4OCLC

Crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ia
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
VQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTYYADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVTVSSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, protein binding
molecule keywords 26S proteasome regulatory subunit RPN8
publication title Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 125
sequence length 125
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oclC00
1D5XA 5TQ0H 1RIHH 2Z8VC 4XNMB 1NC4B 3TO4A 1EVUA 4MLSA 3V4UH 1A64A 1NAMA 4JM2C 3ARZA 3OWEA 3NGBB 3F7VA 1BBJA 2Y5TA 4YDJA 4LVEA 4Y19E 5E1AA 2JE8A 5DJXB 5JHDD 2V2WA 1URLA 3RGVB 4TOYH 1YQVH 1LO5B 2VLRE 5DEFA 3MJGX 1CCZA 3IXTB 3QEGH 2NLJB 1P4IL 1OP9A 3BGFB 3GSWB 3SOBH 4Z0XA 4JFOA 3KR3L 3IFLH 4AMKH 1KJMB 3ULUL 3IS1X 3KXFA 5L9DH 3JVGC 1FAIH 4H8WL 4AIOA 4Y1AB 4TTDD 4LFHD 1F5WA 4K94H 3X11A 4R26L 5LAXA 4EKXA 1KXVC 4KGJA 4E42B 2VR9A 4FFVC 5JQ6L 4U1LA 4J4PC 2VUYA 1FO0H 1G9NH 3CSGA 5CEXB 3LAFA 5AWNH 2O5YH 2X1PA 1DEEB 3ECBB 1AE6L 3EUUA 1MHHA 4JFPB 4JRYA 3WHE1 1JHKH 1TVHA 2CDGB 3TBVA 3HC0A 2LU4A 5D7SH 5I8CB 5FOJA 1IEBB 4D3CH 4HKXA 1EFXB 4LARH 3QDME 3F7YB 5IHUL 4BA8A 4KGLA 4MA8L 4KTEH 4FFVD 4KZDH 4J4PD 4KV5E 4YUEL 1INDL 4LCCA 4S1RH 3P30L 5IB4B 1NCCL 5KG9A 5JOFA 1SJVA 3GNML 2K7QA 4WW2B 1KCLA 1BFTA 1F00I 2ERJB 3ZKXB 5I71B 1CZ8L 3L3DA 2VXUL 3NCYP 2RGSA 4I18B 1A3RL 2R2BB 1T0NB 2F19H 4X7CC 1DBJL 3PWUA 1DN0B 1F02I 2Y23A 1ZKAA 2FB4H 3KHQA 4R4FH 5HGBB 5GGTL 1RZGB 3TEUA 4DAGL 1OVZA 1KIRA 2ZJSH 3VXSB 2QQNH 5CMAA 4PJAE 2DTML 4QRPA 4GKSB 3PWLB 4GG6A 3RQ3A 3T0DA 1KEGH 3LSOA 4FQLH 4FZ8L 7FABL 1N26A 4G6JL 3DUSA 1KV3A 4OAWB 3MUY1 4P5KB 2J1KA 4JHWL 3LQAL 4K8RC 3KPNA 3MRHA 5EIIB 3E2HC 4X4YB 2H26B 3P73B 3QEUB 3HR6A 3RAJH 4WI2A 3SE4C 4QRRA 4G6FD 2ZUSA 4UNVA 4J3SA 4NCDA 1FE8L 1YN6B 3D85D 4L9LA 4EXPX 2BSSA 2F53E 4L4VB 4PJIF 3I6KB 3QWRD 3HMWL 3C9NA 4NQDE 3WEXA 2IBBA 4UTAH 3FT3B 2A6IA 3HAEB 5FGBA 4WW1B 4JAMB 1CIUA 1G9ML 2VISB 2QSCL 3W11C 4NZTL 4CGTA 3CXDL 4HUXB 5GS0C 1I8MA 3MV01 3KPLB 1MWAH 5FYLH 4APQA 3QJHA 5LCVL 3VGDA 4UINH 4NO2B 5D1QB 2Y25A 5EOCJ 4ZAKD 2HLFC 2A77H 4PTTA 2DIJA 3WLBB 1NCAH 3RZCA 4IDJH 1DQML 2O61A 4MQ7A 2DM4A 1Y18A 4LLDB 1CGXA 1T3FB 1S7UA 1EVTC 1DVFB 2FX9L 4W4NA 1JGVH 5BS0E 2VLLA 3ZE2F 3QXTA 1G7MA 1JPTH 3W11D 1S5IL 1LK3L 1OY3B 4WTZG 3CFCH 5AEAA 4YQXL 5KVGH 1KJ2B 3EFDL 4MNHB 5GS0D 4WWKA 4QLRA 4E0RB 1GZPB 2XA8H 3MA9L 3IETB 2HLFD 2PXYA 3UX9B 4EBQL 4U1SA 2FEDD 1FVDB 1UB6B 3PIQA 3ARTA 2I07B 1X5FA 4TPRL 1F3JA 4PJGF 3V5DA 2IBZX 3TPUB 4R4BB 4AEHL 2YPKB 4OQTH 1Z0MA 2E27H 3UC0H 4AL8H 1OAKL 4HS6B 5HYSA 3FO2B 3ZYOA 4F7CA 2VJXA 5E0QA 3QO0B 3MA7A 3GBLA 1IGCL 1U3ZA 4OM0H 5HHPB 1T6WA 1P1ZA 4KXZI 4QY8B 3FONB 5L2KD 2NY0B 4WEBL 1AGBB 5CCKL 5F7NC 3MX0A 1FORL 1KPUB 5KAQG 2GJZA 4LLYA 2H32H 5C08E 4UUJB 1NGQH 2ZUUA 4MXWL 2H8PB 2X4RB 1FL5A 1MJJB 4BQBA 5DRZB 2HN7A 4HIXL 1TJGH 5H94A 5J6HA 1T1WA 4HKJA 4YHML 4QRUB 4BZ2L 3WNOA 3O8XB 1OAQL 4LLVA 4B41A 1NANH 3JWOC 2ZG1A 1AO7A 1UKSA 4PGCA 4EDWH 4IRSA 5FO8A 3NCMA 3WL9A 4Y19B 5JW4N 4ZPTA 5AYUL 3U0PA 2DQUL 4EI5B 4K3HA 2VLRB 5DS8B 1UM5H 3ZHLA 3O0RH 4XNXH 4PPTA 4KDTC 4PJHB 1AGCA 1FL6B 4QHKJ 5ICZB 3HE7D 1ZA6B 1I9IH 2UVEA 3C8KA 2BNRD 1L0YA 4NQUA 12E8H 5AG9A 3D69B 5T3XE 1FG2A 4XRCB 3TBWB 1T04B 4Y2DB 3TF7C 4F33A 4GKNB 5T3ZL 4Y4FB 4JY6B 3QEHA 4BZ1L 1NGXB 4NQEA 3CFKA 3V6OE 2DQTL 5KOMC 4NN5C 1PQZA 2BNUB 5FCUL 1RUQH 5KSUA 2MKWA 2R39A 4LSVH 1IQDB 1J1XL 2YPVL 4Q6IB 1AJ7H 3MRPB 3ROLA 4G8EB 2C7UA 3MLZL 2A6KB 5DT1H 4HIJB 4N0CC 3FQNB 1AHWA 2KQMA 3PABA 1RULL 5FGBC 5IVZB 1ZANL 1MCPL 3U30B 1QFWM 1L7IL 4NWTL 3KYOB 1LEIA 3MCKA 4APQC 1GZQA 4LVHC 4ODSH 1AXSB 3QDMB 1RZFH 2CRZA 3TBTA 4NKIH 2DLEA 5TFSH 5DHVH 1OD7A 3RZCC 4G80B 1M7DA 3MRRA 3MCLH 2NW2B 4PRDB 3G08A 4ZOBA 2DLIA 1O7SA 3KVQA 4MNGA 2B2XL 4M9OA 5I76A 4J3UA 3F62A 4AZ8A 3LMJL 1X4YA 2VSCA 4DJMA 2M1KA 3P4NB 1GGTA 4JZJA 1KC5L 4XWGL 4OCRL 2MPAH 2X70B 4JRXA 4MGXA 4N0CD 1DFBH 1I8KA 3AU1A 2EXWC 3KWWB 1B90A 5SX4H 4WHTA 4D0DB 4XBPB 2Y06H 1GOHA 4R2GB 1BWWA 3BPOC 1DQQB 3T0EE 2VXSH 4K9EH 3UP1A 4NO0D 4OLWH 3JBG7 4APQD 3WV0A 3QQ4A 3M45A 2R0WL 1NC2D 4ZS6C 5CWSB 4HJ0C 1YEDB 5JTWA 2AQ1A 4LQFL 1V5JA 2XN9D 3RIAK 5IOPB 3X13A 4PJAB 3HC4L 3HE6C 1WBXA 4YHNA 1CE1L 1D9KA 1IEAB 1ZHNB 4JFFA 5KVFL 1JGLL 5C86A 3UZQA 2IGFL 1H8OA 5DD0H 5E4EC 4JHAH 4ZG1A 5IW6B 2JK5B 2D7OA 2AEPL 3VXMA 2GITB 3NFPB 1I9EA 3IGAB 5DJ6B 4YHYB 1QBBA 4LDOB 3IF1B 1X5XA 3HG1D 1XZ0A 4YEFA 3L5WA 1K4CB 4NSKB 3QG6B 2BVTA 4HJ0D 4I0PC 1JUFA 2EIDA 4GKZB 1MCBA 3LEXB 5D72L 3QUXA 5C0IB 2VXQL 3HE6D 4PTUB 4NQDB 3GJFA 3DRTA 3T08A 1YN7A 4O4YL 3FO0L 3PHOA 1NGYB 4M7LT 4ORZC 2JIXB 4NZUH 3U0TB 3VH8A 2DQEH 4N8PA 5KSBA 2XA3A 4HX1A 2CDEB 2BJML 1QD0A 3ET9F 4D8PA 2GIYA 5EO0A 3OHXB 4YHOL 4K3EL 4OF6A 1KCUH 4X7SL 5TDOA 4HZAA 1I9RH 1DBML 1SJHB 3LN4A 3TESA 1G7HA 4I0PD 1T7XA 5CIPH 1UYWH 1U8KA 5LWYL 2YKLL 4MCYA 5DDHA 5DI8A 4U6TA 5BS0B 2B5IC 1G0YR 1UQSA 4ONFL 1D5ZB 4DZ8B 4OM1L 1NBYB 5SWQB 4XAWL 5EBWA 2GY5A 5I6XC 4YXLL 5CEZD 2D7MA 2YMXH 2XWTB 1QLEL 1GRWA 3BH8A 4PJEF 5CGTA 5F93C 3BJ91 1WZMA 5ESQB 3HLAA 4BH7A 3QQNA 2VE6B 1OQXA 1A7BA 3DX8A 3PP4L 1TVDA 1UXWB 2B1AH 5IR1A 1T22A 2ED8A 3RZWA 5ACZB 1OAUH 2W91A 3DVGA 5DZNA 4LLQB 4E41E 4DWHA 2OK0L 3SO5A 3MXWH 1GSMA 4U6HB 5K9JH 1FPTH 3MMEB 4U7KA 5D7JD 5I66B 4RRPA 4PRHD 5JMRA 5C08B 3G6DH 3P0GB 2R1XB 1GHFH 3JV4A 3QIUB 5DMJB 3MSPA 1KPRB 2HFGL 4U1KB 1FL3A 4O2FA 3RWGA 3PJSB 1P84K 4YDLC 1U8JB 2XZAL 4Q9RL 3UBXG 3L3KA 4GXUM 2R69L 4NHUB 2GTWB 4Z0BH 1BQHB 1CGVA 4R7DA 4P4KC 3CDGB 3FFDB 3LKQA 1OW0C 2X4PB 3KPSB 3LKOA 4PJXB 4XGZA 5HGHB 1ZVSB 2W65B 2IQAA 3HA0A 1W0WA 3DPBA 1N0LA 1GXEA 2FL5B 3QHFL 4MAYC 3MLWH 1XR8B 4XP6H 3RI5K 5L7XL 3CFDA 1FBIH 5EN2B 1CR9L 2OXHA 3QG7H 3KG5A 4OIIL 3SDXF 4HD9A 1F90H 5ITBH 3DMMB 3T65B 4QHUA 4OT1H 5FFLA 2DYPA 3FFCE 1A9EA 4CMMA 5FAAA 2FO4A 4P4KD 5EOCL 4BSJA 3PUCA 1B4JH 3TCLA 3D2UD 1TETH 4PLKC 5TE6L 2WINA 1D5IL 5AAWA 5DZLA 3ZDZE 3L5XL 1DE4A 4ZDHB 3SY0B 2OJEB 2CK2A 4MAYD 1BFOB 4L8SA 3GSVB 3DGCR 1N6VA 3QDHA 4NBZB 5E6IA 5KSAC 1J0KA 4ALAL 1JHLH 3MRJB 2FWOB 1FZJA 4RAUB 5F9AC 4G8FB 1OAYL 4HJJH 2Y07H 3TH3T 4H0GA 3MTRA 3IDNA 3RWHA 2C9AA 1J1PL 4F57L 5E8EA 5LXGH 1JE6A 3PDGA 4HIEB 5BJTA 4V1DA 1TITA 2YUWA 1RAMA 2OBGA 1NBZA 3EDFA 4PLKD 3MJ6A 3UYOD 1J8HD 5GRJH 3VXRB 1P84J 4XZUB 2WP3T 1WWWX 2N7AA 1OAZH 3MRIA 3WD5L 2R1WB 3DYOA 3TVMA 5FM5M 2GTZB 4S10A 5KSAD 1NEZA 5DR5H 1A4KB 4ZYKA 2RHEA 3ES6B 4KROC 3GB7B 5TDPB 4L4TA 1U8NB 5DK2A 3MOBH 1MHEA 2K9UA 5L2KE 1I7ZA 1VFOA 4P57A 5EZIH 1S7RB 1WQVT 4MJ5B 3IU3A 1A6TB 1F97A 3QDGD 1RK1A 5HHOE 3F5WB 1ZA3A 3CMOH 4AH2B 1IAOB 5DJDB 4OLEA 2BC4A 5FYKD 3VGFA 5FYJH 1KB5A 5F9DC 4KROD 2HTLC 1JGEB 2HFEA 2ADIA 3IFOB 3SDDA 4QTHB 4XVJH 4ETQB 2AV7A 1F2QA 1YNLL 1QBLH 5EC2A 1D5MA 4DKAA 4Y89A 1U3JA 1G6RL 1KPVB 1B9ZA 4LPYA 2QJDA 2ZUWA 3JTSA 4WV1A 2XTJC 4Y5XA 3D0VA 5I8KH 2C3WA 5IFAL 5TH2B 1WLHA 4HMCA 4JKPH 4O02L 4PJ8B 3CCHA 2DD8H 4LMQI 2E6JA 1C16A 3J8F7 5HJ3A 3PV7A 3EYUL 1GPOL 5I1AB 4RMRA 1ZHLB 2HTLD 3U36B 1JYXA 3BZEB 2E7HA 3A67L 2QBWA 5DURD 1F8TL 2HJLA 4MNQE 4L29A 4WFEE 5E9DE 5FDWB 2C1PA 4C55A 4U1IA 3UTSB 4ELKA 4J6RL 4PJCA 5ANME 2P24B 4C58B 1RJYB 1FNAA 3VG9C 2YS4A 4TSAL 1CXHA 2NQCA 2XTJD 1KFAH 3PGCB 5D1XB 3BE1H 5FOBB 1LO4H 1SBSH 4JFZH 3SCMA 4Z7QF 1R5WA 5F1NB 4XMLL 5HYEA 5IESL 4PG2A 1QBMH 3OJDA 2B0SL 5MEQA 3VGAB 3SE3A 1AGFB 1JHTA 4Y5VB 4CNIA 3OF6A 3SO3B 4FZEH 1I1FB 2ZKHL 3OKOA 4XNZB 4XNUL 2EYSB 2AEWA 3G5VB 4Y5YA 1C12B 4O2EB 4ZUWA 1H5BA 4GH7B 1WSST 4GAFB 1NGPL 3L3IA 2E9IA 5IGXH 1UB5A 3KPQB 4LK4A 1DBKH 3R0NA 1CLOH 4NUGL 5A2KH 4KK6C 4OFKA 1M7XA 1NUNB 3ARDC 3J7HA 2MOVA 3FHAA 4DK6A 1QFWL 4E41B 1SHMA 3C5ZC 4Q0XH 4WVRA 4JFYB 3Q3GB 2IFFL 1JMXA 2YSSB 3QXUA 2P47B 4QXUL 2GT9B 3VXTB 4JJHA 4PJBF 1U2HA 3LY6A 2DL2A 4XT1C 3O3EB 4GRMB 4JY5H 4YIQB 3OAZH 3U82B 3ZYJA 1PFCA 1WZ1L 1WTGT 5FM8A 4KK6D 3IU4H 5CGYC 3SJVD 2DQJH 3L7EB 1CTOA 3ARDD 3QEQB 4EI6B 3FT2B 3GRWA 3TT1H 2VITB 3C5ZD 4DZBB 4K3JH 4FFYL 4LEXL 3GSOB 3K3QA 4LGSB 4CVUA 5LGJB 2VQ1A 2VABA 5DUBA 2V7HA 1Z9SA 5ID0A 3ZLQC 1D6EA 2VR4A 3M8OL 4LDLB 5ICXB 3L3HB 3MJ8A 3IAQA 5CGYD 2FSEB 4JQIL 4GRLB 2H9GA 3V7MA 3FFCB 2BVQB 4DTGL 4OGAC 1FLTX 2QL1A 3MNVB 2Q8BH 1TQCB 1WAAA 3BP5B 3MLVH 3NFSH 3O3DB 4L8BA 1QR4A 3C09B 2AK4D 5HYJD 2X9YA 4Y5XC 4UIKH 3BD3A 3D39D 5CP3A 4Z76B 4PV8B 3VRJA 4BK5A 5JIIA 4L3ED 3SE8H 3QH3B 1NSNL 4RIRB 4BQCA 3MUHL 1UEMA 2AXHA 1C5BL 2DLTA 4JFED 4Y16C 1SEBB 2QLVB 4WI9A 3MFGB 3WNMA 1BD2B 3B3IB 3EIFA 5CEZE 2J8UE 1KCRH 3RAJL 1Y6MR 2ED7A 4OGAD 4D0BB 4QRTB 3HRZB 1X7QA 4HT1H 1QP1A 3E8UL 1M6OB 5IFHH 2VDOL 3DUUB 5EO1A 4ODWA 4M5YL 3PWNB 2Z31C 3PXHA 4P5MA 1A6AB 4NUJA 4OBSA 4LASH 3CFJA 1AD0B 4Y16D 3MRKA 1EX0A 3RL2B 3BO8A 4W6WB 3WO4B 2OR9L 1IAIM 1XGUA 1MCIA 2MQ0A 4PRAA 1N64H 4NKMB 3SE9H 4HAFA 2BFVH 1BX2B 2DWDB 2Y36L 3I9GH 3BGMB 3QJFA 4PRHE 1J0JA 1FIGH 4P5TC 1CN4A 5IHZA 1EGJA 5CILL 4BSVB 3OAUH 4Y5YC 5HHOB 2Q3AA 2VUOA 4WUUA 3S37X 5I30H 4PJ7A 1O0VA 1H5BC 2R4RH 2YZ8A 5D93C 3FHQA 1FYTB 2Z31D 4GRWH 3MV9D 3QDJA 5JXEA 2FZ3B 1REIA 1CFNA 4X6BB 5L0QC 2ZPKH 4O58L 1CQYA 2DQFB 4K2UL 4YDVB 5DMIL 4YGVB 5T1KB 4R7NB 4XP9H 5GGVH 2NZ9C 3U4BL 5FM5O 4ZD3H 3HKFA 3PWVB 2DBLL 4E42A 2I5YL 1LO0L 1LE9B 1FNGB 2A9NH 1NCWL 2R2EA 2FLRT 3OKLB 3BZFA 3C6SB 3BEVB 4P5TD 3VFOB 5ACMA 4FQPA 3G6JB 3QUYC 5JIKA 2GI7A 2NXYB 4ZQKB 1KTLA 2BSTA 2W9LA 4Y0GA 4DGVH 2R0LL 4X6CE 5HY9B 1MFCH 1RFDH 4DCQA 1RZ7H 1A7RH 4I77H 5JMOC 4YXHH 4JZOB 2NZ9D 5E9DB 4ZUUA 5C0DB 2OL3H 5DYOB 3IDXL 5C0AE 3MJ7B 5ANMB 3AREC 5BRZA 2A9ML 4PBWD 1R5IB 1NGQL 4H1LH 3C08L 2NX5D 3B9DA 1N59B 2J6EL 4GW4A 5FUOL 3FT4A 1WK0A 1WAAF 3QUYD 3STLB 5LVEA 4H1LG 3ARFC 1A1MA 1OF2A 3EGSA 5D2NE 3DXAA 3IDIA 3I6LD 2H32B 2MTPA 3C60C 4B7LA 3MJ9L 2HRLA 5B3NA 1K8DB 2X1QA 4EDWL 3E3QC 5KS9F 3QQ9C 4F7MB 3D48R 3DURB 1CVSC 3ARED 4NJ9H 3WLWC 1R3JA 1ZSDB 3KS0H 3MZTA 5AD0A 3LQZA 4QO1A 1S3KH 4Z7OF 3VWJC 3L1OH 5D1ZB 5KZCD 1ES0B 1T0MA 3F12B 4JPVH 4IRJA 2NPLX 2AKRB 4IJ3B 1INQB 2AJUH 2VDMH 2PTTB 5MEPB 15C8L 1BREA 4P23A 1TZHB 3ARFD 1T1XA 3SKJH 3QHZH 4L1DA 1S78C 5IM7A 1T03H 5CD5C 3C60D 3ROOA 1U8MA 3P11H 3OAZK 5T1LD 5JLZB 3ULSA 3LRSA 3QDGE 4WFGD 3QQ9D 2YR3A 5IWLA 2DQDH 4G8GE 4JFHE 1YQ2A 2W9EH 4ZXBC 3WLWD 4D9LL 4AG4L 5KBNC 3HPLA 4F7PA 4KRMB 3VWJD 1YA5A 4LCWD 1TTGA 4HG4K 5ICYB 1SYVB 1RUQL 4HMDA 3TIDB 3HAEA 5DWUH 2J88L 2UYLA 5GRZA 2GJ6A 2G75B 1RK0A 5K9OA 1IBGH 3UYRL 4PJ7F 4UV7H 5GRWA 3VD9A 1MNUH 1N7ML 1NL0L 1S78D 3K74B 3CIQA 5CD5D 2E7LA 3UTTB 3W0WE 2P8LA 1HHHB 4G8IA 3TBSB 4AQ1B 4QNPF 1C8PA 3QPQC 3T04D 1KN2L 4NKIL 3U9PL 1CK0H 3ZTJH 5HDQL 1MOEA 4ZXBD 4YPJA 3IJSA 1W0YT 1VB9A 3ULUF 4UDTA 4E5XB 3ZTJG 2OS7A 1OSPL 4QXTA 3GMQA 2QQLL 4R3SB 1NEUA 1T5WA 1F3DH 1UEYA 4Z7VF 4GW1A 1ONQB 5K59E 2AJSH 4FTVE 5CHNB 4Y8DC 1Q8MA 4LPVA 3QUZD 5DHVB 5D7IF 4RFEB 2F54E 2Y06L 3I3DA 3RKDC 1NCTA 2I25N 2VXVL 1KULA 3SDAB 4OLUH 4GXVL 3S36X 2PKDA 1QFUH 5DJCA 3ULVF 3QPQD 3HMXH 2PW1B 3RRQA 1HSAA 3ULUC 1TIUA 1I9JL 3B9KC 4LSSL 2B1HH 4ELMF 1F2XK 4M43L 4H8WC 2ENSA 1W8NA 1VHPA 4ZNCD 2DL9A 2DI9A 1DLHB 2ORBH 3OTTA 1PYWB 4I9WD 3MV7E 4ONOA 5LGHL 3O2DA 3CFIC 3ELAT 2ADJA 3EYQC 5D7LA 4Y4HB 1JZ7A 3LKPB 5DD0L 4XPHH 3T77B 3U4EA 1CDCA 3EO9L 1AGBA 2EE3A 4HG4J 3ULVC 2EICA 5AAMA 3PGFH 1YEGH 5IB2A 3D0LB 1CGSH 3CUPB 3PQYB 3X12A 4NJAH 5BZDB 5C7XL 3QULA 1MCFA 1QRND 4CMHB 1N4XL 3B9KD 4GAYB 5HXMA 4X99B 1YC8A 2CLRA 5GGUB 3EOBA 3U46A 4NRXB 5I8OL 2CD0A 4GAJH 5DRXA 5E94A 3RWEB 1AKJD 3C6LB 1II4E 1YEKL 1HZHH 2XICA 3TWCL 5FA3A 4OZIA 2OI9B 1HCVA 3T2NL 3EYQD 3R0MA 4FQIH 3S88H 4AYFA 1A7PH 3S96B 5DJ0A 1MIEH 3FQWB 5HPOA 1TZIA 2CJUL 3RUGF 2OMBA 2DQHH 4EI5A 3ULVD 1QTYT 1MY7A 4ZUVB 1E6OL 5JO5A 3VRIB 2X1WL 3THMH 2YN5A 1E4JA 2AERT 4POZC 4M4RA 2EE6A 4MDJA 3TIEB 2CKBH 3RTQB 2PTVA 3RVWC 3I3EA 2BNQE 5H35B 2HRPL 1S7SB 4XRCA 2V2XB 2O5XH 4TNWK 4Y2DA 5EH1A 2QHRH 3MQIA 4X6DB 5D2LA 3GDBA 1SY6H 4Y4FA 5ABDE 1BIIB 3LD8B 2FJFB 1B2WL 2OQJA 2YMXL 5CIPB 2WZPD 3VMOA 3RY6A 2OR8A 2W0LA 1SVZA 2CIIA 1AQDA 2FD6H 3AAZB 3UJJH 2XKNA 4PJDF 3LQAC 1IQDA 1H3VA 5ALBH 4M62H 1AD9A 3TCXA 2BVUA 2A6KA 4POZD 3W39A 1L0QA 2B1AL 4I2XE 1R6VA 1A0QL 4EN3D 1J10A 1J7VR 1TNNA 1RJZA 3MRGB 4LAQH 5LG1A 3NAAL 5F97E 4K8RH 5D70L 2R0KH 2WLZA 5DJYB 1BLNA 2VC2L 1D3CA 5J3HC 1MUJB 1WITA 2VWEC 5HYQB 4UT7L 5FB8B 3O2VL 4NFCA 4JJ5A 3QFJE 4MJID 4PJBE 5C0AB 2VDPH 2AK4E 4CVZA 1BEYH 5E08L 3RWFB 3UPCA 4LRNH 3BIAX 1OCWL 4U1NA 1DP0A 4P0DA 2YC1B 5J1TC 4P4RB 3VD4A 2F74A 1QNZL 1UA6H 5D2NB 5GS0H 4Z0BL 5FA4B 3OXRA 5FUZH 5F3BB 3ESVF 5JDSB 4PJFB 3FMGH 3T0XA 5J3HD 1NAMH 2KH2B 2NY2B 5BZWB 5CWSA 5F72S 5IOPA 2EDLA 3BKCL 2EZ0D 1GH7A 5CUSH 1G0DA 3REVA 1IEAA 1ZHNA 1KLUB 4R8WH 4KTYA 4YE4H 1PVHA 3LKSB 3JTTB 4QHKI 1X5LA 2DQGH 3HZMA 1KELH 3I2CL 3V4VL 3WJJC 4JDTL 5FM4A 4ONGH 5JR1H 3WN5A 4OZIF 3IB4A 3VE0B 4F9LA 4KHXH 2F58H 4X4XB 3T0VA 2PYEE 2WBJA 3IDGB 1AC6A 2ITDB 3G6AA 1R3KB 1LD9B 2GCYB 4M7KH 2VXTL 3HTLX 4G8GB 4G3YH 4KJYA 4LPTA 1N2RB 2C3VA 5TDNB 1F6LL 5D6DA 1BBDH 3TA3C 1VACB 1JHLL 2QQQA 5F7MC 4NKQB 1S7TA 2DQCH 2YPLD 5A16A 1AC0A 2HAZA 4Q9CA 2JCCA 4HJJL 3S34L 3WIIL 1MQKL 2JIXA 1JV5A 2FJHB 1ZOXA 3DJ9A 1JMZA 5E5RB 5HTSA 1C1EL 1IAIL 3MYJA 2CDEA 3VFGH 4R0LA 1R3LA 4LLWA 4OFVA 5KSVA 3W0WB 2ARJB 2P1YA 3W9EA 4GO6B 4K7PH 2O26U 1HH9B 1CXKA 4ZO6A 3PNWA 3K2UL 1A6WL 3VWKC 2MHAB 3TA3D 5DR5L 4JN1L 4PRIB 3O6FC 5GSVB 4YDKL 3LDBC 4LIQH 4QRQA 1HSBA 2VLKA 3G04B 2VTFA 4L8CA 1Q94B 5A3IC 1J87A 3OXSA 4CW1B 5DRNB 4FTVB 3JWOH 5CINL 4TSBH 1QFWI 4F2MB 1PW3A 1ED3A 4HJGB 2KL6A 4W6XB 5D96C 1VPOH 5BW7C 1DEDA 2ICCA 3VWKD 4RISL 1IMHC 5JZ7C 3O6FD 4ERSH 2O93L 3RNQB 2YBRA 1NCBH 2G5RA 4G9FD 3OB0K 4WFHE 4F7EA 4NNXB 3SGKA 3I6LE 4X80L 3MV7B 5A3ID 4MDIB 1YY8B 1GGUA 4QWWD 3D87B 3WIFA 4C56A 3A6BH 3U7WL 1NJ9A 4KK5C 4NZDA 5E8NB 1HDMA 1CFVH 5IFJA 3BKMH 5C2UB 1MHPH 3KJ6H 5KTEH 2D0GA 1QSED 1ZT4B 5C0EA 2JJWA 5IQ9A 5KVDH 3QQ3B 3H2WA 4JKPL 1J0ZA 2XKSA 3B83A 4PRPD 5IEKA 5ITFB 5JZ7D 3WS6C 4JHZA 3T3ME 4NHUA 1ZTXL 5T3ZD 4ODUB 2OSLB 1CYGA 3H3KA 5C0CB 3GSNH 4OZGF 3KPSA 1X4XA 3UTPE 3CVHH 2CUHA 4UDUB 3SGEI 3C2SA 4PGBA 4WFGE 4KK5D 2DIBA 5TQ2H 2ADFL 3FB5B 1R0AL 2IALB 3EOTH 3CVIL 3WIHH 3DBXA 3GIVB 1R24A 2X10A 2R0ZH 5F7EH 3BPLC 4G7VH 3KPOA 4OKVB 5KJRL 3AM8A 1S9VB 1MCEA 3QP3A 3IVKB 3QZWB 5L6YH 1NLDL 1WEJH 4KJQD 2GK2A 4KJWC 2FNBA 3QRGL 4FQCH 1OWRM 2ESVA 5MERA 4P46B 1J5OH 1N5AB 1K9TA 4ZDHA 1H3TA 1CICC 1NAKL 1H3PH 2R4SH 4A6YL 4F9LC 5I16B 5I2IA 1J8KA 5FKAB 3LEYH 3OAYH 1B0GA 2ZCHL 5A2IH 3IJYB 1JWUB 4DGYH 3N1GC 1E4XH 3QXVA 4XPGH 1TCRB 3GMNB 5DUPL 4YHPB 4PYGA 2YD5A 4GJTB 3OKKA 2VLMD 2D2OA 3L95A 3MUZ1 4I2XB 2VAAB 5D5MB 3L3OA 4KJWD 3UJIL 4OZHB 4FQ2L 3VXRA 4XCYB 1U3HD 2PCPA 1G9EA 2VZTA 2YD8A 1CICD 3GZKA 3QFJB 4XH2B 5F21B 2VZUA 4X6FB 4GBXC 3IS0X 1DBBH 2Q1EA 3ALWA 1QPPA 2QEJA 2E7CA 3DECA 3FQXB 1MCCA 1VFAB 1YEEH 2QKIB 4OKDA 4HUUA 2DICA 3IU4L 1QO3B 3PWJB 2WUCH 4LLMA 1KIQA 1IL1A 3P0VH 5C2BL 2IAMB 1XEDA 1JI1A 3KDMA 4KI5E 2P48B 1MHCB 1IAOA 3TZVA 4ORGA 1ERNA 4GBXD 3GK8H 3A0OA 2J7LA 3IFOA 4NQVB 3D3VA 3CX2A 4M61A 1CD1B 4AM0B 1IT9L 3ARGA 3UCRA 1CFTA 3BZDA 3VW3L 1QSFD 1G1YA 4JQVC 1VADA 2XQYG 4Y7MA 3SGKC 5BMFH 1TQBC 2EH8H 1SYSB 4U6VL 5ESAB 3P4OB 4I3GA 2OXGA 3D6GA 2EDDA 4QHLB 2PYEB 3K2MC 4ELME 3IDUA 4PS4L 2R2CA 4LHQB 4PRBA 3LQMA 3CPLB 4HKZB 3IJHA 5F8RC 3QIBC 2WQRA 2BOCB 5L8LB 1ZLSL 3U36A 3VCLB 4QOKA 3QCVH 1BVLB 2UWEA 1G6RA 5EUKA 1RZ8A 4GMTH 3KYKH 3V4PL 1UC6A 1UT9A 2IBZY 2Q76B 4GAGH 4NRZA 3HZYA 1WUNT 1V8HA 4OZFH 5IMOB 4I5BB 3WE6B 4K3DH 1G7QA 1B88A 1A6VH 4S2SB 4CUCA 2ICWJ 5JPMB 1YMMB 4PJ5D 3HS0A 4HS3A 4OZFG 5GIRB 3U9UA 2IPUG 5MP6H 3U48A 5F1NA 3HNVH 3QIBD 1AIFB 4H5SB 4QYOB 1XGYL 1UH3A 3B8YA 5IJVB 3RWCB 1N64L 4N90D 1FCGA 1XCTB 1DZBA 3GBNH 1KT2A 1X3DA 3NABH 2ITCB 1NBQA 5I15H 2WP3O 1FIGL 4P2RA 4YX2H 1RHHA 3O6LL 3OAUL 4JQXC 4L5FH 5CKGA 4JFXA 2FATH 3WXWH 1KBGL 5F89B 1JPST 5BV7B 4FQJH 1MI5D 3LKRB 3V52H 3DV6A 1BWMA 1MIMH 4XNQA 1YDPB 3VA6A 1UZ6F 3V2AR 5I1DB 2ZPKL 5DLMH 3MRCB 5DQJA 2VZ1A 3DO3A 3BKJL 5MENB 4EXKA 3T8XB 1XIWB 5DJAB 4NC1C 4HAGA 1P7QB 3O6MH 4EDXB 5GRVK 2AK1H 3MLXH 3MXVL 1OB1B 5FK9A 4NYLA 1DQLL 2P5WA 1T7WA 3T1FA 1S8DB 3MGOA 2Q86A 2HH0L 4ODTL 1FZOA 5C6TH 1FO0A 2RIKA 3ZTNH 2MSPA 1OHQA 3TNMB 1G7IB 1JGUH 2RB8A 4EI6A 3GJFH 3OKDA 1KCVL 5T3XL 1X6NA 1X5AA 2LVCA 4M93B 4M7ZC 1RUPL 1KGCE 1DL7H 1CLCA 3SBWA 2GEEA 1QVOA 1BM3L 5CJ5A 1C5CL 2N1KA 4WY7H 5HHQB 3L5JA 3GMOB 5E8PB 3GMLA 5FYKH 3U1SL 5CEYB 1KG0A 2IANB 3NA9H 5J1AA 3MGTA 4S1QH 4V2BA 4ZSOE 5DMKB 4L1HA 5IVOA 4FMKA 3QUML 5E24E 1PSKL 3S98A 3ZYIA 4LPWA 1P4LA 3EYSL 4H1LB 1XGTB 4TN9A 4FFZH 4MXQC 4L3CA 4XPAH 4G9DB 1RIUH 2DWEB 5EORH 4UT6H 5ENWB 3O3DA 2A6DA 4Y2OA 3VFRB 1MPAH 2GSIB 3V5HB 3B2VL 1S3KL 1W72H 4KVCH 2EO1A 3WXVH 3CLFH 3H9HA 3W9DA 1TCMA 1RURH 2PO6C 3AUVA 3HUJF 4DEPC 4P99A 4JDVA 2CDFA 2IH1A 2ATPB 3BEWA 5EIQA 3RVUC 4YFLI 5GHWL 3RPIA 5I1JH 2BRQA 4MXQD 4MA3B 1RVFL 4JB9L 2EDWA 2DQDL 1T4KB 5SWSA 5JOPD 2W0PA 1LO2H 4ZFFA 1JTPA 2YD9A 2J4WL 3KXFE 1T89A 4KY1H 3O11B 4MAUL 2CIKA 5IQ7L 5IIEA 1MCHA 1WV7T 3FO1B 5CSBA 1AGEA 2PO6D 3BW9A 2DLFL 2P5EA 4NKOA 4UV7L 2COQA 1Q9KB 2VDLH 3P3YA 4S0TD 3O9WC 2D03H 3RVUD 3EFFB 4JLRB 1KCSL 5EC1A 2X4TA 4Z95H 3I75B 2FR4B 3IRPX 1MWAA 3U83A 1PG7W 1X5JA 3HN3A 5IV2B 1LEGA 2FX8H 3MPCA 5E00B 4N1CA 3P77B 2JJTC 3MNWB 5I18H 3RWDB 2CXKA 3EO1B 3OR6A 2AJYH 2AJSL 2CGRH 2KDGA 3WHXB 3OX8A 4WTZA 1JYNA 3O9WD 3P0YH 1NFKA 1EHNA 2X89A 4FXKB 1QFHA 4HPYH 4OLUL 2ZUTA 3QNYB 5EO9A 3LH2L 2APVA 3HI5H 2BXYA 3G6JA 4H26B 5CS7A 1FH5H 3ILPB 2M2DA 5FO9B 4MD5A 4NQCA 2X7LA 4JM2B 2VSDA 2WM0A 4P2RD 1MAMH 1A9BB 3UBXI 2IPUK 4OJFH 5I19L 3MODL 3HI6H 4IRZH 1SJXA 2MFNA 4NC0B 5JORB 5HGAA 2VLJA 4RGNC 2EIZA 4OQTA 2FYYA 3C5JB 1YUHA 4YXKH 2R1YB 2BHYA 2O5ZL 4GG6E 1HH6B 4M3JA 1GGBL 4DN4L 1CGSL 1N59A 4HUMB 2HJFA 2FJGB 3RHWF 5BOPA 4XP1H 8FABB 3GJEA 1P9MA 1N8ZB 2HVJB 4Z8FH 1T1ZB 2VLME 4HBCL 3Q1SL 4TRPL 1HZHL 1IGJA 5EU6A 4KHTH 2H32A 1P7KB 1A7NH 2V9RA 5INCB 3S88L 4QRRE 5F1IA 1HILA 3NOIA 4Y4KC 3T4YA 3UZEA 1A7PL 1LP9A 3FN9A 2YEZB 4RGND 5I1LB 1EK3A 2UZXB 4IIQB 3O45B 5FHAH 4PJ9A 4KKAD 4UTBH 1IARB 3QIWA 2IF7A 1OT1A 1F58H 2GSGB 3I6GA 3VFTB 3ZDYE 1NDMB 3O3UN 2AKRA 3PXJA 1INQA 3Q6GH 1YEHL 2BERA 2L4OA 5C6PB 4NP4L 5LBSH 4LCYB 2XNAA 2PW2A 2X44D 3BDYH 5I74B 4S0SD 2JB5H 1F42A 2ZWLT 1IM9A 3NN8A 5EIVA 1UXSA 3EJZC 1EHLL 2VL5A 4OB5L 1FP5A 5ESVB 1F4WH 5I8EA 4Y4KD 5DD5H 3U4AA 2XKUA 5GGVY 1MFAL 3WDHA 1F4YH 1LK2A 2EE9A 5F96H 1JF1B 4R97B 1IAII 4M03A 1UJ3C 1FVEB 1QBAA 3AXLB 1TLKA 1T5XB 2H1PH 4CADA 4CVWA 1L9MA 3KPPA 1U2CA 4QCIA 3TIDA 1E28B 1HWGB 3BPCB 2G75A 1LEKA 4DUVA 1TTUA 1HNFA 3BZ4A 2A73B 4KQ4L 2C4FT 5FKPB 3O6KH 3RIFK 4G6KH 4LNVA 2AI0H 4XBGA 4XXCC 3RWIB 1VFUA 4G6FB 4J1UA 2HJKB 3B8SA 4U1HB 4P2OA 3EJZD 4XCFL 4HIHA 4JPWH 3EKCA 1HHHA 1EAPA 2ZP0T 4UB0H 1HIMH 3DNKA 5C09B 1WT5A 5HYFA 5JHLH 4K7FB 4H20L 2KZWA 4PB0H 2GQHA 1S7QA 2E3VA 3K0WA 3L3GA 4YHIA 4LHUD 3E2HB 3T0AA 3UJTL 1K2DA 1VGEH 1NCDH 2DM7A 1IAKB 1AQKH 5F6HJ 1OLLA 5EUOA 4XVSH 4ZSOB 1DANT 3QXAA 3VXQA 4LSPH 2AQ3A 4ZFZB 5T33H 2P5ED 3FMGL 2VAJA 5D8JL 8CGTA 4J8RB 5J6GB 3UYPA 2H6PB 1K85A 4WFFD 1HK6A 1TTFA 1IFHH 4U1JA 1WFOA 1NFDA 3C8DA 4D9QD 3VGGA 3WNPA 5GSRB 2AEQH 43C9A 3BYTA 1D5XB 2XI9A 3O4OC 5DJ2A 1ZGLA 1Q9LA 1AFVH 4F3FA 3P4LA 3TO4B 4QT5A 2LABA 5DA0B 5DVMA 1NAMB 3ZE1F 4Z7WE 5FYKU 1AO7E 3F7VB 2Y5TB 4GSDL 4YDJB 5E1AB 1U8OB 2V2WB 1MFBL 5HI4C 3S37L 5EOQL 5IUSA 3O4LA 5DEFB 2DLHA 1IC7H 4KHXL 1TJHL 2RCSL 3MRFA 4GAYA 4FHBD 3PWPA 4DGIL 2ZSVB 4Z0XB 4JFOB 1MF2H 3T3PE 2J12B 3RWEA 1MI5E 2DQCL 3KXFB 1GGCL 4WCYL 4Q7DA 1U9KA 3SQOH 3X11B 2ICES 5LAXB 5CSGA 4LOUC 1RZJC 4NQEE 4YC2C 5IVXA 4BKLA 5HI4D 4U1LB 4X7DC 1S9XA 1UH2A 2WAHA 1RY7B 3GRWH 2XWBA 5C0BD 5J9PA 1MHHB 4JRYB 3IFNL 3ZL4L 1S5HA 4HF5H 3TBVB 4WHCA 3HC0B 5J12B 3RTQA 4MZ3A 5IHLB 2YXFA 4HXBH 1OGAA 5JA8B 5T5FH 2HT3C 4X6DA 4XHQA 4HKXB 4U4BA 4LOUD 5JDJA 4V2CB 4KPHL 2NMSA 4I3SH 4M7JH 1YYLH 3BP6A 3TH4T 5EU7C 4XXDA 4LCCB 4OGXH 1BJ1H 3DWTA 5EPMA 4MNGE 3H3PL 4DKFL 4DW2L 1B0WA 2BNRB 2HWZL 3EZJB 5ISZA 5KG9B 5JOFB 4JRXE 4Q97A 5JOEA 1HHIA 4PGDA 2V5SA 4ERSL 3MRGA 4NNPH 3L3DB 5F44A 1NCBL 4ZNEA 3FB7A 1YPZF 4LVNB 3UAJC 4LKXA 2RR3A 4ZO8A 1WWAX 3PWUB 5C3TA 3WFZA 4F15B 1A1NA 3S8WA 2XQBL 2MCPH 4QXGH 1R3IL 1KIRB 4JFDD 4P2OC 4QGTA 1MHPL 5CMAB 3ZE0F 1QLRA 5C92A 4N8VG 4QRPB 5KTEL 4GG6B 4J3WA 2L7JA 3CDCA 1MCQA 4RDQF 4JFFE 2AGJL 4TSCH 3LSOB 1X6LA 4P3CL 3DUSB 4CVXA 1NFDF 3NIDF 3RDTC 4N0UE 5DHYA 4Q2ZA 3KPNB 3MRHB 4HZLA 5JXAL 3OKEA 3UDWA 4UAOC 3UAJD 4MA7H 3S35L 3GSNL 3UBXA 1DSFL 4QRRB 3KPTA 1A5FH 5IVNA 1FFPA 4C83A 1I7RA 4NN5B 5FIEA 2V2TA 4L9LB 1V3KA 3MV8D 1HQRA 1FSKC 2BSSB 1JFQH 5JOPE 2DMKA 3WIHL 3C9NB 1IQWL 2WNGA 3WEXB 2GW5A 1NGWA 4U7MA 2A6IB 7CGTA 1BAFL 3UTOA 4XC3L 3LN5A 3IYLW 3RKPA 3LKSA 3QPXL 3RDTD 1I8MB 2DIAA 4IHOB 4APQB 3FN3A 3QJHB 3F58L 1WIUA 4PTTB 4PLJC 4K55A 2VIRA 2AABH 3RZCB 2MCG1 2XN9B 1WWBX 1YNTA 1R3KA 2O61B 4MQ7B 1P4IH 1MRFL 1FFNA 1Y18B 4KTDL 5DEZA 1S7UB 4AEIH 2R4SL 3KR3H 1I3UA 2IEPA 3LEYL 3LS5L 2W0KA 4M1GL 3ULUH 2VLLB 4H8WH 1G7MB 4DUWA 4EUPA 4OFYA 5FO7A 3PDDA 4Q74A 4NPYA 4R26H 4YFLF 4WWKB 5E70A 2D31A 2EXYD 3S36L 1JPGA 3RGVC 4X7FC 1NMBL 1I85C 2PXYB 5JQ6H 3FOLA 1N5YL 4U1SB 4PLJD 3KPMA 4URTB 3NZ8A 3NPSC 3KPRA 4XVUC 1U8IA 3WMSA 4HUWA 1BZ7A 3DSNA 2W1NA 3WFBL 3V5DB 3ULVH 4M3KB 5KOVC 1IC4L 5TGBA 4HW6A 1NC4D 5HYSB 1OM3H 5E4EB 4OCLC 2AAVA 1DBBL 3LKNA 4YH6A 4F7CB 1O7VA 3MRQA 3L6FA 3MA7B 4FQXA 2Z93A 5SV3A 2W07A 3NIFF 1V3JA 3STZA 1P1ZB 2VDQL 3E6HA 4J12A 5IHUH 4LDEB 3RGVD 1A4JB 2WUCL 4MA8H 2LVEA 2XFXA 4YUEH 5F1SA 1INDH 3SGDH 4X4MA 2GJZB 5CEZL 3VXPA 4LLYB 4XVUD 3P30H 3V7AG 1NCCH 1FL5B 3FN0L 5DGRA 3WNLA 1GCFA 3T09A 2HN7B 3GNMH 5C8JA 4WW2F 5J6HB 1T1WB 2VMFA 4HKJB 4Y1AD 3GK8L 1ZE3C 2VXUH 3H8NA 3GMPA 1DBJH 2C3HA 3AS2A 3KNBA 5GGTH 1AO7B 1FGVL 1SJEB 4PGCB 6CGTA 4DAGH 1U6AL 5FO8B 1YEJL 3WL9B 2FECL 4G7YH 2X4SA 4ZPTB 3U0PB 3K7UA 3LPWA 2EH8L 4OLYL 3GKWL 1NFIA 4U1GC 4LU5L 4LEOA 1QRKA 3Q5TA 4FZ8H 5EU4A 4HH9A 4G6JH 4WW2C 2B5IB 2ERJC 3ZKXC 5DVOA 4JHWH 3LQAH 5JNYA 4I18C 3C8KB 4LLUA 3ARPA 1EFXD 2DBJA 4P2QA 2XG5A 3QCVL 2X4UA 5ID1A 1FG2B 4GQPH 4LBEA 4H0HB 4F33B 4JGJA 4LGPB 5AUMA 4GMTL 5ACLA 2Z91A 4NBYB 3QEHB 1FE8H 3EHBC 4JRWA 4NQEB 1IGML 3CFKB 1ACZA 1VA9A 2F8VA 4PV9A 4R90L 3HMWH 3QXWA 3HHRB 3MO1A 1A6VL 4K7PY 4Z7UA 5KSUB 2QSCH 4NZTH 4LCIL 1V7NH 2C7UB 3ROLB 3MRNA 3CXDH 4NNYA 5MP6L 1I8LC 43CAA 4RAVA 1AHWB 5LCVH 3PABB 4GG8B 2IPKB 5L8KB 3N85L 1LEIB 5ECJE 3MCKB 1M7IA 3VXSD 1DQMH 1KN4L 5DXWA 4LSQH 3EHBD 3TBTB 2WLYA 3CZFA 1ND0A 3T0BA 3GBNL 2AJ3A 2HT2D 4YBLB 2FX9H 1M7DB 3MRRB 3G08B 4O9HL 3GSRA 4LNRA 4MNGB 5I76B 4L4TE 1S5IH 1U58A 1LK3H 2FATL 5ADOL 4JZJB 3WS3A 4YQXH 3LRGA 3EFDH 5D1QC 3VMPA 1S7XA 1I8KB 3AU1B 4X98A 1F4AA 2FGWL 1YECL 3MA9H 4WHTB 4A6YA 5IEHA 4EBQH 1FZMA 3VXUA 4RA3A 3QQ4B 4TPRH 3QI9A 1TDQA 1FFOA 4L4VD 1DVFC 3LCYA 1U8LA 4AEHH 3NVQA 1IAMA 1HOCA 3X13B 5BOZG 1OAKH 2ICEB 1WBXB 2WUBH 4MJ2A 1D9KB 4YHNB 4JFFB 4ACPA 1IGCH 1RHFA 4QKXB 5D1QD 5C6TL 5IJKC 3UTZA 1J8HB 4WEBH 5IB3A 3VXMB 1BJMA 5DA4A 5CCKH 1WF5A 1WZLA 3RU8L 3UPAA 3PL6A 1FORH 3BXNA 3H0TA 3H9SA 1OARL 4MXVE 1FNFA 3FZUC 4MXWH 2K7PA 3L5WB 1DVFD 4O2CA 1DL7L 1BJ1J 1JUFB 5JIPA 1UM4H 4HIXH 5E8DL 4MMXC 3ARSA 3O2WL 2EKJA 4BZ2H 5HDBE 3GJFB 3DRTB 1OAQH 1YN7B 2P46B 1YY9C 5EZJA 2NY0C 3PHOB 1RUKL 2FIKA 2C26A 4PJCE 3VH8B 4PLOB 2NXZB 1EO7A 5KSBB 5AYUH 5E2JA 2DQUH 4HX1B 4D8PB 5ESAA 1NMCB 5TDOB 3UTQA 3OKNA 3FZUD 2ZOLA 3B5TA 4XP4H 4WEMB 3LN4B 5C0BE 4KROB 5GS1A 1G7HB 2OZ4L 1MPAL 1AY1L 2WWMC 3T2OA 1U8KB 3O8XC 4MCYB 1I1AA 5DDHB 5DI8B 4P3DA 4XVTH 1RURL 1UQSB 3OPZL 1YY9D 2NY0D 1UM6L 5T3ZH 5EBWB 4HXAL 4G42A 3ARBA 1N0XL 5C0JA 3BH8B 4N0FA 3B5GA 2DQTH 4RBPH 4QTIL 1U92A 3BQUA 1ITCA 3HLAB 3LZFH 4BH7B 5FCUH 1E4KA 1J1XH 2YPVH 2QHLA 1LO2L 3DX8B 2WWMD 4YNYA 1G7LB 4MVBC 2UUDH 3V0AC 3O8XD 4KY1L 2VRAA 2E8YA 3V6ZA 2P8MA 4OLZL 5IR1B 1T22B 1RULH 3QO1A 4MD4A 1CFSA 4MA1B 1MCPH 3DVGB 2YZ1A 4PBVC 1L7IH 5I1KH 1J05A 4Y19D 2BY0A 3GI8L 2XTJB 2VLRD 1CXEA 2ITCA 4Z95L 4WO4A 4KV5F 2W0FA 4Q6IC 5I9QB 2B2XH 3SKMA 2G5BA 3JV4B 3LMJH 2FX7L 5E2TL 1HI6A 3RWGB 1FL3B 4O2FB 1KC5H 4XWGH 5DK0A 4OCRH 4MVBD 3L3KB 4N0RA 5IK3A 4R7DB 2WV3A 3LKQB 3VG9B 4QF1A 3LKOB 2IQAB 1W0WB 2R0WH 4K07A 3WUWG 1EDQA 5EBMA 4RWHA 1OSZA 4LQFH 4HPOL 3U79A 3VG0L 5KW9L 3HC4H 3QI9C 3CFDB 4PJAF 1CE1H 1FH5L 5KVFH 3LS4L 1JGLH 5AZEH 3QB7C 1EEYA 2IGFH 3VI4E 4OIBA 1YPZE 3MLYL 4R2GC 2AEPH 1LDPL 5J57B 4QHUB 1IKNA 1G7IA 2BHZA 2DYPB 4JPIA 1A9EB 4U0RB 4RWYL 4CMMB 2FO4B 4HS8L 3KLDA 4KRPB 1VEPA 3QDMD 4N68A 4C57C 4LKCA 3BRGC 2WINB 5SWZA 2LQRA 4BELD 4BFBD 1E27A 1IC1A 1DE4B 1CDJA 4L8SB 5D72H 4RFNB 3DO7A 2VXQH 2HP4A 4XHJC 5E6IB 4KKLC 4UOJA 3AY4C 4A2LA 4U05A 3CC5A 4TQEL 1FZJB 1IE5A 2ICWI 3FO0H 5ILTL 1XH3A 2OL3A 1LILA 3IDNB 3RWHB 4YHYC 2CLZA 4R2GD 3TN0A 2DLGA 3U7YL 5E8EB 5BJTB 2ZUQB 2BJMH 4V1DB 4YHOH 1JRHL 1NBZB 4X7SH 5ETUA 3D1MC 1DBMH 4NKDA 3IXAB 1PKQE 2ZCKL 3AMLA 3MRIB 2N56A 5FHAL 1BMGA 4X9FA 5DQDL 3QUMA 4XHJD 4KKLD 1NEZB 1NUFA 5GPRA 4ZYKB 1T2JA 4ONFH 1T83A 4L4TB 3RL1B 5LBSL 4OM1H 3G9VA 5DK2B 3GHBL 1MHEB 4YXLH 2PETA 1I7ZB 1NUDA 4P57B 4O51A 1QLEH 1X5IA 3C5SA 4KJPC 3IU3B 5I0DA 4J3TA 4UOW0 5E8OA 1BFSA 4MA3A 1CLZL 4HK3N 1RK1B 3ARBC 1QEWA 2Q7NA 4WUUE 1ZA3B 2CO6B 2F53D 3VFWB 4HWZA 3PP4H 3SGJA 2G2RB 4NQDD 2BC4B 5IKCA 3QDJE 1Z9OA 5C07A 1KB5B 2HFEB 1UZ8A 4FABL 4Z78A 3R06A 2ADIB 3T0EA 3E1F1 3SDDB 2AV7B 4G6KL 1JZ8A 1NCNA 4NDMA 2IPTL 2HKHL 4KJPD 2C3XA 1SEQL 3QWOA 1D5MB 4JPWL 4KAQL 1PKOA 5FGSA 3ARBD 4Y5XB 1K6QL 3JTSB 4WV1B 3TO2A 3D0VB 1TZGL 1W2KT 1R3HA 3CCHB 3S5LG 3DX9A 5BVJA 2XZAH 5BS0D 1C16B 4Q9RH 5HJ3B 1EZVX 3D9AL 2R69H 3NIFE 1IJ9A 1I7TA 3QUKA 4NWUL 5JHDA 1DBAL 3G9AB 1DN2A 1N6QL 2HJLB 4L29B 4PJXF 1G1CA 2C1PB 1MRDL 3WHXA 4ELKB 4PJCB 4IMKA 1BVZA 4LSPL 3QHFH 4ZPVA 5BRZE 2ZOKA 3VI3E 1FNHA 1QYGH 3FB8B 5T33L 5A2JH 2YOCA 3QIUC 5L7XH 5CKAA 1CR9H 2J2ZA 1OPGL 3N1PC 3SCMB 1P69B 4JFQA 1R5WB 3QCUL 3DXAE 3Q0HA 5T5NF 1TVBA 3OJDB 5MEQB 1WCBA 5EOCH 1JHTB 4CNIB 2A74A 3HMXA 5DD3L 5TE6H 2ATKA 5E2WH 1D5IH 4XPTL 5IMKA 1HN1A 4P5TB 1T20B 3OKOB 3L5XH 2APBA 4Y5YB 3HNSL 3EO0A 5C08D 4ZUWB 1H5BB 1W8OA 3QIUD 5FV1L 1MVFA 4ALAH 3BISA 3JVGA 3DMMC 4RMUA 2OP4L 2EDQA 1OAYH 5I1GL 1MF2L 5FF6B 4F57H 1J1PH 2XTLA 3MLUL 4J4PA 5TE7L 2DDQL 5L2JA 5M94B 3JWDL 3V6OC 3WD5H 1W0VA 4WIQA 3VFUA 4OLVL 4PR5A 2LFGA 1LO3L 1QACA 3BVNA 2JTDA 4ZFOA 1XF5A 3DMMD 4KWUA 3U0WL 1CXIA 2ZG2A 1IEHA 1VFMA 3MRLA 1FGNL 1E4XI 3NH7L 1DUYA 4HXBL 5HPMA 3AREB 4UT9L 4GT7A 4UQ3A 2FH6A 2A1WL 2CKBA 3AXLA 4RMTA 2UY7A 1MJ7L 2VQ1B 3HB3C 1BQUA 5DUBB 2D4FA 2XZQL 2V7HB 2KZ1B 4N5EC 1ZVHA 2FH8A 1D6EB 3C60B 1JP5A 2DRUA 2HLAA 3MJ8B 4MYWB 3LRHA 1XFPA 1YNLH 2H9GB 3RNKA 3T0EC 2XG4A 3D85A 4HKBA 1N3NA 1EUTA 5DJ8A 4HUKB 2X1OA 3QWRA 1G6RH 3RVTD 4YHKL 1KSRA 5DC9B 3OKMA 4O02H 4BSWA 4L8BB 4LRIA 3HB3D 3EYUH 1GPOH 3VRJB 4ZAKA 1QOKA 2FBJL 3A67H 1HHKA 1F8TH 1Z0NA 4C4KT 3SE4A 2E7MA 1H8SA 4J6RH 4L8DA 3F6LA 3T0ED 1ZT1A 1A6ZA 2WW8A 1ZEAL 4ZXBB 4TSAH 4RMWA 4YDIL 3JV6A 3NIGF 4PJ8C 3MBEC 2FECI 1QG3A 3CK0H 1JFQL 5K93A 2WIIA 1JBJA 5EO1B 4ODWB 2Y1VA 3NTCL 4XMLH 5GZOC 2GK0A 5IESH 4HEME 4P5MB 2XIDA 1LNUA 2B0SH 1NH6A 4UIMA 4NUJB 4TTDC 4HCRH 2X5PA 4RGMC 5HHXL 3CFJB 2QR0A 1BPVA 3TM6A 3MRKB 3BO8B 3KGRA 2HKFL 1XGUB 2ZKHH 4PJIA 4WGWB 4XMKL 1U8OA 4XNUH 4PRAB 3REWA 1I3GL 2V9QA 2AABL 2ZCLH 5CD3A 3QJFB 3GSUA 1NGPH 4PJ8D 5IHZB 3MBED 4PJHE 2ZSVA 4WUUB 4AEIL 4PJ7B 2VB5A 4FQQA 2AJVL 5GJSL 4NUGH 1SBBA 5GZOD 3VGAC 2EO9A 2KBGA 3OR7A 5L2KA 3QDJB 3SO3C 5D2LE 1CFNB 4O5LL 1WBYA 32C2A 3UTSD 4IOSD 1QFWH 4X7TA 2I26N 2IFFH 4PUBL 3CSYA 4DN3L 1QRNB 3OZ9L 4OSUL 4PIRF 5J13B 4QXUH 1ZWIA 2R2EB 3QNXA 4D0CA 3BZFB 5D1XD 4O00A 3ULVL 2NY5L 1EAJA 1OTUC 5GS3A 5HVFB 1HXMA 1KTLB 2BSTB 3PV6A 1WZ1H 3X3FL 2Q6WA 1OM3L 5D6CA 4YHZH 3ZDXE 3LEVL 4DCQB 4PY8J 5DZOA 1SMOA 3UMTA 5F7LB 4PJGA 1CL7L 1U36A 4ZUUB 5F6HI 5HGGS 4FFYH 4LEXH 3H7LA 4BFIA 4Y8AA 5BRZB 1FN4B 3HE7A 3NMEA 3OJ2C 2BNRA 2WWKT 4GW4B 3FT4B 1OTUD 3M8OH 4P9ML 5EB9A 4MNQA 1Z5LA 1CDUA 3FRUA 1A1MB 1OF2B 1FVCA 3EGSB 3SGEH 3DXAB 4JQIH 4XP5L 3IDIB 5HHME 4E41D 1H8NA 4DTGH 5CSZB 3MACL 4OD1L 5IMLA 5DD1L 4IEFB 4G7YL 4XB7A 4AQOA 1R3JB 4KDTA 3ZDZF 5AD0B 3LQZB 1T0MB 2Z35A 4IRJB 1NSNH 4MB3A 4LRIC 2J3SA 1C5BH 2HYMA 4Z77A 4GRLC 4P23B 1F4XH 1T1XB 3QEQD 4NT6A 4ZAKC 3VRLF 5IM7B 4FXLA 4OCWL 3ROOB 3RA7L 1U8MB 1YYMH 3ULSB 2BMKA 3LRSB 4LHUG 2UVFA 4GOSA 3E8UH 1UWXK 3DHJA 2CK0L 2VDOH 2R56H 5L88L 3HPLB 4F7PB 4M5YH 3G5ZA 5FCSH 3GSNA 4UI2A 1VGKA 2JCCE 2UY6A 2UYLB 1NGZA 2AXGA 3CVHA 4Z5RB 1V7NL 2GJ6B 1RK0B 3N50A 5K9OB 2HTKC 2EKSA 4GRLD 2J5LB 3CDYA 4IHOA 4NO0A 2OR9H 3FFCD 1NC2A 1KXTB 3WIHA 1D6VL 2FEDC 4PJDB 2XN9A 2Y36H 2P8LB 4G8IB 3EYFA 4LSQL 5CILH 1ZS8A 2OM5A 4X0KA 4ZTPL 3IJSB 1EERB 4UDTB 2VLKE 3WNKA 4QXTB 3AS1A 2B39A 3GMQB 5IW3A 1G84A 3MFFA 3WO4C 1T5WB 1EEUA 4O58H 4GW1B 4K2UH 2HTKD 5DMIH 3HG1A 4U7SA 3U4BH 2DBLH 2I5YH 1LO0H 4CU7A 1NCWH 5B3JE 5DJCB 3HE6A 3CZJA 3LV3A 1HSAB 1MEXL 3DARA 3HC3L 3F6IA 2GFBA 2R0LH 4WHDA 1JNLL 1MLCA 2WUBL 4TTGA 2E7BA 4KUZL 4XCNA 2ADJB 5GGSA 2VR5A 5D7LB 1LE5A 4OZ4A 3U4EB 1A4JA 4ZUTA 3IDXH 2X42A 3L7FA 4XX1G 2BOBA 5C0FA 4I0PA 1JPFA 2A9MH 5IB2B 1Z9MA 3C08H 5HHOD 4TVPE 1A6UL 1IGFL 3X12B 3TA3B 2J6EH 5FYLD 5FUOH 3QULB 2NXYC 2EH7L 2HVKA 4M8QA 3QCTL 4ZOAA 2AXJA 1UM4L 4CJ0A 2CLRB 2YN3A 3EOBB 3HE7C 4LPCA 3U46B 1P7HL 2VZOA 3NCJL 5DRXB 5E94B 4F7TA 4JHBA 4OZIB 1UVQA 1H0DA 5FA3B 2J8UA 3KPSE 4PJXE 3MJ9H 5T1KD 4RX4A 1U8QA 3ZHKA 1SJEA 1G7PA 2X6MA 3M07A 5DJ0B 5DJZA 1TZIB 1FRGL 1KF9B 2VQTA 1NLBL 2X9XA 4QHMA 1JVKA 2R15A 1U8PB 1QLFA 1IM3A 1WCQA 3P40A 1EUUA 2XXMB 3BKYL 4HWEL 4WI8A 5JO5B 2NXYD 4XP4L 4GUPA 3LDBB 5JPNA 15C8H 1K8IB 3V6FA 3MRBA 1VKXA 3EOYG 3AFLA 4MDJB 2NW3B 1RUAL 3KHOA 5DK3A 5DEGA 4XVTL 3TH2T 4MNQD 1OLZA 4ZO9A 2ESVE 4LCUA 4WFED 5D7JA 2ENYA 5E9DD 5D2LB 4LSTL 1MCOL 4N0YL 4PRHA 5EWIL 3E0GA 1J0YA 1I7UA 2OQJB 5HDOA 5D96B 4D9LH 5D1ZC 4AG4H 1JRHI 2CIIB 1AQDB 1C5DA 1CVRA 3CH8A 1CS6A 4IJ3C 4OCSL 2XKNB 3LZFL 3KYAA 1MH5A 2J88H 1CE6A 2VDRH 1SQ2N 1AD9B 1JN6A 3W39B 3UYRH 5INDA 2FGZA 4PJEA 1N7MH 4OZFA 1NL0H 1RJZB 4GG8A 1T7VA 4N9GA 2IPKA 3RHWK 5C0RH 3FTGA 1BLNB 4LSUL 1I4FA 5I1KL 3VXRE 1FCCA 1LHZA 2UV3A 1KN2H 2DN7A 5HDQH 3U9PH 4JJ5B 1PG7L 4R4NC 1OL0A 5D1ZD 1CDYA 1G7JA 2Q87A 4U33A 1BGXH 4KKCD 4CVZB 4X6CA 2J8HA 1S7VA 2IBGA 1OSPH 2CR3A 2QQLH 3DGGA 5E4IA 2GAZA 4IS6A 4U1NB 1KEML 4ODHL 4P4KA 1BQLL 2JJSA 4LGRB 3GKZA 1OW0A 4HDIA 3D2UA 2YXMA 2F74B 4RDQG 3ZSTA 1DLFH 1RMFL 5TJWK 5HHMB 3OXRB 2VXVH 1HNGA 4MAYA 4GXVH 5IF0A 1KIUA 4PG9A 1I9JH 2PYFA 1G0XA 3BPLB 4LSSH 4R4ND 2EDNA 4M43H 2I60L 3LHPL 3EJYC 2ICEA 3DVNB 3REVB 5CZVL 3ARYA 5LGHH 4U49A 1KJVA 2DQIL 5AZEL 4JG1L 3GM0A 1RJLA 2R23A 4OCYL 3FQUA 1J8HA 3HZMB 3EO9H 5EU5A 3UTTD 5E5MA 3I50L 2B8OT 4UV4L 3WN5B 3VXNA 3BPNC 4ODXA 2J8UF 2BDNL 1MQ8A 2WBJB 3G6AB 4YK4C 3SDXA 5KSAA 5C7XH 1AP2A 3NFNA 4X5XA 4YAQA 1N4XH 2YWYA 4KJYB 4N1EA 4R6UA 2C3VB 4N8CL 2VDKH 3EJYD 35C8L 5IB1B 5I8OH 1CXLA 4FQHB 1GC1L 5A16B 4QOKE 1S7TB 4CJ1A 3T2PA 1YEKH 3TWCH 2UWEE 2JCCB 3T2NH 3GI9L 3JZ7A 3UTSE 1CF8L 3QDGA 1JV5B 4KRLB 3H42L 2CJUH 5B8CA 2VYRE 2F8OA 3MYJB 5IT2L 1GVIA 3NIGE 4R0LB 1R3LB 4LLWB 4KZEH 4FQ1L 4CMHC 1FNSL 5KSVB 2RQ8A 1E6OH 3W9EB 2G9HA 2YA2A 1EXUA 1T80A 3PNWB 2H3NA 1CG9A 5IBUG 2RAMA 3C6LC 1YC7A 1QQDB 5EZOL 1ACYL 2HRPH 4QRQB 1HSBB 5HGDA 4Y4HD 3BHBA 2VLKB 3GFUA 4XPBL 1CFQA 1CD8A 4L8CB 3OXSB 3VJ6A 1B2WH 4P59L 3ORJA 4CRPA 1W72A 2FCBA 5D7JC 4RX4D 3DV4A 2D7TL 3IKCA 3MLSL 1ED3B 1Z9LA 2X9WA 3WJLA 2YD2A 1RU9H 4HIIB 1UWEL 1EA9C 1G7LA 4GQ9L 3C6LD 1A0QH 2F54A 2YBRB 3NAAH 4F7EB 3RP1A 4OI8A 2XACC 5EBLA 4X6CF 3NCBB 5D70H 5CBEA 4XNYL 1TQBB 3LD8C 2VC2H 4YR6A 1EJOL 3IAPA 3WIFB 2Z92A 5F7DA 1PBYA 4C56B 4UT7H 1NJ9B 5GZND 2H2SC 3O2VH 1HDMB 5IFJB 1YJDL 4GMSL 5C0EB 2P5WE 5E08H 1Q72L 3TYFA 5IQ9B 1Q1JL 3AMKA 3GUTA 1OCWH 1HHJA 3IFPA 1T21A 1WICA 5IEKB 1QNZH 3NA4A 3QEQE 4M6OL 4H88L 5DRWA 2JJSC 3O3BA 3AB0C 4XAKE 4PJFF 1ZHKA 4PGBB 1UACL 3EYVA 3I3BA 2H2SD 1MFNA 3AS0A 3QHTC 4PGEB 1QYGL 4PREA 3BKCH 1A3LL 3DBXB 2D4DA 2MQCA 1R24B 5K9QI 3KPOB 1WC7A 3RY5A 3FO9A 1MCSA 5D2NC 3I2CH 3V4VH 1F11A 1JTTA 4JDTH 3JSSA 1GGIL 4FNLL 4YFEA 4EUPH 2NY2C 1AXIB 2ESVB 5MERB 5E2WL 5C0AD 1CIDA 3I02A 2VXTH 2BP3A 3RIFF 5I2IB 4MJ4A 1BZQK 4EUPG 5FHBH 1B0GB 3SJVA 1OP5K 4F58L 3ZMRA 3ARDA 2DKSA 3S34H 2Z9TA 3WIIH 3VRLE 3OKKB 1MQKH 3DX7A 1BD2E 3C5ZA 3L95B 4BQ9A 1C1EH 3L3OB 1IAIH 2NY7L 4BK4A 1JZ5A 1XF2B 2YK1L 3H9YA 1J1OL 2NY2D 1MJ8L 5C9JA 2NY3B 4CBPA 2Y6SC 5EZLA 5CJQL 4FP8L 3IXAA 1B6DA 5B8CC 5FUCE 2PCPB 3K2UH 1A6WH 3OJMB 1JYWA 4JN1H 1PD6A 4YDKH 1FZKA 4OFPA 3RL1A 3UPRB 4KKBC 5MI0B 1BF8A 4HUUB 5E95B 4E9LA 5K59F 4FS0A 4LLMB 4PJBA 1KIQB 1IL1B 5I75B 5CINH 5F9OL 2AK4A 5HYJA 2Y6SD 4G8GD 4NM8L 4JFHD 1EPFA 3KDMB 5FYLE 3D39A 3VFWA 4L3EA 4XMPL 3TZVB 4ORGB 5F9JA 1FYTE 4HFUL 2G2RA 4RISH 2CO7B 4FRWA 2GKIA 4JFEA 3WJLC 3SDCC 4RMQA 4CU6A 1MCRA 3D3VB 4X80H 4M61B 2KKQA 4WU7A 3ARGB 1U8HB 4KKBD 1CFTB 3IDYC 4W68A 1VADB 3U7WH 4NQTA 1X44A 3EBAA 1DQDL 4JANB 4W81A 3W0WD 4PP2A 3G6JE 2A6JA 1OTTC 4NQXA 3HZKA 4NQCE 1CDHA 4OIAA 3SGDI 4PRID 4PRBB 3IJHB 4HSQA 4Y16A 3SDCD 3IDMA 5J0BA 1ZTXH 3B2UC 2AVGA 2VH5L 4QOKB 3V0WL 1QKZL 2YD3A 4KRNA 2UWEB 1G6RB 1HHGA 2VLJE 4FTVD 5EUKB 1RZ8B 2F54D 4UMGA 4DQOL 2ADFH 2BSRA 3BH9A 3MRDA 4NRZB 1X5YA 4WI3A 3HZYB 1R0AH 3FB8A 3CVIH 1G7QB 5DFTA 1OTTD 3CLEL 5KVMC 2Z31A 4MWFA 1CT8A 3MV9A 5KJRH 2AP2A 3CK0L 3HS0B 4HS3B 1M71B 3IDJA 3U9UB 2FHFA 2DM2A 3VD5A 2DB8A 5EU6E 3MV7D 3B2UD 1NLDH 2VZVA 4HCRL 1LP9E 3QRGH 4N5UA 4PD4K 5J1SC 2ZSWA 5FYJD 4P5TA 1T20A 3P9LA 5HVGB 1KT2B 1NAKH 4A6YH 1CGWA 4JPKL 2ZCLL 5HD8C 2ZCHH 4P2RB 3B9AA 1RHHB 3SKUD 4JFXB 5DUPH 5HVWA 3N1MC 5FF6A 3I85A 3PGDA 5C0CD 1J0HA 3DV6B 2UZIH 1L7TL 4TULL 4XNQB 4P46C 4WHYH 2D0FA 4JVUA 3UJIH 3WDIA 3DSFL 5DQJB 2RFXA 4FQ2H 5F7KC 4MQSB 1OAXL 5D71H 3V8OA 2WIMA 2NX5A 4JN2A 3QUYA 4WHYG 1KUMA 1EMTL 3D18A 1HXYA 3LOWA 3TP4A 3CFEA 5DSCA 4HC1H 5HD8D 1UWGL 3RJQB 4ZTOL 5FK9B 3MLTB 2P5WB 4NYLB 3T1FB 5C9KA 3MGOB 2Q86B 1FZOB 2BNQD 4YHZL 3BP4A 1XF4A 1FO0B 1L0XA 5GRUL 1K4DA 3BESR 3LPFA 3UTTE 4P46D 3BUYA 3AREA 5C2BH 3OKDB 4U6XA 5DQ9B 1L6ZA 25C8L 5BCAA 1QVOB 3P4MA 3ARFA 4N1HB 2FLBT 1RIVL 3GMLB 4PD4J 4M48L 5BVPL 4WUKH 1KG0B 3C60A 3MREA 5J1AB 4YWGL 1IT9H 3MGTB 2E8ZA 5EUOE 3G5YA 3DRQA 5T1LA 1CU4L 3VW3H 3QXDA 3S3PA 1I1YA 1RUML 1P4LB 4HGWA 5IHBA 2IAMC 4U6VH 4ISVA 1CLYL 4L3CB 3VWJA 1TFHA 4ZUSA 4LCWA 3QFJD 1MELA 4LVOB 4PS4H 2A6DB 1JZ3A 1T6VN 2IADA 4KVNL 3RX8A 1ZAGA 1Q38A 3MLRL 5E7FA 5IBTL 4JZNA 1ZLSH 3DUHA 3H9HB 4N8VA 3W9DB 1VFBB 3HPJA 5KS9A 4JDVB 1PLGL 1A2YA 1F4XL 2F5BL 2X4NA 2CDFB 2IH1B 4JO3L 3V4PH 4UILL 3BEWB 4RFOL 2G60L 3O4LE 3TBYA 4ZXBA 1LDSA 2IAMD 3X3GH 1YYML 3PQYE 3RPIB 1NBVL 4EOWH 2JJVA 3PWPE 2YRPA 3BN3B 3ALXA 5SWSB 4MD0A 4ZFFB 2R56L 4G5ZH 5AYQA 4WWID 2CIKB 3QUZA 1KB5L 5IIEB 1XGYH 1AGEB 3B5HA 4PY7B 3BW9B 5F6IB 1YMHA 2N7BA 1A1OA 2BY3A 4Q9QL 2P5EB 3ZHDA 4NKOB 5IVXE 3BSZL 2ADGA 1JGDA 4I3RL 4XCEA 1MCLA 2PYED 4FOMA 5EC1B 2X4TB 4IOFC 2NNAA 2W60A 1Z3GL 3O6LH 5FECA 1MWAB 1KBGH 5B39A 3LB6D 1LEGB 3SPVA 3UXFA 4HULB 4JO2L 1BOYA 5TPWH 4S11A 5F88A 4X6DE 4JM4L 2I9LA 5GGRY 3OR6B 4HUNB 2IC2A 3DVIA 3VFNA 3BKJH 3OX8B 1QRNA 1WFTA 1KTKE 4J3OC 5E2UH 3B9KA 3MUGA 1BQHG 1IC5L 2VKXA 5JIHA 3SN6N 3MXVH 4IOFD 1HINL 5EO9B 1YMMD 2P43B 1JWMA 5ISZE 4Z7VA 1DQLH 3IAGC 1AKJA 1IGYA 5BV7C 4MD5B 4NQCB 5D7IA 2X7LB 2HH0H 4ODTH 1J0IA 4ZNEE 1P6FA 1RQ5A 4HLJA 3T3MF 3JWDC 1FJ1A 1KCVH 1FAKT 4PB9L 5T3XH 5HGAB 2VLJB 2XRAL 5T5NG 2EIZB 4ELMA 1XIWC 2FYYB 3MOQA 1CDBA 1YUHB 1RUPH 3VFSA 1ITBB 1RZJL 1BM3H 3SKOA 1FN4A 3X14A 1C5CH 4I13B 2HJFB 1OP3H 5L8JB 3U1SH 3GJEB 3TJEH 1KTRL 5M95B 1P53A 3MC0A 5J11B 1KXQE 1ZK9A 2E9BA 3QUMH 4WFHD 5JUEH 1PSKH 1IGJB 4YC2B 4S1SL 5EU6B 3EYSH 4PJFE 5CSZA 2RBLA 4C4KO 5F1IB 1HILB 3IT8D 3QNZA 3S4SA 3T4YB 5MEND 1LP9B 4M93C 1XIWD 2EE2A 2ILLA 4Y88A 1P7QD 5I1EL 1FC2D 3ARWA 4PJ9B 5D9SA 3B2VH 3QIWB 4X4ZA 2HG5A 3I6GB 4EN3A 5C1MB 2JF1A 5GGTA 4ETYA 2QQKH 2LTQB 3CFBA 2XNAB 3RUGA 1YEIL 2PW2B 1KLFA 4CKVX 5F3HA 4JG0L 1IM9B 3NN8B 1S9YA 3OMZA 1UXSB 2VL5B 4MJIA 1A22B 5I8EB 5GHWH 3UTPD 1IVLA 1RVFH 4JB9H 1BZ9A 1F6FB 3P9MA 1LK2B 1KIPA 4X9BA 1HQ4A 3S35X 1UGNA 5BQ7A 1HWHB 4KMLB 3VGEA 4CADB 1PY9A 3U2SA 2J4WH 3PHQA 4JDZA 3KPPB 4MAUH 4QCIB 2IAND 4WI6A 5IQ7H 2VDRL 3EYOB 4Z5RA 1S7WB 1LEKB 1CFBA 4RNRA 5DFWH 3BZ4B 2DLFH 4RZCA 4XBGB 4OCXL 5EU3A 3QUZC 4YPGA 4J1UB 5IMMA 5F8QC 2CLVA 3QAZC 3O81A 4P2OB 2JELH 5C0RL 5I73B 3KPRE 2I9TB 1Q9OA 4PJDA 2A83B 1KCSH 4HIHB 4PY8I 3KLHC 1GIGL 1EAPB 5I17A 1D7FA 4KI5F 4XBEH 1S7QB 4PRIE 4P9HL 2F5AL 1BGXL 3L3GB 4HMEA 4MHHI 4YHIB 4DKEL 3FQTB 4WTXA 5KANG 1JF5A 1MRCL 4NN7B 2E9WA 1K2DB 2V5YA 4UAOB 5ADPL 4KQ3L 3QA3A 3R4DA 1DR9A 5EUOB 3WFEH 4JR9L 3QXAB 1DLFL 3T2QA 3VXQB 3VDAA 2EEDA 1FSKB 3KLHD 1MCWW 5T1DL 3LH2H 3ZKMC 4LFHG 4KI5C 3CH1A 4U1JB 2YPLA 4MQXC 1NFDB 1WBZB 3CAFA 43C9B 1P2CA 4Q6YA 5HI3C 3ARVA 5IROC 2WWKO 5DJ2B 1ZGLB 4ZS7L 1Q9LB 5I19H 4F3FB 3MODH 4QT5B 3WJJA 3DLQR 3FCTA 3K80A 4U3CA 5FYJE 2AXFA 5KVEL 4OV5A 1DQTA 2O5ZH 2NY5C 3QT2A 3O4LB 2GUOA 1GGBH 4DN4H 3TA3A 3ZKMD 4KI5D 3OB0H 3ESUF 2IG2L 2Q7YA 2LE9A 3MRFB 4MQXD 3H9ZA 3PWPB 1EGJL 3C2AL 4HH8A 2ZUYA 2VDKL 1BHGA 1D5BA 4JEGB 5HI3D 3NCFB 4P2QE 4HBCH 3Q1SH 4TRPH 5C0CE 5FGCE 1E6JL 3CXHJ 2XPGA 4KKNA 4TUOA 1I3VA 3U6RB 3GBML 4HHAA 4NRYA 4AENB 2R29H 3NPSB 4H25A 1FDLL 5IVXB 2IWGA 4BKLB 4G43A 1U8PA 1QPXA 1S9XB 4KZEL 3VWKA 4U2YA 4Z7UE 1EZVY 5K9KA 4Z9KB 1IGTA 2WK2A 2XWBB 2NTFA 3O6FA 5J9PB 4JM2D 1YEHH 4G9FA 1K8IA 1S5HB 2V9TA 3OBAA 4NP4H 4IBLT 5EFIA 4OQ1A 2BY2A 2NW3A 4EN3C 2CUMA 5IBUB 1EHLH 2AJZB 1OGAB 2NY6B 4OB5H 2OLDA 5JW4M 1E4WH 5ERWB 1MFAH 1JNNL 3GEWB 4IIQC 1QSEA 4POUB 4KMQA 4RMSA 3BP6B 4KH2A 5BW7A 2SEBA 4TNVF 3BN9C 4XXDB 4B53A 3BIKA 4PRPA 5EPMB 1ORQB 2BZDA 3DVFA 4YO0A 2IH3A 1RU9L 5ISZB 1VDGA 5I74C 4KQ4H 1HHIB 5E2VL 4PGDB 5D5ME 1XGQA 3BT2L 3FB7B 4OZHE 1OP3K 2QTEA 1EEZA 2W9DL 4LKXB 1FV1A 4XCFH 5CJXC 3VXUE 3WKML 1EH9A 4R97C 3GMRA 1A1NB 5DVLA 4U1GB 3F8UB 4ZOEA 3NCCB 1QLRB 1J12A 4H20H 1A6PA 3BN9D 2EZ0C 5FXCH 3WS6A 2VKWA 2EC9U 4CN1A 2Z4QA 3SKNA 3UJTH 4CVXB 5DHYB 1AH1A 4Q2ZB 4HZLB 1U3YA 3OKEB 2BY1A 3H9SE 4GLRI 3UBXB 3MGAA 3RFZC 1GOGA 2Z8WC 5D8JH 2ZNXA 1FFPB 4C83B 1I7RB 2V17L 3FQRA 2V2TB 1QHOA 4OF5A 1ORSA 1HQRB 2HFFA 3DI3B 4TUKH 4XC1L 4RCAA 3WUWA 3BP7A 3DVNA 3DX6A 1NGWB 4OZGA 1ULVA 1ZLVH 3ZKQD 3LN5B 1AR2A 3GO1L 4EIGB 4GSDH 1LWRA 2VZSA 1LMKA 1U3HA 5CLTA 1MFBH 3VFMA 3S37H 5EOQH 1CICA 2VIRB 5C09D 1YNTB 3HNTL 4OLXL 1TJHH 3AGVA 1KGCD 2RCSH 3H7BA 1CD9B 1FFNB 4QHNA 4DGIH 4K8RD 4FMFA 3N9GH 5FHBL 5IB1A 1SM3L 4FQHA 3TO4C 1EBPA 1GGCH 2EYRB 4WCYH 4EUPB 5FO7B 5AZ2L 4OUUA 1S9WA 4NPYB 3W82A 1DDHA 2D31B 1KJ2L 3BYYA 3O3AA 5F7WC 3WBDA 1JPGB 5EOTA 2QSTA 1ZHBA 1U91A 2CSPA 3FOLB 4BUHA 4BYHA 3HRPA 3K4AA 5EA0L 3KPMB 3NZ8B 3KPRB 1U8IB 5T1MA 4HUWB 1BZ7B 1YMME 4GBXA 1PEZA 3IFNH 3ZL4H 3MRMA 2LV4A 2BRRL 3SEPA 2QADB 5TGBB 1QQDA 3TO4D 2CUIA 3LKNB 1QSFA 1F13A 3MRQB 5CZXC 3L6FB 4FQXB 1I75A 2Z93B 4BQ8A 3O2DL 2OJZL 4QWWC 3STZB 3E6HB 3VXOA 4KPHH 4I4WA 5F7YC 3DI2B 2NCMA 2XFXB 5I1HL 4NHCL 4NQSA 1JCKA 3VXPB 3H3PH 4DKFH 4DW2H 2DF3A 1JZ6A 3HZVA 2HWZH 4HIIA 2EDOA 5I1CL 5J12C 3KYMA 5MHSE 1NMAL 1ZLWK 5C8JB 3KXFD 3KYNA 5A43C 5F9WB 4OGYL 4JQVA 5E99L 3KLAA 4NZJA 5CZXD 3GMPB 3L5HA 2NZIA 3BD4A 3KNBB 5MENE 2P44B 2XQBH 1R3IH 4LCCC 1I1CA 2X4SB 3FRPA 4GRWE 4PJ5A 1WIOA 1NFIB 4GG6F 4JRYD 3QIBA 4LEOB 2AGJH 1RZKL 4M5ZL 3W2DL 5EU4B 4P3CH 4HH9B 2Y4SA 4Z7WA 5JNYB 4NZRL 5E7BA 4LVNC 3BAEH 3CNKA 5JXAH 4LLUB 3S5LA 4P2QB 4KJQC 3S35H 2X4UB 5FGCB 4F15C 1B6UA 5ID1B 4LBEB 5CBAA 2XXCB 3L9RA 1DSFH 5SWZE 5CJ8A 5AUMB 2VDNL 2Z91B 1INEH 1E0OB 4RQQA 4PGEA 4PV9B 1T2QH 5DC4B 1IQWH 1HEZA 1MI5A 2AW2A 3CMGA 2IANE 3MO1B 1G6VK 2OTWA 4Z7UB 1BAFH 3ZDYF 4XC3H 1V3LA 3MRNB 3QPXH 4NNYB 4DVBA 43CAB 4RAVB 5F71A 2YD6A 3F58H 3RJDA 1HKLL 4I0KA 5F1OB 3N1FC 2X09A 3S9DB 4JO1L 3OGCA 1M7IB 4L9LC 4PLNC 9CGTA 2OX5A 4WDIA 3QR2A 1U3HC 4X8JA 1MRFH 3ABZA 4QRPD 4KTDH 3CZFB 1ND0B 4JQXA 3ARXA 3TPKA 2AJ3B 5JW3L 3OKYA 3LS5H 4M1GH 4MJ6B 4OFIA 1RZIA 3GSRB 5DHXB 4LNRB 1TXKA 1MLBA 3TNNA 1U58B 3MR9A 4HV8A 3TT3L 3WS3B 5HVHC 4LF3A 1S7XB 3S36H 1V7ML 4X98B 3ETBF 5IEHB 4A6YB 2UZIL 3GHEL 4PP1C 1NMBH 2BVPA 3C87A 3IRZA 1MFEL 3S7GA 4QRRD 1OT2A 1XF2A 1N5YH 4AIZB 3LIZL 3DROA 2Q8AL 1FZMB 4U1MA 3VXUB 5D71L 1QR1A 3V79C 3FAXA 2VO5A 3QI9B 3WFBH 1B3JA 1FFOB 1WIPA 1T0PB 1GC1C 1U8LB 3MROA 1IC4H 1HOCB 4YHLL 4HC1L 5C07E 5E1HB 3CD4A 3MNZA 3ZKNC 4WWKC 2EC8A 2VDQH 2PXYC 3UTZB 5IB3B 3WFHA 3BI9X 4PP1D 4HUVA 3RZCD 3PL6B 3BXNB 3H0TB 3H9SB 4B5EA 1ZLVK 5CEZH 1QFOA 2R2HA 4U3XA 4HWUA 3FN0H 5LQBH 3O41A 4O2CB 4S1DC 2B7DT 2EXWD 4N0UA 4OV6F 4BM7A 2M8XA 4NO5A 5JHDE 3ZKND 4WUKL 4WWKD 3D25A 1AXTL 1U8HA 2D0HA 5EZJB 2FIKB 4GW5B 4FXGA 2PXYD 1FGVH 4ZS6D 4Z7WF 1U6AH 4M1CC 1YEJH 5IW1A 4PFEA 4JANA 2F53B 4OLYH 3GKWH 4LU5H 2XWJA 3RWJA 3UTQB 3JUYA 3OKNB 5GGRA 2ZOLB 5TE4L 4S1DD 4M7LL 5GS1B 3VMNA 2PO6A 4LSRH 4OD2A 2X4QA 4LPXA 1I1AB 3BRFA 1KJ3L 4P3DB 3T3PF 1K5NA 3T4AA 4IRSC 3EZ8A 1BP3B 1A7QH 1YJDC 2E6PA 4M1CD 4DKDC 4G42B 3ARBB 3INUL 5C0JB 1IGMH 2IQ9L 3UO1L 5C71A 4N0FB 5DVKA 1EO8H 5IB5A 3X3GL 4I8DA 4JREB 4R90H 4UZGA 4EOWL 1U92B 3BQUB 5BXFA 3QFDA 3V5KB 2B4CL 3HUJA 3GM8A 1M71A 4M6NL 4LCIH 4YNYB 4G5ZL 5EBGA 3VFVA 3V6ZB 2P8MB 3QO1B 4MD4B 1CFSB 3TV3L 1XCQA 3O9WA 1ZGLP 1AO7D 3N85H 4IRSD 1PZ5A 5F7FA 1J05B 2D9QB