3UZEC

Crystal structure of the dengue virus serotype 3 envelope protein domain iii in complex with the variable domains of mab 4e11
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
99
structure length
94
Chain Sequence
YAMCLNTFVLKKEVSEHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKVNIEAEPPFGESNIVIGIGDKALKINWYRKGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Variable domains of murine anti-dengue Mab 4E11
publication title Mechanism of dengue virus broad cross-neutralization by a monoclonal antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 94
sequence length 99
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uzeC00
2JV6A 5LBVA 5JHMA 1OK8A 1URZA 4GT0A 4X42A 2ALAA 1SVBA 5H37A 3UZVA 3WE1A 3UYPB 5KVFE 1S6NA 3UZQB 2R29A 3N41F 5LCVA 1Z3RA 4UTBA 3N40F 3VTTA 5AAMC 5KVEE 2R69A 3P54A 2HG0A 3UAJA 5LBSA 4ALAC 5GZOA 3C5XA 2JSFA 5IZ7A 4UT9A 1PJWA 3G7TA 3IRCA 4FFZA 2H0PA 4UTAA 4UT6A 5IREA 3J2PA 4FG0A 4GSXA 4L5FE 5KVGE 5B1CA 4BZ1A 1TG8A 4FFYA 1UZGA 4AL8C 5JHLA 3J27A 1Z66A 1RERA 3UZEC 4BZ2A 5KVDE 3N42F 2I69A 2P5PA 2JQMA 4AM0Q 3MUUA 5AAWC 1ZTXE 1OKEA 5GZNA 2GG1A 1OANA 3N43F 3C6EA 4UTCA 2V33A 3N44F
chains in the Genus database with same CATH superfamily
4CBZA 2Q86A 3N55A 1LO0L 1T03L 1FE8L 5E51A 3ESOA 3RVWC 3GJEA 3R4DA 2FYYB 4L4TD 4RRPM 3X3FH 43CAB 2XZZA 5SWQB 1QRNB 2VDKH 4GP4B 4CMMA 2F15A 4QHPA 3P9MB 4LPXA 3P69A 4MJ5A 3EO0A 3DX7A 4MTMA 4H8WL 4LMQE 4AM0A 5AVXB 2ILLA 4HIHB 3I6SA 3THMH 1R46A 2MRYA 4NUJA 3T2NH 1BYPA 2FWOB 3QXTA 4POZD 1MFDH 2VERN 1EAOA 4AWJC 3VYNA 5TD4A 3BVVA 3BQUB 3T6XA 4PJCE 4CDHA 4FFZL 4U1HB 2R15A 4C47A 4UQBA 3BP6B 3LXUX 2WMPB 1A6TB 1A1OB 1D5MB 1TJGL 2OMNA 3CZSA 1PW3A 2Z7UA 2PP9A 4FTVD 2HVKA 4N1CA 3D39E 5LBSA 3RZCA 4JRYE 4XMZA 2W9EH 1KN2L 3D30A 4TVPE 3Q2WA 4N6QA 3NUKA 4F7EA 5LWYL 2Q7YA 2GBUA 1P84J 1DBAH 1ZS2A 1O6VA 4Y4FD 1CDYA 1LE5B 5IHUL 4GKNA 5E7FA 2DQJH 3V4PL 3D4CA 3VFMA 2XA8H 1XGRB 1NMBL 2YD9A 3SDXB 3VFRA 5L2JB 2KMWA 5K59F 2XOTA 5E9DE 4WW2C 3MMEB 4LPWA 1ZT1A 1WITA 1R3HA 2Q5BA 2V9TA 5IB5A 2DS4A 2WSDA 4F92B 2HX8A 2FGWL 4X6DE 2LTQB 5FUZL 1SEBA 4LPCA 4Y5VC 5EEXA 4UQEA 2YRLA 4R7XA 4MDJB 4JAMA 4V2BA 1VERA 3MJ9L 3V0WH 3WG7B 3FONB 3EJZD 4BCYA 2IH3A 4X4ZA 3CVHH 4OIIH 1YECL 1I7TA 3MRQA 3JVGA 2E27L 4UUJA 4PJCA 3PXJA 2Y7QB 2D9QB 3O6FC 5F0PB 3I9PA 1MFNA 2EDMA 1RZ8A 3OB0H 3S6CA 3EYVA 4BWUA 3VFNA 3MV8E 3KPRE 2X4QB 3MUJA 4WHTB 2ICEC 4QRPB 1A4CA 4KVCH 3LYRA 3HLAA 2QV2A 2HN7A 4JRYA 3WTVA 1FLTX 2NDFA 1ACYH 2NQDA 3FTWA 4PG2C 5FO8A 2VDLH 1VRSA 3GXMA 5B38A 1P4IH 3MRBA 2OYMA 2C34A 4LSVH 4Z76B 1J5DA 1D6EA 5ADOL 1D7BA 3IPEA 4FXGA 4LP8A 2JMRA 5E9DA 4Z18A 1RPUA 4M6AA 5D5MB 2BM3A 1MFAL 2AF2A 2QBWA 4YC2B 4G3YH 2EZ0D 2DH3A 4WWID 3Q1SL 2PWDA 1L4IA 2Z4QA 4CKQA 1IVLA 1YMHA 3AY4A 3IMTA 1EBAA 2X3BA 3LKRB 3MRJA 5K1VA 1JGIA 3SE3A 3QI9A 3IDGA 3GUTB 3OR7B 4S1SH 1JGVL 3VVVA 1JOIA 1ZE3C 3BVNB 2Y7SA 4X9HA 1ODAA 3WE1A 1SJHB 3VFOB 1I8IA 1F0LA 1CFNA 3ZMNA 4J5VA 3SO3C 4B0MM 1FDLL 4F27A 3VM7A 4DN4L 3AVEA 3QVAA 2X2UA 3BEWA 2ERJB 4M7KL 4QXVA 4KI1A 1EEYB 2Z31C 4X6CE 3VRJB 4I8DA 5AKSA 4IGBB 3L81A 1P2CB 3IDIA 3BPLC 1KJMB 3MV8A 3QG7H 3KPRA 4LRNL 1X5FA 4PS3A 3VYPA 1ZA3B 5TE6L 3UROR 4P9HL 2ZPKL 5BS0E 4M9PA 3QPXH 3TIEB 3IU3A 3C5JA 3OKOB 3CFDB 3ZT5A 5I1JH 1TFPA 2COQA 1T1XA 3O3EB 3WKQA 3WKYA 3D7PA 3LKNA 4E5XG 1MCDA 1N6UA 3W39B 2WXRA 3V6ZA 5C3IA 3TA4D 3EZ8A 4FJ6A 3DARA 1G4RA 1W6WA 2VZVA 5FM8A 5SWSB 4F33A 5KW9L 3LQMA 5EDXA 2X9ZA 2Z1KA 2IH9A 2OMTA 4C8XA 3F58L 1CFSB 4G70B 2YMOA 4JJHA 1WBXB 2DBLL 1SXCA 1MFBL 2MTAA 4HIEB 2R83A 3H8NA 4K94L 1FN4A 4YLBA 1NMAL 5JHLA 4L8BB 1QP1A 4YBQC 4ZFFA 1PLGH 1Q38A 1SN5A 5ISZB 4WFGE 1QR1B 4FXKB 4EI5C 12E8L 1SUJA 4LVNB 2P7TB 1OE3A 3L5XL 3BVUA 4HGKC 4A6YA 3H2PA 4WENB 4F8TA 5FCUH 1HDMA 2R29L 5FYLD 3OXRA 1MREL 1RK7A 3EGXA 5BS0A 5EEWA 2VO8A 4QLWA 1A6WL 1MI5B 2V7HB 2YN5A 4KZ0A 5HDQL 2E4TA 4X6EA 4AYGA 2Z8SA 2AABL 4X4XB 1P5UA 2VAJA 2E6JA 4P57B 1H6EA 4C56B 3T6VA 4GRLD 4DP1X 4QHMA 3I9AA 4NNPL 5KSUB 2WOYA 3IDUA 4GT7A 4DKTA 3CBKB 1NCNA 5T3XH 4HMCA 3RNKB 1D2OA 5CXPA 4BK5A 2V5RA 5EO0A 2UYLA 3V9FA 5ERWB 2HMID 1H15B 3NZSA 1F3RB 4NKIH 3K6SA 3WFDH 3BP7A 3SQOH 2EECA 4Y2OB 4UTAL 3DDGA 1UWXH 3CXDH 3GNMH 1MOEA 3HI6H 1HHJB 2RBLA 3JUYA 2W38A 4L3CB 4BUQA 5KUMA 1E4WL 1OF2A 5DHYB 1N5YL 3O6MH 3D18A 2PCXA 2WW8A 4JL1A 2I60H 1ID5I 2VXVH 2R0KH 3GMRA 3KL5A 4G7VH 4GAFB 1IU1A 3FO1B 3QQ9C 4HDIA 1ES0B 2BOBB 2R7EB 3QORB 4RWYH 1KV7A 2D2CC 3CX5K 1NFIB 3LPPA 3UTSD 5CLXA 3CK0L 1EZSA 4AEFA 2Y36L 4RQQB 3S8WA 1J1PL 2VR4A 4FG4A 1R0AL 1R3JA 3MRDA 3S3DB 3SPJA 3L1FA 3FU7B 4TQ8A 5HGBB 3AJ7A 3D2UD 1PSKH 2PXYA 3LZPA 1N64L 2X89D 1E3FA 1FVDB 3L1GA 4JVWA 5FUCC 2RALA 3FCUB 2ZT9C 4JJ5B 4MNHA 5HPMB 4Z7WE 2AEQL 3MXWL 5I76B 1FFTB 1MIML 2BOCB 2WOBA 4PD4J 1KWGA 1E4KC 5BRZB 3OKDA 1OGSA 5FWRA 4DETA 3BT2L 1EJ8A 4FQXA 3IKCA 5JIHA 4JFOA 1IKNA 3LKPB 1WBZA 4WI5A 5HGGS 1HH6B 5DUBA 1U42A 3BDYH 4IOIB 3VXNB 5DK2A 4LL9A 4TQPA 2FWUA 2NY3D 2DWEB 1XH0A 3QQDB 4PG9A 4DKFL 3LN5A 2HT3C 1SY6L 4X5LA 2E7HA 1HEZA 2W80C 4WAFA 1B88A 4MJ6B 1RLWA 4QHNA 5KSBE 4K2UH 2XV3A 4PWJA 1J1OH 5DJXB 3Q06A 1RJCA 5HP5A 3ECBA 4KXAA 5KS9E 4PJ5B 2F53B 3EH1A 3SGKA 4QRQB 4RA3A 5J9PB 1F3JB 1UQSB 1BMZA 3WENA 3MRKB 4FAAB 3N43F 1FRGH 1KEML 1M42A 4K9JA 1FZKB 2RHEA 3GBML 3W11D 4B7LA 4Z7WA 2PLTA 1IBBA 3KLQA 3CHQA 3NACH 3ORJA 2NW3A 3VFWB 2A9MH 5K1JA 4ZK8A 5JPMA 1RIUH 1ZEAL 4HETA 1JGLL 4APXA 4D8PA 3HZYB 4GSQA 1INDL 5JOPE 3H3PL 1LQBC 4UT7L 2CO7B 2EDTA 3GMQB 3LNFA 3U7WL 1QQDA 1LXMA 2NY5L 5EWIL 4DSYA 2P49B 4LF3B 1OGAA 4ODTL 1KMGA 2FX9H 1TZIA 2OZ4L 4PWIA 1MFEH 3Q1EA 4PBWD 5DJ0B 2OXGA 3IETA 1CXKA 3UO8B 4CNIA 5L2KB 1F6LL 2JQZA 3WO3B 5DDHB 4PAZA 1TEFA 1B0RA 5KS9A 2QTEA 2JH2A 1A6VL 1KBBA 4PS4L 3GLAA 4JKKA 4YL4A 4IOFC 1Z9LA 2BWQA 3LS5H 1ASPA 3EYQC 5HJ3B 1TIUA 5JNYB 3HAEA 4WIQA 5GRVK 1J0JA 2IALB 4XBPB 3WELA 5C0CD 4KX7A 2CO1A 3B3IA 2F5AH 3NZHL 1Q94A 5K9QI 2FX8L 1NFDE 4NPYA 1U4FA 1F4YH 1DSFL 1U3JA 1BQLL 3A21A 4ZG1A 5IG7B 3KJ4B 4KFMA 4OTXL 4KJYA 5TFSH 3DO7A 2BVOB 4K7PL 1BAGA 3GSVA 3CN3A 1SLWA 3WSQH 3MYJA 1JXGA 1YEGL 3UACA 1HILB 2EE0A 3NT0A 5EZPA 3B7YA 2AVGA 3BFQG 2B14A 1DVFA 2MNJB 1EK3A 2QQLL 4FQHB 3EFOA 3FUIA 4NO5B 4JKPH 1T22A 4NO3B 3QNXA 2O30A 1JHTA 1KCRH 2VXUH 3KPQB 5MERB 5DR5H 2I26N 4L8DA 2DQEL 2AXHA 1UXSA 1X9UA 3H0TB 1HHKA 4KZCA 5A2KH 5JW4Q 1EGJH 1TMCB 1BOYA 4Q2ZA 4V33A 3C09C 2AJYH 5CP3A 4DGYL 2XQBL 1M1XA 3ELAT 1YN7B 2FYVA 1OLZA 1MCWM 2EH7L 1ZOXA 2YLHA 2YPLD 3RB5A 5IQOA 2F68X 4MCYA 1ZVSB 3CMOH 2K7QA 1X5GA 3G6JE 4G9FE 1SLXA 4JMNA 1KYFA 3PWPE 4RGNC 3F04A 5EEYA 1AVAA 3L4CA 3INUH 3O0LA 2YC1B 5CKGA 4QRTA 4W4OA 1OAUH 2NX5B 4B50A 4EN3C 5AW1B 4DP8X 3QR0A 1JFQL 1CR9H 1SGKA 2FJGA 3HOGA 5C9KA 2H3NB 4HZ1A 4O2FA 1KXVC 5JORB 2EDKA 1JYWA 3VO0A 1SJEB 2CK0L 1F56A 4GQ9L 1BEXA 2IVFC 3L7EB 7PAZA 4YUEL 2C7UA 3ZYJA 3D05A 3WI9A 5I6MA 3QZBA 4PY7A 2R2BB 1OK8A 3W9DA 25C8L 3Q9PA 1V3MA 2BMKB 5GXBB 4JX0A 3D0VA 4MAYC 5C7XH 5K9JL 4L0PB 1U93A 2VUOA 4LQ1A 2YHGA 3KPPB 5ID0B 5DMKB 3MCYA 3DDFA 4PJAE 5DRNB 1KCVL 3K46A 2XZQL 4OCWL 2ESVE 3ZSSA 4N2EA 1T0MA 4HJIA 3SE8L 5C6TL 4JO4L 1FIEA 5IQ7H 2YQ3A 2ZCHL 3NCMA 3QE5A 3T3PE 3QZNA 3OGCA 3ETTA 4Y9CA 2VXTH 4LP4A 3U2IA 2DM2A 3G6JA 2BP3A 4G9FA 3AACA 2CO2A 3PWPA 1HSBA 2A83B 3G5YB 3MV9B 4YR6B 5GSRB 3K8KA 1JVLA 3MLPA 3K8MA 5EF2A 4KTDH 4UAHA 5DFVC 5FYKD 3NVQA 1NIBA 2VL5A 4RZCA 4ZMNA 5SV4A 2OMUA 5JOEA 3CZGA 4PWKA 5HI4D 2Q3AA 4LVOC 3AM8C 4RFOL 2ZQKA 3T5WA 3U6RB 1GAFH 3FQTB 4AGLA 1WFIA 1B3IA 2A73B 3HIZA 1FV1B 3VGAC 1P9MA 5CHNA 5D70H 4HC1H 4IMKC 3DTXB 3EIFA 3CE1A 5I9QC 1MWAL 3T4YB 2OJEA 2AXJA 4LASH 4PJAA 5E00B 3EOTL 3LNIA 5IKCA 1NUNB 2W9DH 2ESVA 3K81A 3QARA 3HZVA 4OZFH 1ZWIB 1V7NH 4U1GB 2JKIS 4AC4A 3TZVD 2NMSA 1NEPA 2IV8A 1JYVA 1CG9A 1Z9MA 2CXKA 5GRVL 4RISH 3CU7A 1OAKH 3NGBB 1LILA 3PFUA 3U1PA 2NCEA 1UACH 2BVUA 3LPGA 4W9CC 3TJHC 5IMOA 2FL5A 5HYFA 1E4HA 3TA3C 1NTDA 4YSUA 1WRFA 5FIEA 5CFHA 5DRZA 4KGLA 4TN9A 1UENA 4XPGH 5LKNA 2P52A 4GSDL 1KTDA 5D1QB 5I73B 3QEQB 2O93L 1QTYT 3FFDB 3MNWA 5D7LE 1B4RA 4G43A 2R1YB 4F8OA 3TVMB 4WI0A 1F2XK 2GK0B 4KNQA 2O6FA 4POUB 4QXUL 5D2NA 2EACA 5BVPL 1MWAB 2CJUH 2UWEF 4U05A 3AS1A 2YBRA 3EH5B 4K5PA 3CU1A 4HMEA 4P4KC 4ZUUB 4N86A 1WFUA 5L8LB 3RPIB 3CPLB 2X28A 3K8LA 1X7QA 4PS7A 4QGYA 3RFZA 1QOKA 1J8RA 4YHMH 3K4DA 3M1BA 4CN6A 3H2QA 4ORGA 2WZPA 3PWNB 2A1WL 3QNYB 3PDOA 4OCLC 7TAAA 2P24B 1VFBB 4FCHA 1CFBA 1YQVH 4Z8FH 1KTLA 3MBWB 2O26U 4AMXA 1YSOA 3ZTNH 1KTKE 2JTYA 2N7AA 4OF7A 5FDWB 5ILTH 3KWVA 4B9YA 4C4KO 1Z9PA 2HPTA 3HNTL 3ZE0E 1FCGA 3ZDWA 3QRFM 5DS8B 3O4LA 2R9HC 4G8GB 2GTWA 3ME0B 4X4KA 4NC1C 3ARED 5IW3A 2BSED 4PCSA 1AQ8A 4L3AA 5C9JA 3BJ91 1ODUA 5T1LA 3HHMA 4A37A 2AEIT 3G04A 5I1CL 5JHDD 1A14H 4GAJL 3QH3A 5T1KA 3PL6A 1OTSD 4P2QB 4R2GB 1KXTA 2A6JB 1QUNA 5D7LA 3TN0B 1IZKA 1ERNA 5JMOC 2ZKMX 4KJPD 4MLIA 4XP4H 4Y9FA 3MLVL 3S3JA 3DLQR 3ZU8A 5IUCA 2B9BA 3FQNA 4AYDC 5F7HA 3VXPB 2F7RA 3KHQA 1BFOB 5EU6A 4KHXL 3I2CH 2ITDA 5FYJL 5AAMA 2N4IA 4MJ4A 5I1KL 2UX6A 3FTGB 1OTTD 1FFOA 2PW2A 2XT1B 1S7TA 4LFHG 4CDGC 5J6GA 4MMZC 4X99B 3WY1A 4LOUC 5D7EA 2NY1B 2V9RA 5ESVA 4CMHB 4WEBL 3HJEA 3QUYD 4N8VG 4Y1AE 1AGCA 2NTSP 1T1ZB 2P1YA 1EXUB 3H42L 4MA1C 1ZT7B 4OKVB 3GGWA 4ZUTA 2VDOL 4HPOL 1VEOA 1J8KA 5GJTH 3GZPA 1OW0A 2D3NA 4FF9A 1RK0A 4NCC1 1ZHNB 3G5WA 4CJ0A 2YAHA 1AO7D 1M9SA 3JZ7A 4RWHA 2CPUA 1FFPB 3EGSA 4LCWB 5FO9A 2GFBB 2Y3AA 4A2HA 3FS9A 3CLFH 3NA9L 4L1LA 1A7OH 1K2DA 4PJHF 5FB8B 2JLPA 5JIMA 5GRJH 4YE4H 1HH9B 1QPXA 5E08H 2HT2D 3LMJL 1TOXA 4C58B 4OD2A 3GKWH 1TJHH 2YD1A 5DJZB 5I0YA 2X70B 3BZFA 5TGBA 2C9AA 3MLYL 2OI9B 4AY0A 2WIIA 4OJDH 4K7PX 5T3ZL 2VR6A 4OLXL 3MO1B 1KACB 4YFDB 2H0EA 3HG1D 1MW3A 1X3DA 2AZAA 4XN5A 4IDJL 3WFBL 1RZQA 1DJXA 4Y1AA 2VDOB 3UBGA 3IF1A 5I75C 4WEEA 2D3LA 4JQIL 2H26B 1RD6A 4QAWA 3VXTA 1BJ1J 5KANI 3IM1A 3VWJB 4HK0A 5ITFB 1GHFL 2VITB 4MS6A 5LAXA 3NIDB 1HFUA 2CR3A 3ULVL 3VSTA 4X9FA 3O9WC 3JWOL 1KGIA 3OJDA 1B2YA 4O2EB 2XFXA 3QO1B 1I1RA 1MHPH 5KSAB 4U1LA 3DXAB 3JTSB 4MYPA 1JFHA 4LLVB 4R8WH 1B4LA 3MNZA 1LGVA 2RGSA 2J5LB 3HRZA 1VIWA 2H1PL 3KLDA 5BZZA 1YYLH 2DYPB 3NK4A 4XO9A 2XV6B 3VFPB 1E0OB 1G7PB 3EO9H 5LQBH 4MCZA 5EOQH 3EYUL 2FJHA 1JPTH 2JKRM 3CN4A 1A25A 3LEXA 4JJOA 4BE6A 3HE7A 4QR7A 2VLRE 5GZOA 4O51B 2J6EH 4IIQA 4BZ1L 5IB1B 2XTJD 3OJ2C 5AW3B 1AY1H 4JPKH 3WLBA 2X1PA 4QHLA 3HCVB 4FHJA 2WQ8A 4IRJC 4KC3B 1N6QL 1XCTB 3QZWG 5JIDA 1VFOA 3GS0A 4UMGA 3V8OA 1I3GL 1WC7A 3QFJB 3DMMC 1AC0A 2PYED 4AQ1C 3RDTC 4N0UA 2P26A 4Y9BA 1O7DC 4PRBA 1EAQA 2GY7B 4P3CL 3UYRH 4AL8H 2D2OA 1H3PL 1P7HL 2L7JA 5G2NA 5IMKB 2D7TH 1IC5L 2JCCB 3NZUA 4XP1H 4Y4FA 4H40A 5I19L 2YSSA 3MFFB 3SDDB 1KELH 2IWEA 5AVVB 4NENA 3UTQA 4NS0A 1MNUL 2FT6A 3QUKA 5K5YA 2KDYA 4UWQB 3H85A 1N4XH 3EBGA 3UTTE 1AHKA 5D2LE 5HHQB 3A4FA 4GKSB 1NGYA 2Z0UA 4OFPA 4TNFA 4P46A 1QSEB 4IKLA 3RX9A 3SBWA 3LIZL 4K3JL 2EDNA 3GIZL 1KBKA 4N0YH 1VZHA 5KN5A 4JDTL 2VLRA 1K8IB 3DVIA 1XR9A 2HH0H 2CJTA 4MMYA 2XN9E 2BSSB 4I4WA 2WBKA 1V10A 2JQAA 3PJLA 4KAQH 4HUWB 4OLWL 3RGHA 3JSSA 3RHWK 4IRSA 4R4BB 4CN4A 3N1MC 2BJML 5EBGA 1HSAA 3E80A 3O2DA 4E9LA 1CVRA 2R4SH 1DBJL 4OAWA 2FT8A 4PJEB 2Q3XA 2MCMA 4ODWA 2HVJA 3ARFA 5E1GA 5SWZE 2QFRA 3ENEA 4WNQB 5LCVL 2J8OA 2Q6WA 5GGUA 3IDJA 4Y0GA 1C08A 1X5MA 1PZ2A 4N2IA 1ZLWK 3APCA 4LPYA 2ZX9A 4HWEH 5DO2C 2NT0A 2MQGA 3QEHB 1QMUA 1GTFA 2PF6A 3R7RA 2A74A 2D03H 3SKMA 3QWNA 3WV0A 5CIPH 1HQ4A 3PU7A 1S6NA 1M7DB 3BGFC 1BX2B 3LZQA 2AQQA 2APFA 4LGPB 5D2LA 3EXJA 4PRDA 3I9IA 3AB0C 4OVUA 5E2WH 4ZW3A 3KJ6L 3V6FB 4PJCF 1SMOA 3O6LL 4KJWD 4L0ZA 4ZAKC 3L5WB 3VFSA 2ZOKB 2OW6A 3UGXA 5H2BB 2E9IA 3RWDA 1RMFH 1UD2A 2CA3A 4HCRH 4U6VL 3FAWA 1AFVL 1C1EH 1HXKA 5D7SL 3PCYA 5DJCB 4AGOA 2JSFA 4AG4H 4HJGA 4UOW0 3PHQB 3VFUB 4ES9A 2IFFL 1ONQA 5HJGA 3LHPH 2IMMA 1QI3A 1JV2A 4KUZH 4G1EB 1D5ZA 5AZUA 5M7QA 1B4TA 1QEWA 2NY0C 3K6NA 4UB0L 4HS3B 1DJGA 1HN1A 3V0HA 5CUSH 3WS6C 4PFEA 5TE7H 2R4RL 2AEPL 3QG6B 4WU7A 4D0BB 2FX7H 5MEOB 5HJDA 1BEYH 5DCCA 3Q48A 5HHOB 1A22B 4LLYB 1YJDH 3ZDYF 4F2ME 2ZCKH 1GGIL 2GAZB 3QRGL 4KXDA 2ZWNA 4QCIB 4ZMQA 1Q9WA 4QO1A 4TOYH 1KB9J 5T33H 4JFUA 5DA0B 3O4OC 1WWAX 2FB4L 2HZHA 2UVEA 2C9SA 2LLLA 1R5VB 2ZICA 4QGTA 2JIXA 2NXZC 5BUGA 4QYOB 2HJFB 5KJRL 5AVZB 4D0CB 4O2CA 1F8TL 1YJDC 1AR1C 3D0AA 4TSBH 4X4ME 3WFHB 3O3UN 3FTUA 2HTLC 3G6AA 1U41A 1ADQL 4V1DE 3QJUB 3MU3A 1ASQA 2ZOUA 4Y19B 1OAZL 5D4HA 2ADIA 3V4VH 2NZIA 4NKDB 2YEZB 5I15L 3JV5A 1E6JL 2DLFL 3C5ZA 3GSQB 5B1AB 4AQEA 4U0RB 4EOWL 3AS2A 5L7XH 1HYRC 2GITA 4NNYB 2O5XL 4FNLH 1V3KA 2AXWA 2X2HA 4JANB 1QO3B 3CUPB 2EDBA 4FLSA 2BCKA 5EZJA 1XDTT 2QR0A 3LRSB 5E5MB 4F2MA 2LU3A 1TJXA 3PGDB 1GVIA 2AQ1A 4LGSB 4BHUA 5TE4H 4OUUB 3PJSB 4M6MH 2PYFA 1IQWH 4YBLC 1ZLSL 1M05A 5DSCB 1GJIA 5F7KC 1TJIH 3L6FA 5HI5D 4URTB 2Z0BA 1E28B 3QCTH 3RWGB 3P1VA 4Q9RH 2AK4D 1A5FH 2WQRA 1OARH 1WBYB 2AERT 5JA8B 2G9HA 3MZTA 1KWKA 1AHWA 3A5VA 1XIWB 5TDNA 2LHAA 5FM4A 4BWWA 4ZOAA 2TAAA 2K4WA 1OV8A 3FRPB 1OSZB 5HHXH 3TEXA 4XWGL 2CLZB 3MLRH 3MUGB 3VFTA 1AZUA 3HE6B 1JZ4A 1DDHB 2FQGA 4V1DA 5C0BB 2IWFA 3L3OB 1QRNE 2FIKB 1LLAA 1EHAA 4H8QA 2SEBB 2VZUA 2XJLA 4NZTH 4PP1D 4J2XA 4LCCA 4EZMA 3U30C 1WH0A 4Z78A 1JWSB 3G7TA 4OGQC 3ISRA 1BMWA 1U8QB 3WS3A 1NAML 1NGPL 3HC0A 4NCC2 3UTSA 4AYID 4KPHL 3V4UH 3VXQB 4DPBX 3NSDA 4NQVA 2J73A 1YAIA 1RURL 1AKPA 5CEZL 2GT9A 1MNNA 4ANKA 3K72B 5KVGH 1K4CB 1BQHA 3LV3B 1NC4D 4HT1H 2QMJA 4YIQA 4WWKA 2C5DC 3FB6A 2I85A 3MLUL 4YE0A 5JPNB 5H94A 3R7QA 2AQ2A 3O8XD 3UERA 3JVFC 3MUY1 3QJRB 4KK8D 5TJWK 1F00I 3UFIA 5IOPB 3TESA 4S11A 2X88A 4Y5YB 1YNKH 4BZ2A 1AG6A 1A47A 1IQDB 3P3RA 4ZSOB 2HP4A 3IJEB 4HZAA 2NR6C 2X3AA 5K9KB 5KSAD 1RUAL 5DEJA 4H88H 5A6IA 2XZAL 2FYYA 3SDXE 4K15A 2PPDA 2VDRB 2Z8VC 5MI0C 5SWQA 4JKWA 3BD4A 2YPVH 1JXFA 3GKZA 1T6WA 2VSKB 5DD0L 4DP0X 3K5SA 3BKYH 2BP0B 2CIKB 3P9MA 3R1GH 4GFTB 4MA7H 1KJ2L 2E8YA 4OM0L 2CH8A 4HIHA 3DK2A 4KWUA 2K45A 1WYJA 4ZTPH 3QPQC 3TBBA 3UG5A 2YD3A 2FWOA 1VCAA 1FNAA 4PPTA 4WO4C 1MQKL 3ABKB 3BQUA 1CIUA 1S3KH 2XETA 1W72L 4U1HA 2JKTM 3BP6A 1OTUD 1A6TA 2WMPA 1JPSL 1Y6KR 4OT1L 4WFED 5BMFL 4G6KH 5F7EH 1K72A 2X1WL 4LVHC 5B4MC 3CCHB 4QRPE 4PJDB 4XCEA 3IGAA 1XZWA 2IV9A 3UAEA 4H8HA 2XY1A 1BZ7B 1QLRA 4ZO7A 1F90H 3V52H 1UCBH 5E24E 3IT8D 3FYIB 3VD1A 3RKDD 1LE5A 1BAFL 3IAPA 3CFJB 4WJ5B 3PQYD 4K5NA 4ODXB 3SDDD 1MY7A 9CGTA 5KG9B 1RAMA 3IMSA 2H6OA 1FGVH 3SDXA 5L2JA 4Q9BA 5I26A 3MMEA 3F00A 4XXCA 5D5ME 2G60L 3C2AL 1KJ2B 2WLJA 1F97A 3ZT7A 2CKBA 3NIGF 4G80B 3STZA 2ZF8A 5DJ6B 1IAOB 4PREB 1D5IL 1ZA6B 4OJCA 1PJWA 3I6KB 4TM9A 4Z7WF 4MDJA 3RUGB 3QEUB 4FFZA 1W72B 1WFNA 3SJVB 2KPNA 2CDGB 3RTQC 1OF0A 3E6HB 3GXIA 3ESUF 1SM3L 2A9BA 2IH1A 1QFUL 5ESQB 5KVEH 2Y7QA 1DLFL 5KTEL 1YPZF 3K3QA 1CWVA 1JHKL 3D69B 2X4QA 3DURB 4WHTA 4MS8D 4QRPA 1E6OL 1R4XA 4OY9A 2ZAHA 4U2YA 3LS4H 3BP5A 1SEQH 2QPFA 3C60B 4YSPA 1CGSH 1RULL 1Z66A 1CK0H 1LK2B 1RERA 4LSPH 4QXGL 1OQXA 3IU4H 3ZSTA 1RJZB 4NIKB 4QJ4B 3N42F 2YAFA 4Z76A 1XGYH 3QA3B 3BDXA 3JV4B 5KS9F 1BFVH 2IMNA 4QHKJ 3E9TA 4TLTA 5D5MA 4Z77B 5SWSE 1W16A 1Z5LB 2E76C 2P8MB 1OP5H 1BAWA 1R5WB 2DJUA 2NTFB 3GUFA 1RXLA 4K8RL 3CVDA 3LKRA 4OLZL 1UVQA 3E3QC 3GUTA 3SKJL 3OR7A 1EEZB 3MJ9A 3BVNA 3NAAL 4I18C 2H41A 4U2ZA 1SJHA 1E5BA 2B08A 4J4PD 1MVUB 5DZLA 2CE6A 3VFOA 4D9QE 5ISZE 5EA0H 2X4NB 4PH8A 4YBHA 2ZYRA 4J27A 2YPLA 4A66A 1JP5A 3B37A 1EEYA 5IF0B 3CQFA 1I9RH 3VRJA 3US0A 4YWGL 4IGBA 3SGJC 1KJMA 1F1DA 4XPBL 2W91A 3PWVB 1UT9A 5B8CB 3FT3B 1ZA3A 5KSVA 5J13B 2DQIH 4Q52A 2CK2A 4IEFA 5D1ZC 3BH8B 3TIEA 1YYMH 1MI5E 3ROOA 3CFDA 4HXAL 4RFNB 3L5HA 3O3EA 2KKQA 2UX7A 4KQ0A 1IBFA 3M1OA 4C56E 1A4KB 4YLCA 3CQQA 4JE0A 3W39A 2DEWX 2ROYA 3MDJA 1B0WA 1KB5B 2B5IB 2X6AA 5FO2A 4IMLB 5SWSA 5KOMC 1KYOJ 4N8UA 3HB3B 5K39A 5I8KL 1GGUA 1MSPA 1CFSA 4P49A 2CD0A 3HBQA 1GIGL 1WBXA 4YDMA 2D0HA 4WGKA 2MOVA 3LD8B 1WCQA 1EXHA 4L8BA 4NRXB 2I24N 5ISZA 4N8PA 3K6DA 2VQ1B 4I0PC 4HUVB 4FXKA 1T66C 3VGEA 2W92A 4J23A 2WUCL 2P7TA 4DOHB 4UM9D 3HG4A 1E67A 4KKLD 2ZWZA 1EA9C 1GYUA 5L4JA 3VE0B 3VSUA 3OXSB 4NO0B 2KBGA 4HQQL 3PV6B 2GBVA 4GFXA 2WV3A 1QFOA 1X5JA 5KOVC 3WUZA 4L4VB 3KMDA 4GSXA 2EICA 1MI5A 2DMBA 2V7HA 4PEEA 1KC5H 3WIIH 4HWZB 3D4GA 2JB6B 4X4XA 4P57A 1AJ7L 1F1AA 3OGOE 4OCYL 4C56A 5DJ8B 4XMKL 2IBBA 2A9NL 2OMXA 2VSDA 4K23H 5AZEH 5KSUA 2F8IA 2NQ3A 1VAHA 1XZ0A 4JLRB 2BWIA 3EDDA 3DHPA 3E8UH 3RNKA 4Z6AT 1HEJC 4LLMA 4AEIH 3GSNH 1NIAA 1FHNA 1P7KA 3N2JA 4FG2A 5FV2A 4FZ8H 1NEZA 1JZJA 5I6PA 1SYVB 5ERWA 1KIQB 1H15A 3G6JF 1EZVX 1L9NA 4KNUA 2I07A 2ITCB 1OWWA 3WNMA 4L5FH 4RGOH 4Y2OA 5BRZE 3MOAH 3UBXG 1NAKL 3CFUA 3TZVA 1HHJA 3KYKL 4L3CA 3GF8A 4U7KA 4Y16B 5DHYA 1C7TA 1L7IH 3MV7D 3S8GB 1UJTA 3B9EA 4J2QA 3U9PH 1CD0A 3UO1L 2PWEA 2ZUQC 2VDMH 4PIBA 2PTTB 1DO5A 1D5BB 4IU3B 4KY2A 4LLQB 4EIUA 1T6VN 5F6IB 3FO1A 4S2SB 5D7JC 1ES0A 4O02H 4GBXC 3QW9A 5LGHL 2BOBA 1RZ7L 4G8AC 2ZSVB 2XV0A 1NFIA 2EABA 1LO2L 3UP1A 2OMWB 4Z7QB 2MPAL 1V7ML 3A67L 2W9LA 2F53E 4PJ5E 4RQQA 3V55A 5DS2A 4A39A 1G1YA 1FGNL 1N0XH 2ZXBA 4M7LL 1KULA 4EDWL 5HGBA 2X1QA 1NEZG 2A6KB 4HKBB 3T3PF 1QZNA 5CKAA 5GGVY 2WTRB 2XQYK 4IRZL 1DO6A 1UD8A 1FVDA 2Y06H 3IFLH 3S3SA 4K3DH 1MH5B 1KENH 2VSMB 2GYSA 2EE9A 4Z7NB 5HPMA 5I76A 2BOCA 5KBPA 5B3SB 3AXLB 4M48H 2NZ9D 1WHOA 1YNLH 3IMRA 1XF5B 3MLZL 1RSFA 4Q6IC 1LMIA 5EULV 4NHUB 4IJ3C 4L18A 4OV6F 2A6IB 4ALAH 5JXAH 2YAMA 5E4EB 3LKPA 4DP5X 2D7MA 1HH6A 2CDFA 4CVZB 4IOIA 3QO0A 3VXNA 5ITBL 4NYLB 2DWEA 3QQDA 4BCXA 3ETSA 2H2PC 2GJRA 3V7MA 2J1YA 5L2KE 2I27N 2FGZA 5C0JB 1TENA 1MHHB 4MJ6A 2DTML 5TDOB 3BZDA 3AC0A 1TETH 4HIJB 4PJ5A 3P3TA 1TEYA 2WKOA 3EDFA 4FDWA 2QSVA 5J9PA 1IC7L 1IILE 2IPUG 3ZDZB 4HHWA 4BFJA 3F05A 2XWTB 1F3JA 3GO1H 1UQSA 3FN0L 3IJHA 1BZ9B 3MRKA 4BFKA 3B9KB 2AW2A 5HI3D 3CDFA 3UZEC 4Y4HB 3OB0K 1FZKA 1GGCL 5AWNH 4H1LA 1D9KB 4QRRB 3QUYA 4U6XB 5A2AA 5DK0B 1D5XA 3DOHA 2B1AL 4G8IB 3APNA 5CCHE 1B0IA 3RWHB 3SDCC 1S5IH 3Q2NA 4YSEA 5ETUB 4CC1A 2CO7A 3DETD 3GMQA 4WUKH 1IKOP 1VENA 7FABL 1ZV9A 4X7EC 2VOTA 4FE9A 1SY6A 3HI5L 3GMMB 1YMMB 1PCSA 4X7DC 5H37H 1JZEA 1YEEL 3G5ZA 5DJ0A 3JXAA 3FCBA 3MRNB 5L2KA 4POZC 1G7LB 4TULL 5MEQB 1J88A 1P1VA 3IDMB 3O3BB 3SOBH 2H6UA 2Y69B 1GYWA 5DDHA 4KMTH 2EADA 5D7KD 1BPLB 4KNTA 4OF3A 1IM9D 2APXA 3ET9F 3ABLB 5DUML 1BVLB 2OA9A 2YGPA 5KZCB 4S1QH 2LW3A 5F7LB 3RGBA 3ZKQD 3CLWA 5LXVA 5I6NA 3I3DA 2ADJA 5HJ3A 4ZS7L 3W2DH 1K3ZA 5LNDA 1PZDA 5JNYA 4BEIA 1VPOH 4HPYL 2Q9OA 2B16A 5K33A 5D6DC 1OXYA 3RWJB 4R84A 5I66B 2IALA 4XBPA 3FAXA 5SV3A 2E7CA 2KL6A 5CSBA 1DN0B 4XC3H 3IJ8A 5BVJB 4QRBA 1L0QA 2XCMC 1LEGB 1XX9C 2VM3A 2NX5E 3KL0A 4KTEL 4ODSH 1N19A 1XL4A 3MBED 4ZFGH 1XF4B 3W3BA 5IG7A 4KOCA 4OLYH 5GHWL 4J3TA 4M00A 2BVOA 3JYBA 1INEH 2F54B 3M86A 4BQ8A 6FABH 1FVCB 2OZ4A 4MZRA 4XP9L 5HHMB 1NICA 1HILA 2BFVL 3KM1A 3VAEA 4ABWA 4UZSA 5F88B 2VERA 3GI9L 4FQHA 2DPKA 3VMNA 4XC1H 4AH2B 4NO3A 5DQDL 2QVMA 5C08D 1S8DB 2O5YH 4K9EC 4MRBA 5MERA 3THML 3WKMH 3H0TA 5C0AD 3S35L 4PP2B 3Q8BA 3QQNA 2W8CA 4YNYB 4U6YB 1J9SA 3GK8H 5SX4I 1SXSA 4TSAH 3ZTDC 3J2PA 5I1HL 1YN7A 5K1NA 2WXHA 4BKLB 4ZBJA 3U7YH 1CGVA 3TBSB 3TV3H 3B83A 3F85A 1ZVSA 3QIBC 1A3ZA 1ZVNA 4G7YH 1KTJA 4XX1E 2BIIA 3MV9E 4AEEA 4ETYA 2YC1A 2NLJB 2QQNH 5I2IB 1EJ6A 3Q8EA 5AVSB 5LDUA 2NX5A 3HA0A 4HWBH 5F7DB 2FO1A 1Y07A 1KCLA 1AGFB 4KK9D 1AI1H 1RFDL 3ULUD 4JFTA 4KROD 2DWDB 2H3NA 2UZPA 2DEXX 4W9ZA 1SJEA 3L7EA 4XBEL 3CHXA 2R2BA 3FZUD 3OQ3B 4PMFA 5AB0A 2X4RB 3KXFD 3P0GB 3TONA 1I1YB 3ZTJG 1MCBA 2O6PA 3MCLH 4N2CA 4UV4L 3RPBA 5DMKA 4HVBA 2QDWA 5ADPH 5DRNA 2R27A 1FG2B 1JE6A 2R51A 4WHYH 3TH2T 4N0RA 3SKOB 3FF7A 4MJIB 5GSVB 5IFJB 1NCJA 1GKOA 4B9CA 1AS6A 1UWXK 2GHZA 3CVHL 3NESA 3VD7A 2GY5A 2BZ7A 3BGMB 3D85D 1IJNA 2EKSB 2VM9A 5IEKB 2YKLL 3HN5A 2VLJB 1DQLH 3CD4A 3IJSB 4XVUC 2VQUA 3HFFA 4XNUH 4Y5VB 3IAGC 2X41A 2A83A 3G5YA 1ZT4B 3MV9A 2R69H 5GSRA 4YR6A 2XFGB 4KI5E 3QIWD 3DX3A 3NEOA 4PJ6A 4EKJA 4DTGL 1X4XA 4GUPB 4RLDA 4PW4A 1UXLA 5D1QE 1QBMH 3QEQE 3HR6A 3FQ4A 2V3DA 3O6FB 2QGCA 4KRMB 3P0YL 1YY9D 4D2NA 5EORL 4YL9A 2ICEB 3M8OH 5CJ8A 3U6RA 3FQTA 1OP3K 4H0IA 1KN4L 4GW5B 2A73A 1F2QA 3VH8B 1FV1A 2PWFA 3OWRA 3WNNA 5JLZB 2B2XL 3HMXH 5IVZB 1UC6A 1I7ZB 2JXMB 3BIKA 4HPHA 3JUZA 2JJTA 4TNWK 1XCQB 1U6AL 5E00A 3CVHB 1UGKA 4P2OC 2DQGL 3WXVH 2CUIA 2V5SA 2X2IA 3ECVA 4OQTL 4WV1C 2E0PA 4HCGA 2WQAA 3Q2CA 3TXAA 4X7TB 1UATA 1OCCB 1RUPL 1C5BL 4MA3B 4Y8AA 5AVQB 1BBJB 2XBTA 3R4RA 1FHGA 1I3RB 2OQJB 4G8GE 2G4EA 4U0QB 2VDLB 4R4FH 1CZ8H 1LDPL 4UQ3B 3AY2A 4GRLC 1KLUB 1UYWH 4FFVD 1Q9OB 3SO3B 2C3GA 3QUHA 3FCTB 1P4BL 1MRDL 5D1QA 3QEQA 2VLME 2Z31B 4P2QE 5DURB 3L3HA 4OJFH 3JWNG 2R1YA 2FAUA 3V5DB 3BPLB 3IJ7A 3MV11 3TVMA 1RIVH 3KCWA 4DW2H 2GK0A 2NY4D 3AG3B 3P02A 1NGQH 5J7CC 1MCLA 3D3VB 3F7VA 4LRIC 4RMRA 4ZMOA 3GSXB 2K8QA 4XCCL 1MWAA 1T7YA 2K7PA 3DECA 3NCFB 5E6ZA 4HSAC 2HKHL 5AW5B 4ZNCD 1CBVL 2NSMA 4OSUH 4ZUUA 3VXUB 3RPIA 3CPLA 3L2LA 4YXKH 4BYHA 4WI6A 5F1SA 2VLKB 3EBHA 4KITB 4W9IC 4PRAB 1NANH 2BX5A 2CJSA 1KIPA 2FJUB 3PWNA 3QNYA 3X11B 2P24A 1VFBA 3BKCH 4BSVB 3MBWA 2AQTA 1JXKA 3OVUB 2WNKA 3L3JB 1XO8A 1J86A 4OUOA 1QYGH 3W5NA 4DO5A 3MFGB 5DS8A 4NZRH 15C8L 4G8GA 4C83A 5IFHH 1NIDA 3OHXC 3KPSD 2VH5L 2DI9A 4ZODA 1RZJH 1N12A 5BRQA 4LCWE 4L1SA 1XGUA 1HNGA 2WXQA 3DHJA 4ZMTA 3GRWH 4N25A 5CZXD 5AKTA 1WK0A 3KVPA 4P2QA 3U1SL 1X5LA 3TN0A 2E9GA 4G42B 2VISB 4WGVB 2D8KA 2OK0L 4H20H 2D0FA 1WIUA 5FYJE 3N41F 2K3TA 3VXPA 3TLRA 1AD0B 1BFOA 4ODHH 5L88H 4M43H 3U4BL 2Q3ZA 4BFEA 2Q87A 4PVNA 5I1EH 5E2JA 4ZX6A 5AB1A 2E7MA 4WWPA 1V27A 3GTVA 3WFZA 1RZJC 4PJIF 5AENA 4X99A 5AW9B 4MZ2A 4KQ4H 5MEPB 2RCSL 4U1JB 4P2RD 2I32A 2NY7H 2UY6B 1SFDA 5ACLA 3DYPA 5IY5B 3N43B 1HHIB 2O6DA 2F0CA 2IDSA 3EH2A 1H8SA 3QHZL 4U3CA 1T1ZA 1EXUA 1ZT7A 5FX3A 1D6VL 3LVEA 1DCEA 4AK2A 1CI3M 3QJQB 1K3IA 1OAQL 5CGMA 3FPYA 1SBSL 3NIDE 1RUML 4U1IB 2JKXA 1S46A 1ZHNA 1I85C 2E47A 2AQ3A 2WBWB 4AJWA 2C3WA 4S1RH 1G7HB 1Q0YH 2C8NA 8PAZA 3D1MC 3PP4L 2HRPH 3OSVA 2ATKB 3L7FB 1UTDA 4LCWA 1KB9K 1EMTH 3LRLA 3DXAE 3HNVL 3PNWB 5F7NC 3TCTA 5AG8A 3W38A 4JREC 1G7MB 2VM4A 4BH8B 4OZ4B 5FB8A 4FFYA 3TP4A 5D4IA 2DQDL 1E4JA 4DIXA 5IIEB 4M7JH 4A55A 2WTOA 5DD3L 2HFTA 4MNQD 2F19L 2F5BL 3DJRA 1XEDA 5DJZA 3W11C 3CVCA 3AG1B 4RBPK 1T2JA 5T3ZE 1I7UB 3M46A 4UAOC 3ZO9A 2IQAB 3H9YA 3LEYH 2V5YA 3BKMH 1CFQB 1IAIM 1FFRA 3ARTA 3JTTA 4ZMVA 1TSRA 3MO1A 1Q9LB 4WUUB 3VFGH 1FNHA 2AJZB 3EGDB 1MIEL 2DIAA 5KYYA 4I2XB 1U8OB 1NC4A 3M45A 4JHAH 4I3GA 5DI8B 1NH6A 1TTRA 2CO6B 3JT2A 4GKOA 5JA9A 2R56H 3HEIB 1I1CA 2A9AA 4QLRA 2EH8L 3MACL 3TURA 1DJZA 1M6UA 3QFJE 2F8XC 2HRLA 2WVSA 3ULVE 4L1DA 3S35X 1HL9A 4HV8A 2VITA 3FH8A 4F93B 3L45A 2E9WA 3FT4B 4O2EA 2JCCE 3BLKA 5FC9A 1QLEL 3QO1A 1BG9A 3D4YA 4PTUB 5KSAA 3DRQB 3DXAA 3HS0C 3JTSA 5AW8B 4LLVA 2W65A 4M5YL 2V2WB 5LNGA 3RVWD 2BXYA 2DYPA 5IK3B 3VFPA 3BSGA 1BVKB 3QUML 1G7PA 1P7QB 1NBQA 1QSEE 1OHZA 2WCPA 3FFCD 4XNXH 1XHHA 1J8HB 4ECNA 2DJ4A 4BRVA 4J12A 4O51A 3NJLA 1HL8A 4B9JA 1QFWM 3TPKA 4FABH 4X8JA 5IB1A 1UD5A 2G3ZA 1WE5A 4JFED 4XVJH 1E50A 1E5CA 5CU5A 3HCVA 1U8NB 3TO4D 3WUWG 2YZ8A 2AXGB 1IAII 1XCTA 1OALA 1RIUL 2ZUYA 4JQIA 2OMYB 5FXCH 4A67A 1D3CA 1MAML 3CHRA 4PJEE 4LXFA 1MFCH 3QIUB 1FZOB 4TYUA 4N8CH 3B2VH 3NBNA 2B1HL 2OYPA 3WJJA 1QLEB 3TWCL 5HHVL 1F4XL 1RQ5A 3GDBA 5IMKA 1M7UA 4KDTA 3T2PA 5E0QA 2OCFD 2FIRT 3SDDA 4F58H 4LHUD 4ERSH 3L3KB 1V5JA 4BXVA 5IB2B 2HWZH 3QUMB 5IB3B 3T0ED 3MCKB 2NRDA 5HHQA 4GKSA 4LNRA 1X5KA 4MJID 1QHQA 1QSEA 1QA9A 4DZ8B 4FHKA 3BE1H 4BZ1A 1UZGA 2ODHA 4UDTB 1NBCA 4Q6KA 4H44C 3U1QA 3UJIL 1K8IA 2BK8A 3C12A 2X7LB 5HYIA 1JNLH 2BSSA 2IPKB 4IW4C 1W6LA 3VU1A 4FKKA 4X98B 2OTWB 4FQJH 3ZL4L 3TBWB 4HUWA 3FUFA 1QFWI 4R4BA 4R7DB 5CINH 3C08L 4BA8A 1IGIH 1UH4A 1O75A 1L9SA 2A4EA 4KQ3L 1NOAA 3NG5A 4JRFA 2B8OT 3SDXF 3Q01A 3VG0L 2PKDA 1MCPL 1T3FB 2YD7A 1YVLA 3IBOA 5DLML 1ZHKB 2F1EA 3DYOA 1RLBA 5HHOE 3HS8A 2VAAB 1CLOL 3QEHA 4P04A 4W9EC 3VQLA 4Z95H 3SDYH 1JZ5A 1L7TL 4B7IA 2G5BB 1HKLH 4FG6D 5KVDH 1QATA 4ZXBD 1M7DA 3L5IA 1A7BA 3U7AA 3V6BR 5IESH 1GZHA 3FU0A 4FXLA 2ENSA 4IS6B 4PJ7B 4EMZA 4BE5A 1IO4C 2FT7A 4LHQB 3OLIA 4I7ZC 3CIAA 3ROLA 3VI4B 2VYRE 2K1MA 2GJJA 3L5WA 2ZOKA 1AKJB 5H2BA 1UM4H 2DMKA 2WGXA 5F96L 1ZTXL 4J4PA 3WE6B 4YQXH 3GMPB 3C09B 4XMLL 3CC5B 1K85A 5DJCA 5HI4C 4ETQB 1I75A 3NCJL 4UV7L 1MFUA 3PHQA 2Q8AH 2AV7B 1T5WB 4Y19E 3O3DB 5LCVA 4PJGF 2J56A 2B59B 1T83A 1O5PA 1C12A 2YN3A 5TH2B 4G1EA 4RGNB 4Z3JA 2IAND 4LHJB 5D5MF 4HS3A 3QWRA 3AADB 1DUYB 3T6WA 3T4AA 1RZGB 2GTZA 1THAA 3QG6A 4D0BA 5MEOA 5F9DC 1U8PB 2AI0L 4EN3B 2APVA 2FTAA 5HHOA 3OL2A 5LB1A 2YOCA 1T4WA 1WT5A 2GAZA 1F11B 4PJ9D 5E5RB 5C07E 5TTRA 1E7UA 2BY2A 2CBPA 1CE1H 3B7TA 4OGXL 1P1ZB 1FAIL 5JW3L 2J2ZB 3BZ4B 3KWUA 3RAJH 3T0AA 1BQKA 1X5YA 4MAYB 5DVOA 2W59A 2OMZB 4HIQA 1HINL 1R5VA 5B1CA 4QYOA 5F93C 1YDPB 1B6UA 3QDGB 4D0CA 1DZBA 4IHOA 1RZKH 3MLWL 4N0CC 4LNVA 1OD9A 4YBQD 1F02I 3TYGL 3W0WE 3WFHA 4DJMA 4UM9A 2YWYA 2KYIA 4AGPA 4O9HH 5FWQA 2NXYD 2CU9A 2V7NB 4TVPH 1DQDL 3OF6A 4Y19A 2DL9A 4EI5D 4XZ4A 1CU4L 2IPTH 2W0PA 4NKDA 2YEZA 5FA3B 5C0BE 2RAMA 1IGMH 1N3NB 2P80A 2YS4A 4X9YA 5EU7E 3EXLA 3GSQA 5FM5M 3UDWA 2V5TA 4N3TA 4HBQA 3S5YA 4NNYA 2FBJL 2CRZA 4JANA 3LDBC 4R9HA 3VGFA 1QO3A 2YXVA 2JJSA 3C8KB 4N2MA 2IADB 3PGDA 1C8PA 3N1GC 2J43A 1E8WA 1OCWL 1QLFB 4LVOB 2NSXA 1Z3GH 3BSZA 3PJSA 5DSCA 5JDSB 3QNZB 3VGAB 4D9RE 1I9IH 1TPXC 3UBFA 4KDWA 1NBYB 1E28A 3AREC 3I50H 4HSCX 1EDHA 4NQCB 4NQSB 5CWSB 5I9QB 3RWGA 8CGTA 2Y5TB 1WBYA 3IDXH 4UZUA 1XIWA 4ZSOE 1OTSC 1CYGA 3FU9A 1AIFB 4FQ2H 3N85H 5EO1B 1J9RA 3FRPA 1OSZA 4KJPC 2F1AA 5B39B 1A7PL 1UM5L 2A99A 3EOAB 3MUGA 4ADIA 3HE6A 1Z5YD 4JQVA 4YSRA 2UY7B 3FB8A 3UYPB 5EOCJ 2E74C 5C0BA 1G9NL 1QASA 4E9WA 3SDAD 2FIKA 5T3XD 3BAEH 3EH4B 2SEBA 1UA6H 1T21B 4JG1L 4N68A 2AAAA 4XTRD 3TA3B 4P48A 4G71B 3DX4A 4L37B 4K07A 1CTOA 2AVFA 1JWSA 2EQDA 1T7ZA 2G75B 4WI8A 3TPUB 1U8QA 5CEZE 2WWKO 4FLQA 2ID5A 1KCUH 4WFHD 4KY1H 3BAIA 3QRBA 3VXQA 4OZFB 1YEJH 4N2HA 4UT6L 3K72A 5A2FA 4OFDA 1K4CA 1CF8H 3LV3A 3D07A 2BHFA 1F4WL 2DICA 3ZY7A 3P9WB 5DD6B 1JGUH 5F7BA 5JPNA 4P4KB 4FNPA 5J3HD 2E9JA 5IOPA 4O5LH 1LEKB 4FQCH 4PJDE 3RNQA 4AUYA 4Y5YA 3U0WH 1V8HA 35C8L 5D9SB 4WNJA 4A6YH 1IQDA 1UFUA 4NUGL 2CWRA 4LP5A 4ZSOA 2CMRH 3MA7B 4NWTH 2VR7A 3IJEA 4L8SB 4TQEL 3QXUA 1MCEA 2HT2C 2J71A 1S7QA 4YHZL 8FABB 2QFPA 2WP3O 4KUCF 5K9KA 4M4PA 3ILQD 5IBTH 5EIIA 4G82A 1E5YA 2Q2EB 2D73A 3H56A 2PN5A 5EZOH 4X9BA 3REVB 3GXDA 3S3BB 2QELA 1JZIA 4D8OA 1ZAGA 2BP0A 1QSFB 2CIKA 2AEOA 4ICXA 5I16A 1KXQE 5DC2A 2RD0A 3F7KA 1JK8B 3CFIC 1LO5A 1KJ3L 1CYXA 3N0PB 3BVXA 4YZWA 3RUGE 3VGBA 4MBRA 4J8QA 2MOQA 3SJVE 4HOZA 1P5VB 4LCUB 3RLSA 1KYDA 4R26L 4XNBA 3MX0B 1LO3L 4KK5D 5BZXA 4J28A 5BO0D 4QTIL 4TPRH 4XBGB 5LBSL 3CCHA 4GAYB 4PJDA 3LVTA 2Q86B 4MMZB 2OBGA 5T1DL 1NCWL 3MODL 5LG6A 3WIFB 1BZ7A 1SXAA 4ZX5A 1TYJA 3L9BA 4HOXA 3WJLA 4M1DH 4XNYH 2YBGA 1UJ3C 3CFJA 4MA1B 4ZTOH 4ODXA 4GIOA 2OP4H 3MRMB 5FGCB 3QDMD 5KG9A 4PCYA 4IKJA 2OMVB 2OLDA 3N1PC 1XB8A 1S7RB 3EO0B 1NQBA 4MJ5B 1KJ2A 5HDBB 1QFPA 2E75C 5ACZB 2VDNL 2Z92B 3Q3GB 4QJ5B 5CJQL 1JL8A 1FNLA 2WBXA 4XMPL 2WQWA 4G80A 4QHUB 4EF3A 1QTSA 3DJZA 2XVLA 5DJ6A 3QJFB 1IAOA 3QJXA 5D8JH 3ARGC 3QXAA 4L3EB 1T7VA 3I6KA 5CGYD 5C2BL 3RUGA 1G7IA 3SCMD 4H2CA 3QEUA 5IQMA 4TXVB 5D7IA 2DM4A 4W6XB 2CDGA 2ISDA 3LPWA 3E6HA 4MHHI 2EUXA 5ESQA 4I1RA 3EJTA 4M6NH 3NFSH 3RZCB 2EXSA 1SMDA 5AYUL 4GEIA 4F20A 1H6FA 5EIVA 3D69A 3DURA 2ZYIA 1MVYA 1CGUA 2YD4A 3HC4H 4ADGA 2KUTA 3MBEA 1Z1WA 3C60A 1UZ8B 2OL3L 2YGQA 3NRFA 4Z3GA 1LK2A 4AMKH 1ZT1B 3SD5A 5I75B 1RJZA 1I8AA 2OAAA 3POHA 3VQMA 1BFTA 3QA3A 1ETA1 2VDNB 3JV4A 5JHBA 3S5LG 4Z77A 1M9WA 3QK0A 5CLTA 2YSTA 1Z5LA 2YA0A 1R5WA 3H9SD 2NTFA 3O9WB 4XAKE 1CLVA 1JF1B 3OKEB 1S5HB 3NCWA 2AJ3B 1IEHA 4AYMC 3KR3L 5DZ9A 2XKUA 4JAMB 3VXRD 2MNWA 1G9MH 3J27A 3DIVA 3JT0A 3GBLA 1EEZA 4JPVH 2C9XA 3N44B 1AKJD 4OFYD 5C09B 1KFGA 1FPTL 2ODIA 5BO1L 1BQUA 5H35B 4LSRH 2HFGH 3BD5A 2X4NA 3EYVB 4UINH 5I5MA 4B9KC 1CICC 4XNDA 4L2YA 3FTXA 3GLDA 3JWNC 4PY8J 1UH3A 4DOHE 4WY7L 5IF0A 3N9GL 1U8MB 3ZE1B 4PRPB 5A3ID 3C75A 4JZNB 5FKPB 5CN3A 4N2LA 4PJXF 2QADC 3PWVA 4LSSL 2B0SH 2OL3B 5B8CA 3FT3A 1MCOL 2BNQD 4PV8B 2VDQH 4L4VE 2WD0A 4IRJB 1G9MC 1QFWH 3PREA 3BH8A 5B3JE 1Q1JH 4E5XB 1LDSA 4PWHA 3JBG7 2Y07L 3UTZB 2QPDB 4AYSA 1A4KA 5K9OB 5J57B 4AQ1B 2LAAA 2BWDA 3CSTA 1KB5A 3FPXA 1O6SB 1WIPA 5BV7C 4E9SA 3F7PC 4FXTA 4IMLA 4OCXL 3TNMB 2R2CA 4J3VA 1IM3D 3ZDYB 1URZA 5D71H 4GMSH 2L7EA 3B3BA 1BVOA 2WZ0A 5E6YA 4R5XA 3HNSH 4HULB 2WPGA 1QKZL 1CFNB 3Q05A 2H6PA 5JHLL 3E2HC 3I74A 5J6SA 5TPWH 3LX9A 4PVBA 4YZFE 4NRXA 1EJOH 2VQ1A 4HUVA 3NH7H 4NFDA 3S36H 4TRPL 5FYKU 4TUKL 4HJJL 4Y89A 3VE0A 3X1GA 1PQZA 3IU3B 1BLNB 3FUDA 3V9EA 3OXSA 4NO0A 5F9WC 3PV6A 5FHBL 1UT1A 3V9CA 1YEFL 1IGCH 1SNRA 4UQCA 4L4VA 3QHFL 4RAHA 4KRLB 1GPOL 3V6OA 1EUTA 3HFML 4HWZA 3OPZH 3CLEL 4JB9L 2JB6A 4YHKH 5C6PB 5F9JB 4F91B 4Z7QE 5DJ8A 4WTZG 1NCAL 4XBMA 4XOCA 3ZRCC 1NM9A 4APQC 1A9BA 2H0PA 4JLRA 1HS6A 3KCPB 4KKCC 1A1NB 1UWGH 1ZXKA 2EDJA 5I6XC 4G6FB 1OM3H 1SYVA 4Y4KD 2FD6L 2Y7OA 1KIQA 2D7NA 1HJCA 4Z7NE 2P43B 4F8NA 2KT6A 2ITCA 2ETWA 3BGFB 5CCKL 1M57B 1R3IL 3AB0B 4E2OA 4N90E 2ZUWA 2FLMA 3LY6A 4YLQT 3DTDA 4ZOEA 1PAZA 1XV8A 4Y16A 3BJLA 1HXMB 4RDQF 1GMEA 3QUZD 1VGKB 1VB9A 3EUDA 4DK3A 4ZAKB 3KW7A 1NPJA 5TDPB 2CBTA 1BM3L 1HIML 2AJSH 4IU3A 1D5BA 2DZEA 3B7SA 2UZIL 4LLQA 4HH9A 3ZLQC 5KAQG 1SVCP 1BD2D 4LT7A 2GBTA 2GKIA 4S2SA 5DZAA 1B9KA 2ZSVA 3FT9A 2OMWA 4HS8L 4TL4A 5HI5C 1EAPB 4Q74A 3KH3A 2V8LA 1H9VA 1VFAA 1G94A 2NY0B 2W0FA 2QZ5A 3MNMA 4L2LA 1DTUA 1EFQA 1VEPA 4FKHA 3ZDZE 4R90H 4NB7A 2A6KA 4HKBA 1WDAA 4OFIA 2WTRA 2Q1EA 3MRLB 3DROB 1LEIB 3C6LD 2ZXAA 3U9UB 2DDQL 1T0NB 1MH5A 2X38A 2AMUA 1MLBA 2YEVB 2FQEA 1JS4A 3AXLA 4OGYL 1KTCA 4QRRE 3JV6B 4FLHA 4XGZB 1TQUA 1H9DA 2BSRA 4NN6C 2ZXEB 4PP1C 3MOBH 1XF5A 2YOAA 3O4OB 4KVNH 1JDAA 4K3HA 4NHUA 3GINA 2A6IA 1IAIL 1NCHA 5FEBA 3EJPA 5EN3A 1KBGL 1B4JL 1YMME 4NYLA 2B3RA 3UYOD 1CT8B 1QX1A 2ZYSA 4NM4L 1HI6B 5HDWA 3NZ8B 3QJSB 5AUMB 4RESB 1MHHA 5ICYB 3D9AH 1GGYA 5TDOA 1UD6A 2GIYA 3B5GA 2X4TA 2NSQA 2J3SA 2PXYB 2GK2A 2X44D 3O8XC 4HIJA 5CJOH 4KK8C 4JFYB 4Z7UA 3RJDA 4AEHL 3CTTA 1PY9A 2MCPH 2HJLA 2XIBA 4X7SH 2XWTA 4JGJA 2TRYA 1KIUB 4KHTL 2ICWA 4F3FB 2J5WA 1BZ9A 3B9KA 5IFAL 3LH2L 2UXGA 4Y4HA 4M6OL 4PW9A 1LK3H 1JF5A 1VCBC 1OCOB 1SBBA 4KZEL 4DGIH 2EXWC 3C2SA 4OLVL 1HCYA 4YHOH 4FQXB 4LPUA 3U6XA 1A9VA 4H0HB 1D9KA 1BP3B 1W91A 4U6XA 4JFOB 4BZYA 4LOUD 4QRRA 2AS5M 4JY5L 2F18A 2XACC 5DK0A 4FS0A 1L3NA 4D3CL 4Z0XB 2K6ZA 1CVSC 5DK2B 2ATAA 4TSCL 3VX0A 1WP6A 5JR1L 5LG1A 4XNZC 4HX1B 2F54E 1NC2B 3SGDH 1TZGL 5HHME 2MKLC 3GMMA 1K6QH 1EERB 1YMMA 1TYRA 1OP5K 4BFRA 2YEQA 5BQ7B 4BHUI 1IBZA 3ZUCA 4XVSH 5C6WH 3MRNA 5EG6C 1G7LA 5MEQA 3TJEL 1JRHI 2FJFA 5DZOA 3IDMA 3O3BA 3RGVD 3IE9A 4LCIL 5BZDB 2R8SL 4NJ9L 5AVYB 3UIZA 1NDMB 1IMHC 4OIBA 3NIGB 4M8RA 4J3XA 1T4KB 2D4FA 1AE6H 2P8LB 5AAWC 1BVLA 4P23D 4FULA 1UXWB 4KOBA 2X9WA 4R5VA 1YAZA 2GG1A 3HC3L 4PRHD 5MP6H 3U30B 4N0FB 1S9WB 5HDRA 5ECJE 2NW3B 1I82A 4TUOB 2CPCA 4PJ8D 2WM0A 4HLJA 2HTKD 3MLSL 4JG0H 3MA9L 4GP5B 1ZLUH 3BP4B 4NHCL 1HXYB 2GUYA 3RKDC 3RWJA 1EO5A 4HFUL 3X14B 3ZKND 5I66A 3P3SA 4P9ML 1DN0A 4OF6A 5CSZB 5L4MA 3JTBA 1T5XB 1LEGA 1YPZB 4PGZA 3DGDA 1OGAB 4JPWH 1XF4A 3TC9A 2BDNH 3ULAB 4YDIL 4PYGA 2IF7A 4RVBA 4JZJC 5F9OL 3RVVD 3WDHA 2F54A 3OWEA 3QJHB 5C0EB 4OIAA 3DX9B 4WHCA 1FVCA 2NW2B 4X6FB 4ANWA 1EANA 3UAJC 4GS7C 2M8XA 2BRRL 5JW4M 3TEWA 4NWUH 5I1IH 3CG8A 5F88A 3UTPE 1MLCA 2XSKA 4GAGL 2GJ6B 2MH4A 3HUJA 5DD5H 3SZKC 1S8DA 2ARWA 4I85A 1QSZA 2EYRB 2EO1A 4N24A 3NSXA 1VGEL 5DTFB 4ZUVB 1GC1C 4ODVH 4PP2A 4UM8A 4IBVA 5MI0B 3U0TB 4OM1L 2A0LD 2ZKHH 4U6YA 4XP6H 4YNYA 3OQRA 4X2UA 4N28A 4X5QA 4K3EL 4MS8C 4UQAA 4BKLA 2VLJE 3DWTA 1SDAB 3TBSA 2PPCA 3B3IB 1Z0MA 2R2HB 3WY4A 3CZKA 4PRPD 2JJUA 3CDGB 4DQOH 3NIDF 3A0OA 2NLJA 4YK4B 5I2IA 3MN8A 4KVPA 2G5UA 3DKHA 4XOAA 4WO4B 4IRJD 5J06A 5F7DA 1AGFA 3PHAA 4B41A 5GJSH 2VR5A 4XCFH 1TF4A 4LVHB 1FBIH 3DMMD 1WA0X 1WVZA 2NT1A 2R0WL 4NZJA 1GGBH 3RDTD 3QBTB 3FU8A 4AX3A 3KYAA 4IKIA 4XMXA 4A2EA 1CDUA 2DMGA 1UASA 3HC2A 2OJZL 2X4RA 4XOBA 5EDSA 1I1YA 2Q0ZX 1V05A 4JO3L 4DGVH 4BH7B 3J07A 5MEND 2UXTA 4NGHL 1FG2A 3I6GB 1I4FA 2H3XC 2CO3A 4MJIA 1CXIA 3HG0A 5IFJA 1QTPA 1G6RL 1X7SA 2O5ZH 2IDUA 2ZJSL 1MCNA 5BPPA 2P4AB 3BGMA 1A0QL 3BAXA 4FX5A 4I0CC 5IEKA 4KRPD 5JUEH 4LLWB 3MRCB 2VLJA 5I8CA 4MFHA 3TH4T 1H3XA 2D7PA 5IVNA 3WHXB 2X4OB 2DKMA 1A2YB 4Y5VA 4JFXB 2G2PA 1XT5A 5CJXC 2KC0A 1X5AA 1DEEB 1ZT4A 2DWYA 3AUWB 1E90A 3QQ3B 3JWDL 4GUPA 3ALWA 2C7UB 3BWUC 4U3SA 2FECL 1YEKH 1RJLB 3I02B 3O6FA 3RWFA 4AV5A 4GB9A 4WSKA 2B77A 2IG2L 4H8VA 3O6KH 4Q9QH 2ICEA 3O0RL 1U93B 3NCYS 1I1FB 2F9BT 4GW5A 1IEAB 3D3VE 3CV5A 4LHUG 1AANA 4UIMB 3VH8A 3LKQB 4PG2A 4G8FB 4NBZB 4EZKA 1ZXQA 1I7ZA 3VXUE 2JXMA 3KBEA 4HG4K 4YHNB 4G83A 4Y9EA 3IMUA 5AD0B 5DO2D 3W5MA 2VLKE 1G6RB 2XQYG 1UUNA 3CVHA 4M1GL 3CX5J 1NLDH 4KKLC 3U48A 1R5IB 3OGCB 3BAWA 3NIFF 2IAMD 1LD9A 4LQFL 2AJUH 3RY6C 2ENYA 4X7TA 4ZD3H 1DQJB 2CRYA 2F1BA 1HSBB 1IFHH 4MA3A 4FL4B 4AE0A 1BBJA 2G2NA 2EIEA 2QHRH 1ULVA 1I3RA 3OZ9H 4FC3E 1JNNL 3ABMB 1MAJA 1A8ZA 1EVUA 5IQNA 1N8ZA 2PR4H 2DQTH 4E36A 2VL5B 1PG7H 4RZCB 1KLUA 4JHUA 4KO5A 2W5PA 1PDKB 1Q9OA 3FCTA 3EJQA 4EI6B 3GHEH 1O9VA 3V79C 3BAKA 2Z31A 3NABH 1ZMYA 5DT1H 4W9JC 1XH1A 3V5DA 1LWJA 2Y1ZA 5B22A 4OCSL 2MTPA 5C86A 1A6UL 3ARRA 3KVDD 3D3VA 5D1ZB 3GSXA 2BSCA 2X2YA 3WGVB 3VQ2C 4JRXD 1RIHL 3HZVB 1OCZB 4I9WD 1ZPLA 4OQTA 2VLKA 4ZFQA 2IDTA 4NP4H 2WGNB 3S4SA 5ABDE 4PRAA 1IBDA 4NP9A 2PCFB 1BJ8A 2AGJL 3GEFA 3X11A 1HWGB 2G0KA 2PTUA 2DN7A 4HIPA 4Z7VB 3LEVL 4YDVB 3L3JA 1QHPA 1WZ1L 2X05A 3GLZA 2AKRB 5T1MA 3GJFK 1FORL 2EDDA 4UIKH 1FLRL 2CM6A 2VJ8A 4NXSA 3BYYA 2OJ1A 2P3YA 1KTDB 3ZE2B 3FUEA 2NXZD 2RACA 3BVDB 5CZRA 4RAUB 1I9JL 4L0YA 4I0PB 1MHCB 4EI5A 1AR1D 3K2IA 5DHMC 1TNMA 5IT2L 4IQHA 5T1JA 5IROD 2K4AA 3S88H 1HE8A 5D2NB 4PB0L 5L6YH 2Y0SA 2YBRB 4KKQA 4JN1H 4LIQL 3A6BL 3BWUF 4G42A 2VISA 1FNSH 4PCKA 5L9DL 1CB4A 1AD0A 3U83A 2JK5B 4ORGB 2EDQA 3CSBA 4NLAA 1U3HD 2XXCB 4WUUE 5F44A 4WEMB 4LEXL 1MVFA 3CIQA 4I2XE 4N8VB 3WAKA 5MEPA 2ED8A 4NUMA 2UY6A 2NCMA 4FP8H 1EO8L 4U3XA 4Z7OB 1HHIA 4JCLA 2F8OA 4PB9L 3CH8A 4I77H 4PRID 4Y8DC 2Q8BH 3CDCA 3O4LB 1WICA 1ZCRA 4DVRL 2X5PA 3RIFK 3SPIA 4E41D 5H4ZA 3KS0H 5C9JB 1H3TA 4U1IA 1N5AB 4N1HB 5T1LB 3X1BA 4YDJA 1TCRB 4MNGB 1G7HA 3CGTA 4YDKL 4AGMA 4OGAD 4MQXD 3VWKB 1FZMA 2ATKA 2WBJC 2VXQH 3L7FA 3CVIL 4E68A 3PNWA 1D7FA 1FIGL 5F0JB 1J18A 1ORSB 4K8RD 5DF0A 1J9CT 1IT9H 5FYJU 4BH8A 4HUUB 4OZ4A 1TKWB 4OVVA 5IIEA 2ZUQB 5HI3C 5IJKC 5EU6B 4KH9A 4XH2A 3ARZA 4MB4A 2EINB 4Y5XC 4PLJD 5D7JB 1J8HE 1I7UA 4GBXB 3QUXD 3FO0H 4DAGH 2IQAA 4N6RB 4NQDD 1EHLL 1CFQA 3HN8A 4JPQA 1XSIA 1WA2X 2XPGB 3V5KA 4WUUA 1Q9LA 1OB1B 1CJYA 3VSVA 5I1AB 2AJZA 2WWKT 3EGDA 3QEGL 5F7UA 1MRCH 4I2XA 1U8OA 4TUJB 2W0LA 1LMKA 3DETC 5DI8A 2CO6A 1WEJH 1ITCA 4LO9A 4GIPD 4UOW1 3BUTA 5KEZA 2R23A 5G4MA 2LLGA 3ZBMA 1YEHH 5EZIL 1YEIL 3LIUA 4Q58C 1GW6A 3WJMB 5DYFA 1BM7A 3EGSB 1TYEB 4O02B 2BY3A 3GTNA 4AXWB 5EBWB 5A2JH 1E4KA 3FT4A 3U46B 4AYEC 1H5BC 1MCSA 3MGTB 1FSKC 4G6ML 1IE4A 1SZNA 3WFEH 3DRQA 2EIKB 4Q6IB 2PTVA 2RJMA 1KYAA 4I1PA 3D51A 2WP3T 2V2WA 1O5DT 4WW1A 3BZFB 32C2B 4Q6YA 3VD4A 1WIOA 4HZLA 2E7LC 2P46B 2CBMA 2J8UB 1BVKA 4MAZA 1P7QA 3HMWH 1ESOA 2FR4B 3P4OB 1YUHB 2X3CA 5GGQH 1J48A 1J8HA 1JRHH 3X12B 1CL7I 5AL8A 1IV8A 2FJSA 2OX5B 4XPAL 3RA7H 3RHWF 4O00A 1SXZA 3HLKA 4UT9H 4YGAB 3I6LE 1SRDA 1IC4L 4BA0A 3O2VL 4CJ1A 3NJVA 4G6AD 3QZWB 3BRDA 3PIQB 1U8NA 3GXFA 4JZOB 4YPJA 4OFKA 5T5FL 3GBNH 4XX1G 1FH2A 3UTOA 2PCPB 4DUWA 2WAQA 3E1F1 2EUWA 3OJDB 1XCXA 5DZJA 1FZOA 3CSGA 2QSCH 5B4MD 5JQ6L 3KGTA 3U4KA 5GGSY 5C0RL 5DEGB 3MHZA 4L4TB 4WFFE 1IEBA 3U2SB 3BKJL 4JM2D 4OD3L 3FOMB 3L3KA 3ZTEA 1AXIB 1QBLL 4X4YB 5IB2A 4LOFA 1SHXA 3QUMA 5IB3A 3PYCA 2FBRA 4TS6A 3MCKA 1NOFA 4E9QA 5IW1B 2JLLA 2AJXH 4PJ7E 2LU7A 4WSGA 5J8OA 1RVFH 3HVDA 3HVNA 3T8VA 1AQMA 4DZ8A 1C5CL 3QJTB 3VI4E 4UDTA 5EBLA 3U4AA 5AZ2L 1CDBA 1D5RA 4OF8A 2YMXL 3PABB 1S4IA 2X7LA 2XJKA 4NM8H 2VRKA 3TCXA 4AQ8C 2IPKA 3GSWB 1DSYA 2G3MA 4PJDF 2QKIC 1UXMA 4KK9C 2GIMA 3FT2B 4WVRA 3DV6B 4K9EL 3TBWA 5JIIA 4U1KB 3S96B 3D34A 4R7DA 4GMTH 4FTVB 4BZ2H 3K0YA 2VZ3A 2NQCA 3GJFB 3O2DL 1QWHA 4N0UB 1A7RH 4QKTA 4WKZA 4PRBB 4ZFGL 3RTQD 2ZP9A 4P5TC 3A3YB 4N2BA 2GJPA 3C8HA 1SYSA 4Y4FB 3ARBD 4RGNE 4URKA 4KKAC 1T3FA 5AOKA 4OCMC 1A7QL 2WQUA 4NX0A 4WWKC 5I8OL 1ZHKA 3RU8H 4XVTL 3W82A 1TTGA 1M3IA 2YGVA 3QR2A 4I48A 4NQED 5C70A 3KYNB 3D2TA 3Q5OA 4F7CB 2IGLA 2DQHL 2I69A 2G5BA 3GXTA 1YZZA 3RUGF 3KVQA 4B9GA 1YHPA 4Y2NA 5E1HB 4P2YA 4RMVA 5D7IF 4PJ7A 2O72A 3EBIA 4IS6A 4LAJH 1BGXH 2F7QA 5CILH 3VI4A 4E9TA 1ZTXE 3QIWC 3H6JA 3Q5YA 2RA1A 4OFYA 1AKJA 4W81A 4ONFH 1RU9L 3GI8L 3WE6A 3QDGE 3WYRA 1PZAA 3FTSA 3GMPA 1GSKA 5I1GL 4OAWB 3CC5A 1QSVA 2IDFA 4GRMB 4ETQA 3B6SA 3QZPA 1SDDB 2E5EA 2K78A 1LO0H 1TU2A 2AV7A 1LM8V 5AYTA 2EDEA 1T5WA 1T03H 1S9VB 1FE8H 1MKFA 3IDJB 3O3DA 4JG5A 2Q6WB 4JNXA 2WC7A 2B59A 2PPFA 1PY4A 4WTXA 2BNQA 1I8KB 2F8VA 5TH2A 4MB1A 1MUJB 1FQ9C 3SKMB 2NZ1A 1EHKB 4XN2A 5AVUB 2OW7A 1QZ1A 1U8PA 3D0LB 3KGSA 5JDJA 2Z65C 2KZ1B 4EN3A 1SJMA 1EGJA 4H8WH 4YDNA 3UEQA 1JNJA 4O58L 1OO2A 1KXVA 1RCYA 2XKNB 1F11A 3WKNA 3WKPA 4OF0A 1CFVL 4FQLL 1P1ZA 3KPLB 2J2ZA 3BZ4A 3NMEA 2F58L 2H8PB 1WO2A 5C0FB 4MAYA 4FFZH 5FECB 2MHAB 5I1GH 4FFVC 4NQCE 3CH1B 1OE2A 1TJGH 2BNRD 3L3IB 1EX0A 5EOCL 5CR1A 3TASA 3VXMB 4JPSA 5EEVA 1YDPA 1HCFX 1KN2H 1NPNA 4B9IA 3Q8CA 1JZGA 5E99L 2NY4C 5LWYH 3VMOA 5TQ0L 2X6VA 3ULUF 2V7NA 5IHUH 3U0PB 4N2DA 3V4PH 2MKWA 2NUPB 3EAKA 5FA3A 3CZUB 2W95A 2J88L 2YPKA 4XO5A 1NMBH 5FYLL 4F9PC 4A68A 4EPSA 3HR5A 3FQRA 2Q10A 1AZCA 1P4LB 3FTZA 4ISVB 5KYXA 2MPVA 2H2SD 5C92A 1XD0A 1MCRA 3SY6A 2FGWH 3C8KA 5IWLC 4B9PA 2IADA 3LXAA 5FUZH 1FYTD 1MJUL 4RRPG 3N41B 4WZ9A 2EO7A 3DGCR 1QLFA 4XWOD 3AM8A 3MJ9H 2R0ZL 5AKRA 4AVHA 1OWRM 2CCVA 5JDSA 1YECH 4PJFB 4XN7A 3PXHA 5G5DB 4PJIB 5J5EA 2E27H 4IMKA 3AMLA 2VXSL 4X80L 4QY8A 4NQCA 4NQSA 2YGOA 1GS7A 5CWSA 3V7AG 4MQSB 2Y5TA 1XL6A 2RIKA 5CZXC 3W81A 1CZ8L 1P69B 3BIAX 4YC2C 5JXED 2CLRB 4GNKB 4CGTA 2EE2A 1GH7A 3VXOA 1CDHA 3ZX1A 5B39A 3EOAA 5B3JF 1TMQA 4D9LL 4Q4IA 2CHDA 2UY7A 2YRBA 3Q7JA 4JVPA 2E56A 4ZDHB 4PS8A 4KNSA 4BBWA 3OAUL 1OPOA 5ADOH 3PHOB 5DVLA 3VDBA 4HC1A 1MFAH 1T21A 4NC1E 5JHAA 3TA3A 4GRLB 1QSFE 3VW3L 3Q1SH 4L37A 4GXUN 3SY0B 2BW4A 1P6WA 3QJVB 2G75A 4UTBL 1WAAE 4P59L 2XXGA 4JHZA 5EC2A 3NJGA 3IJYB 1JGVH 1AQKL 3P0VL 3GZQA 4OZFA 5DU7A 1U21A 4MAUL 4BGDA 4DUVA 2N0MA 3BWZA 1PMYA 1EUUA 3LQZB 5FOJA 5HGAB 4TKWA 4DKAA 4G6JL 1TDQA 3LRHA 3ZHNA 4B5EA 3MZGB 5BOJA 1NM4A 4DN4H 4M7KH 1TJMA 1XMWA 1F1GA 3I9GL 3FQWA 4JFZL 5DD6A 1A6ZB 4P4KA 4X5PA 4X7FC 4MXWL 2J1KA 2EDHA 3ALXA 3EADA 1LEKA 4LRNH 5D9SA 3P4MB 4HCIA 5TE6H 4EQ2A 3MA7A 4OIFA 4P9HH 2ZPKH 3OD3A 2LU4A 2DJSA 3OAYH 8FABA 4WF7A 2VQTA 2YO3A 3PWUB 1H19A 4FLRA 5FGCE 1E4XL 4NZUL 4Z7QF 4XMVA 1NINA 4YGVB 3OC8A 2BVPB 3FHAA 1BV8A 1CGWA 4KV5F 3F7YB 5HDBE 3WS3B 1KV3A 3HC0B 3UTSB 4HJ0C 1GJWA 4NQVB 5E8NB 5KW9H 1ZVYA 1QSFA 1KCSH 2P47B 1VACB 1S9YB 1WAAA 2ZX5A 3F58H 4FI8A 4UT6A 3WD5L 3D2UB 3FN3A 2PO6D 4L3EE 2DBLH 1MFBH 1NCIA 1YUKB 2ZUVA 4P9HC 4UNUA 5HDLA 4Z7NF 2YAEA 1HTYA 4GO9A 4K94H 1NMAH 1U58B 2OSLB 4XN8A 5GISL 4UMSA 4LPTA 3B4NA 3FMGL 3MYZA 2A4CA 4GP8B 2RQ8A 12E8H 3MX0A 5FFGA 2OSXA 2HX9A 4YX2H 4NKMA 1HESA 3L5XH 4DPCX 2COVD 4WI3A 2F74A 4RMTA 4FN0A 1VFMA 2LV4A 2ZD0A 4GAYA 3OJMB 1AGEB 2EDLA 4MMZA 2R29H 1U8IB 1KXHA 4HP5A 3WIFA 4GXVL 1MREH 3MROA 5HVFB 1A6WH 1KT2B 5HDQH 2NY3B 5DMJB 3WCYA 5JIPA 4K94C 2AABH 4ZPTA 3MRMA 4FMKA 3SDCD 2OMVA 1TQCC 4NNPH 1S7RA 2AAVA 5LJYH 3VNYA 2FATL 1P6AB 4LSUL 4Z7UF 2CKBL 4EO5A 3C6EA 2I25N 5ACZA 2Z92A 3Q3GA 3ZDZF 4ZW6A 3TO4C 2FE0A 4QHUA 2BNUB 1SF5A 3ILEA 1PIFA 5F7FA 3P30L 3QJFA 4JREB 3BI9X 2DYRB 2YD8A 3LKOA 4L3EA 5HVHC 5C09E 3F7QA 3VFGL 1SUHA 3GPSA 4UTAH 1CDCA 3APFA 2DL2A 2ZWLT 4AUUA 2IDQA 5TF1L 4ZNEE 1MW0A 3QORC 4XCEB 1E4WH 3IGAB 3J7HA 4U4BA 4UAOB 2EYSB 1MRFL 3BOVA 1R33A 4XAWL 3ZE1E 4PRPE 1N5YH 1QLRB 2LT9A 1KCWA 1IVTA 1OGTB 3KH4A 1BYOA 3RBSA 1BZ8A 1NSNL 4PLKD 5FKAB 2VRAA 4AQOA 4Y2DD 2Q7AA 3TBYB 3S8FB 4LLAA 1PLAA 2X42A 4XR8C 3T0EC 1UZ8A 3CQPA 4JM4L 4JFHE 3HHSB 3VRIB 4ZMWA 4X7CC 4B53A 1BIIB 2CHXA 3WIHL 1HHHB 2CKBB 4AKOA 1PJ9A 3CK0H 3ZZSA 2P42B 2Y36H 4S10A 3STZB 4EQ3A 1J1PH 3ZK0A 1R0AH 2JB5L 3ZDYE 3K7UA 3O9WA 1JF1A 1VADB 3OKEA 1RUQL 1S5HA 2AJ3A 2IPUK 1UOVA 2HSIA 1N64H 3HS0B 5GS1C 4Y2LA 1PEWA 1W0VB 3UGEA 3L3GB 4X6BA 5F3FA 1TT6A 2DQCL 2IH1B 1N2RB 2AEQH 3FL7A 1F42A 1MIMH 3MXWH 5C09A 5IOKA 2XQ0A 3GYRA 4IDLA 5H35A 5KBMA 4XI5D 3BT2H 5C0CB 4ZNEA 1S7SB 1GOGA 4HGMA 1T2QL 1U8MA 3LB6D 4PWGA 4PRPA 5FKPA 3BP5B 1TZAA 4JZNA 4JCMA 3L4XA 4AJVA 3B43A 2OL3A 3QIBD 4ILDA 1FG9C 4PV8A 5GRWA 5GS2D 2BERA 2NYYC 4PJGB 1HZHL 4FG6C 4IRJA 1GTNA 4JHWL 4DKFH 2NY6D 4ZXBC 5KBLA 5LGJA 3CDYA 1SY6H 4E5XA 3CHOA 3HUJF 3MJGX 2LFGA 1MF2L 3UTZA 3AG2B 3DMMA 5K9OA 4AQ1A 3RDTA 2QQKL 2XN1A 5AVTB 4ELMF 1O6SA 1UVQB 2HG5B 3TNMA 4BV1A 2N7SA 3S48A 3P2DA 1MN4A 1ZS8A 3ZRSA 1HOCB 4A2MA 3IE4A 4WSJA 4KKNA 1NPUA 2EAEA 1KEMH 2YPLB 2ZP0T 3GBMH 5GZND 1RV6X 1R17A 4HXBL 4BFIB 3VXMD 3UG3A 5GRYA 1WFJA 4JFDD 4EBQL 1EBPA 5EUOB 3ZMEA 2YD6A 1ZEAH 3QCVL 5KWYC 1JGLH 1TQWA 4BJLA 4YHYB 5KSVB 3BCDA 2AJVL 1INDH 2AQSA 4IEFB 1ACZA 3H3PH 4XOEA 4FA6A 1BLNA 1TLKA 4UT7H 3ROOB 1W8NA 3U7WH 2FZ3B 2NY5H 4XVUD 5EWIH 2CM5A 4ODTH 1SLVA 2EVFA 5FYKL 1FO0L 4ABVA 2OZ4H 3GHBL 1EZVY 4GG8B 4PJ9C 3VQ1C 3ZGIA 4YHLL 3ELQA 1JMZA 1O0VA 5F9JA 3B9AA 5C97A 2ZUTA 4YDLC 5K39B 4OB5L 1SOQA 4AOFA 4WW2F 1Z5HA 4OZHF 3AU0A 5IJVB 2WLKA 2Z64C 1A6VH 1KBWA 4PS4H 5F9AC 3SKNB 4NFBA 3MRRB 5PAZA 4TNGA 1ZANL 3KCPA 1A1NA 3SE4C 1CXHA 2XWDA