3UZEC

Crystal structure of the dengue virus serotype 3 envelope protein domain iii in complex with the variable domains of mab 4e11
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
99
structure length
94
Chain Sequence
YAMCLNTFVLKKEVSEHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKVNIEAEPPFGESNIVIGIGDKALKINWYRKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable domains of murine anti-dengue Mab 4E11
publication title Mechanism of dengue virus broad cross-neutralization by a monoclonal antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 11
structure length 94
sequence length 99
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uzeC00
1Z66A 5LBVA 1S6NA 2V33A 3MUUA 5LBSA 5KVEE 3UYPB 2JSFA 4AM0Q 3VTTA 1URZA 3N42F 4UTCA 4AL8C 2JV6A 4GT0A 2JQMA 1OKEA 1Z3RA 1SVBA 4FFZA 4BZ1A 3UZEC 3UZVA 3C6EA 5GZOA 1RERA 4UTBA 5B1CA 2H0PA 3UAJA 1TG8A 1UZGA 4UTAA 5H37A 4BZ2A 1PJWA 5JHMA 2R69A 4GSXA 3J2PA 3G7TA 1OANA 4UT6A 5KVGE 4ALAC 5IREA 3J27A 4X42A 3WE1A 3N41F 4FFYA 3P54A 3N40F 5LCVA 4FG0A 5GZNA 1ZTXE 2HG0A 5AAWC 3C5XA 2ALAA 5KVFE 3N43F 5IZ7A 5KVDE 2R29A 5JHLA 2GG1A 1OK8A 4L5FE 3UZQB 4UT9A 2P5PA 2I69A 5AAMC 3N44F 3IRCA
chains in the Genus database with same CATH superfamily
2A6IB 5GRYA 5DJ6B 4DCQA 1NBZB 3LEXA 3V0HA 2DY2A 2W65B 3LMJH 4LVOB 4X0KA 3AROA 4LPCA 2VO5A 4Y1TA 3UC2A 4JO5A 3CIQA 1Y07A 3HI1B 3LEVH 5EB9A 1IEHA 4FYSA 3DX1A 5E94B 3MODL 5I76B 2DEWX 2HMID 1SMOA 5DD3L 3V6FA 2HN7A 1KFAL 4QXTA 4NUJB 1RUKH 4JGJA 3VFPA 5D9SB 3VMOA 3VB8A 3VNZA 2I25N 3MDJA 1W72L 1LO3L 2OP4H 4HAGA 1A1OB 4M7JH 4TYUA 2ARWA 1QHPA 2NNAB 4FQIL 2XWTB 4XMPL 5J13B 4BEIA 1IE5A 3RPIA 3A6BL 2BVTA 5DJDA 3RVXC 3GJEB 4F7EB 2H5UA 3VCLA 1XTLA 2PO6D 1N8OE 4YBLC 4WHTA 3BKJL 4DP2X 3HI5L 5GGSY 2J8UA 3THML 4HK0B 1GS6X 1SDDA 2X12A 1F1DA 4FQXA 3H56A 5F9OL 3F04A 2HH0L 3CK0L 4QAWA 3VUAA 1WAAA 2LVEA 3U0WH 1RZGB 1SF3A 2C3HA 4GKOA 3EUUA 3L9RB 4F2FA 5IFAL 3F62A 5DZNA 5JO5B 4YAQA 4JDZA 4P05A 1PCSA 1WD8A 4CSTA 3J2PA 2PCPA 4N5UA 4P3CH 4QF1B 4XWGL 3FQUA 5DYOB 3F6IA 3EFDH 3GKWL 2LU4A 2X2UA 2WM0A 1OY3B 2FR4B 2XQBH 3D33A 1PZ2A 3TVMA 2RA1A 5GQBA 4YSTA 1R4XA 1BEYL 1XGPA 4P0DA 4ZYKB 4CW1B 4F9PC 1ECZA 3L9BA 3P4MA 1HKLL 2XPGA 3OSKA 2ZXQA 3LNFA 4OJFH 1U8KA 3L95A 4A7SA 1KGCE 4NJAH 3L3JB 3P11H 3IETA 4PTUB 3IDGA 4MQXD 1A6VL 1J5DA 4GO8A 1WCBA 3DLQR 5CCGE 5FCUH 4QRTB 3UEZA 4F58L 3O8XA 3QDJE 3IAQA 4O5LH 3AMKA 3V5DA 4DF9A 2X4OA 1M53A 4AEFA 1AXIB 4HD9A 3F7YA 2PYEB 3B6SB 3HB3D 2VXTL 4G8GD 4HKJA 1OAQL 1G7QA 4YHZL 3CFKA 1ERNA 1FA4A 3MJ7A 2MFNA 1IAIM 1RL1A 1V7ML 1ZLUH 3LN4A 1CFTA 2B77A 3QEUA 3I6KA 1LJMA 2FHFA 4I13B 4I88A 1K3IA 4OZFA 1T66C 5CJOH 3L5HA 1R5WA 1VIWA 1ZS2A 1GKEA 2F19L 1F58L 1MAJA 2JMRA 4PJDA 3GMPB 2UWEE 4L1TA 4IKIA 3K6OA 3HMWH 4GIAA 3CD4A 1C8QA 3L08A 2D73A 5FGCE 5K1JA 1R3LB 2NY1D 4PJEB 4FTVA 5HHME 4MVBC 3LIZL 3K0WA 4JRLA 3OLIA 4NJ9H 5KANG 4D0DA 5CCKL 2ZUVA 3MV7E 3SBWA 1OT4A 3MOBL 4KJPD 5E6SB 4DP6X 1U2CA 2NY6B 1KCVL 4WUUB 3GSQB 4QRPE 2UZPA 3T8XA 3DGGA 3EF7A 4YDLC 3TEUA 3QORC 1MHHA 1TCRB 1XEDA 2VTFA 1E4WH 3FT1A 1EWHA 2HVBA 2BSTB 2PPDA 3AQXA 1Y0LB 3BN9D 3FN9A 4HCGA 4PJFB 5I6OA 1FZJA 4I8DA 4Y1AE 4LBAA 1SYSA 1YRKA 1L6XA 5E6IA 4NQCE 1VEMA 1XF3B 4R5VA 4NC2B 3I6GB 3VFVA 2HFFB 1DYZA 1PJWA 2V7HB 1KBKA 2D03H 4Q97A 5J1AA 1COBA 2E9IA 3KH3A 2PYFA 2R4SH 3JWNH 1S4IA 4X99A 3QJRB 4Y2OA 5TD4A 5AB1A 3IBOA 5LBSH 1W9XA 5I1GH 4EKJA 2WLIA 5C8JB 4MNGE 4ZFFB 1DQLH 2FJHA 4Y16B 3HPJB 5DHVA 5HDQH 4PW4A 3G5ZB 2AQSA 1ZVNA 1SOXA 3GJFH 1BVOA 4YGAB 3VFRA 2PWDA 1P0SE 3Q8FA 4G8EB 5HDLA 2AZUA 4J5VA 3DROA 3HC2A 3RE0A 1S9KC 1TFHA 1TF4A 5HHOE 4NM4L 1R75A 2V6HA 4MXQD 2VL5B 3AFLA 4ANWA 4LOEA 3KM2A 5H37G 4G9FE 4ADGA 3FT4B 4S2SA 4X6FB 4JGMA 3FRPG 3P3RA 4DGIL 1EMTH 1UH3A 5EU6A 3QDGA 4UZSA 1A6ZA 3FO2B 1NMCB 4XHJC 3PY9A 3SE3C 3L3DA 1DJXA 3FQ2A 3WIFA 4J3OH 4XPBH 1X9LA 3VXTA 3JV5A 3CFIC 5IEHB 4LOUD 1NBQA 4JO4L 3BN3B 4WU5B 4GKZB 4XBEH 3LX9A 3IJ9A 4G8FB 5L88H 1CU4L 5D7JD 4BSWB 5CJQH 3GBNL 4I9WE 5DA4A 2DICA 1NKGA 2AEOA 3LY6A 4C54A 1QNZL 4BYHA 5T3XH 1U3HD 2XZCH 3U0TA 1FVDB 3BGMA 4C56A 5HYIA 4J39A 1ASPA 4GB9A 3CLWA 4J1UB 4A7GA 2VW4A 4FA6A 1YEDB 3AACA 4YBQC 5I8EA 5D2LE 1J88A 1JK8A 4BFBD 2ZF8A 1E90A 1IJNA 1AXTL 2VDOB 4TSCH 5J6SA 3HG1A 1MIML 1YMME 5F0LB 2AJYH 2QV4A 5DZLA 3OXSA 3TN0A 3RFRA 4FG6D 1EK3A 5CUSL 1OKEA 3QBTB 1E6OL 5EZIL 3MO1A 2UZYA 1JZ4A 5EIIA 3ZHKA 4QRAA 3N85H 4PWGA 1CD9B 1QEXA 3C6EA 4D94A 4PVNA 2KZBA 3QXAB 4B7LA 4L1LA 1GZQB 2J2ZA 3O3DB 3OZ9H 4YVUA 3SDDB 3HFFA 2NNCA 4Z7VE 3FW6A 3V4LA 1AAJA 2Z9TA 3O6MH 5J3HD 1MHCB 3GIZL 4FNRA 2BS8A 1YEFL 1A9BA 4LLYA 3VFTB 3PQYD 4LDCA 3MODH 1FNFA 5DJZB 1KFAH 4KRPB 4JFHD 2YQGA 2MHAA 3SY0B 1JGUH 4U7SA 1GJUA 2NY0C 2CE6A 2HAZA 2X1QA 3BDXA 4DOHB 1UEMA 4DO4A 1LO3H 3QUYC 3GRGA 2ZOTA 5J11C 3KR3H 2K3TA 1NC2A 4FQIH 4XMPH 2VDOL 2F08A 2VQ1B 4ZMNA 3A6BH 3U7YL 2F1AA 1JHLH 2IWGA 3VYPA 3ZR5A 3GMMB 4BDVB 3HI5H 4RNRB 5MENE 3PV7A 5DRZB 2AJ3A 5ICUA 3THMH 4IU2A 4NQXA 4WEUD 5F9OH 3SN6N 1B4RA 3O6FB 5AKSA 2HH0H 3CK0H 5A7EA 1IFHL 2EJ1A 3KVDD 1EEQA 5ES4B 3QI9B 5E9DB 3VXNA 3MRQA 1OB1A 3U6RA 3K4AA 3LD8C 5IFAH 2O6DA 4QRSA 2BP8B 4ZRGA 4N1CA 2P9RA 4LEEA 5HJBA 1CQYA 2WLJA 4JPKH 4GRLC 4LCUA 5J0BA 2R29A 3QEHB 4NSKA 2YUWA 3BPCA 3QIUC 3ARFD 3VGFA 4Y4HB 2NQ3A 2NTFB 3B43A 2V2XA 1OF2B 5D2NB 5SX5H 3UZVB 1S46A 3LEYL 2VDRB 4B3EA 1LMIA 4KJQC 1RUQL 1MI5E 4EIGB 1DL7H 4MQTB 1QSFA 1MWAB 5J6HA 1HKLH 4L3AA 4RFNC 1YMHB 3QZBA 1K3ZA 1OSPL 3GTTA 4N1HB 4L29A 1JWMA 3RWJB 1RZIA 5IKCB 4HZ1A 4RMWA 5D93B 2M1KA 3TO4B 2Q7YB 1TJGH 1U8IA 3VTTA 3W38A 4QRUA 2JV6A 2FEDC 1DQDL 2VWEE 4X6CA 2WBJC 3PL6A 4XGZA 2H26A 3FQTB 3HAEG 2DYPD 2IQAB 4TNGA 2J7LA 5IBTL 2AKRA 4JQIA 2B14A 3FBQA 1S9WB 3MCKB 5INCB 1HL5A 3CVDA 1G6RH 3NG5A 4NQDA 1RPQA 3QUXD 1NFIA 5T1KA 4GEIA 2GBUA 4H5SA 4PRBA 5AVYB 1V7MH 4FYTA 3SE9L 1CFVL 4JHAL 1FFPA 4YPGA 4UZGA 2R1WA 4ABVA 4XMTA 3MOAL 2LU3A 3MC0A 4N9OB 4DP7X 2F19H 3ZE1F 2VDRL 3NSYA 5I24A 1DVFA 4HGWA 1XIWC 1UXSB 1QI4A 1ZLEA 3S0PA 3U25A 1MWAL 4PJ8D 5I17A 2GTWB 3EYFB 4FJ6A 1QP1A 1RZKC 3LIZH 1TZAA 5CCKH 5TFSL 5E5UB 2VLLB 3MOBH 1OF0A 4S11A 1S3KL 1KCVH 2XZQL 4DSYA 2X70A 2CO4A 3J27A 4OFPA 1Q9KA 4LLQB 2AP2A 3GI9L 5IQNA 3T0XA 1WZLA 1AIFA 5JHDB 3VNYA 5L0QB 1E40A 3GXUB 2RHEA 4L4VB 2HUEA 2XBZA 4N0UA 3CVIL 5IUCA 3FU8A 1T89A 3F05A 4F8TA 4XNXH 3EYVB 2R23A 5JIHA 3ZDWA 4R90H 3DURA 4HZLA 4HF5H 4LSUH 4A37A 2DLGA 1R34A 4LHUD 4PRNA 4QNPF 4FNSA 4OH2A 3OHMB 1GGIL 2V9UA 2YRLA 4DUWA 4F7PB 3IGUA 1NCTA 1KDJA 3OHXB 3H9YA 4WW2A 4JM2B 3I6SA 5FO8B 1HHGB 1YEGL 3S37L 1XR8B 3L5JA 4R4BB 4HFWB 5JHLA 1LK2B 3M1CA 4IK6A 4AEEA 5HHXL 3WSQL 4O2EB 3AUWB 1T04A 5BMFL 3IAGC 3IPBA 4RLDA 1BX2B 2AEQL 3ETBF 3KPRD 3H9SE 3NPZB 4H7VA 4NM4H 4UT6L 3C8DA 1OGAD 5CNHA 2E4TA 2GITA 1XFPA 1XXFC 1ETB1 2Y25A 3PV6A 4LZKA 5TDNA 4NDMA 1CXEA 1X7QB 2VDKB 4LCWA 4QYOB 3LQZB 3ARGD 3A6CL 3BEVB 4F37K 2WWOA 5DJ8A 2NLJB 4A6YA 2WXIA 4JKNA 3FSOA 5AVQB 1CICA 2GBVA 3EHBC 4Z95L 2ZUWA 3BGFB 4HUNB 1XB6A 3WEOA 4W9LC 1VEPA 4AL8C 5I6PA 1BWMA 4P3DB 4PYHA 4ZTPH 1SJXA 3RL1A 5C0AA 4HPOL 4JDEA 2EDNA 4ONGL 4YEEA 3LKPB 4F57L 1F2QA 2H32H 2F8OA 4KK5D 2D7OA 5F3FA 1GGBL 4TTDD 5T1MA 1U4EA 3MXWH 3QB7C 3EDFA 4MJIB 5JOFA 3R7QA 2BJML 1MW1A 1K6QH 4B50A 1L9NA 1N68A 3K91A 4WGWB 5FCSH 3WEMA 3GBNH 5E8EA 4Q2ZA 1QYGL 1SYVA 1WWAX 4EXPX 3FH7A 1QNZH 4KDTC 2FWOB 4RH4A 1NKOA 2V3FA 3QJHB 4NT6B 4Y88A 1F6FB 1NBVH 3MBWA 1IC1A 3D39A 3LHPL 3QIBB 2P42B 4K0OA 1AXTH 4Y19B 4F7CA 5IESL 1QFWL 4OZ4A 4GBXB 3VJ6B 4ZDHB 4AQAB 1IX2A 2VDKL 1EAOA 5CUSH 3MRFB 4WFHE 5C0ND 5EZIH 2YC1A 2EDFA 3GQFA 3JV6A 1UZ6E 1UGNA 1X4YA 2V2TA 4XP6H 3EH2A 1KLGB 3BH9B 4MJ6A 5BO1L 2RH0A 5DQJA 2HJFB 1BD2D 3HLAA 2QQQA 3IKKA 4IRSA 4PV9A 4P5RA 1VGEH 3U2IA 4ZBJA 2ESVD 4JLRB 4OIAA 3WDJA 3PNWA 1YEFH 2OFQA 4UIKH 4EI6B 4OFVA 3HS0B 3ZUNC 5IMLB 2WZPD 3S6CA 1ZRUA 5HGDB 1AIZA 4G9DA 4EIZC 5EUOF 2VLRE 1UKQA 2CRIA 1Z6JT 5DHDA 4ADIA 1I85A 4XNUH 1U8JB 4FFWD 1E5UI 3GT6A 4U6XA 4KKZA 5C9JB 1MPAL 4JUTA 4LPXA 2F7IA 1ZWIA 5IZ7A 2N56A 5AVWB 1FIGL 4HKZA 1EEYB 2AXGB 1G7IA 1JUFA 2O6FA 3BUTA 3GM8A 4NQVB 3ARWA 3UTOA 3FTSA 2LAAA 4CMHB 5KYYB 3TCLB 1M4KA 5E8OA 3ZMEA 1Y1UA 4HK3J 1TYJA 3ZHDA 4NZRH 3SZ6A 3BVDB 4LHUG 2IGFL 5EH1A 4CJ0A 3O81A 3KEDA 5TDPA 4XMXA 1AY1L 1AZRA 3UPAA 2BVEA 3NJHA 3LDBB 1H8NA 4RAVA 5KUMA 1I3VA 5LAXB 3FU3A 1AR1C 4N8VB 3O3EB 1H3UA 5I16A 1TQBC 1XWVA 2X89A 2FATL 3BAKA 1EVTC 1T03L 1YNTB 3ATBA 1HDMA 1UCBL 3V6ZB 3PGDB 4XX1G 3ZK0A 5KSUA 2X05A 2LLNA 1YYML 3QS2A 1MCRA 3ISWA 2C3VB 5KSAB 3GINA 5D96B 1WIOA 1RUQH 3NRFA 4FQ2H 3IM1A 1A8ZA 1FN4B 1R1CA 3WO3B 4PJ5B 3OZKA 3UAJA 4OV6F 12E8L 4EF3A 1QFUH 1VF5C 4D8OA 1NINA 4EE2A 1A0QL 4I0PA 3UBGA 3P69A 3TEXA 4YFEA 2MEJB 1OAXH 2YXVA 5HYQA 2DMCA 4YE0A 1A4KA 1NGZA 4MAYC 3S48A 3US0A 2NR6A 1IBFA 2DZEA 5D55A 3F12B 4RGNB 4QRRD 3K2MC 4WTZA 5IBTH 3LYRA 4FERA 4PJGE 2BVPA 5IROD 2Z93B 2MCAA 1JPFA 2BNRB 5KAQG 4GXFA 3C5ZA 5FIEA 4U2ZA 3P40A 1M71B 4M48L 2CR3A 1DQJB 3QNZA 4UM9D 1J5IA 2GIMA 1BZOA 3GF8A 2A1WL 4MMYB 3RNQA 2UUDK 4V1DD 4XBPB 4IYKA 1Q9WA 5DC2A 3SE9H 5E9AA 3RIFK 1PX3A 1GAFL 5AKVA 3VD3A 2GBTA 1UXMA 3GMLB 4LB8A 3MOAH 2CGZA 1ZVSB 1A66A 1IBDA 3P1VA 3VX1A 2CRMA 5SWSD 3K0YA 2E8ZA 4BGLA 1NKRA 32C2B 1SJMA 5DUML 1A6TB 1FC1A 3DX6B 1SLUA 5DJ0A 4POZC 1MJ8L 4Z3FA 1OW0A 1BECA 2WQWA 2UVFA 2CAKA 3QUZD 1KBBA 3IKCA 3KPPA 2DYRB 4R7VA 1S3KH 3V0FA 1EHKB 3MRHB 5KSBB 2G3ZA 1XGYL 2XZQH 1K85A 4XNMA 4LSQL 4PV8B 1CDYA 5CINL 3F7KA 3CFBA 3T2NL 1J87A 4ONOA 4TUOB 4UINL 3GI9H 4Z7UF 5C0IA 2GUOB 3D0LB 3VI4F 4D9RE 1J8KA 4JDTL 5EA0H 4NBZB 1EA9C 3VMNA 1HYSD 4GRWB 1WT5C 3N0AA 5K9QG 3CVIH 3EYUL 5IB1A 4DN4L 4HH9A 2N3JA 5EZJB 5HDOA 1Q0XL 4WNJA 4WI9A 4HIHA 4Z3JA 4ZNEE 1NCAL 5AKTA 4HHWA 2ZWYA 4W4OC 5KJ4A 4PB0L 1BFOB 2DV6A 4WO4C 5GRXG 4JQXA 3PHQB 1J8HB 2I9TB 5IJVB 2ZCLL 5FUCC 1IKFL 2ATKA 5DA0B 5JPMC 2VXVL 2Z8RA 2PETA 1YEGH 2NY2C 4FC3E 3S37H 5IHLB 3ULUL 2WD0A 1I7ZB 4WKZA 3FUMA 2DWDA 3QXUA 4HUWB 2YS4A 3O4LD 3VXOB 4Z7OF 4UT6H 2AEQH 2P80D 3P9LA 4NPYB 1GCFA 4GKLA 4JZNB 4CC0A 3OJ2C 4FQHA 1N0XL 3G6AB 1BA9A 3BP7B 4UTBA 2YSSA 4JFEB 2FGZA 3O9WA 1C5BL 2LOEA 5ACZA 3MUGA 3DUHA 3HZYA 2VERN 4H8PA 3WD5H 4Y7MA 3A6CH 3O4OC 1JF6A 1KB3A 4JPQA 2A74C 3PGFL 4Z95H 2WCPA 4PWEA 5AW1B 4JK0D 3B5HA 5D1QB 4K3GA 3WNNA 4HS8L 2VN7A 3IDYC 4M1CC 4HPOH 4ONGH 4EOWL 2ADIB 3FCBA 4G1MA 3VXUB 4F57H 3NP4A 2B5IC 3UDWA 3MV9A 2WQVA 3S35L 1GGBH 3VB9A 2ZWZA 1EFXD 5DQ9B 1SY6A 4YMPA 4P4KC 2BJMH 2BP5M 2FWUA 3K4ZA 4Y4FA 1LO5A 1ZANL 1HQ4A 1H3TA 3E9UA 4WFGD 1AYRA 4Z7WB 5HHQB 2FAUA 4R7NB 5F93C 2QVKA 5F3HA 3OX8B 3RDJA 3A67H 2WWNA 2PF6A 4OLZL 2EP6A 2PR9A 2Z34A 5GGTA 2Q8AL 1OAZL 1XF2B 5JZ7C 3KDMB 3K6SB 2Y1VA 3MLUH 5GHWL 3M17A 1SDAB 3LHPH 5DJXA 4BV1A 1ZTMA 4DCQB 3LEXB 2EEAA 4HCRL 1QFWH 4X0KB 2PNDA 1THCA 5EF3A 4GUPA 2X09A 3SDAC 4FI6A 1MLBA 2VDKH 5E56A 4BCYA 1JF1A 3JTSA 2FTAA 3V6FB 3VQLA 2HN7B 1NCBH 4DVRL 4QXTB 2FBJL 1FNSH 3VFPB 2J6WA 5C09A 1U92A 3RTQA 5BO1H 5HI5C 1ET7A 1G7HA 5FAAA 1FC2D 5D71H 5HI4C 1VESA 4L3FA 2QMJA 1EH9A 4LP4A 1ND0A 3C09C 4F37F 3S3DB 3RPIB 3RVTC 1KCKA 4G7VL 5DJDB 3V6OE 1KXTA 1WP6A 2RTTA 3VCLB 2CHWA 3DJZA 4WHTB 1LE9A 2NSXA 2D7QA 2L4OA 4IRZL 4XPFH 3ZY7A 1CMOA 2J8UB 4N2HA 2JLPA 3ISYA 1P9MA 3WXVH 3ECBA 3FU5A 1SDDB 4FQXB 2CK0L 1REIA 1P7QD 3KWWA 4G8GE 4GT0A 1FIGH 4KZCA 3KLHD 2NOYA 5MP6L 2IH3A 4YAQB 2B59A 4JDZB 3SCMD 1R3KA 4NNPH 1SVBA 3R19A 4Q9CA 5IHBA 4IEFA 1HL4A 2PCPB 1FRGL 4L2YA 5I0VA 5D7IF 1ESOA 1QQDA 3FB5A 5BOZG 1GZHA 3FQUB 4QTHA 4APQD 5IQ7H 3L3HB 1RSYA 4RGMC 1IAIL 2BO0A 2J1KA 1U8NA 2XN9D 5JIMA 3TVMB 1VCAA 1XGPB 2I85A 4KHTH 4ZFOA 4HPYL 4ZO6A 1AY1H 1CBJA 1HL9A 4B9PA 2HPTA 3US1A 3P4MB 4HT1H 3SGJA 1Q38A 2XPGB 3ATFA 3SJVA 1U8KB 3L95B 4H4NA 2Z65C 3VGEA 4NWUL 3IETB 3IDGB 4N2NA 5B1JA 3ZTDC 2WP3O 1KEML 1WCBB 1CK0L 3EH4B 3DTXA 1E2WA 1T03H 5DHEA 4A7TA 3O8XB 5C08D 3WXWL 4UI2A 2QQLH 1FZKA 1O6SA 3V5DB 2R0WH 3NABH 3NCCB 3CQQA 2B3IA 2X4OB 4GQ9L 3WKPA 1MFUA 2XRAH 3F7YB 1KGXA 5L7XL 4WK2B 4WEBH 5D1ZC 4KH9A 2VRKA 1BJ1H 2DYSB 4HKJB 1G7QB 2W5PA 3CFKB 4FFYA 1BFTA 2XCMC 3HFML 4RCAA 3AU0A 3MJ7B 3B9DA 1A0QH 2Q86A 5E2VH 3C2AL 2F8VA 2QADC 3LN4B 1WUNT 1CFTB 5H4YA 1HWWA 3FH5A 3QEUB 3I6KB 4JL2A 1EZLA 4EXKA 3K6IA 2BS9A 1KEGH 1E9QA 4OZFB 1R5WB 5AOLA 3WIIH 1MXGA 4PJDB 4QWWD 2DIBA 1HSBA 3GSNA 4F5CA 3DIDA 4KRMB 3IDXH 4GQRA 5CGBA 5DS2A 3GXMA 4LGSB 3AS3A 4G70B 5DFVC 3CIAA 4FTVB 2A1WH 4K94H 2VJ0A 4D0DB 4ABWA 1OK8A 1GAFH 2J5WA 4PGDA 5AYUL 5D72L 4X4ZA 2WLZA 3T8XB 4K3DL 3DGGB 4Z0BL 4OV5A 1MHHB 2WN2A 4GYBA 3OAUL 1EAJA 1TQWA 4P9HC 2AJXL 2E56A 5DUMH 2F5AL 2VSKB 1FZJB 4KTDH 3M07A 1SYSB 5F0MB 4R7DA 5E6IB 4EIUA 2R7EA 3VFVB 2BMKA 1WITA 2YAQA 2VXUL 5J1AB 2PYFB 3FULA 3FQ1A 3KPOA 2C3WA 3ASOB 5CINH 3T2NH 4X99B 1MY7A 2OR8A 4Y2OB 3IWUA 3UTPE 3ZIYA 5C2BL 4UINH 2EEXA 2QHRL 2NY7L 4GG6E 2HRPH 2WLIB 4JDTH 3LRLA 2YAPA 1I1YA 2FJHB 5DHVB 4X4KA 3UERA 1QAWA 2NZ9C 3EYUH 4DN4H 3B56A 3VFRB 2KQNA 1F4HA 1PKQA 1OXYA 2DQHH 3DROB 1NCAH 4UBDC 2C4FU 2DTMH 2GHZA 3GHPA 5AW5B 3GKZA 2VOTA 4YXHH 2FB4L 4HAKA 1PZDA 2PP9A 2K7QA 4WCYL 4S2SB 2R39A 2L0DA 1H5BA 2ZCLH 1IKFH 1BM7A 4I48A 4PRHD 4WY7L 2VXVH 5EU6B 1KYUA 5DHXB 3QDGB 2NXZC 2X3BA 1A6ZB 3IE9A 3ZMNA 4RDQF 3ULUH 2FVNA 2G0LA 4BWWA 5KBPA 3GS4A 4F20A 3L3DB 3P3TA 4MNHA 3RIFF 3WIFB 3AC0A 1PG7W 3INOA 1U8MA 3D87B 3U9PL 5JR1L 4W68A 1S3RA 2AEIT 3VXTB 4X9HA 2EXTA 1GR7A 3AM8A 3QUKA 2FH8A 1DJHA 4UV4L 1FE8L 3PQYE 1IUZA 3PWPE 4LASL 3FH8A 4P2QE 3CBKB 4BCZA 3T0EA 4KKNA 3S98A 4KKRA 3PGFH 2Z91A 3WTXA 2EIJB 2VJ8A 3HE7D 4WHYH 2XQYA 3U0TB 3BGMB 4C56B 1KTLA 3BW9A 4EOWH 1ES0A 5I8EB 3WFDL 2WOYA 1JK8B 4JW3A 3FUKA 2EC9U 2V5YA 3HG1B 4MA3A 1WZAA 5FO2A 1UWXK 3QCTL 5I1DA 2R1YA 2BHZA 3OXSB 3TN0B 1U91A 1EQWA 4LSSL 4ZFQA 4HIIA 1D7BA 1ZANH 1AO7D 3T2PA 3MO1B 3F7VA 2UZYB 4CU8A 2E74C 5EIIB 2VLKA 3GRWL 3WNPA 2W0LA 4KVCL 2Q8AH 1OAZH 3ZDYB 3LHAA 3RWFA 2X9ZA 3U6XS 5BRZD 2J2ZB 3FTVA 4YUEH 2XDHA 5GHWH 5AOMA 3MXVL 1H8SA 4TUJA 7TAAA 2PXYC 4HCRH 5BS0A 2FIKA 4HXAL 2VZSA 2FO4A 1A9BB 1HEHC 4LLYB 4CRPA 4HJ0C 4KI5D 3RIAK 3EBAA 4JNXA 3BDBA 3C9NA 1FI8C 2CR6A 4WI6A 4N87A 1PG7L 4Y9CA 3H3PH 4QCIA 1H9VA 4WNQA 4PJ7A 2MHAB 4K5PA 4HCFA 4RX4A 4FQCL 1R3IH 3KS0H 3DO7A 2G2NA 1AGEA 5I6KA 3MRJA 4FFZA 2EVGA 4L48A 1NC2B 1FHNA 4P2OD 3UZQA 5D4IA 3DHMA 1EDHA 4S1SH 3BRDA 2RAMA 4X8CA 3A5VA 4PJHE 3A0OA 1RK0A 1M6OA 3HPLA 1RULL 3B5GA 3BX7C 2AJ3B 3LZOA 5HI3D 5DFWH 1P69B 3UX9B 2CPCA 2H9GA 2VSCA 4IU2B 1KCRL 4NQXB 4PJIE 2CK0H 2IWKA 4FG2A 5FDYA 1TZIA 2J21A 3FO9A 4BKLA 2V0AA 3VXNB 3CBRA 3MRQB 2BOLA 1HWGB 1WK0A 1JYXA 1UYWH 3U6RB 4ELME 4QRSB 4PI2A 2EO9A 4LCUB 1AP2A 1FRGH 1JXKA 4OCWL 4P4RA 4FNQA 4N9GA 3JWNC 3K46A 4DGVH 4M61A 4FL4B 4NSKB 5I73C 4A68A 4Q9QL 1GC1L 3CZJA 3BPCB 2X4SA 4S1QH 2GBAA 3CN2A 1BJMA 3MCG1 4TNVK 2V2XB 4Y5XC 4G6FD 4NKIH 2WTOA 4H1LH 4HPYH 3NTCL 4QRFA 4X6EA 1QSFB 4CDHA 1X7TA 3ZZSA 4CGUB 3GUFA 5J6HB 2WQAA 4L29B 1IB5A 1JWMB 3PGCA 3W11D 1RZIB 4NWUH 1JWUA 4ZS6C 2IDCA 1RFDL 1PLBA 5SV3A 1U8IB 3IS0X 3Q8CA 4QRUB 4X6CB 3PL6B 4H2CA 4XGZB 1F5WA 2H26B 4Z1PA 3RUGF 1K72A 1TMQA 4ONFL 2AKRB 4P3WA 5L7XH 4J3OC 3E6FA 5BOJA 1JZ6A 3CDFA 3UO1L 4NQDB 1ICTA 4A2DA 1BXUA 1NFIB 3ULVH 2Q0ZX 5T1KB 3GXPA 3HFMH 4H5SB 4PRBB 2OMTA 2HTLC 2R29L 1AOZA 3F7LA 1FFPB 4YPGB 4E9SA 2WGXA 2R1WB 4H1LG 1QMUA 4BK8A 2NY4C 2TRHA 4OZGA 2XV0A 2I27N 3SDCD 2YEZA 3E3QE 2APFA 1DVFB 2LHAA 1FYTA 1NAML 4HGWB 4KITB 4WWKC 1DEDA 1URZA 1P4IL 1H6TA 2FLBT 3ME0A 5E99L 5B1BB 2C4FT 4M7LT 3NJKA 4C4BA 5I17B 1ZHLA 2Z4QA 3KPRE 1NC4A 3MLWL 1EFQA 2PP8A 5JW4M 4XX1E 4B9IA 1LWHA 4HUCA 4OVUA 4YDZA 3FQWA 5HGAA 2X70B 5GZOA 1Q9KB 4GMTH 2YPLA 3OAUH 5G5DA 3FU6A 4XWOC 4TVPD 4AGMA 1AIFB 1FGNL 1PSKH 4FULA 4XTRD 3C12A 3RKDD 4JJ5A 4X7EC 6PAZA 4N0UB 1KJMA 4X6DA 3IEAA 2ZWSA 2ZOWA 2V17H 2VUOA 3S5LG 4P59H 2BZ7A 2R23B 1XGQA 3LH8A 4KY2A 1JNLL 1SOSA 1TT6A 1PZ3A 3DURB 4HZLB 1X4XA 4O2CA 4PRNB 4IBWA 1SBBA 4YHML 2WSKA 1MCHA 4OZFH 2QHRH 4WW2B 1MFNA 5KW9H 4LKXA 4BQCA 3BZ5A 4ISVA 2WO2B 5GXBB 1FPTL 2YXWA 1VFAA 1MFDL 4DKAA 4ORGA 3X1EA 2HWZL 5ECJE 3M8OL 2EC9T 3EZ8A 4R5XA 1BOYA 5FA3A 1T04B 2YA0A 3OAYH 3S8GB 3N41F 3VFOA 3PJNA 5M7QA 3JT0A 3ABZA 4K3EH 1R17A 2GITB 4JGUA 3N40F 1AZVA 3PV6B 4AM0A 5TDNB 5AW8B 5ADPH 4NDMB 1FLRH 2UWEF 1DO5A 2CK2A 4NXSA 4LCWB 5L4IA 4WY7H 3QW9A 5GJTH 2J12B 4FG0A 4A6YB 5DJ8B 3TZVD 1CICB 1K4CA 2QFRA 3APMA 3PHOA 1CYXA 2VR7A 3U9PH 5D7EA 3ZPDA 3FMGL 2BCKA 3WL9A 3RL1B 2ESVE 4JDEB 5C0AB 3L9YA 5JA9A 2C7UA 3BAEL 1PLGL 5F0PB 4BFIA 4UV4H 3FFCA 5T1MB 2HLFC 3QSKB 4LASH 5JOFB 3HJ0A 3LXCA 5JQHC 4J2QA 3U36A 5L2KD 2ADJA 1SEQH 1U8QA 4XN9A 5E8EB 2UY7A 1L0XA 4PJCA 4Q2ZB 4U1LB 2GFBA 1SYVB 5DHVH 1Z66A 5JHLL 3ARRA 5B39A 2EDRA 3OTTA 1BXAA 5F8QC 3MBWB 3T0WA 4AUUA 2J1YA 3D39B 3WFDH 1F1AA 2HJLA 4L4TA 1E27A 2XTJD 4F7CB 4LSDA 5D5MA 2J6EH 3ERXA 3QCTH 4OZ4B 1B6UA 4N0YL 4LFHD 4OJCA 5ID0A 4E0RA 4LSSH 1M57B 1WIPA 4A2GA 3TBCA 1U8PA 3Q9QA 2H7WA 4TVPH 5GGQL 3BKML 2C9SA 2YC1B 3JV6B 5I1EL 4A6YL 2OSLA 1OARL 2FIRT 3GRWH 3FCTA 4Q89A 5DO2D 2V2TB 2O30A 4LVNB 4MJ6B 3VFGL 4P2RD 2RMNA 3MBEA 4ENEC 1I9JL 5DQJB 3UCRA 3HLAB 1W80A 4IRSB 4PV9B 1GS7A 3MXVH 1AHWC 5D7KE 5KBMA 2IIJA 3PNWB 3T4AA 1JYWA 3RJDA 2YGQA 1O0VA 1WZ1H 1SLWA 2A4EA 3Q44A 1R46A 2ZJSL 4GJTB 1KV3A 1UC6A 1YQ2A 2YPVH 3WJMA 3BCDA 4G9DB 4NCDA 4H40A 1L3WA 5T1LA 4OLYL 1EHLL 1GCYA 2A3TA 1WSST 2VIRA 5F7NC 4LGPB 4U6XB 2E4FA 3RVWC 5C0JA 5IHUL 2XPYA 1ZWIB 2A9MH 2ZXEB 4F93B 5BUPA 4HWNA 2XOTA 3O6LL 1KULA 4HKZB 1T0OA 1G7IB 3FC8A 3N91A 2LLGA 1JUFB 2APTA 2AV1A 3ZSTA 2A9NH 2BC4A 4MLIA 3BQUA 2Z8WC 4MZ3A 5ICYA 5SWZD 5HBBA 5TGBA 2W0PA 1ZPUA 1JZ3A 3ZL4L 5E8OB 3WO4B 4F15B 5D2LF 4QRRE 1DANU 1KCRH 1UOVA 4D7PA 5HYSA 5F7WC 1WF5A 5TDPB 2D2CC 3Q2LA 4R4NC 2X40A 3RZCA 3V4PA 2W9LA 1EJFA 4HLEA 2P24A 5JW4Q 3OJVC 2DJSA 4JS7A 4RAVB 3UOAB 4V1DE 1YC7A 2QTEA 3CMOH 3NRPA 1JHKH 3ABMB 2QQKL 4N2FA 3B34A 4XMZA 5I16B 2HT2C 3CN3A 3BVTA 2ENSA 1GC1H 4Q9QH 1JE6A 2J1ZA 7FABL 3FN0L 1JPST 2EDXA 1H3PL 3LVEA 1YZZA 5SWSE 4Z7VF 1HDMB 1NIFA 4PREA 2Q5BA 5ANHA 5KSUB 5LQBL 3T77A 4BQBA 3TF4A 4OZHE 3SGEH 4XN7A 4EI5D 2RD0A 1JMZA 5HJGA 1EJOL 1D2OA 1G7MA 4OGYH 4W9HC 5KS9A 4GRLA 3TLRA 4XPGH 1F1GA 2VZUA 2G5UA 4I0PB 1QATA 1RFDH 4X83A 4YWGL 3K4DA 5HYQB 2X4RA 3RVVC 3QIUA 4BQ9A 4ZMXA 5FFGA 1A4KB 1NGZB 3R0MA 2VQUA 4DIXA 5F70A 1NJ9A 2ZYIA 1KCLA 2BVPB 3DBSA 1JPFB 3UO1H 3C5ZB 3JYCA 1Z0MA 1SM3L 5BO0D 1MAKA 3QNZB 1ZAGA 4KVPA 4PJ9D 2VXQA 2Y7SA 5I18H 3RNQB 5IBUG 1Q9WB 5B1CA 5B7FA 4PJAE 3IJHA 1KYAA 1A6WL 1BBJA 1UA3A 2YRZA 2ZAIA 5AW4B 1FORH 1XH0A 1FWXA 2ZCKL 4M7ZB 3Q5TA 4NUPA 1YNLL 3KJ6L 1PYWA 4LFHG 4Y16C 2DWEA 2EACA 1NAMH 5EBWA 1P4IH 5E99H 4KVNL 3O4LE 4R9HA 5DJ0B 2IALA 4GP4B 2K9UA 3QJVB 4HWBH 3ZE1B 1TVBA 1JGLL 5CD3A 5A3ID 1J0KA 1I3UA 4YSRA 4IKNA 2W88A 1VZGA 4I89A 3IKCB 3KPPB 3ATAA 1OHQA 1W2KT 4XNMB 5CU9A 3P3SA 2AQRA 5GS0D 2BRRH 3OB0K 3CFBB 1EHNA 3PWVA 3EDDA 5FKPA 5C0IB 1NMCC 4TQ8A 2KC0A 1BZ8A 4X98A 4Y89A 1L9OA 1OP5H 5D7SL 4HH9B 4M43H 4PWHA 2VC2B 4AVJA 5IB1B 4HIHB 2QFPA 3D3VD 4GQQA 3D12B 5B8CA 1E5AA 3HBQA 4DEPC 4LVHB 5DD0H 4PS4L 5E51A 2DRUA 3U46A 2I32A 1WH0A 5D7LD 1H3GA 1XGUA 3INUH 4NQSA 1EAPA 3KGTA 3GS7A 3N1MC 3QDJA 4WFGE 1GY2A 4YHMH 3ARBD 4BA8A 4PLKD 2ATKB 4BH7A 1Z5LA 2DTSA 1HH9A 4JE4B 4LOVA 5E2UH 1B2YA 1XF1A 3U1SH 4CSSA 1CZ8L 1PZBA 1ZJAA 1MFDH 4WKZB 2DWDB 3VXSA 3GO1L 1A14H 5AZ2L 3OVUB 4XODA 3RWEA 3P9LB 1HK6A 1DBML 2YAFA 4FQHB 4P23C 6FABL 5AAMC 4XMKL 3V79C 2YSSB 2ZKHH 4FKKA 5IJDC 5ACZB 3O9WB 1U3NA 1XSKA 3MUGB 3HZYB 1FO0A 5KVMC 1BQRA 3DGDA 3ZO0A 2QJDA 5T1JA 2B16A 4HXBL 5IIEA 1QZ1A 4IIZA 2DM4A 3O2VL 4AM0Q 2QGEA 2E5EA 4KUCD 4NNYA 4CC4C 5C9KA 4L1SA 3BQVA 2ICWA 3FMGH 5ISZE 2XBTA 4F92B 4R3SA 4J6IA 4G1MB 1MDTA 4Q6YA 4ZOAA 3BAEH 3NJLA 4DTGL 3MV9B 1V3MA 3HEIB 5JXED 4NQEA 1TZOA 2EYRA 3SZKC 2NY3C 4LCCA 5DUBA 3F84A 1AHMA 1UGKA 2XJKA 4Y4FB 5DJYA 1LO5B 1HQ4B 1D5ZA 1IFGA 2R2EA 3GMQA 4J8RA 5E9NA 2PYED 5F3HB 5I74B 3IMUA 1JF5A 4R84A 3ZKMC 4PRPA 3UEQA 4LCIL 3M17B 3KJ4B 2APBA 3M86A 2WKOF 2XN2A 5DJXB 5AQ0A 3EJUA 4M6OL 3CU1A 2QZQA 4UM8A 3MA9L 4GUPB 2QGCA 3F65A 2JKXA 4N0YH 3VWKA 1G9NL 1MLBB 3IAPA 4PIBA 5C0BD 2CBPA 1E9PA 2X1XR 1JF1B 1DANT 3BKMH 3JTSB 1ANUA 3S34L 3UABA 5I1EH 1KXVA 1NUGA 3NZHL 2MCPH 1I8MA 5C09B 1A4CA 1U92B 3RTQB 3COOA 1I9JH 4DP8X 1G7HB 1BZDA 2FGWL 3UPCA 1ASQA 3H7LA 2OMZA 1ND0B 1V10A 2DBLL 3T4YA 2NY6D 4IDLA 1DLFL 4G9FA 1VERA 1SY6L 1KXTB 4E9LA 3HG3A 4U6VH 3QGVA 3KWUA 4FNTA 4Z7NB 3Q2WA 2YOCA 3FHQA 1RQ5A 2RACA 3QJQB 3S8WA 1LE9B 1BZQK 3KPLA 4H26A 4TNWK 5C08E 4Y4HC 3DYPA 3AT9A 3ECBB 4OLYH 3E0GA 1EHLH 5GGTL 2RFXA 5IHUH 2ENPA 4ZTOL 4JN2A 3KWWB 4N2KA 4FNUA 4N85A 2H1PL 4LF3A 3O6LH 4XMLL 3X13A 4OKDA 3IFLL 2IH3B 2BIPA 2B59B 3MSPA 3S97C 4KK8D 1R3KB 4HVBA 2YKLL 1SRDA 4IEFB 5D93C 4YHYB 4KTEL 1QQDB 3T71A 3FB5B 3TO4C 4QTHB 3X3GL 5J1SC 5BV7B 4MMZC 3L81A 3NFSH 3QPXL 1JYVA 5AL0A 4NHUA 1Y1DA 1U8NB 1J9TA 4FQ1L 3BFQG 3VWJA 4ZFOB 4JFYA 4XP5H 5D2LA 4EZLA 5AVRB 1TYRA 5LDUA 1D2PA 4OGQC 4MD0A 3W82A 3SJVB 3RP1A 3RZWA 1UZ6F 1MZYA 4QHKI 5DS1A 3MACL 3ML8A 2QQKH 4JFZL 4XI5D 4YEFA 1N19A 4LLDA 5I0YA 4AUYA 3DTXB 3W2DH 5FYJD 3FN0H 4JCMA 4R97B 1J86A 5DZPA 1FZKB 1O6SB 5LQBH 1PLAA 1H8LA 1LVEA 1UH4A 4G80A 1DUYA 1DSYA 1MCOH 1OTUD 2DJ4A 4JRXA 4YOKA 3MCLH 5LVEA 5C07E 1EJOH 1EO7A 1TTFA 4K73A 1B4JH 5EO1A 1OLLA 2AXJA 1EEUA 1SHXA 2R9HD 1JGIA 3EDKA 2XKUA 4QEGA 2BSEA 3O11A 4N2AA 3OAZK 2Q86B 5A6MA 3BMWA 1S7SA 2DMBA 5CILH 4YWGH 5LCVH 5BV7L 3DARA 5IVXE 3QAQA 4DK6A 1E9QB 25C8L 3UGUA 3FPYA 4XNZC 1KIPA 4K8RL 1HSBB 3GSNB 4ZFOL 1R0AH 4X4YA 2CUIA 2A6JA 3PP3H 3HG4A 4FZEL 4E2OA 4OJDH 4BK5C 4LL4A 5EZOL 5DD5L 3V0DA 5T8IA 5ANMA 2VZTA 4PGDB 2H2SC 4M4PA 3CZEA 4LMQE 3P30L 3OHXC 4OV5B 1CL7I 3VFSA 4JM2C 1QG3A 2ZCKH 3DX7A 1YNLH 3KJ6H 2Y4SA 3SDDD 1UM5L 2EABA 1T0MA 5AB2A 4R7DB 1IE4A 1FGVL 3NP3A 4MS8C 3NIFB 4FFYL 2R7EB 1NCDL 2BMKB 3NCJL 3QEQA 5IOKA 3DO4A 3MUJA 5AZEL 2DWXA 4PLOB 3KPOB 3MLPA 1I7RA 4KRPD 4OFYA 4QTIH 3UBXI 4E42A 4HOZA 1KBGL 5B22A 2EE6A 1PAZA 1JZ2A 2WGNB 4XO4A 1I1YB 1MI5A 2XKSA 2OBGA 3GSNL 3BGFC 3E7JA 4ODUA 5FLUA 2HYMA 2QBWA 5BVPL 5LN8A 3QZMA 1HILA 5D7SH 2BY3A 2X3AA 1A6PA 3K2UL 4L0PB 1PKQB 1HX0A 4JREB 1PGRB 2OZ4H 3KW7A 2A4CA 2E86A 4M03A 4ZW5A 1AO7E 2I9LA 4PJGF 2XA8L 2VDNB 4I48B 1H5BB 5TTRA 3O6FD 2VZ3A 5C6TH 2Q10A 1O5PA 4KNSA 1U33A 4LSPH 1CZ8H 5E9DD 4A67A 2X6CA 5KVEL 1VFOA 2OMVA 2WZAA 4MNHB 5BRZE 3GO1H 4MRBA 1U8MB 5AZ2H 2MQ3A 3QIBC 4JG0L 5CJBA 1DBMH 3QUKB 1RUAH 5EO9A 6FABH 4GBXC 4Z7OB 3TBSA 4ZZKA 4KI5E 1BJ8A 1AC6A 3T0EB 5JPMA 5H94A 1QUNA 3DVNA 2Y0SA 5AUMA 2Z91B 4HC1A 1KN2L 4BWUA 3TF7C 4I3GA 4R8WL 1KTLB 2F54D 3KXFA 4HD5A 5E4EB 1MCCA 3BW9B 4F9LA 4FA8A 4Z3GA 1ES0B 3Q7JA 2PW2A 3WCYA 4DTGH 3GXFA 4MA3B 5K33A 1YEWA 3D6GA 5F7FA 1I8LC 2R1YB 5I1DB 3FAXA 1U91B 3MJ9A 4HK3N 3GPSA 4WEMB 1MCQA 2OCJA 4HIIB 2VDNL 2XI9A 4HJJH 2Q2LA 1NLDH 1ADQH 3F7VB 2CGRL 4LIQL 5CIPH 2P5WE 2VLKB 5CEXA 2A74A 15C8L 2HJKA 5CLZA 2HVKA 5D1XD 3SHSA 2YEVB 3RWFB 3S88H 3CUPA 3KGRA 1L9PA 3FCSA 1B88A 5E00A 1BYPA 4WIQA 3QFJA 4TUJB 2Y5EA 5IM7A 5EC2A 1I1AC 5BS0B 4UAOB 1JFHA 2FIKB 3IYLW 3ILPA 4K15A 3RGVD 3SY6A 2FO4B 1E5BA 3HTLX 3MA9H 1QHOA 2F8IA 5AAPA 2EQDA 2EDDA 1OAUL 2XX0A 3LH2H 1AGDA 2DWTA 1S9VA 3C9NB 1KCSL 4AY0A 1CLZL 3ALXA 5CM1A 1RZ8A 1LQSR 4AQZA 1I8IA 2GSMB 1TJHL 2YRPA 4QCIB 4WNQB 1BF2A 2ZNXA 4PJ7B 1W0VA 3LZRA 2Z7YA 2CCVA 1NANI 3BPNB 3DO7B 1AGEB 3MRJB 1I75A 4YVNA 2YZ1A 3ESOA 5H8DA 4CBPA 2DBLH 3UZQB 4Q56A 1KYOJ 1AZZC 4ECNA 3WDHA 4UYPA 2EXWC 2VRQA 2J25A 4Y5VA 4U1MA 3L4UA 1RK0B 3QYMA 1HI6A 1M6OB 3HPLB 1WA0X 4QOKD 1HEJC 1JCKA 4GSUA 4L5FL 2BDNL 1WFMA 2WXFA 4XVTH 4E41A 1JBJA 2H9GB 4KQ3L 4CADA 1GSKA 5IT2L 4PP1C 4ZTOH 5D96C 1TZIB 3FO9B 5DRXA 4BKLB 1BEXA 3TBVA 5CJXA 2H1PH 4XMLH 1DVZA 5I2IA 3IFLH 3VGHA 2LLLA 5DTFA 3D0VA 4H8UA 3OWRA 2X4UA 2EDBA 3AG4B 4I4WA 2X6VA 3RU8L 1AP2B 4P4RB 3ARDA 3G9VA 2ICEC 4N9GB 4M61B 4YH6A 2P8PA 2AK4A 4E36A 2X4SB 4AVHA 4HOMA 2B2XL 2IAND 3GLAA 3AU1A 3D08A 5E5RB 3WNKA 4F8QA 1XD0A 3VFWA 4I3SL 4FQ1H 4WUKL 1H15A 3V9FA 4X6EB 2Y7QA 4FFZL 2XXCB 2ZP0T 2BVQA 3T3PE 1OL0A 2JKTM 1NMBL 1ZVHA 2YXFA 3VSQA 2BSDA 3PGCB 2KBGA 1C5DA 3I50L 4JHZA 1EANA 2JELL 4ZFZA 3QUMA 1JWUB 2ZXDA 3QIWD 4UANA 4NCC2 1S7WA 2IQ9L 4J7RA 4XPHL 1IC7L 1CDUA 4I9XA 4TRPL 2F1EA 2PPEA 1VAHA 3CVCA 1MJUH 2AI0L 4HLZH 1BVLA 4K3JH 2R83A 3ULUC 2N7SA 5E8NA 3E6FB 4OF6A 3BFWA 3WNLA 4A2EA 5GS1C 2GCYA 4TNWF 4BQ6A 4BXSV 3KWXA 1WBZA 1XTMA 1KTDA 2FJFA 3W5NA 2OMTB 4GAAA 3QYNA 2E7LC 3H3KA 5IJKA 1RY7B 2ZONA 1OE3A 1KY6A 2ED8A 3V0AC 1UZ8A 4MB3A 4HX1A 3HJEA 4OCNC 1ET8A 3CVHA 3U30C 4PIRF 25C8H 1VJSA 4OZGB 1HCYA 4Y8DC 4G11A 3QCVL 2YEZB 3MBXL 4K8RH 3FPXA 4LO9A 4TULL 5CSZA 1KGYE 1FYTB 3ME0B 4PBXA 5D1ZA 5CHNA 1PVHA 5I19L 3NSJA 1ZHLB 2Z4QB 2XUWA 1NC4B 4OF3A 4WV1A 4TM9A 4MBOA 5EZOH 3L3KA 4LLWA 4HLZG 3MLSL 5KVFL 2AEWA 1PZAA 1UD8A 3T0VA 3FQWB 5HGAB 2XIBA 1IFRA 1QRND 2YPLB 5G5DB 5CZXD 4A2MA 2WXGA 3DRTA 3B2VL 2BNQD 4HLJA 4JJ5B 3ELAT 1O7DC 1KJMB 1FGVH 1SJEA 2DKMA 4X6DB 5JPNA 2HTKD 4IJ3B 4R4FL 5GRUH 1GGUA 1DQMH 1NCDH 4BZ2H 1HWHB 1XGQB 3APFA 3NCJH 1FJ1A 3WFEH 1ZEAL 1QSEA 1LLAA 5AZEH 1G9EA 3WLBA 1WE5A 3B9EA 4O2CB 3LPFA 1ONQA 1WA2X 1X5GA 3NQIA 1WBXA 2DW5A 3S36L 1TTBA 4FTDA 4RESB 1AGCA 1KBGH 2YKKA 5AENA 3DA0A 4LKXB 1TR7A 3DKHA 1ZXKA 5PCYA 4ISVB 1UCTA 3TT1H 4XP9H 3GSNH 2FZ3A 1VFAB 2R4RH 3NN8A 2X4TA 4ORGB 5B3JE 5BVPH 3DIFA 5D1QC 3K2UH 5FA3B 2GKIA 2XTJE 2ZXGA 2V2WA 3VFOB 2HT4C 1C08A 2WB1A 3DMMD 4AM0B 4CILA 1CLYL 2ITCA 5CZRA 4IMKC 3S3SA 3HA0A 4UQ2A 2J88L 5EZPA 3S3CB 2XA8H 1E8YA 1FFRA 1J48A 1D6VL 2DB8A 3SYAA 4MAUH 1K4CB 3M1OA 2LABA 2ZICA 4P2RE 5KVEH 4XOEA 4PSPA 3PHOB 1MCBA 3K6NA 2F5BH 3LS4H 2ETWA 2BCKB 3QDHA 4JG0H 4S0SD 3WL9B 5J56B 4X9FA 3OJDA 2C7UB 4BFIB 5F2FA 1N7MH 5JXAL 2OL3L 3FFCB 4L3EA 2FT6A 3B9KC 4ZX4A 1F3DH 2YMXL 3GBML 4JBSA 2W60A 2LV4A 4FQJL 3U36B 4LP5A 2ADJB 3NIDE 1U8QB 5KSAD 2UY7B 4ZZFA 5HVGB 3U0PA 2GFBB 1LP9A 4Z0XA 4J3BA 3LRGA 1JG9A 5B39B 4UNVA 4R8WH 2P8MA 2Y6SD 3QRGL 1CPUA 3IXAA 2A6KA 4ZW8A 1YC8A 4OIIL 5ACMA 1LE5A 2HG0A 2HJLB 4L4TB 1E27B 4P99A 2R8SL 1IILE 4L1HA 5D5MB 4NRYA 4GG6F 1NBYA 1G6VK 1MF2L 2DQ6A 2MTAA 3FXIC 5ID0B 4E0RB 2HKFL 5SWZE 5KJ7E 4OD3L 2YLHA 1U8PB 2VDNH 2BFGA 4RGND 3ENEA 2OSLB 1OCZB 3FCTB 4FQXC 4FKEA 3NFPA 3W0WE 2Z31D 3MBEB 1YY9D 4YDKL 3TH4T 1SMAA 4W9GC 1N67A 3N1PC 1KTKE 1IGFL 4MD5A 3ULVC 1X5MA 3T4AB 5DC9B 1N5AA 4L1BA 1HHJA 2DWYA 3BT2L 1OAUH 1MCWW 1EZUA 3I9AA 2GJ6D 3WJMB 1KCSH 2YJQA 1CLZH 5ADOL 4OZIA 4KX7A 3RL2A 1TJHH 5F72S 5T1LB 2CA3A 2WZ0A 2AK1H 3TVMC 3ZBMA 3OKDA 2VIRB 3EFOA 2VLMD 3WTVA 1BMZA 2KH2B 2EZ0D 2FWSA 3KL5A 5C0JB 1UB6A 4NQTA 3IRPX 4XN4A 1SZNA 3ZHFA 3I2CL 2NXYB 2PXYA 3BSHA 1KWGA 3HHRB 1DCEA 5KSVA 5A2CA 3GXDA 4AVIA 4OLEA 4K5OA 2P45B 2AV1B 1DEEA 1QSZA 2BC4B 3M88A 3BQUB 5ICYB 1IEBA 1WG3A 4L5FH 2BDNH 5TGBB 3OQRA 3O8XC 4KQ3H 3RWCA 5IT2H 3NCWA 5HYSB 2WO3B 5FOJA 2SEBA 3DC0A 3U2SA 3RZCB 3V4PB 3C8KA 3X1GA 3A4FA 1NH6A 4UIMA 2P24B 3VE0A 2WKGA 4JFQA 1J8HD 1HYRC 3RU8H 2DM7A 3U7AA 2IGLA 2UX7A 4Z77A 1UUNA 1F4AA 5I0WA 5IBLD 2B7DT 1IAKA 1KSRA 4PFEA 5I75B 2P44B 2B2XH 2C1PA 3MAWA 4PREB 2PLTA 3OC8A 3FQ4A 3HUJE 1S78D 4I3SH 3T77B 4BZYA 2D9QB 2VDQB 2R2BA 4M56A 2FEJA 2ALWA 2OJZL 2WZ6A 3D4CA 4FFZH 4YSQA 3CFUA 2BSBA 1TQCB 1G7MB 1NMBH 3ZDXB 5KS9B 1T2JA 4JFED 5I1KH 3GFUA 2CCLA 4GRLB 2DLFL 2JELH 3SBWC 2V9QA 2EDMA 5I0XA 1A6UL 4TRPH 2EUWA 2X4RB 4N8VG 3QIUB 4TLKA 3HI6L 2D0HA 4LSTH 2AI0H 2EDTA 1WEJL 4Y5XA 3SOBL 3P77A 1C5CL 1NJ9B 3B2MA 3IMVA 4G7YH 4PJHF 3C5JA 3NJNA 1KZYA 2O5ZL 1BV8A 3D3VE 3NCYP 3V4PL 3WYRA 4RFNB 4X9YA 5JW4R 4ORZC 1MRFH 5D7LE 3PDOA 1II4E 2OKMA 4PJIF 4HZAA 3IRCA 2VDMB 1TQSA 3IJHB 1BBJB 3CTTA 3D2UA 3C6LC 3VTAA 1HSAA 1UA6L 2KZ1B 4OY9A 1U42A 2X5PA 4HHAA 3TV8A 5AB0A 1T0PB 5J57B 2PUQT 4UTAH 4DH2A 3MBXH 1QACA 3LTVA 4ELMF 1PYWB 2XWDA 5I8CA 1RVFL 2DWEB 2E76C 5EBWB 4G8GA 5DD6A 1AZCA 4IGBC 5I19H 5F44A 2IALB 2FJUB 4C55A 1IGMH 1TVBB 5CD3B 1LO0H 3DDGA 4UCFA 2ZYRA 3FDWA 3NEEA 4HBQA 4JRYD 5KVFH 5HYEA 3NACL 2Y2WA 2AAVA 3PWVB 1HOCA 2IAMD 3WNIA 4UQIM 5FKPB 5K9QI 4LDEB 5LBGA 3FU7A 3B2VH 2ZCHL 4YDNA 4JFFA 2LU5A 2D31A 1XV8A 1IM3A 3LS5L 4KZ0A 3S8FB 4XVJH 4MA8H 2PKDA 3H4FA 5B8CB 2X87A 1CGXA 5HTSA 5LJYH 2Z35A 2VXQL 4C59B 3GC3A 3U46B 1JRHL 2NUPA 1MRCL 4U3CA 1XGUB 2VDML 2I7OA 1YYCA 1EAPB 2EC8A 3CXHJ 1RK1A 3D69A 3BE1L 1KXQE 3LZFH 3QDJB 4JO2L 3EOBA 3QA3A 2QKSA 4PLJD 4BH7B 1Z5LB 2PYEE 1HH9B 2P26A 3PDDA 5T33L 4G82A 4YX2L 1QUPA 2KKQA 1FNAA 5KVGE 4G3YH 2OMWA 4BUQA 3BUYA 4U3SA 3VXSB 3W1ZA 1ET5A 5E6UB 3WENA 4XVSH 1KCWA 2L7JA 1CXLA 3NFNA 3KVPA 3RWEB 1EV2E 1N6UA 3U9WA 4FGMA 4NQUA 4DKFL 4NYLA 4DGYH 3N41B 5C0BE 2J88H 3KLAA 2XT1B 1FO0B 3ZYZA 5CZKA 5MHSE 4OLWL 3SQRA 2ZWNA 4YDIL 4BCXA 5IIEB 1D6VH 3KVQA 3P0VH 1LXMA 5E08L 4H8WL 4G72B 1BBDL 4PJEE 4NNYB 5BRQA 4KZDH 3N43F 2ICWB 2E46A 2W92A 3IBEA 3OKLA 4KJWD 1F8TL 3WNOA 4R3SB 3QHFL 1UWYA 3B9AA 3II2A 2NW2A 5JXAH 2OL3H 3NT0A 3WS6A 4DPAX 3IMTA 4NQEB 2YMXH 2EYRB 4LCCB 3GBMH 1EO8L 5DUBB 4FQJH 4PJFE 4CU6A 5LWYL 4QY8A 4YBHA 5DJYB 1GC1C 2BRQA 3FTGA 1D5ZB 2R2EB 3GMQB 4ONHA 4J8RB 4TUUA 4WSJA 5IJCC 1J0IA 3WMPA 4BFEA 1SBSL 1N9PA 2EXYD 4G6AD 3F5WA 3OMIB 4PRPB 2HLAA 4X9GA 3QRGH 1RUML 3NVQA 2DS4A 3GZPA 3Q13A 2R8SH 5KAQF 2QKIC 2JWYA 1MDAA 1JCVA 2A9DA 3BKCH 4UM8B 3S3JA 5D7JA 5EG6C 1MF2H 1D9KC 2DM3A 5EU5A 3VWKB 3N0PB 2ORBL 4OD3H 1FO0L 4YHLL 1E9PB 4KOCA 3NYKA 1W8EA 1T21A 2O72A 1U3HA 4ZMTA 4MAZA 4U0QB 1I8MB 3ZTJG 2QTVA 3N1GC 2WWMD 4AIZA 1FL6A 1XGTA 4PCYA 4XB7A 5DLLA 3QJZA 4JPVL 2OMZB 4WENB 4N2EA 5FC9A 1IGFH 2R15A 1SHSA 2WIMA 3T4YB 4FP8L 2HFEA 3EIFA 4G9FB 4HU8A 2WTPA 4AIXA 1F41A 3LNGA 3BT2H 4FL4C 4J2XA 5E6ZA 5I5JA 5FYJE 2EILB 4NZJA 3TIDA 4H26B 3KPLB 2YMTA 4WHDA 4E9WA 4N2CA 3MV8D 1WS7A 1K4DA 4OLXL 4AIOA 5E6ID 4QJ4B 2H2PC 2RFXB 4XC3H 1J1OL 4JN2B 4ZMAT 5CLYA 1AHWA 2W95A 1G6RA 2VAJA 4LF3B 1NFDE 4LRNL 3X13B 2BNUA 4OB5L 4JGNA 1XB8A 1W0YT 3GSXA 1G0DA 3PQYA 4PQXA 4YSOA 1V8HA 4KROB 3APDA 3CQPA 3O45A 1T5XA 1Y6KR 2BY0A 3EJTA 1AS6A 4U1GC 2CXKA 2L8AA 4GPVA 4HJGA 3PL6C 3DIVA 5F21B 4NHUB 2VR9A 4Y5YA 5FHAL 2JKIS 1DN2A 3VWJB 2VM9A 2VT0A 4JFYB 5D2LB 2BH0A 2FT8A 3LRHA 4MJHA 4DEUA 4MD0B 1E4XI 3GPEA 2JB6A 2ZSVA 4NFBA 3NBNA 3QNYA 2XYCA 1CFSA 1LQBC 2MIZA 1KXHA 3ESMA 4A63A 4LLDB 1HC1A 1PX8A 3WOVA 5JIPA 5D4QA 2YWZA 5CMAA 3LNIA 2AAAA 4AQOA 2OJZH 4G80B 1DUYB 4JRXB 1TEGA 2ZX5A 3D51A 1OV8A 1OTSD 1PDKA 5EO1B 1SEBA 4M6NL 2V5TA 5BZDA 1CIDA 1LO2L 3O11B 5E7FA 4XNQA 5HVHB 1FUNA 1S7SB 3DX9A 5D8JL 4AW7A 1A6UH 1FL3A 1Z7JA 3AMLA 4DOHE 4PVMA 3ULSA 2CBQA 1WEJH 5B1AB 1BAWA 1ULVA 1KIPB 2HFTA 4GRMA 3SOBH 4X8XA 1C5CH 4F8NA 3CFJA 4X4YB 1A3ZA 2A6JB 3WFCH 4UDUA 2O5ZH 2R0KL 1T89C 1JVLA 4NENA 4U4IA 3ZMRA 4IQHA 3S7GA 3TYFA 3TN0D 2LFGA 3BIKA 4PJHA 3WIHA 1L3NA 1X4ZA 3H1ZA 5ANMB 3TV3L 3V5HA 5IB3A 4LQFL 4DQAA 4PMFA 3CFNA 4WW2C 3VFSB 1QVOA 3O3AA 4PJIA 2WXQA 3DX7B 1KWKA 2V37A 2MPVA 1MW0A 5E9DE 5C7XL 2OMYA 1RVFH 2EDKA 2H1XA 2V3EA 5CCJA 2GEQA 1T0MB 2V9TA 4PWKA 3QUXA 4H8VA 3BVWA 3MV11 4ZMQA 4RZCA 1KF9B 4HSQA 1IGIL 2FO8A 2I24N 4QTFA 2H32A 2ZOLA 3G9AB 3QEQB 5FEBA 3GXNA 4JPIA 2B0SH 2KT6A 4NBXB 1YSOA 4ENZA 4NZTH 4OZHF 5E7BA 1A7QL 1I7RB 5D2NE 4E42B 4ODHL 1D5MA 3Q3GA 4OCMC 3VRIA 4QHPA 1Y6NR 1TNMA 4HWEL 2ZCHH 1CICC 1AXSA 3LAFA 4ODUB 1C12A 1JL8A 4XO9A 4ZX6A 3LS5H 3P54A 2PW1A 1HILB 4NZ8A 4XXWA 1ZV9A 3RRQA 4QXGL 3BWAA 4YQXL 3POCA 1BXXA 4LPYA 1C16A 4UU9A 3VD5A 1HNYA 4H88L 5AVVB 1HESA 2X0WA 4JFDD 4JO1L 1MRCH 2VDMH 4AX3A 1AE6H 2RR3A 4K7FA 4X5WA 1IVTA 2I9LB 2ZP9A 4JO2H 3OKNA 4J4PD 1KLFA 3L4ZA 4R2GC 4OI7A 5T33H 5D1XE 2UXTA 4GINA 1M6UA 4YX2H 2DQDL 4JY4A 4U6TA 3JBG7 4KAQH 2OMVB 4ZD3H 3PCYA 1YEHL 5E5MA 1GSMA 3RHWF 3PRZA 4PJAF 2ITEA 5TPWL 3B7TA 1N10A 2CBTA 5DK2A 4LHUA 5EO9B 2X42A 1TZGL 1MVFA 1SPDA 5C86A 1F6LL 1JZEA 4FZ8H 4M62H 4XPTL 1IZJA 3TBSB 5H35A 1CQKA 2FQFA 1CDJA 5E8DL 1BZEA 3OZLA 5H94B 1QUNB 3DVNB 5JPMB 1L4IA 5AUMB 2B39A 4I18A 2Q7AA 3JYBA 2Q3AA 1QSFD 1XZWA 2VH5L 4GLRI 4LVNC 5ICXA 3OJMB 4KKBC 5JHAA 4YHKH 2HX8A 4IRSC 3SE4A 5ILTL 3KXFB 2AERT 1F8TH 1OGAA 4MXVE 2CJSA 4PB9L 2QHLA 4UT7H 3QR1A 2PW2B 3A24A 2QR0A 4P23A 5A2FA 5HYJA 3B2UD 3Q1EA 5C0FA 2JF1A 2YD4A 3ARGA 4ODVL 2YBGA 5LWYH 4QOKE 2Y72A 5JHDE 1N6VA 4Y9FA 2OCFD 2WNXA 3LKSA 3VG0L 5CEXB 2G5BA 1NMAL 2A74B 2E3VA 2HJKB 4LNRA 2HVKB 5TF1L 3LRKA 3CNKA 3B7SA 4NQDD 2D7PA 3CUPB 4CC4A 3DYOA 1QTYT 1FVCA 3FCSB 1RUMH 5T1KD 5E00B 4K5MA 4Y4KC 5EEYA 3QFJB 4TL5A 5IM7B 4FLRA 2B5IB 5EC2B 3CHRA 5D4JA 1PD6A 3ILPB 3ZL1A 3ZXAC 4KXCA 3H53A 4GSDL 1T6WA 1MNUL 3TT3L 4YHLH 1AGDB 1OAYL 5EZLA 3JT2A 5EEWA 1S9VB 5C0EA 1JGDA 3DTDA 1DVFD 1RZ8B 4XXCC 4F15C 1I8IB 4I9WD 1WA1X 4K9JA 4D9QD 4HMEA 1W0VB 4KK6D 3JWDH 1AQHA 1I3RA 3ALPA 1DVXA 1SUJA 4M1DH 3ZTNL 3NH7L 3L9EA 1CVSC 3SIKA 4PJBA 1UWFA 3H3BC 5GIRA 1PZ5A 4NO2A 5BQ7A 1YMMD 3V0JA 1UJ3A 1A1MA 4Y5VB 3FU0A 5AWNL 4U1MB 4AUJA 1HI6B 1EEZA 5F9DC 3KBEA 1E6JL 5C1MB 2AMUA 2FJGA 4I2XE 2VXSL 1L9QA 1R33A 1BD2A 2NX5D 2Z8SA 4OLXH 4E41B 3DX3A 2J44A 1TNNA 1IO4C 1J1OH 4TXVB 2BHFA 5DRXB 2ESVA 3VW3L 3NJXA 4YN3A 3TBVB 2LFEA 5JLZA 3ARTA 1SJVA 1Z9PA 4MJIE 3UAJC 5I2IB 5DTFB 3D0VB 3QFDA 3ASWA 2X4UB 3ZYJA 4I4WB 4PGJA 2WZPA 4YZWA 2DL9A 3ARDB 4U7MA 1J5OL 3DETC 2I69A 2P8PB 2AK4B 3V4VH 3ZL2A 1XZ0A 4LP8A 3X1FA 2NR6C 3BUQA 3AU1B 2ZAHA 4LMQI 5IEKA 3VFWB 5FHAH 1DBJL 4XVUC 2PTUA 1H15B 3EDEA 2Y7QB 1P6AB 1CTOA 2XETA 2CM6A 3WN5A 2BVQB 3C5ZC 1EHAA 1ZT7A 1OZUA 4KKLD 3SKUD 2VYRE 2JE8A 4HQQL 4OR1A 2WVSA 1C5DB 4ZFZB 3S4SG 3QUMB 1G7JA 2I60L 1S7WB 4HWUA 1IC5L 3V8CA 4NIYE 1E30A 4MMZA 1QRNE 3B1UA 1QOKA 4MCNA 5MEND 4MCZA 4EI0A 3RX8A 4M7ZC 4MRCA 2CO6A 1ITBB 5C0RH 1BVLB 2BNQE 2NUTA 1ZK5A 1U93A 3PREA 3QUGA 2E9WA 5E8NB 5JA8B 1ACYL 4WGVB 2GCYB 3K5RA 5CKGA 3NA9L 1A5FH 1WBZB 2FBOJ 3H2QA 5DVNA 1KTDB 2FJFB 2WLHA 4ZW6A 4ANKA 1LO2H 2VSMB 3V5KA 1WWBX 5DT1H 3DECA 5D8JH 1UZ8B 2JI1A 4HX1B 4AYEC 4EVNA 2ID5A 3CVHB 2IG2L 4HUUA 3ILEA 4WTQA 2G75A 2ROXA 1VPOL 2FECI 4KOBA 1WV7T 1UACH 5DF0A 1N64L 1UHVA 3SSGA 3L4VA 4NQQA 1XF5A 2BIOA 1SGKA 2WVVA 3CG8A 5CSZB 1TENA 2DM2A 3KS0J 3SO5A 4P46D 5D1ZB 5CHNB 1H6EA 1UWXH 2GB2A 2QVTA 4WDIA 3LN9A 5F1KC 5LGKA 2H3XC 4UT6A 4C47A 3B3IA 5EF0A 1THAA 4LVHC 4WV1B 4UWQB 5FW7A 1ZLUK 2B9AA 3L3KB 3PWNA 4LLWB 3L7FA 3L1FA 4IBSA 4JQXC 4LQFH 1RIUL 1A02N 2ATPA 1ZOXA 3OLGA 4DPCX 1TCMA 2JCCA 4NIKB 4MBRA 2HX9A 4EQ2A 3NJMA 3OBAA 5K93A 3DRTB 5IROA 1RSFA 5INDA 3WJLA 3SYPA 4I85A 1TZ8A 1ZV2A 4UM9A 2OTUA 1SJEB 5JPNB 4XXDA 3GZQA 1IGIH 4BK5A 1QBML 1ZPLA 5FA4A 3AY4A 1FJ1B 3MFGB 2VSDA 3SE8H 2CLRA 1QSEB 4MB5A 3WLBB 3SKOA 1G9NC 1A4AA 4W9FC 1ONQB 5SWSA 2GT9A 1GGCH 1WBXB 4YLCA 3CVHL 1MVUA 1AGCB 5HJDA 3GXTA 2E7BA 4FRWA 4HWEH 4OZHA 2CSPA 4PUBL 4PVBA 2FZ3B 3GXIA 1J8SA 4NERA 4PJ5E 3NN8B 2X4TB 4K9EL 1O9WA 3TJHD 4OCRL 2ZZUT 2E6PA 1XAUA 3DIFB 4JL1A 1SDYA 4G5AA 3AWEA 2H6OA 4OT1L 1MEXH 1JD9A 3QUZA 2PMZA 4ETYA 4YSAA 2V2WB 1GYAA 5IVXF 3CQFA 1URIA 1C08B 3T2QA 4KTYA 2JJVA 4JO1H 2ITCB 4LHJB 3AWGA 3A21A 4UQ2B 4Y4FC 4RGNE 4HEMA 3DXAD 4WI8A 1TFPA 3EW3B 1NPUA 2WXNA 4K3HA 2DQDH 4WFEE 3ROOA 1CTMA 2BNRE 3EXJA 3EJSA 4ZUVA 2YD3A 3GJFK 1NEZG 3VI3A 2HP4A 4GG8A 1Z3RA 3F58L 3SEPA 4G7RB 3KJ4C 2ADYA 5TPWH 1KYOK 1FNLA 3T65A 5FYKD 3OJDB 1UKSA 4L3EB 2X89D 4ZX5A 4PJAA 1KN4L 4HEPG 2W60B 2PPAA 2GJ6E 4MKTA 5E8DH 4A39A 1UD2A 3RBSA 2GAZA 2ED9A 3QJSB 1MFBL 3CDGA 2BX5A 4IOSD 4RMBA 3U0PB 1LP9B 4Z0XB 2VLME 2N59A 2P43B 4XBGA 2P80A 1QLFA 1IRAY 1JWSA 5DLML 2P8MB 3IXAB 4HFUL 2A6KB 3H42H 4PB9H 4Y8AA 5KSBE 1EGJL 1LE5B 4HUVA 4NNXA 4I0PD 5A2BA 2EE9A 4KMTL 1RHFA 3LMJL 4NRYB 5A2LH 3H2WA 1NBYB 3S2AA 1FCGA 4JZJC 1BFVL 1J10A 3R18A 4QGTA 5GZNC 1N6QH 3EJZD 3WTWA 4GRWE 3DX4A 3V7MA 1IGYA 5IMMA 1NMAH 2VABA 2Z0UA 4WWOA 1P9MC 1RUKL 5IB2A 3B2DC 1S7TA 1I8UA 3NFPB 3BDYL 3TO2A 5DUPL 2EIEA 3Q6GH 2MOGA 3B9VA 4F2EA 4P5TD 4MD5B 3QEGL 1J8HE 3IGLA 1JAEA 1U3JA 3N6YA 3UZEA 4FN0A 1I8LA 1N5AB 5DMGD 3FSAA 5FXCH 1MNUH 4YHYC 1ZTXE 2RQ8A 1HHJB 1I53A 4KKCC 1TSRA 5FYLD 1GZHC 1RIHL 3UG4A 1MCLA 5BV7C 3N44B 3SKJL 1FNHA 3DJSA 4OZIB 2UV3A 1S7QA 3JWOL 3RL2B 3DO3A 2WUCL 1CURA 1O7DE 3HW7A 4IBYA 4AIEA 3PWLA 4ATWA 3EO9L 2VUYA 3O3UN 2K8QA 2GUYA 3E8VA 3LH9A 3EFOB 1SHMA 3IDJA 3OKDB 4K8RC 1QFWM 5DGQA 2FRGP 5F7LB 3U0WL 1DQVA 1SXAA 2WMPA 1UB6B 1B4TA 3AABA 3FT0A 1YNKH 4KI5F 1BVNT 3STZA 2BSCA 3SGJC 5I23A 2PXYB 1I1AA 4JFEE 4J28A 1TTGA 3O2WL 5KSVB 1NPNA 2G0KA 1DEEB 5AW3B 1AQKL 5A7BA 4ES9A 1GZPA 1IEBB 1E6JH 2XWXA 3EFDL 3DDFA 4GXUM 4R97C 2WJ7A 2X2IA 1N3NA 3RWCB 1DZ0A 1OK0A 2WO4A 1A7RH 3EGXA 1CC3A 2SEBB 2YUXA 3U2SB 3C8KB 4UIMB 3VE0B 4ODTL 4JFQB 2BIQA 5I9QB 4J3XA 3RJOA 2H0JA 4BHUI 3P11L 3FQRA 4Z7WE 3UP6A 4B6ZA 2G2RA 4Z77B 5CFHA 4PGZA 4Y2LA 5EBLA 2JI2A 4DNLA 2X1PA 4MDRA 1IAKB 4GAFB 2C1PB 2VLRD 1XH3A 2RBLA 5IP4A 3SDYL 3SGDI 2G60H 1DBJH 1DBAH 1MXDA 2R2BB 3OD3A 3ZZQA 4UZUA 4BFGA 3JV4B 1HFUA 3WKMH 4BINA 3SCMA 2H8PA 2OJ1A 2CALA 4LSRH 4M5TA 5CP7A 3VM5A 3O9WD 2IV8A 3CU7A 4JRYE 4DUVA 5I0ZA 4APQA 1NCHA 3GTVA 4YS4A 2ICEA 2I60H 5EWIH 5I73B 4KBPA 1IC5H 3LN5A 5LB1A 2XN9A 1KMGA 2F53A 1J1PH 3UPRA 3MRLA 3CFTA 1IGJA 1MFCL 4Y5XB 4EO5A 4X50A 1P84J 1RAMA 1BOGA 3EG9A 3P77B 5CGYC 5CSBA 3HMWL 5E2JA 3V0WH 1X9QA 2J71A 4NUGL 3C5JB 3V9EA 3OPZH 5AL8A 3O41A 3NA9H 4PG2C 5ABDE 3DX8A 4UQCA 4NJ9L 2K3HA 4N2BA 3UH8A 3NOIA 3PDOB 1PFOA 1VACA 2J8UE 1GVIA 1FV1A 1X9UA 4JM4L 5B4MD 3SPCA 4C58B 4NN7C 1PLCA 3UYOD 1CYGA 3D2UB 3SYCA 3WY4A 1HSAB 2IG2H 4HHAB 1B9KA 1WAAE 2A9BA 1N64H 2D3JA 3HB3B 1BW8A 3BP5A 5I8CB 5MI0C 4G6JH 4G8GB 5DD6B 4LK4A 4BE6A 2NYKA 4JDVA 1RPUA 2YO3A 5GS1A 1ZSHA 4CUCA 4JREC 3P3YA 3EXLA 1ROWA 4EKXA 2QSQA 4HCIA 4NQSB 1RIUH 3FZUC 2HT3C 3DPBA 4YFLI 5CZXC 2NY4B 3MJ8A 2R1XA 1HOCB 3RTQD 5I1GL 3T3PF 3FU7B 2ZUXA 2C26A 1DQLL 5L6YH 4JFFB 3VGBA 2D31B 1IM3B 1CLCA 1NLBH 1LEKA 2EDOA 1QPPA 2NY1B 3BXNA 5IW3A 4ZI8A 1JZ7A 4LL9A 5MEPA 2NT0A 3BWUF 3LCYA 2ZXAA 2Z35B 4N2MA 1OHZA 1VHPA 3IE4A 4NXKA 4DKDC 3WDIA 2NUPB 3QQ3A 2W81C 1YPZA 3KLLA 3D69B 3GLDA 1RK1B 1TPXB 3QQ4A 1OCOB 3BCFA 3QQ9C 1E2ZA 3EOBB 3QA3B 3BP4A 5TE6H 3T0EC 3ZDZB 4PLNC 3TEYA 4ZAKD 4LGRB 2GI0A 1KB5L 4PUBH 3TFKD 4L9DA 2OMWB 4K9EH 3T6WA 3BUYB 1XMWA 4OCRH 4U3SB 5LGHL 4O4YH 2X2YA 3L7EA 4XO8A 1TITA 4XPBL 4E9RA 3HBPA 4ELKA 2W1NA 4OT1H 2JXMA 3A4AA 2V3DA 3NFNB 3MZGB 4FFTA 1A7BA 3CC5A 1JHTA 3MGOA 4KQ4H 2NYYC 2DBJA 1ASOA 1H6FA 1TTRA 4NYLB 3OR7A 1UTDA 3TNNA 1OCRB 4F80A 5L88L 2JI3A 3KLAB 4N5EC 2XHNA 1J05A 4B96A 2O6EA 2V4LA 5IVZA 4D9RD 1UWGH 2FYYA 2O6CA 3L5WA 2XWJA 3F58H 1ODUA 5F1SA 3OKLB 3RQ3A 2L3BA 3JZYA 2NW2B 4UAOC 1QR1A 5GRVL 2AJYL 2FEEL 1JVKA 1QHQA 5FF6A 4RGOL 4PRHA 1P7KA 5HY9A 4QY8B 2C9QA 4Y2DD 5A2KH 5JMRA 3WTYA 5DVLA 1CDGA 2BPBA 3QAZC 3FTGB 4DP4X 2PPFA 3MV8E 4JPWL 4ONHB 1N59A 1ZA6A 2GC4C 5AKRA 1OO2A 2FD6L 3U4BH 1QO3A 4QLWA 2IAAC 2QPEB 1XF4A 3F5WB 4RSYA 1XCQA 2HLAB 3U1PA 5DLMH 5EN2A 3U1QA 4HG4J 3JSSA 2YARA 5EEXA 4ERSH 4HFUH 1JZFA 5F9WC 1EGJH 3O6ML 4OJYA 4IMLA 4KMTH 3C5XA 3IU4L 2B9BA 4ANUA 3B9KA 4HSAC 1OPGL 5D7JB 1BFVH 5EU5B 1L7IL 2WPGA 1MCPL 2WWKT 2YEQA 4AC2A 5B3JF 4GOSA 1T7WA 1T21B 4H20H 1BAFL 3HE7A 1QW9A 3D09A 3FAWA 1U3HB 2ZX6A 3KLDA 4JFTA 4J3VA 4B53A 4WWID 1JGUL 2FDBP 3BDYH 3U4EA 4AIZB 1FL6B 1XGTB 4BZ1H 4H1LA 4KX9A 5DUPH 4W9JC 4YNYA 3FO0H 1WAPA 3KR3L 3EJPA 3RUGE 3QEGH 4BFJA 3FOMB 3LB6D 2HFEB 1TVDA 1JHLL 3H9HA 3KCPA 3KYMA 5CCHE 1AO7A 3N06B 2X4PA 4WI0A 5EU6E 4JG1L 3QDGE 1RIHH 4YL4A 5EDSA 3SKJH 1DJIA 3TIDB 2AS5M 1MCJA 3V7AG 3JWOH 4M3JA 4FI8A 1IBZA 2WUCH 2K0RA 3N42F 4MKMA 2R2CA 1K4DB 2PR4L 3EO9H 5BRZA 3NJGA 2P5ED 4W1TA 2NCMA 1GIGL 2Y7LA 1AHWB 3ARQA 4TQEL 4ZXBD 1G6RB 5I5IA 2BNUB 1ZLWK 2QT6A 2CDFA 2NQDA 3NIDF 3O2WH 3GSXB 3PQYB 2Z1PA 4JPKL 1Q4NX 3GIVA 1AQKH 3V0EA 3O45B 1T5XB 2AC0A 1T2XA 4U05A 2XTSA 4FQQA 4KY1H 2EH8H 3S5LA 1IC0A 1HNGA 3HHSA 3MHZA 4HJGB 2IF7A 2KI6A 3FB6A 4C56E 4X4MA 5TQ2L 3HNTH 3QQXA 4Y5YB 2CUHA 1R3HA 4FXGC 4NRXA 4OQTH 4D9LL 5IMKA 1DL7L 1JJUA 5CGTA 3QPQC 5LN4A 5FM5M 5CWSA 4ODTH 2JB6B 2ZSVB 4R7XA 3GMNA 1E8WA 5HDRA 1JGVL 1RZ7H 2Q9OA 3QNYB 2W91A 1CFSB 4GW5A 3G6JA 2RGSA 3VFNA 1TJGL 1ZDQA 2JKSA 2XA3A 3ZDYE 3Q8BA 5CMAB 1ZLVH 3SDYH 5I1LA 3UG3A 43CAA 2JFCA 3QXDA 8PAZA 1R19A 4MQ7A 4H0IA 5EN3A 4PJXA 4OW6A 1G6RL 2DLIA 5LLIC 5FUZL 1PDKB 4NHCH 1U6AH 1WGOA 5IVOA 1SEBB 5DEZA 1CL7H 1VZHA 4PW9A 2YA2A 5BZDB 4NX0A 3RPKA 3Q43A 2X1WL 1KC5L 2GI7A 3CXHK 4XNQB 4PI0A 1ZT4A 3DX9B 3SPIA 1FL3B 3H7BA 4FLHA 2Q76A 2XQ0A 5GZOC 3WGUB 3QO0A 1W16A 3ULSB 3ZGHA 1MFCH 3RI5K 4GRMB 3UAFA 3IPFA 3N3EA 2WYZA 5E8PA 4N2OA 3CFJB 2EDYA 3ZYOA 4NUGH 2HPOA 1E4HA 4UDUB 4H0LC 4IJ3C 4NENB 4RISL 3MX0A 3TYFB 2MNUA 2P5PA 2DOCA 4AWJC 1NCIA 2P47B 3BIKB 2PCFA 4JFDE 2DQGH 4PJHB 1UM4L 1OEZW 4JM4H 3V5HB 3OGOE 5IB3B 4W9DC 4R96A 5K9KA 1A7OL 1QVOB 3O3AB 4FHKA 4PJIB 2EEBA 2OK0L 1CI3M 3P2BA 5H37H 2OMYB 4UQ3A 2VM4A 3EJYD 4OI9A 2JKNA 3R4RA 4WJG3 3RGHA 3QUXB 5BS0D 4P5SA 4PRID 1TQTA 3OAWA 4RZCB 4XNXL 4K4KA 1JI2A 2AW2A 1WUZA 1TMCB 4ALAL 4R90L 2H32B 2D4DA 1JV5A 2ZOLB 4HF5L 4LSUL 3K6DA 2CNZA 1E9OA 4JPIB 3HUJF 3T0BA 1JERA 3C6LA 3EJCA 1D5MB 5K39A 3SDCA 3Q3GB 4G6KL 3VRIB 1BREA 5LAPA 4YK4C 2XWCA 2J1XA 3UBXG 5JORA 1QSFE 2BHUA 2NZIA 2VR4A 2E59A 1AXSB 1C12B 4IGBA 3T3MB 4Z5RA 4N90D 4AT6A 2PW1B 3Q48A 1KIRA 4POUB 3CC1A 3QZPA 5A1AA 1NDMA 3BWAB 4JG5A 5JQ6L 1M3JA 1C16B 4UU9B 4YC2C 2J6EA 3WIHL 1USQA 2IWEA 1UOLA 1GOFA 2OM5A 3W9EA 2G30A 2F6AA 4X6CE 3B7UX 4K7FB 4X5WB 4B5EA 3QUHA 3OKNB 4N0CC 5F89A 1T7ZA 1KLFB 1S5HA 4ZT1A 2JJUA 4OCYL 3AREC 1A7PL 4TUKL 3KPSD 2X6AA 1KB5H 2BP3A 3GRWA 4JY4B 5FOBA 4U1JA 5DWUH 4NQDE 4GT7A 5LGHH 5IVNA 4TSAL 5E5MB 1S9YA 4ZTPL 1CG9A 3L4WA 3RVXD 3HHMA 3WLWC 4DEPB 2CKBA 5DK2B 3F8UB 1B0WA 5ID1A 4LHUB 1KT2A 1DVSA 3TP4A 1JI1A 3MXWL 5FPIA 2O5XH 4ICXA 4K7PX 5H35B 1K6QL 4DPRA 1FQ9C 2UZIL 5KBKA 5CGMA 2YPVA 3UTPD 2X6BA 2X6UA 3WY3A 4D9QE