC 2G5BA 5KSAA 1QO3A 2EQDA 4N0CC 2VITA 2Y7OA 2WXMA 3L3HA 5DRNA 3KBHE 4AV4A 2WLKA 1SHWA 3EG9A 4BFBD 1RZGA 1FWXA 1KPUA 2R29A 4F8LA 5B7MA 4H8HA 3DA0A 4HWBL 5AB0A 3ZRSA 4NQEE 2CCWA 3C5XA 5HHOA 4QTHB 4XN8A 3ZRFC 2WXIA 4HK3N 4MS8D 4CDHA 1YQVL 1FHNA 3JWOC 3UH8A 2V3EA 3BKCH 4Y19E 4BFFA 2APVA 5KVFL 2WNWA 1UCTA 3ECQA 4K3GA 4L4VD 4DK5A 3SY0A 5D4HA 1QLFA 4G8IB 4X9YA 2H8PA 2C34A 4JHWL 4AEEA 1S9WB 4E9QA 2NNAA 1SBSL 3G5VB 2YEZA 4MMYA 3UTTB 4J3OC 1C12B 2H9GB 4ZAKB 4QGYA 3D08A 4LO9A 4JDZA 5E2UH 3I2CH 2WY3B 3PWJA 4J6RH 4PJ9C 4NM8H 2BK8A 2B0SL 4PBXA 4PS3A 2FGWH 1O7SA 4ZD3L 2VERA 4ZO8A 1OP5H 3VW3H 3MFFA 4UT9L 2CA3A 2E47A 3LZFL 3T6ZA 1IKOP 1S8DB 5TF1H 5D7IE 5GS2H 1N59B 2ZUQC 3MGOB 2QJDA 4XP4H 2RFXA 4XNZB 4FFZL 1JXGA 3ZTNH 4PJIF 5DRZA 4HJSA 4I48A 5HHNA 3ECWA 3PL6B 4L8BB 3V6OC 2BOBA 1JGEA 2UWEF 1B4LA 2WP3T 2PKDA 1M4KA 4RGOL 4YBLC 5CEZE 5CIPH 3ORJA 3THML 2EDMA 4YDJB 4DVRH 3MNZB 4D9QD 2WYIA 2V8LA 5I8EA 5J13C 4R90L 3BVNB 4G7RB 4GLRI 1ONQA 1JN6A 3K6SA 5JHDA 3C60C 4N0FB 4LARH 1KBGL 3H1ZA 4OQTL 3ZY7A 1KNOA 4PR5B 2FVNA 4K9JA 1X4ZA 3LRKA 3MV8A 5D2NE 5EEUA 2O5ZL 1DFBH 2UV3A 2EDTA 3VVVA 2CG9X 4E0RB 1UGNA 1C1EL 1F45A 5GZOD 4L3EB 4UQBA 3WIHL 5FOBB 5F0JB 2GY7B 3WTSA 1MW0A 5LNGA 3Q06A 5I15H 4L1BA 1EEYB 1L9OA 3K4AA 3JYBA 4MDJB 4V1DD 2EINB 1CFSB 4M7KL 3W1ZA 3K5SA 1YEGH 2OZ4H 4TQPA 3WFDH 2BHFA 3LQAC 1B0GB 4XN5A 4F7PB 4HZ1A 1N2RA 2VL4A 2J3SA 1VHPA 3KS0J 3FF7A 5CN1A 5DUMH 4GW1A 1SRDA 3HUJB 2F7IA 3A67H 3R19A 1L7TL 1KJVA 3L8QA 1MCSA 4P9MH 2HA1A 3WKML 5JTWA 4MCZA 1OE1A 2VRAA 3APNA 4MNQE 5L6YH 1MJ7L 1Z3GH 4TQ8A 5FYLH 5G4OA 3FFDB 4UILH 1KB5H 4S1SH 5DJ0A 2GTZB 3CFQA 3Q8AA 2Z7WA 4JLRA 1R6VA 1SHMA 3DHMA 3SCMC 1J0KA 4K7PY 3RGHA 4C56A 4P0DA 5KBNC 4IK7A 5GJSL 4GY4A 5IM7A 5TJWK 1DVYA 2DM3A 3KAAA 4W9EC 1P5UA 4PJXE 2VW7A 2XJKA 4NO0D 1FFPA 1T7YA 4LCIL 4TNWF 5IVXA 1FBIH 1XD0A 4LSTL 3TZVA 2EDRA 3VD3A 1D5ZA 4Y5VB 3S3DB 1CF1A 4H88H 3NCFB 3X12B 3V5HB 3C08H 1F2QA 1TJXA 3D85B 1VERA 5CIPB 2R69L 4HKJB 2ZCKH 5F2FA 2P43B 3BIBX 4IK6A 3WLBB 3QUMH 2A83A 1IGYB 4K3EH 1UH3A 4QRFA 1MFMA 5IFAH 4YHNA 3IJ8A 1GVIA 3L3OB 3IFLH 1NUDA 1KCRL 1NCNA 3T0EE 3CFBA 3GSRB 1JYXA 4QDGA 3WMQA 3OMZA 5LWYL 1YN6A 3D12B 3LEXB 3D1MC 4F2MB 3QK0A 4LSDA 4P2QD 3GMMA 1E7UA 1QNZH 3RIAK 4D8PA 4IQHA 4HAFA 5CMAA 25C8H 4Y5YA 2FO1A 3S8WA 4NNXB 3Q6GH 4EEEA 4FXGB 4DESA 3IWUA 5C9KA 1F18A 2PW1B 1JMZA 2IH3A 1L9PA 3MRRA 1ZGLA 4WNSA 4QI3A 1KFAH 5IQNA 2A99A 4OB5L 1FGVL 2X12A 4OVUA 1O9ZA 3KYKH 4P04A 3ASOB 5LN4A 4HJJH 4R7NB 4IEFB 2Z31C 1Z5HA 5D55A 4WWKC 4LOEA 5EUOB 2G0LA 2B9BA 3O3AA 5HHMD 5FKPA 5KW9L 1WA2X 3N41F 3T65B 1SEBB 3OKKA 3KNBB 4FYTA 4AITA 1F4XL 3L1OH 3WELA 3WSQH 1KB5B 1D7CA 5GPRA 2VYRE 3TVMC 4ZOAA 4JFYB 5CNHA 4ZRGA 5A7EA 4AYMC 4JM0A 4OJYA 1NDMB 1X5FA 2XG5A 4JY4B 2LGNA 4G80A 5IFHL 3LVEA 2OR8A 2XWCA 1CXLA 3K2KA 1ZLVK 2OMZA 2DQCL 5E99L 4C47A 4DT2A 1Z1WA 4MGXA 1ZJAA 3SD2A 6TAAA 4N90D 4N1CA 4ZTOH 5KANG 2X1XR 4D3CH 3GBMH 1XH1A 2E9BA 1REIA 4YR6A 1G9ML 4E9YA 3E38A 3OV6A 2VLJE 1BAWA 1YRKA 1XB3A 4YHKH 4GLRH 3V10A 1IM3B 3QUMB 2X4OB 1WCBB 2P5EB 4UAHA 3RKDD 4C83B 5KVEH 3ULVC 3VD2A 2IAMB 3GMOB 4QY8B 3GXUB 5I17B 4WI5A 4A37A 1M9SA 2HP4A 1QBAA 4XH2A 2TSAA 3OGCB 1X7QB 4IJTA 4YSDA 4I77H 3E6HA 2XXFA 4IIQC 2Z35A 4OLZH 5GGTH 4A2MA 2GIXA 2BOCA 1SN0A 4JFZH 5AOZA 1JFQH 1QZ1A 4PJ7A 3LSOA 3MRJA 3VI4A 3TBYB 2X4QA 5SWZE 4KHTH 1JNLL 2G4GA 2ZKXA 5AW8B 4A6YH 4DP6X 4Z78B 2WV3A 1VSCA 3JSSA 4GB9A 3NACH 2P3YA 2AXFB 3VFVB 2E9JA 3PV6B 2EDOA 1U4FA 2BC4A 3MBWA 5KBLA 4HPOH 3MZTA 3BEWB 1T66C 3AS3A 4M62H 5EOTA 4U1IA 2CIIB 3FFCA 4Y1AE 5D5MF 5JIMA 1AZRA 4ODUB 2PLTA 2VUOA 1EAJA 1CC3A 4YPGB 2X4SA 3HCVB 1Z66A 5E8PB 3WJMA 4JFDE 2WQVA 5T1KB 2V7NB 5ICZB 4BGLA 4LVNC 5JUEH 4MKMA 1K5NA 2ESVE 2KT6A 4LHUD 4MVBC 1MY7A 4N8CH 1FJ1B 4JFXA 3OX8A 3ATDA 1CBJA 2OMXB 4FTVE 1BFVH 1DBJL 5CGTA 3WKNA 3ZYZA 5L0QC 4JR9L 4UV7H 4XNBA 4Q0XH 2I9TB 4KNQA 1AQDA 3G08A 4DZBA 1JIBA 3C5ZB 3D39E 2GT9B 5IWLA 1DBKL 4PWKA 4P4KB 5JHLA 4I1NB 1ZWIB 1SPDA 1ZT7A 4Z7OB 5INCB 5K1NA 1OT1A 2DWDA 3BC9A 1TQUA 2BWQA 2IANA 2IWFA 2QDVA 1DLFL 4WUKH 4YDVA 4G8EA 1Y1DA 5TE6L 3VMPA 2D4DA 1PLGH 3MGAA 5JZ7C 5C0EB 1P6WA 3FDWA 4OFYD 3FYEB 5F1OB 2AKRB 3BZ4A 4ZAKC 5IHZA 15C8H 4P2YA 4Z3FA 2GPZA 4L0ZA 2YPKA 4KRMB 1E4XI 4GMTH 5KVMC 2VLLA 4B6ZA 2JELH 4JO1L 5T5NF 3MV8D 3ULSB 4A6YB 5B3NA 4NPKA 3SQOH 1EMTH 4ICWA 2DYRB 2OTUA 5AW2B 3BUQA 2OSYA 4KK6C 3P9LB 1NBZB 4I2XB 1KJ3L 3GWJA 4KOBA 1QBMH 2N1KA 4EVNA 5FGSA 3AROA 3W11D 1HKLH 1FVEA 4Z6AT 4PJBB 3BKJH 3CC1A 3L3KB 3A6BH 4KFMA 3ZKXB 4GRWF 2Y22A 1UUNA 4D7BA 4Y2LA 1J9SA 4H20H 1GZHA 3F7LA 2K6WA 3AUWB 4NZTL 3BE1L 5E4IA 4LP5A 2A73A 4ZS7H 1IC5L 3MLRH 3IDYB 3CDZA 4PJ8B 1RUKH 3A24A 3TH2T 5TPWL 3DX6A 4UM9B 4X7TA 4AQ1B 3L45A 2P42B 3TA4D 1NGYA 1NFDE 1G9NH 3F12A 1K2DB 3LH2H 4AYSA 4DUVA 2XN9B 3RAJH 3BWUF 3ZX1A 2BHYA 1G4RA 4AG4L 3A3YB 3BOVA 1JPGA 4LGSB 1JG9A 3UEZA 3GT6A 2JKJA 3DX9B 1U91A 1Y6MR 4FI8A 2FL5A 1ET5A 2Y7QA 4ZX5A 2FQFA 4P59L 1G7MB 3D9AH 1SXBA 4ZX6A 4HS6A 3IKCB 4BEIA 1VFAA 2VE6B 4Y1TA 1K9TA 1E30A 4LLUA 1EBPA 2J12B 3GKWL 5HGHA 3TZVD 3RGVA 3SDDB 1JVKA 1YJDH 1N8ZB 2FEEL 1JVOA 2XV0A 4AJWA 5D6DA 2VDNH 3TU6A 2NXYD 1RY7B 3OJVC 4AQ8A 2AQ3A 5JA8B 1TJMA 2YD3A 4NUPA 3T0AA 4EIUA 1W0YT 4U31A 4WFFD 3CFCL 3CD4A 1G7JB 2FX7H 4XXDA 5CEXA 2DL2A 3DPBB 3EFDL 2FX8H 4QRQB 1U8KB 3ML9A 1SYSA 1MIEL 4UBDD 4PTTA 1A3LL 1UXWB 2NZ9C 2Q20A 4LSVH 5CUSL 3O4LD 3LQZB 3T8MA 4NM4H 4PV9A 1OHZA 4HGKC 4XBEH 3QQ3A 5AW5B 5GHWH 1KN2H 2HH0L 5MERA 1J8SA 4GO8A 2Q0ZX 3DIFB 4RBPK 1AGFA 4FQXB 3KPLB 5I26A 1LD9B 4GG6E 3MYJB 5L4IA 1IU1A 1G7PA 1UWGL 2MOQA 1E9QA 3MV9E 3ZE0F 3PDOB 1CCZA 1NAKL 3MC0A 3VFGH 1QG3A 1AY1L 4K55A 3SPIA 4LK4A 3HJ0A 2R1YB 4X5WB 5CZVH 2JCCE 3ZHKA 5MENB 2VR5A 3UXFA 2A6KA 4FKEA 2YAHA 5J06A 7PCYA 2XYBA 1BEXA 2WXOA 5TH2B 43CAB 4AC4A 3DHJA 1DBBL 3ZUCA 5C0DB 4JJHA 1XX9C 3KPSD 1JJUA 3L3OC 5HP5A 4RGND 1JK9A 1FVCB 1HXKA 1X9QA 2H5UA 5JIHA 4HV8B 3P4NB 4XWGH 3GF8A 3OR7A 4UF7C 1MCOL 4JN2A 4DPCX 2F18A 4M3JA 2ZSVA 1WICA 3ZMNA 2PPEA 3GBDA 1I1AA 3MRQA 4MD5B 1YNTA 3A0OA 4NQSA 4PWHA 3ABKB 4OCWL 4Y4HC 4Z7VB 1IFHH 1FYTA 3D50A 4YHMH 4QXWA 43C9A 3SZKC 4FNPA 5CLZA 1TSRA 1KEMH 4FXGC 2CK0H 3HNSL 5D1XD 3OB0H 3X13B 2QVMA 5ANME 2WGNB 4N2OA 2LFGA 5JXEC 4K94L 5B38B 2WQAA 2VDNB 2ZPKL 4F8NA 3P2DA 3VYOA 3RBGA 3GMPA 3M8OH 2N4IA 3FO9B 4B96A 2UZPA 4XMVA 3QJHB 4HG4J 1KMGA 2PN5A 4IU2B 3ZSSA 2QPSA 4AI7A 1TENA 2WC7A 3NJKA 2CUMA 5F1NB 3V0WH 3VWKD 2PP9A 3U2SB 4QD2E 1IL1B 2ZCLL 2A74B 3B3IA 5TQ2L 4O5LH 1E4XH 4ZXBB 5DJ6A 1IT9L 4WJ5B 3T0WA 2FNWA 3G6AA 5DQDL 1OTUD 2YGQA 4OJCA 2J25A 2PCPA 4G42B 5DHYA 4AGQA 1C08A 4DQOL 2XY2A 4GQPH 3GS7A 1FZOA 2WAHA 3IVKA 1KG0B 4HXAL 1IAOA 2ZOKB 2NUPB 5FPIA 2VC2L 5AW0B 3QNZA 1TQBB 2DLGA 4GSXA 3RIFF 1V5JA 2J21A 5ISZB 3H3PL 3FCTB 2B3RA 3HHSA 3IAQA 3VRIB 3ZT5A 2MCAA 1YY9C 3VB9A 4LLVA 3ZUNC 3ULVE 4EBQL 5FLVA 2OXHB 4HWNA 4ZFGL 4CW1A 3CZSA 1S2EA 2E7LC 5BZDA 5HYFA 3FOMB 2SEBB 2OL3L 1UB6B 3X3FH 4AX3A 3FFCD 1ZLSL 1OF2B 3Q13A 3EYQC 2OMTB 3QQDA 5DEGA 1OCRB 4QOKB 2YEQA 4PY7A 5IP4A 1KB3A 1T1WA 2CKBL 3UZVB 2QKIA 1W72H 3IS1X 4L8CB 1A9EA 4G9DB 2XZQH 3CFEB 3UL4A 3V5DA 5C7XL 5HHXL 4DKEL 2QDWA 2YPVA 5DK2A 4U1KA 3ECBB 1A6WH 4WEMB 5I75B 3V5KA 1KGJA 3AXHA 3GMLB 3IB4A 4OW6A 4UOZA 1BEYL 4ODSL 2Q7NA 2X3AA 3GRWH 1TZIA 2GI7A 2C1OB 1QFHA 1N9PA 3JZYA 2JB6B 2W65B 4M3KB 5D7LE 3CLEL 4M1GH 4U1HA 1T5XB 4LVHB 5J57B 2UUDK 4OQTA 12E8H 1UM4L 3LQMA 2DQEH 4LFHD 3TYGL 5JYMA 1A6ZA 1GHFL 3OWEA 4JY5H 1YO4A 3BN3B 1M7XA 3GMNB 1PNCA 5EZJA 3B4NA 3QIUD 3EF4A 2IAND 5DCCA 2J88H 5HJGA 2HYMA 5C0BB 1CIUA 3PP3H 2VXUH 4DP7X 1JRHI 4GP4B 2QHLA 1IC7H 1Q9KB 4IRSB 2AERT 4HUKB 1ECYA 4WFEE 1C7SA 3ZZ1A 1DZ0A 4JAMA 4L8SA 5IKCA 3OPUA 3HE6C 3P54A 4FXKB 4XXCA 4DGVH 4NRXB 3TWYA 1HIML 2VDQH 4K9EC 4BSVA 3CFTA 3CVHA 4LASL 3MBEA 2A0LD 4GW4B 1NCDH 4OD3L 4NUMA 4ZG1A 2OJEB 3IFOA 4ZX3A 4HKZB 3C5ZC 5HI4D 5F3HB 3H9YA 1RULL 1HXMB 3E80A 1B0WA 3PP4H 4WV1B 32C2B 4PRHD 1KTKE 5SWQA 3D18B 2HT3C 3IAPA 1LVEA 3OTTA 4MJ6B 4HYTB 3RVTC 4OJAA 3CQFA 3C09B 3K72A 3TA3D 5D2LE 3MXWH 4DCQA 3U7AA 2IOIA 3KPOB 4U6VL 3TNNA 2MQCA 2P7TB 3BI9X 1WFJA 4ONFH 4RAVA 4KZEL 1W72B 4ENEC 2WKGA 1A7NL 3A6CH 3VXPA 5DS1A 3IMWA 4N9GB 2D9CA 1QBLH 3HA0A 3HKFA 3LMJH 4A63A 3MODH 1XZ0B 1ED3B 2DQJL 4MX7B 4EUPG 4YSUA 4CJ1A 3PHSA 3M1CA 4BSWB 3E7JA 2W9DH 2YQBA 2OMWA 3QDGB 5A2CA 5C0AB 5D72L 4N1EA 1CMOA 3MNWA 4MB3A 4Y5XB 3OKEB 2R2BA 1R3IH 2R7EB 3X1EA 1VEOA 1P1ZA 1D5BA 3S4SB 4OCSL 1RH8A 4U05A 3T3PE 3X14A 2NY5H 3ZKXC 3MX0A 4XO4A 3U0WL 5E70A 5I8CA 4DGUA 3MLYH 4OZHF 4QHNA 4UTBH 4F24A 2XQYG 4QO1A 4OZIF 5HYIA 2JLLA 3QRFM 5EO9B 4AGMA 4NC1E 3TCLA 3U1SH 3D0LA 2WWNA 4M7LH 3ETBF 2DQUH 2ZCHH 5IOKA 3IDYC 4K07A 4PJ8C 1KIRA 3NJLA 4FX5A 3B9KA 2IADB 2XQBH 2VDQB 2DKUA 5JIIA 2YD7A 3R06A 2JB5L 2DQTL 3ARRA 3KPPB 1G6RL 3CG8A 3U0PA 1T21A 2W9LA 3MLUL 5D96B 5JLZB 4OD1L 1JHLH 2NY3D 2F74B 1UTDA 3FQTA 4L4TA 4I7ZC 1PG7W 1KV3A 4I0CC 1EUUA 3NTCL 3CFDB 1IBGL 3RVUD 1KLGA 1KENL 2XWTA 2VCOA 4J3UA 2ZWKA 2J2ZA 4N6RA 1YC7A 1ETJA 2WTRA 3FTWA 3M45A 4TVPD 5C0FB 2R9HD 5EEXA 2OW7A 1MFVA 1KPVB 4LEOB 4J2XA 3HI1B 1LP9F 1KGUA 3K8KA 4TSAH 4EIGB 1A47A 3GZQA 4JREB 4OF7A 2BXYA 3GYRA 1H3UA 1BM7A 2GJPA 2GFBA 3BQUC 1HCYA 5EBLB 2BINA 2BS71 3ROLB 2CDEA 3U1QA 4LF3B 1HXYB 1J0ZA 2YD2A 2F8IA 5EOCJ 2WD0A 3J7HA 3SDAD 4XWOD 3M17A