4RGOH

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
213
Chain Sequence
EVNLIESGGDLVKPGGSLKLSCATSGFTFSAYGLSWVRQTPERRLEWVASISGGGSVYYPDSVKGRFTISRDTAGDILFLQMNSLRSEDSAIYYCVRDLYGDYVGRYAYWGQGTLVIVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 46
structure length 213
sequence length 220
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoH01
4LPUA 5DRWA 1XH3B 4BFEA 5GRYA 5IMLB 2BXZA 4BUGA 2ERJC 5JMRA 1Q38A 2QTEA 3BPCA 3BQUD 1NUDA 5ANMA 2P8MA 2GY5A 1IAKB 1QVOA 2VC2H 5E9DD 3WUZA 3DUUB 4Y88A 3VH8G 2DQUH 3Q3GB 4BZ2H 1UT9A 3QDMD 4NYLA 2XQBL 4HWBL 1MRCL 2FGZA 2DQIH 2EH8H 4JZJC 2V2TB 3CSPA 3GMOA 4O9HL 1GGIH 1CE1L 3RU8H 4QHMB 3VXPA 2P1YA 2NY1B 3SGEH 3QNYB 1XF3A 5CEZE 2E7LA 3RL2A 3P9LA 4O5LL 4X7CC 2YXMA 4XI5C 3O2VH 4MJID 4YUEL 4NFBA 3VFOA 1OLLA 2H3NA 1FG2B 5EU3A 2X4TB 1F4YH 5SWZE 4ISVB 1XGPA 3FFCB 1KENL 2DICA 4HFUH 4LHUG 1BBDL 1KCKA 1YEKL 3BD3A 1FV1A 5TE7L 2HP4A 3BAEL 3QULB 2V9RA 4U1GC 3GMPA 2E3VA 4LASH 4XP4L 1DSFH 2JCCF 2X4QA 3EKCA 3OR7B 2HVKB 2R15A 5TPWL 3MLVL 2GJ6B 1CD1A 2ZCKH 4NSKB 1E4WH 1NBYB 2FB4H 3UYOD 1NGWB 4XCFL 3T4YA 4K7PX 1TTGA 3AU1B 3HS0A 3E3QE 2QHLA 3QYCA 3TH2T 3WL9B 3HG1D 2N1KA 3CX2A 2FBJH 1EBPA 4H8WC 4R0LC 3GEWB 5K59E 4XWOD 4W68A 4U6YA 4XNUH 5HJ3B 1KJ3H 1CICC 5JLZA 3VW3L 5EORL 2C1PB 5IQ9B 4HXBL 1JNHB 1T66D 3KNBB 3C5ZD 5IBUG 4TULL 4S2SA 2C4FT 3DVFA 5B4MD 4OI7A 1ERNA 4OUUB 3T04D 2MPAL 4KXZH 4LIQH 5CEYB 3FZUC 5FYLD 1ZLSH 5JA8B 4RA3A 4HJGA 4APQB 1GXEA 1CFTA 3MA9L 1NBVL 1S7SA 4FG6D 2IGFH 3P4OA 4D9QE 3QO0A 2XNAB 3NACL 4HPOL 4EXPX 1OD9A 3CD4A 1KUMA 3OKKA 1C8PA 4QGYA 1LHZA 5DA4A 1PVHA 3G5ZA 3TM6A 3TFKC 3WN5B 3GSUB 2FHFA 2BJMH 4POZC 3DVGB 5C0RL 5D7SL 3N1GC 3FO1A 4R90L 4DWHA 1BOGB 1NC2A 3AAZA 4X8XA 1J1PH 1G6RH 5CINH 4N8VA 1LP9F 4G8EA 32C2A 4FTVA 4N0YH 3RDTA 1BPVA 1YC8A 4LNRB 3IFOB 3HC0A 4QHUB 2BSED 4S11A 3TEUA 1E6JL 4XBGA 1Y6KR 2HVJA 3E6HA 5JA9A 1S7XA 2J12B 4XVJH 2ICES 4P46A 3G5YA 3OR6B 4PRHB 3RPIA 1WVZA 3KPRB 1EGJH 4L3ED 5TQ2L 2I27N 3O4LB 4AY0A 5F6IC 3VXMB 4RIRB 3DGCR 5BO1H 1QSEA 2NXZC 2VUYA 4PJEB 2QHRH 3V7AE 4XCNA 2CUHA 3WUWB 2UZYB 3WHE0 1YJDL 1JI2A 1CK0H 1NGZA 1Y6NR 5BV7L 4KI5C 1P69B 1T5XA 3VXTA 3B8SA 4QRSB 1C5BL 4AEIH 2DQHH 4M4PA 5D7KE 3MV8E 3LCYA 4V1DD 2AJSL 1UH3A 1FNEB 3MRHA 3LEVH 5EBLB 1GJIA 4RMSA 4WW1B 3MRKA 5IB3A 5C07E 4YE4H 2OSLA 4OF7A 1FPTL 1GCFA 3E0GA 4PJ9B 2MNUA 4KKLD 1I7RA 1S7QB 4JFOB 1MCWW 3BH8B 2P8LA 4X80H 2YA2A 1MH5B 4YNYA 3HNVH 5GRXG 5CJ5A 2QL1A 3HI6L 4MSWB 1MREH 4WCYH 3TPKA 5I1GH 2JELH 1O7SA 4Q2ZA 1P84K 1TQBB 3MLZL 1FAIH 5JO5B 5DFVD 3TZVD 5DVMA 3QBTB 5TE6H 2AJVH 3T2NH 4RA0C 5E2VL 3HC3H 5MP6H 3GI9H 3QWOA 1MCBA 4MQ7A 2F74B 1U8QB 4LQFH 1RZJC 1IAOA 4KZDL 2OL3L 3ZKQD 1TCRB 3G6AB 3ZKNC 4HFWA 4JN1L 3ZTNL 3MRLB 5ESAA 3U7WH 3VRLE 5DFTA 5DSCA 1G7LA 1JV5A 1NGXA 2P46B 3ARBC 4KMTH 5IROA 4DEPB 3X3GH 5CAYB 3NABL 2IANB 3BPLB 4DVBB 4JZNB 4JE4B 2XG4A 4QRPE 1WBXB 4DKFL 1JTTA 3U7YH 3CFEB 1JF1A 2K1MA 4LCUB 4JKWA 1BFOB 4MDIB 3QIWD 1F45A 3MNZB 4M7LH 4WI4A 2R2HA 1NKOA 2Z31A 5DJ6B 5M7QA 2E27H 1I3VA 3BFOA 1LEGA 1INDL 4U1NA 1BJ1J 1ZVSA 3BSZH 4DZBA 3L3HB 5HSFA 1G7MB 1O5DT 1NBQA 4A6YL 4JQVA 2GITB 5B8CB 4QRUA 1DBKL 2BSSB 5D96B 3TJHD 2IFGA 4KPHH 4LLQA 5KG9A 3IDGA 5GRJH 1W72B 3REWA 3QXDB 4NQXA 4YDIL 2DIBA 4Y4FB 2BRRH 4D3CH 4YX2H 4MJ6A 4AIZA 1SMAA 3EYSL 4F7EB 4O2EA 5AYQA 3IDIA 4WY7H 3EGSA 4L3CA 1MI5D 4P2RB 1Z5LB 1DBAH 2BCKB 1WCQA 1U91B 3MRDA 4W81A 1HH9A 1MHPH 2DLFH 5CSZB 2YN3A 3NPSB 1WC7A 4MLSA 3NZ8B 1CT8B 4I77L 4WDIA 5BRZA 4DJMA 5CJXA 4EZMA 3TNMA 4DUWA 4GRWE 4H5SB 2VE6A 2NLJB 3O6KH 5LCVH 2OR8A 5HY9A 1GYAA 3GMQB 4D0CB 3L95A 5GZOC 3QG7L 3KYOA 4CN6A 3FQXB 4KKCC 3JVGC 2WM0A 3BKCL 1E27B 5FYJE 4YQXL 4ONHB 4Y1AD 2FBOJ 3IU3A 5EFIB 1YEIL 2IPTL 3BVNA 2LTQB 1A3LL 1KIRA 3SE3C 2BZDA 1HNGA 5C0CE 4LFHG 3JV4A 4L4TA 4JY4B 3QR2A 4PJDF 43CAB 1N0LA 2JB5H 4GG6B 1SVCP 3OJDA 1M71A 4WV1B 1BZ7A 1YEDA 3HRPA 1BVZA 3IGAA 4G7VL 2FH8A 3HPLB 4WHTA 5DK2B 3TT3L 5JOFA 3FN0H 3ZE0E 4ZPVB 2XV6B 1GC1L 4M6NH 5IM7B 3QH3B 2DLHA 3BEWA 4BKLA 3DRQA 3VGFA 5GGRB 3DXAD 1J0YA 3SDXF 1REIA 4LARH 3VXQB 3VFMA 1IE5A 1KBGH 1OCWH 4HXAL 3RGVB 3NH7L 3L9RA 3OKLA 4LEXH 3RIAK 5D70H 1P4LB 3IDXH 3SKNA 2XWBA 1A3RH 4XPHL 3VRIB 5HVWA 3K7UA 2JF1A 2BY3A 4QOKD 2B4CL 5GXBB 5LXGH 4BK4A 1DLHA 2H32A 2E8YA 2J7LA 2A38A 4WO4D 3DRTB 1I8MB 4X9GA 3CDGB 4KKNA 1FNAA 5TE4H 4X7DC 2DLGA 4J3OC 3GI8L 2X9WA 1ACYH 2CQVA 3D0LA 1JGLL 1RZKL 4XMLL 4XVSH 3BN9C 5LWYH 4QRQB 2Q20A 4GKOA 4CRPA 5KSUA 1LD9A 4NPYA 2OBGA 4Z7VF 1GGBH 3QXWA 5JIIA 2Q8AH 1C08B 3WKML 1JMZA 3WDJA 5F21B 1VACA 5F96L 3TBWB 4DN4H 1ZAGA 2B1HH 3QHTC 3TPUA 1UJ3C 1LO0L 5GGTH 5EC2A 3MRIA 2EIZA 3MNWA 2OZ4L 5FYJL 4JRYA 4MD4A 5T1MB 4JFEA 4LLUB 1J8HA 5I8EA 2VL4A 4OKVA 5D2LF 4QRPD 1RIHH 2R4RH 3Q2CA 4YZFE 5ABDE 1QRNB 1CLYL 5FO9B 1CVRA 3QEUA 5E8EA 1T20A 3MV7A 4FA8A 3VD9A 1F8TL 4XP6L 4RX4D 2F15A 4HC1A 4DK6A 1XF4A 4QRTB 4Z76A 4N5ED 1PD6A 4HIIB 3SN6N 5EOTB 3S7GA 5D72H 3MMEB 4RMVA 1YN6B 5GGVH 2XPGA 3BX7C 3W9DB 3VXOA 2Y5EA 4POYA 1IC7H 4X6FB 4DW2H 1Q9OB 4J6RL 4P3WA 1U3HD 2LABA 5F72S 4Y4HB 2PUQT 1L9NA 2ADFL 3ECBA 4JO3L 4LSVL 4CJ1A 5IB5A 5IGXL 4OLUH 2LAGB 4G7YL 4P2OB 4K3EH 1AQDA 1N64L 4RISL 4Z0BL 3ZKMC 4MNQD 1MVFA 2UYLA 4AH2A 1T2JA 2RCSH 4HKXA 2VDRL 3MRQB 1U8HB 4ONGH 4U33A 4L8SB 1P4BL 3CSBA 4FQXB 1A22B 3GSWB 3PV6B 3WIFB 3AM8C 4YPJA 1HDMA 4KH2A 3PWPE 3A67L 3GSNB 5CP7B 5KTEL 5E94B 3VFWA 1MIMH 2IALB 2D7PA 3I75A 5CJQL 3RNQB 1ZOXA 4JFXA 4JREB 5H37G 2Q1EA 4X7SH 1AD9B 4OCSH 1GGTA 3MOBH 4NNXA 1MJ7H 3T2QA 3O3DA 2W9DL 1HH6B 3S34L 4IRJA 5KVDL 1QQDB 5EBMB 4HUVB 5GS1C 2WP3T 1S78C 2CIKA 1X5FA 1G7QB 1J05B 3DTXB 1FVCA 4MZ3A 3R1GH 2YUZA 4K8RH 5IKCA 2DDQH 3QXAA 4FQIL 3VI4F 2FJFA 3O45B 5BZWA 2IBBA 3HE7C 5EU7C 1BAFL 3RWJB 3TP4A 4L29A 3UTTB 5HVGB 3CFKA 3UZQA 2YD6A 4NRYB 3PWNA 4NC2B 1K6QH 3HAEA 3LKNA 2R0LL 1DQJA 2GJZA 3O6FD 1T1ZB 3QNXA 4R7DB 2BNRE 1YYLH 2VLRA 2FO4A 2NY4C 3HNTL 5I1KL 2ZPKH 3LQZB 4WFGE 4R96B 3EYOA 5E1AB 5D1QB 4DKDC 4PJIE 1NH6A 5C09B 4PFEA 1WZKA 3BQUA 1A7OL 2R0KL 3DOSA 2J4WL 3HMXH 3MRMB 3C9NB 4HH9A 3KPLB 5E9DA 4FFYL 1FFOB 1JZ5A 2P43B 1R3HB 2VQ1A 3QDMA 1FP5A 2DWDB 1O7VA 2NW2B 4UT7H 1IM3B 4N8PA 2ESVD 2VISA 4JKPL 1ZEAL 1DL7L 1P6AB 4GUPB 1RUKL 2XZAH 3PWJB 4Y16A 3RTQD 3TN0C 4R9HA 1CFSB 2E9BA 2B4CC 5DUBB 1LO3L 2L7UA 1CFNA 5AZEL 5CJOH 4ZFZA 5GS0D 1I3RB 5F1IB 3KVQA 1BF2A 4MJIA 4LVHB 3FO2B 4GW1A 5ISZB 2VLKD 4HZAA 4D2NA 3H42L 1NC4B 3C2AL 4OFYD 4Z8FH 1XGYL 4CU7A 3VGAC 3O3EA 1M05B 1UXWB 3LEXA 3CVIL 3VGDA 1JWMB 4Q97A 2FJHB 3RVWD 1S7WA 1WBYB 2FHCA 2CIIA 1MFBL 3BP4B 4PYHA 5J1AA 2Q7NA 4XPGH 3QJHA 1H8NA 4OCWL 5ESVB 1F11B 4U2ZA 4LKXB 4KQ4L 3WO4B 2PYED 1VPOL 4MX7A 3PJSA 3ULVC 3K4DA 4ERSH 4L4VB 3AREA 4I9WE 3TNNB 3FRUA 4PJAE 3ZDYF 1EXUB 3FQRB 1HILB 2CDFA 1NMAL 4XH2A 3TO4C 1RJZA 2DMCA 5IESL 3MV9B 3LIZH 3JUYA 4U2YA 2B2XH 2BSTA 2EDRA 3C5ZA 1FC1A 3L3IA 2FEEL 4GLRH 4HX1A 2Z91B 1NANI 4JO4H 4JG1L 4Y5VA 3O6LL 4PTTB 5DRZA 2XTJE 1FORL 4Q6IB 4HWBA 3UJJL 3UJIL 1RZ7L 4YC2C 1B0RA 1VGEH 5EZJA 3K1KC 4UQ3B 3ZYZA 3V6ZB 1I1AC 2GTWA 1YEFL 4PJ7F 5DD6A 4Z0XB 1LK2B 3WS6A 3C6SB 2H1PH 5DTFA 5GJTL 4OI9A 1R3JB 2EE6A 1Q0XL 3D3VE 3VD3A 5IIEB 1UZ8A 1A6WH 4ZFGL 1DTUA 4NKIH 5D1XB 1UACH 1FL5A 4Y8AA 1L4IA 5H94A 3U30B 4R2GC 4JJ5B 5I1EL 4IBLT 5FYLH 3QEHB 2EYSA 5I19H 4DN3L 4P9HH 4E41A 1I1CA 1FL6A 4N8CH 4RCAA 4OCRH 1Q9KB 5T3XE 5ICYB 5C2BL 3SDYH 1GZPB 1D6EB 2CLVB 1JGDB 2VABA 4XXDA 1RUAL 5T1LB 1WCBA 3LRHA 2XN9D 1MCCA 3MLPA 3BIBX 5L8JB 1YDPA 1U8NA 5ENWA 1IKNC 3HUJE 4UILL 1N0XH 2DB8A 4LGRB 4UQ2B 5D4QA 3UJTH 4Q9QH 5GHWH 3O9WA 5H37H 1R24A 1X5KA 4OZFB 4PBVC 4HJJL 1FNSL 4F9PC 1EFQA 1PSKL 4DGYH 4H1LG 4ZYKA 3BW9B 1CZ8L 3WS3B 5CMAA 1JGUH 4HBCH 2BNRD 3T0EA 2IEPA 3DARA 3V6FB 2P24B 1S8DB 5EDXA 3V52L 5J1TC 1QKZL 4TUJB 5JOPD 5SX4H 5J1SC 4NZTL 2F54D 4Z7WF 2VR4A 5I73B 3LMJL 3CXDH 1A7NH 1MEXL 4WHYG 2FWOB 4DZ8B 5B21A 3SCMA 3WHXA 5CBAB 3BDYL 3AS1A 2QADB 3OXRB 5EC1A 5D1ZB 2EIBA 2F58H 3DLQR 4LVNB 2ZCLL 1UB5A 2XI9A 1I1RA 4P23D 1F6AB 5IBTH 5TJWK 5HPMB 3DWTA 3UPRA 1ORSA 4DKEH 2V5SA 3CSYB 3WJLC 3RNKB 2VLJE 3IJYA 4HGKC 3QQ4A 2MWCA 4PRBB 3X12B 1IQWL 2YD5A 3H0TB 4X8JB 3TZVA 4FZ8H 1GAFL 3F12B 3C60D 5KJRH 3PNWA 1KFAH 2H8PB 2I07A 3VWKD 1OHQA 4KJPD 2P8PA 1K5NB 1OARH 4JZOB 1MOEA 1NCDL 3L6FA 3QUYA 1DE4B 4PJFE 3UTZB 2JLLA 4PG9B 3Q6GL 1QEWA 2VDQH 4YHOH 5GGSB 2XY1A 2CUIA 1QSFD 4KJYB 5INCB 3WV0A 4FFZH 4G6MH 5SWZA 3S5LG 5BMFL 2XWJB 3N50A 4P4KD 5AZ2L 4EI5C 4PY7B 5BCAA 3R0NA 3ZMRA 3IFLL 1IAIL 4MA7L 1NMCB 2V2WA 5T3XL 1V7ML 1JPFA 1CBVH 3T3PE 2AI0L 4U6VL 1S5HA 4HCRA 2F19H 4TTDD 3VI3E 2C3VB 3TA3D 5IVXF 2EXWD 5C08B 1CXLA 3WKNA 4NQCE 1PZ5A 3WNOA 3GO1L 5JXAL 4YHNA 4PRPD 4NZUH 1OSZB 3RY5A 2NY6D 1F3DJ 3RWEB 1M7DB 4S1RL 3SJVD 2X41A 3ULUL 3LRGA 1XR8A 4BZ1H 4XCCL 3TVMC 5KSVA 4YXLH 3MCLL 2AKRA 4XC1L 5DRWB 1EHXA 1OP5H 1UM6L 2VYRE 1MI5A 1I9JH 4YHKL 2FX9H 3CUPA 3G6JF 1OL0A 1XGUA 3BPCB 2I9TA 5ANMB 2P8MB 4IIQA 1QVOB 5HHNA 4FP8L 2PCPA 3IU4H 5FYJU 2VO5A 3ARFD 5EU6D 5F7YC 2CGRL 4Z95H 4CJ0A 3WXWH 3SDCC 3NCYS 1YPZA 3OBAA 1QFUL 2F53D 4PJCF 3D2UB 3GMOB 1RUML 2BDNH 4PB0L 3BP5A 4HIJB 2L0DA 4P59L 4YHPA 5I8OH 3O2WL 3VXPB 3DIFA 1R3LA 1XF3B 3T2PA 4UT9L 1TZHA 2VN7A 4N0UE 3RL2B 3UTSD 4CADA 3LQAH 1CGYA 1KCVH 3P9LB 5EWIH 3QFDB 1KCRL 3AY4C 3VFOB 2H3NB 3I50H 5EU3B 3VXUE 3FMGH 5T5NF 1B6UA 1YMME 5F1KC 1XGPB 4FMKA 3OF6A 3HRZA 1FV1B 5IHUH 1RJYA 2R29L 5CLWA 1JTPA 4YDLB 3EFDH 2JJSC 3GMPB 2XKNB 3HNSL 2YA0A 5JTWA 4R26L 2X4QB 3LZFH 3ZE1E 1CD1B 2PR4H 5DQ9A 4NHCH 4PREA 4LLWA 3T4YB 4J3WA 1MWAA 1KV3A 5MHSE 3GIVA 1QO3B 3HS0B 4OJFL 1K4CA 3MSPA 4LP5A 1JF5A 3MV8A 1MCHA 5SWSD 4LRIA 2ICWA 4ODUA 4RGOL 4U6YB 5JLZB 3SGJA 1TPXC 4LSTH 1SEQH 3D18A 1JJUA 3S35L 1IC4H 1JHLH 4S2SB 2B8OT 3K8MA 2KQMA 3DURA 4WO4A 4OZFH 3NAAL 5C0IA 4F37F 3P4MA 1UH4A 2R0ZH 4XNMA 2DAVA 4JO1H 5J89A 1VFUA 4HJGB 3SDAC 4OIBA 3S36H 1CFTB 5IJVA 1OAYL 1S7SB 5J11C 3OKDA 1F90H 3P4OB 1UWEH 4JRWA 1DFBH 3QO0B 1OSPL 4XI5D 4TYUA 1WLHA 1NFIA 2VLJD 1WWWX 2FIRT 4K9EL 3OKKB 1OP3K 1JPTH 4OTXH 3U0WL 4M8VA 3G5ZB 5CZXC 5DJ0A 4WHYH 2WW8A 4K7PH 2FX8L 3HI1A 4KUCF 4W4NA 5D7JC 3EYVA 4PP2A 3LH2H 2NY2B 4JY5H 1U2HA 3BO8A 1F42A 3FO1B 5KS9E 3TT1H 2YMXL 1WZMA 1H3PH 3ARTA 4MA3A 4XVUC 3AAZB 4Q9RH 3JV6A 4N8VB 4G8EB 5LKNA 32C2B 1DZBA 4FTVB 3RDTB 3LAFA 1NAMA 4KAQL 1LK3L 3HC0B 4KHXL 4XBGB 1KB5H 2HVJB 3G04A 3E6HB 5CIPH 1NGPL 3I6GA 1S7XB 4P46B 3G5YB 5GGQL 4QRPA 4OBRA 3RPIB 1CICD 3VFRA 1JUFA 1OGTA 2J3SA 4NUGL 3KYKL 1HN1A 4NWTL 4K23L 3RJQB 2NY3B 1YYMH 5FUCC 5B22A 1QSEB 3TBYA 5CWSA 1J8KA 2VTFA 4XCNB 3BZEA 1UFUA 4M1DH 4UZGA 4WVRA 5IEKA 1EHLH 1UJTA 1NGZB 3FZUD 3RY6C 1T5XB 3VXTB 4KGJA 3O3AA 1MQ8A 5IMKA 3LD8C 1U3HA 1OPGH 4LHJB 2NX5E 1FGVH 1A7QL 4ZTOL 3MRHB 3R4DA 1CGVA 3TFKD 2GY7B 5K33A 3MRKB 4BSWA 3N1FC 5AAWA 4GFTB 5IB3B 4S10A 4POZD 2OSLB 4EOWH 3ULUC 4JFPA 1YY8A 3KLHC 4JGJA 4XX1E 4OZHA 4HWEH 2P8LB 1T5WA 4JCMA 4YNYB 2A74A 5DK3A 1J11A 3PDOA 3MJ8A 1OW0C 1KC5L 4Q2ZB 3F6LA 1BVKA 3U79A 2VR9A 4KTDH 4IHOA 3AS3A 5MEPA 1CVSC 3QWOB 2PXYC 3T0AA 1IAOB 3BOVA 2NXZD 2HFEA 1A6TA 3L3JA 1JWSA 8CGTA 4M93B 5ESAB 3IDNA 1PBYA 1G9NC 5C0CA 1ODAA 5DSCB 1G7LB 1JV5B 1NGXB 4LVEA 4OLYH 1ZLVH 4YWGL 2DM7A 2Z8WC 4KI5D 1S9XA 2ZJSL 5HGBA 5DDHA 1JF1B 1IVLA 4MA1B 3HI5L 3QUZC 4G6FB 1ORQA 5L0QB 3KR3H 2R2HB 1PY4A 4WWKC 2Z31B 4IJ3B 1AGDA 4U1NB 1MLBA 1ZVSB 3LY6A 4DZBB 1LE9A 1AXSA 4H0HB 5JPNA 2IPUG 4UINL 4KMQA 2WBWB 4TVSa 2B1AH 4JFDE 4QRUB 1ND0A 4LLQB 5KG9B 1AXTH 3FAWA 3REWB 4NQXB 1T4KA 1WTLA 5GIRA 4MJ6B 3SOBH 4AIZB 2GSIA 3QIUA 1BFVH 2OR9H 4Y2OA 3K2MC 3IDIB 5IMOA 2NXYC 2CKBH 2YK1L 3EGSB 3PP3H 4L3CB 2Q8BH 3VWJB 2ESVA 4MAYA 1CDYA 4NNYA 3SKUD 5EU5A 5JDSA 1YQVL 3MRDB 1HH9B 3CXHK 3J8F7 2KPNA 1TLKA 4YGAB 2E6PA 1WC7B 4NN5B 3L5HA 2YD8A 3ARBD 4KI5F 4WDIB 5BRZB 1B2WL 3H7BA 4MWFA 5EBWB 3TNMB 2B0SH 3PGCA 2MQ3A 4IRZH 1KPVA 2VE6B 1BM3H 1CU4H 5E4EC 2W59A 3CZJA 5HY9B 3L95B 4YHIA 1B6DA 2Z0BA 3SGEI 4Y5XC 4UU9A 5JPMA 3C6LD 3GBML 1A4JA 1KIQA 3O8XC 1T7VA 1Q9WA 3BVNB 5GS0H 4HZLA 1KIRB 4CMHB 2D7QA 4NRXB 4U1MB 3K74B 3CU7A 4F8QA 3JV4B 4PRHE 4L4TB 2OMNA 1CDIA 3KPRE 1TJIL 1RIVL 1UKTA 5CZVL 2KL6A 3ZYJA 1P7QA 3OJDB 1M71B 1BZ7B 1YEDB 1AI1H 3DO3A 3IGAB 3VXME 35C8L 5T5NG 4Z7UF 5JOFB 1IGML 1UYWH 1MFCH 4Q6YA 4C83A 4LCYA 4NC0B 3BEWB 4BKLB 3DRQB 3MA7A 3FB5A 4OLWH 5C7XL 3SPVA 4YR6A 3MJ9L 3VFMB 2BOBA 2ZOLA 5DHXB 3ARYA 2WUBL 3L9RB 3OKLB 1FZMA 2O5YL 3SKNB 5LGJA 1FC2D 2XWBB 4N90E 1KLFA 2Y5TA 1IILE 4NN7B 1X6NA 1NEZG 3GMLA 15C8H 3FT3A 4P5KA 3VGEA 1AJ7L 1DLHB 2H32B 5D7LD 4KKCD 1BQSA 3QB7C 2VDLL 3KJ6H 4D9LL 3FQUB 1CLCA 3UPCA 1L6XA 1JFQL 2VXQL 3H9ZA 4ZOCA 4ODWA 3NGBC 3D0LB 3MO1A 2IFFH 3DJ9A 1D9KC 4WU7A 4R97B 3VMNA 2VSDA 1YUHA 1ZS8A 4KY1L 2AXHA 3P11L 5MENE 5KSUB 1LD9B 1D6VH 4NPYB 5L9DH 2GTZA 3MCKA 1HKLH 2ED8A 2PETA 2FX7H 4JQXA 4BJLA 4U6HA 5FUOH 4YK4C 1VACB 4NZJA 5MERA 1IFHL 3C5SA 3RHWF 4XP5H 3NOIA 4LSSH 3SO5A 4TOYH 2M26A 3QUMH 3TPUB 1ITCA 2VZ1A 4AT6A 5EC2B 4LCCA 3MRIB 2EIZB 3MNWB 1AGEA 4JRYB 4MD4B 4EN3C 1RU9L 5JOEA 4JFEB 4XVTL 1J8HB 3QRGH 5I8EB 4OKVB 3V4VL 3HPJA 4XHQA 4ZO6A 3QEUB 1NCCH 5E8EB 4XNZB 1Q1JL 1T20B 3MV7B 4M7LT 4ZS7H 2X7LA 2EC9T 4P5MA 3UO1L 5KN5A 2F8XC 3BPOC 2BNRA 4FMFA 1XF4B 4Z76B 3V5DA 4IDJL 1DBJL 3RZCA 2FZ3A 4PB9H 4ODSH 2OI9C 4BSVA 1XGRA 3FOLA 4PJIA 4M5ZL 4NQVA 5HYSA 5HHVH 3VXOB 1N3NA 4WW2C 3T65A 4OFDA 1NCBL 4KDTC 1YEGL 1T83C 3BMWA 1JK8A 3RAJL 5ACZA 3BN9D 3RKDC 5DLML 4QXGL 5J9PA 4PGDA 5IB5B 4U7SA 1TJGL 3I84A 3Q48A 4IRSA 3VG0L 4K2UH 2HLFC 3RX8A 3GRWH 3V4UL 4KGLA 4RMUA 3T09A 3ARGC 4AH2B 2UYLB 3BPNC 4TSBL 1IGIL 3MV11 4HKXB 4MVBC 3VWKA 1A1OA 1TVHA 4M1CC 5CILH 1HDMB 2D0FA 3G6JA 3WIIH 4XP1H 3VFWB 3FHAA 3MLSH 4NHUA 1QSFA 2G60H 3I75B 1RJLA 2KZWA 4JFXB 3L1OH 1NFDE 4P4KA 1HK6A 5D5ME 3A6BH 3UTPD 5KANG 4NNXB 3O3DB 4KVNL 4M3JA 1NDMA 3DYMA 2VDKH 1CWVA 4RGMB 4IRJB 2FCBA 1L0YA 2CIKB 5IT2L 1FVCB 4HKBA 1UWXK 4ENEC 5IKCB 3Q5TA 4DVRL 2CMRH 1A6PA 4ZDHA 1PKOA 3QXAB 5E99L 1N5YL 2FJFB 4RWYL 3CXHJ 5BZWB 2AJ3A 3OPZH 4WFFE 3QZWG 5TF1H 5C6WH 5I8KL 3QQ3A 5HYJD 4L29B 5T33L 4Z9KB 3CFKB 1T03H 2NY1C 3PWNB 1KXTB 3HAEB 3LKNB 5CGMA 4PRDA 4PJAA 3C87A 1D5BA 1DQJB 2GJZB 2ICCA 4XP9L 5HHMD 3QNXB 2RIKA 1NL0L 1OT2A 3D39D 2VLRB 3H9SE 2FO4B 1L7TH 1R5VA 2H41A 1D5MA 4RFOH 3ZKMD 2OS7A 3EYOB 3MXVH 4WEUD 4C59B 2VDPL 5JXEC 5BOZG 3VFGH 2BERA 3FTGA 1GPOH 3BQUB 1WZLA 2QKIA 4HH9B 2W0PA 2XZCH 5E9DB 3WFHA 2Y07L 4MQTB 1DUYA 3ARFA 5GGRY 2VQ1B 1Z6JT 3QDMB 3OG6B 5FA4A 3S37X 1UM4H 2W07A 3NTCH 2J2ZA 2VISB 3D3VA 1G1YA 1YC7A 4OCXH 4L5FH 4Y16B 4OUOA 3U1SH 3IF1A 2DKUA 1CFNB 1SY6A 3HE7D 4GMSL 4PLKC 4ZFZB 3GUTA 1OWRM 4JPVH 3K0WA 3FRPA 3UTSA 1FZJA 1N2RA 2EEAA 5DD3H 4KTYA 5I66B 4MJIB 2CUMA 3N85H 2C4FU 4GW1B 4MQXD 4X9FA 1X7QA 1WV7T 3CMOL 3KPOA 5ELIA 4I0KA 4APQC 1C5DA 1FH5L 3O3EB 3LEXB 1S7WB 2CIIB 5D8JH 1LDPL 3HUJA 5D2NE 2NY4D 4R8WH 3A6OA 4M03A 1J0IA 1NLBH 3QDJE 4KDWA 5J1AB 5F89A 3WN5C 2GK2A 1KJ2A 3EIFA 3QJHB 1CXHA 3TLRA 3TIEA 2LQRA 5D7IF 4U31A 1IJ9A 1JNLH 1AQKL 2P42B 4KC3B 2Z92A 2HFTA 1MPAH 3VG9B 4MX7B 1MCRA 3PJSB 3F7RA 3G5XA 3AREB 4I48A 2COQA 3IXTA 1KCLA 4PS4H 2ZOKA 2Y7QA 4YHMH 1WWCA 2CDFB 3QFJD 5HGDA 4M9PA 4XH2B 1RJZB 1RMFH 2VITA 1U3YA 4JZJA 2WANA 2BC4A 3OAYK 2BSTB 3C5ZB 3TN0D 3UMTA 3NFNA 1K8IA 3CNKA 3L3IB 1CXIA 4HX1B 4JHAH 4Y5VB 1OTTC 2EE2A 5DRZB 5C0BE 5F9WB 3NIFE 3ZE2E 3FQTA 2A1WL 4TSCL 4PGEA 3MLWL 1B0RB 1G7PA 5EZJB 2VLJA 5B38G 4M62L 4JFFD 4FQCL 1AY1L 2VXVH 2GTWB 5DD6B 3UC0H 1FE8H 4LLAA 5DTFB 1A7RL 2AK4E 3P9MA 5IEHA 1MFNA 1U8PA 1UZ8B 1GHFH 3F62A 2JTDA 1FL5B 5H94B 4TNVF 5SX5H 2PW1A 1S7RA 1Q94A 5C0AE 4OM1H 4EBQL 3DSNA 5B39G 2EYSB 3WFEH 4E41B 2OP4L 1FL6B 1OVZA 4PJ9C 1PLGL 3ULVD 5E2WL 1URLA 4ZTPL 4G8FA 5LQBL 1W8OA 4MJ5A 5C70A 2BVUA 2VABB 4XXDB 3ZDZF 1WCBB 5H8DA 4M00A 1D5IL 4NKQB 3QAZC 3AMLA 1IBGL 1ZANL 1YDPB 3TO4D 1U8NB 5ENWB 3B3IA 3KLAA 4NQCA 1EVTC 1XGTA 3V6OC 5IWLC 3O9WB 1MAKA 3UTTE 1FNGB 2VL5A 4PJGF 1R24B 3KWWA 3Q1SH 3MBXH 3GMRA 2ZUXA 3IRPX 4PRID 4ZYKB 1AHWA 4NDMA 1SJEA 4H8WH 1MCNA 5FGCB 4XC3L 4A2MA 5DC4B 3T0EB 3FO0H 1I1AD 3KLDA 2GUOA 4DEPC 3M8OH 5D6DC 1VHPA 2VKXA 4WHDA 5I1DA 3CFIC 4L1HA 4O2CA 3T1FA 1MFAL 5C09E 4B50A 3OGOE 3SCMB 1Z9LA 1MVUA 3WHXB 5AYUH 3NIDF 5EC1B 4R2GD 2HH0H 1ADQH 2ITCA 2PYFA 4I2XE 2YD9A 1UB5B 3PV7A 4GAFB 2D7NA 4UT6L 4JRXD 4NP4L 2YUWA 3UPRB 1ORSB 4HWNA 3IJYB 5B8CC 5B3NA 3QQ4B 5IVOA 3L5XH 3TZVB 1G7IA 1FO0H 5D96C 3WSQL 4NBYB 3VE0A 5HYFA 4JM4H 2I07B 2FLBT 1JF6A 4Y4FC 3ZKXB 2P8PB 2DQEL 3MRRA 5L88H 5JIKA 4N0UA 3L6FB 3QUYB 4BFGA 5I18L 1BREA 2HT3C 2FYYB 2XACC 2D4FA 4YJZL 4U1LA 1QEWB 2YZ1A 1BIHA 4MB4A 4DUXA 3VXUA 5SWZB 1YMMA 3DSFL 1YECH 1HZHL 4K71B 1HQ4A 2BNQD 4PJXE 3SBWA 3EHBC 2V2WB 1JPFB 1V05A 5LAXA 4AM0A 4K94C 5DMGC 1S5HB 4OLZH 3NPSC 4JR9H 3JWDH 2EH7L 3FB8A 2EO1A 3RUGE 1I85C 1NGQL 4MZ2A 3WIHA 5BV7B 2OK0H 1PZ5B 4OF6A 1XMWA 2IQ9H 2V7HA 4YHNB 1HINL 1S3KL 1RY7B 3M17A 4AL8L 3K4AA 1IT9L 3GNMH 4J4PC 1C1EL 4Q58C 1AGBA 2FEDC 3X3FL 3F8UB 2R9HC 4C58B 1XR8B 2R1WA 3MBEA 3MLXL 3MV9E 1S5IH 1T7ZA 5KSVB 5JHDD 3OHXA 2AKRB 5KVEL 5GS3A 1MI5B 4WV1C 1WITA 5KW9L 4XPTL 3CUPB 1A1NA 1BECA 3D85A 1F5WA 4QNPE 1Q72H 1XGUB 1LILA 2I9TB 2L4OA 4GO6B 5HHNB 5C0GA 1MCEA 3UDWC 2PCPB 4TSAL 5E6ZA 2XZQL 2V5YA 1AKJA 1XGQA 5TQ0L 1FJ1A 3PQYD 4HSQA 4ZPTA 4EI5D 1YPZB 3ARBA 1EFXD 1CIUA 3BD5A 4YBQC 1S9KC 3OXSA 3PGDA 5F9DC 2YS4A 1O0VA 1UH2A 3BP5B 4ELMF 4LPTA 1A14H 5KS9A 4YHPB 2XQBH 3DIFB 1R3LB 3EDFA 4YZFF 1TZHB 3C6LA 5LG1A 4CADB 5GJSL 3TH4T 3O2DH 4O9HH 3MRFA 1CE1H 4NN6B 4G43A 4NC1E 4MLIA 5ECJE 5GQBA 2ADIA 4Q7DA 5AEAA 5CGTA 4GW4A 3TV3L 1T7WA 3FFDA 3HRZB 3BUTA 3V4PL 1RJYB 2R1XA 4Y5YA 3TVMD 3QDGE 3ARDA 1KENH 1RVFL 3E1F1 5DQ9B 2DLEA 4PREB 4LLWB 4ZOAA 5TE7H 4CU6A 4G9FE 3BAEH 4ZUWA 2XRAL 5I6XB 3GSVA 2NY0D 3GIVB 4XP4H 4GBXC 1K4CB 4NGHL 3MLVH 3MV8B 2NX5A 2ICWB 4M02A 4ODUB 5DFWH 2APBA 3SDCD 4RMTA 2ENYA 3B5TA 5EZLA 4OLXL 4XCFH 2YOCA 5J12B 3UYRH 4NQEE 5C07B 3D18B 5GISL 5CD5C 1D5ZA 3HA0A 3O41B 3VFPA 5BS0D 3WJJA 3DURB 4WO4B 5HI3C 5C0IB 3VXSE 3P4MB 4XNMB 4HG4K 1IKFL 3MJ6A 4Y4KB 1OGAD 3VW3H 2XQYK 3DVNA 3N1MC 5T3ZE 5IJVB 1EUTA 4HXBH 3OKDB 4RFNC 4TULH 1NFIB 2N7BA 4ODVL 4QF1A 3EZJB 2DM4A 2LAAA 2MPAH 5DJ0B 3P0GB 2VH5L 1IEBA 3HI1B 3U9UA 3TBVA 1JMXA 2HJKA 3EYVB 3THML 4PLJC 12E8L 2EEBA 3MA9H 4PP2B 3NIGF 4U49A 4HPOH 1Z3GH 4Y4HC 5TGBB 3BO8B 4OD3L 2XKSA 4MA3B 3BGFB 4P2OC 3DBXA 3JV6B 5HDOA 1FDLL 3DX8A 2OYPA 5CD3A 3I02A 1AE6L 5LGKA 4ZUVA 3WYRA 3G04B 2FO1A 5C0RH 3I6GB 5HHXL 4L8SC 4R90H 2DQDL 3GK8L 4FQXC 4QRPB 5FOBA 3O3UN 4X6CF 2A0LC 2FLRT 4Z78A 2LU7A 5GGSY 1WT5A 3R8QA 3EO9L 5E7BA 3VFRB 1JUFB 1AFVL 1OGTB 2X6MA 5DGRA 3QXTA 5EOCJ 1E6JH 3GJEB 2V17L 2VLME 3LEYL 5C08E 2AJXL 1YMHA 3TBYB 5CWSB 4C55A 2MQCA 1PEWA 3BZEB 3BJLA 3MLRL 4LPXA 2FD6L 5AWNL 4MGXA 5IEKB 4JFDA 4KFZC 5HHOD 5TQ2H 3KPMB 3NBNA 4L8BA 3AGVA 3SDAD 5EA0H 3ZL4H 4W4OC 3O3AB 5IMKB 3ZTJG 1X6LA 5K93A 4OGZA 4PIRF 5CZXD 5A1AA 3MREA 5KVFL 4RQQA 1LE5A 3HCVA 4BYHA 1KIUA 3FOMA 5D7JD 1KYOK 3OX8A 4LPWA 1C5BH 4JFPB 1YY8B 5ANME 5FUZL 4OZHB 1GOFA 5D93B 2AJSH 4XVUD 4AENA 1AR1C 2IF7A 1KNOA 1JTOA 1VFBA 1KCSH 1T5WB 2W65A 4MD0A 1JNJA 3JTTA 2A74B 5IK3B 3PDOB 3MJ8B 3F58L 1FPTH 4OZIE 4X4ME 1BVKB 4GRWB 5IB2A 5JIPA 4EJ1C 5B3JE 4C56E 4IHOB 5MEPB 4WEBL 2VAAA 4OZGA 2ZSWA 3ISWA 2HFEB 1A6TB 3W39A 1YNLL 1W2KT 3L3JB 1JWSB 5KSBA 4LRNL 4YHYB 2BVOA 3QISA 3IDNB 1K8DA 4K3GA 5C0CB 1KTLA 4B53A 2WBKA 5HYJA 3C8HA 5DJCA 2KBGA 4KZDH 2OL3H 1S9XB 5HGBB 1QHPA 4G3YL 2R8SH 5DDHB 3PIQA 4JN1H 4HLZG 3ZTNH 4ACPA 3RQ3A 1ORQB 4FQ1L 4LVHC 4BH8B 8FABA 3AB0B 4WTXA 1LVEA 3NABH 1MLBB 1J9CT 2DLTA 1TVDA 1LE9B 1AXSB 1KLGA 2OTWA 4LIQE 4R4BB 5JPNB 1BFSA 4U6XA 3OG4B 2D7MA 1ND0B 4OSUH 3HE6A 3ARRA 2H2PC 1E4JA 1CCZA 1INDH 1KIPA 1T4KB 3DX7A 2VZSA 2HFFA 5GIRB 3T1WA 4BELD 4FFVC 1FVDB 4KU1A 4A6YH 3WO4C 1WUNT 2GSIB 3QIUB 4R4FH 2DQIL 2EH8L 1DBKH 4XWGH 3L3GA 4LCWD 2ESVB 2PXYD 4MAYB 4PJ5D 5I9QB 2DKSA 4YDIH 4NNYB 1EHNA 3RU8L 4X7EC 4FQJL 5EU5B 5JDSB 5T3ZD 3QPQC 1CE6A 3EYSH 5ILTH 4HV8A 1E4XL 1KG0A 4O00A 3PF2A 1NGYB 1MCKA 2I9LA 5MENA 4JFZL 1MCLA 3H7BB 4MWFB 1KEGL 3PGCB 1KPVB 4HFUL 7FABH 3QEQD 3OGCA 4Q6IC 2Y6SC 1A9BA 2EC8A 3QUZD 4YHIB 4ZG1A 4LASL 1MCFA 4LOUC 4WWKD 1EH9A 3G5VA 1VENA 4UU9B 5JPMB 4FTVE 4HG4J 2E9JA 3ULUF 1E4KC 1A4JB 1E4WL 1KIQB 2ZCKL 1T7XA 1BEYH 1Q9WB 4HZLB 3OWEA 4MJ2A 4I18A 1OQOA 4H88L 5D1XC 2EDFA 3KXFD 1X5GA 3QEGL 4YO0A 3U30C 1VA9A 1P7QB 3NCCB 4P2QE 1YEIH 2IPTH 4WFHE 1A3LH 2ZUVA 4JLRA 3MRNA 2NXYD 5IBLC 3T0XA 5IJKA 5HVHC 3DI3B 4IM8A 4C83B 4LCYB 3JTSA 3MA7B 2AEPL 1GOHA 3FB5B 2IH3B 4YPGA 2IAMD 3BI9X 2YPLD 4LIQL 3SPVB 4YR6B 5F9JA 2BOBB 2ZOLB 4KTEH 2YHGA 2IGFL 1FZMB 3QT2A 5LGJB 1ZE3C 4MXQC 5E5UB 1T1WA 2Y5TB 1TQCB 1UCTA 4F7TA 3FT3B 4P5KB 2ZUTA 3NH7H 5FGSA 3BT2L 3C8DA 1FGNL 3FT2A 1XIWA 5JHLL 5DEZA 4XMKL 2G5BA 3ZTJH 1G6RL 3O8XD 3IVKA 4ODWB 2B4CH 5I73C 4G9DA 3MO1B 4MNHA 1U36A 4JKKA 4WU7B 2ED9A 1KCUH 1NFDA 5D5MA 5ETUA 2QADC 4C56D 2GTZB 2H6PA 3MCKB 4MA8H 5IFJA 4LVNC 1KULA 1KYOJ 5FGRA 4JQIH 4U6HB 3I6LE 5KOVC 1JGLH 5DURB 1RZKH 4XMLH 5A2KH 5MERB 3C5SB 3ESVF 3TO4A 3B6SA 4JM2A 4URTB 4AT6B 2JIXA 3U4BL 4LCCB 1J0ZA 1AGEB 2VJXA 1X5AA 4EKXA 4PJBF 2PTTA 1MHEA 1PG7L 5F96H 4M6OH 4N0CC 3HPJB 2AABH 2GK0A 2CDEA 2DD8H 4PRIA 1LO0H 2XXCB 5JW5A 2HA1A 4AEIL 2DQHL 2X7LB 1JZ3A 4P5MB 5KN5B 4QCIA 2BNRB 2AJZA 2OZ4H 5I74B 3H9SA 4JEGB 3V5DB 3RZCB 5BXFA 4YE4L 4BSVB 1XGRB 1J1OL 3QPXH 5TDOA 3FOLB 4PJIB 4NQVB 5HYSB 1F8TH 1N3NB 4XP6H 3KPTA 1QHOA 1UVQA 3RWCA 3T65B 1QLEL 2UWEF 2YRPA 1B4JL 3DETC 3KPNA 3HNVL 4HLZH 4D0BA 4WCYL 1JK8B 5ACZB 2B39A 2JELL 2NR6C 5JQHC 2QSTA 3PWLA 5J9PB 4PGDB 5HI4C 4EUPG 4JRXA 1RUPH 4IRSB 3RBGA 5TE6L 2AJVL 3T2NL 2YD3A 3T4AA 3LS4L 1DQQA 2VIRA 4J6RH 5MP6L 2CLZA 1H5BC 4X4XA 3GI9L 3S96A 3S3JA 4I5BA 2FR4A 5J6HA 4LQFL 4LSVH 4JO3H 3VWKB 4CU8A 1A1OB 2X4RA 1KXVC 1TVHB 4Y19D 3ZLQC 4OCNC 3OKNA 3O6MH 2DOCA 1BIIA 1RPQA 4HAGA 3RVXC 4EN3D 1N64H 1V7NL 3U7WL 4FXKA 4NHUB 5BRZE 2AEQL 1QSFB 2DWEA 4GRMA 1RJLB 4RISH 1MFDH 4Z0BH 5DUMH 2NYYD 2VDRH 1QTYT 4P4KB 3X3GL 4MMXC 4NUJA 5IG7A 4EI6B 4G6JL 1CDBA 3H8NA 4GOSA 3RWGA 2EDNA 5DWUL 2HG5A 3IXAA 1WK0A 5I1JH 3HZVB 2MSPA 5DK0A 3VDCA 1DEEA 4M7LL 3QDJA 4HKBB 4MXVE 3PUCA 4KK9C 5CJQH 4ZDHB 4DQOL 4B5EA 4WUUE 2AJ3B 4UTAL 2W9DH 1N4XH 2YSSA 3QQ3B 4WWID 5KVDH 3KYMA 3T3MF 3QCTL 2AQ2A 1ZVHA 3WLBA 1IQDA 4KPHL 4V2CB 2GKIA 2E7LC 3RKDD 4P4RA 3U9PL 1B3JA 1L0XA 4PRDB 4WHCA 4PJAB 4FQIH 1D5BB 4QWWC 5CSBA 1MNUH 2BRRL 4PY8J 4RWHA 4J3TA 3WJLA 2ARWA 2HLFD 1ZHLA 1R5VB 4ZFFA 1D5MB 1JBJA 4JDZA 3ARGD 1FBIH 3MV01 4H20L 2R0LH 1DANT 4MVBD 1MF2H 2KQNA 1X5HA 3PL6A 4YDLC 4D94A 4M1CD 2XTJB 5C0BA 4OFKA 3SKMA 5E4IA 1MHPL 2V9TA 5DRNA 2QKIB 3HNTH 5I1KH 1T7YA 3WFHB 1BZQK 1BQHA 5T5FL 1IM9D 1DUYB 3ARFB 4H26A 4EIGB 2DI8A 4RGNC 1TVBA 2GI7A 3AS2A 4KI1A 4XCEA 5JW4Q 3FQWA 3O81A 3EJZC 4HAFA 4X6DF 3TCXA 1A7OH 2R0KH 2J4WH 2AK4A 3D3VB 4JKLA 2Q3AA 1TNMA 2WINA 1SEBA 4FFYH 4LSQL 4OCLC 4ENED 2X44D 5C0AA 5T1KB 5CEXA 3IF1B 3GUTB 1CXEA 4WW2F 3UTSB 5EO9A 4JKPH 1FZJB 1N2RB 2KKQA 4R7NA 2CK2A 4NOFA 3WNNA 2I26N 2HJLA 3H2WA 2NY1D 1X7QB 3KPOB 1C5DB 1LO3H 5AZEH 3GJFA 5ICZA 4MXWH 2OQJA 3RIAF 4ZMAT 1I4FA 2Q86A 3FFCD 3HUJB 5F89B 4Z77A 1KJ2B 4JRYE 3H42H 4JFEE 2ICEA 3TIEB 1VGKA 3QHZL 1OTUC 1J8HE 4MAUL 4JAMA 3QQ9C 2NY2C 2Z92B 1K4DA 3CVIH 4ONFL 3VRJA 3NFSL 5F7NC 1ZGLP 2EEDA 1MFBH 3GIZL 2IBZX 4LARL 4NKMA 5GRVK 4R3SA 3MOQA 2GJ6D 3G5XB 1OCWL 4I48B 9CGTA 1N6QL 5DRXA 3IXTB 5C8JB 4NJ9H 2ZOKB 4LEXL 2Y7QB 1B0WA 3RWFA 3ARVA 2V7NA 4I13B 1A3RL 5HGDB 4OCWH 1B0GA 3GM8A 4KQ4H 1VPOH 4LAQH 2VITB 3P73A 4JZJB 5LXGL 2BC4B 3D1MC 2QJDA 3NFNB 1K8IB 5BS0A 3MGOA 5TE4L 2XFXA 4H0IA 4I2XA 4JPWL 4PLKD 2HMIC 5IESH 2NY3C 1ACYL 3FQTB 3QUKA 4F33A 5GRZA 4PGEB 3S88H 1EX0A 3GSRA 1FHGA 2DBLL 1G7PB 4MQSB 2VLJB 3BDBA 1EPFA 5GSVB 3R0MA 1ZXQA 3O6LH 4APQD 5E2TL 5EOCL 5DEFA 4MD5B 1FORH 1GGBL 3UJJH 2Q8AL 1RZ7H 5IEHB 1JYVA 1MCPL 3EOTL 1U8PB 4DN4L 4HIHA 2B1HL 4PJFB 2FECI 3UYPA 4F2MA 2PW1B 1S7RB 1Q94B 2VQTA 1YEFH 4FFWC 3X11A 4EUPH 4U6TA 5GJTH 2J6EH 3GGWA 1Q0XH 3IYLW 4G8FB 1I9IL 1RIHL 2R4RL 3S3SA 2CR3A 2I5YL 1JNNL 4MJ5B 5C3TA 4N9OB 1A3QA 3VMOA 2K7QA 4LLVA 3RUGA 3SE8L 3B3IB 3KLAB 5C2BH 4NQCB 5EUOA 1MUJA 4PUBL 5GGVL 2ZUWA 1JHTA 4FQQA 2VL5B 3GBNL 5DQJA 3O4LD 3KWWB 3BP7A 1OTTD 5F6HI 3NCEB 1IC7L 2HJFA 5HHOA 3GMRB 3OAZK 1AHWB 4N0FA 4NDMB 1Z0MA 4PJHA 1SJEB 4IOFC 1ZHBA 2WSKA 5FF6A 2FNBA 4I0PA 1CFVH 2O5XL 5IROC 2JCCE 3T8XA 1FIGH 3NCJL 4Q0XL 4Z7NE 4L9LB 5I1DB 3LPGA 4O2CB 2RCSL 1MVUB 3RP1A 4TVPD 3OKOA 4JO2L 1EMTH 3K1DA 3S4SA 2ITCB 4KRPD 1U8IA 2PYFB 4NZTH 4GJTB 4RMQA 5E9DE 2Z31C 4XAKD 4CW1A 1MIML 3QDME 5SWQA 2VNCA 4PJ9D 3NCMA 1MEXH 2OR7A 3OKEB 4JQVC 1WZ1L 3BDYH 3MOBL 4P5TB 1MJ7L 1G7IB 1H9VA 1QSVA 2ZCLH 5F1NA 3SY0A 1F13A 3DO7A 3VE0B 2PO6C 3V6BR 4WTZG 2HKHH 3MRRB 5JZ7C 3ZSTA 4N0UB 1EHAA 4K8RL 3RVVC 3EO1A 2DDQL 5DHVH 1JN6A 4WI8A 4U1LB 4MJIE 4IMKA 2NZ9C 3VWJC 3VXUB 2CH8A 2FSEB 3U4AA 1YMMB 5IP4A 3T0VA 3P0VH 1HQ4B 1BJ1H 5HI5C 3H9YA 4PJEF 2DJSA 1NCDH 4UMGA 3MFFA 1K6QL 4PRNB 5LAXB 4AM0B 2VXTL 2X09A 1A0QH 1I7TA 3QDGA 1F4XL 2DI7A 3PXHA 4NN5C 3FB8B 1YYLL 3RVTC 5AZ2H 5CJXC 3V8OA 2IAND 5HGHA 3TYGL 1IAIH 5CKGA 1LP9E 1V7MH 3P0YL 4G9FA 2AI0H 2YD4A 2J8UA 3QCVH 2V7HB 3PP4L 4U6VH 1FFQA 3AVEA 4YDVA 1UM5H 1R0AL 3M17B 3HG1E 1AGBB 4FNLH 1BQLH 3ET9F 4U0QB 2H9GA 2R1WB 3MBEB 3JWOL 3GO1H 4NQEA 4CMHC 5JXAH 2DIAA 3OHXB 3C8KA 2DL2A 3GSXB 2AERT 2CRIA 4LBEA 3MZGB 4LCWA 5J7CC 4Y4FD 3VXSA 3B2UC 1SVZA 5HGAA 3ULUH 1A1NB 3D85B 4NO3B 5FYLE 3GKWH 3ABZA 4XCCH 2HT3D 4XPFH 5C0GB 3TWCL 1FZOB 3MCLH 4XC1H 1UM6H 2MJWA 4P2RD 1AKJB 1XGQB 2HTKC 1FJ1B 4ZPTB 2EDHA 3VFSA 3ARBB 3EHBD 3UBXG 4ZUSA 5FHAL 4ZFOA 1IGFL 3OXSB 3PGDB 3STZA 3PHQA 5DMGD 4NKDA 4FP8H 4M1GH 4YH6A 4LL9A 2VXUL 2CGRH 5KS9B 4M61A 5A40E 3IS0X 3PGFH 4GS7B 3JXAA 1X44A 4BZYA 6CGTA 1HHIA 2CRMA 4J3UA 4WWKA 3CVHH 1RULH 4RAHA 3C6LB 4XPGL 4HT1L 5FYKL 1CQKA 5IHBA 4LLYA 4X0KA 3MRFB 4NZRL 1UWGL 1RUMH 4U7KA 4G43B 4JPKL 3G9VA 4LLMA 2ADIB 4P59H 3QUXD 4U3CA 1A4KA 3QI9A 4J4PD 4ERSL 4GW4B 2WMPA 1QRKA 4UT9H 3FFDB 2FEDD 3EUUA 4L3EE 2R1XB 2R9HD 4Y5YB 1M7IA 1OM3H 4AYFA 1KCRH 2FGWL 1CQYA 2J5LC 4R97C 4FN0A 3ARDB 1YQ2A 2WP3O 4GRLA 1G7JA 4GXUN 3F65A 4NQTA 2GAZA 3OB8A 2AV7A 2R29H 5JUEL 4JO4L 4ZUWB 3WFBL 2IAMA 1HKFA 1TDQA 3GSVB 5IVNA 1ZTXH 1BP3B 4R26H 2XZZA 1A2YA 1I7UA 1CFQA 3L7FA 2NX5B 4V1DE 5F70A 5DMIL 1NFKA 1SJHA 4YBQD 5EZLB 5DVLA 1F4HA 1D5ZB 1EIBA 3NZHH 1EZVX 2H1PL 4XNZC 3VFPB 3OL2A 4M48H 3ARQA 2P48B 3IDUA 4Y5XA 3MRGA 5JQ6H 1OAZL 3DVNB 2UWEA 4P9ML 2NTFB 4NT6A 5FYLL 3O8XA 3S35H 3IETA 4OZIA 4X4MA 4OCRL 1GRWA 4QF1B 4WFED 3RRQA 3NAAH 5CUSL 3SDYL 3JUZA 3X13A 4C56A 1IEBB 3U9UB 2NZIA 3TBVB 2HJKB 4FZEH 1EEZA 1QLRA 4OCMC 1OAYH 1VADA 1OSPH 4YDKH 3KJ4B 1QFWH 1DBMH 5CS7A 3SO3B 3MACL 4GG6F 3DX8B 5IFAL 2FX8H 5CD3B 3I02B 3UJTL 3IFPA 3FONA 4ZUVB 3UPAA 1LGVA 3EJYC 1AO7E 5GRWA 1FLRH 4GBXD 4PLOB 2YMXH 3GMNA 5FOBB 4Z78B 2AV1A 1UCBH 25C8L 4F15B 5ERWA 3S36X 2DQCH 4KAQH 1LK3H 4PGBA 4KHXH 1MCJA 1N59A 5CD5D 1NGPH 1P4IH 2A6IA 1YMHB 2D31A 5I76A 5GGQH 3CXDL 1GH7A 5HI3D 5KANI 4XNQB 2YPVH 4RGMC 4IRJC 4JFDB 5A3IC 4KV5F 1JWUA 4L8BB 4NUGH 3KYKH 4NM8H 4NWTH 2Q76A 4K23H 4PJDE 4JVPA 1T3FA 4UAOB 3ROLA 1SHMA 5CGYC 1F3JA 3MREB 4RQQB 1D5XA 1LE5B 2BHZA 3HCVB 3FOMB 3OX8B 4PLJD 1MI5E 4FZ8L 4QRRD 2I60L 3LRSA 5KAQF 5KJRL 3W2DL 1G6RA 4Y4HD 2MTPA 4MDJA 3QSKB 1JGVL 1EK3A 4LVOB 4AENB 3F7PC 2QV2A 3QDAA 4P2OD 4ZTOH 1KNOB 1VFBB 4X99A 3SDXE 1PG7W 2W65B 4MD0B 3RI5K 3ZYOA 3JTTB 4FABL 5FA3A 1S7UA 2VDQL 3KPPA 2XKUA 5GRUL 3OB0K 4G6ML 1YPZE 2HKFL 5DJAA 3V5HA 1EGJA 5C0ND 4FQXD 3PWVA 3RJDA 2A0LD 5IB2B 3MC0A 2EDJA 2YWYA 2VAAB 1KC5H 4F9LC 4OZGB 2F19L 2EDYA 2ZSWB 5F7UA 3I3EA 3W39B 5CEZL 4Y1AE 1OB1A 5I0ZA 2ADJA 5KSBB 2BVOB 1K8DB 4NO0A 3OTTA 1OOAA 1KTLB 5HYJB 5HDLA 1T04A 3D5OF 4Y16C 1EJOH 4NZUL 4UDUA 5DJCB 5I15H 3JWDC 4KDTA 3LS5L 5FM8A 1T83A 2DMBA 4P2QA 4Z7VE 5L7XL 3PIQB 3JV0A 4BZ1L 1J5OH 4HCRL 1Z9SA 3WUWG 8FABB 4YWGH 2Q7YA 4YEFA 1F97A 7CGTA 5FCSH 3NIFF 3ZE2F 4LP4A 3WDIA 5IHLB 2ZJSH 2G5RA 2OTWB 1VFMA 1I9JL 3DXAE 1OD7A 3C08H 4U6XB 1AR1D 1UXSA 1H3WM 4YHLL 3HI5H 3STBA 4D8PA 1I75A 4UV4L 3HE6B 3HR6A 3IU4L 3BE1L 1KIPB 4B7IA 3DX7B 2HFFB 1IM9A 2EZ0C 2LE9A 4ZO7A 3WXWL 4UINH 4AG4H 1VFOA 4QOKE 3VG9C 3U46B 4O58L 4R4NC 1BQUA 1PQZA 4BQCA 3L3GB 4NQSA 3VH8A 3AREC 4QTIL 4YAQA 4YXHH 2VWEC 3VU2A 1XCTA 4K7PY 1CE6B 5DD5L 4OD2A 2YZ8A 3LQAL 4HV8B 1KCVL 1LWRA 1KG0B 1LO2L 3GFUA 5EWIL 4DOHB 1T66C 4LSDA 3C5ZC 3FMGL 2I9LB 1RFDL 5MENB 4X83A 1WICA 3ZYIA 1EAPA 2D7TH 1WGOA 2H2SC 4CBPA 3QNYA 2CLRA 5DJYA 5F9WC 4EDXA 3OGCB 2Y72A 5FOJA 2KZ1B 1A9BB 1OAQL 5ISZD 5TH2A 2X4TA 3G5VB 5BVPL 3FFCA 3LZFL 3OZ9H 1B2WH 4E0RA 4LHUA 1NC4D 5ADPH 4NHCL 1AO7D 3WS6C 4ETYA 1M6OA 1QLFA 3SDDC 1AP2A 4HUNB 1ZHKA 4I18B 4ZXBC 2NMSA 3B2VL 4OD1H 2H2PD 3GBMH 1KF9B 2HVKA 4YO0B 2VN4A 4XPBH 4RBPK 1UKQA 3ULSA 2W60A 1RAMA 4AEHL 4JLRB 3ZT7A 3MRNB 4LSTL 1WEJL 3V5KA 4L4VD 1ZT4A 3AU1A 1JHLL 2F5BL 2QBWA 4O2FA 3VI4E 5ADOL 1TJIH 1RIVH 5CZVH 4KWUA 3JTSB 2EXYC 4YPGB 1B4RA 3W11C 3QPQD 2R0ZL 35C8H 1MWAL 2DRUA 3S36L 1BLNA 1I3UA 1F90L 1U0QA 1UWEL 3BP6B 1DFBL 5HHQA 4OI8A 3O9WC 1VESA 3S9DB 1T1WB 1WAAA 3GHEL 3B9DA 4K7PL 2R69L 2V6HA 3OV6A 1WWAX 3MJ9H 2Y6SD 43C9A 4F7TB 3VGAB 1ZHNA 2K9UA 3LH2L 4MNQE 4OZHE 4GW5A 2WUBH 4LOUD 3T0EC 2XICA 3FT2B 1XIWB 3TT1L 1UA6L 1FLTX 2G5BB 3KDMA 3IVKB 2VXSL 2RHEA 4PYGA 4G9DB 5TF0A 4MNHB 3QWRD 4HMDA 5AUMA 1AJ7H 5CZKA 5BVJA 2AJYL 1NFDB 1J7VR 5D5MB 5ETUB 3SCMC 2X70A 1IARB 3AFLA 3QJFA 2VDLH 4MJ4A 5J57B 4D9LH 2Z9TA 4PG2A 2H6PB 5IFJB 3DGGA 2ORBH 4OCYH 1FN4A 5ICXA 2WNGA 1QBML 1QSZA 2RFXA 5IBLD 4G8GD 1YYML 1I3GL 4JM2B 4XB7A 3P11H 4WUUA 1SYVA 1AXIB 4EDWL 4D9RD 5T1LD 2JIXB 2EIEA 5A2LH 4M1DL 4OF8A 1NAML 2PTTB 4UOW1 1MHEB 3MLUL 4L3AA 4UTBL 5IB4A 4HKJA 4P99A 2BY0A 3QUYC 2CDEB 2BY1A 4TQEL 1W0YT 4PRIB 5JW5B 5IF0A 4YC2B 5FM4A 1OPGL 4MXQD 3GHBL 1CIDA 4QCIB 2AJZB 3H9SB 1U3ZA 3MJ7A 4NO5A 4K71C 1KTKE 4OIAA 4CKVX 3MQIA 5BXFB 3V4VH 2DTML 3PWUA 1EEQA 5TDOB 5GS2H 5EIQA 2UUDK 3WFCL 1GIGL 3UO1H 1N8ZA 2OM5A 1UVQB 3CLEH 3RWCB 3QO1A 3RHWK 4HWEL 1YJDC 5FYKU 1MY7A 1DBJH 3KPNB 4D0BB 4I8DA 1A6AA 3PWLB 5BV7C 4WUKL 4M5ZH 1JZ6A 4JRXB 2QADD 2R23A 3E3QC 2ESVE 3T4AB 5ALCL 5CHNA 5DD0H 1DQQB 2IQAB 2VIRB 4LU5L 2CLZB 1ZVYA 1YEGH 4X4XB 5GGTA 3S96B 3H3PH 2WBJA 2FR4B 5J6HB 4XZUA 4RAUA 2X4RB 4F7MA 3OKNB 4TVPH 5FDYA 4ZAKC 1B88A 3VG0H 1BIIB 5KAQG 4Q9CA 4FXKB 3MXWH 2H45A 2DWEB 4GRMB 4XAWH 4N0CD 2VLKE 3JWNC 3QIBC 4OLYL 4TSBH 3LVEA 1T89C 3OAUL 1IGIH 4ZSOE 1I9RL 4CDGC 3NFPA 4PJ7E 5INDA 4FQHA 4NUJB 4QXUL 1SM3H 5IG7B 2C5DC 4UB0L 1MFEL 1RZIA 3RWGB 2DQTH 2HG5B 3IXAB 5D2NB 1F3DH 5DK0B 3I85A 1DEEB 3KR3L 3QDJB 1AH1A 2BK8A 1XF1A 4GMTH 1DQTA 2NW3A 1LEIA 5IB1A 2IANA 1MHCA 1V5JA 4JZNA 4KVNH 5GRVL 2YSSB 3CFEA 3FB6A 3I6KA 2PYEE 3V0WH 3KYMB 4MDIA 3DETD 3WLBB 3OSKA 5IT2H 1IQDB 3U36A 4KJQC 4DVRH 2NR6D 4P4RB 3KG5A 2NY7H 5F7MC 5HI4D 5HGGS 4CVXA 3ARWA 4MMZC 5I8KH 2A83A 4NN6C 1GVIA 5J13B 4OIIH 1JPGA 2WUCH 1BFVL 5T33H 1ZHLB 4ZFFB 1ED3A 2OR9L 5DT1L 2CKBL 4JDZB 3CC5A 1CDGA 2B20A 2AXGA 1AIFA 2F9BT 3PL6B 3W81A 2YPKA 4RRPG 4BFIA 2WIIA 1RUQH 4DAGL 5C0BB 4ZOBA 1Y0LA 3SKMB 5DRNB 3OMZA 3RVXD 4S1SH 1BQHB 5DMYA 3F7VA 3WNPA 4C4KT 4G5ZL 4M7JH 4H26B 1TVBB 4Z7QE 1Q9LA 4XCEB 3FQWB 1QYGH 2B0SL 4LGPB 4HWUA 4LSRH 1BM3L 1CU4L 1TENA 3BYTA 1CD8A 3LN4A 4FRWA 4KRNA 4Z7WE 2X4PA 1U92A 1WSST 2AK4B 2YC1A 3NCYP 4NO2A 4LRIC 4AEEA 2WINB 1W72H 2Y07H 1SEBB 3MRPA 4M43H 1BF8A 4KK9D 1NDGA 3H9HB 1SYSA 5C0AB 3SGJC 5CEXB 5J12C 3D2UD 1V3MA 3O0RH 5EO9B 4GXVL 2V5TA 5GS0L 2R0WH 4R7NB 4PJ8B 2HJLB 3QUXA 2Z8SA 4Y4KC 1E27A 4QWWD 4GMSH 3GJFB 2XN9E 1AI1L 3QQNA 5ICZB 4K94H 2OQJB 2DYPA 5HYEA 1I4FB 2Q86B 1BHGA 1P9MA 1JYNA 1IEAA 1UYWL 4JB9L 4ODTH 5E2JA 4Z77B 4BFBD 3I2CH 3CMOH 2AP2A 2XA8L 3QG6A 2ICEB 1VGKB 1FH5H 5EPMA 3HMXA 2D0GA 3RWHA 4JAMB 3ARPA 3BGMA 1CLOH 1K4DB 4UOJA 4UNTA 1CLZL 2JJUA 4NKMB 1LDPH 5H35A 4R3SB 2NY0B 4JVUA 3BGFC 1CD9B 4IS6A 5DRXB 4ALAL 5DJDA 5FKPA 5I71B 4RGND 5IM7A 3RWFB 2V7NB 1PZUB 5JOPE 1AQKH 1B0GB 2F54E 4JDTL 2JCCA 4U1SA 3EJZD 2YN5A 1XZ0A 3P73B 15C8L 4P3CH 1NMBL 1EBAA 1NCTA 4AZ8A 5BS0B 5C0EA 3AROA 1GC1C 3MGOB 1R5IA 3KJ6L 4PTUA 1HI6A 5HYQA 4KK6C 2XFXB 4P57A 1TJHH 4I2XB 4Y7MA 4HQQL 4YFDB 2GSGA 2FECL 3MUJA 3CFDA 5JNYA 3QUKB 5F7EL 5FHBH 4F33B 3GSRB 4QHLA 3I9GL 4X98A 4G6KH 3WFZA 4QO1A 4LSUL 1MAJA 2X4NA 1D6VL 3E8UH 3MUY1 1HKLL 4OLVH 5DEFB 4A2LA 3VA2C 4TNWK 1YNTA 2A1WH 2Y36H 4TSCH 2HRPL 3MLWH 1T2QH 2P44B 4HIHB 2A6DB 3J7HA 1HXMA 3G6JE 4M62H 4F2MB 4DTGL 1KPUA 1AY1H 1V3KA 2VDOH 3X11B 1QSFE 1OTUD 5I2IA 3QQ9D 1DVFC 4HPYL 2NY2D 1H3TA 1G9ML 4PJXB 3TC9A 1N7ML 5DYOA 3GGWB 1NCWL 3QRGL 1RZKC 3WD5H 1JPSL 4GBXA 3WE6A 2VKWA 1G7HA 1UB6A 3MRCB 1HCFX 3L3DA 5DGQA 4EBQH 3WMSA 4LLVB 1E0OB 4V2BA 3RUGB 1TPXB 5E2WH 3MLTA 5LQBH 1LP9A 2BNUA 4ODSL 1MUJB 5EUOB 2AEWA 3CH8A 1I8KA 3MUZ1 4GAJL 1JHTB 4FQQB 2ITDA 1D5IH 5DQJB 3BP7B 4PRPE 4JN2A 2HJFB 4KJWC 5HHOB 1IBGH 1ZANH 3HG1A 2HMID 2NY3D 1QSED 4N0FB 3SJVE 5HXMA 4PJHB 1ZHBB 5ESQA 1W0VA 4YHYC 3VXRD 4HS8L 4Z7OF 4I0PB 4HIXL 1TMCB 4LSPH 2DQGH 5DVOA 4MB3A 3T8XB 1Q9OA 6FABH 2DQFA 4QRRA 3D25A 2QSVA 4XC3H 5I1CL 3OKOB 4Z5RA 1Y18A 2E9IA 1X5LA 3S4SB 1U8IB 4FFWD 3AB0C 1BFTA 4CW1B 1JYXA 1XAUA 5EU6E 5I1IL 4AQOA 5SWQB 1A5FH 1FL3A 5GPRA 1MFAH 3FN9A 2F53E 4TRPL 1UEMA 5CBEA 1PY9A 2VDKL 5F1NB 3JZ7A 3LKSA 4UIKL 3SY0B 3DO7B 4LGSB 4HLJA 4UT6H 3CGTA 4NP4H 4GG8A 5C71A 3K4ZA 5M95B 3D48R 1CGTA 2CMRL 3EO1B 3UTSE 3QIUC 4HUUA 1JN6B 4M6ML 3OPZL 5TF1L 5E00A 2YUVA 4JG0H 1ZLUK 4MAYC 5I9QC 1U95B 3B9KC 1C16A 2DQEH 3VMPA 4KHTL 4Y2DD 3H3BC 5L6YH 1KEMH 2MCPH 4L3EA 5I18H 3MFFB 4IOFD 5KZCB 4CVUA 3BISA 4FOMA 1I7TB 3PHOA 3QDGB 4LCIH 3GSNH 3LB6C 3WXVL 1HZHH 4UV7H 4E42A 1L7TL 4NM4H 2OLDA 1IEHA 2Z4QB 4U1HA 4RFEA 4G9FB 1A1MB 2J8UB 1INEL 4OZFG 1RURH 1T1ZA 3VFGL 4YDVB 2YRLA 1GPOL 2Z31D 1IGCH 5I16A 4V1DA 5SWSE 2W0FA 1NGQH 1VB9A 1VDGA 1BVLA 3CJJA 5I17A 2H9GB 1P5VA 2YEZB 4NQEB 1HINH 1MRDL 2BVQA 1S3KH 4JHBA 5D9SB 3NTCL 1CDJA 4LBEB 4JCLA 2PO6D 2WWKT 4LCWB 3V7MA 1ZT7A 3VXSB 4L5FL 5JZ7D 4UOW0 5HGAB 1WJ3A 3RVVD 5K9KA 1UEYA 3MLXH 4YDJA 4OB5H 4F57H 5C6TL 1CFBA 3DMMC 5DC0A 4EIZC 2NZ9D 3VWJD 2LU3A 1KN4H 3B4NA 1FRGH 5KVEH 2ENSA 3SQOL 5HI5D 5EBGA 3VFSB 4HGWA 4XPTH 4ZUSB 4MCZA 4X6BA 4ZFOB 3C09B 3O4OC 5EOQH 3STZB 3PHQB 2ZUQB 4NKDB 1OP3H 1HOCA 4NZDA 4M61B 2XZQH 3WDHA 3PABA 3RVTD 5TQ0H 1DN0A 4GH7B 1HHIB 4WWKB 1NLBL 2C3WA 3BZDA 1TQCC 3HLAA 3K46A 3IJHA 3EDJA 1NC4A 1SY6L 4LLYB 1JI1A 3EAKA 4X0KB 1AO7A 1JNLL 2O5ZH 1MPAL 4LLMB 1F00I 3QHFL 3QI9B 2MMXA 2CRZA 3SKJL 4KROC 2P5WD 3QIWA 4ELKA 1M7IB 3DX6A 2HTLC 2Z35A 4ZS6C 4YHML 4JJHA 4XBPA 1MJ8L 3SGKC 4M8QA 1ZLWK 2OJZH 5F7DB 4L4TD 3VJ6A 5IMMA 4GRLB 4YBLC 5GZNC 1NAKL 1G7JB 3TV3H 4DFIA 3ZHLA 2VOTA 3B2UD 1KJ2L 1M4KA 1KN2H 2GAZB 2AV7B 4JQXC 3V4PH 4OQTH 2IPKA 3W0WD 2CXGA 3FQRA 1FNHA 1TIUA 2IAMB 2DQJL 5K9QG 4GQPH 3CK0L 4NBZB 4WI5A 2JJWA 4XPAL 4JFHD 4PJDA 4YGVA 2VRAA 1A2YB 1I7UB 1RVFH 1CFQB 3L7FB 2BVTA 4LCCC 2HTKD 1U8LA 4QY8A 1SJHB 2I24N 4WJ5A 2VXVL 5E8NA 5EO1A 1FE8L 3HMWL 2A6JA 2E7HA 4Q6IA 1P5UA 3VFNA 1KTDA 2W38A 3SDXA 1JHKL 3BH9A 4Y5XB 3MRGB 4OLXH 1AC0A 4X6EA 2C3HA 3V6ZA 3RZCC 1DLFH 4NYLB 4NT6B 1E4KA 1MJJA 3VDBA 1ZWIA 3GM0A 3IETB 3OKYA 2D7OA 3WFEL 4OZIB 3QWRA 4I3SL 1X4ZA 5E0QA 1FSKB 5GSRA 1IKFH 3X13B 3EYQC 4C56B 1EEZB 1QLRB 2ZKHL 3HZKA 1VADB 5F7KC 3B83A 5ALBH 5ICYA 5E24E 4Y1AA 5E6ID 5HDBF 4IRSC 4G8GA 2VH5H 5I1HL 2CLVA 5C86A 3IFPB 1C7TA 3FONB 5DO2C 3THMH 3MOAL 12E8H 1NCNA 1DDHA 2VQUA 4I0CC 1MJUH 4QHNA 3MBXL 3TIDA 4KI5E 5K9JH 4KUCD 4OD3H 5H2BA 5IFHL 4KJPC 3GMNB 4Z7VA 2X1WL 1RK1A 2AV1B 1Y6MR 1FDLH 4MS8C 4K3DL 2R2EA 5ERWB 1AE6H 2C3GA 4PGBB 1ACZA 1N59B 5FB8A 4KKBC 5D71H 2A6IB 1HCVA 2AXFA 3GJFK 4H1LA 4P4KC 2D31B 4TUOA 5I76B 2DQDH 1OF2A 1TITA 3GK8H 3MV7D 1BOYA 3DXAA 3WS3A 1F6LL 2RQ8A 1HYSC 1CL7H 3KS0J 2AJUH 5F9OL 3EO9H 2BSRA 1AFVH 1JWUB 5D2LA 3P4NA 1ADQL 4LHQB 2Q76B 4AIOA 3LEYH 2XOTA 1XF2A 3LHPL 1ZV5A 3W5NA 4KZEH 3HZMA 4QOKA 3MLRH 3ROLB 2FD6H 2AGJL 5AWNH 1F3JB 5FO8A 4Z7UE 1D5XB 3L5XL 1ZT1A 3EDDA 5F1OB 3LRSB 1P7HL 1J0KA 1G6RB 4KRLB 1JZ7A 4MDJB 3MODL 4JM4L 4NNPL 5HPMA 1E6OH 5L88L 1J1XL 4X99B 3FN3A 1KB5A 5CIPA 4ZO8A 5FA3B 1S7UB 1BD2D 3KPPB 3R06A 2BRQA 4ORGA 2CJUL 3OKMA 3A6CL 5DJAB 3V5HB 5FUZH 1NSNL 3PWVB 4JZOA 4LDLB 2XTJC 2BVPA 2IMMA 1L9MA 1TXKA 2XT1B 1NC2B 4OLZL 5FCUH 1YY9C 3BPOB 3S5LA 4DGVL 3TESA 3ARFC 3RL1A 4M7KH 4N8VG 3MUGA 1BZ9A 5DUPH 4XNYL 5DMKA 2OI9B 4J3XA 1OB1B 2NCMA 2ZG3A 2ADJB 4NWUH 4ZODA 1VEOA 4IRJD 2H26A 5A3ID 2IQ9L 4NO0B 1DCLA 3IRZA 2LFGA 1T04B 3O11A 4UDUB 1IZJA 3DPBA 4XBEL 4WENB 3N1QC 4RX4A 4G8IA 1YNLH 3RZWA 1RIUL 4P2QB 4P2CG 4O51A 1CG9A 5ID0A 5CGYD 5JR1L 3BD4A 2DIJA 1H15A 2Q7YB 2P5ED 3DUSA 2EYRA 1H5BA 4NQDD 4N68A 3WIHL 3VFVA 1L7IL 1HYRC 1MRFH 3FQNA 5FK9A 1UXSB 1Q72L 2K3TA 4LEOA 5IW6A 4XXCC 1X4XA 1J12A 1N26A 4D8PB 4MYWB 4TUKL 4ZO9A 2UY7A 1U93A 3PHSA 4HUWA 5GGUA 1IM9B 3ZSSA 3BIAX 1PQZB 4MNQA 1I7RB 4NQSB 3VH8B 3P2TA 1XFPA 5D7LE 1A14L 2BFVL 1P1ZA 4YAQB 3VXNA 1XCTB 4W6WB 5CP3H 2C7UA 1RZJL 3V95A 2FL5A 1JCKA 3ESUF 4OD2B 2EKSA 1DQDH 3O2DL 3D2UA 4CL7A 4Y16D 4HIJA 4X7TA 4S0TD 4FQJH 5T1DH 1EAPB 3W82A 1XCQA 4MQ7B 5FYKD 3SE4A 2ATKA 1T6WA 2CLRB 5DJYB 4ZD3L 4EDXB 5E08L 1NLDL 1QNZH 2XG5A 1HSBA 1E4XH 4PP1C 3QFDA 2P47B 3MRBA 4XMPH 5KVGH 5TH2B 3RY4A 4HFWB 2IG2L 4JFZH 4WNQA 3HR5A 3CIQA 1KEGH 4E0RB 4LHUB 5EIIA 3L7EA 2A9ML 1KSRA 3UAJC 4NJAH 2E6JA 2PKDA 2Z93A 1M6OB 2YR3A 4LMQI 3RA7L 1QLFB 2E7CA 5C6PB 1AP2B 5CCKL 1ZHKB 2XKNA 3O6FA 3U0TA 4Z7NF 4ZNEE 3ULSB 1RZFL 2EZ0D 2CKBA 1NCAL 5IV2A 1CTOA 1U2CA 1LEGB 2W60B 3ZDXF 4R4ND 3UYRL 3V5KB 1QO3A 1NUGA 1ZT4B 1UKSA 3ARED 4H88H 3U7AA 1MQKH 1R3IL 4O2FB 3B9EA 3QEGH 4FS0A 4K7FA 1OAKH 1A6UH 1MHHA 4OZ4A 4OM0L 1DEDA 1B9ZA 1U8KA 2GJJA 3IDGB 2R2CA 4F58H 1Z2KA 1BLNB 5IBUB 3L5JA 5HHQB 4AK1A 1F2QA 2MHAA 3A0OA 4O2EB 1F6FB 2AEPH 3EBAA 2RBLA 3OJMB 1JE6A 2H2SD 2IMNA 2WWMC 1FYTD 43C9B 3RTQA 1AHWC 1ZHNB 4GW5B 3ZKND 3D69A 1Z3GL 1IMHC 5DEGA 2KDGA 3JV5A 1J10A 2N56A 1ZMYA 3KDMB 3DV4A 5E5MA 1YNKL 1A6VH 5AUMB 4L9LC 2VLKA 3SDDD 4YBHA 5BVJB 4ZXBD 4ZSOA 3BT2H 5EZIL 4AJ0A 2A77H 1FGNH 2X70B 3QJFB 3UTPE 4OFYA 4PJ7A 5J8OA 5JHLH 3KYOB 4ZOEA 4XMKH 4K9EC 3DGGB 1FN4B 1S9YA 4OZGE 5ICXB 4E41D 1QFWI 3G6DH 3CDCA 5J6GA 2RFXB 1CF8H 3BMVA 3IU3B 1JP5A 5KSAC 5KSBE 1WIUA 4WUUB 1SYVB 4K3HA 2QSCH 4P5TC 1KGCD 2EXYD 5HYJE 1MIEH 2PYEA 3W11D 4MNGE 1UWXH 3P40A 5IB4B 2KH2B 5EA0L 4HKJB 4R6UA 2YKLL 1BJMA 3M45A 3ZL4L 2OX5A 5IF0B 3DYOA 4WHTB 1V3JA 3O9WD 5HHME 3U4BH 2ZCHH 4JHWL 3MJ7B 4NO5B 3VXRA 3D39E 1PG7H 4LQ1A 3SBWC 2A73A 3PWUB 4KUZL 1G0DA 2E8ZA 5K9OA 4FQLL 3T0ED 5D7IE 3MNVA 4TPRL 1N8ZB 2Y06L 3QO1B 5FV1L 3F6IA 5M94B 4WI6A 1KCSL 3G08A 3EYUL 4KRPB 2EDWA 2OCFD 3QCUL 1A6AB 4HH8A 1OAXL 1J1OH 5EO0A 3SCMD 4NCC1 4CVWA 4HWZA 5GZOD 2R23B 1BJ8A 1QLEH 4PV8A 1R6VA 4Z7WA 2E7BA 1B4JH 4KXZI 5CHNB 4J8RA 3QUMA 1AD0A 1U42A 4RDQF 2D03L 2WBJB 3QAZB 3CFJA 3DROA 1LDSA 4XZUB 4RAUB 3MBEC 3T0BA 4F7MB 5EU7E 4WU5A 2V9QA 4DOHE 1WFUA 5E8DL 3LS4H 3RPKA 5I75B 2ILLA 1UC6A 2XA3A 4H0GA 4QTHA 5FO7A 5CEZD 3QUYD 2BOCA 4AIXA 3NFPB 4G80A 5INDB 4FQHB 2XN9A 4Y2DA 2R8SL 4AEFA 1RZIB 2DJ4A 5FECA 5SWZD 2F5AL 1GGCL 1V7NH 2AEQH 3BRDA 1GGYA 4GXUM 3WCYA 4XNXL 2NW3B 1LEIB 5IB1B 4YXKL 3UBXI 1I7ZA 1MHCB 2R4SH 4K55A 5LGHH 4G6JH 3VFUA 3E2HB 3FB6B 1PYWA 3I6KB 5DWUH 2J88L 3UTQA 4OF3A 1MCDA 4GS7C 4RMRA 5F3HA 4OSUL 3U36B 1K3IA 3C6LC 3TF7C 2PTUA 4M4RA 4HUXA 2SEBA 4DQOH 3V8CA 3ZDZE 4CVXB 3DX9A 2EDQA 3QFJE 3GRWA 4UTAH 2F54A 2W0LA 2A83B 4OGXH 3WEXA 2XPGB 4R4FL 1JPGB 3QCTH 1ED3B 5IVXA 4GQ9H 1PW3A 3SE9L 4XWGL 2CO6B 3U82B 3CC5B 4W6YB 3U9PH 2AXGB 3U48A 3FCTA 2PO6A 1AIFB 4IOIA 4PJGE 4Y5YC 5C92A 2YPKB 4BFIB 1TETL 2WIIB 3MLYH 1G1CA 3OAYH 3T08A 5JW4N 3ARDC 3KLSA 1Y0LB 4ZAKD 4P23A 3ECBB 3UX9B 3C5JA 2QQQA 3DVIA 3L3KA 5ILTL 3F7VB 3VWJA 2QQKL 3QIBD 1QBLH 4H20H 4JFFE 1CR9L 5JORA 1AQDB 1KPRA 1Q9LB 5HTSA 2ZUUA 4J7RA 3C60A 4D9QD 7FABL 3LN4B 4I3RH 5IW1A 2X4PB 1ITBB 1U92B 4N1CA 2YC1B 4NO2B 4I4WA 5T5FH 1F2XK 3MRPB 1NDGB 3NIDE 1SYSB 5EBWA 4CMMA 1H8OA 1OAUL 1BEYL 1MAML 1Z0NA 1EO8H 3CMGA 1C5CH 3BWAA 3ULVE 1YEEH 3WJJC 4LSQH 4KJQD 3UCRA 3QUXB 4PJCA 5FXCH 4LK4A 3CPLA 2V5MA 1WIOA 3MRJA 2P5WA 2HWZL 2DYPB 5F93C 3TA3A 1VEPA 1IEAB 4NRXA 4U1MA 3T0WA 3M1BA 5K59F 3OF6D 2EDXA 5FDWA 1RK0A 3QG6B 4PRPA 5EPMB 3RWHB 3BGMB 1S7VA 1T22A 1OT1A 4FQ2L 1KJVA 1XF5A 3W0WA 5J3HC 3KJ4C 4PRIE 3HAEG 4UDTA 3SJVA 5H35B 1P6FA 4HJ0C 4HKZA 3SO3C 4IS6B 4KTEL 4WGVB 2JJTA 5DJDB 4DCQA 5FKPB 2J8OA 2AAVA 1QZ1A 3QHZH 5C0FA 4MAUH 4OT1L 2JCCB 4RZCA 4ONFH 4U1SB 3NFSH 1XZ0B 5DJ8A 5BW7A 3GIZH 2XQYG 5KOMC 5D7KD 3MV8D 2I25N 5I30L 2PN5A 1N6QH 1MSPA 3LKRA 1WT5C 1YPZF 4F15C 5C0EB 4QEGA 4HS6A 1R5IB 5FEBA 4PTUB 1HI6B 5HYQB 2XIDA 5FGBA 1CGWA 4P57B 5E5RB 5C07D 1NEZA 2NQCA 2GSGB 5EU6A 1N6UA 1ULVA 3CFDB 5JNYB 3BZ4A 2HRLA 4JRXE 4QHLB 4X98B 3BRFA 1QUNA 1CGSL 2F53A 1BWWA 1KCUL 3RFZC 3ETBF 1LO4L 2X4NB 1KLUA 4Y4KD 1KELL 1S78D 3FQUA 3NA9L 2A6KA 1EUUA 4MA8L 4JPWH 2RGSA 4JQIL 1YNTB 2X42A 4UAOC 4YHZH 2DBLH 4IDLA 1X4YA 1HXMB 1A9EA 2W9EL 1FNLA 1KPUB 1QFOA 2QR0A 5E6IA 2YXFA 5E2TH 5EOCH 5BQ7A 1IC5L 5I2IB 5D6CA 2BNQE 2H32H 5DYOB 4ODBD 4M6OL 1MCPH 3EOTH 4LVOC 2AABL 1DBBH 1MCSA 4GBXB 3WE6B 5L2JA 3MUHL 1LNUA 2DD8L 3ULVL 1G7HB 1UB6B 5DVKA 5ACLA 3P77A 5F1SA 3L3DB 1VERA 3GSO