3UZEC

Crystal structure of the dengue virus serotype 3 envelope protein domain iii in complex with the variable domains of mab 4e11
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
99
structure length
94
Chain Sequence
YAMCLNTFVLKKEVSEHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKVNIEAEPPFGESNIVIGIGDKALKINWYRKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable domains of murine anti-dengue Mab 4E11
publication title Mechanism of dengue virus broad cross-neutralization by a monoclonal antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 11
structure length 94
sequence length 99
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uzeC00
3UYPB 3WE1A 4AL8C 5JHMA 4AM0Q 4ALAC 4X42A 3IRCA 2GG1A 2R29A 3UZQB 5KVFE 1SVBA 5KVGE 5B1CA 4GT0A 4BZ1A 1Z3RA 3VTTA 1OANA 3N43F 3UAJA 1TG8A 5LBVA 2P5PA 3UZEC 2JSFA 3G7TA 5KVDE 3C6EA 1URZA 2JQMA 3N40F 3J27A 5AAWC 2V33A 5JHLA 4FG0A 4UTAA 1S6NA 4UTCA 1Z66A 5IREA 5IZ7A 2H0PA 3UZVA 5H37A 4UTBA 3N41F 5KVEE 5AAMC 1UZGA 2R69A 3P54A 5LBSA 5GZNA 4UT6A 1PJWA 4L5FE 3C5XA 2ALAA 2HG0A 3MUUA 4UT9A 2I69A 3J2PA 2JV6A 4FFZA 3N42F 5LCVA 1RERA 1ZTXE 4FFYA 4BZ2A 3N44F 4GSXA 5GZOA 1OKEA 1OK8A
chains in the Genus database with same CATH superfamily
4QHLA 2J6EH 2HA1A 4BINA 3GYRA 2ZSVA 1LWHA 1SQ2N 5INCA 3L3HB 1XSKA 2G5BB 3AT9A 3IXTB 4FQXD 3TYFB 5IKCB 1GH7A 2YPLE 4NKIL 3OAYH 2X2JA 2FEJA 2WVVB 4LSPH 1TCRB 4JRXB 3CSBA 2F7PA 4UT6L 2X5PA 4CILA 1JNHA 3QFGA 3B1UA 4OGXL 2HTLD 1RK1B 4XTRC 4BQCA 3HPJB 2RQEA 4NZJA 3L2NA 3RURA 1TPXB 1ZDQA 2MIZA 4K7FA 5E1GA 4EN3C 1P5UA 1AAJA 1OF0A 3CDYA 3KBEA 2IMNA 3SGKA 4IU3B 2EDKA 4S2SA 2C9VA 3GUFA 4JDVB 1DVFB 4H25A 4OBRA 1XF1A 3LHAA 1A9BB 4PJHF 2VL4A 5JW4R 5ENWB 2ED9A 2F53A 1U8IA 2YPLB 5IMOA 4RGMB 5AB9A 3EBAA 3QNXA 1BG9A 3JTBA 3DRTB 5EZPA 1WBYB 1AGCB 2V3DA 3HB3C 3CFBA 3DK0A 3K8KA 4K71B 4L8SA 1G9NC 3NCJL 4FULA 5LWYL 2AS5M 3HBPA 1XGYH 3MGTA 3H6AA 3NN8A 4A04A 3SCMD 3WTWA 2D73A 2IC2A 4WEBL 3N44B 5EEXA 3CX5K 1WEJH 3RKDC 2J7LA 2PR4H 5I1EL 1U95B 2WZPA 4DKEH 2KS0A 4X6DA 4M43L 3MROB 1Z9PA 3CU7A 4GXFA 5EZLB 4Z7WE 1ET5A 2L4OA 5IQ9A 3V0AC 4ERSL 2XWBA 4MGXA 5LGHL 1Y0LB 1CXFA 3HNTH 4FQCL 4Q6IB 1IGTB 4MMZA 4IDJH 1HHGB 4NN6C 2GYSA 5K33A 5D1XA 1D5IH 2VDPH 2PXYD 4GIOA 3QIBA 1VSCA 1T2JA 3DETC 4NRZA 5D8JL 2V7HA 3KGSA 2EDXA 2YAEA 2XRAL 1WFTA 1MI5D 1J9SA 2VH5L 3MRPA 1M05B 1XH0A 4JHVA 4TNVK 4Y9BA 5LG1A 3RFRA 1UKSA 1A4JA 4UAHA 2NY1B 4G8AC 4HKJB 4FQQA 4JFHD 2FVNA 5C2BH 3S8GB 4R7NA 4X9IA 5KBPA 6FABH 3E3QC 4WHYG 2HTKC 2BZDA 3L5WA 3H1ZA 4I3RH 1JZFA 1IZKA 4NT6B 4Z7WB 1IC7L 3TO4D 1N6VA 2H9GB 4F2ME 4Y16D 3QQ9D 1AP2B 3Q2LA 4JANA 2VC2B 1OGAE 3NG5A 2C9QA 2J43A 2R83A 4XHJD 3D34A 2BP3A 1JYXA 5DI8B 3LSOB 1EHKB 4Z6AT 2AABL 3E38A 3X1NA 1QFOA 2RALA 3CH8A 4ISVA 4LDLB 1JHKL 1XGTB 2UVFA 2XIIA 3DYPA 5EBWB 3UAAA 3BJLA 5DYFA 3LH8A 5AAPA 3B7TA 1NFDF 5F7FA 3UYPB 2WN2A 5CP3A 1ZJAA 4GRLD 2DLGA 2NDGA 4N8VA 5C0EA 3H4FA 4OV6F 3G5VB 4ZPTB 3MRLB 3I6LE 1M71B 4MDIB 3PP4L 4L23A 1WA1X 1H8SA 1EO7A 2LAGB 3K0YA 4MD0B 4PVLA 3HZYB 2XWZA 1ASOA 5KVGE 3BWUC 4NENA 1FNGA 1Z3RA 4X99B 1SOKA 5EBLB 3UZEA 1CE6A 1BGXL 5BO0D 3QDJD 1T1XA 3R0MA 1EANA 5DLMH 5JIIA 1BVNT 3QRGH 4O00A 1FGNH 2MCAA 1RZFH 1X9UA 2DWYA 2YGVA 3D39A 4P5RA 3D2UA 3LRSA 2A6IB 3Q8AA 4XNUL 4M1CC 1NFAA 1AO7B 1T7ZA 3LQAL 3HC0B 2I5YH 1YUHA 2B8OT 4PJXA 3K8MA 3UAFA 3QR2A 4ZNEE 1X5FA 2NW3B 3QHZH 1RSFA 32C2A 4HIHB 1N19A 1UB6B 2RD0A 3O6MH 5D6CA 4TOYH 3CDZA 3RWFA 2HT4D 3TOPA 1YAZA 1EAPB 1DL7H 5DRWB 5E2UL 3S3DB 3LZNA 3VMOA 4H0GA 1IVTA 2ENYA 4Y9CA 1AZUA 2IO5A 1I8LC 3ULVH 5C09D 4X4XA 1QP1A 1FZKA 1ID2A 1AHKA 3ROLB 3LH2H 5AKTA 3HRZA 4KROC 4XP5L 3VXSD 1JV2B 2AJVH 4Y5VC 2BXZA 1QHPA 4PRIE 3HI1A 1WWAX 4GKSA 5AZ2L 2CGZA 3K4DA 4RFEA 1QWHA 3H9SA 2HN7B 4YUEH 4PYGA 2DQFA 1BBDL 5MI0B 3CIQA 3Q9PA 1I9JH 4GI9A 2AHIA 4PJDB 5C0CD 2UXVA 3PREA 1XGUA 3GJFA 3RFZA 1DQJA 3PWUB 4Q9QH 1BWWA 3ARDA 3GI8L 4LAQL 4RZCA 4P2QA 3SPIA 5DSCA 3MNVB 3FO0H 1BVNP 4JFWA 5JXEA 1V3JA 4QF1B 4IKKA 2EEBA 3ARGB 3D48R 4U3SB 4UAOC 3CGTA 2D2CC 1NAMH 1FQ9C 1V10A 3K74B 3TA4D 1KENH 2HXAA 2ESVD 3RPBA 4L18A 4PJ5B 2GSMB 5GGTA 1N2RA 1JYWA 1KXQA 1PFOA 5CR8A 4F9LA 2DI9A 4UQAA 2X42A 4LCCC 4DAGL 5I8CA 5C08A 1FZOA 4DKAA 5D7IA 3CHOA 4IBUA 1EXHA 3GIVA 2WQWA 3LZPA 1FBIL 1EK3A 2X7LA 4NQDA 2EACA 4QI3A 5KJ7E 4OQTL 1DBAL 2FATL 3SE4A 1VZGA 1G7JB 5K93A 3KYNB 4MNQE 4OGAD 2YAFA 2HJLA 4L4TD 4X8CA 3SDDD 3ILDA 3ZK0A 3W5NA 4B9PA 2GAZB 5F1SA 4PJ9B 1ZAGA 5DJYB 3U83A 4RNRB 4ILDA 4YPJA 2ZUQC 4M3JA 2DH2A 5F72S 5CZVL 2Z92B 1EO5A 3OKLB 4HBCH 2F54A 1C7TA 2OW6A 4G42A 4JRYD 5KYXA 2Z91B 1F5WA 1HEJC 1XQ4A 1R6VA 1BECA 3HAEA 3APCA 2DW5A 3OKYA 3TZVA 2IH3B 1UQSA 1E30A 5CWSA 1CLZH 4JFDE 5AWNH 5GXBB 4NI6A 2WWKT 4WEUD 1J1XH 1LDPL 1NPNA 5DF0A 5GGRB 4UT7L 4MDJB 1I7RB 1WAEA 2N56A 5EWIL 1RURL 3E7JA 1AGBA 2OX5A 3CDGB 5L4MA 3GXPA 3V7AG 4AYGA 1FVCA 3KYKL 4DQOL 2XWCA 2A73B 1JGDB 2W91A 3MLZL 4M62L 3LNDA 2WUBL 3HUJE 3AS2A 3GJFH 4R8WH 4YHNB 2PWEA 3PAVA 1GZHC 4HIPA 4JFDB 4TSCL 2JCCE 3F2LA 2Q20A 3VD7A 1JN6A 2J72A 3FU8A 5L2KE 5E2TH 4AJWA 4K94C 2H6PB 3IU4H 3BWUF 1OARL 3K2UL 1LWRA 3VFVA 4YXKL 1PMYA 1OP5K 3VXME 1WZ1H 2FEEL 3WOVA 4F24A 4JG1L 2UUDK 1TO5A 1TNMA 5F7WC 1T7VA 4NFBA 1TTRA 1MFEL 3T77B 4UI2A 4XTRD 3KPLA 4C56A 3GO1L 1E4XL 2R69A 3SDXB 1LO3L 1JJUA 1HL8A 4LLQA 3U7YH 3SE3A 2QVKA 3QEQA 4NJAL 1JXKA 2NNAA 1EWHA 3HI5L 2ZXEB 4W4OA 4EN3D 1M57B 1PCXA 4OZFA 3C6LC 3QWRA 5ISZA 4Y4HD 3O6FB 4N2HA 2B20A 2BRRH 5F89B 1T3FA 2X4NA 3N9GH 1NBCA 3V8OA 1GTNA 4FFYA 5EC2A 3GXIA 1BIIA 4BQBA 1L6PA 3PPEA 1W91A 5ECJE 4CUCA 5MHSD 4JFZL 2R4SL 3L9RA 1ORQA 2FQFA 1QHQA 4DGIL 3H8NA 1EXGA 4ZUSB 4LVOC 4WV1A 3RG1C 1GL4B 4PB0H 2YQBA 5IUSA 2NY4B 3ARWA 3KPSB 4QRPE 4AEIL 3RUGE 1XGPA 3KLSA 3PWNB 5IROC 3HAEH 3CFEA 3GSQB 3MLRL 4OLYL 4OZHF 5TDPB 3VJ6A 1ZTMA 5F3BB 3EXLA 2XU9A 4HXAH 4KOCA 2K8MA 5E5UB 2D31A 1R3KA 1QX1A 3RKDD 4JVWA 3F5WB 3LVEA 4XO3A 3NFSL 2HPOA 4IRJA 2W9EH 1BW8A 2FYVA 4FP8L 3DX6B 1IGCH 4HG4J 4S1RL 5E9DA 1XB8A 4XPFL 4MQTB 4HETA 2IQAA 3Q5OA 1G0YR 4CGUB 3B5TA 1TO4A 4IS6A 4NKOB 4ZMQA 1INDH 3X1EA 1LEIB 4GXUN 1REIA 4LL4A 2ZKMX 3IKKA 3DETD 3D69B 3QFJA 1JGVH 4M1GH 5FYJL 3DGDA 4XBPA 4FLOA 4ZMVA 5JORB 1DVUA 5E8PA 1E8XA 4G80B 2B15A 2G3NA 2V7NA 1HKLL 4PVMA 5FDWA 4WW1B 2DQHL 4FQ2H 4JVPA 2FGWH 4JL2A 3JWNC 3GMMA 1QFUH 1ACXA 2KERA 4QR7A 3ZYIA 4JE0A 3K3QA 5JIKA 2HTKD 2WQUA 5I76A 4JY6B 5C86A 5IOKA 3EO9H 4MMXA 4JFHE 4FMFA 2TRYA 3EAKA 2HWZL 1GZQB 1TYJA 4DP2X 3V4VH 4ONFL 3NK3A 3W82A 4K15A 1IFRA 2OSLB 2GI0A 3BW9A 3HLAB 3A23A 2GCYA 4ZUWA 4MDRA 4F27A 1NGWA 3ISYA 3N85H 5IZ7A 2QFPA 3IJYA 5DZNA 3S4SB 3VGEA 5JHDD 4OZFH 4Q8BA 4QLRA 2WK2A 2WXNA 4XE5B 4P23A 3W9EB 4IIQA 2YOCA 1H5BC 2EXTA 3LRLA 3T2NH 2A0LC 2WO4A 3RWHA 4Y5YC 3H53A 3DV6B 1YYML 2E0PA 3LQMA 5DRXA 5IW6B 4AEHH 3CIAA 3DK2A 4LEXL 4CBPA 2QPEB 1Q9OA 4JPVL 2IAMA 1KIQB 3T2QA 3MLTB 2PW2A 3ZE1E 3WN6A 1CF8H 3Q6FB 2XN9A 4GOSA 2VB5A 4XE0A 1FFPA 1OD7A 4M1CD 4LK4A 5B3SB 1XWVA 4ZDHA 5HGBA 4QRQB 1EZSA 5GZNC 1MJ8L 4BQ8A 1WITA 1WISA 1CDJA 4Z76A 1EERB 4KXZI 4KQ4L 2PYFB 4CMHB 1I1CA 4Y4FB 2DLFH 4PJAF 5GZOA 4MVBD 4DZBA 3D3VB 1G7LB 4EF3A 1SN0A 3SEPA 4ZAKC 1UUNA 3QUXB 1ADQL 4PG2C 3WIIH 2E9JA 1MCFA 4H88H 4WK0B 3ZE1B 4O02L 1CD8A 2YGOA 2VABA 5IK3A 1GS6X 1ZCRA 4KTYA 2BY0A 3SQOL 1TCMA 4D0BA 4WSJA 5EOCH 3CFCL 4L2LA 3FB6B 5D1QD 3HMWL 1BMZA 1PSKH 4K4KA 4WO4B 4OM0H 3U9UB 4TLKA 2B14A 1JXFA 1YMHA 2LGNA 1Q4NX 2A5UA 3UAJA 3FCTB 5CJQL 3GINA 1GIGL 3V0WH 4Q9RL 1MFBL 4U4BA 4QXVA 1WFUA 4ALAL 2WLNA 4QCIB 5DQJA 2ZP8A 1RJZA 4GW5A 4PR5A 2VR7A 7FABL 5B8CA 2VNCA 3CFKB 3QPXL 5C0CE 3UEZA 3MV9D 2HT3C 3OR7A 5C07E 2HJFB 3SDYH 2M8XA 1HNGA 3SBWC 5AW7B 2BFVH 5LGKA 3RVUC 1H6TA 5BPPA 5BRZA 1KYUA 3CZUB 1JGEA 2QHRL 5DWPA 4DN4L 1HH6B 1P7QD 3S0PA 4OCWL 4PLNC 4KNQA 2B59A 4H2AA 5EO9B 5H94A 4JHUA 3VSUA 4YDVB 5LVEA 4LCWA 4R3SB 4ODTL 4HCRA 2FQGA 1WT5A 4NN5C 2CLVA 1JF6A 3P9MB 3ZIMA 4Z7UE 1RZIB 1KCVH 1ULVA 2VJXA 1HNFA 3VRIB 2VR4A 2H0PA 5ICXB 1LJMA 5T3ZH 2QGEA 4CKQA 2VLRB 3QHFH 3PGDA 5CU5A 3APMA 3N1MC 2W60A 5CJXA 2D03L 4PW4A 1NCAL 1XR9B 1BAGA 1BVKB 4J6IA 1LHZA 1A22B 1DN0A 3HVDA 1UA7A 2ICCA 4DW2H 3UBGA 3RPIA 4DTGL 1EHLH 2WAHA 4V11A 3O8XA 2H6UA 2WV3A 1VB9A 4CJ1A 4NWUL 1UXMA 3WFDH 2PPCA 2NNCA 4F9PC 1QA9A 1DBMH 1YQ2A 3D85D 4YHYB 1FDLH 1A14H 4L4TE 4EI5D 1FNEB 2A7BA 2ZWNA 4YLCA 3D50A 4G5ZL 1Q0EA 2O5NA 3FUEA 2J88H 3BSHA 4ESKA 1RLWA 3HI6H 1SEBA 3IJSB 3OD3A 4YO0A 3X11B 1IGIH 4TTDC 4IBLT 3T6VA 3S35H 3WNPA 4UT9L 3CXFA 5FUCE 2PUQT 3GWJA 5PAZA 3VXPB 3L9YA 4PD4K 1DR9A 1BYOA 1YY9C 5BMFL 2YD4A 1TYRA 4OJFL 12E8H 3D05A 5JLZB 2J1YA 4HS8H 4O2FA 1QSEB 4M1DL 1TZIB 5C0NC 2J1ZA 5D7HA 4TULL 3T0VA 4K9EC 4LLVB 1ZHLA 4JLRA 3RGVA 4O51A 1AZZC 4MNHB 5F7DA 4GLRI 1XF4A 4X7TA 2P8MB 5IM7A 2O5XL 3WL9B 1R5IB 4BGDA 3OAZH 3DARA 3OX8B 1LO4L 4M29A 2V2XB 4X6BA 3RTQD 3QI9A 4KQ3L 5D72H 4KJYA 4WU7A 3BN3B 4DGVL 5I1DB 1DFXA 4PJ8A 3FU7A 4OZGE 2FJUB 4YJZL 4YBQD 5HYJA 1TR7A 4DFHA 3BPCA 3UX9B 1A65A 1DVFC 1FLRH 2VZ1A 2XWEA 2BIPA 3DKHA 4XOCA 4DP1X 1BX2A 3QULB 4GQRA 2IJ0C 3FT4B 2WJ5A 2X4UB 2YEVB 4HCRH 4HKXA 4LFHD 4RGMC 1KTDB 4WRLA 1CL7L 2ZE0A 3QZBA 4Y5XA 3OKKB 1CG9B 4NPKA 5EIVA 3VQ1C 4QYOA 2E9IA 2IDSA 3C6LD 5C9JA 4PJIF 3KYAA 4HF5L 2ATKA 1KLFA 3R0NA 5AD0A 1H3TA 4PP1C 4K71C 1N7ML 3MRBB 4MZRA 1ZLUK 3RX7A 2CK0L 2WLMA 1PD6A 2LOEA 2WYIA 3G6JE 4NP4L 4NP9A 2VZSA 3EYVA 4HYTB 3MCKB 3MBEA 4LO9A 3ARBB 4BQ9A 1CI5A 2EVJA 4JFSA 4ABUA 3KPRB 1IC5H 1SGKA 4U1NB 4BSVB 1H3XA 3MRNA 5KVDL 2R1YA 4ELKA 4NRXA 1L7IL 1LEGA 3FOMB 4LIQE 3V4UH 2IADA 3NCCB 5JOFB 4XOEA 4OFVA 4Q6IC 1EGJH 3P1VA 2X38A 2PO6A 4AQAA 4KQ0A 1MCCA 3VWKB 1T03H 3OL2A 1A6AB 3EIFA 1JZJA 3ROOA 2X70B 3EJRA 3HG2A 2B16A 2EH7H 2NYYD 4AYSA 1XAKA 2H1XA 4D8PB 4AYFB 1F2XK 1KELH 1I8MA 1RU9L 2H26B 4PJGB 1IIIA 2B1HH 3K5SA 2EEAA 5EDSA 3WY4A 3PL6D 3BSZH 2G4GA 3BKYL 1CLVA 4LPVA 5KS9E 4HWUA 4IOSA 2FT8A 4WWKD 3TIDB 1J5IA 5IFJA 3BAEL 3K6SA 1PPIA 3S37H 2JK5B 2P1YA 2Z0BA 4PJBF 1T4WA 4QTHA 3ZYOA 5JDJA 1F6AB 4PMFA 4NM8L 2PYED 4E41E 1D6EB 3FONA 3L3KA 5AVXB 3VTAA 5IP4A 3QYMA 5KSBF 1J5OL 1C9SA 1T80A 4N9GB 1CGSH 1RJLA 5IVXF 1NANH 2HKFL 4PLKD 5GISH 4FFVC 5C8JB 2EIBA 1V54B 1YDPA 4HUXA 4LOVA 3E6FB 5TD4A 1I1FB 2YD0A 1NCCL 1QBLL 2QLYA 4WWOA 4NZTL 3QEHB 2YGQA 3MA9H 1S78D 5F93C 4E42B 3QEUB 1VDGA 5DTFB 1BZDA 2A0LD 4BHUA 3BLKA 4ORGB 4ZSOA 1OAQL 1UXWA 4JE4B 4PBXA 4HJIA 4PLJC 1UZ6E 3SKUD 3QCUH 4NCC1 4Z7VE 4RQQA 4WDIB 1T0OA 1GKOA 2B1OA 4HPOL 4K9JA 2FJGA 5CHNA 4O2CB 5LJYH 3MLWH 3F7VA 1ML0A 3P4OB 4Y1AD 5HJ3A 5I1AB 4JFQA 4YPGA 1S9XA 3AG1B 1CI3M 3FFDA 3LN5B 4PFEA 4DP5X 4Z1PA 1BFOA 4QWWC 1KCSH 4X6CE 3MLXL 4LDCA 1LO5B 3QDAA 4PWJA 3Q2NA 5GZND 1JHTB 4JQXA 4AZUA 4A7GA 3VSQA 2BCMA 5MENE 4HULB 1B9KA 2NMSA 1F4AA 3DO7A 3Q8FA 4APQA 8CGTA 2QR0B 2VDNH 3CBKB 3ARVA 3C5SA 1A6UH 4Z7VB 1M53A 1V3LA 3C5ZD 5J1SC 5HDBE 4YEEA 3VDAA 3F6LA 2XHNA 4UQ3B 5MI0C 4LSPL 3O3DA 3BAXA 4I1PA 1MHCB 1KBGH 2J1KA 2YRBA 3MJ8A 3OHXA 3MLPA 4TUJA 1FHNA 1ITCA 3B6SB 2K1MA 2O72A 3A5VA 1I3VA 1KXVC 4IBTA 1KPUA 1UA3A 5E6IA 4FQHB 1HEZB 3U4BH 5MENB 3ARGC 1IBYA 1CF1A 3EH1A 4K8RC 3QJQB 3HG5A 1AZVA 1C5BL 3D12B 5E8OB 1BVOA 1S9YA 5A16A 1FH2A 3ZKNC 1NIEA 3NPSB 5DJ2A 5DZ9A 2NR6A 2ZYRA 1ACZA 1M9WA 5T1KA 1C08A 3S4SG 4QY8A 4PSRA 3SGJA 3N44F 4UANA 2F0CA 3O41B 5I1LB 3GSXB 2NNXA 1LTXA 1WD9A 3I75B 2XPZA 4UUJA 2CO7B 2XZQH 3LN4B 4KXBA 1OT2A 4XWOD 1XGYL 5IR1A 3SO3B 1S7TA 2ZJSH 3GXUB 3ZN6A 1WEJL 4ZTEA 3TN0B 2PR4L 3ATDA 4U1KB 1KZYA 4DKEL 4DVBA 3G08A 4HK0A 1JWMB 4IOFD 2BP0B 5D7SL 4PJ9C 5LN4A 5K9OA 1UCTA 4N8UA 3QDMD 3WY1A 3ZL1A 3QQXA 2G2RA 1MJ7H 1AMYA 4EXPX 3GSVB 3GSRA 3FO9B 3L3IA 1Q72L 1ZHKB 3CN0A 4IDJL 4UV4H 4YNYA 4L1DA 4EXKA 5CAYB 2A9AA 3GXNA 3P0VH 5SWQA 1D5IL 2VDPL 5T5FA 3W81A 1P6FA 4X6EA 2EQDA 3BKCH 4Z7WF 3B37A 1CFSB 2ZOKB 3BPNB 4JM2A 1ZA3A 3B3IB 5AYTA 2QGCA 1B88A 1UWGH 1Q1PA 5C2BL 4QKTA 3C6EA 1KBWA 2P45B 4I0PA 4QRFA 6FABL 4TNEA 1NA8A 5J06A 1GOFA 2BSEA 4I3RL 3TLRA 4F7PB 2DQGH 2OCFD 1E50A 3ARUA 4OQ1A 4TTDD 4GG8A 4NUJA 4P57B 1BHGA 4GQ9H 5D71H 4N2MA 4JO3L 3LCYA 4ZFGL 5LDSA 2Q0ZX 3IFLH 1JTPA 2MKLC 5G2NA 5LAPA 3WU1A 4BFFA 2WGNB 3AU1B 3OKMA 1O7SA 4NRYB 5EPMA 4B7LA 4BFKA 2RGSA 4ZUTA 3MUY1 1O9ZA 1U8JB 3QZWA 5K69A 1E5UI 1KC5H 1OHQA 1E4WH 1QRKA 2ED8A 5AVYB 5J6GB 1CO1A 1CFVH 3FTGA 3FL7A 3QR1A 2ZAHA 1P1VA 3NCFB 4I4WB 3VXQB 4A1RA 3VFRB 3O3AB 2DD8L 1D2OA 4KXZH 4JRFA 5DT1L 2IOOA 1A1MA 3AAZB 4QOKA 5C0AD 4NAJA 5TE7H 4L3EA 2NY7L 3PABA 4IRSA 2FX8H 4PTUB 2HYMA 4LT7A 3V4PH 5DLML 2NX5E 1WIPA 4LPUA 3QRGL 4W9LC 1U91A 1FGNL 2OTUA 1RZFL 3AITA 3N43B 3VXUA 1E28A 1KIPB 4U3HA 5E9AA 5IQOA 1CFNB 3L5XH 3IDGB 3SPJA 1MW2A 3WTSA 2XZCH 4YE4H 4FDWA 1AZRA 4QIRA 4GO8A 5JUEH 1UVQA 3MA7A 4FNUA 3MLUH 1OQXA 3L3OA 1EFXA 5DK2A 5CCJA 3QHZL 2I27N 2VDOB 3ERXA 2CUIA 4TOYL 1JNJA 3O6ML 4IGBA 4M8VA 1L9SA 1F86A 4AJYV 2NY4C 4JZOA 1DL7L 1C5DA 1X7SA 1T0NA 1VJSA 3MZGB 1HHIA 2DRUA 4W6YB 3ESMA 3GD1C 2NX5B 1ACCA 5T5FH 3I6GA 4BCXA 3M46A 2J73A 4JN2B 5FM5O 4OLXH 1L9PA 2ZX8A 3LH2L 1BREA 4YHZH 5E5MB 2XKUA 2UX6A 4PJDF 3A24A 5DS2A 2IH8A 1CDCA 2AJVL 5EU6D 3BP6B 3X17A 4UIMA 2W1NA 1DVYA 2EIKB 2ZOOA 1QZ1A 4ODVH 4YUEL 3NQIA 2X6BA 3WMQA 1OANA 4R5XA 3PWJB 1NLBH 5I75B 3QZOA 1G6VK 1I9JL 2CKBB 3F7YB 4Y2DC 2FX9H 4I89A 1J8RA 1KGYE 1NWPA 1SJEB 1TSRA 3CH1B 4Q9QL 3MV7D 4TVPE 4C47A 4CC4A 2P24B 3ECUA 3FO0L 4IU2A 1MQKH 4JGUA 3KDMB 1H8LA 4YEFA 2IMMA 3ALWA 3AB0C 2D9CA 1FYHB 3DSNA 2Y2TA 3LKOA 4QYAA 1KENL 1OM9A 2WXLA 5A6IA 5BVPH 1F6FB 2BNQA 1T89C 1E40A 4GW4B 4DGUA 2VLMD 2IWFA 3PQYB 4WI3A 4GBXB 4QHUA 5AW1B 3IE4A 2CH8A 4XP9H 2MPVA 5K1VA 2FR4A 3DVIA 1CJYA 1AHWA 5B1JA 1MQ8A 3DGGB 2HFGH 1TQTA 4OB5L 4G1EB 5CGMA 4WZ9A 3X12A 3E8VA 5DHEA 1PEZA 3UTQB 4JFPA 4WI8A 4NDMB 1F3DJ 1U33A 1NEUA 4F8TA 4ANWA 3BUYA 2MOVA 2CAKA 5ID1A 1CR9H 3TV8A 4D0CA 1SMDA 1J1OH 5HVHB 4J4PA 1K72A 3SPVB 3NA4A 5FF6A 4UZUA 4HQQH 4NQXA 2PLTA 1GYAA 4HBCL 2V2TA 3UTTA 4LBEA 2VQ1B 1HOCA 4L4JA 2XV0A 4ZFFA 1JV5B 2B3IA 1CLZL 1QI4A 4G70B 2HCZX 3CWGA 4HMEA 4PGBA 1IAII 4HD5A 4FXKB 1J8HB 3E1F1 1CN4A 4DKFH 1J1XL 4GLRH 3SDAA 3ZY7A 4PLJD 3DIVA 3EO0A 1QFWI 1KFAH 5DJZB 3P11H 3NJLA 1I3RB 3O4LE 4GKZB 4LHUB 4NQVA 4CMHC 4F8LA 4Y4FC 3FT1A 3QQDB 4MSWB 2YSTA 1E9OB 1CGXA 2BVTA 3QUXC 1I3GH 4MJIE 1AGDB 2QTVA 2MCPH 4OGQC 5A2JH 4R8WL 4ETQA 1DQMH 1OW0A 1Z9LA 1BFTA 2AV7B 1F00I 2F08A 1KF9B 4IEFB 1A7PH 1V8HA 1SQMA 4W1TA 4ANKA 5E2TL 3WEMA 2O1AA 3O2WL 3KDPB 3KPQB 2MRYA 4WO4C 2X2IA 4OY9A 3SDXF 1R1CA 1NFIA 3E9TA 4W4NA 3WHXA 3VDBA 1XIWB 1WZ1L 1FVEA 1F58H 3HZVB 4KY1H 1OT1A 3IGLA 3KJ4B 3BJ91 2XQBH 3K91A 3O3UN 3ZTJH 4GRMA 2P5PA 4MJIB 3CSYA 4MCMA 4NI3A 4R7LA 4P46A 1TZ8A 1N64L 3JSSA 3QP3A 4XXCC 2WJ7A 3VXOB 5C0BA 3WS6C 4YXLH 3UJJH 2EIZA 2NPLX 3K4ZA 4MNGB 3N9GL 1P4LB 2VN6A 1AZNA 3ZKND 1ZV2A 4Z7NB 4P2CG 5IOPB 2NW2A 3D33A 3L4ZA 5D6DC 4FQIH 3LNEA 3TVMA 4HKZA 1SLUA 5KSAA 1FRGH 1JS4A 1HILA 2VQ4A 2DQJH 1Y1UA 4K5MA 4PB0L 1GJWA 4ZX5A 3P0YH 3Q06A 1YVLA 4IHBA 4NQSA 3PDOA 4DP7X 2X4SA 3HG1D 4KNUA 3MGOB 1NKRA 1TMCB 5DZLA 4HXAL 1AY1H 2DL9A 2BMKB 4FLQA 4G9FB 4WWNA 3DIFA 1B90A 2IF7A 3PE9A 3TO2B 3TBYB 1UFGA 1KZQA 3V6OA 4KDTC 2W9EL 3IYLW 1M2VA 2ITFA 3EH3B 4XAWH 3VXRE 1KFGA 1G7IA 3PNRB 4YHYC 3DX8A 2VDQB 2OMBA 5HVFB 3MMEB 4MHHI 2ROYA 1INDL 4PMEA 4O5LH 2YA2A 2WMPB 2XBZA 2WGXA 3WJJA 2BOBB 4M1GL 1JGVL 1PL3A 4UDUA 5AOLA 3QG6A 4HK3J 3JV4B 4G72B 1RERA 4W68A 5BZZA 1QTPA 3PS6A 1J5HA 2ZSVB 5TE6L 5TF0A 5E1AA 3GUTB 1A4CA 2FGWL 1NBYA 5C0JA 4GIPD 4K3DH 4AH2B 1QFUL 1HL4A 3VD0A 4JFVA 1O7VA 3LRMA 3B56A 3ES6A 2APTA 2PXYA 4JKWA 3QUGA 1QEWB 4YSOA 3STZA 3VXRB 1JNHB 5KBLA 5FM5M 4EJ1C 4J3UA 4JREB 1DE4B 1ZE3H 2AXGB 1U8PB 4L8BB 1FNSH 2N0KA 1OEZW 4XAKD 2WXJA 4N2AA 4HT1L 5EUOE 5F9DC 3FSVA 2EIMB 4GI8A 2YC1A 5I1JH 1WBZB 3POHA 3TYGH 2MQ3A 3N85L 3B1TA 4GUQA 4KDVA 2P7TB 1Z3GH 4LCIL 3DGCR 3G3LA 2G3ZA 1KXTA 1MCKA 25C8H 3NSXA 5BXFA 4U1HB 3N1GC 5CKGA 5SX4I 3T4YB 3T2NL 2Z34A 3AT8A 4U05A 4Z7OB 4PJCA 3K71A 4IBZA 3MX0A 3R4DA 5SWSA 5DJ0A 2L7JA 4AEHL 1ZK5A 3RY6C 1P6AB 5INDA 2J2ZA 4UNTA 4KK9D 2CJUL 1T6WA 3PDGA 3QQ4A 5EUOB 5F6HJ 3BP7A 3UBFA 3GLEA 2G30A 4TNWK 3W57A 3PNWA 5KJ4A 1HHHB 4MRBA 4XOAA 4FQPA 2R8SH 4EPSA 2EYTA 1QWUA 1BBJB 5DQ9A 1ZVHA 4P5KB 4L0YA 3QZMA 1QUNB 3QDJA 4X5XA 2DLFL 1HSAB 4MWFA 5IB1A 3ARBC 4S10A 5IMKB 2C9RA 4FQLH 4DVRH 3K81A 1ZHNB 4KTGA 4F20A 4RX4D 5IEHB 3PG2A 3FN9A 2GJ6A 1Z5LA 4JG0H 1F4WH 4RRPG 4PTTB 1NFKA 3LKPB 4DZ8A 4ES8A 5EOCL 1ANUA 3AS3A 4OT1H 4UINH 5TDOB 2CBOA 3U46A 1N5YH 2MMXA 1PSKL 4JN1L 1NC4D 2Y1VA 2NQ3A 4PJHA 4U6TA 3VG9B 5HHQB 4K55A 3B9KB 3KGRA 1PX4A 4HG4K 2ALAA 5DUBB 4PG9B 5DEJA 4Y2DD 3V0WL 4BSJA 3W0WB 3SYPA 3U2SB 1OP9A 2P5EA 4G2AA 4ZXBA 2Y0SA 4GSRA 2P48B 4HAKA 3P9LA 3D52A 3VXSA 5A2IH 1YMMB 1MJJA 4Z3GA 1YQVH 1MZYA 3IGAB 4P2RB 2NOYA 5D96B 4C57C 4GUPB 3SDYL 1SRDA 3HR5A 3DHUA 3WDHA 2BFVL 3QUZD 2IPTH 2OL3B 1BZQK 3PHSA 4KH9A 4Y4KC 4UNUA 3U9WA 1M7DB 5FFGA 3UROR 1FC2D 4QRSA 1MFDH 1T21A 1FG2A 2B39A 4WF7A 3FB7A 4KNTA 4Q9BA 1T66C 1K4CB 1KCVL 3RIAK 3VH8A 4PJEE 4NLAA 1UWXK 3BX7C 3IMRA 1SLVA 1ZLEA 5E94A 1F02I 2FIKA 4XXWA 5T3ZL 5I8OL 1OTUC 1TU2A 2Q86B 4EUPA 3EF7A 2VMCA 1O6TA 5CKAA 2BHFA 4XPBL 1MCJA 4KNSA 4DW2L 3FHAA 1EHLL 1J5CA 3FO2B 2XC8A 3WFDL 3WNKA 2WOBA 1DBML 1F3JA 2ZOLB 2NNFA 1NGQH 2BP8B 2FSEA 4Z0BH 3UPCA 4MB5A 3DPBA 4YFLI 2J88L 3HI6L 3IPEA 3LNFA 4A2MA 2V9UA 3SDDA 4DOHE 2FTAA 1IEBA 3GSOA 1IGIL 2CA4A 3IDMB 4KK5C 3VRLF 2F61A 2IH1B 4XVSH 5J6HB 4ODWB 3RVTC 3PGCA 3SPHA 4YDMA 5DA4A 4B6ZA 1L5GA 2AXFA 3L7FA 1NFDA 1E0OB 4M4PA 4XCEA 2OMUB 4KITB 12E8L 1F4HA 1SXCA 3IPFA 4HS8L 3GBMH 4OCRL 3WE6A 5L7XL 3O6LH 4Y4FD 4YHKH 1UACL 3QNYB 1IEAA 3BP5B 3JWOH 3D3VD 3NFNA 2EDYA 3O6KH 4NPYA 4R83A 1SJHB 4I77H 2XPYA 3ELAT 2NUPA 2VM3A 2EICA 3QUXD 5BO1H 1JZDC 1OAZH 2IFFH 1GW6A 2FT6A 3KH3A 1IARB 3BFOA 2FRGP 1NDGA 5HHMD 4L1LA 1G7HB 4UTBA 1UM5L 1A2YB 3BZFB 4KMTH 4UCFA 5TJWK 3S97C 3UMNA 1JZ6A 3OTTA 4PP2A 3WIAA 3VFUB 4WO4D 2ZX9A 5D72L 3VFOA 2OJZH 4X6FB 1ET7A 2RCSH 3D4CA 2CGRH 5EOTB 2FD6H 3GSUA 4TN9A 4GRWE 2DIJA 4MAUH 1B4JH 5EU5B 1FLRL 1KYDA 4HKBA 2X7LB 3UYRH 2CJSA 4X9GA 1S5HA 3NPSC 5ETUA 4HCRL 5G4OA 2C9SA 3QJTB 5FKAB 1JDDA 4B7IA 3UAEA 4ZFOB 1UC6A 1V27A 3DX7B 2KC0A 1LGVA 1IAOA 1HXMB 1CFBA 4MBOA 1KLGB 4WTZA 4Y2NA 3S3BB 3IETB 4U1IA 3E2HB 4ZQTA 1I53A 1JCKA 3MRJB 4R97B 4EUPH 4RAUA 4QUOA 5GRXG 4IHOA 3FPYA 4L8CA 1P7KB 3SO3C 1CYGA 4U0RB 4N0CC 5KYXB 3S96A 5EV7A 2EVFA 2H45A 1JERA 1SYVA 4N9OB 4ELDA 3TBTA 4GRWB 2D3LA 4XI5C 4JDEB 5I66A 5HSFA 1XF2B 2VE6A 1IC5L 3TZVB 5IQ7H 1L9TA 1U4FA 3B43A 3PV6B 4H44C 4N8CH 5CZKA 5E51A 5E6UB 3V4UL 1EDYA 3KLHC 3P02A 1BJ1H 5C1MB 3KM1A 4HV8B 1EGJL 2VLRD 1RUQH 4PRPE 4PJGF 5GGUB 3DJTA 3UZQA 4LHUG 3I50H 1NIBA 2EH7L 3QSKB 1YPZF 3HG1E 4HIXH 3MRCA 2DL2A 4X4ZA 5I9QB 4K07A 3P3SA 1KELL 1CDYA 5GSVA 3ULUE 3GNML 5TDNB 4E9TA 1XF5A 5H4ZA 3PWVB 1FFRA 4PW9A 5CGBA 2B1HL 1KJMA 2ZXQA 3PRZA 1ZHBB 5FFLA 4MD4A 1DQTA 4N2CA 2ZWZA 1NSNH 3BSZL 1IKNC 3HBQA 2XQYK 1XGQB 4GUCA 4S0TD 4HVBA 1P9MC 4MQ7B 4UTBH 5E8NB 1J05A 2A4CA 1XTMA 3T1FA 4OGYH 4BK4A 4XNMB 4FTVA 5F7NC 3K8LA 4OR1A 1MLBA 2XT1B 2R23A 5B3NA 1QSED 4N25A 2ARWA 2IIJA 4K3JH 4PY7A 5JIPA 4PGCB 4HA1A 3LZLA 3TBSB 3MDJA 1TLKA 3WCYA 2AZAA 3GMRB 4MAYA 4FS0A 1Y6KR 1CGSL 1A1NA 1QFWH 3VB9A 2P80D 5GISL 4MA3B 4WGVB 3QDHA 2HX9A 3WIHH 3I9PA 4OGZA 4DP6X 2VXUH 1Z9SB 5KN5A 4XAKE 4LLAA 2VIRA 5G4MA 5ABAA 4JKNA 3MA9L 1K8IB 1NTDA 3FOLA 1K8DB 4Y2OB 4KY2A 3L5HA 1N67A 2NY2C 5DJ8A 2P5WD 3BAWA 2CLZB 3Q13A 3DVGA 1RI8A 1S5IH 1PZSA 1G0DA 5ACZB 3MLWL 1UG9A 2BNUA 2EINB 1WUZA 4AYDC 1JWSA 2IDFA 2M26A 5C0RL 3KL0A 1PKQA 2KQMA 3PXHA 2GIMA 3IS1X 2ENSA 1KCSL 3CVHB 2R0WH 3IWVA 1ADWA 1RCYA 2FX7H 3IDNB 4GFXA 4Z7VF 5HYIA 4NEHB 1D7FA 1FSKC 4P2AA 5IGXH 4H1LB 2R29A 3ARBD 3KVQA 2VDNL 2ID5A 1G9NH 4KVCH 4XC1H 1DLHA 2WXPA 5H37H 2OYLA 1A6UL 3T8MA 4IOIB 1DJHA 2ATPA 4NNYB 2XVLA 5DRZA 1TFPA 3DROA 5I75C 1S9VA 5DFVC 1WC7B 2KH2B 3VI4B 2QSVA 3ZR5A 1Y6NR 1KIRB 4ONOA 1VGKA 3TESA 2OSWA 1JFHA 5DR5L 1H15B 1JOIA 3BT0A 3U4BL 4AGLA 1JF1B 1I8LA 2XN1A 2QADB 2DWXA 3EJPA 3GSNH 5E6SB 3X14B 4FFZH 3UMTA 1ACYL 3H9ZA 2M83A 5HGAB 1GZPB 3K72A 2ZAGA 5AG8A 1E5CA 5JW4N 4Y5VA 1IQDB 4HJEA 4JO4H 1NGWB 5H35B 3LEXB 2O6EA 2JE8A 3TS8A 3KS0H 5SX5H 3IJHB 4GBXC 4OZHA 4LRNH 3PWLA 2YRPA 3TWCL 3ASWA 1U93B 2P4AB 2RMNA 4NKDA 1R3JA 1UB5B 2XZQL 4X9BA 1AQHA 2ZWSA 4OAWA 3BGFB 1W8NA 2WXQA 1HDMB 2R56H 2HMID 2FL5A 2HRPH 2BVQA 2ITCB 3QZNA 4HLJA 4Y4KD 4YR6B 1FFOB 3MUZ1 2ZJSL 1KMGA 3EW3B 4ZPVB 4G7YH 4P2OB 4YSAA 4OBSA 2LFGA 1N12A 2PABA 2WZ5A 3EH2A 5FO9A 4HPHA 1A7OH 1HI6B 1OAYH 2WZ0A 3MV9A 3RDTB 3WFEH 4F5CE 1M56B 3QZPA 1SOQA 4W9ZA 4GKNB 1T66D 2E7LA 2X4RA 2BVYA 1G1CA 1WWCA 2AJSH 1P7QA 3UZVB 1MJ7L 3IDYB 4UV4L 5D7LE 5IT2L 5KZCB 1OTUD 1TTUA 3F84A 3P0VL 3VSVA 4LCCA 4NBYB 2VR9A 3DBXB 1GYCA 3FQWB 4AIZB 3D6GA 2P9RA 1WBXA 3BKCL 4JCLA 4FXKC 1UGKA 3LQZB 4EO5A 3KD4A 3X1GA 3Q6GH 4NNXB 4HJSA 3Q3GA 1UWGL 1IBGH 3BQVA 4H8HA 2R29H 3IFOB 5F7EH 3DTDA 4ENZA 2OTWB 1PLCA 1YEHL 4N0YH 4RMWA 2DQGL 1OB1A 1R24B 4Z5RA 5KYYA 4C4KT 2XI9A 2VQTA 3T0EB 1O7DE 1OCZB 2BNRE 3JV0A 3WD5H 4KK5D 1ZPUA 5SX4H 1SJMA 5D71L 2R2BB 5D7LB 5BNXD 1A7RH 3IFLL 2E4TA 3D85A 3RVTD 4E2OA 1EMTH 5PCYA 1JPGB 1BD2A 1MRFH 3CUPB 4HX1A 1F1AA 2XY2A 3KWXA 3H85A 2YD9A 3VMPA 3ZKMC 3O3BB 1MAKA 5F2FA 4CVZA 3VFPB 3ISRA 3VFGH 1W8OA 1OWWA 1GSMA 3KL3A 1FYTE 4PN6A 1KC5L 1E4WL 2F6AA 2WWMC 1XIWC 5BJTB 2KZBA 3GLAA 3TV3H 1CFVL 4U6XB 2CDGB 2Z4QB 3N43F 2KBGA 1NBZA 2V8MA 3KJ4C 5KVMC 2BNRB 5C0FB 1ZOXA 1A6TA 3VXTA 3OKNA 4TL5A 1WA0X 2FBRA 4IYKA 3ATEA 5TE7L 4MMYB 3MFFA 2ZOTA 1HQ4B 5HHME 3VACA 5E0FA 3RX8A 1S7UB 4QRTB 1L4IA 3BAKA 4XVTH 1KB5H 4HWBH 1U3JA 4L37A 3RWIB 4U7SA 4CN1A 1H0DA 4JUSA 4JFXA 4Q97A 2CO1A 1H3UA 3RWCB 1KTBA 3QUMB 1GZHA 3L5XL 5FLVA 2XZCL 4NSKA 4GUOA 5I1GL 2CIIB 2P8LB 4XNDA 3BEWA 3CNKA 5JUEL 3MLUL 2GFBA 2WSDA 4WHTB 4DP4X 2B0SH 2VN7A 3CSGA 3W11D 4DETA 2UZXB 2BIQA 4KBPA 1WFJA 2V17L 1GHFH 4XN1A 2BSSB 1SFHA 4ORZC 4MA7H 5EC1A 3MOQA 3QWOB 1IGYA 3DBSA 4MZIA 3SOTA 3UPRB 4JHWH 5T5FL 3WUZA 3FB5A 3KYOA 3BRDA 1OAXH 4OLXL 5E00A 1CTOA 2BC4B 2VWEC 4N0CD 2DBJA 3BP4B 4BH7A 1RV6X 4YHPB 3HZMB 3FH8A 3TEWA 5HGGS 1HT6A 4ODVL 4LSRH 2P8PA 1N4XH 1QOKA 1NLBL 4H20H 3UO1H 1NBVL 5BRPA 1TOXA 2FX9L 3U7WH 5D55A 2IFGA 3TBCA 5BQDA 1OSZA 2F58H 4RA0C 4JZJB 4XXDB 1EX0A 3BKMH 2JV6A 2EE3A 4MCZA 1NL0H 3RJDA 2D0FA 4ICXA 1MQKL 2Z1KA 5IROA 1T4KB 2X2YA 3A22A 3QVAA 2OMYB 4RDBA 5C71A 4FI7A 4UQ2B 1AXSA 3DMMD 4NQEA 3QS2A 1XF4B 2BOCA 3P3YA 4HJ0D 1ZPLA 2W38A 5C97A 3TNMA 4GYBA 4JREC 4JFED 4V1DD 1MVUB 2FZ3A 2JB6B 4X6BB 3CZFA 4FZ8H 4XP9L 4EDXA 1YECL 2XOTA 4MYWB 4AL8C 3NT0A 3OXRA 1RHFA 4LCVA 1P5UC 3IAPA 5HD8D 4LKCA 2HFGL 3AU0A 4MKTA 4ADGA 3QUKB 4XO9A 3BC9A 3HC2A 3LKSB 5HYJB 4JNXA 3LHPH 3U0TB 2FWUA 5LNGA 5KVEL 5EU4B 1BX2B 1DANU 3QORA 3F12B 3HFFA 4UF7C 2JKLA 1CR9L 4WHYH 5CEXA 1HCFX 1J1OL 1PCSA 4MASA 3DOSA 2EYSA 1JZ8A 3RA7H 5AKVA 4K94H 4HQQL 4PWIA 2QPSA 2MKWA 3HE7A 2R2HA 1PBYA 1RZKC 3KXFE 4L8SC 2OQJB 4M6MH 1IEHA 3ARTA 2WLHA 4XCNB 2YPKB 3AXIA 3H6JA 4P49A 1AQKH 4XP6H 1TJGH 4F7CA 2XQYG 2XG5B 4DKFL 3RI5F 1W72A 1FN4B 1DSYA 2CBPA 5G4NA 1KFAL 4PIRF 3TNNB 2ETWA 2NY2D 2UY7A 5MEOA 5CMAA 3P11L 4ELKB 5IHZA 1NUDA 1XH3B 2GY7B 2XIDA 1ID5I 4NO3A 2XFXA 4XO4A 3D25A 4HJJH 1PQZA 2B9BA 1IM9D 3QXDA 3TEUA 1H5BA 2KKQA 1AOHA 1XD0A 2ARJQ 2GJZB 3FU0A 4N1EA 3WFBH 3FQYA 3ARQA 3K0WA 4KI1A 5CSGA 4AEFA 4Y5YA 1I3GL 3B83A 3TC9A 2FH8A 3LV3A 1U8QA 1FFNA 2MCPL 5BS0E 4Y7MA 4OV5A 4Q56A 1DQML 4X0KB 3RVVC 3V0FA 2W65B 1BYNA 1UWFA 1T1WB 3UG3A 4QTFA 2EDTA 1D5ZB 3ATFA 3DSFH 2G2NA 4KVNH 1Q9WB 2D0HA 2PW1B 3VG9C 2DICA 5GZNA 1FZJA 3HZKB 5MEQA 5DFVD 1K4DA 1ZJBA 4FERA 1RPQA 4HAGA 4DP0X 3LKRB 4Z7NF 1KGIA 5HHOE 3MYJB 3AS1A 4ZAKA 4IMLB 2ZYIA 2ADFL 4PG2A 5E5LA 5KBKA 2VDLH 1KJ2A 2D2OA 2QZQA 5D96C 2VISA 1BOGA 1OV8A 3Q8EA 2AAAA 4YXLL 1BLNB 4MX7B 2V5TA 1KBBA 1OZTG 1KEML 2Q6WB 3RIFK 3EOBA 5I2IA 1DDHB 4FMVA 4FQIL 1X44A 1BM3H 2ED7A 3FPXA 3MYZA 5BVJA 1FRGL 3GGWA 3PWPB 4EAEA 4GBXD 4AYBA 3MRHB 1T5WB 3JWNH 3FT2A 5FYJE 3DXAB 5D7KD 5JHMA 3EYUH 5CINH 1J12A 5D2LF 4AGQA 3P0YL 1SNRA 4C59B 5HHOB 4ZX4A 3B8YA 1RPKA 4ODXA 5I71C 1AY1L 5H2BA 1CICB 2MHAB 3KPOB 1WAAF 1OOWA 2VOTA 2OR8A 3M1BA 4ZS7H 5CD3B 1W72H 3GLZA 4ADIA 1B6DA 3CSTA 2EUVA 3F7VB 3EFFB 2WTOA 2Z31B 1J86A 4XAWL 3ARFD 1XCQB 3TEXA 4CAGA 4ABVA 3OQRA 1U8NA 4A2GA 1VFUA 4O5LL 2FCBA 1QAWA 5E9NA 3MV8B 5AEAA 5M7QA 5AVWB 4PJBA 1AR2A 1UASA 4HOMA 4H1LG 4IBSA 1N0LA 5MEPA 4JB9H 3QDMA 1OSPH 3O9WD 1AACA 1ZGLA 3ML9A 4AUJA 1R46A 4FEMA 4B3VA 4NC1C 1NBQA 4QRRB 4K3DL 1UWEH 2EZ0C 2N7AA 4XMKH 3BZEA 1WJ3A 3FQTA 2R1XB 1R3HA 3DVFA 3TTSA 5T1DH 2CHZA 1VAHA 2XTSA 1MEXH 1X3DA 2H0FA 4TUKH 3SE9H 5IVXA 1YG9A 4BFNA 5HVWA 1Z0NA 1FNSL 2Z4TA 4F9PA 1FL6A 1AKJD 4KI5D 4XNXH 3GLDA 1E3ZA 5I1JL 4NXSA 4XZUB 5ITFB 3TYGL 4Z7OF 5IJCC 1RIVH 5LAXA 1Z3GL 1KJ2H 1O6SA 3B5HA 2WWOA 2A1WH 2AQ2A 2CHDA 5DRNA 3RPKA 4X7SL 2WWMD 1XIWD 25C8L 5EUOF 3QJUB 3GEFA 3L4UA 5AVZB 1XZ0A 5LXGH 5I0ZA 1RZGB 4NHCH 1PY4A 4O2EB 3LD8B 3NJIA 1TXKA 4GFTB 3WTTA 4X6DF 2W07B 2HX7A 3EH5B 4JPWH 4F8PA 4G8FB 5ALCH 8PAZA 2N4IA 5IR1B 2VLKD 3PGFH 3IXTA 2G5BA 3Q9QA 3TYFA 3UFIA 5IKCA 3N55A 1AXTL 5FO8B 1J9TA 4Q89A 3E2HC 1TCRA 1QSFE 4JRXA 4R97C 5B21A 4HWEH 4FEIA 2R8SL 1L9NA 4P4RB 1GVIA 1RK1A 1PG7X 3HPJA 1CC3A 4ZT1A 2O26U 3NCWA 4U0RC 1BQUA 1Z0MA 3LS4L 3BWZA 3EBIA 4FQLL 3OLDA 1BIHA 4DVRL 4J7RA 3TZVC 4DFIA 5C0DB 4IU3A 2XVBA 5D1ZB 5L88H 1A8JH 3HS8A 4JG0L 1F4WL 4JDVA 1DVFA 4WUUE 1A9VA 5I0WA 1A9BA 1TTBA 3KZ8A 4HUUB 4QTIH 4QJ3B 1AC0A 1A6VL 4J8QA 5CJ8A 5ENWA 2YPLA 1WHPA 2XWRA 4UM9B 2W9DH 4JFFE 3CHQA 4OT1L 4UINL 2NT1A 1N5YL 3P4NB 1AQ8A 3DRTA 3KVDD 1WBYA 1GCYA 1AGCA 5I9QC 3KVPA 1FNHA 4U3CA 4N2NA 3FTVA 2EXYD 4A55A 1J9RA 2OM5A 1P7BA 3CHRA 4OLWH 3MRIB 1U95A 3D07A 3M07A 1E65A 4WUUB 3SY6A 3MROA 1YQVL 2K0RA 2R7EB 5EZLA 1XB3A 1WF5A 4CDHA 5CGYD 1Y0LA 2WIIB 3US0A 3QIUB 2CALA 2L8AA 2QV4A 5KBMA 4AGPA 2IPTL 2PTVA 5ANME 4Q6IA 1DUYB 1IGTA 3FTGB 2VZUA 1HHGA 4WI0B 1UOKA 1ZLDA 4NQQA 3FQ1A 3CMOH 1VACB 1U6AL 5GRYA 4J12A 1E2VA 1OPOA 1T20B 3VCLB 4JAMB 2VCOA 4JK0D 1MFDL 1M05A 1OVZA 4WAFA 3HMXA 3SE3C 5L4IA 4B9IA 4ZO8A 4AXWB 3RDJA 5A40E 4MXVF 4JHBA 3HW7A 3L4WA 4HKJA 4R96B 1U58B 1R5WB 3DJSA 2RH0A 1MWAB 4K9EH 1SM3L 4KU1A 2ARJB 4KUCF 4OFQA 4V1DE 3U4EB 4NT6A 4Z7WA 3T04D 2H9GA 1CMOA 4WFFE 3SO5A 3I84A 1W0VB 1AP2A 4KRPD 5DD6B 3GDBA 2F53D 4WNQB 1G84A 3A4DA 4OUUB 5DI8A 1UD6A 1UD3A 3LSOA 2Y36H 3IJ8A 4WV1C 3SQBB 2MQ0A 4JZOB 1NGQL 4Z0BL 3C60B 2VZTA 4JR9H 1XGTA 3CFDB 5EBWA 5JDSB 3UYPA 5DK0B 4GAGH 2KQNA 3CE1A 3L95B 3PHQB 4P48A 5A43C 2H2PC 3G5VA 1HH9B 4ZPTA 3MRLA 4GI6A 3IMBA 1M71A 5J13B 1QATA 3PXJA 4MDIA 3M1CA 4MA1B 3GB7B 2WZPD 2CO3A 4MD0A 4XVSL 5I6KA 3HZYA 4UU9B 3HG4A 4X99A 4QAWA 5EBLA 4X5PA 4CSZA 4YXHH 4YDLC 3GBML 2QQNH 1BWMA 3QYCA 1KACB 4NUMA 1PJ9A 3JWOL 3O6KL 3OPZH 1IJ9A 5F7MC 1P4IH 2A6IA 2ORBL 3GQFA 4ODHH 4YSDA 1OAZL 2EADA 5BO1L 2IFFL 4DPRA 5JW4M 1AO7A 1E42A 2XBTA 4HSQA 1X6LA 3HC0A 3ISWA 5DJ6A 3GTVA 5CEZD 5CCGE 1DFBH 1HHJB 4BYHA 4KMTL 3T0AA 2PWHA 2JIXB 4XB3A 4HSAC 2NW3A 4OFYD 2C4XA 4HIHA 4TPRH 5A7BA 1UB6A 3R8BB 4NIYE 3CLWA 3FSWA 2OJZL 4XMWA 5DRWA 2RCSL 1MUJB 3SKNA 2CGRL 3T2PA 2FD6L 1MHPH 5KVDE 2QADC 3QB7C 1B4JL 1J18A 1KCUL 1SOXA 4Q2ZB 2IAAC 4N1CA 3WNOA 3UYRL 3QQNA 5CIPA 3X3FH 1SHSA 4HZAA 3FW6A 1JV2A 3J27A 3NCYS 4JO8A 4KVPA 3JT2A 2GABA 2Q8AL 3M8OL 5E2WH 2XZZA 3PAZA 2HN7A 4JPSA 4EQ3A 4TRPH 4N2IA 1KWKA 4GRWF 5FYKD 1JFQH 1BFSA 2EKSB 2R0LH 3HRPA 4NQTA 1JZGA 4BXVA 4PJDA 3BGFC 4EIGB 5JOEA 1EEYB 2EXWD 5D5ME 5I0DA 4ZRGA 2J56A 2VC2H 4OH2A 3DUSB 1TENA 1RK7A 1ZXQA 1EIBA 2FB4L 3PWUA 2PCPB 1SVCP 4P2OC 3WN5B 3Q05A 5EN2B 2IAMC 3MNVA 1INEH 4QF1A 4YSCA 3ARGA 4U3SA 3RDTC 5IQ7L 1I9IH 2VR6A 1KYOK 2ZUVA 4N8CL 3CAFA 4JGNA 1DEDA 3D39D 4PJ5A 1OTTD 4FQ1H 2DH3A 1ZT4B 1AQMA 3IDYC 1TDQA 3FQUB 4M61B 2H41A 3DNKA 5I6PA 4M7KL 4XN8A 4AMKH 5FA4B 5L4JA 5DHVB 4KKNA 3I50L 3DTUB 1LP9E 2WB7A 2FNWA 4HIXL 5IW1B 4E9QA 3RYMA 2PTUA 4WUKH 3C09B 5GZOC 3KBHE 4LLYB 3H56A 1N59B 5BOPA 2IANE 2ZX7A 1MFNA 3G04B 4KUCD 3QDGB 2HFEB 3ZZSA 1AR1C 4QXGL 1G7JA 4MJJA 3KYNA 2CK2A 2X4TB 4NQCB 3BLBA 3JZYA 4ETQB 1NSNL 4MA8H 2CM5A 3VD3A 3AC0A 3BI9X 1Q0YL 3T0EC 1P4BH 2GAZA 4PJ9A 4UTBL 5IFHH 1YCSA 5DJYA 1CB4A 4RNRA 4XVJH 2HRGA 4OGYL 2Z92A 3OKLA 1K5WA 3PP3K 2Z91A 2FEEI 2W0FB 4AM0Q 1MCHA 1LP9B 4CU6A 1SVZA 2IH3A 1JI2A 2NLJB 3GKWH 4K3JL 4ZS6C 4QJ5B 1E4XI 2DPKA 2QSQA 4K5PA 5HBBA 4BZ1A 1MREH 3PF2A 4P2QD 5GGRA 1QFWL 4KWUA 4MDJA 1I7RA 1X9QA 2BP5M 3UIZA 2XWJB 1NIDA 4QD2E 2YQGA 1HIMH 3WIHL 3BRFA 3CDGA 5ABZA 2VXUL 2E9BA 4KI5E 2A73A 4AJ0A 1DQVA 4R7VA 1JGDA 5EB9A 4DP9X 1ETZB 1ICTA 2X0UA 4DGWC 4N26A 2XTJE 1T1ZA 1NCUA 5C08D 5C0GA 4YHNA 2GB2A 3BXNB 4JCWA 3OJ2C 1WT5C 4JFDA 1Q8MA 4NQDD 1ZIBA 3POCA 2M2DA 4L5FH 2H6PA 1S5IL 1NUGA 3V6FB 3K2MC 2J21A 1U92B 2Q3ZA 5IHBA 3ABGA 5CJXC 5F7UA 2OSYA 3I02B 3EJZC 2R0WL 2MQGA 2ADJB 3WKQA 2DLIA 4LLUB 4UIKH 3G5ZB 3OMZA 1HCYA 1UD2A 3MRMB 2VLKE 3T77A 2PPFA 1OE3A 3C6SB 3SDXA 3NRFA 3TM6A 3MJ9A 3L4TA 2F54D 1ZWIB 4PJFB 3WEXB 3VI4F 2ZX6A 1NMBH 1KG0B 2A6KB 1BQHB 1G9NL 4KVCL 4XC1L 3TZVD 2HKHH 3O6FA 3SE8H 3PXLA 4DF9A 5ADPH 3AMLA 3I6KB 4NZUH 3FCUB 5B3JE 1VFMA 3FU5A 4OD1H 3AUVA 1CZ8H 1U30A 2K4AA 2AVFA 3D18B 1E3XA 4J3OC 4AK1A 2HFFB 1YNTB 4JZJC 4QXTB 1FL3B 3OZ9H 4ZUSA 4DEWA 4LDEB 3BQUB 1RQ5A 3ES6B 5A2FA 3ZE0E 3STZB 3KPSA 2IXQB 1N5AB 4EE2A 2D7TH 3CJJA 3PWNA 5I1HH 1N18A 1QG3A 3GSQA 2CO2A 5TDPA 4FNSA 1OALA 2XZAH 5F3BA 5JQ6H 4FFZL 1N68A 5JOPE 1OP5H 1TTGA 2GBTA 2WM0A 3F5WA 3UDWC 4E68A 1MPAL 2NNRA 4NO2B 5DMGC 4JO4L 1A7BA 1JNNL 4GP8B 4UMGA 4LRNL 4A6YB 3DX6A 4WFED 2YD8A 1K3IA 4P5MB 2Y07H 1KXTB 4FYTA 2WNWA 3EJSA 3PFQA 1F41A 1KCRH 4NKOA 5JR1H 1LEIA 2R56L 2HRPL 2QELA 5J1AB 2JJUA 3D69A 5JORA 4G7YL 3VA2C 3BVUA 4C56D 4G80A 1ZXKA 2BK8A 1RIUL 1T2XA 3QEQD 4WW1A 1I8AA 3WFEL 4NM4H 3V9FA 1WFMA 1V5JA 4H0IA 2LTQB 3N41B 4YFDB 3RNQB 3QWRD 2AJSL 5LBVA 5ISZD 5AB1A 2VDPB 1YAIA 1T89A 4OFKA 1IIKA 5BRQA 4JY6A 3VX0A 4C55A 3CTTA 1FNLA 1JPEA 3JWDC 1G9HA 3QIWB 4DWHA 1GZQA 4M3HA 4LU5H 3NCXA 5FO7B 3SKOB 2OSLA 4NLHA 5HYQB 3HLAA 3MJ9H 3Q6GL 1IBGL 2GJ6B 2IOMA 3FN0L 2R29L 3P73B 2F53E 4YE0A 5F7EL 3V0EA 3S4SA 1UKQA 4HJ1A 3WJLA 5JMOC 1OGPA 4N0YL 3IDUA 4PBWD 3RB5A 3W9EA 2H2PD 1IL1B 1LK2B 1G9MC 4LEEA 4YZFF 2ISDA 3WD5L 4MQXC 1FIGH 3UGXA 3U46B 3ZOAA 1GR7A 4IRJD 1A7RL 5LLIC 3DV6A 4ELMB 1EMTL 4R90H 5IW6A 5CFHA 1OE1A 1MRFL 2Y72A 5E9DD 4YSEA 1KTRL 2YO3A 2Q7NA 3NCJH 1KIQA 2VN4A 1FPTH 3MLTA 4HUCA 5LN8A 2K6WA 2DYPB 2X9WA 5FFOA 3VFGL 1U42A 2F18A 3Q6FA 3QAQA 4G6FD 3DX1A 4WEBH 3ASOB 4ZXBB 5GPRA 1UJTA 5I1EH 2MH4A 3I9GH 3MUGB 3K5RA 3CFQA 3TV3L 4QRQA 5FO2A 1V7NH 4ERSH 2CRYA 5HJDA 1WLHA 1C5CH 2R27A 4M7LT 4XN2A 5D1XE 2PYFA 3BCFA 3SOBH 4Y4FA 4KKZA 2BERA 1IC0A 3D3VA 3AFLA 1G7LA 3U2IA 4ZFZB 3H54A 1W0WB 3QUXA 3ZKQD 1Z5HA 4XVTL 1A47A 1KB5L 3GSWB 4XRCB 5F0LB 3TCLB 2WOYA 1TZAA 3MRFA 2ZUUA 4QRSB 1AHMA 1CPUA 2D7OA 2VH5H 4CW1B 1OB0A 3VFSB 2O6PA 3OM3B 4YLBA 2BVEA 4YGAB 5IG7B 3FB6A 2Q9OA 3QW9A 1BEYH 4WO4A 3U9UA 2W92A 5JZ7C 2LU3A 1IC7H 1TU2B 3HIZA 4KKPA 4XX1E 2FQEA 1MIMH 3ZW3A 4P23D 3FCTA 4N0FB 1JVKA 4X0NA 4MA7L 2J6WA 4JHWL 1RZ7H 1OAXL 5FYJU 4QCIA 2DI7A 3FT0A 3DRQB 3D7PA 1JHKH 3CFKA 2IAMD 4J3OF 3IU3B 4FG2A 5I6LA 3WO4B 1XR8B 4AM0B 3RDTD 3WS6A 2ATAA 2HJFA 3SY0B 2XN9D 1J9CT 3F64A 2Z31C 3ZRSA 1BZ7B 2JVUA 1B9ZA 3DDFA 1N4XL 4NX0A 3UO1L 2ZG1A 5EO9A 3LNGA 1OCWL 5D6DA 4O58H 1FHGA 3U7WL 3PGCB 4YDVA 1MXDA 2RR3A 1YEEL 2F7QA 4G11A 1SJXA 2F58L 1WTGT 4R3SA 4IKIA 4P06A 3BKML 3NP4A 1DYZA 3WE6B 3T1WA 1JNLH 1MDAA 2Y3NA 4APQC 1NAMB 3P9MA 5GZOD 3G5XB 4R26H 5DD5H 5DD0H 5ACMA 1RZIA 3NEXA 4KKBC 5ICXA 4XN4A 1AR1D 2VLRA 3JTSB 5JPNB 4GW1B 2HLAB 1E8ZA 4LSVL 5B1AB 2NXYD 2WYZA 1BVKA 4BK8A 2D7NA 3T8VA 4KDTA 5DVNA 4Y9EA 1SDDB 4FZ8L 2AJXH 3I2CH 2C8NA 3BD4A 4F15B 1JSYA 3WLWC 4PVBA 1NCIA 1UCBH 5HYSB 2MTAA 4ZYKB 3LXBA 1FNEA 4U1GC 3KLQA 1HOEA 5ADOH 1PG7L 3EF4A 5FK9B 3OC5A 2ENJA 3IJSA 4RAHA 3LHPL 3LEYH 3IB4A 4I2XB 5IY5B 3X11A 4ZS6D 4ZFQA 4X4YB 5DURB 3CFTA 5ETUB 4LP8A 3H9SE 4WJKB 2WLKA 3KG5A 3HE6B 5CD5C 2UWEB 1TNNA 5IJDC 2OMXB 5KVFH 3VXPA 3RA7L 2B1AH 1CLCA 4WK4B 4K94L 4F8OA 3GXTA 3LD8C 3ZXAC 5JLZA 2E86A 1VFOA 1QSEA 1TZIA 3FHQA 1D7CA 4M6ML 2XDHA 1EVTC 1P84K 4LF3B 1A7QH 4P2QE 4LLVA 4YHIB 1YEDB 1AQKL 4XP6L 4CMMB 1TJGL 1M3IA 3KGUA 4LAQH 4LOFA 5SWZB 2BS9A 2L0DA 4MNHA 5I1CL 3RJOA 2P8MA 3OG6B 1A7NH 4POZD 4YL9A 3M45A 3WL9A 5JNYB 1R5IA 2M1KA 3ETSA 3OX8A 2FT7A 5KWYC 2V2XA 2Y5TB 1PLBA 4JMNA 3BUQA 3HJEA 2WKOF 4Y89A 5C08E 4FHKA 4HJJL 1BZ8A 5I1DA 2H1LM 3WFBL 3UZQB 2R0ZL 2OBGA 4PJ7B 4YN3A 4NQDE 3NK4A 3BE1H 3QFDB 1NCTA 3QULA 4WI9A 3ML8A 3RY6A 1E5YA 1F3RB 3S3PA 4D0DB 2X4UA 1ZT1B 3OKEB 3FUNA 1KTDA 2FATH 2XETA 1PZUB 3BO8B 1H6UA 4U6VL 4NUGL 1CG9A 1UJ3B 3DSFL 1J10A 2P42B 4OKVB 4KVNL 3F7QA 1WS7A 1HFUA 5T8IA 4XN9A 5GS3A 1G9EA 1MRCL 2F54E 3MRBA 3M6DA 5A3IC 5F7LB 4NAQA 1S7RB 5FYLD 2RACA 4J3OD 1BFVL 5CZVH 4PRHE 3WDIA 3MCKA 3GXFA 3ARBA 3IE9A 2AI0H 3NEEA 3T3ME 5FGCE 2GJJA 3KPRA 4DQAA 5CSZB 4U1NA 5G55A 2EDFA 4A39A 2VDLL 4BSVA 4KKAC 3FOMA 2HP4A 1MFVA 3QIUC 1TYEB 5JOFA 1FC1A 2XLLA 3OPUA 1NICA 2A38A 2ED6A 1VERA 3VWKA 2KLRA 1A6AA 5DMGD 3E9UA 1BM3L 2I25N 2X70A 2FUTA 4D8PA 4AYFA 3CDFA 4YSTA 3EYUL 4M6NL 1ODUA 4PRHB 4I88A 4OUOA 2H26A 3FOLB 4PJ8D 2WUBH 4KGLA 4YDZA 5HYJD 3S5LB 4ZS7L 4WFEE 4XBEH 4OSUH 1W72L 1ZLUH 4AYEC 3TIDA 3L3OC 1A4BA 5F88B 2JK5A 2YXFA 4TQHA 1F6AA 3SJVE 2PP7A 3C60C 3I85A 1NEPA 3QEQE 1D6EA 4C83B 4G6MH 1QPXA 1CDBA 4B9FA 1E4XH 1LO3H 3IMVA 5GS1B 4FXTA 5ISZE 1PS3A 4G8GB 4N9GA 3MBED 5J13C 4MA1C 1BQHG 1DQKA 1Q90A 1OSPL 3CVIL 2ICES 5C8JA 5KS9A 1MFAH 1Q9KB 4CU8A 3E6FA 1UWEL 4XMKL 1I1FA 3L3JB 2BOLA 3B7RL 3CK0H 3QEHA 3ECWA 5T1DL 4MD5B 2PO6D 2WUCH 1MEXL 1BZ9B 4TUKL 3V4VB 1I3UA 2GW5A 3QEUA 3LS5H 4JG5A 3SJVB 3NA9H 1FO0A 4MQXD 5DTFA 3VFNB 4MS8D 4ORGA 1RSYA 4UWQB 3VI3E 2NSMA 2QFRA 3PJSB 4XNXL 3AREB 3D0AA 1HTYA 2YGNA 4LMQE 4OF0A 1N26A 4WDIA 3FO1B 4TQPA 3CLEH 1E4HA 1RIVL 1XBDA 2W59A 4MCYB 4GQZA 1KJ2L 1LXMA 3P4OA 3NUKA 2A1WL 5I1AA 4WI4A 3BVDB 1YEJH 3LN5A 2ICWJ 1S7SA 3CN2A 4U6YA 1LO5A 4IOSD 2V37A 1KEGH 5LXGL 3VTMA 3FTXA 4AZ8B 1YNLH 1NOLA 2WVTA 2XA8H 3A0OA 4NHCL 2XICA 4ENEC 1F1GA 4MLSA 2IPKB 3LZFL 1AHWC 3QFJE 4CN6A 4JPWL 3WKPA 2VLJE 2QR0A 4HFUH 3VI3B 4F37K 3W38A 3O3EB 1QLRB 4RVBA 1E6OH 1J0HA 3PGFL 4Z7VA 2E56A 2WYTA 1NCBH 4G7QB 2R15A 2V8LA 4FA7B 4UQ3A 4F58H 4HWEL 3QJRB 1MHCA 2ODHA 4J4PC 2LLNA 1ZTXH 3EJJX 3L1FA 5EU7E 3B6SA 5LGJB 1I4FA 2QQLH 2FWOB 4FQHA 2VSKB 5JHBA 1HEZA 2X6VA 5GGVY 3TEZA 1JPTH 5MENA 3MPCA 5DZPA 5L88L 1EDQA 2VLJB 5E8OA 3VYNA 5IJKC 5F1NB 2HWZH 2J25A 1OSEA 2YUZA 4QTIL 3RZWA 5KW9H 3SDAC 2DF3A 4DUXA 2WHVA 3RZCB 2W9DL 4PV9B 2H2SD 4AMXA 3I74A 2X3AA 3LNIA 3O41A 3KWTA 3GSXA 5I1LA 2DIEA 2BINA 2E27L 3I75A 3C09C 4Z5RB 2CO7A 3C8HA 3LN4A 3NIGE 1YEIH 1USZA 3QPQC 4YHOL 5J9PB 3U6XA 3DLQR 1R3LB 2EE9A 2JI3A 2X4OB 3FQRB 3AUWB 4I85A 3NSDA 2AXHA 2A9CA 2WXHA 3O11B 3Q43A 4L4VE 2XN9E 4LEXH 3TN0A 5T3ZE 4J28A 3HS9A 4U1KA 3V0HA 3AXHA 1VCAA 4M7LL 4APQD 1JWMA 1M3JA 2BP0A 3WNLA 3NCYP 5E6RB 3RWGB 1NQBA 4HH9B 2X88A 4KKBD 3MCG1 4K7PX 4ZG1A 5IJVB 3M86A 3GSVA 4QRRD 3FO9A 1ZHKA 5EO1B 4UYPA 3TCXA 3C8KB 1RXLA 3CMOL 4KZDH 4KQ4H 5D9SB 2EDOA 1CFSA 4HIJB 4RRPA 5D7JB 5E6ID 3Q1SH 2ZOKA 3HHSB 4AUYA 3B3IA 3WLWD 2C7FA 3FXIC 4N2FA 3VGDA 4L4VB 5C3IA 1RUPH 5KAQG 2YOAA 4NUPA 4AV5A 4K9EL 3NEOA 3TBVB 4A7UA 1MCQA 4MB3A 3ABKB 4URKA 4IBYA 4F7PA 1IKNA 1HSBB 4NSKB 4P57A 5ITBH 1QD0A 4OZIE 4NO0B 4QNPF 3NDZE 5DQDH 4G5AA 2Q3AA 1HYSC 1IILE 2AK4B 3CMGA 1ESOA 1TZOA 1DQDH 5JIDA 4P59H 2Y36L 4PRAB 2IV9A 3AU1A 4S1QH 1U8CB 4NRYA 2K9FB 4JR9L 1BCIA 3EDFA 4XVUC 3VFWB 2D7PA 3VB8A 5IV2B 4G9DB 4E9YA 3B34A 2FEDC 3UTSE 1U8JA 3AWEA 3MKGA 4GAGL 5C6WH 4AUUA 1YZZA 1IGMH 2R59A 4JFYB 5J6GA 7FABH 4FG0A 1YLBB 4JDZB 3MJ7B 4I4WA 3VXQA 1U36A 4NZ8A 3VFRA 3O3AA 5BRZE 1CFTB 1G1OA 3HN8A 5ICYB 5TQ2H 1RK0B 3K6IA 5IB2B 3MTRA 4OZIB 4TQEH 1NOAA 3A21A 4YXHL 3AAZA 3S34H 4GSUA 4LCWE 4X5RA 4PTUA 4RZKA 2QQNL 5I16B 5DJCB 1ROWA 3SSGA 4Q58C 4HWZB 3OPZL 1E2ZA 1EXUB 1P4IL 2QDVA 2EUXA 1K2DB 4HXBL 4ODTH 4ODHL 1CFNA 4YBLB 3NH7L 2HLEB 3IDGA 3UTSB 3K1KC 3NTCH 3MRKB 1DFBL 3EGDB 1ZDSA 4JM2D 3ZT6A 5LBSA 2UVEA 2LLLA 4BELD 2UZIH 1EZUA 4BCZA 2F5BH 3NIDE 5JYLA 4QKXB 4TPRL 4I0PD 2BSED 2YA0A 3BQUC 5B39B 2DIAA 3WLBB 5EMYA 4UM8B 1VENA 2WB1A 5A3ID 2NX5A 1MHPL 4G6AD 1C7SA 3KGTA 4JN2A 4RAVB 3Q5TA 3CXHJ 4FL4C 2XJLA 4ANXA 5HYSG 1E27B 3TWYA 1PEWA 4M56A 5E5MA 3X3FL 4M5ZL 2CIKB 4JGMA 4LLWB 2A4ZA 1VRSA 3BP6A 4U7KA 3VFMB 3LZRA 4KKLC 4KKAD 4HZ1A 4TRPL 2Q76B 4RA3A 4XVOA 5F9JB 1JFQL 5CEXB 3PWJA 3NIDB 4W9JC 4QDGA 4XOBA 3F7YA 1ZVSB 4ZD3H 5B38B 5I18H 1UOVA 1MFCH 1SJEA 2VC2L 1F6LL 2PWFA 2WBWB 3CH1A 5BMFH 1R34A 2F9BT 3HE7B 5DJAB 2P24A 2ZZUT 4M1DH 1MAML 2L7QA 3FB8B 4L3ED 1INEL 3KDMA 4IRSD 3MRRB 1I9IL 2W81C 4N90D 3UOAB 2I85A 4YVNA 5CLXA 2PWDA 3VXUD 5K9QG 4Y1SA 1MCDA 3ESNA 4FQ1L 1HCZA 4FJZA 1N8OE 1HXKA 4GW4A 2AK1H 2DZEA 1EUTA 3PQYA 4AMKL 4GBXA 3OB0K 2ZXBA 4I1NB 5L0QB 3K46A 5DEGB 3MREB 1EFXD 4HEPG 4WUKL 1LQBC 4IGBD 3WDJA 3UO8B 3DGGA 2BY2A 1CT8B 3FCGA 4G1EA 4GS7B 1A4AA 1AYRA 1YN7B 3DTXB 4RGNB 3C60D 3UTQA 1TQWA 4F3FB 1HKFA 2OI9B 4IRZA 4M48H 4NDMA 4X9HA 5LDUA 1EEUA 2DLEA 1LP9F 4MA8L 4MXWH 3UL4A 2CR3A 4ATTA 1P4BL 5IFHL 3SPVA 3KLDA 4E9SA 4QLWA 4XVJL 3RVWD 4KFMA 7PCYA 3ZR6A 3LEVH 4HF5H 2VQ1A 3WNMA 1Y7VA 4WFHD 1JV5A 2CK0H 2BHZA 1G6RA 2SODB 1K4DB 2BLFA 4MB1A 3GKWL 4A7TA 4C4BA 1XL4A 3U79A 4ZXBC 2YD1A 1B4TA 2MCG1 2RFXB 5J6SA 4FXKA 1J8HA 5AQ0A 4LPWA 1I1AB 4NNPH 3AWGA 4K7PY 1MREL 1KUMA 2PCFB 2VQUA 4N5EC 4Y7OC 3O4OB 3D4YA 3SGEI 5DJZA 1RP8A 3OGOE 4V1DA 4DN3L 4FJYA 1L7IH 1I3RA 3HC4H 1P5VB 2WCSA 1HIML 1E90A 3ECBB 4GKZA 4LHUA 1W80A 2CMRH 1GOGA 2DWDB 3QQDA 3FFCB 4MSWA 1E9OA 2E59A 1ED3B 3TF7C 4XMLH 2H8PB 2CJ3A 2CKBH 3GS4A 4QHKI 2JJVA 1AGDA 3D06A 4CC1A 4OF8A 5IBLC 4Y9GA 1S3RA 4JKPL 2VRAA 3I9AA 4ONHB 2AV7A 3NSCA 1EJ8A 4ENED 4IEFA 1RU9H 2RHEA 4PRDB 1U3HB 1OKEA 2VR5A 3C5JB 5HDOA 4L5FL 2V5YA 3KPQA 4K8RL 3QAZB 3S5LG 3FN3A 4XXWC 1XIWA 3NIFE 3UEQA 2MNUA 3ETBJ 4N22A 4PJFF 2BSRB 4FLHA 3WO3B 4DO6A 3ARYA 1I7ZB 3ULVC 3HZVA 2HG5A 2WZ6A 4TM9A 2XV6B 3BAEH 3EG9B 3FTYA 4J4PD 4UIKL 2X44D 3P3TA 1WIUA 3GT6A 4EN2A 2V5MA 5ERWB 4PW3A 4MJIA 5CM1A 4XNQB 3UTTD 1TFHA 4CC0A 2DI8A 1NMBL 3QK0A 1F1DA 5IVOA 1FGVH 3VXOA 5GS0C 2HKHL 3SE8L 4AYID 2XV3A 3P30H 4NZUL 4LEBA 4MNGA 1P4LA 5GRWA 3MRQA 3WFCL 4OD1L 1QQDB 2IV8A 5IOPA 3SDAD 1E8YA 1CZ8L 3L6FB 2Q3XA 4KK6C 3LB6C 3GM0A 2Y2YA 4LSQH 2VXTL 2O5ZH 3RU8H 3I3BA 3OZ9L 4BWUA 1HE7A 5EIIB 4LOUC 2KT6A 3MOBH 1QBLH 4HOWA 5LO7A 5D93B 4ZSOE 1GRWA 2D7TL 3QJXA 3VQMA 3QPQD 5JQ6L 2XZAL 4HEMA 3MGOA 2VDKB 2J1WA 2PETA 4ECNA 2XSKA 2BMKA 4G9FA 4NQCD 3TO2A 4NYLB 1QRNB 3TBYA 5E8DH 4BZ1L 2CWRA 4HPOH 1PIGA 2XJKA 5LNEA 3H42H 2Z9TA 3BEVB 4NCC2 5GGVL 5DU7A 6PCYA 4AW4A 5A2KH 2BHUA 2H1PH 2HUEA 2YHGA 4F15C 4R4FL 1URIA 2Z7YA 1WAAA 4B9CA 3UBXB 1KCRL 2DMKA 4KX8A 3MLXH 1EHAA 3QO0B 4E9VA 3N41F 3LN9A 2WMPA 2PWGA 2BOBA 5HHNB 4F80A 5EEVA 4H8WC 3JV4A 4EIZC 3F7PC 3BZ5A 2LR4A 4KV5F 4MXQD 2AC0A 2GK0B 4P46D 1YC8A 3GUTA 3HE6C 1S2EA 4NM4L 3N0PB 3HG3A 1DO6A 1FAIH 1MNUH 4AGMA 1IGFH 3WXVH 4AH2A 2BCKA 5C0BD 2XXCB 3S6CA 3Q2WA 4TYUA 1KIUB 3R19A 4LMQI 1QEWA 4ZO7A 4LPXA 3VXRA 4ZMZA 3WNJA 1DE4A 1YN6B 2J8UB 2AXGA 1U8PA 4L8BA 3TVMD 3WEAA 3N1PC 4R4NC 5KSAD 5T1LB 5CJBA 4LU5L 2AGJH 3MJ9L 1T5XB 1WBZA 1CXIA 4PGJA 3D0LB 3BH8B 1C5BH 1AIZA 5FEBA 5EA0H 4ELMF 2P7TA 4GT7A 1EZVX 2ITDB 2FEDD 3IXAB 4F7TB 4AIOA 4JJ5A 1BAWA 1TTCA 4U1HA 1FIGL 2MTPA 3T4YA 2COVD 2EUZA 3VWKD 4H2CA 4JQIA 3OMAB 1IUZA 4YDNA 1SLWA 1ZEAH 5HGDB 4R90L 5I30H 2WXKA 5DUMH 5FGRA 1FPTL 5E08L 1BXAA 5EUOA 4GEJA 3RWJB 2X89A 5KBDA 1UJ3C 4WNSA 4PS8A 4QHMA 3I9GL 2ZPKH 1HHHA 3P2DA 4WJ5B 3GRGA 5D7SH 1V7NL 3L3GB 3CHPA 4KO6A 5HPMB 1BBJA 1C5CL 3FNKA 4Q9CA 5E7BA 1URLA 3OZLA 4P5KA 5KYUB 3SOBL 1QUNA 1IBZA 1T7YA 2CUAA 3V4PB 3VO0A 2WXRA 5DGQA 1HSAA 1Q72H 4FCAA 5IMKA 4J3VA 4M7ZB 1G0XA 3EADA 4POUB 2VDQH 3N42B 1ZHNA 1DQIA 5IEHA 2IVFC 3FT3B 2AQNA 3EJUA 4HPYL 4A2HA 2AEIT 4PTTA 3H7LA 2JJTC 1QW8A 3LKPA 4D3CL 3FF7A 2EEDA 4MAYC 3ULVF 4Q4EA 1KGCE 5EULV 3RB7A 3L9BA 4LOEA 1R5VB 4OFYA 5TDOA 3TBWA 2WBXA 1BEYL 3QXUA 4KKLD 4YSQA 1QTSA 3A4AA 3A6CL 1USQA 1CDIA 1X4ZA 1RZQA 2NT0A 5HHQA 1MIML 3S8FB 3T6QC 3B9KA 4ZK8A 1AS8A 5FXCH 1T6VN 2BZ7A 1OCRB 5DUBA 4JO3H 4NN7C 2ZP0T 4PG9A 4PWGA 4AVHA 4ZFGH 3W0WA 1J11A 4L1BA 3U2SA 1CGYA 1RZ7L 1SUJA 5SWSD 2NY3B 2NYKA 4AL8H 1D5XB 1MJUH 2QQKH 1WFIA 1YMMA 3THML 3ZU8A 3IGAA 4P2RA 2ZWYA 4GUPA 4HHWA 5CN2A 5EZJB 3ZHNA 2UX7A 5I82A 5MP6H 2OL3A 1OL0A 4WCYH 4QOKE 5IQMA 1M7DA 2DD8H 3B2UC 2QKSA 3LY6A 3QUHA 4IW4C 4L3EE 2E46A 3LKNB 4O58L 4F2MB 5DT1H 1OGAB 1SHXA 4X2UA 3WUWB 5B1KA 4JQIH 5GS1C 1FP5A 2A6DB 2NY7H 1JNLL 4L29B 3MXVH 4JS7A 2OZNA 4R26L 5DD0L 2CR0A 5DD5L 5BQ7A 5JMRA 1RZKH 3F58L 1K4CA 3SHSA 4YDIH 3ZPDA 1DJGA 3S98A 2GJ6D 5E4IA 3V8CA 2Q86A 5DJ6B 3U25A 4Q6KA 4R84A 4HC1A 4P3WA 3OLGA 4UNVA 3TEYA 1L6XA 5KANI 3FO2A 1MCSA 4RESB 5FUZL 2X4PB 2AJXL 3I2CL 2X6CA 5A2BA 5B39G 2ADGB 2JXMB 1YNKH 2Z64C 2MCMA 2ZOLA 1UCBL 4AVKA 4GQPH 2BP8A 2TSAA 1CIDA 2UWEF 5ADOL 1XT5A 3SKNB 2J55A 1D9KB 4P3DA 5KUKA 3LEYL 2DYPD 4ZZKA 3UGEA 2B5IB 1OXYA 2P5ED 2YR3A 4PCSA 5I15H 5D4HA 3IDMA 4TLTA 4ZXBD 3RL2B 5CIPB 5CEZH 4EKJA 1OQOA 4WFHE 2IH1A 5J6HA 3EFOB 2WTRB 4N5ED 4ODWA 4XB7A 5FOJA 5KVFL 1RMFH 2B1AL 5HI5D 1J8SA 5KBNC 2D4FA 4P9MH 4J23A 2OMUA 2CRMA 4OCLC 4Y19E 5FC9A 5B38G 1L0XA 3BP5A 2N0MA 3QNYA 1SJHA 1A7QL 1AG6A 1U3NA 3ILPB 5F3FA 1UWXH 4PV8B 4DKDC 1G7HA 1YYLH 5IB4B 4GPVA 1FORL 1A7NL 1A2YA 3BZFA 3PU7A 4PJ7F 2BNQE 3AQYA 2GSGB 2KZ1B 2E7LC 4U1MB 4FADA 2W95A 1NUFA 4PRIB 1UM4H 3MCLH