4RGOH

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
213
Chain Sequence
EVNLIESGGDLVKPGGSLKLSCATSGFTFSAYGLSWVRQTPERRLEWVASISGGGSVYYPDSVKGRFTISRDTAGDILFLQMNSLRSEDSAIYYCVRDLYGDYVGRYAYWGQGTLVIVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 46
structure length 213
sequence length 220
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoH01
3DRQA 1IQDA 4QRQB 4S1SL 2H1PH 5IT2H 5HHPB 5IOPA 4I3SH 2JK5A 4JQVA 2C3VB 5IESL 4E41A 4HMDA 5T1KA 1BEYL 4XBEH 2I9TA 2GJ6B 5D6DA 1FQ9C 1G7JB 1J86A 4LCWD 1OAUH 2CH8A 5BJTB 3NMEA 3VXRA 2DLGA 3LS4H 3ZL4H 3MRDB 1F4WL 4WHDA 2VR4A 4DUVA 4LLVB 1DVFA 4MA3A 5DC0A 3FONB 1JRHL 5A40E 5IFAH 3UTOA 1E4JA 2APVA 2YC1B 5B39B 5F1KC 4OGZA 1DTUA 4ISVB 4UB0H 5T1KB 4NC2B 5C0AD 4X80L 4F7CA 5EBLA 4H25B 1EZVY 2P5WD 3LS5L 4U6TA 3HCVA 3EO1A 3RWGA 3KLDA 3SCMB 4HGMA 3MLZL 1CT8A 2QL1A 2IMNA 32C2A 3MRRA 3EW3B 1CIUA 4IHOB 1FFRA 4KJWD 1OAQL 4EN3B 1TTGA 5KAQF 3QFDA 2X4RA 4DZ8A 4JFYA 1LWRA 1LP9A 3MBEB 4YHZL 1CL7L 5DJ8A 3TNNB 2DQIL 3U7WH 4JG0H 5FO9A 5FHAL 4MNGB 1HXYA 1RUMH 3BVNB 3JWOC 5MHSD 4KPHL 5L7XL 2D31A 5HHOB 3VWKA 1ZHBB 4PBVC 4M43H 3ZYIA 2KH2B 3IKCB 2BOBA 4NN5C 2Z92B 3NABL 3DPBA 3VXPA 4PJ5D 1NLBL 3ZO0A 6FABL 3Q6FB 3KYNA 2BSRA 1K3ZA 3JWDH 3RZCB 1F90H 4P5MB 1EXUA 1P6AB 1KB5A 3MJ8B 3N1PC 2R2BA 1NFDE 3EO9H 3U7YH 1SHMA 1OM3H 4GBXD 4HIIB 5I1GL 4Q9RH 3X12A 1DVFB 4GJTB 4DZBB 3UEZA 1OGTB 3MBXH 4HIJA 3GIVA 4F2MB 1I7UA 2XZAH 1MI5E 1OP5H 2XPGB 4PJ7B 3OJDA 1M6OB 4M7JH 4UT6H 4JFEE 1K2DA 3VD7A 5CIPB 2O93L 4FABL 2CRZA 4CVXA 1K4DA 2D4FA 3HG1E 1KCSL 2HWZH 4MCYA 2J5LB 5I74B 2GJ6A 1CLOH 1IZJA 2QQNL 1S3KL 5M95B 4FFVC 5KSAB 5GSRA 3T0EC 5C07E 2J6EA 4ZS7H 1I8LC 2QQKL 1CDCA 3IFOA 4R97C 2R29H 3OKYA 3T4YA 3IGAB 4M8QA 1FH5L 2BDNH 3QZWB 4R90L 4JY6B 1LP9B 3GHBL 4G6JL 4PRBA 2FATL 3PIQB 1XF4A 1GIGH 2CUMA 3LQMA 2W9DL 4DOHE 4FZEH 1ORSA 4XMPH 1KIPA 4ZTPH 1JGLL 5I1IL 4R90H 3ARDA 3ILQD 3T0DA 1IC5H 3SE3C 1UJ3C 2J3SA 5GZNC 4EDXB 3IKKA 4PJIF 3WEXA 1CLOL 4YHML 2XTLA 1FAIL 3KPPA 3OPZL 4EI5D 4ZAKB 4TQEH 2R1XB 4FABH 3VGDA 5IWLC 4FQ1H 4RDQF 5D7IA 3W2DH 3RRQA 1ZTXH 4FXKB 5B8CB 2KBGA 1RJLA 1KG0A 2HFEB 3I6LE 3MBXL 4I48B 4WGVB 5L88H 5IVOA 3MYJA 4HV8A 1QPPA 4NC1E 5JHDA 7FABL 3U7YL 2H8PA 3VGGA 2X4SA 1K2DB 3VXQB 2I5YH 3FO9A 4P2YA 5D1ZD 5JMRA 1DZBA 1G9NH 4AIOA 3P40A 1KB5L 1X5FA 2OS7A 5E4EC 3MGTB 5KZCD 3KNBA 1TNNA 3NGBC 2A9MH 4YHNB 1D5IH 1FZMB 4ZPTA 5JHLL 1E0OB 4Y2DC 1QHPA 2HVKB 3S3JA 3E8UL 4G9FA 5I8KL 2YA1A 3CDCA 4BUHA 3TIDB 4HKJA 1XF5B 3SPVA 4W4OC 5D96B 2VB5A 3FB5B 2CLVB 4RZCB 1KB5H 5HYSA 3BYTA 1MUJB 1G9NL 3G6JB 2XN9B 3CH8A 4POUB 4RMUA 5IKCB 2I5YL 3CUPA 3O11B 4WFFD 3JUYA 3QDMA 1BF2A 3CH1A 1OGAD 4YHZH 4W70A 2DM2A 4L8BA 1A7BA 2DIAA 3E6FB 2IH1A 3RL1A 3KYKL 4L4JA 3BHBB 1QNZL 2E9IA 1UCTA 2YA2A 4G9FB 2JELH 1FP5A 4MS8C 2AK4D 1A8JH 4FQ1L 3N85L 1QSZA 3D48R 3TLRA 5DRWA 3GJEA 5ALBH 3VG0H 4JQVC 4PP1C 5FYKE 1IEAB 3VXNA 1GZQB 1FAIH 2IADA 1DQJA 3BPNC 1ACYL 4M1GH 1BVKA 5EOCJ 3TA3D 1HWHB 4JB9H 5E9DA 3QDMB 3RVTD 3QB7C 5HYJA 1JRHH 2NLJB 3HR5A 1JN6B 4AIXA 3MYJB 1KB9J 1NBYB 4ZO7A 2F53B 1KNOA 4G6AC 3ZL4L 5ENWB 4UNVA 3ZHKA 5FAAA 5C6TL 3U83A 3VXQA 3GB7B 1XR8B 2BRRL 3ALXA 4NKOA 5IM7A 5AAMA 4V1DB 3QXDA 1G7MA 4YBLB 4H0HB 4OZHA 1UXSB 2B20A 2WBJA 2D0FA 3C6LD 3E2HC 1UM4H 5INDA 1IBGH 3QCTH 3BJ91 4KY1H 3CFEA 2QQNH 4EEEA 3KYOB 4URTB 1IM9B 4XBPB 2IJ0C 3AY4C 2CXGA 43C9A 4GS7B 4AIZB 2Y72A 1PY4A 2ICWI 2XNAA 4MWFB 5GGRY 1A3RH 4GBXA 5B38A 3O8XB 1I8KB 4KDTA 2BERA 3PQYE 1J0HA 2FGWL 3DNKA 2VABB 4ZXBB 3TYGH 2J88H 1J18A 4ZUWB 4ELMB 2P24A 4PRHA 1B0RB 2VLRE 3MRMA 5TPWL 1WWAX 1AD9A 3MRBB 3VMNA 2DM3A 1FNHA 3PL6D 5IFJB 3JV6B 1MCQA 4G8FA 5ADPH 1HILB 5HSFA 3TWCL 1GOFA 4NT6B 5K9KB 3VXUE 3EFDH 2MSPA 1NBYA 2E9WA 4RBPK 3TA3A 1AFVL 3DGGB 1E28A 3FRPG 3CFBB 5I6XB 2HJFB 4HHAB 2VISA 1T20B 3OZ9L 3NTCL 1AQDA 1JPST 3TGXA 3STZB 5J6GB 2GSIA 3QIBC 3LKQA 3WNKA 1H3UA 4UI2A 2WBJB 1GCFA 3UTTA 1RUML 4FG6D 3VXTB 2V5TA 3NCBB 5L2KA 5I1AB 4PJ9A 5IM7B 4JDVB 2R69L 3BKMH 3WMSA 1SJEA 1EXUB 4YHNA 3UYPA 3QUKA 2QADC 4MHHI 1EO5A 3GRWL 3TT1L 1P1ZA 1U9KA 1MSPA 4GW1B 5F3BB 3V5KA 2AJSH 3FQTB 1II4E 2E9JA 1G7QB 1CDJA 3H42H 1I1CA 1XH3A 5DHYA 4F15C 4XGZB 1E4XL 4IBLT 3QA3A 4YPGA 3EBAA 3EHBD 3G6AB 4NN7B 1QBLL 5DD0L 1DP0A 3KYMB 1CFVH 1OSPH 1MJJB 2RFXA 3QFJB 3W0WD 1NDGB 1DSFL 2GI7A 2YBRB 1NCCL 4JDVA 3LKPB 4KKLD 3W11C 1AGFB 2R4RH 1XCQB 2BNRB 5SWSD 3BPLB 4NBZB 3BHBA 4AQ1B 5BOZG 4BM7A 2XWBB 3DURB 3FQRA 2VR9A 3QUZC 3S36X 3WXWL 3OGOE 5ESQB 1OGAE 4Z7QE 4BQ8A 5I75C 5J1SC 1OB1A 1FYHB 3BW9B 1G6VK 1OW0C 5F7FA 2Z92A 1FV1A 5HDLA 1NC2A 3LIZL 3C5ZC 4PJDE 2FHFA 3IDGA 3F7YA 4ENEC 4XTRD 1QLRB 2WW8A 1X6NA 5F9WB 4H88L 4LARL 1RIHH 1Y0LA 2C3GA 2EDQA 4P59H 3FFCE 4MA1C 3FKUS 3OAUL 5FM8A 1A6AA 1NEUA 2JIXB 1ZV5A 4NZRH 1MH5B 3ARBA 4NJ9H 1T80A 2BJML 1IL1A 2EH7L 2BFVH 4H1LH 3RUGA 5B38G 2OJZH 3BUYB 3U46B 3S6CA 3UPRA 1UA6L 3MFFB 3BRGC 3LKRB 1F00I 3MRBA 4U3HA 1PSKH 3RBSA 2J8HA 3KYAA 5LCVL 1ZVSA 1FSKC 3LAFA 4RCAA 3KYOA 2C4FT 1DFBL 2LVEA 4M00A 5I1JL 1CTOA 5DS8A 2X1PA 3U82B 4F33A 4HQQH 2R8SH 5JUEH 2VDQH 2R1WA 5EU3B 3ARUA 3MGAA 4L3CA 4Q6YA 1UB5A 3UTZB 3HE6A 3O41B 4NQCB 1NCCH 4KVCH 5H37H 1KJMA 4KMTH 3LEVL 5CUSH 2BOCA 1ZLVK 2PYFA 3TESA 2ICEA 1BLNA 4U1SB 3SE9L 4EN3C 2CO6B 5HJ3B 3CMGA 4YWGH 4DN4H 3MRNB 4JLRA 2EDXA 3TZVD 1YUHA 3FQNA 5I1HL 4LSPL 4IRJC 3VFMB 3VDCA 5DUPL 1SEQL 1UEYA 1JNNL 4YHOH 5I8CB 5GGQH 4RFOL 5GRUL 2R69H 3BKML 5EOQL 3QWRD 2NX5B 3QCUH 1TQBC 5GXBB 3BH8A 3S97C 4ODXA 4PRHD 1ZLUH 4JPIB 2GITB 4EN3A 4KRPD 3QG6B 5ALCH 3HA0A 2O26U 1A7OL 2H32B 3T3PE 2L7UA 4UNUA 3T65B 3FO2B 4LHJB 5A2JH 3OZ9H 4N8CH 1Q9LB 3LKSB 2UVEA 3ARSA 4X6CF 4QTIL 4AT6B 5C1MB 1HI6B 1FL5B 5JW3H 3V0WH 5J13B 3GBNH 3ZYOA 5J89A 4OF5A 2EYTB 4YDVA 1KYOJ 3BGMB 4B41A 5E5MA 1P7QA 4ODWA 3H2WA 4NBYB 4L4VD 2J88L 4WI2A 1QRND 5F7HA 1WAAF 4HKJB 4JREC 2QHRL 4LLUB 3C5JA 5I8OL 3CPLB 4GH7B 4QCIA 3KXFB 3QT2A 1FJ1A 1V5JA 2XQYG 5HYEA 2BY0A 4RGNB 4YUEH 4NO2B 1TCRB 2VDOH 3FHQA 1CGXA 3U79A 1ZANL 3O9WA 5D2NA 2EYSA 2UY7A 3SKJL 3ARBD 4KY1L 1UZ8B 5D1XC 5IJVA 3P9MB 2LTQB 2V17L 3T3ME 4MJ6A 3MNVA 3MNZA 1NFIA 5D2LA 5LGJB 2Z31A 3SOBL 5GGTH 3TM6A 3TBWA 1KENL 1P4BH 4LDEB 1AXTH 4K8RC 2BVPA 2JB6A 1J0ZA 4RX4D 4PJDB 2GUOB 4O5LH 1A6WH 1E4KC 5JXEC 1S9XA 3VW3H 1SBBA 4G6FD 3SDDD 3VXME 3U9PL 3AREC 4OZGB 3T0ED 5I75B 1QFWH 4EVNA 2X5PA 1I7RB 4K71B 1EA9C 5DQDL 4BFIB 2AJVH 1V05A 4I48A 1BBJA 5DDHB 3PL6A 2Y07L 3JVGC 1P7KA 3KPRA 3M1BA 3SKMA 5F21B 2UWEE 2QTEA 3JTSA 2YK1L 2FZ3A 3C6SB 1GC1C 1S7RB 2BSTA 3MZGB 1VGEL 1VESA 1ERNA 2V5RA 2PKDA 1AC0A 3VG9C 1J1XH 1X5GA 3W81A 2GUOA 2XZCL 2ZPKH 4WU7B 3D39B 5J1TC 5I1DB 1JYNA 4GRMB 4XAWL 4N0UE 2E6JA 4MNHA 5LGKA 3F7VA 4Z5RA 4HX1B 3REVA 5ERWA 4KHTL 2V6HA 3MLSH 4N90E 4Z7NF 5J3HD 2B0SL 4HIEB 4TRPL 4ISVA 2DTML 5E70A 4P2QE 2Q8AH 4E0RA 3OXRA 3W5MA 5C71A 1TCRA 4JDZA 4JHBA 1RMFH 2ADJA 4AQOA 5DUMH 3H9ZA 3GSXA 3M8OL 1YNKH 2PETA 4PJEA 3KGRA 4E5XB 4CGTA 3W39A 5HBBA 4XWGH 5IJVB 5EZIL 5L2JB 1RPQA 2XWJA 4XCEA 4NZUH 1TQCC 3SE4C 3BZDA 4H8WL 1OD9A 4OF8A 3HPLA 4Y2DB 4YHPA 5JZ7C 5KS9F 1RVFL 4HJ0C 1I7RA 1IGJB 3QXUA 2HA1A 3DV4A 5I2IA 3VDBA 4KKNA 1L7IH 1YEGL 3RTQA 3QHFH 4UINH 4LCCC 2O5YH 5KW9L 1BJ1H 4MDIA 1BVZA 4KQ4L 5F96H 3IDMB 4ELME 1NGYA 1KUMA 1LK2B 4NNPH 2A73B 3LDBB 1UWGL 1T2QL 1QRNA 3WNOA 3IKCA 4TQEL 4HIXL 2QBWA 2UZXB 5D5MF 1JGVL 3WIIL 2X4PB 5TF0A 1JGEA 1T22A 1M1SA 1Q1JL 5KSBE 1CG9A 4XPAL 5I76B 3MYZA 3QJHA 4ZPVB 1SJHA 3O45B 5ID1B 4LIQE 4Y1AB 1H3VA 3I3BA 4KRNA 2GJ6D 1R3IH 1IC5L 1ZT7A 5KN5A 1A6UL 3QWQB 3PHQA 1QYGH 3RY6C 3KLHC 4HZAA 12E8H 3IB4A 2DQGH 2DQFA 1P5VA 4K55A 4S2SA 3L9RA 4OCYL 1S7XA 3HMXL 3LKPA 2R2HA 3GHBH 3QPQC 1KEMH 4YK4B 4S1QH 5D8JL 4B53A 1NUGA 3HS0B 4XWOC 3OGCA 1QSEB 4O4YL 4WNQB 1QSFD 2J4WL 1FZJA 1LEGA 3TH4T 4ZS7L 4L8DB 4JKPH 2X89D 1KPUA 4LRNL 1YPZE 4CVWA 3MA9L 3V6FB 4PLKD 4JFOB 4NKMA 3A67H 4G42A 1BBDH 3QQ4A 2UZYB 3TO2B 5ECJE 3AS2A 1FFNB 1XIWC 2NY6C 3DIFB 5DYOA 2RR3A 3MOQA 1NBZA 1UADC 4KKAD 3QG6A 1BQLL 1E6OH 3QDJE 4XPFH 2AV7A 4L1DA 1UCBH 5CEXB 2HFEA 4ZFFA 2FO1A 4M61B 1NCAL 5JA9A 4UQ3B 2JE8A 3WNLA 3X13B 4BFIA 1YMMA 4Q9RL 1QFPA 3MBED 1ZT4A 3ARYA 4LVNC 5JMOC 2MMXA 2Q7YB 3MLRL 1UM5H 3OXRB 4MB4A 1N64L 5LJYH 4S10A 3STZA 1DQQA 2F54A 5BXFA 3GGWA 2VMFA 1TLKA 4Y4HB 4FTVE 1HCVA 3RVUD 1H15A 4LSVH 1A6TB 4L8SB 4FN0A 1NKOA 2PYEE 4UT9H 1AXIB 4A2MA 3KLAB 6FABH 1FNGA 1RURH 5JOPD 3V9FA 5LAXA 4M43L 1VDGA 5DRNB 1CQKA 5E8OB 3I6GB 4WRLA 1FIEA 4FXKA 3KS0H 4MB5A 2VN7A 4K3DL 4FQPA 1FL6A 2VAJA 1D9KA 3CX5K 2XT1B 3ZT6A 3DVGA 4TSAH 3B4NA 4KJYB 4LVEA 4JG0L 4JFDD 2QHLA 2DBLL 4TTGA 4PJXF 2E5EA 1JNJA 5DRZA 4L5FL 4N0RA 3SQBA 5L0QC 1OPGL 3EOYG 2NW2A 3PJSA 3K2MC 4X5LA 1DVFD 4J6RH 2IH1B 5TE4L 3RL1B 4L3ED 4OLEA 5J9PA 2FR4B 2E7LA 2H41A 5E99H 5IQ7L 1WAAE 3LPFA 1WCQA 3MLZH 4OZ4A 5JR1H 2IANE 3OAYK 1VEMA 2V5SA 3VWKC 4D0BB 1FO0A 1M05A 2VUYA 1YEJL 5I76A 5IW1A 1ZGLA 3RY5A 5SWQB 4WW2C 3MJ7A 2I25N 1AGEA 5JZ7D 5EU6D 4X80H 3IETB 3VFTA 4TYUA 1MAKA 3I6LD 3EOAA 4OGXH 4RGOH 1FV1B 5IBTH 1UXWB 5IFAL 5B22A 2HT4C 4WHYH 1JL8A 3TVMC 3MREB 3DLQR 3QG7L 4QHUA 5EFIB 5ELIA 1E4KA 5JXEA 4RIRB 4WI5A 3MV01 2MKWA 5TDOB 2A38A 5DK0A 4HUWA 2X6MA 3EYUL 1JYVA 4N0UA 5HGAB 3QI9A 4Q74A 1LD9B 3A6OA 1CFSB 2KZ1B 4XP1L 1NLDH 4XBEL 1Z3GH 1T5XB 4V2BA 1QKZH 3GSWA 2BY3A 3MUY1 4HXBH 4JPWL 1EEZA 1HINL 2ATKB 4KROB 4NRZB 3QDJD 3VGFA 2FH6A 4EBQL 2NQCA 2Q76A 2VZTA 3UZEA 2R1YB 3MXVH 5FKPB 5KJRH 4H26A 4Q9QH 1FSKB 4OLZH 2WP3T 1GPOH 1F2XK 4GOSA 5EC1B 1CGVA 2HJLB 4XNXL 3AXLA 4W6YB 5HI5D 1EEQA 5BV7L 1XF2B 1N59B 4LCCA 4YBQC 2Y7QA 3WIHL 5FECB 3EJYD 3D85D 1GHFH 2V2XB 1KJ3L 3M17A 1YMHB 4G7YL 5ISZA 5TQ2L 1HSAA 4NKQB 3H8NA 4PREA 1PQZA 4RMVA 5H35A 4PJAF 2Z91B 3GJFB 1ZK9A 3KPMA 2VDKL 1LO0L 1MCOL 1OAXH 4CU6A 2D3VA 3BP4A 5E5UB 1F6LL 3RWIB 4IMLA 2FWOB 1RZGB 4K7FB 2PXYB 1YEDA 3O6KH 3T0VA 1DEDA 1BQSA 4HUUB 4TTDC 5E8EA 4X0KA 5JXED 4YX2L 2JJSA 2V7NB 2BCKA 1PG7L 3I3EA 5SWZA 4HS8L 3VWKD 4Z7OF 4V1DA 1ZA6A 2HRPL 1NBVH 1GC1H 3L3KA 3QWOB 1FNEB 1EEUA 2EDBA 1KCVH 5FO7A 5IVXF 2X41A 4BQ6A 1TTFA 3KPMB 4Y7MA 2ED9A 3FOLB 3OKMA 4YDLC 4NKDB 3RUGF 1JPTH 5HTSA 1WBXA 1FN4B 4YQXL 1YYLH 3UTTD 3OWEA 2G5RA 4OCMC 4ETYA 3K1KC 1N59A 1RUQH 2DDQH 4H5SB 5BJTA 4PJBB 2YWYA 1RULH 3HUJA 3OGCB 3NZ8B 3JZ7A 3AXLB 1KIPB 3FMGL 2P44B 4L8SC 4CN4A 3F12A 1I9EA 2DRUA 5D1ZC 3WLWC 5IIEA 1P53A 4J8RA 2ZNWA 3BUYA 3DYPA 4LKCA 4O51B 2CUHA 4P46A 4KXZI 4XC3L 2G2RA 5J4MA 3QEQB 5FA3B 4K8RH 5JXAH 4D0DA 4WTWA 1VEOA 2H3NB 1YY9C 3IAQA 1NGQH 1NAML 1F4YH 3EHBC 4ZNCD 5FF6A 3VXMB 1I1YB 4UUJB 5DJ6A 3T2QA 5FYJH 4M7LT 3UAJD 3WS3A 1XMWA 4JVUA 3TA3C 4PRNA 4XRCB 4OZFB 1ITBB 4PB9H 1P7QB 3RPKA 2IFFL 5CZVL 1I8IA 3HG1D 4WTZA 4DKFL 5I1LB 3MBEA 2Z35B 3WNMA 1CTNA 1EFXB 1F13A 2VDLL 3VI4E 4X98B 1J0JA 2DAVA 3CX2A 1MEXH 4W81A 2X4TB 4Z7VE 4ZSOA 3MRNA 4JLRB 5AEAA 4NNXA 5ID0A 2ORBL 2O5ZH 4WUKH 4PRPE 3CFJA 4DOHB 1MIEH 5E2TL 4H5SA 2E6PA 2ITCB 3UAJC 4YPGB 2NTSP 3VFPA 2VDPH 4PLJC 3WDIA 1SVCP 4JAMB 5BZDA 1P2CB 3KPLB 4YXHL 3ULVD 1BM3L 1UB5B 3UTZA 4BSJA 2NX5A 4OD1H 1MCPL 3GMLB 4OCSH 3PP3H 4YZFF 5J13C 1K4CB 5ICYA 4MJIB 5ITBH 3BDYH 3D2UD 2HVJB 4ZYKA 4D9QE 5L8JB 5EU4A 3BT2H 4LKCB 5C6WH 1T0MA 4WWKC 3F58H 4DQOL 2VXVH 4Z95L 1IM9A 3FN0H 2QSTA 1HKFA 1DBBH 4KQ3H 2I9TB 3I75A 4NKIH 1X5KA 2H45A 3MLPA 2AK1H 4U1JB 3FL7A 3OB0K 4AEHH 2Q86B 3SCMA 1WISA 2OCFD 1FORH 5IEKB 3MRIA 3HNVL 4FXGA 1LDPH 5GGSB 5DD1H 5MP6L 3U0PA 1GGBH 4X9IA 4K9EH 1LO4H 1HEZB 5HGHB 3H9SD 1QP1A 2X4QB 2V7HB 1Z9LA 3L3JB 5KBNC 5CIPH 3X13A 4GMTL 3MV8A 4ZUTA 4WI4A 3GIZH 1A6ZB 3Q6GL 1DLFL 2VLKA 3C5ZA 1MCKA 1R5WA 3U6RA 4JFPA 4EI5B 1KJVB 4BSVA 4G5ZL 1DBAL 4M48H 2WUBH 2EDHA 3RDTA 4OF0A 3H7BA 3EDEA 1HDMB 4HIHB 4U6VL 3SE3A 1CVRA 1MFAL 2R0KH 1W72H 1BAFH 3I84A 4G6ML 4Y16B 4YHIB 3FCTB 5A2LH 4ODWB 3U4AA 3VFSA 5EULV 5JO5A 4PTTA 1M7IA 4PRIE 4X4XA 1P84J 3CD4A 4BFEA 3C6LB 3MCG1 1AGBB 1A1NA 2IFGA 4HIIA 3HI6L 2IQAB 3CSPA 1U6AH 2AEQL 1QFUL 4PBXA 3TBVA 5HHOD 5IG7B 4JFZH 4OCXH 1GGCL 1KPVA 1CDYA 5HYSG 5HHXL 3VXUB 5HDOA 1A6PA 4D0CA 1A2YA 4OTXL 5HI4D 2FH8A 1TQBB 3OHXB 4RMWA 1HH9A 2XACC 2IAMC 2GQHA 2HKFL 1K5NB 4NQSB 1F45A 1FRGH 4PJFE 3VGAB 5HHNB 3P4OB 2CPCA 1KB5B 4XZUB 4Y5YC 5LQBH 2Y5TA 4PB0H 1IAKB 3BESR 1CYGA 5ESAA 4WV1A 3CMOH 5SWQA 4JY5H 1TJIL 1A1OB 3KHOA 2XIDA 2JCCF 4HAFA 3ARXA 3V7AG 3OAZH 4PRHE 4OLWL 5DRWB 3ETBF 1YNLL 3BIBX 1S9VB 2GIYA 5HYQA 2F74B 3GEWB 3IXTA 4I0PB 3ELAT 5F7EH 5TFSH 4S1RL 5I1CL 3PQYA 4JPVH 5IUSA 1RZJH 3AM8C 2X4RB 3KJ6H 4QXTA 4DZ8B 2IEPA 4CW1A 1JMXA 1Z5LB 3SDDA 1LGVA 2M2DA 5ITFA 4H0GA 4HCRA 1K5NA 5BRZA 1RQ5A 3QUKB 2QKIA 4Y88A 4BSVB 1MRCL 1EVTC 2CUIA 1X5AA 4TUOA 4X8XA 4NQTA 5CCKH 5KVFL 3DMMB 3TA3B 3ABZA 3B8SA 3CVHL 1ZHBA 5C08D 3TCLB 2EO1A 4ZNEE 3MOBL 1LE5B 1B3JA 5DJ2B 1TIUA 2NTFB 3UTSD 2F53D 2VDRL 2IPUK 1KC5L 4YFDB 3RNKA 5E8PA 2X4QA 1U93B 5IGXL 8FABA 5I0ZA 5C2BH 1NANI 1JGUL 3VH8B 3DARA 1YJDH 4IRSA 4E41B 4OUUB 4UU9A 3P73B 2AXGB 3TFKD 2Q8BL 2H8PB 5C0RH 1IQWH 5BZWA 1C08A 4QGYA 4AENA 5FGCB 4LCIL 5HDBF 3ARFA 2VQUA 3CSYB 4PJ8D 4JO3L 4HK0B 5D72L 5FA4B 4KUCF 3CDGB 4QT5A 3L3HA 3U7AA 1FGVH 3MLYH 4CU7A 3BDBA 1EO8H 4K71C 1Q9OA 2FEEI 4QEGA 1ZS8A 5EBMB 4ZXBD 4YGAB 3HI5L 4OJFH 1H0DB 1TJHH 4B5EA 2XA3A 1GGUA 1B0WA 5C0GB 2XYCA 1JWMB 4QY8A 4D3CL 3QUXB 3ZKNC 3QIBD 5DSCA 4ACPA 1IQDB 4LPTA 1G0DA 3UPCA 1CZ8H 3IAGC 4JFXA 5AYQA 4DGIH 1K85A 1CWVA 5IQ9A 3BGMA 5CZXC 1NGXA 2VQ1A 4Q6IB 2MHAA 4AM0B 3BXNA 1W0VB 2MFNA 4DEPB 1RZJC 3TJHD 5BS0D 3GBML 3LRGA 4C83B 2IGFH 4LOUD 2AABH 1RIUL 1CFNA 1KCUL 4JM2B 4R26L 4BH7A 5LKNA 1OVZA 3KXFA 4NZDA 3TBSB 5C0BD 1IGYA 4HUXA 1BVKB 2D9CA 2W65A 3MUGA 2QR0A 1KPRB 5CINL 4P2RD 1LNUA 2CMRH 4U1KB 1CLZH 2X70B 4Z18A 4P4KD 4GW4A 3RWDB 2VE6B 1ZGLM 5F89A 1Z5LA 3SDDB 4PJDF 3MACH 5A16A 2R2EA 5BOPA 5E56A 1QHOA 4I77H 5FHBL 3ZKXB 2ZJSL 2GT9A 2JCCA 4TSBL 1BZ7B 2OZ4A 1WBYB 5HHNA 3V7AE 2A77L 5EDXA 1MF2L 1QVOA 2H3NA 1N3NB 2NXYD 4CN6A 5I8EB 1FVCA 2BY2A 5F6IC 3E3QC 4Z8FH 3DROB 4YIQB 3H9HB 4Y4FC 5C09D 5DURD 4ELKA 2VLKE 3GSNL 3K74B 1NGXB 3DECA 4XPBH 5B39A 2J8OA 1G7IA 3O0RL 4WWID 1YN6A 3ULVC 3V5KB 3D87B 3UBXA 1DUYA 4WW2B 1FCCA 2D31B 2NY3C 3PGCA 4POZC 2OJEB 4LVOB 3VFGH 2PXYC 1YEKH 2B4CH 1D5ZB 3QA3B 4FXGB 1DL7H 2Q20A 3HE7A 4D2NA 4R2GC 3GUTA 4MA7L 1KCLA 1MIML 4NHCL 5C07A 3VDAA 4Z0BH 3QQ4B 2I9LA 4GG6A 1LNUB 1KF9B 2GJ6E 2D4DA 3QUML 4NSKB 2YHGA 4PJBE 4U1IA 4PUBL 4N8VA 3TBSA 3KXFE 1HXMB 4A6YB 3VH8G 5ANMA 1TETL 1IAIM 4LRIA 4HHAA 3B9AA 3U4BH 3DVGB 1Q72L 3LMJL 1ADQL 3BGFB 2IG2H 2VR5A 1GGIH 3BKCL 2PXYA 4LGRB 5D1QA 4CJ1A 2W1NA 5EU3A 4PJEB 4E5XA 2IPKA 5E8EB 4HT1H 3PHOB 4Z76B 2EXWD 2NX5E 2CD0A 1FYTE 1A47A 3NCYS 3O6LL 4Z77B 2DLTA 4P23B 1U3HC 2PO6A 1RZIA 2PR4H 4J3UA 4U6XB 1BP3B 1T5WB 1UM6H 1FNLA 5IHUH 4NQVA 3OKKA 3GI9L 1IGML 1G7HA 2R0ZL 3S8WA 4PV9A 2AV1A 4OZGE 4YH6A 5J11C 1DUYB 1IEAA 3VXNB 2ARJQ 2D03L 5GS0D 1JF1A 4KV5F 4D9QD 1S5HA 1F8TL 3BEWA 3UYRH 4D8PA 1F3DH 1IC7H 2A73A 2EH8H 2WBJD 2R56L 2VRAA 3MV9A 2C3VA 5BO1H 4CL7A 4Q9BA 1R0AL 4I13B 4S11A 5A43C 5EZOL 3O2DL 4XP4H 3I50H 1U3HD 4AIZA 4XRCA 3KPRB 5C0BA 3HNTH 2PTUA 3A6CH 1RU9H 1A6TA 1NUNB 4L8SA 4NWTL 1DBJH 1L4IA 3GB7A 2EE2A 3X17A 1TZHA 2UUDK 1BZ7A 4WHCA 3AS1A 3LQZA 1A9EA 1CE1L 1FVDB 3HZMA 5DJAA 3GSWB 4RZCA 3HI1A 2OM5A 5EA0L 4JDTH 4F7TA 5DJDA 1N2RA 3WO3B 1EHAA 1KCKA 3BKJH 3CNKA 1RSFA 2I60L 2E7MA 3CFCL 2XKNA 3PGFH 2MKLC 4TPRH 3REWB 3MPCA 3HNSL 3PWVA 4U7MA 5DZOA 3ZE2E 4UIMB 1HHHA 3JV0A 3E6FA 3DVIA 5EPMB 1MY5A 4OKDA 4PPTA 5AWNH 3UBXG 1G7HB 5GRJL 1FVDA 5DJAB 3MLXH 1NH6A 2DN7A 4NM8L 1WBYA 1LD9A 2A6IA 3DHJA 5CGTA 2KZWA 4K9EC 2F8OA 2EIBA 1FPTH 4PJXE 2XRAL 4P46C 4K3EL 4UT7L 2BVQB 3VRJB 5B4MD 2FL5A 3GMQB 3VFNA 3IVKA 3HRZA 3VXMD 1I3VA 3T08A 3PV7A 1MRFL 4OGAD 2E9BA 3S36L 5C0CA 3VFRA 5LWYL 2CLVA 5EUKB 1MFBL 3WJLC 3S4SB 2OR9L 3ZE0E 5FOBB 3AAZB 1IAKA 2OI9B 4H25A 1NMCB 5D5MB 1S7UB 5TGBA 1A7RL 1FNAA 2YR3A 3WFDH 4R4FL 5SWZE 3T8XB 3TIEB 8CGTA 5HVFB 5E03A 4U05A 2ICWB 4BKLB 5JORB 4Z78B 1A14H 5TQ0H 4HPOL 5IMOA 1S7TA 2YOCA 3O81A 1MQKL 3K4AA 4UAOC 2PO6D 4HJGA 4RWYL 3U0TB 4G8IB 1BLNB 2AEIT 5D7JC 5H94B 3BP7A 4TN9A 1A6VH 3BMVA 2W92A 3BPNB 4LLQB 2EKJA 3DUSA 3B2UD 2R0LH 3QUYD 3N1MC 2VTFA 2GEEA 2NY5H 4E9LA 2X89A 4NKDA 1CXEA 2JIXD 4MNGE 2IAMB 5C7XL 2E7CA 4ZOBA 4XC1L 3K2UH 3VXRD 4I0CC 4B7IA 3BAEH 4FMKA 1DQQB 2F15A 1ITCA 15C8L 4LLMA 1G9MH 3MRFA 4HF5L 5DJ0B 3DBXB 1MHPL 3N9GL 2OL3H 5C07D 4EKXA 5IMMA 4Q0XH 2FB4L 3NCCB 4RWHA 5C0BB 1S78D 1A02N 3TZVB 3UC0H 1QVOB 5DVOA 3GMMA 4OFDA 4FZ8L 5CLWA 5C0CB 3V6FA 3GMOA 1T89C 4MX7B 4UV7H 4IRSD 1WQVT 1CU4L 3P11L 3GMQA 4XI5C 2EE9A 3VFNB 3BP4B 4PJ8C 4ZTOL 3Q48A 4X5XB 2DQJH 4DUXA 4QHMB 1AJ7H 1I9IL 4PJ7E 5JQ6H 4JHAH 1JP5A 5EO0B 3V6BR 3VFPB 1EAJA 5CJQL 3IDGB 3WIFB 4GSDL 3FZUC 4WU5B 2YPKA 5HYFA 3WD5L 4CVXB 3RKPA 1HKLH 4KROD 4KRPB 3QIUC 5C08A 2YD6A 4NUGH 3TBYB 3T65A 1LK3H 3H0TB 2W38A 1S9YA 2J8UE 1NCWH 1NGPH 4LVOC 3PWPD 1D6EA 4XPGL 3IGAA 1RZKL 2F54D 1U95A 3TBTB 5HPMB 5LGHL 5GS0H 2Z93A 2F58L 4RMQA 1HZHH 1N2RB 4AMKH 1WFOA 2VQ1B 1A5FL 1MFCL 2DMCA 4V2CB 4Y4FA 3GDBA 1IGFH 2XG4A 1JNLL 1P7HL 4P2RA 3QPXL 2XN9E 1VKXB 4NWUH 1WAAA 5C8JA 3P77A 2RB8A 4JFHE 5CEZL 1MOEA 1N0XH 1PKOA 3D3VE 2R9HD 3OF6A 4NFBA 4X7SH 2NY5C 4LK4A 3MLWH 1MCEA 1YQVL 4C4KT 1SYVB 3ARDD 5JW4N 4YBLC 5SX4I 4PLNC 2D7TL 3CX5J 2CJUL 3MJ6A 3ZTNL 3MRKB 3FB6B 3IJHA 2VKXA 3JWOH 4Y2DA 4LEXL 3U30B 4UIKL 5C0JA 1GJIA 5B21A 1AI1H 1MCWW 5KVGH 4P3DA 3RWJB 2Y5EA 4JG1H 5LAXB 3EYSL 4ODVH 2FO4B 5I30H 1MCJA 4HGWB 4U1HA 3CLFH 1ZGLB 5CWSB 4P49A 3NA9H 1WWCA 4HBCL 2NXZB 3OJVC 1AGEB 3ZYJA 1AY1L 2AP2A 2J6EH 3TPUB 1LHZA 1ETZA 3DETC 1LEIB 5JLZB 5T1MA 1AR1D 5B39G 1UT9A 4Y5XB 5D70L 4XPTH 4X4XB 3MRRB 4U6YB 1Z9MA 4PTUB 4RX4A 3UTPD 1Q9OB 5T33L 1J11A 2DQHH 5DJ8B 3KR3H 4LKXA 1BFVH 4EI5A 2RCSH 3RVXD 1YC8A 3TT3L 3BN9C 2YMXH 2Z93B 5SWSB 2ADFL 4XVUD 3H7BB 2YD4A 3I75B 4OV6F 4XMLH 2PTTA 3O2DA 4KTEL 2HJFA 3U1SL 5BW7C 1FDLH 3EO1B 3DO7A 3H9SA 5JA8B 1I9JL 2GY5A 1F3RB 1I3GH 1LEKB 3PWNA 3SDAA 2CIIA 4PS4H 1SBSH 4RNRA 4M5ZH 3VFOB 1LEGB 4ZD3H 5I71B 4MNHB 4M6MH 3UTSA 1NPUA 1J1PL 3V95A 4C83A 3M07A 2A6JA 3P3YA 3HE6B 2EEDA 3L3JA 5DMGD 4E41D 3MRHB 4X9BA 5A2IH 4XCCL 2APWA 4G43B 2N56A 2ERJC 2EDDA 1D6VH 2WIIA 1CGWA 5D1QB 1S9XB 3EDFA 4PRAB 1WGOA 4YC2C 4JZOA 4HC1H 1R5IA 1UEMA 2Q86A 1LP9F 2FX8H 1T2XA 2Y25A 3EKCA 3HR5B 1T1WA 2G5BB 3HMWL 1JGEB 2ICCA 1FE8L 1QLEH 3L7EB 4LGPB 5IW3A 3ULVH 2AJXL 1P4IL 3SN6N 4RAHA 1RZGA 1ZE3C 3D85B 4OLVH 2YPLA 1IMHC 4O2FA 2MPAH 5C0AA 4OZFH 1NFKA 5DEFA 1UB6B 3WKMH 5F88B 1KN4H 1X5IA 3QIBB 5C0ND 4MAYC 4Y19B 5I1KL 4NNXB 3WFZA 5JHDD 1UC6A 3WO4B 4CJ0A 4N5ED 2EICA 4YHIA 5K9JL 2O61A 1Q94B 4OI7A 4EDWL 3MOAH 3GMRB 4ORGA 2YRPA 1CG9B 1P69B 2NNAB 4IOIB 2AGJL 2FEEL 2JJTA 4PJFB 2FD6L 3WL9B 5EUOF 4JRWA 2YSSA 2VLJA 2Z35A 5E0QA 3IT8D 4LCUA 2ZCKL 3FOMA 4D9LH 4MQTB 1T21B 3CDFA 3HKFA 2GITA 3LEXA 2Z8SA 4P2QA 4ORZC 3TNNA 3ZE0F 3H3KA 4LQFH 2CDEA 4NP4L 4ONGH 1L7TH 2H32A 1RZ8A 1P4LA 1H3XA 1MPAL 3T3PF 1CXKA 5TE7H 1JWMA 2X1WL 4QY8B 3GMOB 1J8HB 4IDJH 3UROR 4JN1L 5LVEA 4M6NH 4KUZL 1WIUA 3NCJH 2BSED 4QHMA 3VFMA 2QSCH 4RFEA 4UILH 1W72B 3L7FB 4N1CA 5EBWA 1B2WL 5TDNB 3O3AA 3O2VL 4KKCC 5I73C 4X6EA 4DFIA 2VZ1A 5F6HJ 5J57B 4PGCA 3D85A 1I1AD 3LHPH 4DGYH 3DETD 4ZAKA 4DVRH 3I6GA 3ARDC 3VFVB 4KVNH 4J12A 1VFBB 4JFED 4S1DC 4XH2B 4JRYB 5KVDH 3WSQL 1PBYA 2PW2A 3VWJD 4YE4H 1K3IA 3FB8B 2AV1B 3GJFH 3RWIA 3OL2A 4AZ8A 1OARL 3EJZC 4X4YB 3HLAA 3O3EA 5F7MC 2GY7B 5JW4M 4GG8A 4IRZH 4XVUC 3CVIH 3CFJB 4WU5A 1S9WB 5CSZA 5E2VL 1WV7T 3NIDF 4GAYA 2ITDA 3UO1L 2F5AL 2UWEF 4RGNE 3RVWC 2AJUL 4HWNA 3F7RA 4WTXA 1A3QA 5BVJB 4YDIH 5EWIH 5SX4H 4Y5VC 3S9DB 4FFVD 3AGVA 3ROOB 3EOTH 3BP5B 1IAII 1T03H 5CKAA 1FJ1B 3G5VA 3OKEB 2NCMA 2PYEA 3I6KA 5DJCB 4POYA 1SY6H 5CIPA 1JHKL 5E1HB 4L3EB 2DWDA 1F3DJ 3U30C 4XT1C 4PJXB 1FC2D 1S8DA 3FFCB 5I19H 3IDUA 3B9KA 4Z0XA 1MHCB 2EZ0C 1OF2B 1CGTA 1MREL 2VQTA 4JGUA 5D7KD 5GZND 3QHTC 4XVTH 5F9OH 2LTQC 2YD2A 3V2AR 3ULUH 4O51A 1EFQA 5D2LF 2FJGA 3V4VL 3V52L 5L2KD 4KK8C 3F5WA 3PGDB 4JY6A 4OIBA 1OGAB 5FDWA 3QDJA 1ZT1A 2A1WL 5E8DL 3T0BA 4M4PA 1WIOA 4HG4K 5KANG 2B1AH 1RHFA 3NAAH 4A6YA 2FL5B 4N8PA 2ZUSA 1BWWA 5FKPA 3BRDA 1U8OB 5DXWA 4NRXA 5D71H 1OAYL 5BRZB 4F80A 5ADOL 2YZ1A 4PJHF 4LU5L 4EI6B 1BIHA 3FQWB 3TPKA 3CVHB 2WWKT 2H2PD 1XCTB 4J1UA 2ENYA 35C8L 3PWJB 4ONFH 2LAGB 1DN2A 5IVXA 1HSBB 1NANH 5HVHC 2OZ4L 2HFGL 3CSBA 5BW7A 1R3JB 1MHEB 3TH2T 2HAZA 1F42A 1NKRA 1WZ1H 1DUZB 2CK0L 1KT2A 3ZZ1A 3L95A 1YDPB 1JI2A 4WO4A 3DXAB 2BK8A 4LNRB 1G9MC 4XB7A 3IDNB 4PGJA 1N5AB 2FR4A 1OAKH 3E1F1 3V0VB 3ISWA 1U8QB 3LQAC 3TO4C 4X8JB 2C3HA 2AI0L 5DJCA 5I2IB 3QUMB 4APQC 3VWJA 3OX8B 4QHKJ 3CGTA 5CD5D 2KPNA 2XQBL 4QTHB 5JW4Q 1NAMB 1TTUA 3MODH 3AROA 1S5IH 4ZUTB 5IVXB 1NCDL 2V9QA 2YRLA 4PRAA 1SYVA 3HZYB 4NQDE 2YKLL 4PJAA 2DQUH 5EU6A 3TBVB 1W8OA 4KGLA 1YEEL 4M1CD 4F15B 2MQCA 4EZMA 2JCCB 1QRNE 2AEWA 4KK8D 3RI5K 3Q0HA 1XGYH 1EZVX 4Z0XB 5JOEA 2J1KA 4ODSL 4ELMA 1MNUH 3IJSA 3MZTA 1WLHA 3LH2L 2EIZB 4M02A 1FBIH 1V7ML 4DW2L 2VC2H 3MLTA 5IB5A 4GQ9H 3JV4B 1A4KB 3C08H 4LPXA 1TZGH 3CLEL 3NZHH 2W0FB 3OTTA 1HXMA 4I2XB 2XN9A 1HIML 4A2LA 3IU4L 4HUUA 2E3VA 4JJ5A 1TNMA 5C3LD 4K3JH 1FFPA 2W07A 4PJGE 1DBKH 3AREB 2LQRA 4GAGL 1Q0YH 4KJQC 2FX7H 1JUFB 1NFDB 2Y6SC 4FQQB 1RUKL 3KLAA 5JDSB 4FFZL 4JZJC 2BC4B 3KPPB 4MAUL 5DRNA 4M6OH 3BE1L 1QSED 1FNSL 4J3XA 4PJDA 3DUUA 5EZJA 3VXRB 4R7DB 2AJYH 1A4JA 1NCTA 5FYKH 4EXPX 3QUXA 5ANMB 3S96A 1HHKA 1EAPB 1OB1B 2NR6D 2DQTL 1N5YL 4MMXC 1E4WL 1F58H 4WFGE 4R0LC 1MWAL 4OBRA 1S7WB 3MC0A 5E00B 3VD5A 1BF8A 1T1YA 3T4AB 3ZHLA 1KACB 3ZKND 4OSUL 5ENWA 4GAJL 4A6YH 5DURB 4Z76A 3FRUB 1S7RA 2NY3B 4MA8L 4XP5H 1JIBA 2IQ9H 2YD3A 1OD7A 4TUOB 4HXAH 2XKUA 4WHYG 3V5HA 1JRHI 1FL3A 3MLUH 1QR1B 5HHQA 5I8EA 4P57B 5E95B 4KZEL 3J8F7 5FYLD 4OZ4B 3VXSD 5DFWH 4X6DE 5K9OA 3C8DA 1LE9A 3PDDA 2YA0A 2B1HH 5FF6B 3PHQB 3L1OH 3DYOA 3G6JA 3ZKSD 3RGVB 4XVJL 5JIPA 4GFTB 3O3DB 1IGIH 2GAZB 2MJWA 4QXUL 5DT1H 4IMKA 2CGRL 4XBGB 3ROLA 1O0VA 3QXAB 3JUZA 5DJXA 1YECH 1JTPA 4KRMB 2MQ0A 5CBEA 2VDNL 1N6QH 3LKOA 4GRWB 1IAIL 1RZFH 2MQ3A 4XNZC 5IG7A 1JHLH 2NY0B 4NJAH 4EOWH 1EMTH 3SQOH 5M7QA 5EZJB 4X99A 4PFEA 3O4OB 4M62L 3FQTA 5JW5A 5D1XB 3BP5A 1Q8MA 4KTDL 3D9AL 3S88H 5IMKB 5HYJD 3L5HA 1F3JA 3QXWA 1NGYB 4XNUL 4AEIH 2AEPH 2EC9U 4GLRH 5DRXA 3OR7B 4WV1B 1C5CH 4PJXA 5KVEL 1S9WA 1ZGLP 3ZTJH 4IRJD 4JM2D 3IDXH 2R0WL 2DBJA 2VXUH 1L9MA 4JM4H 5TDOA 3SQOL 1H8NA 2HVKA 5E6ZA 2M26A 2YPVL 3JBG7 1IGJA 1GRWA 2CKBL 3BZEA 4JZNA 1U91B 4DN3H 3DSFH 3NN8B 3P73A 4OQTA 2BVOB 1ZEAH 3SHSA 2IALA 4F7CB 3EUUA 5H35B 3DGGA 4FQJH 1ZKAA 5CSBA 2PYEB 3I6KB 3QNZB 3QEHA 3BN9D 3FB7A 3VRLF 3X11A 2YC1A 4AL8L 5SX5H 3ARGC 2N4IA 4L9DA 4KFZC 5CD3A 1DQDH 1S8DB 4QT5B 5FYJD 3BSZH 4M7ZB 1VFUA 3KPSB 3FHAA 3SDYH 1K6QL 3MRLB 1YNTA 2Z9TA 4HS6B 4LCYB 4XP6H 3BOVA 1TMCB 1G7LA 1QQDA 2XNAB 4MWFA 1CT8B 4Y1AA 2P5WE 5C0BE 1ZHKA 4EUPA 2DQCL 2XA8L 4GG8B 3MV9E 2ADGA 3T2NL 3FQUA 1D9KC 3HZVB 4OGYL 4A6YL 3UZVB 3A0OA 3ZDZE 1OOAA 3WO4C 4YHLH 2VIRB 3IFPA 4HWEL 1X5JA 4RISH 3N1GC 2FJFB 4RFNB 5K59F 2AK4E 3QP3A 5LGJA 1N5YH 4P5MA 2DQTH 1WFNA 5D7JD 3K8KA 3L5XL 3MA7A 4X4ZA 4JZNB 4PJGF 3SO5A 3IXTB 4NQEA 5FIEA 2E27L 4QRSA 1F6FB 2P8MA 3BE1H 5ILTL 5F3HA 1V7NL 4O9HH 3SKOA 3MJ8A 3O4LA 5EOCL 1J0IA 5SV3A 3RUGE 3X3GL 4YFLI 1Q0YL 5F1IA 1D5XA 1UZ8A 4NQXA 5D5MA 2CRMA 5TGBB 4P2RB 4XX1G 3TVMA 1NAKL 5HY9B 4K3JL 1KIRB 5IMKA 5IP4A 2FRGP 2NNAA 4NN6C 4X6DB 4ZUVA 5B3JE 4M7KL 2J7LA 3PL6C 2YXMA 4Y4FD 4ZFOB 4ETQB 4GQ9L 5FKAA 1A0QL 1C7SA 2XZQL 5I73B 3CIQA 4L29B 1RK1A 4Y4KC 4CN1A 2OTWB 5IR1B 2CDEB 2P8LB 1IGCH 3O6ML 2M1KA 3GO1H 3QQ9D 3DI3B 2NXYB 3PHSA 5IF0A 5LXGL 1HI6A 3HCVB 4W4NA 3CC5A 5IB4B 1QO3B 3TIDA 3IDIA 4PGEB 3QEGL 4OQTH 4BH8A 5JDJA 2UV3A 1S5IL 5D7SH 1C7TA 1JPSH 3QCVL 4D94A 1A1MA 3MRDA 3DBXA 4JQIL 2P8MB 3B2VL 4G6KH 1JTTA 4GMSH 4JPIA 5GJTL 4LLVA 1OCWH 4O2FB 4XP9H 1FYTD 5H2BA 5EN2B 1MJ7H 2G60L 3IDJA 1OAKL 5HHQB 1QQDB 3NFSH 2WIIB 5JNYB 2CK0H 2UZIL 2A74A 1UFUA 1Y18A 4HG4J 4HV8B 4FQXD 4P48A 4OZGF 4LSUH 1X5HA 2H6PA 1PFCA 4MDIB 3JSSA 4LAQH 4W68A 5J12B 2L0DA 5T1LA 1EFXD 1IZKA 2D7PA 3CDGA 5E1AB 3VI3E 2FLBT 5F7KC 4YR6A 4MQXD 4U6HB 2K9UA 1HWGB 4HGKC 4G3YH 5D71L 3GSOA 1BD2A 25C8H 2XI9A 1I7ZB 3NZ8A 4OCRH 3EJZD 2VITB 2GFBB 2YWZA 5I15L 1FGNL 2FGZA 2IANB 1HCFX 3KLHD 2A1WH 4RA0C 4NM4H 3T8XA 3VXSB 2HTKC 4LCYA 5CZXD 1W8NA 4JFPB 4WWKD 2ZCLH 4ODHH 1KLFA 4OD2A 2OTUA 2DD8H 1KELH 2CLRB 4HJGB 1HSAB 4XVTL 3QPQD 1S7SB 1E6JL 3RL2B 1Z9SA 4MCZA 2CLZB 4HC1A 2Z91A 1MREH 4XNMB 1NFDA 3QULA 2ESVB 2Y6SD 1E6JH 5I19L 4TSCH 4JFDA 3OG6B 4LLQA 3HC4H 3EAKA 3UBXI 2JK5B 5FM5O 5DFVD 2ITCA 1UG9A 2YPLD 3KVQA 1W72A 1NGWB 1FO0H 3QO0A 5LG1A 4XXDB 5E6YA 2DB8A 1FG2B 5FXCH 3C8KA 4OZFA 3IRZA 3QJHB 4ZPVA 4KC3B 3IF1A 3U46A 1I4FA 2Q6WA 2NMSA 1WZMA 3BQUD 1N5AA 5IBLC 5TDPB 2EKSB 4M5YL 1A7PL 4XCFH 5JPMA 2F5AH 4IRJA 2VZSA 3ARBC 1C5BL 1MWAB 4OCWL 3M1BB 2DQEH 1MFEL 4OZHE 5DD6B 1IAOA 1BX2A 1T7ZA 3CVIL 3QIWD 5L6YL 5T1LD 2HMIC 3HZYA 4PJAB 1KCRH 5E08L 1QSFE 4BELD 3CC5B 3VA2C 1ETZB 4HS3B 3C09B 4AG4H 1RY7B 4JAMA 5DD5H 1OTUC 2XWJB 3PWLA 4XCEB 3C6LC 5CMAB 4YE4L 3CFKB 4HKBA 5C09A 1KFAL 3WSQH 1T0PB 4E42A 3V6ZB 1MJJA 4OQTL 2H32H 4XCYB 2A0LD 1XCQA 2FBJL 4JFFA 4C54A 4QXWA 1GOHA 3FOLA 5IB1B 1K8DA 4XNZB 3IS0X 2VO5A 3OR6B 5DD5L 3O6MH 1B2WH 5B3JF 3MLVL 4CADA 2QSCL 5E08H 1TJGL 3VXRE 2VE6A 1A0QH 5I16B 1JMZA 4WTZG 5C09B 5HI3C 1MLCA 4ERSL 4L4TB 4QHNB 3WNNA 1C5BH 1B0RA 2Y4SA 3R1GH 2NY1B 4M7KH 3FN3A 3P4NA 1GZPB 4MVBD 5FK9A 2ICEB 3RU8L 4YGVA 1AHWC 1RJLB 5JOPE 4ZUUB 2ED8A 4NQEB 1HE7A 1A7NH 5GGVY 5IMLA 1MCWM 1CFNB 4JM2A 4D9LL 3QEQA 1PGRB 3BH9B 4M8VA 4P3CH 3FO1A 2HH0H 4HH9B 4AENB 5JPMB 3VXOA 3CK0H 3L3OA 1C12B 3SDXE 4H1LB 1FFPB 1EIBA 3V4UL 1EUTA 1MI5B 5J56B 2ZSWB 1F5WA 3HC4L 5L8LB 4PG2A 3O4LD 1U41A 3P4NB 1HQ4A 4NIKB 3ARDB 5IROC 4I5BB 1OT2A 1AHWA 3ULUE 5E2WH 4XHQA 3ET9F 4KZDH 2R23B 5DJ2A 4YDJA 4KK9D 4RISL 2IALB 3QBTB 5IHZA 1G9NC 5C07B 4OGYH 1ULVA 4NO2A 3GMNA 5IVZB 2ID5A 3MRKA 1IKFL 1JN6A 1JNHA 4U2YA 4JFFB 5CD3B 3ULVL 1FIGH 4I0PC 1NC2D 4G3YL 2PUQT 4FTVD 4O58H 3DRQB 4QRQA 1UZ6F 5C2UB 3WFHA 4L4VE 3SE8H 3N50A 4CADB 3CXDL 3RWCA 2DLHA 5BZDB 3BO8B 5IEKA 5IFHH 4OT1L 3MV8E 4XP6L 1WITA 3UJJH 3WIHA 3PABA 4JFHD 3CZJA 1FLRL 3SGJA 4MJIA 4U3CA 3BSZL 5ESAB 3HPJA 2AJ3A 3LEXB 4P2QB 5FYJE 5K9QG 3HRZB 4PJ9B 4AL8H 4NFDA 2WWKO 4LSSL 3CXHJ 4WJ5A 4GMSL 4G6KL 5CP3H 1SEBA 2E6QA 3AAZA 4HKZA 2VZUA 3PWPB 1JPSL 3QCVH 4JJ5B 3O3DA 2FJHA 4WUUA 5ICZA 3GMRA 4ORGB 1J10A 3D25A 3LKSA 1F3JB 1MRDH 4KTEH 2DJSA 3KG5A 2FNBA 3X3FL 1XGRA 2DQDH 3O3BA 4JFEA 1A1MB 1WWBX 3GO1L 5C9KA 1BFVL 2JLLA 3IDYB 3KHQA 3QXVA 2DOCA 4LASH 5MHSE 2HT3C 3FO0H 4AEIL 2Y06L 5IEHB 3TYFA 3PWPA 4PJIE 5DLML 3LQZB 4KJWC 1KPRA 3D25B 4KK6C 3FT3A 1RI8A 3GM0A 5E00A 1R24A 5F88A 3FB5A 1UKTA 1M7DB 3ZDYE 4WDIA 2XKNB 5BS0A 5EBLB 1U8NB 4PRPA 1DVFC 3NA9L 4ZSOE 3S37X 3ZSSA 3DSNA 1EEYA 5ESVB 3P0VH 1TENA 3Q5TA 4ODVL 3C9NB 1H3PL 4RAUA 4Y4KD 5D1ZA 1AI1L 5FA4A 3BP6A 4HJJL 4MJID 4HWBL 3BRFA 3J7HA 3JWOL 5HI3D 4J3WA 1A1NB 5AZEH 3ZTNH 1G7MB 1L0QA 2E27H 1QOKA 4Y19E 2J2ZA 3L1OL 4KXZH 4R97B 4TUKH 1B4RA 5FUCE 2MWCA 2J8UB 5IB3A 3ILQC 3PV6A 1ZVSB 2ZUQC 4YHLL 3L5WB 3QUYB 2ADIB 1MFCH 2LE9A 3MLUL 3VFOA 4HXAL 5DMJB 3C5ZD 4QYOA 2C7UA 4XP5L 4XPGH 1JYWA 4APQD 3S35L 2X9YA 1AP2B 4NZTL 5F7UA 2FSEB 3QSKB 3KDMA 2VXQL 2Z8VC 1BECA 4XHJD 1EGJA 3VH8A 1E4WH 4YIQA 1TVDA 5DFVC 1WEJL 1J8HE 1TPXC 3ULUF 1MVFA 3OR6A 3P9WB 3S37L 4GKNA 5MEPB 1S7QB 5FGCE 1I9IH 3QEQD 3Q1SL 4BFBD 2IPKB 1S7UA 2EEAA 1HNGA 3P11H 2Z31D 4FFZH 2COQA 1SY6A 4M9OA 2UUDH 1H3PH 4WO4B 3ARQA 4QRRE 1PEZA 3JWNC 1F6AA 1YYML 4POZD 3P0VL 4JFEB 4UMGA 2CKBH 2HVJA 3MR9A 4ZYKB 1QSEE 3B6SB 3B9DA 2AV7B 2P46B 3RWEB 1A9EB 3D1MC 1KEGL 2DLFL 3IU4H 3NBNA 1CD0A 1MHPH 4LMQI 4N9GA 1ZLWH 1JGDB 1B88A 4EI6A 3MJ9L 3C60D 1GXEA 4MXVF 2NY2B 3BVNA 3VMOA 3C08L 4GXUM 2VC2L 3CUPB 1ZWIA 5EIIB 2VZOA 3HAEB 3BAEL 1AQKL 5CD5C 4WUUB 1MJUL 3FO0L 2XTJC 3AY4A 1BQHB 2E8ZA 3PP3K 1JZ7A 4KTDH 1MNUL 4XC1H 2GCYB 3KYNB 3BXNB 4JFDE 4ESKA 4LNRA 3F12B 2DQDL 5D4QA 1U8QA 4NJAL 3W11D 4NPYB 4KU1A 1NCUA 1X3DA 4RFNC 2D7OA 4R2GD 3UYOD 2IPTH 5DQ9B 5F72S 4TNVF 3HPLB 1U3HB 3MCLL 3HZMB 1FZOA 4LCWA 2VNCA 5J0BA 4BA8A 3MODL 4AK1A 1N6QL 1CF8L 3RDTC 3O2WL 5D7LB 3ALPA 5TQ0L 1U95B 1YECL 3TBTA 5HPMA 1O7VA 3DO7B 4NFCA 1JHTA 4QOKE 2OLDA 3WFDL 3O8XC 2CGRH 2OR9H 4Y4FB 4QXUH 4XTRC 5DT1L 4WUUE 1RUPL 3GI8H 5BQ7A 5HDQH 4PIRF 2JJWA 2NZIA 4PJIB 2H2SD 4XVJH 3MRQA 1WZ1L 4M3KB 1G6RB 1Q9KA 4LLAA 1I1AA 4P46B 4KV5E 3KPOA 1WTLA 35C8H 1WTGT 5AYUH 4GRMA 2WK2A 3W0WA 3MV7D 4JFFD 5GGRB 1N7MH 3UJIH 4R7NB 5FUZH 1IKFH 3F7VB 3R06A 3PDOA 3H9SB 4MA8H 1OW0A 4JRYD 4C57C 3JXAA 3V8OA 2FIRT 4L4VA 5ACZB 2IBGA 5F1NB 3WFHB 4HGWA 4U1HB 3WFBH 3V52H 5IMMB 4U6HA 4M7LH 2BC4A 1T0NA 3QRFM 1I7ZA 3MRHA 5CKGA 2I60H 1VSCA 3BGFC 4KMQA 4P2QD 3U4EA 2IANA 3THML 1EDQA 2AJYL 5GSVA 2C7UB 1QD0A 4PJ9D 5FO7B 4JREB 1INQB 4N8VG 2OR8A 3BP7B 4R7NA 4PJ5B 2D7MA 3JWDC 4CNIA 1DBJL 1IC4L 1ZA6B 3RVUC 4DAGH 4YBHA 3VFVA 3HNTL 3LZFH 1MHHB 5CJOH 2WP3O 3K80A 1C8PA 5C0EB 1CCZA 4ONOA 5E7BA 5E9DB 3MLTB 5IB5B 4GW5A 5D6DC 3FB8A 4XMKH 3Q5YA 4GAGH 3QYCA 4HK3J 1ND0A 2EH8L 3NIGE 5GS2D 3S4SA 4WCYH 2OJEA 1F8TH 2OP4L 1CBVH 5CBEB 4LGSB 1KIQB 5HGAA 4N5EC 4L3CB 3OAZK 3C9NA 4JVPA 4BKLA 5JORA 5INCA 3VXUD 5FKAB 2MNUA 1TZGL 4HKBB 2YXFA 3BP6B 2DICA 3O4LE 4FTVA 5IHUL 4PLOB 1RIVH 4HW6A 2B7DT 2DYPD 1TJGH 1ZHNB 3SGDH 3VCLB 3TF7C 1U93A 2HKHH 4I3RL 1R5VA 5IF0B 4OFVA 3MROB 5DQ9A 5I66B 3K1DA 2RGSA 3IVKB 5KSUB 5GGRA 4LL9A 4P4KB 5HYSB 4HT1L 5AUMB 3RY6A 5FYLL 2HFFA 1KPUB 5EO0A 5FOBA 5T3XH 1FL5A 4FQXA 2AJ3B 3OKDB 4DGYL 2SEBA 3DX7B 1KFAH 5DK3A 5L9DL 3QFJA 1H8OA 2FIKB 3OKOB 5ICXB 3N06B 3TN0C 1I3RA 5BQ7B 4NBXB 4EIZC 4PUBH 3VWJC 2XTJD 1EFXA 2WSKA 4MXQD 2ZKHL 1JZ6A 1VEPA 1TZHB 3RWHB 2DF3A 1NMBH 3GRWA 2GTZB 5E2UH 2P5WA 1KJVA 4I2XE 4JN1H 2DQEL 3CZFB 2FHCA 1P1ZB 4K94L 1XF3A 4LCWB 3T0AA 4FFYL 4U1NA 3NCFB 2ZCHL 4XCFL 5IJKC 1L7TL 2C1PB 1J1OL 5I1EH 3MXWL 4UIMA 5I18H 5MEOB 4S0TD 2ZUVA 3HHRB 3O0RH 4MYWB 1NUFA 4XI5D 5J6GA 3L3DB 5ADOH 2ZCKH 3EO0A 5F1NA 4NNYB 1UH4A 1I8MA 4UTAH 1AXSA 1BJ1J 3SDXB 2AGJH 4XVSL 2WUCL 3RTQB 5KSBA 1CK0L 3MOAL 5C0AB 4KKLC 2N7AA 5K9JH 5D9SA 1A6ZA 4F3FB 1MFDL 3RGVD 4PP2A 3VG9B 4GW1A 4WO4C 3W9EB 3HZVA 2B4CC 2H6PB 4M61A 5SWSA 4WY7L 1KN4L 2CIIB 4ODHL 2ZCLL 4N68A 1U8PA 5GIRB 3SY0B 4OLXH 3GHEL 1T6WA 1SY6L 1KBGH 3NA4A 3IU3B 2MPAL 4N9OB 4MXQC 1IAMA 4U1LA 1FGNH 4PV8A 3OV6A 1CLZL 4MCYB 4OLVL 3U9UA 3UCRA 1BFSA 3WLBA 4MXWL 2R23A 1JPGA 3EOTL 5F6HI 2NXZD 2ZOLB 3IDJB 3U0PB 1PX4A 3HMWH 4PP2B 4U0RC 4R26H 1FLTX 3S96B 2Y7QB 1CFTA 3QZWG 3S35X 4U1SA 1FVEA 4HC1L 4X7CC 4WW2F 1N4XL 5IB1A 4LAJH 4PGBA 5T5FH 1BD2E 4F2MA 1TQCB 4PREB 1QEWA 4NCC1 3TJEL 4PD4J 3BZEB 4JO4L 1XGPB 2E8YA 1VFMA 1UJ3A 4QYOB 4F9LC 1QLRA 4XCCH 2BXYA 5FCUH 1I8MB 4G9DB 1CL7I 2BVOA 2EDYA 4PJFF 1MJ7L 2G60H 2ZUXA 4HKXB 2VABA 3OMZA 3CFKA 4QHNA 2GCYA 2IC2A 4BSWA 4UOJA 4PS4L 4P3WA 3G6JE 3D0LB 2J5LC 1J05A 5DC4B 5I74C 4OZFG 1CD1B 3NVQA 3QRGH 1AR1C 2O5XH 3OJMB 2P42B 4ZSOB 1T0MB 3CCHA 2CR3A 4N0UB 3S4SG 3OB8A 4NRZA 4XMLL 1YZZA 1PYWB 2DKMA 3O2VH 1KV3A 4CAGA 2VLRD 4JGJA 3MJ7B 5JTWA 4OFIA 1PY9A 4L8DA 4JHZA 4OCNC 5HY9A 3GKZA 4PRIB 5FYKU 4WW2A 2DTSA 1IFHL 3QQ9C 3NCEB 2DL9A 5DJXB 5JIKA 1XGRB 2E7BA 4LIQL 2GJJA 4Z7VB 1HHGB 2G75B 4FQXB 3DX8B 4XPTL 1EJOH 3VXMA 1YJDL 1LQSR 2VLMD 5BV7B 2V2TA 3TBYA 2BMKB 3BPOB 1Z6JT 1RK1B 1F11A 2J6EL 1KTKE 1HK6A 3RFZC 1AC6A 1L0YA 4MHHG 4ZQKA 4HFWB 2VERN 2VDRH 3QUZA 2O5XL 3RGVA 4P2OB 1S78C 4QRRD 4ZAKC 1MWAA 4FQIL 1XF5A 1ZLVH 1BX2B 5K9OB 2NW2B 3PJSB 1RFDL 2I27N 3WN5B 3D2UA 1WF5A 5CHNB 2CXKA 4JY4A 3FO9B 4Z7WE 4KAQH 2YPKB 4L9LB 4PJGA 1ND0B 1X7QB 4Y4HD 4I18C 2DL2A 4JO4H 5CGYD 5DJ6B 3K8LA 3TJEH 1B90A 4J4PD 4X0KB 4JPVL 5I1CH 4X6CB 3B3IB 3LN4B 4ODXB 4X7SL 3D39A 5T3XE 2IF7A 5F7EL 5GGTA 4JR9H 2EXYC 5T5NG 4HWEH 1QBAA 3PUCA 3QIUB 5FGRA 2GSGB 2LV4A 1DBML 1TJIH 1IEHA 2AAVA 5C0IA 1HHIB 1DDHB 1SEBB 2IAMD 3MX0A 1JV5A 4MSWB 4JFDB 3ECBB 4D8PB 1CLYL 3IFNL 5LGHH 3ARFB 5KZCB 1C5DB 1KBGL 1YMMB 4XAKD 3GHEH 3NFPA 4IDLA 4LP4A 2X9WA 4ONHB 5H8DA 2EE6A 2OI9C 5DMYA 5K33A 3PABB 1O7SA 1SM3H 3VXSA 1T20A 1TVHA 3RWFB 1U6AL 9CGTA 1K6QH 1WZKA 3SDYL 5B8CC 1D6VL 5CJ5A 2FX9H 2DYPB 1DQDL 4GG6B 1ZHKB 1EK3A 1HHIA 5DHVH 3MCKB 3LRSA 3A6BH 5GJSH 1XF4B 1EERB 2WUCH 3LV3A 4ZD3L 5F9DC 1PKQE 3LPGA 4H0IA 1UYWL 2LU4A 3QEUB 3OKNB 7CGTA 1P4LB 2XFXB 1PKQA 2EIEA 3QHZL 4F58H 4UTAL 2NY3D 1J87A 1NAMA 2ZSVB 3CJJA 1I85C 1QPXA 3QNZA 3B3IA 3LN4A 3MXWH 1T83C 1LE5A 2FEDC 2VXUL 5D7LE 1DR9A 2A9NH 3IYLW 1M6OA 1EH9A 2XTJB 3BWAA 4EI5C 2FBOJ 3QUZD 4K94H 4M03A 1I3RB 3KR3L 3RNKB 4HZLB 4M6AA 2DS4A 2QSQA 1V3MA 3SPVB 2R2BB 4K9EL 3N0PB 5HXMA 4J1UB 5T3ZE 3BWUC 1Q9WB 1Q0XH 4HWUA 4EQ3A 3DRTA 3INUL 3BDXA 5AG9A 1KLUA 2X7LA 3G08B 4GRLA 4M1CC 1BQUA 3VFWB 1MHEA 1S7XB 4V1DD 2RJMA 2YD7A 3SGKA 4HPYL 1KT2B 3CLFL 3O3BB 5DHXB 2DLEA 2VDNH 4G80B 4OZIF 5L2JA 2A83B 3ARVA 4CDHA 3EOBA 2P1YA 1QLFA 1DUZA 1DN0A 4OLYL 1ZSDB 4Z7WA 4YHYC 5DEFB 2HKHL 4R8WL 2EDJA 1FL3B 1GZQA 4ENED 2NY2D 3GKWH 1BQHG 4ZODA 1ZLSH 4ZFGL 3S36H 1IC1A 3NCYP 4O02L 2NXZC 1JZ8A 3CFDA 5K9QI 1OQXA 1BM3H 2Y23A 3OXSA 3CU7A 1AO7A 1PLGL 3QXTA 2E7LC 3K4DA 2NYYD 2X4UB 4HAGA 1FPTL 1CBVL 3WUWG 3IDMA 4QRPD 3ILPB 4WCYL 1A2YB 3ZSTA 4RA3A 5A2FA 4NM8H 5EUOB 1INDH 2I26N 1MVUA 4NOBA 3MFGB 1NC4B 2P43B 4HKXA 3B9KB 1RZIB 1XIWD 2IQ9L 2NY6D 3BD4A 4PD4K 4DAGL 4GAJH 5FCSH 4YBQD 4H8WC 2WMPA 4NUJB 5DGQA 2PYED 3KAAA 1LK3L 5CZVH 3RVTC 3PG2A 5HHME 2CR6A 4KK5C 4LSRH 5J06A 3DXAD 4MAYB 3QUXC 3FCTA 4DK6A 4WEMB 4WFEE 3EFFB 5D1QD 1XF1A 4GKZA 1NUDA 4LPUA 1FZKA 5CJQH 3O8XA 3K46A 2CQVA 3RDTB 43CAB 4BQBA 3TFKC 4KTYA 1MJ8H 4MS8D 4NWTH 4LLWB 5TH2A 3T09A 4YZFE 3TBWB 3V4PH 4J3VA 3BQUC 5GQBA 1G7JA 4Y5YA 1H15B 1SMAA 3O2DH 4R7DA 4XP4L 5FUZL 4IJ3C 2X4NB 4P4RB 1R0AH 4OFKA 5HYIA 1INDL 3CFEB 4G8FB 2A74B 2DM7A 1S7SA 1TCMA 5AYUL 3KDMB 2HLAA 4OF6A 2IAND 3U0WL 4NO0D 1NBZB 1ED3B 2BSSB 2X9XA 1HIMH 3PF2A 4QOKA 2PW2B 4XBPA 4P2CG 1G7IB 4X99B 5HHMB 2EDFA 1P2CA 3KPLA 3CLEH 2X05A 3CDYA 3GI8L 3GSOB 3GIVB 3B8YA 3GKWL 3LH2H 2ADIA 3L7FA 1NDMB 5EBWB 2GFBA 2Q7YA 3ILPA 3K2UL 2PO6C 2NY1D 2QLVB 5C6PB 1MCCA 4ODSH 3F8UB 2NLJA 4OLYH 3O6LH 4KI5E 5FOJA 5JOFB 2XY1A 2K7QA 2NY5L 1IKNA 4ZOCA 3G04A 3O2WH 1CF8H 3STLA 3UPRB 1KCVL 3LN9A 1OP3K 3IDNA 4PRBB 4HUNB 3MCLH 4D9RE 3RGHA 2IPTL 1UVQA 2GSGA 3LMJH 5EZLA 4ZFOL 5KOVC 1YN6B 2A6DB 1XH3B 2XQBH 4YX2H 1A14L 3EDDA 5FB8A 4YNYB 1CFQB 3H3BC 2AI0H 1LO3L 1C16A 4YO0B 1DQJB 3QUMH 1VACB 1FG2A 1GYAA 4J23A 1MJUH 1AQKH 5DMGC 3QR2A 2XXCB 2W91A 5C08B 4QRPE 3LKOB 4NQCD 4FXLA 2YUXA 1F6AB 4XXDA 4FNLL 1G6RL 4WHTA 4C56A 4LFHG 2OZ4H 4ALAL 2XWBA 3FQRB 1A7QL 4MQ7A 3U0WH 1CXHA 1GHFL 5DVMA 1MLBB 1I85A 3IXAB 2CDGB 3BPOC 1YUHB 2OSLA 1QFWM 1YYMH 1LE9B 4D0DB 1E28B 3UTSE 2VZ3A 3H7LA 2LVCA 3WS6A 2ATPB 3V4PL 4U1MA 5E8DH 2JKXA 5IVXE 4L3EA 4KH2A 4OLZL 3MRJB 4Y16C 3CVHA 4Z8FL 3A6BL 4TUJB 4GW4B 1WUNT 4ZXBC 3WUZA 2VIRA 3IFPB 5DJ0A 3ULUD 3C2AH 3BN3B 4ZOAA 4HXBL 4JDTL 1DQLH 5FGBA 2GKIA 1SM3L 4ZXBA 4XP1H 4IRSC 4MLIA 4K07A 4O2EA 3WJJC 3WXVH 1DE4B 4KKBD 4NZTH 3MCKA 5IBUG 1UQSB 1RJYB 4FA8A 3ZMRA 3EYQC 4OQ1A 1HHKB 1LDSA 3IFNH 1U8KB 3NIFF 3MRPA 5EZOH 3BX7C 1QEWB 5DS8B 5F70A 5TJWK 1GAFL 1WJ3A 2H2SC 5MEPA 3D5OF 5BO1L 1LILA 1ZHLB 4HX1A 3HMXA 2V9TA 4YDIL 5EWIL 1RIUH 2A2QT 4LDOB 4JR9L 4OZHB 3UTQB 2GTWB 4TUKL 3DXAE 1JPGB 4P9HH 4O02H 2FSEA 3GI9H 2AXHA 1ZLSL 5IBUB 4KAQL 2ESVD 2PTVA 3GSRA 1HYSD 5FUCC 4JZJB 5BS0E 1ONQA 3FQXA 5F7DA 1IT9L 5C70A 4HJJH 4YHYB 4L4VB 3OXSB 4FQIH 4OJFL 2V5YA 4WWKB 1I9RL 4IMLB 3D3VA 3CFIC 4NN7C 3BKCH 4HPYH 5JLZA 4DVRL 3MNZB 2IG2L 1NC2B 3RPIA 3OG4B 4X6BA 3QISA 2DJUA 5IW6A 3BQUB 1UACL 3W5NA 4Y2OA 4ZUSB 3ZDYF 2JB6B 1X5ZA 3BZ4B 4XAKE 2EC8A 1JFQH 4QHLA 1T21A 1KGCE 1VENA 4J8RB 1UENA 4Z7WB 3BUTA 4Z0BL 3EJYC 2P5ED 2DKSA 4ZQKB 1XZ0A 5C0RL 1MIMH 2Q3AA 1IFHH 1VADB 5E8NA 1V3JA 4FQHA 3KS0J 5ICZB 1EHLH 2EDRA 1G9EA 1JGUH 3H9HA 3HI1B 1N64H 2A9NL 3MLRH 1INEH 3H6JA 2EZ0D 4HK3N 4LQFL 5F1SA 2X4UA 5IMOB 2JTDA 5E5MB 5GHWH 3VGHA 3ZDZF 1G1CA 1KC5H 4XPBL 2NW3A 1MRDL 3VXTA 3RVVC 2LU3A 1WC7A 3QNXA 1RK0B 3QHZH 4MJIE 4XPFL 3STBA 3QIWB 1FCGA 1UYWH 3CVHH 1M7IB 4LRIC 5DQJB 4P99A 1MFNA 5D6CA 5GJSL 3VFUA 5IIEB 1AH1A 2X4NA 1C1EH 3HG1A 2A77H 2VL5A 3B9EA 5KSBF 3T0EA 2H2PC 4W6WB 2QADB 1R5IB 1ROWA 1RZJL 3KJ6L 1NMAH 4LCWE 2G5BA 5T5FL 4G8GA 5F7NC 3ARGB 5GRVL 4HKZB 4H1LG 4OT1H 4P5TD 3EFFA 4BZ2L 3CFBA 4NO0A 3CXDH 2SEBB 3SDCB 5AAWA 3ROLB 5ETUB 3OKLB 1IEBA 4GAYB 4Y2DD 1P4IH 5HGBA 4P23D 2BP3A 4HUVB 4MD4B 4MJ2A 1FE8H 1QLEL 4ZUSA 1FRGL 5JOFA 2DI8A 2V2XA 3ZDXE 1DBMH 4MX7A 5I1AA 4UOW1 1KCUH 1EBPA 5C0AE 4F3FA 2AABL 4BZ2H 1BZ9A 1Q1JH 1YA5A 3E6HA 5AG8A 1ORQA 3LV3B 3QQNA 4OCXL 4X9HA 4QF1A 1NMAL 4KZDL 5EUOA 3NPZB 3RVVD 2ZUYA 1U8KA 2FWOA 1T1WB 3SGDI 4HIHA 2PCPB 2ZSVA 4CMHC 3QEQE 3AS0A 1ZVYA 4OV5A 1PEWA 1HQRA 3UXFA 1C1EL 2AKRB 1FL6B 5DVNA 4YR6B 1FHGA 4QRRA 2BNQA 3CK0L 3KPRD 4M5ZL 3QHFL 4GBXB 5B38B 4KRPC 1HEZA 5HGHA 2RHEA 1AP2A 3HC0B 5DC9B 2CLZA 2EIDA 4L9LC 3AU1B 3ZE1E 5EN2A 3WJJA 2R0KL 3SO3B 5GHWL 1A7NL 2FCBA 1J8HA 1DBAH 3OKKB 4FHBD 5I1EL 5E6IC 2CRIA 2WQ8A 3C5JB 1INEL 3RU8H 5CWSA 5C0GA 4JO3H 1EHLL 1EJOL 3H9SE 2X4OB 3TO4A 3HS0A 4MXVE 4U1JA 2JIXA 1RMFL 3TZVC 4U0QB 5E2UL 5IB3B 3I02B 4JCLA 4MD4A 4X6EB 4TUJA 1BIIB 5DJYB 2VLJB 1JFQL 4P46D 5MP6H 4PG9A 2BMKA 1K4CA 5ICYB 2VJXA 5IEHA 3MUJA 1WBZA 1ZA3A 3O6FB 1UACH 5D7IF 5DYOB 1W0YT 4GKSA 5ISZD 3MRQB 1DN0B 2FBJH 2FYYB 2GTZA 4U4BA 3OX8A 4FMFA 1RJZA 4QHKI 3QRGL 1QSFA 4DCQA 2WBJC 5T3XL 5I30L 1I9RH 1J1XL 4QXTB 4E41E 4XXCA 2VXVL 3VJ6B 2YUVA 4Y19A 1BFTA 1IT9H 4KKAC 5KVFH 4LEXH 4JN2B 2YK1H 1OL0A 1GSMA 5EO9A 4PJCF 5C9JA 2IPUG 2OTPA 3C60B 3UTPE 4BH8B 1JK8B 1RIVL 3WV0A 5ITBL 1SVZA 1YN7A 2CO7B 3WHXB 3G6JF 4XZUA 3TCLA 1W0VA 4P9HL 1CE6B 2XWTB 4OD1L 4QRTA 1I8IB 5IBLD 4D0BA 4LVHB 4Q6IC 4NWUL 1A7PH 1T4KA 2CIKA 3I85A 4J4PA 1XR9B 3V6ZA 1MUJA 4OLWH 1JNLH 3B5GA 5HI4C 4KI5C 5CS7A 5C86A 2Q7NA 1VACA 4GUPB 1GAFH 1SJXA 3KPQA 2O5ZL 5D1XD 4R2GB 4DWHA 5CJXA 3I02A 4LF3A 1T66C 5CJOL 5GS1A 4OBSA 1FYTA 3EZJB 4IIQC 4Y4KB 1MCNA 2DIJA 3GJFK 2X4OA 3WHXA 1IC4H 4YFLF 4RDQG 5HHXH 2EYRA 4WY7H 1AQDB 4DKFH 5JDSA 3WXVL 4NQVB 2M8XA 4WFHE 1I8KA 4HK0A 1DQLL 2EECA 3BZFA 1QFUH 4ZO8A 4LMQE 2AKRA 1HKLL 2VITA 3R4DA 3C2AL 3F6IA 3DIFA 4U3XA 5CP7A 3HI6H 3UTTB 3WD5H 3ARRA 1MFDH 4WI7A 1KELL 3BEWB 5F3HB 1AJ7L 4WW1A 1WSST 5JQ6L 5JPNB 5CLTA 2DQJL 2MTPA 2BOCB 4XVSH 3MV9B 4IRSB 4NM4L 5C08E 2BX5A 1V3KA 4JZJA 1TDQA 5I15H 4NOFA 4OCRL 3PXHA 2ESVA 25C8L 3SY0A 4G9DA 3LSOA 1N7ML 3UJIL 1W72L 3S3PA 5CSZB 1I8LA 4HSQA 5I18L 1RV6X 4EUPH 1A7QH 4NRYA 4EDXA 2BZDA 4ALAH 4LAQL 1EEYB 4FFYH 5ESVA 1PD6A 1G6RH 3ORJA 4FNLH 4X4MA 3GIZL 3QIUA 1LO5A 4PJBF 4R9HA 3DX9B 2UZIH 5D93C 4CU8A 1U3ZA 4K8RD 5F8RC 5FDYA 1OLZA 1JWSB 3C5ZB 1LO3H 3JVGA 3BEVB 2VL5B 5EOQH 2CKNA 5GRUH 3QDGA 3TIEA 1AO7B 3B2VH 2FZ3B 3C6SA 5L9DH 4NQED 1YEDB 2R0LL 2XG5A 1FORL 1T89A 1SEQH 1NMCC 2GJZB 3NPSC 3SDXF 4G8GB 4AEHL 2DQFB 3ZE2F 3MRGA 3QEGH 5GGSY 4Z95H 5ETUA 3QO1A 3B43A 4N1HB 3F58L 1QLFB 2UYLA 4OIAA 1CLCA 2CKBA 3M17B 3MQIA 3BZFB 2AQ3A 4Z7OE 2XWTA 1A7RH 2V9RA 4I3RH 4YGVB 4PJHE 4NYLA 3SDXA 1L6ZA 2ZG1A 3DURA 3GJEB 2XZQH 4QTHA 3X12B 2VDKH 1UXWA 2R15A 2ICWA 3D2UB 1ZT1B 4G8EA 3QIUD 1H3TA 1BFOB 3OJDB 2FEDD 2BVEA 2VDPL 1K9TA 1KEGH 3PWVB 1KJ3H 5J11B 1T2JA 3RZCC 3HTLX 2P4AB 3LD8B 4LEOA 5GRJH 1Q94A 3S3SA 5MENE 2D7NA 4FTVB 1MEXL 4YEFA 1AKJA 1XZ0B 5E2JA 2A83A 5AWNL 3RVXC 3DV4B 1CFSA 4QRTB 5F3BA 1HOCB 5DA0B 1KTDB 3KJ4B 1I4FB 2AXFB 1MJ8L 1V7NH 4O9HL 3Q1SH 4Q9QL 2K1MA 4X5XA 3VA6A 2EKSA 1XR9A 3G5VB 1Q38A 4NJ9L 3MR9B 4P9HC 4K3HA 4IRJB 2QR0B 1XGQA 3THMH 1LK2A 2EO9A 4KJYA 3HN3A 5T3ZD 3RJQB 1YY8A 3JTTA 2QSVA 4LSRL 5DSCB 2EDOA 3BEVA 3VWKB 4LARH 4M7LL 2VXQH 5HHOE 4EIGB 1BBJB 3QO0B 1O5DT 2X4SB 4Q7DA 1S7QA 5KSAC 3QDAA 5C09E 4N1EA 4I5BA 2YD8A 1ZAGA 5T5NF 4CNIB 1OHQA 2VAAB 1U36A 2XA8H 2HJKB 1NGZA 2YUZA 3DX8A 2BVPB 4MLSA 3OKEA 3DJ9A 1TFHA 5IJKA 1OWWA 1XT5A 1BD2D 1B9ZA 2VUOA 5HJ3A 2OL3B 3BISA 5HGDB 3EIFA 1PLGH 3MV11 1N26A 1QBLH 5DGRA 4EJ1C 5D7KE 1PYWA 4ZFGH 1RUPH 5F7WC 3MV7B 4PG2C 2ZG3A 4R8WH 2PR4L 5I71C 1WVZA 4G42B 5BRZE 5IVNA 2DYPA 4HWBH 5DJZA 2VSDA 4MDJB 5E4IA 3R0NA 1KXQE 5FM5M 1R3HA 3BPCA 2ERJB 1G6RA 4L5FH 1H3WM 3IRPX 4DN3L 5FFLA 1GGIL 2W9LA 4RGNC 2F53E 5MERA 1PG7H 3BI9X 2R2HB 1D5BA 5KG9B 3INUH 5HD8D 4QLRA 3QEHB 1Q0XL 1IE5A 3LVEA 2BNQB 4PJCE 2ENSA 3IDIB 5C0IB 4PJFA 3WL9A 1X9QA 3ZT7A 5E4EB 1A9BB 1D5MB 1IGTA 4F37F 4XNUH 1AFVH 5SWZB 1BREA 2PNDA 3EFDL 4WI9A 5CHNA 5ANME 3D9AH 1DL7L 3S88L 3MJ9H 2GW5A 3L3IB 5E9DD 5FK9B 5EC1A 1XFPA 2WAHA 2DLFH 3AB0C 5BCAA 4OZIE 3U9UB 5H2BB 3RWJA 1PG7W 2I9LB 4GG6E 4JFOA 1EMTL 2H26A 2KL6A 1IAIH 3FTGA 3BFOA 1BJ8A 4CVZB 5C3TA 5JIHA 4MNQA 4PRIA 4F58L 4HIJB 3OKDA 1BQHA 1A3RL 5I0DA 2F74A 5IWLA 1Y6MR 4RQQB 3V7MA 3F7YB 1CDHA 4YPJA 1HHGA 2G75A 3WHE1 3A67L 3CH1B 4EBQH 2NW3B 3KWWA 4Z7NE 3S37H 1JF5A 1HINH 4S1DD 3MA9H 2FX9L 1T7XA 4NC0B 3QCTL 1OTSC 3G9VA 4JKPL 4F8TA 2HN7B 3LDBC 2B1HL 5FHBH 4BSWB 3SBWC 3MACL 2P8PB 4HWZB 3S35H 2WZPD 1IKNC 5C6TH 4RQQA 1CLYH 3O3UN 5MEQA 2PW1B 4WFFE 3VRLE 4Y4HC 4YJZL 1KJ2B 1OP5K 1PDKA 5F71A 4RNRB 1U8LA 2W0PA 5KSUA 2NY1C 5EO1B 5IBTL 3RWCB 3RPIB 3P77B 4XPAH 5JO5B 3PDGA 1I1AC 1D5MA 1XCTA 3CPLA 4WIQA 1ACYH 2EDNA 4L4TD 5F97E 1IRAY 2AXJA <