1R17A

Crystal structure analysis of s.epidermidis adhesin sdrg binding to fibrinogen (adhesin-ligand complex)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
321
Chain Sequence
b'GSNVNHLIKVTDQSITEGYDDSDGIIKAHDAENLIYDVTFEVDDKVKSGDTMTVNIDKNTVPSDLTDSFAIPKIKDNSGEIIATGTYDNTNKQITYTFTDYVDKYENIKAHLKLTSYIDKSKVPNNNTKLDVEYKTALSSVNKTITVEYQKPNENRTANLQSMFTNIDTKNHTVEQTIYINPLRYSAKETNVNISGNGDEGSTIIDDSTIIKVYKVGDNQNLPDSNRIYDYSEYEDVTNDDYAQLGNNNDVNINFGNIDSPYIIKVISKYDPNKDDYTTIQQTVTMQTTINEYTGEFRTASYDNTIAFSTSSGQGQGDLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fibrinogen-binding protein SdrG
publication title A "dock, lock and latch" Structural Model for a Staphylococcal Adhesin Binding to Fibrinogen
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Cell adhesion
total genus 83
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r17A02
1R17A 4B5ZA 4RMBA 1R19A 3IS1X 4LEEA 3AU0A 2F6AA 4MBRA 4BBWA 2Y7NA 2YLHA 3IRPX 3AT0A 5CF3A 4FJ6A 4JDZA 5IHWA 4Q6KA 2VR3A 3V10A 2F68X 3ASWA 4LE8A 4JE0A 4B60A 3IS0X 4MBOA 2Y7MA 2Z1PA 4F27A 4F20A 4LEBA 4F24A 2RALA 2Y7OA 4F1ZA 3IRZA 1N67A 5CFAA 4JDZB 2Y7LA
chains in the Genus database with same CATH superfamily
3PHSA 2Q7YA 4WV1B 4PSRA 5CP3A 1YEDA 3I6KB 4P06A 4OIAA 4GSXA 1QLFA 1U2HA 3RILA 1LMIA 2Q20A 3PL6C 2Z4QA 3PQYD 4JRXB 3CVIH 3O6ML 5A16A 5KBDA 4IQHA 3ESPA 3ZZSA 1O6TA 1OAQL 2WXFA 1JCKA 2V3EA 3KGUA 4G6ML 3NSCA 3QHTC 4ONFL 3S34L 4AYFA 4XNYL 2VR7A 4GSUA 5FYJL 3VMPA 3FOMB 4OZHE 3RL1B 1L0PA 1I8IB 1PKQA 2E9WA 5LN4A 1QO3B 3L4UA 1KEMH 1JRHH 4LCYB 2HFTA 4OV5B 1MCBA 1TCRB 3LKSB 4OM1L 3RQ3A 1KXTB 3K8LA 4U6HB 3THMH 3B9KB 3MQIA 3T3MF 3B2VH 2CE6A 1OK8A 5D70H 4JO2H 12E8H 1D6VL 3QC5X 5GRJH 3QUZC 4LSDA 2VDKB 1FL6B 1U95B 4KRPB 1NINA 2FSDA 3EO0A 1NIBA 2W9DH 2L7EA 5L2KA 3RUGF 4QO1B 3VWJD 1UXWB 1KBGL 2ITDA 1ZA3A 2NW2A 3VU1A 4Q2ZA 4OKVB 4G5ZH 4LSSH 5A2CA 1HHKA 4URKA 4CVXA 5F1IA 3ATEA 3PIQA 1JXFA 4IBTA 3EO1A 3HNVH 3QPQD 4MVBC 5IEKB 2A6KA 2IPKA 4N8VG 5E00A 1FFNB 1KLFA 3IJSA 1NCAL 2WZ6A 1MCDA 5LAXA 2WLMA 4OCMC 1YEFL 1EAPA 1N19A 1P7KA 3WNKA 1CXIA 2VQUA 3DI3B 4NO5B 4PJGF 4RIRA 4NUJB 4X7SL 5HYJB 4FOMA 1U3YA 3MV9B 2F5BL 2QKSA 4R7VA 4KNQA 2DM3A 1DQJB 4AGOA 3TO2A 4RMRA 3B6SA 4NQDD 2X0WA 3C5ZA 4RMWA 5I8KH 2VXQH 1ZLSL 3TBTB 1H15B 2P43B 1MCWM 2O4EA 3GI8H 1NAML 3E8UH 3FU9A 3LDBC 4U6TA 4PMEA 3U83A 3LVTA 4DKEH 4R97C 4MA8H 4PGDA 3HMXH 1EMTL 4L8DB 1P0SE 4K5NA 3L4XA 4W70A 3WFCL 3GPSA 5I17B 1EEZA 2J2ZA 5BVJB 5AAMC 2R8SH 1AZRA 1PFCA 2FT8A 1VGKA 5B3JE 5BRZB 4QUOA 1I8MB 2HX7A 1D7BA 3PQYA 1C08B 4HEPA 4JY6B 5AVRB 4KKLC 3V5HA 1ZTXE 1R3IH 2DEWX 2O6FA 2P8MA 3ZTJG 1QATA 3HI6L 2NDGA 4JE0A 3ZDYE 5LCVA 4XOBA 4AKOA 3NG5A 2R15A 3LAFA 3SE4A 4FFYA 2QVIA 3SKOA 2OR8A 3L5HA 1ZGLM 5F71A 3RHWK 1CGSL 2VDQB 5E1HB 3BZ5A 2IAMB 4HZLB 4KZDL 1YJDC 3HG1B 5KVMC 1EEYA 2CJSA 3WKPA 5BJTB 3P77A 1KZYA 3MJ7A 5GJSH 3VXUD 1UKSA 5AVVB 4F7PA 4M03A 5AOMA 1CL7L 5CN2A 2ZP9A 3BN9D 2DQJH 3PWPE 3TWCH 4ELDA 2WQAA 3DO7B 4I8DA 3FTYA 5CBEB 2DWSA 4QHMA 4WNQB 2CCVA 3R0MA 1FUNA 5DK2B 3VWJA 1K2DB 2VLKD 4ODTL 1MCPL 3D85B 1BV8A 3CZSA 4JM4L 4UBDC 3I75B 2WO3B 4L1BA 1MRDH 4PTUA 4BYHA 2CMRH 3ILQD 3FCUB 3GSRB 2MIZA 2DQDL 4FXGB 2Q7AA 3BISA 1S7UB 4RSYA 3EYVA 5FUOH 2NY5C 3VXNB 2OJEA 1P1ZA 1X5YA 4I0PB 1DBMH 2LQRA 4NJAL 1TPXB 5HGGS 3VFNB 2EYTA 4N2FA 1JFQH 2JSFA 4L1LA 5DEFA 3RA7L 4TL5A 4YHLL 2X4RA 3WBDA 5FV1L 3GHBL 1ETA1 2CHXA 1XZ0A 2JIXB 4RGNE 3RTQB 5E8PB 4BKLB 1C8QA 1NGPH 4OF0A 1KTLA 3HHSA 3TFKC 2NRDA 3SBQA 4G70B 3WV0A 2EDRA 2WN2A 5TQ0H 5JHAA 2OTUA 4HUXA 4M4PA 3T3ME 5EOTB 2JKRM 4M61A 4FC3E 4Z7WA 1G7LB 3FUFA 5A7BA 4MJHA 1I9JH 5HDQH 2BOBA 1AGCB 3KM1A 2WY3B 3FB8B 3NCJH 1NCNA 4HXAL 3O3BB 5J9PA 4WTZG 2DW5A 2Y7SA 3B2XA 3PL6A 4FAAB 4KKLD 1CGVA 1RZQA 2V3FA 4F33B 1A3QA 4ODHL 2CNZA 4WFGD 43C9A 5IBLD 4X7TB 1E40A 3P30H 5DJZA 2P28B 4PJGE 1R3LB 4QR7A 2WVUA 2DMHA 1GOFA 1XGZA 3FO9B 5FS5A 4Q9RH 5F89A 3U4BL 1UENA 4J3BA 3VD1A 4Y2DC 3CFDA 3BP6B 4NRXA 4ORGB 4CC0A 4B9ZA 5L7XL 4CSSA 2YAFA 2D0GA 3WU1A 2W65B 1KCUH 4NKDA 4PJIA 2EKSB 5EDSA 3QUZA 1JD7A 1R5VA 2Z8WC 3TT3H 1W72H 1CTMA 2CIKB 3IFOB 3VQ1C 2D4FA 3HFML 4UQ3B 3HTLX 1I1AC 3RL2B 1FFQA 1MCEA 2LLLA 2H8PA 3CSGA 1E2VA 2GTQA 3HRZC 2X2YA 3QYCA 4K55A 1OP9A 1OB0A 5LWYH 4JKLA 1CL7I 1GL4B 2VN7A 1QBBA 4F1SA 3Q8EA 5JA8B 1IGCL 1LTXA 1DFXA 4K3DH 4NN6B 1HQRA 2FNBA 4OZFH 3DDGA 2GJ6A 5DEJA 4LP4A 4D0CA 4XMXA 5ALBH 1AGEA 2ADFH 1A4JB 1A7QH 1BM7A 1JZFA 1S7TA 5DHEA 4BZ1L 2E7MA 2IALB 1QW8A 3WY2A 1MAKA 2AEQL 2ZCLL 3T5WA 1EDHA 3R7RA 3SE8L 2F18A 3FQTB 4N2CA 1RUML 4U6VL 5AVWB 2DYPD 4PLJC 4OD1L 4OZHB 3D69B 5IQ9A 1U3HB 3KWWA 5I6XC 4I2XE 1HL8A 3APCA 4XAWL 3WIAA 4PS4L 3V4VB 4ZPTA 4ZS7L 4RMBA 4HT1L 3TN0D 4ELKB 1KCRH 1CLZH 2BW4A 5AAMA 4YWGL 3FQXA 4YPGB 4G9FA 1ET5A 3O0RL 3C6LC 5ESQB 1WZAA 3OG4B 1J1OL 2RMNA 2WZ0A 2FJUB 1Z9SA 5E51A 3SO5A 1U8HA 2YXMA 4PJXE 1KXQE 3GBML 5DU7A 2ORBH 5E9NA 3K2MC 4LCUB 4OUOA 1Z3GL 2JB5L 4E0RA 1CD1B 3RNQA 4PWGA 2EIMB 4FRWA 5AYUL 4XPBL 3BKML 2IOOA 4ZODA 3JWNH 5T5FL 3VGGA 3FCTB 4BHUA 3V0VB 3QIWB 2X9XA 3OPZH 4PD4J 1EXHA 5F3FA 1S7VB 3VGDA 1HVXA 3ARVA 1QTSA 4AL8H 5SX4I 4Y2DD 5I0ZA 2LU3A 3QA3B 2HRPL 3KLSA 4LQFH 4UT7L 2VUYA 5DWUH 1ADQL 1N6VA 3CHXA 1DDTA 3H0TA 3R06A 3ESVF 1CLYH 3T65A 2F8OA 4XWGH 2YPKA 1QTPA 3K4ZA 3AS0A 3KDPB 4G7YH 5IBUB 4U31A 3UYRL 1A1OA 1FF5A 3CQPA 3FOLA 4UWQB 1QPXA 2X0UA 3BP7A 4JN2B 4M93B 4B27A 32C2B 3CUPA 3QNXB 4HP5A 4JG1H 5I8CB 3FRUB 4G7VH 2YN3A 3BDBA 4YGVA 3T4YB 5HGDB 5EZIL 1LL1A 4PVBA 1JYXA 4GXFA 4G5AA 1CF1A 4UINL 2YBRB 3ZDYB 3QSKB 5C0RH 5JHDB 5EUOF 3KJ6H 4KRLB 5TE7L 4YSQA 2P8PA 1JXGA 5C0GB 3S8GB 1E6JH 3AUVA 1HE8A 3S6CA 3HN8A 4UQBA 1JGUL 3RWJB 4XN8A 5B38A 4N22A 4JY4A 1JPST 3O11A 4OFPA 3NFPB 2YC1A 1A9BB 2A1WH 4M5ZH 5DD5L 5IB2B 3ARPA 1U8CB 5LBGA 2BRQA 1PZBA 3D3VE 3H56A 4JCMA 4KU1A 4P9HH 3OF6D 1BIIA 3NZ8A 4PCSA 3PWPB 1CI3M 3ARUA 3U0PB 5IFHH 2R2EA 2UX7A 1L9PA 4U1GB 3SGKC 4X5WB 1Q72H 3LXAA 2D3NA 1EUUA 4FQJH 3AGWA 2LAGB 4LLQA 3ZO9A 4LT7A 2K70A 4QTIL 1NJ9B 4ZNCD 3LKNB 3GLDA 1LQSR 3GSNB 5T1KB 1YDPA 2Q3XA 3IDXH 4LF3A 4X4YA 5F97E 4LLVB 5KSBA 4F80A 4LCCB 1HINH 1SLWA 4YR6B 5C07A 3EFFB 4R0LB 1XWVA 3FH5A 4Y5VB 3GF8A 1JMXA 3RFRA 1HXMB 2NX5B 3S36X 5HYQA 3N9GL 4RGNB 2H6UA 4Y2DA 4DKFH 4EQ2A 4HIHB 1M1SA 2JI1A 1LP9E 3GQFA 3ZE0F 2GJJA 4J28A 3MRJB 4UM9D 5E08L 3W0WE 1ROCA 4KBPA 5CEZH 1T0PB 2OLDA 3L2MA 4Q58C 4YDVB 1H3VA 3S0PA 1GGUA 5DC2A 3QQ3A 3I6LD 4P0DA 5JPNC 3KGTA 2WLZA 1DQLL 3PPEA 5KVDL 1I1AA 1UZ8B 2EEFA 4APXB 3HRZA 3JQOB 2BSED 4U4BA 2I9LA 3LKOA 3QFDB 3JVFC 3P9LA 3BE1L 4DESA 3RIFF 4F7TA 1IM3A 1YEHL 3ZY7A 1IC4L 3W11D 5L0QC 4R83A 4XNZC 4Z8FH 4A7QA 2WK2A 3LPFA 4PW4A 3EYFA 4WJKB 5EU6D 4EVNA 4PJ7F 4IYKA 3W2DH 4PY8J 3DMMD 4XMVA 3TBYA 1I1CA 3E80A 1T5XA 4XP5H 4FA6A 3G5XB 3DK0A 3GLEA 3V52L 1BG1A 2UY7A 1UM4L 2G60H 3QQ9C 3H7BB 4K3JL 4GSDH 2NW3A 2YZ8A 4JCLA 3Q13A 1OT2A 1F11A 1MJJB 3GIVA 3DECA 1M3IA 4Y2NA 3DPBA 1SPDA 5IFAH 1PJ9A 4AJWA 1KGXA 4QF1A 1VIWA 2CK0H 2NPLX 3MRNA 3DV4A 3X14A 3MRQA 2BP8B 3C6LA 1UJTA 4KKBD 1PQZB 1HYSC 5F8QC 5ENWB 5SWZD 1IGTA 2WOYA 2QSTA 3F04A 3OZ9H 5JW3H 3FS9A 1YC8A 4XP1H 2Y7LA 3PDGA 4BD4A 4YO0B 5BW7C 3GKZA 1WFMA 2EZ0D 5C70A 4AGMA 4YSTA 3L3IA 4E41D 1AH1A 1TENA 2CNYA 1PS3A 1D2OA 3NFNB 4I48A 4KTGA 1EHXA 1INQB 3N43F 4M48L 1VA9A 1DJSA 3NZHH 3UPRB 5EUOE 2BVYA 1R46A 4AYSA 4ZX6A 3IT8D 4NZRL 2VR9A 1F58L 4QRRD 4NO3A 4QRQA 1WBYB 1UA6L 1OOAA 3BP4A 2N4IA 2C4FU 4JDVA 1IU1A 5AKTA 3TBWB 1OY3B 4I2XB 1YMMA 4NQCD 4Y4HD 1NCHA 1RJZB 4M3JA 4C4UA 1G4RA 1NKGA 4Y19E 5JQ6H 1DQQA 1V7MH 4KVNL 4NWTL 5T3XH 2ZQKA 3TEXA 2GK0B 3O2VL 3O6LL 1C9SA 3MJ8A 3SE3C 3BWSA 1FO0H 3HG0A 3PWNB 3J2PA 1OTUD 3BXNB 3B5GA 5DK0A 5AZ2H 4OBSA 2C1PB 1VZIA 3HNTH 3O4OB 4NQQA 4KX7A 5T3ZE 2FECL 4PJXB 4BFFA 3GSWA 2CDGA 4S2SA 4OZGE 5C0CD 5CD3A 2NYZA 1N0LB 7CGTA 1YUHB 3FU3A 2V2WA 2NY2D 5EZPA 1MFEL 3QE5A 3W9DB 3J27A 3H55A 2WQUA 4DZBB 5I1LB 1BJMA 3N04A 2CXGA 3FUEA 3F12B 3CZFA 4IDJL 4OLYH 2BSRA 3OG6B 3ZU8A 1ONQA 4O02L 2PTTA 3T4AC 2E9BA 3L3OC 3S97C 3WDJA 5GRXG 4NM4L 1AHKA 4LLYB 1H8LA 2WCPA 2WXNA 4IHOB 2NNXA 2YPLE 1JHTB 3SGKA 2AXHA 1GHFH 2O26U 2LAAA 2ZUQC 4XO9A 5EFIB 4X9BA 8CGTA 2Y7OA 4UMGA 1FAIH 1OGAE 5EU4B 1G84A 1SEQH 4GG6A 1LK2B 1H3GA 4E41A 4GAJH 4G1EB 3NEXA 5E6IC 2IMNA 2AP2A 3EBHA 3L1FA 4YSAA 3D2UD 3PWVB 2VN5A 5FHAL 4OD2B 4U6XA 7PAZA 5HHQB 2WYTA 4PJ7E 4UQCA 4CUCA 2Y1AA 5DUMH 1OAQH 1ZE3C 3VACA 5IMOA 1A2YB 4ONFH 1DJXA 1XCTB 2ZD0A 5LHDA 2XN0A 2EP6A 1HI6B 1U2YA 2RIKA 3BH8B 3LIZL 2WXGA 3QDGE 3GUTA 3ZE2F 3ZR5A 3KVDD 5JPNA 4RAUA 4LFHD 1BAFH 1FG2B 1E9PA 2W59A 4Q0XL 1MWAL 3ARBD 4OM1H 3LN5B 5GS2H 1UURA 3RY4A 1PYWA 3ZRSA 5CMAB 4Y9BA 2AEPH 5I9QB 1A7BA 1SXAA 4K8RL 5PAZA 1JPTH 1ANUA 2RACA 3VFWA 2MQGA 2RBLA 3ZQ9A 1UYWL 3QUML 4YZFE 2UZYA 3EYSL 1UVQB 4NQXB 3GUFA 4Y5XB 4L18A 5GZOD 1GTNA 2EIZA 1Q9LA 1ZT4A 4G6KL 4G1MA 3BUQA 2WQXA 4MNQD 4K9EC 4Y7OC 3WUWG 5AZEL 4JFQA 2F1AA 1NCAH 4N2EA 5IM7A 4QNPF 2RQEA 1Y6KR 4HQQH 4LMQE 5GJTH 5ABZA 3KPMA 1ZLEA 4KQ3L 5J57B 4X5XA 5JPMB 5JNYB 1E5YA 2V7NA 2CRZA 2K7PA 1OCRB 2DWDB 3T2NH 1LP9B 2OKMA 3MLZL 4YIQB 2HVKB 1KCWA 2FECI 4FQPA 3T04D 1MIEH 3EKCA 5FEBA 3U79A 5C0IB 3MA7A 5IW6B 5IVZB 2XZAH 1W8OA 4X98A 1ZLSH 2DIAA 3VXPA 4HHAB 3ZE1F 2PWDA 4W4OC 1OGTB 1AZUA 1XGPB 1QUPA 2XV0A 2CBPA 5C0NC 2MHAB 2XKSA 1NEZB 4Q74A 5MEOB 1G6RH 1M71A 1F86A 1AXSA 1AO7D 1ZCRA 3CLWA 2D3VA 3WFCH 2DLGA 4N4YB 1WIOA 2ZJSH 5BW7A 4E5XG 3QQDA 5F1KC 1UWXH 3EJSA 3MLRL 5CLYA 3PGDB 4WUKL 4HMEA 2WYIA 1EVUA 1I8KA 1CE6B 1OSZB 2VXUH 5HDBF 3K6FA 1NCWH 4YHIB 4Z0XB 5KYUA 5L4IA 1AKPA 2WXLA 3UJTH 4RBPK 1I4FB 1XMEB 1NAMB 1NH6A 2HFFA 3QCVL 4NKMB 4RWHA 4UYQA 1F45A 3ULVE 2V2TA 1H3PH 4H0GA 4UU9A 1QSFD 5EC1B 5HGHA 4XMZA 4LEXH 1OARL 1QG3A 3MFFB 4XMPH 1E65A 4A67A 4YZWA 1N6UA 2V0AA 3FU5A 3GXTA 5DHVH 1J1XH 2CKBH 4R4NC 5JYLA 4XC3L 3SE3A 4IBUA 2A3TA 5E9DE 4CKQA 2EDJA 4DW2H 1B9ZA 2X41A 4LU5L 1L9MA 4WSJA 5CAYB 3QORC 2NY0C 2FIKA 4JLRB 1S9WA 1MCPH 4KFZC 4I4WA 4MCZA 4OFIA 4DP4X 5IQMA 3TIDB 2VYRE 5K1NA 4MNQA 1WC7A 3E3QE 2P5WA 4RZCB 4X8JB 4P2OD 4ODVH 1CR9H 4NOFA 1Q0EA 2VXVL 1GS7A 1YNLH 2AJ3A 1QEXA 2WLKA 2Q87A 3AU1A 4P3DB 5EIIB 2R1YA 1JVOA 4XZUB 3GHPA 3AQDA 2DWEA 3HBZA 1XEDA 3RA7H 3QJQB 1KZQA 1NGZB 4UT6A 4EBQH 1KFAH 3T4AA 2M83A 1IFHL 1Z5HA 1UB6B 4WGVB 5JIPA 3Q7JA 1SN5A 3L3OA 4MDIB 2G4GA 1RZFL 1SLVA 4HJTA 4WZ9A 3VM5A 2K6YA 2A4ZA 1JTTA 1MHPH 2CBOA 1K5NA 2NYYC 3EOYG 1Z32X 1KIPA 5DTFB 4J3OG 2JJUA 3TGXA 3WN6A 3B8SA 4QD2E 3H42L 4TQEL 4XE0A 5DJDA 5LXGH 1I1YA 1AJ7L 1FNFA 1WBXA 2GQHA 1MHHB 2BNRB 5C0ND 4MX7B 1JZ8A 1OZUA 2OAAA 2OMWA 2WJ5A 5IREA 2N7BA 2V33A 3BQVA 3BVTA 4JFPB 1MFCL 3S5YA 1X7QB 4ZZFA 5E6IA 2Q76A 4HG4J 1GC1C 5KSAC 4HC1H 3T0EE 3PAUA 5GS0D 3UJJL 4ZFOL 4IBYA 4MNHB 3UBFA 5C09A 4Z78A 3QAQA 5FECA 4OZGB 4ODHH 5I1CL 2ZPKL 4FS0A 2AXFA 4DTGL 3TBBA 1BJ8A 4Z76A 2J8UA 4OLXL 3QARA 1EJOH 2X9ZA 4RQQB 3RNKB 2VL5B 4JG5A 4YS4A 5EN2A 3P9MA 2LU4A 4PY7A 3GFUA 4AQAA 2X1PA 5BPPA 3GS0A 3HZVA 4HWBH 4PJ5A 3QFJA 4JRFA 4I3SH 5E8EB 5T1LD 1MW2A 3SQBA 2F58H 2YD1A 4NJ9H 2YPLB 1U21A 2ZKHH 2Q9OA 4AV0A 2NY0D 1GIGH 4ILDA 4ERSL 5I30L 3SKNB 1UWGL 1OGAB 1JNHB 3K6NA 3TNMB 2H1PL 4PV9B 1BG9A 4RISH 2VLLB 4WSKA 3LVEA 3SPVA 4PG9A 3FB6A 4R2GC 3P0YH 4WEMB 4DQOH 3BD5A 2ZYRA 3C6SB 1SMAA 4RGOL 4TLKA 4FYQA 1IGCH 5HDBE 1A7RL 1LVEA 1RFDH 3P1VA 1OIOA 5AYQA 4RRPG 4R7DB 4TPRL 1JPFB 4F8TA 2R69L 4GKOA 1WGVA 1JK8B 2X70B 1HK6A 5BQDA 3MRHB 4J4PD 3VFTA 4YC2B 1A4BA 4MQXD 2WIMA 1YLBB 2ZCLH 4U2ZA 4WKZB 3TWYA 3C5SA 3C87A 4PGZA 4OD1H 4BRVA 5A3ID 3QDGB 2F53B 2ZWSA 3BHBA 4W4OA 1HXYB 1RZKL 4WDIA 3KNBA 3F85A 5LNEA 2F54D 2XTJC 2PPEA 3MLYH 2MNWA 1S5IH 4XN5A 5LBSA 3WO3B 2Q10A 3PNWA 4NQVB 1UA3A 2E9GA 4P3WA 1U2CA 4IRZL 4X8CA 4IGBB 4H13C 4ONGL 1CFSA 3TZVB 4ADGA 3RUGA 5TJWK 3UTZB 1G94A 1BA9A 4R4FL 3O0RH 3LQZA 4ES9A 5F3HA 5G4NA 1VLXA 3ROOB 1JWUB 4A2FA 5I5RA 5TH2B 3S3CB 2QSCH 3FUMA 2YRLA 1L5GB 2F0CA 4PJEF 2H3NA 3ZDWA 1ZIAA 1KB5L 3UYPB 5J11B 3MMEA 3UDWC 1F8TH 4CVZB 1ZLWK 1XR8B 2AABH 4PJGA 4JZOA 3PV6B 5AYUH 3BKMH 1QLEB 3LMJL 3ULUL 4FN0A 4JNXA 4DGYH 1I3RA 1DVZA 2EUZA 4YN3A 3ZL1A 1XCXA 5T1LA 1HT6A 1J5HA 5KBPA 1RK7A 2A77H 4H26B 5AB2A 3E6FB 4OJYA 2HRPH 2OXHB 1GYVA 2H6OA 1T6BX 2Y25A 3QORA 2V5SA 2AQRA 5CUSL 4BKTC 4P2QD 4TQPA 1SDAB 2X7LB 4XVJH 1CC3A 1MSPA 3C2AH 2OZ4H 4NAQA 2M1KA 2BOCA 4JFFD 2APVA 2KLSA 1IILE 3UYRH 2EVGA 2D2CC 2MPAL 2MCMA 1HOCA 1K8IB 3IGKA 3EYQD 1DDHA 3MUGB 3GMPA 2PCPB 5BO1H 1A6AB 3ARFD 2XVGA 2NXZD 2YD2A 2NY1C 1BF8A 4ZTOH 4LLUB 4MD0A 4UINH 3QR0A 3RWGB 4KITB 4EIBA 3DIDA 4D94A 5TE7H 2JJSC 4PJ8D 2Y22A 4TNVF 2ENQA 3NZSA 5JZ7D 3DYOA 1DJGA 2HKFL 4TRPL 3HIZA 3MV8A 2D7OA 3TT1L 4UIKL 5I76B 1ZRUA 3C6EA 1CLOH 3MRKB 2Z65C 2ZCZA 3KEHA 4LVHC 3ASWA 3TVMC 2QQNH 4QHLB 4N0UE 4LLDA 2AQ1A 2ZUVA 2A9AA 3MRDA 4OGYL 2FATL 1PTZA 2IBZY 2R2CA 3VRIB 2P26A 4HS8L 3TS8A 4G8FA 4LIQE 5MENA 5KSAA 4IJ3B 2J25A 2IH1B 4LCVA 2P24A 4JX0A 4AW4A 4WWNA 2KKQA 2WXPA 3O6KL 1NIFA 2QQKH 4L0PB 2QKIC 3MJGX 1KBPA 2WZAA 3QZWA 1FAKT 2Q8AH 3KYOB 4FNQA 4AVIA 4N9OB 1UEMA 2BCKB 4PYGA 1K6QL 5DHYA 5FOBA 2VM3A 3SKJH 2B08A 5C08D 2KUTA 4JPWH 4H4NA 4LHUA 1FN4A 1XZWA 3EJTA 2IJ0C 4LPXA 5TE4H 3F7QA 3LZQA 1FVDA 4PCYA 1EXUB 2BRRL 2VLME 4WEEA 3BZFB 3CC5A 4KKRA 5E08H 3H9SE 3QS2A 3M1BB 4MAUH 4N26A 4Z7VE 1U93B 1Z66A 2W0LA 4Y1AE 3T77A 1ES0A 3KBHE 4KROD 4J3UA 1JDAA 4D0BB 3SDYH 3ZGHA 1T2QH 3TTSA 2N0MA 2K4AA 4NB7A 5D4IA 1QBAA 2SEBB 4ZMOA 2ADIB 1YN6A 5AOZA 4PHXA 4GRWF 3BE1H 4BWTA 4LRIC 5CKAA 3SCMD 2Z6FA 4C83B 3T0EB 4J2XA 1OVZA 2LTQB 3JXAA 4D9LH 1ZVYA 4BELD 2VISB 4PJEE 2NY1D 3RWCB 1S8DA 3ZW3A 1JGLH 4EUPA 3NPSC 3BEVA 4WWOA 3U6RB 2FDBP 4LNVA 3IETB 4IRJB 1T4WA 1U8PB 5JOFA 3DHUA 4KWUA 1Z9PA 4R4BA 4X8XA 3ATDA 5AUMA 3V52H 4LP8A 3FW6A 4WUUA 1JHKL 4ZOBA 3UTQB 2EC8A 4GQ9L 4KQ0A 2F68X 5IB1A 3TCLA 3WL9B 2WYHA 4CJ1A 4FL4B 2GIXA 2OYPA 4IU3B 4D3CL 2MQCA 2O5XL 4QRFA 1WD9A 2EEBA 1MFVA 3DO3A 4MAZA 5B1JC 4C4KT 4P07A 1XF3A 2VAAA 4XBPB 4XTRC 5DMGD 5TTRA 3VWKC 1QHPA 4Y5YC 2VLRE 2XN9E 3DOSB 1HEJC 1RJCA 3D0VB 4NGHL 5IMMB 3NH7L 2XZQH 1JDDA 5TDOA 3WFDL 3UDWA 2YHGA 1JZ2A 4HETA 5EF3A 2YAOA 4CDHA 4HJ0C 2X4OA 4AZ8B 3FQNA 2GJZA 1N4XL 3E0GA 4Y9EA 5IQLA 2QTEA 1G1CA 4OIIH 5I8EB 3V7AG 4KV5F 1BQHA 2VZ1A 5D7KD 3Q2WA 3UACA 2C3HA 1S7WB 4WI0A 3MODH 4FABH 1F58H 3DX9B 3HPJA 2H6PA 3LRSA 5IV2A 5HVFB 1UA6H 2EVIA 3VFGL 1ZHLA 1BOYA 1MCHA 2VNCA 3TH2T 1NIEA 1YPZF 3HRPA 5FW6A 2IH8A 4U7MA 3WIHH 4N8UA 3WEXB 3AGVA 4IRSD 2CHWA 4L9DA 2VDMH 4NWTH 1ACCA 3ESNA 3S88H 4BWWA 2OX5A 3O6LH 2IDUA 5FCSH 1YECH 5DXWA 1JS4A 4KI5D 1LE5B 1XGQB 3QGVA 4I18B 3ZBMA 4PRID 4CSZA 4LKXA 3EHBD 5J6GB 4BDVA 1AQMA 5DHXB 3BIBX 1S7SA 3MBEB 2GEEA 4K7PH 5A43C 3GXMA 4MD4B 4RNRB 1UJ3C 2DTML 5K9OB 3RKDC 4D0DA 2C5DC 2JJSA 3U1QA 3QO1A 3LHPH 2ED9A 4Z7QF 1E28A 2YWYA 1ZV5A 4ADJA 5T1MB 4S1SL 4AYGA 2APWA 4IDJH 4GAFB 3M46A 4YK4B 4KZEH 2HKAA 4OI8A 1XIWB 3TVMA 1EX0A 2LR4A 4POZC 3WTXA 3BWAB 1ORQA 2MNUA 4K5MA 4JFVA 4D7PA 4ZXBB 5C0BE 3IGAA 3NRFA 1VEMA 1J12A 1H6TA 3CFJA 4WLCA 1NIAA 1JI2A 4MZRA 3UBGA 3EG9A 3WN5C 5IROC 3BJLA 4BQ6A 4OQTL 3E6HB 4E9XA 3VWKD 2HUHA 4BQ9A 1FZJA 1D5ZA 1S3KL 1CFVH 5B7MA 4HIJA 2VRKA 4BEIA 4KKZA 1E8YA 1BFOB 1QSED 2QKIA 2X88A 3HZKB 4FTVD 4O02B 2G5BA 4R9HA 3ZQXA 2C9QA 5DD6A 3A24A 3T0VA 5IFJA 3BWZA 2JXMA 5FHAH 3MX0A 2NY3D 1KWGA 1BXXA 5EUOA 3DX1A 5LGHL 2BMKA 4WI7A 1AGBB 4PREA 2DBLH 1R1CA 1X9QA 3TA3C 3D34A 2PWGA 2HRLA 4UT9A 5F93C 2L7UA 2WXRA 3SYQA 4RA0C 5IK3B 4UMSA 5KAQG 2WVVA 1X9LA 4JHZA 3OKOB 4PRPD 1T0MB 5D7LD 4ZS6D 4ZX3A 2BK8A 5D4HA 2PP8A 1IBZA 2L0DA 3DSNA 2N1TE 4Y19A 3NEOA 3WYRA 1AXTH 3CCHA 1DVFB 1NM9A 1MWAH 4N0UB 3SQOL 1TQWA 3WOVA 1NANI 4HS3A 5JOPE 5I15L 3IDIA 4L48A 3IE4A 1SJHB 4LSPH 4OCWL 2JKTM 1OTTD 4JHUA 4LRIA 1NAKH 5D1ZD 2GAZB 2OL3H 2XQBL 4Z7UB 4BFRA 4QXTB 2AJXL 1RV6X 3RZWA 4TULL 3QWOB 3CZJA 4G6KH 1F4WL 1T1XB 4OVVA 1TZIA 4GLRI 2MCAA 2P8LB 4M1CD 1CICC 5ECJE 1N6QH 2AV7A 2HB0A 2VR3A 1QVOB 1OK0A 4NKOA 3V2AR 4L3AA 4KV5E 2GI0A 4ZUVA 1SNRA 1F3JB 4HD5A 2VXTH 2PWHA 3FQWA 4Y16D 5CR8A 1OWRM 2A9MH 3QJSB 1VFBB 3OC5A 5GRVK 4FZEL 2ICWI 4UNVA 3F05A 1KV3A 1PZ2A 5K9JL 3H9SB 1Q9OA 4KJPC 3ZN6A 3N1PC 4Z7VB 5B1JA 4NT6B 2O6CA 1VCBC 3H4HA 5L9DH 2IGFL 4RAHA 2KPNA 3MLTB 3SOBH 3VWKA 3WY3A 4H1LB 4PRAB 4MQ7A 1DVQA 4WJ5B 4Y5YA 1G7IB 2VDPL 2FJFA 3T3PE 1EH9A 4YXKH 3QBTB 3VQLA 3BZEA 3UBXA 1QSEA 3G5ZB 5IHUL 1IKFL 4DO5A 2PW2A 4L23A 5H35B 3EJUA 2HLAB 3MLRH 2OJZH 3TJPA 1WH0A 4GUPB 3G6JA 3GXPA 2F9BT 1WHOA 3ZZQA 1P6WA 3U30B 1T22A 2DQ6A 4AQ1B 4PJ7A 3WMSA 4FFWD 3CZUB 4GIOA 3UPCA 2QQLL 1LWJA 3FQRB 1J8KA 3LRHA 2VB5A 3WKML 4YBHA 4Z7QE 5FF6B 3QCVH 3ZXAC 4HPYL 2EUWA 3FRPA 4NIYE 2CO3A 4YHPB 4WJG3 1GA2A 1H3WM 2XWTB 4PRDA 2ARJB 3PWUA 4UI2A 1RZJC 1NMBL 3CFBA 3BZ4A 1HHGA 3WG7B 1HJBC 3NJJA 3TO4C 5EBWA 1DJZA 3U1SL 1UT9A 4MRBA 2XPGB 4QY8A 5DJYA 2XG5B 2EDYA 5C6TL 2L4OA 1BQKA 2A0LD 2K3TA 5J56B 4LEBA 1CGTA 2QPDB 3OJ2C 3VXOB 1SRDA 3AG2B 1PZ5B 1MUJA 4N86A 4N0RA 1DQIA 4ZUTA 1QFWH 2WP3O 4PD4K 4WWKB 5L4MA 2BWIA 2VLRB 2XN9B 1AVAA 2XXCB 1F4XL 3BVWA 3AT8A 4B41A 1A6TB 1KBKA 3SODB 3OGCB 4MHHI 1I82A 1UJ3A 4GMTL 3N6YA 3ATAA 3MO1B 1T03L 2H9GB 2BVOA 3KM2A 4ZDHB 1U0QA 2EUVA 3L9YA 1I7TB 5EOQL 4G6JH 2V5TA 1EEQA 1YYLH 4AVJA 1D9KC 5A2AA 3WD5L 2X0VA 3GNMH 2ZXCA 3K91A 4Q4EA 5EBMA 5AVUB 1J8HD 1T4KA 2VZVA 4NQUA 1MKFA 4ABUA 3T08A 2R29H 5IB3A 3FUIA 3UAEA 2AQSA 4G11A 1L9OA 4HK0B 4JUSA 2DI7A 2X2UA 3VXMA 4NSKB 1ODAA 3GMQA 1WTGT 2OK0L 3BSHA 4M4RA 4XOAA 3VA6A 1NC2B 3V8OA 3WN5A 4O2FB 4FJ6A 5IROA 4N28A 3F3HA 4BCYA 1PY4A 3P4LA 1FSKC 4C8XA 3DROB 1SY6H 3OX8B 1SHMA 2EDDA 4P46C 4LPCA 1NUNB 2BWDA 5BRPA 1MFCH 5J12C 2C9PA 1NFDE 4YHOL 4JB9L 1TTGA 4HCRL 4KGLA 4DNLA 4YSCA 3CXHJ 5LUMA 2GT9A 1MRCL 4GBXB 1ZA6B 3JWNE 1M2VB 3TA3A 3RDTB 1I9IL 3D0LA 3ECQA 3BKCL 3ILPB 1B2WH 3RVUD 1NUGA 1X5XA 3ARDC 3U0TB 2Z91A 2FR4B 4R8WH 3ZZLA 4L8CB 3O9WD 4K7FB 4XNMA 4ZO6A 5KVEH 1ZVHA 3GJFA 1X9UA 1FC2D 2QHRH 4N2KA 2CAKA 1D7FA 5E9DA 5C0BB 4ZFFB 2R4RH 3EGDB 5E24E 1KTRL 3AREC 4C56D 2NLJA 3CSFA 5I75B 3N41F 3K2UL 3UFIA 2CALA 4MJJA 2XLLA 5IBTH 1AD9B 2J8OA 1UWGH 2CK2A 2O6DA 3WEBA 2MNJB 1BZEA 5DVNA 1T1WA 2AK4D 3LXUX 5EPMA 3MLXH 2X6VA 4MLSA 3QIBC 1N3NA 3LRGA 1QR1A 4YNYA 1CICA 2FHBA 1KLUB 2B39A 3JV4B 3TBSA 4LLWB 4Q97A 1KB9J 3ELAT 4L2LA 5BUGA 4KHXL 1JOIA 1BOGA 2NY4D 2G30A 1FFOB 1ZK9A 2Z8RA 4G8AC 2AANA 3VI4B 3EOAB 1JZEA 3QZOA 4OCXH 1A0QL 2K9UA 5L8LB 2YKLL 3NK4A 4JFDE 5AVYB 5IW3A 4CMMB 5L2JA 5KVFH 5CHNB 3VSUA 1M56B 1X3DA 1ZT1B 4G8EB 2H0PA 4QRPE 5AOLA 4OCNC 3BQUB 4JKWA 4MDJA 1MCCA 3O2DA 4KK9C 3Q5OA 4Y2LA 3LJ3A 2FLMA 1BP3B 4MYWB 1IEHA 3CDGB 15C8H 3KPQA 1SF3A 5IW1B 1J9SA 4S1RL 4P2RE 3QDME 2AC0A 3K8KA 3F7PC 3STZB 5IB5B 1MH5B 4N9GB 5FCUH 4N2NA 5FYLH 2G4EA 3HI1A 4U0RC 4WCYL 4EI6B 3EH5B 3RX8A 1HU8A 1UKQA 4U1KB 2B4CC 1A3RH 4GI6A 2PP7A 3MLPA 1SQ2N 3Q48A 1KYOK 2GFBA 3ULUH 3K3QA 5CEZE 5KBNC 1QOKA 1SHSA 1U8IB 4LDCA 3ARDD 3TO4A 3MC0A 5HHOD 4O51A 5D1QE 1BM3H 3B2DC 1Q4NX 2J4WL 3MRCA 1T04B 5AW9B 1FZMA 4NAMA 2FAUA 1A7PH 2BHUA 2X9WA 4XN9A 4RWYL 5KUMA 4PRHD 2ZKWA 1KB5B 4FXKC 4GRLB 1OCOB 1Q1JL 3T3PB 1HH9A 3P73A 4KK6C 4QJ3B 1ZLDA 2EDWA 4KXBA 3BDXA 4F37F 1V55B 4DP9X 5FK9A 5MEPB 5ESAB 3QIBD 4JFTA 2KPWA 1KNOA 4WFEE 2LU5A 1BYPA 5K1JA 4WW2F 1O5DT 5CP3H 3OKEA 1D9KA 3RGBA 1P4BL 4XO5A 1YNTB 3DDFA 4I0KA 1BWMA 4WW1B 2ZUWA 2FVNA 5DEGA 4ZMZA 3KDMA 2E8YA 2Z7ZA 4Z5RA 1BBDL 4HKXB 4X4XB 3PPSA 4OM0H 3TT1H 2H0FA 4UIKH 2QGBA 4JJ5B 3UGEA 3BPLB 4EKXA 1IAOA 1ZAGA 1YEEL 5L4FA 2PR4L 3M45A 4HJSA 4E9RA 1W72B 1CGXA 3R18A 4ODXA 2VE6A 5DC4B 4XBGB 1QZNA 4P46A 3EXLA 1A1NA 1BBJB 3K1DA 4HGWB 4NP9A 3PY9A 2FATH 3BYYA 3LKPB 1BJ1H 2BHZA 4OVUA 2WZPD 4HS8H 2H2PD 1RCYA 4PJHF 4MAYB 1PNCA 4K3GA 1DBBL 1E50A 2NSQA 3TIEB 2J5LB 2BS71 3WFHB 3ZMRA 4OZFB 5AL0A 4NUQA 2IPTH 3N06B 4L4VE 4OGXH 4JKKA 4DEPC 5DLML 3WEOA 3B2UD 3R1GL 4H25B 4TNWK 4AIEA 2OCJA 5TFSL 1W9XA 2FQGA 2LU7A 3TURA 4H2CA 2ADJB 3G6AA 1A6UL 3ARDA 3NIDE 2HT3C 1K6QH 1N8ZA 2R0ZL 2OMZB 4KO9A 3QG6A 1TQUA 4U0QB 5I1HL 2BC4A 1RZGA 2CPCA 4XNBA 1EFXD 2BNQD 3U6XS 3IJHB 2BRRH 4AWJC 2Z31D 4O9HL 1NIDA 3M8OL 5T3XE 4AW7A 3LEYL 4PRHA 1T1ZA 5KS9A 3AREA 4AJYV 4M62L 3I6GB 3GMRB 4HJGB 3NTCH 1BX2B 4DPBX 1CD0A 1AR1C 3PNRB 5F7LB 1J11A 3CK0H 2B3RA 2CPUA 3GHEL 4KK6D 5K39B 1QA9B 3DETD 3QIBA 4XPHL 3IGUA 5E2UL 5HHPB 4AQZA 1E9OA 3L6FA 1NFDB 2E7CA 2VDNB 3F58H 4YLQT 2XA8L 4TKWA 5IEHB 2F7IA 2EIBA 1WZ1H 2GSIA 4FXLA 1GW0A 2OQJB 5AWNH 1F0LA 2AJUL 3DYPA 3K80A 4JKNA 4CNIA 3L3KA 2J43A 1DEEA 1UB5B 3KXFB 5LCVH 2VIRB 1KGUA 2OP4L 2F7PA 4KDWA 4KUZL 2J88L 1DBJH 1PX3A 2Z4TA 4ISVA 3O3DA 4XCEA 4KUCD 1DANT 4UDUA 4APQB 5IMKA 4JRYA 4D9QD 3QXWA 4PB9L 4JRXD 3PAZA 4HF5L 3RE0A 2CBTA 1XSJA 3NJMA 1BFTA 2IQAB 3QHZL 3O6FB 4NUGL 5IZ7A 2AJYH 5EU7C 1N5AB 4D3CH 3SDCC 1X7TA 4DN4L 4PIRF 1E4WH 5GRWA 1D7DA 4XMUA 3WJMA 2ENYA 4QHNB 3UJIL 4YQXL 1IQDA 3JTTA 5E2TH 5F7DA 4CMHC 2ICES 5FUCC 2NOYA 3KPRE 1D7CA 1SDYA 4HEME 4NGHH 3H3PL 3RVTD 4NNPL 3B9KD 4XO3A 3TYGH 2VXSH 4JDTL 2XXGA 2PYFA 2BZDA 1KG0B 4LBEA 4ZTPH 2WINA 1AQDB 3G6DL 1INDH 4KRPD 5JW4Q 2P44B 4Z7OF 3CLEH 2UZPA 2YD9A 3RPIB 3A4EA 4LXFA 4K23L 4DAGL 2CD0A 4FDWA 1GZQA 2E76C 4IKNA 4ZW6A 4DHLA 2XG4A 4YXLL 1W8EA 3UZEC 4ANKA 4WTWA 2ITFA 3VFGH 2E9JA 4H20L 1U8OA 4Y1AA 5GIRB 4J3OF 4BXVA 4JRLA 1D6EB 4FXKA 3ABMB 1PZDA 2F2HA 3QO0B 5HYJD 4FG6D 4QRPB 3CFNA 3MV9D 1T5WB 2DQFB 5KJ4A 3HE7B 4MMXC 5EEUA 3TPUB 3Q05A 1YRKA 2GK2A 4KKCC 4I5BB 3T2OA 4PJHE 2WVSA 4RGMB 5DSCB 2NUPB 4FXTA 1N5YL 2NZIA 3UOAB 3QDMB 1XGUA 1W91A 1U30A 3DVGA 3FT1A 4XNQB 5KYWA 5MP6L 2O5YH 2WWMC 3PJLA 1VCAA 2RQ8A 2YMTA 1JN6B 2FUQA 4L8SC 3STLA 1DQKA 2YD4A 4IS6B 1JV2B 1M9SA 2AI0L 4M7JL 4TUKL 5BRZD 1RQ5A 1UQSA 3NOIA 3I85A 1MHCA 4QXVA 5GGSY 4S1SH 5DJ6A 3S5LB 3SQRA 1IC1A 3FFCB 2UYLB 1NDGB 2X4UB 4Y4FB 3BGFB 5JDJA 3WDIA 1SUHA 4JZJC 2ICWB 3RL1A 4E9WA 4IBZA 2IAMD 3L8QA 1JUFB 2KZ1B 2Z93A 3HG1D 3Q8AA 4GIAA 4AV4A 5FDWA 4OV5A 2IDTA 4RA3A 3S37X 4IW4C 1PG7X 4E68A 2DIEA 4XHQA 1NGQL 1TETH 4LPUA 3MZTA 1I7UB 1L7TH 1V3MA 4U33A 4FCHA 4WU7B 3GJEB 5C0EA 1NC4B 5KW9L 4KAQL 4DKTA 1NOAA 3TC9A 4OJFH 4QO1A 1LO4L 4I1RA 4R7NB 5LGHH 3D85D 4X9HA 4OKVA 3J7HA 2HKHH 1X5FA 3FPXA 1OGPA 4RAVA 5LKNA 2DB8A 1IAIH 1RJLA 4KGJA 3OGOE 2BW5A 2XWXA 2LVEA 3BUIA 4G6FB 4GO8A 5H94B 4HG4K 3B5HA 4MHHG 1TYEB 4I0PD 6PAZA 5I66B 1J05B 4Q9QL 3UTSE 4NUJA 5HPMA 1WUZA 3MRGA 5FM5O 2AAVA 4ZMPA 2WXMA 1OP4A 1A5FH 1CDHA 2JIXD 4ZOAA 3RTQD 4HFUH 3UEQA 5I5IA 3TF4A 2JE8A 4ODSH 1RXLA 5BV7C 4MTMA 1IC0A 3TBTA 4GT7A 2MKLC 3RIFK 2VMCA 5HHNA 1BDYA 4UUJB 2X1QA 3OB0K 4YDKH 4TOYL 5DVMA 1SXCA 5GS0L 1GW6A 2AAAA 5KEZA 9CGTA 3R7QA 4L4VB 4JS7A 4N8VA 4ZW7A 2Q0ZX 1U8LB 2WWMD 1WZLA 3D06A 1IKNC 4NO2A 4QWWC 4Z7OE 4B9PA 1SJEA 2B20A 3NIDB 4OZIE 3K72B 1YJDH 1T5KA 2QADC 3EDFA 3CMOH 3HUJF 1TZHA 3EFOA 4GMSH 4IHBA 4U1SA 3U36B 4JPKL 3GBEA 1YN7A 4FLOA 1HILA 4AUYA 1YQ2A 4PLKD 4PJAE 3T1FB 5EO0B 1VRSA 3IU3B 2ZWKA 4FZEH 1X5KA 3SDCA 5K9JH 4ANVA 3OKDB 3IE9A 3SJVE 1KYDA 2K6ZA 3PP3K 1CK0H 4Y7MA 5BCAA 4JG0H 4X6EB 1UFGA 1JPEA 3REVA 2ZOKB 1O6VA 3V4UH 3DJTA 1QRNB 1TTBA 3RZCC 1TNNA 2F19H 2QBWA 3IDGB 4K5OA 3NIGF 3DO7A 5D2NC 4PJCB 4L2YA 5IHUH 4LVNC 1TQBB 3VDCA 3DVFA 4XX1E 4L29B 3CH1A 5DK2A 2NY5H 4LNRA 4MQSB 3GSUA 1SEBA 1UT1A 4ZO9A 2YGVA 3VFVA 3MUY1 1TO5A 4MQTB 2EICA 3W81A 1O7DC 3MRBB 5KG9B 1O5PA 1WFTA 4H8VA 5GGRB 2GITB 3LQAC 4G9DB 5C8JA 1D5XB 3U7AA 1JCVA 2J6EL 4HPYH 3UZEA 5C9JB 4LGRB 1J9TA 4LAQH 3LN9A 4AL8C 1MVUB 5E8DL 2HPTA 3ZUNC 4I77L 5INCB 4ZFQA 4L3CB 2XX0A 4ELMF 2FE0A 4W6WB 1TEYA 3VNZA 3U1SH 2JIXA 1CT8A 1AGDA 5HGBB 1A8ZA 1H0DB 3SY0B 4M5TA 1PZSA 3KBPA 1K4DB 5DHMC 4MMXA 1GS8A 2Y6SD 3PHOB 2G3ZA 4G8IA 4P4KC 1ZHKA 4N1CA 4CW1B 3AXHA 2IF7A 4YE4H 5SWSA 1GCYA 4IOIA 1NCDH 5EOTA 5JDSA 1F4XH 1LE9A 4YH6A 4AMKL 4DGWC 4WK0B 4LPWA 3KPRB 4Y88A 1G7LA 2FYYA 3PU7A 5C2BH 1IL1B 4UCFA 5ITFB 4L8SA 4U1JB 3MUUA 5H8DA 1ETB1 4N90D 4M3KB 4TLSA 5D71H 1QSZA 4ES8A 5LQBL 1GJIA 1ND0B 4PLNC 4PS7A 2BVUA 2KLRA 3QUGA 2E6JA 2GG1A 5J13C 5L4JA 5DUPL 4NP4H 1QR4A 3PGCB 3M17B 2VZSA 3NGBC 1DO5A 4GXVL 4EXKA 4J7RA 1ETZB 2IANE 2R0KL 1FBIH 1Q0XL 3E7JA 3L81A 5D2LB 1YPZA 5D7HA 5CEYA 5CU5A 1OM3L 4FG2A 3I9AA 1AFVL 1CDCA 4KJWD 4U1MA 4GINA 3US1A 4X8GA 3BO8B 1KJ2A 3PHQA 3QIWD 4M43H 2NZ9D 5H37G 1X5JA 2V9TA 3BP6A 4ORGA 4FEIA 2QGCA 5H4YA 5GGSA 2PMZA 3ZKXC 3KMDA 1BVZA 4LCIL 4PGBA 1J5OH 1GGCL 4X4KA 3SYCA 3DOIA 3HLAA 3IFOA 1JYVA 4DGIL 3T09A 1WRFA 2Z0BA 4FFZL 3DRTA 4WO4B 3N44F 1P4UA 5EZOH 1MRCH 3PWJB 3OLGA 3B1TA 1OLZA 4HX1A 4EDXA 5IB4B 4LSVL 5DMJB 1HH6B 2P49B 3E2HC 2XKNB 2FEEL 2ZXGA 3BKCH 3OR7A 2Y06H 1FQ9C 1M7IA 3HUJE 1ODUA 2JCWA 3X3FL 2FWSA 2C9UA 2PTUA 2VC2L 4Q14A 4BSVA 4HXBH 5D1QC 4Q56A 4DZ8B 4YDNA 4JANB 5JHDD 4QRTB 1XH1A 1G6RB 3FQTA 4BE5A 1XDTT 1YNKH 2BZCA 5HBBA 4M02A 1AP2A 4XO4A 3D69A 3DUUA 3MRFA 5KSUB 4OFQA 4XHJD 3P0VL 1WZKA 4JDZA 3EH2A 1KJVB 3K2UH 3WE1A 5F7AA 3BX7C 3JYBA 3CVHA 4NX0A 4QXWA 2R7EA 3NIGE 1LEKB 4EI5C 3GSVA 2WXIA 1M1XB 3KCWA 2CJUL 3GRWA 4UAHA 4P57A 3D4GA 1S7XA 2FCBA 2LOEA 4YMPA 1IKNA 3RVVC 2O5ZH 4UOW1 4X7DC 6FABH 2EYSA 4NCC2 1TG8A 1X4ZA 2R23A 2ZCHH 1B0IA 5E1IA 5IVOA 2UWEF 1LO2L 3DXAA 4G7QB 4DT2A 5I1EH 4G42A 2FTAA 2RH0A 2YRZA 4FQQB 1XR9B 3P3RA 1CVRA 4XCYB 3GM0A 5T1KD 2JWYA 5F2FA 3GD1C 3QUXC 5EORH 1J9RA 1A0QH 1I85C 3NCEB 2XWBB 3DV6B 3UTSB 3R19A 3RPKA 4OLUH 3L5JA 4WTXA 2NX5D 35C8L 4NBZB 1OQOA 1PZAA 3MJWA 3SE9H 1MREL 1KXVC 3VXSA 4ZTEA 4EN3C 1SJVA 2HXAA 4OF8A 4LSQH 4RGND 3RZCA 4L9LC 7TAAA 4YBQC 5L6YL 2HTLC 5D2NA 3ZKND 1LEGB 5AYTA 1A64A 4NO0B 3LH8A 2VJ0A 4HWNA 4Z0BL 4AZUA 3BH4A 1KEGH 2H41A 1C5BL 5DD1L 1KIUA 3Q6FB 5F7EH 3JV6B 3R0NA 4WCYH 5HY9A 3O3EB 5HGAB 2YQ3A 3PAYA 4AYID 1MFAL 3QNXA 1MZZA 4S0HA 2MCG1 2CO1A 4HW6A 5HGDA 2JK5B 2DQIL 3CN0A 4OZIB 4UTBA 4WEBL 3OXSA 3ZTCC 4H44C 2HVBA 4TUJA 1JJUA 3S36H 1ZD6A 3NSYA 3HG3A 5C0DB 1BQUA 2X89D 2YGNA 4PJAB 4RFNC 5C0GA 3DX2A 2ATPB 1KELL 3ULAB 3R8BB 5AAWC 1TQCC 2ZX6A 1OCCB 3BVVA 2N59A 3PV7A 4RWYH 1I1FB 3VG9C 3KYNB 4P4KA 3NFPA 4KK5D 2YO3A 2AEIT 4KJQC 1UUNA 4KMLB 2BJML 2DMBA 4BV1A 1Q1JH 2GY7B 3LY6A 3ZRCC 1NWPA 2IVFC 3BPCA 1CFQA 1KLGA 2B1AL 5D1XB 1CQKA 1P9MC 3CSYA 3VFUA 4BK4A 4AM0B 5DRWA 1WCBB 3IVKB 1NCBL 1MOEA 4I87A 2R1WB 1IJ9A 1JV5A 8PAZA 1WEJH 2JLPA 2OSYA 4N6QA 3Q5TA 3GBNL 1RUQH 2VDLL 4FQIL 1ZGLP 2O5NA 1ACYH 4LRNL 3IK2A 4DCQA 2LT9A 3SO3B 1O75A 4XXWC 3DX6B 2PW1A 4O2CB 3L7FB 3ETTA 3EFFA 1WPCA 1OPGL 4JFDA 4ZUWB 4A6YL 3VXTB 3U4EB 2NX5A 4ODUB 4RFEA 5ETUA 5TK4A 3FU6A 5EU5A 2GW5A 4YHYC 3A47A 3BPOC 3PGFH 5IIEB 1R24B 3B8YA 3HHRB 1XFPA 1FVEB 3FTUA 5D96C 1CTNA 4GS7C 4UILL 5H2BB 4L8BA 2DQHL 2C3VB 1KN2H 2OMTB 4JM2F 4MCYB 5M95B 4JPVH 2IWEA 4APXA 2F15A 4OAWB 3GBDA 3E1ZA 3C5JA 5HJ3B 4IBLT 4X6CF 5D7JB 4WW2C 4CU7A 2B1HL 1G0YR 5TFSH 4F2ME 1JZHA 1XGYH 5EZLA 1CB4A 5FM4A 4MJ5B 1KIQB 4L1HA 3HNSL 3G04B 5D1QA 2IXQA 2V4LA 4QRUA 1WAAE 3MLWL 2IANB 3HB3C 5D93B 2YOAA 1S5HA 3D52A 3LEYH 1WSST 1WICA 2QPFA 2FQFA 5FV2A 2YAPA 4S1DC 3D9AL 1R3HA 2WLLA 1F02I 5AZUA 2VL4A 3QNZA 3QEGH 1GMIA 3C09C 4EI5A 3CC1A 4XRCA 3MNVB 5JIQA 2ZXDA 3GHEH 5ANME 5F6IB 2EDQA 2ZF9A 4MZ3A 1Z5LA 3OHXB 4M7ZB 3QCUH 5CCGE 1W16A 5FWRA 4XXDB 2ZCKH 2XWDA 1IGML 1U9KA 3WAKA 1KSRA 1W0VB 1EO8H 2ALAA 2OP4H 4YO0A 2G2RA 5ADPL 1NMCC 4KUZH 2J88H 2XNAB 4P3CL 4LFHG 3QUXA 1ZV2A 1XAUA 1DBAL 4HIIA 1MW0A 3IDJB 1I85A 3HOGA 2BVQA 4N2LA 3MRMB 4HVBA 1OSPL 4G7RB 4PB9H 4NKIH 2A74B 2FO8A 4TQ8A 2CR0A 2DQGL 5ESVA 1FZOA 4EN3A 1KXVA 2WB1A 4CADA 3O41A 1TJIL 2B59B 4WSGA 1QBLH 1WBYA 4NUGH 4W9LC 4L9LA 4NWUH 3IJYA 1F5WA 3W56A 2HJFA 3U9UB 1L9TA 1XSOA 3MUHL 5B1AB 4B9KC 3IU4H 4YFLI 4AUUA 2QVTA 1W6WA 4XCNB 1BZ9B 2I9TB 2Y72A 2IWGA 1L6PA 4YAQA 2EVJA 2PR9A 4M1GL 2WZ5A 3H3PH 4HOMA 4PJ9C 2VERN 3IB4A 2NTFA 2EXYC 2DV6A 5EUKA 1TTUA 2ZAGA 3G6DH 5CZVL 3V4PA 3QCTL 4F9PC 5C6PB 2X1WL 3GMMB 2HT4C 2OW7A 4DAGH 4YXLH 4UT6H 3IAQA 3MBXL 3SDAB 1OP3K 3A67H 4HIXH 1MNUL 3IBEA 3NJIA 4OCYH 4RX4D 1YUHA 3II1A 3FUNA 4CKVX 3FFDB 3QEUA 4CA4A 5AAWA 3FU7A 1HHIB 1L7IL 2XOTA 5M7QA 3QUKB 5LLIC 5CZXC 2CDEB 4ENZA 1BVOA 4LVOB 5EH1A 2WIIB 2B8OT 4FG4A 5E4EC 1XGTA 4JHWH 5B1CA 4PRBA 1PCSA 1R3JB 2Q6WB 1DJHA 1BD2E 2KI6A 1URIA 3GIZL 1NCGA 3VCLB 1P9MA 1UOVA 4IHOA 3DNKA 4P2AA 1MG2C 2HFEA 3CFMA 4FEMA 2UZXA 4ACTA 1AHWB 2YARA 3MV7E 1OP5H 2H2SC 4FKEA 5C0FA 2HTKD 4WI2A 2G5UA 5EU4A 4CC1A 2VH5L 4R6UA 4HS6A 4X6CE 3JZYA 3RGVC 2CJ3A 3P9WB 4HKJB 3EXJA 4B60A 1PZ3A 1ZE3H 4Z18A 2A9DA 1RULH 4XXWA 4TNVK 1Z1WA 2OMXA 4TXVB 1J0HA 3DSFH 4YXHL 2VABA 3N0PB 3EDJA 4K71B 5ANHA 5GRUL 3INUL 3W39A 3ZDZF 5JIMA 3BSZL 4XB3A 1YEIL 5CEXB 1JGEB 2FEDD 2EILB 5FYKH 4PS3A 5TGBB 2YKKA 3L9EA 3UIZA 1T66C 4H7VA 4J3OC 1BQSA 1GGTA 1BVLA 4OGAD 3WIFB 4NN7B 2D03L 4QHUB 2NY6C 2R0WH 1BZOA 2CGRH 4Y2OA 5D7IB 1NGYA 3MLUH 3POHA 1UFUA 4HEMA 4WHYG 3UC2A 1HCZA 3LS5L 4KNSA 3SE6A 2DDQL 1E6OH 2LGNA 3OKKB 4WW2A 5F7YC 5KW9H 2XXMB 4K9EH 4KAQH 2HN7A 2ENPA 2YUXA 3MRRB 4XPGH 2JTYA 5DI8A 4FNUA 5D1ZI 1LO4H 2EDMA 1B6DA 2BXZA 5F9AC 3H2PA 4RX4A 2APSA 5JHLL 1U8JA 3QUHA 1KIRA 2EDNA 3D8MA 3LN4B 4P4RB 4GW1B 3P40A 3UX9B 1TTCA 4JDEB 4BH8A 3HS0C 3HC0B 2XWRA 1KCSL 3CXHK 2YR3A 2IPUK 4Q9QH 2VJXA 3IKCA 3P11L 3F6JA 3B56A 2ITEA 4YC2C 3WMQA 3JUYA 3S35X 3QG7H 1GGBL 1TJHL 3UXFA 2XWJB 2Q8BH 2HFGL 5F70A 3UTTA 3NP3A 5KBLA 3ABLB 2LE9A 4U05A 1NGXB 1BLNB 1XCQB 5IW6A 2CO2A 3LKRB 1OAZH 1PL3A 1XGPA 4HWZB 5AW1B 1TZOA 5DUBB 3E8VA 2JCCF 3SIKA 5GS0H 1LHZA 1QHOA 2EO9A 2G9HA 2WUCL 3UAJC 4DVBA 1RU9L 2AZUA 3WUWA 1W2KT 3SKMA 2BNRD 3W9EB 3ULUF 1S9YB 4F2MB 4KKAC 2EE0A 3I02A 2JJVA 5DD0H 5E99H 3DUSA 2R2HB 3B3IB 1NAMA 5T3ZD 4JO3L 4NKMA 1T7ZA 5DQ9B 4LGSB 5K9KA 2VDMB 2A9NL 3D0AA 4XOEA 3K2IA 1T66D 4TUUA 1NKOA 3KLAB 3EFDH 1KB9K 1NBVL 2ED6A 4L4TB 3TXAA 3TPKA 1AYRA 5HYSB 3K5RA 5GGUB 2VMFA 3LH2L 4E5XA 2VR8A 4N0CD 4P5TC 4IK6A 3TONA 1AR2A 4D7BA 2W1NA 4PJ9A 4ZOCA 3VXRB 2YMOA 4KQ4H 2ZUYA 4NC1E 4OJAA 5ANMB 4JFOB 1ZT7B 4Y8DC 1VADB 2YPLD 4FKKA 3ZIMA 1AI1L 3RX7A 2ICEB 4F9PA 2H0EA 1C1EH 2GSGB 5KYYB 1MW3A 1FYTE 2BSDA 2BSTA 3TIDA 1OGAD 2OMUA 2CCWA 2E4TA 2X4TA 3IDYB 4KZ0A 1FNLA 2H3KA 2J6EH 5FO2A 1XF5B 2E56A 5KVEE 3ZDZE 2F8IA 4P3DA 5E8DH 2OSLB 3RU8H 4HDIB 1U92B 3JZ7A 1B0RB 3OAZH 1MCOL 1A7OL 3LEXB 2DWYA 3RVWC 1NL0H 4HJJH 1BZDA 5TF1H 5AQ0A 3BLPX 4B5ZA 1GKOA 3MACH 4PGCA 4R96A 2JMRA 3SHSA 2XI9A 1MCRA 3UO1H 1OB1B 3WFEL 3ME0B 3VD5A 1HSAA 2UVEA 2XIBA 3QHFH 3QDGD 4LL1A 5DZNA 3WTYA 2F53D 1GC1H 4WU5A 1QEWA 3V0GA 3LB6D 5C0AA 1DCEA 2YK1L 2BSBA 4L3FA 3RGVA 5I1IL 1BVKB 1FE8L 2A6JA 1OALA 2YQ2A 1ZSDA 4IGBD 3QYMA 2XFXB 2OV0A 3FO2A 3TZVD 1SVZA 4M8RA 4TUOB 1CGUA 5LQBH 2FO4B 5D9SA 3TU6A 5JO5B 3VW3L 1KT2B 4MMYA 4MMZC 2GPZA 4A04A 1XMWA 4YE0A 3N1MC 5DUPH 5KVFE 4HMDA 4KTEL 4I9WE 2D2OA 2DH3A 2YSSB 2FX7H 5GGVH 1PPIA 2R0KH 1Q0XH 1X6LA 3LZNA 4F7CB 4RQQA 3RNKA 5EZJB 5I5MA 3SJVA 3X1FA 4DP0X 1AFVH 3WFZA 1VACB 1KYUA 4FZ8H 2Y36L 4LOUC 1IBBA 4DOHE 4YX2L 5KOVC 3IFLL 3EJCA 1MI5E 3ARYA 2OL3B 1BD2B 3MU3A 1QQDB 1HCYA 1Q9WB 3SPJA 5F96H 3LZOA 3QUYC 1UM6H 4P5TD 5FYLE 1GGCH 4G82A 3VFPB 2WQSA 2MWCA 5DR5L 4XVTH 5LB1A 3MV7B 4TTDD 4GW4A 4TVPL 4QHKI 2DLFL 3B7TA 3EOBB 5DJ2B 1M7DA 2NNCA 3T6WA 1CFNB 1IO4C 1TU2B 2DKUA 4N2HA 4PV9A 3ULUE 2X5PA 4EUPH 3FT3B 5FB8A 3C08L 3C6SA 5F7FA 1OCWL 3Q3GA 4HKZA 3SEPA 1M42A 1KCVL 4CU6A 5J1AB 3HS0A 4ACPA 3S8FB 3QWQB 1JPFA 2ZAIA 4BSWB 2HT2C 4M6NH 5KVGL 4PP2B 2G75B 2XV6B 2X12A 1N0XH 1A4CA 2AMGA 4HLEA 4MNGA 4NXKA 4W1TA 3S3DB 3X3GH 2EE2A 4BGDA 4IRJC 2XX1A 1WFNA 5DRNB 3BCDA 5E6SB 3ULVD 4OLVL 3Q06A 5ABDE 2CBMA 2RFXA 2O1AA 4N3TA 2F53A 1Q94B 4JFEE 5I1KL 1HXYA 2YOCA 4QXUH 1KTDB 3VVWA 2QHLA 3L3DB 4OGZA 4U3CA 1E3FA 3PWLA 3UAJA 4HLZG 4JREB 4ZUUB 2BIHA 3HVNA 2O72A 1ZDQA 1PBYA 3S98A 4F15B 4RRPA 4BZ1A 1B90A 1NLBL 2VLJB 4ZK8A 1B4RA 3N1FC 2QT6A 5E23A 4JHVA 5FGBC 4DGUA 2TRHA 2G2PA 1L5GA 4PUBL 4F3FB 1NFAA 2VZOA 2A6IB 4F2EA 2Y7QA 1PKQE 4IBVA 1FORH 3NACL 3UTPE 3RP1A 1IM9B 1TQVA 3UYPA 1BEYL 4NQEE 1LDPL 3W57A 4KHTL 4H0IA 4PSPA 1CXKA 4NNYA 4QT5B 4LLMB 1FVCB 4MSWB 3KVQA 3G08B 1VFAB 3BAWA 4U1IB 3REWB 4U6YB 1PNDA 1JK9A 4P5TA 5L2KE 3MCKB 5L6YH 3ETSA 2BO0A 4XAKE 3KYKL 1FLRL 1P7QB 2WAQA 5B39G 5BVPH 4QLRA 3LOWA 1ECYA 5CXPA 4J27A 2DMCA 4RMVA 1A6VL 3UC0L 1JPGB 3BGAA 5CLZA 1CGYA 1NPUA 2V8MA 1C5BH 1ORSA 1IJNA 4M9OA 5T5FA 1A7NH 2E7DA 3U7YH 1ERNA 3QJFB 3SDDB 1KPVB 4KJYA 4B96A 1UT2A 1ZY9A 2WV3A 2FL5A 2F7RA 3O8XC 1QYGH 5MHSE 2R1XA 3HUJA 2OMVB 5I16B 5JQHC 1OT4A 2DQIH 1A4KA 4LLUA 3RWGA 3T0ED 1ADQA 1HAWA 3B9DA 1UATA 1AD0A 3NJKA 1ZEAL 5K1VA 5F88A 1NM4A 2JKLA 1KELH 1ZK5A 1RLBA 4YOKA 3GRBA 4P5MB 5J3HC 3IAGC 4HPOH 4IRJD 3GMNA 4MRCA 5EA0L 4A66A 2BSCA 4PH8A 2DI8A 2CBQA 2J1KA 4NZJA 3ZL2A 5GSVA 3NUKA 4Y4KC 2BJMH 1OPOA 1M6OA 4F20A 5I74B 3PQYE 1OOWA 3WXVL 5CGYC 5D7SL 3NAAH 1PLAA 4ZXBC 1NBZB 3MROB 1NCBH 2AXGA 2VDKL 3Q43A 3JT0A 5AVTB 3HI5L 1RUAH 5M94B 4MMZA 1I53A 1P5VA 1HYRC 1S7RA 2AEWA 1P2CB 3UABA 4E42B 3O45B 3OXRB 3F7VA 3G5VB 3VG0H 3QJXA 1W8NA 4UT9H 2DQEL 1R3KB 3SBPA 4ELMA 3BPNB 5TDNA 4FFVC 1OPGH 3CFIC 4F24A 1U8MA 1BQRA 1VEOA 3VFOB 3ZHFA 4A6YH 4A7TA 1WIPA 1NMAH 1GGIL 5AVXB 1RHFA 3HJ0A 3P4NB 1P5UB 3CN2A 2PWFA 1UM5L 5FA4B 4F7KA 1P4LA 4OBRA 1YAIA 2ZKMX 5GGTL 2CM5A 5T5NG 1K4CA 2DOCA 3QUYA 3VFRA 2W0FB 4EN2A 2VDLB 2FB4H 3J8F7 2W9EL 4M6OH 5ID0A 5LGYA 2OCCB 4CILA 4D0BA 4I3RH 1DANU 3UROR 1P53A 1TYJA 1U8QA 3QP3A 1GVIA 4XVSH 3V6OE 2AJVL 2BY1A 3KJ4B 1TVHB 3VD7A 4HUCA 1OAYL 3WS6C 4GNKB 4JJOA 1WWBX 2APFA 1FIGL 3OB8A 3PJSB 4GP5B 4L3EB 2BOLA 1T2JA 1LK3L 5KYXA 1DSFH 1GPOL 5HHME 5FO8B 2KLTA 1DL7H 4HD9A 1DBKH 3V5DA 4A7SA 1AGFA 3T0WA 3L48A 4KTYA 3NBNA 3RWDA 3MNZA 1LMKA 5DVLA 3F7KA 3KPNB 3MBED 3N85L 5IHWA 1A9EB 2LABA 4O5LL 3EUUA 3MGOA 4IRJA 5F7BA 1U8PA 2JH2A 1MCFA 4MXWH 2CO7B 1E4XI 3ENEA 4Z7WE 5EULV 3IFPB 1QWUA 2JF1A 3QJOA 4K8RC 4U1LA 2EC9T 4HKBA 1URZA 1EHAA 3VGAC 4DOHB 2I25N 2E4FA 2HG0A 2PXYB 3I2CH 3QIUC 3S4SG 4IU3A 1S3RA 1T6VN 3FT4A 1XAKA 3L7EB 3FO0L 4FE9A 4R5VA 3MNWB 3B4NA 4JM2C 2XT1B 4FCAA 4XBEL 2X2HA 5TE6H 1GJWA 4ZXBD 1TF4A 5FO7A 2IDFA 4NCDA 2A38A 4QJ5B 2PP9A 3A6BH 3QDJA 2IQ9L 3DOSA 1TKWB 1UACL 5FGBA 3F5WB 3CN4A 3VXQA 3FB7A 3GKWL 5ABAA 3C60B 2J12B 1QNIA 4N5ED 1V3JA 3LRMA 3EJJX 3P2DA 3VXUE 3QW9A 4WGWB 2BSSB 4ZD3L 1AXIB 2H47C 4C55A 1NUFA 3U30C 1HDMB 2GUYA 4UM8B 3HE6C 4LASL 1ZLVK 4GO6B 2DQGH 1S7WA 4J3SA 5MEQB 1F13A 3LEVH 4PJBF 4ALAL 4EZJA 1UH3A 3L9RA 3OSKA 3FHQA 1H6FA 5I1DB 4F57L 5FKPA 1SDDA 4V11A 4N6RB 1D5BA 1LO3H 1HL5A 2Q7YB 3QXAA 1SYVA 2ESVA 3S37L 1YEDB 5F7HA 1DVFD 4M1GH 1QLFB 4GW5A 1PG7L 2DQUH 1AE6L 2GJ6E 2Y24A 2Z4QB 5A16B 3CG8A 3HA0A 4P59H 1U3NA 1BJ1J 3CBJB 3FQUB 1G7PA 2QTVA 3GC3A 3O8XA 4YVNA 2YD8A 1AZBA 3RWEA 4AYFB 2UWEA 4WWKC 5J6GA 3T1WA 3QCTH 4NN5B 2F74A 4PV8A 4AH2A 4AIOA 4XPAL 2BNUA 2X9YA 4S1QL 1IGIL 1PKQB 3SGEH 4JFZH 4XBMA 1B88A 3U0WL 4ZYKA 3OLEA 4D8PA 5DJCA 3VA2C 1Z0MA 4XCFL 4OCRL 1KULA 1YQVL 3BW9A 2RD0A 3CXDL 2VSKB 2NXYC 3NJXA 4Y4KA 4Z3TA 3NJGA 4G9FE 4UQ2A 1B0WA 1E8XA 3EO0B 2ZOLA 4DP8X 5L2KB 2CIIA 3GIZH 2VLMD 2ITDB 1ZA3B 2NW2B 3NA9H 4ZXBA 4GP4B 5A6LA 3H9SD 1I8LC 1HHKB 2JJWA 3I6SA 4JM2D 2GKIA 5F1IB 4CVXB 3PIQB 2VMEA 3EO1B 3S96A 3X1EA 1HZLA 5DJXA 1GSMA 5E00B 2IPKB 1DQVA 3IJSB 4RDQG 5LAXB 4PVLA 5C97A 1EAPB 1P7KB 2E6QA 5F1SA 1J0KA 1MLCA 4O02A 3P4MB 5DO2D 5MERB 1PIGA 4ATWA 4EZMA 5I24A 1CURA 4WENB 4MJ2A 2C3XA 4ANXA 4JQIL 3TO2B 2RCSH 5IF0A 3B6SB 4UOQA 3DA0A 5GRUH 1QUNA 3N1GC 4QXGH 1HN1A 4MA3B 3UAAA 1SM3H 3B7SA 2YA2A 3GJFH 2YEZA 1XH0A 4PGDB 5DJAA 3DARA 3OV6A 5T33H 2P80A 3ECBA 3EAKA 1EEZB 2D03H 2J2ZB 4XNXH 3V4VL 4ZT1A 4B5EA 4XC1L 1VGKB 2ZWYA 5GRVL 4M3HA 2CUMA 4BFIB 3U4KA 1U6AL 3V5HB 2P8MB 4PW3A 5F1OB 5HVHC 3WS6A 2DDQH 2I7OA 5IQOA 4DJMA 3HAEG 1U91A 2JB6B 3BAJA 5DFVC 4Z3HA 2YD5A 3KLKA 3SKOB 1YEJL 1PAZA 4MGXA 4WWKD 2IGTA 2E47A 2VLRD 2XN9D 5HTSA 5FO9A 3LIZA 4DK6A 3QWOA 4KMQA 3T0BA 5GRZA 2ATAA 1EEYB 1I1RA 3QS3A 5AB1A 3U46B 1GOHA 1Y1DA 2DMGA 1MWAA 3F7YA 3P77B 2C1OA 1QVOA 3MJ7B 3OKYA 3CN1A 1UGNA 4FLQA 4IOFC 4F7PB 1KCSH 4QMEA 2AQ2A 1N8OE 3BOVA 3QQ4A 4H40A 1T7XA 4QHMB 3RURA 3QUMA 1JBJA 2P5EA 3QIUA 3VWJB 4G71B 3OJVC 4EI0A 1UWXK 4KPHH 3QULB 3EJZC 4AV5A 4GAGL 3D18A 2YD7A 4JM2A 4GEJA 4PTUB 4L37A 1HIML 1MY5A 3ESMA 4NT6A 4JQVC 1OAXL 5BZWB 1NC2D 2UUDH 5D5MF 4PRAA 5KSBE 3JTBA 3R8QA 3EYVB 1G7IA 4JQXC 4X7EC 2OJEB 1P1ZB 2R2BA 4X6CA 4OTXH 2EYTB 4WWID 1N68A 4XP6L 4JVPA 3DGDA 4OLZL 4AE0A 5DEFB 4Q6YA 2L04A 2X4RB 3HKZA 5KBKA 2CSPA 1KN4H 4UV7H 3RB5A 1E7UA 1XZ0B 3EGSA 3X1NA 1S78C 2APTA 5HHMB 2O6PA 5G5DA 3EJRA 4AEFA 1RZJH 1ZTXL 4FQXC 4KKPA 3HE6A 3HHSB 3KPSA 4BA8A 4F7EA 2DL9A 1ZJBA 2JVUA 5AW3B 1RZKC 4GBXD 3LCYA 3H7LA 2OTUB 1MQ8A 4HUXB 3T8VA 4OLWH 1EO5A 2XWTA 4M56A 1DVSA 4M61B 3BN3B 3LPWA 1E43A 4M7KL 2GTZA 4XP4L 4IMLA 5HHVL 1WFUA 4OB5L 4Z7WB 3OAUL 1JWSA 3RWIA 1NBVH 5K59F 5ALCH 2K8QA 2XPGA 1TZ8A 3CFQA 3CDZA 4M5YL 5F9DC 1FDLH 2ZOOA 2B0SH 3PL6B 3OJMB 4MDRA 3L5WB 2ZX7A 4RH4A 5C0BD 3VXOA 3BD4A 3RTLA 3DX4A 3IM1A 1GXEA 3KCPA 1AI1H 4GRLC 4WWKA 1CO1A 4GKNA 2EDKA 4JY5H 4NI3A 4JKPH 3U2SA 3ULUC 1Y7VA 5DT1L 1IGFL 3MO1A 1FV1A 2H9GA 3GSNL 5F89B 1T1YA 4FP8H 4R90L 1BPVA 3CGTA 3CFDB 4KXDA 1XF1A 4NRXB 2QL1A 4U4IA 5BZDA 4WAFA 4NM8L 4CVUA 1A6WL 4NKDB 4PJIB 5ISZA 4F9LC 3QUZB 1SYSA 1R5VB 2A6DB 2Q3ZA 2W38A 1LEIA 4NAJA 2YEQA 1IBYA 3IJEA 3MOAL 5INDB 2AGJH 2AITA 2P3YA 1GZPA 2E74C 2QELA 4GP8B 1BQLL 4NSKA 5LJYH 1YCSA 3HFFA 3NMEA 2H8PB 1I8LA 4FLSA 3EH4B 2XQYK 1A3LL 1FNEB 3AACA 3FDWA 1AZVA 4LCWA 1V7NL 2WVTA 5AD0B 1HQRB 5JHBA 5HI5C 2GJ6B 3BQUD 4D0CB 5I1IH 1A9VA 1AGEB 1NEPA 3WTWA 1S7TB 1G9ML 3I50L 4KNTA 3BT2H 1USZA 2ED8A 4HUUA 1OQXA 3VDAA 5LXVA 5JXAL 1HWWA 4JL2A 1TUPA 3KEDA 4NHCH 3KZ8A 3DJZA 3I6LE 1M2VA 3KWWB 4QTFA 3SYPA 5IQ9B 1YMME 1Q9KA 3A3YB 3LDBB 1VHPA 4BM7A 2B5IC 3L5IA 4R97B 2A9CA 5D6CA 4AEHH 3DGGA 2BY3A 3FKUS 3BFOA 1WGOA 3MJ9L 3FJTA 3U0TA 3RYMA 4BE6A 5E70A 3E38A 1W0WA 2FR4A 3ZHDA 3H8NA 4L8CA 4M8QA 2HUEA 3FQXB 4G9FB 2QVFB 1NQBA 4YX2H 1RIHH 4UOJA 5CP7A 4P23C 1O7SA 2C9SA 4ZFOA 3APMA 2V9UA 2VKXA 4PP1C 1Z9SB 4Q6KA 2UY6A 1U8HB 3TH4T 3LPPA 1OTSC 1KENH 2ATKA 4LAJH 5ICZA 1GAFH 3RNQB 1FGNL 4E0RB 4GRLD 1KTCA 2CGYA 3WXWH 4QKXB 4L0YA 1KTJA 3QEQD 4V1DA 3VAEA 4C47A 2HMID 4JHAL 3MSPA 3C08H 3L3JB 5I2IA 1TSHA 4BFEA 4F92B 5FLUA 4OSUL 4Z7NB 4P48A 2UXGA 5HD8C 1C5DA 3X1GA 1MJ7H 4ETQA 5CF3A 4P04A 3H0TB 3OZKA 3R06B 2IBGA 4PYHA 1SOKA 4G8GD 3T65B 2YPKB 4L1DA 5FUZH 3VI4A 3VSTA 2F1EA 2OR9L 1W80A 4OLVH 1A1OB 5K59E 3CD4A 3KW8A 5IQ7L 3B3BA 3FOLB 4Y9CA 4AG4H 5JR1L 4JQVA 4YHNA 3BP7B 1ZSHA 5LNDA 4NBXB 4E41E 4JQXA 3CUPB 4G8EA 4WF7A 2RA1A 4YGVB 2R69A 3AJ7A 4XMLH 1E90A 2WNKA 2QV4A 5AKSA 5IJVA 2C26A 2VMDA 4HWEL 4H5SB 4FMFA 3RVXD 1IGYB 1NLBH 4X6DB 5IW1A 2B4CH 4UZUA 2P8PB 4X6BA 4HJ1A 4FQXA 4MAYD 2WKOF 3JBG7 4NQCE 3RJQB 2MPVA 1KY7A 3FTGA 5B38B 4EI6A 4JY4B 4ZG1A 3O11B 5I1AA 3IFNH 2YC1B 4FQ2L 3U7WL 2EDFA 3CQQA 3EBAA 5F7UA 4A37A 1LDPH 1BIIB 3NZ8B 4IRZA 4WRLA 4ENED 2G3XA 1IBGL 1DJWA 4BUQA 3FN0L 3NVQA 2N3JA 1WD8A 5FM8A 4LLQB 1N12A 3HS9A 1LO0L 1FLRH 1T89C 3QPQC 2JCCA 3ZT7A 4LSUL 4MA7L 1YDPB 3QRBA 1KB5A 1VEPA 4GRLA 1T83C 4LF3B 4A38A 4X4YB 5KSBB 1F3DH 3T8XB 1WAEA 3L08A 3CFTA 1HEHC 3V6OC 2FSEA 5C07B 3HE7C 3QEQA 2X6AA 1OHZA 4R26H 2FBJH 3MN8A 5DRXB 1LWHA 2H4EA 3H9ZA 4W68A 5HYQB 4RGMC 1G7HA 1M6UA 2ZWZA 3CTTA 1A6ZA 3EUDA 5GPRA 1XH3A 1TNMA 2I60L 4FKHA 3SKUD 3KLDA 4F9LA 4PEEA 4G8GA 4WW1A 1U58A 3VFMA 3W5MA 4ZMLA 3DPDA 4PJDF 1JP5A 5I8OL 3QQ3B 1DQDL 2W0PA 3KXFD 3NABL 3DX7A 1MLBA 1I1AB 2XBZA 4KVCH 1RUPL 2FX8L 2VO5A 5IG7A 3HC3L 1J8RA 2D7QA 2AMUA 4IMKC 4JFEA 4J1UA 2HJKA 2I9LB 3LKOB 3P9LB 4APQD 5B22A 3TBVA 4CSTA 1IM3B 4F7TB 4X42A 4LDLB 2Y5TA 1JPSH 2GCYA 1LXMA 3WXVH 3O6FD 1MF2L 2V17L 3VFSB 1J88A 1PFOA 4EVNB 5DD3L 2PYEA 2ARWA 3MRLA 4DKAA 2CUHA 4NENA 4HFWA 4HJUA 1AIZA 4E9QA 2VR6A 2UY7B 5I6XB 4E9SA 4O4YL 5IHZB 3QK0A 2NW3B 2GTWA 3B7RL 3QRGH 3HG2A 1IX2A 5EBGA 4QOKB 1F11B 3CHSA 4NQEA 1B4JL 4NRZA 4UB0H 3GIVB 1QKZL 2ILLA 3BN9C 4XPFH 5LGJA 5EO9A 3DPBB 3UP1A 2COVD 5EG6C 1H5BC 1CF8L 4QF1B 1GGIH 4PWHA 1GYUA 3MRNB 3OVUB 3DV4B 3N42F 1QFUL 3MRQB 3C6LB 2YPVL 4P23A 5TPWL 3FTXA 3ZUCA 4YPJA 2AF2A 1IGTB 3E9TA 3ILQC 1OGSA 5ID1A 3ASNB 4KXZH 5AL8A 3UGUA 2VKWA 3I6GA 4MNQE 4OFKA 1QFHA 4YFEA 2P5WE 2XJKA 2BP0A 4N5UA 4PJFF 1G7MA 2A73A 4QRPD 1JWMB 1PCXA 4M7LL 4E9LA 1AOHA 1R19A 1OAYH 3HE7D 4W9DC 4WI8A 1ID5I 2DWXA 1EBPA 2ZYIA 4NO3B 1I7RA 1EEUA 1RIUH 1TYRA 2I85A 3QDMD 1X44A 2IG2L 3N85H 1M7XA 1YMMB 1AZCA 3ORJA 1QP1A 4A2GA 2W94A 1DQQB 1ZVSB 4WTQA 1AO7E 1KDIA 2JKXA 4MXVF 1DSYA 5LBVA 2VDQH 2DQMA 5DRZA 3BEWA 3MJ8B 4Y1TA 5HJGA 3V9FA 1JVLA 2R56H 1JE6A 1A6PA 2M2DA 2WYZA 5DK0B 1ED3B 3FFCD 3ELQA 5KN5A 2DI9A 2WNWA 2V8LA 5I1GH 4GRWH 2W9LA 5F7NC 4M5SA 3HZYA 4Y4FD 2D0HA 1TTFA 3JWDL 5C09E 3RBGA 3GSWB 2CDGB 5IBLC 4S2SB 1QACA 2EDLA 3ZTJH 4QHNA 5CD3B 1NGWA 2XIDA 2DZEA 4H8WL 2BP5M 2V2WB 5I1JH 5IJBC 1QSFE 4IBSA 2DQCL 2DLTA 2J8UE 5C2UB 3ZDXF 1IB5A 2OZNA 3GKWH 2WM0A 3CZFB 3IJ7A 4X50A 1KG0A 2BSRB 4WI5A 1ONQB 2PTTB 4J8RA 4ZD3H 4R5XA 3V7MA 1NC4D 5FYKE 3KYAA 1EERB 3V6BR 4PJ5E 4N0FA 1D5IL 3QFJE 4AI7A 4Q9CA 4TMPA 4B0MB 3KPPA 3RPIA 3FQ2A 3BGMB 3BVNA 4GKZB 4POUB 4QDGA 2AJSL 2CWRA 3MRPB 4JUTA 1JGVL 4LGPB 1FRGL 1RVFL 4OZ4B 1T89A 4NHUB 4GG6B 3BLBA 4G6FD 1ZHBA 1HCVA 1K8DA 1QABA 2CU9A 3BUPA 3FSAA 3NIFF 3CHQA 3QWRD 4JKMA 4MD5A 4ZMXA 1MJ8H 1T83A 4E41B 3PYCA 1KCBA 2DQTL 4HU8A 5CJOH 5DJ8B 3V6OA 3S37H 4FQ1L 3HE7A 5D4JA 1PG7H 5E5MA 4I5BA 1GJUA 4K94L 5T1DL 3FH8A 4NQDA 3D39B 2NQDA 5IMOB 4QIRA 2Y3AA 3P0GB 1IFRA 4XPAH 2KMWA 3UTOA 2X40A 5T3ZL 4JFXA 4L4VD 5E6YA 1IGIH 5BXFB 1XSIA 5JPNB 4RAUB 4AENA 3TN0C 2KZKA 4WHDA 1E9PB 3O2WL 3U0WH 3WTUA 4XCFH 1R4XA 1K5WA 1YQVH 2EYRB 1PYWB 4IMKA 5J89A 3GZOA 1L6ZA 3CXDH 3IJ8A 1ASQA 43CAA 5A6MA 1EHLL 3BDYH 4KDVA 2OJ1A 3RUGE 3MPCA 1KJ2H 3S35L 2D4DA 3CWGA 4NRYA 2UZYB 2E27H 1UWFA 5HVGB 1M53A 5HI3C 5F0PB 4P8QA 4Q7DA 5T3XD 5DJ0A 2OI9B 2EIZB 4PI2A 1R0AL 1Q9LB 1ZT4B 4LZKA 4G1MB 2XTLA 4F5CA 4NOBA 4OT1H 4JFQB 4LSRL 1RP8A