1N6QL

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCSASQDISSYLNWYQQKPEGTVKLLIYYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n6qL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n6qL01
1U92A 4L8DB 3ARDA 4JFDE 4GXUM 3GFUA 4GKSA 4QHNB 3LKPA 4PRNA 5CP3A 1G7LB 4Y5XB 3VFUA 4D0BB 4S1DD 4GUPA 2K9UA 1GPOH 3HE6A 2OP4H 4KJPC 1U8MB 3MXVL 3ARFC 3GJFK 4CL7A 1QSFD 3S35L 3H2WA 3QDMA 1MFAH 3CDFA 3SKMB 3BKCL 2IQAA 3DXAE 3V95A 4J3XA 3T0DA 4S1RH 3OAUL 5CZKA 4MXWH 1G7QB 4RGNB 4R4BB 4Z0XB 2Q6WB 2KL6A 1N2RB 2A0LC 4R26L 4CNIB 1K5NA 3X11B 1KPUB 1FORL 1KJ2B 1BJ8A 1DBJH 5C0BD 4PRPB 3CAFA 4JCLA 3INUL 3AXLB 4TTDD 5BQ7A 3DRTA 4FQHB 4JFFB 4JO4L 1NBZA 4M1DL 2CXKA 1RIUL 4TSBH 5F89B 3IKKA 1DEEB 4NNXA 2I60H 5C0DA 1OGAB 3L5WB 3QUYA 4V2CB 4X6CF 5ADPH 5GGTL 2GJ6A 4JZNB 2DM7A 5CLTA 4GQ9L 4U7KA 1YA5A 1HH9B 2QR0B 5F1NA 3QXAB 1KLGA 4NT6A 1E0OB 4OF0A 5FK9B 1RHFA 3OKNB 4G8IB 4KI5D 5IJKC 5T1LA 5C08D 2H1PH 2J8UA 5MHSD 3TO4D 3BT2H 4N68A 1BFVL 4NZRL 4ZS6D 2MTPA 3MRHA 1M05A 1A6UL 4N1EA 1TZGH 1R24B 3AU1B 4OLVL 2FHBA 4WRLA 5FUOL 3RKDD 2EC9U 4M7JH 2RAMA 3V9FA 3OXRB 3HUJB 4HLZH 2AJVH 2IAMD 5GGVH 4IRSB 4UT6H 1H3VA 2YD4A 2Z31C 4GRMB 1MREL 1S7UB 4BFGA 2MOVA 3WSQL 1XFPA 3WXVH 5LGKA 1JPTL 4NQCD 1F4WL 4X6DB 4EQ3A 1TETL 2QQNH 5B4MC 5C9KA 1YQVH 4P46A 4QT5A 1EO8H 1F6FB 2F54E 3UJIL 5IMOA 3GKWL 4RISH 4OCMC 3MV7A 25C8H 4LNRA 3V6OC 1LE5A 2B5IB 1QSEB 43C9A 4I48B 5JW4M 1I7ZA 1IAMA 4PREB 4QF1B 3M1BA 1INDL 4KHXL 3QIWA 3DTXA 1Z9MA 1JHKL 3VGAB 3ZDZF 4OCRH 1MQKH 4OZHA 3WFDH 1A6WL 3HAEG 4PJGA 4S1DC 3QSKB 3CLEL 5D7KE 1CF8H 1YEKL 2Q7YB 2YUZA 1JIBA 3B2VL 2WBWB 4LK4A 4JGMA 4GH7B 1F58L 3WFHA 5TF0A 2FD6H 2IG2L 1U8JA 5E8OA 4YDVB 4M61A 5EG6C 5HYEA 5T3XL 5I8EA 1EBAA 1LDPL 2XKUA 2X4UA 4XH2B 4MJ4A 4TVPH 5F7WC 3OKDA 3ZHDA 3MOBL 3QCUL 1RSFA 3ORJA 1ZSDA 5GPRA 4MJ2A 3TNMA 1CU4H 1T3FB 4LMQI 4GSDH 3IDNB 4TTDC 1RZ7L 3LN5B 5E7FA 1QA9A 3DVIA 4U1HA 5CEXA 3QEUB 5K9KA 3MLSH 2AEIT 4X7TA 3P4MA 2G2RB 3SE8H 4LCIH 3MRQB 4WVRA 2DQDH 1EJOH 2GITA 2DM3A 4U6VH 1D5BB 3O3UN 1YNLH 4NNPH 2GFBB 3EO9H 3SE9H 1TQBB 2ADJB 1HQ4A 4R0LB 3VXUD 4V1DD 3QPXL 4LPWA 2GQHA 3QWOB 4B53A 4JDTL 4M6NH 4X4YB 3VXMB 5DLML 4KI5C 4O2EA 4R2GB 3T0AA 3TO4C 1XF5A 3JTSA 4JFDD 3NGBC 4PG9A 1XZ0A 4WI4A 4ZS6C 1NCDL 5IBTH 2XKNB 4XP6H 4MB3A 4NM8L 4PRDB 4LEXL 4GO6B 2JB5H 3RKDC 5I1AA 2YSSB 5HI5D 5ELIA 1V7MH 2H2PD 5HDLA 1ACYH 3SCMD 3GUTB 3T2OA 2IAMC 4YR6A 4MZ3A 1WCBA 5FF6A 2ZNXA 3TT1L 1EHAA 2P8LB 1EXUB 2BSTA 2Z35A 3FTGB 5E4EC 5C7XH 1NSNL 1JNHB 3DXAD 4IDLA 1G9NC 4N0UA 3NIGE 2CQVA 2VLJB 3PQYD 1WBXB 3ZZ1A 4OKDA 3RVUD 4YHIA 5I30L 2D31A 2Y7QA 1P7QD 5T5FL 2VDQH 3KYKL 5I75B 3IRPX 1IAIM 1ED3B 1F4AA 2M1KA 4QXGL 1CCZA 3KPSB 1K6QH 2ERJC 3TNNA 3A67L 5FYKU 4LRNL 3DNKA 4J4PD 1A2YA 4Z9KB 3TIDA 3PP3K 4QCIB 1AIFA 1AXTH 2ADGA 2X70A 1YC8A 4X6FA 2DLHA 3VH8A 2MPAH 5EU5B 4F8QA 5IEHA 5MEPA 1LEIA 4Q0XH 2CUIA 1JYNA 3VI3F 4LLVA 5IEKB 3FOLB 1A6TB 3LQAL 4UIMA 3PHSA 5IB1B 2X4NA 1PYWB 4G8GE 1EHNA 4LAJH 4CVXB 1Q9WB 3DJ9A 2HMID 1S9WA 1FNSH 3GHEH 1YUHB 5JPMB 4ELKB 4JFEB 4BELD 1FDLL 2BHUA 1KCVH 2AERT 5DQ9A 2UY6A 3ZTNH 4EXKA 4ONHB 5FCUH 1LK2A 3CFKB 2GEEA 4DQOH 1P7HL 4LLWB 4UIKL 4XXDB 2R4SH 6CGTA 2XY2A 4KRNA 3QQ3A 1T0PB 4PJBE 2PNDA 2ATKB 4KJYB 4TRPH 5C0AE 1OTUD 2YUXA 1N0LA 5IB5B 3SGJC 4F58L 2VYRE 5TQ0L 1KCSL 1NLDH 2JIXD 3OQ3B 5HYSA 5JIPA 1MI5E 2WWKO 1FYTA 4RNRA 2MQCA 1MFNA 4U7SA 1OQOA 3ARBA 2IANE 3G6JB 1HWGB 3KJ6L 2M2DA 3KXFB 1ZLUK 2F54D 3AB0C 5TE7H 4TUOB 1IEHA 3IU4L 3FO9A 1G7MA 1MEXL 2NR6D 3S5LA 5J8OA 3I84A 4MHHG 4LSTL 32C2B 4K2UH 1CICB 2VIRA 3H6JA 2HLAA 5HI5C 2FGZA 2H2PC 3FFDB 3PWLA 3SCMC 5IIEA 1NCBH 2CDFB 1KELL 1ZXQA 2I5YL 5D7KD 2BFVL 1U3JA 1FFPA 2IH3A 5J9PA 1RZJH 3C5SB 1S5HB 5DHVA 2KKQA 3UBXB 1JK8B 4FQIL 4U1KB 3ARGB 1QLEL 1SJEA 4Z7NF 4G8FB 4PS4L 3RVUC 1GGCH 3ULSA 4BSVA 2XFXA 3GGWA 3ARFA 2GSIB 4GKNB 1VFOA 4PJ9B 1NJ9A 3LY6A 4S1SL 3DUUB 1VACA 1I9IH 3MJ9A 4A2MA 1IM3B 3ET9F 2HJLB 2O93L 4RQQB 5T3ZH 1IBGH 4UT9H 3S96A 4GG6F 2F53B 3D3VA 3VRIB 4J4PC 5DJXA 4EVNA 1XH3A 3MRJB 1RJZB 4NKIH 5C0IB 1QVOA 1EO5A 4I5BA 2HKFH 2NYYD 3PWNA 5FHAL 4U1NB 3JXAA 4OLUL 3CVHA 4Q9RH 3VRJA 3UTSB 3TF7C 3BN3B 3GHBL 5EO1A 1ADQH 5IESL 5DD6A 4HF5L 4XPBL 3KPMA 2R4RL 4JDVB 3LN4B 3TYFA 1F8TL 2DQCL 2FO4B 1EA9C 2HMIC 2KDGA 1RZKC 3ILPA 3CSPA 1BZ7B 2YPLA 5DJDB 1HK6A 4FQJL 3UCRA 2PYFA 4OF8A 1EVTC 3S35H 3BGFC 4BH7B 5MI0C 3TA3D 1W8OA 3QWRD 3BKCH 1JV5B 3K4AA 1FHGA 1E6OL 4MNQB 3OAUH 3Q6FA 1Q9KA 2DJ4A 3T0XA 5L0QB 1OTUC 3UROR 1HHIA 3O2DA 2YXMA 3REVB 1V05A 3T4YA 2CLVB 2FSEA 5E2WL 1JNJA 1G6RA 4WU7A 1FORH 1VADB 3U46B 1RUAL 4X4XA 3VH8G 3INUH 2V2XB 2Z31A 3NABL 4GOSA 1N0XL 2OR8A 3GI9L 4ZUSB 4HAFA 4JO4H 4WI7A 3DOSA 3V6BR 1IGJA 1A3LH 4HK0A 1OHQA 5FKPB 4L4VE 2NR6C 3N9GL 3QUKA 4NRZB 4Y0GA 2YK1L 4PJIB 1RIVH 2FNBA 2P5EA 3P77A 4G6JL 1H5BC 5IV2B 4GQ9H 1FNAA 1OAQL 1YPZA 3WMSA 4JG0H 3SDXB 4OV5B 4PP2B 4I2XB 1UKQA 1UH3A 3HZKA 5IB3A 1SY6H 4HX1B 5LBSH 4UQ3A 1DN0A 1OLLA 4MD5B 4POZD 2APFA 5BZWA 5C09E 3N50A 5HYSG 4UNUA 2V5SA 5EU7C 1JRHL 3BIAX 2HKHL 4JZJA 4KROB 1GGYA 5DDHA 5FOJA 4OCXL 4TSCL 3E6FA 1J8HA 2A1WL 4OUOA 5IM7A 1C7SA 1UB6B 2R0LL 3D25B 4JM4L 3OXSA 3JUZA 3DBXA 1JPTH 1OP5K 4CAGA 1SQ2N 2BVPA 4I4WA 1TETH 3C9NB 3U4BH 4S1QL 3DETD 3SE4A 2NYYC 4MA7L 4JFQA 5DJCA 3U30B 3W9EB 1NFDE 4G6FD 1RZ8B 3GKWH 1MAML 1NFIB 1MHEB 1MI5D 3ZKXB 3IETB 1SYVB 3P4LA 5I19L 3LKRA 1FNLA 3QRGH 4JJ5A 5E03A 2IAND 2DI8A 1INDH 1JHKH 1KJ3H 1MSPA 1ZLVK 3G04A 2H32B 3C5JB 4MD0B 1AGCA 4LKXA 1A6WH 3E6HA 4Z7WE 3CLEH 1LP9B 3BWUC 4JRYA 1BIIB 1LO5B 3L3HB 1XIWB 1F58H 3QXTA 4BZ1L 4HIXH 2GT9B 5GGQL 2DJSA 3TA3C 1CK0L 3GDBA 3MCLL 3O0RL 2BSRB 5C08A 5ERWB 3WBDA 4M7ZB 4Y2DA 1RJLA 2WV3A 1RUKH 4PB0L 2NY7H 1LDPH 4JM2A 3SOBH 2E8ZA 3KYMA 3UP1A 1NEZB 3MOBH 2F5BL 4ZNEA 1J0HA 5F70A 4QRUB 4L1HA 4PLOB 3QCUH 4P5KB 5DWUL 3TESA 3BOVA 5D5ME 2ZSVB 1HE7A 4TUJB 2NCMA 1HCVA 1CXLA 1CQKA 3L3OA 4PLJD 5ICZB 5KZCB 3BWAB 4XNMA 3P2TA 4CJ1A 5K9QG 4G42A 4HCRL 4PJAF 1JZ4A 1HKLL 4NQCA 2AKRB 5C3LD 3O41B 4DVBA 4UDUB 1URLA 1T1WB 4JKWA 2ADIA 4NRYB 1AGBB 1HYRC 1CDHA 3H9SB 3MXWH 4M93C 4H0HB 2EDTA 3QUXA 1A1NB 4W68A 5FM4A 4ACPA 2E27L 2ZG3A 5D93B 4LVHC 2JCCA 2Z93B 4J6RL 3BZDA 5FDYA 1LE9B 5GGSA 2H45A 1VFBA 1MQ8A 4NN7B 1O5DT 1FLRL 4POZC 4LSSL 3FAWA 5FXCH 3MRGB 3S37L 3O11A 2YD9A 3WS3B 3MROB 2VDNH 1MLCA 5C0GB 3BHBB 2HYMA 3O3EA 1JE6A 4KDTA 2GJZB 1IGYB 1JPGB 2EXWC 3C6SA 4JFYA 4MLIA 1R3IL 4PG2C 2VZTA 2OYPA 5HGHB 4QRSB 4U3CA 1NSNH 1AD0A 5E1AB 3C8KB 5EU6B 3GEWB 5IUSA 5KTEL 5IHUL 5KANG 5BJTB 5I30H 1KNOB 5IBUG 2P4AB 1P2CB 1G9ML 2WIIB 5T5FH 3UPRA 1KJ2H 2ATPB 3UTTE 3BPNC 4FTVD 4W6YB 3KYKH 4PJCF 4LHUB 1ZGLB 3C5ZD 1H3PH 1UQSA 5DRNB 1T0NA 2EC8A 3CFBB 3EGSA 4QXGH 4LLMA 4BQ6A 4YQXL 4OGXH 2XXMB 3O3BB 2X7LA 4BFEA 3HE7D 4ZUTB 1R3JA 3NOIA 4LRNH 4QRTA 3BEVB 3O6FD 4W4OC 4OZ4B 3IVKA 3OB0H 3VDAA 4K7FB 4XGZA 1AD9A 3QHZL 5C0CA 3L5HA 3I6KB 2DLGA 4OZFB 1WWAX 1XGPA 1K8IA 4XPFH 2J6EH 1AKJD 3RWFA 2QL1A 3LQAH 1M7DA 1I1AA 5LG1A 1SEBB 5IK3A 4ISVA 4NJAL 3O6LL 4J1UB 3VWJB 4IBLT 2J4WH 2BMKB 2R2HA 2CO7B 1FDLH 4ZXBA 4MX7A 2UUDH 3HMXA 4A2LA 2D7NA 4PLJC 2COQA 4ESKA 4MDIA 3L95A 1YYLH 4FZ8L 4JVUA 3LEXB 5EB9A 5MENE 2VABB 5DRZB 5I2IB 1RPQA 5CBEB 1OQXA 4KKNA 4F58H 2AJYL 1P7QA 1KCSH 1J18A 1AGDB 1D5XB 2LE9A 5I18L 1U8KA 5K9JH 1WAAF 1JP5A 4Z7VB 5DZNA 3RIFF 4E41B 2BSED 4X8XA 4U1SA 4OB5L 3RIFK 5T1MB 1UXSA 4TVPD 1J0IA 4MCZB 3IU4H 4BM7A 1MEXH 3PGDB 4U0RC 1IGCL 4F15B 1F6AA 2CLRB 5GGSY 3GIVA 4LCCB 5J3HC 4LSTH 5IMMA 1SM3L 5T3ZE 4DGYL 1ZV5A 5J06A 4HUKB 3CFCL 2I5YH 3TCXA 1KELH 5B8CC 2BFVH 4F7EB 1CFBA 1DE4A 2OQJA 5HYJA 2F19H 1EV2E 3ISWA 5I16B 2W60B 3BZFB 4O2FB 4FABL 3QXDA 35C8L 4AENA 3LSOB 4FQIH 3KPNA 1QLEH 2ILLA 2HH0L 4U6YB 5D72H 3CD4A 4PS4H 4I77L 3DO7A 2Q8BL 1WWBX 2AJZB 4RZCA 5IVZA 3FT3A 4PJXA 1TNMA 2DDQH 4L8BB 2YN3A 4JKPH 3RZCB 1YY8A 1YECL 2VOTA 1UYWL 5AD0B 4NO2B 2BERA 3C5ZC 4L1DA 3P0VL 1T0MA 2CR6A 4RA3A 1A7QL 5ANMA 4RAUB 2ESVD 3WKML 3BP4B 3F7VA 4HUXA 4XNYL 1K4CA 2YXFA 3HE7C 2BOCB 5SWSE 3O6FC 4LCWE 1B6DA 5HGBB 5DJAB 3RWEA 1UACL 5F9AC 3BRGC 4X83A 1SJXA 2X05A 3V4UH 4OZGA 4D9LH 2EDLA 4OLUH 5KOVC 3X17A 5KG9B 3RDTB 3HG1D 4UB0L 5BVJB 4LBEB 4OCWL 4HF5H 4LPTA 4L8SB 1HDMB 4HJ0D 2Z91A 4J3TA 4M62L 4NFBA 3BYYA 4Y5VC 1VDGA 3FL7A 1H5BA 3SGEH 4XCYB 1JWUB 4O51A 3UYPA 1XCQB 4Y8AA 5SX5H 1FG9C 3ZE2F 1HXMB 3K4DA 5C07E 2HVKA 2OZ4L 15C8L 3G5XB 4FQJH 5CLWA 3G5ZB 3MGOA 3TBSB 1N3NB 4YDIL 3E3QE 1AH1A 3J7HA 4XNUL 1AO7B 1RZGB 4YFLF 1TPXC 5L7XL 1IT9L 1H8NA 2V7HA 1J1XL 3MBXL 2P5WA 1QFOA 3RGVD 2NY4D 3L1OL 1MFBL 2PW2B 3H7LA 4NUGH 5EBLB 5E2WH 4Q9QH 3H0TB 5IROA 3QCVL 2VLRE 4WV1C 5BS0A 4PGBB 1RUAH 3ULUL 2R0ZH 3IFPB 3V6ZB 2KBGA 3NABH 3D85B 1N0XH 2DKMA 4HXBL 4L5FH 3UTTD 5KVEL 3IJYA 4F7PB 5GXBB 1YY9D 1JTOA 2X41A 3MRDB 3BVNB 4L4TA 4ZPTB 4Z78B 3EDDA 3K8LA 5EZLA 5EOQL 1F4YL 5FA4A 4G6JH 2FWOB 4RIRA 2XA3A 1PZ5B 5F97E 1NC2D 3MCKB 1OAQH 4H25B 3NVQA 4Z95L 3RUGE 1BZ9A 4ODWA 3IGAA 3HZMB 3GI8L 4MJ6A 2R2BB 4TPRL 5J0BA 3S97C 2FIKA 5KVMC 3FO1B 1MWAA 4HFWA 3QULB 4NO5A 1T03H 1UVQB 2BNUA 3QIBA 4PJHA 3VFGL 1JRHH 3LS4H 4P57A 2IBBA 1BF8A 2HKHH 3MCG1 4K3GA 4TSCH 1DQLL 1JGLH 1UA6L 3F5WB 3QA3A 1G7PB 4CMHB 3QFJB 5LVEA 2VDRL 1VPOH 4NKOB 2VN7A 1JNNL 2R0LH 1CQYA 3VJ6B 1ODAA 5D2LE 5DD3H 1DTUA 5F96L 5TDPB 2C1PB 2NPLX 3UYRL 5FYJE 5MEND 4HSQA 4EI5A 5BCAA 4BFIB 4N9GA 3CFDA 3L7FA 4S1QH 4K7PL 4MZ2A 4WGWB 4MA7H 5BZDA 1FBIH 3MLTB 4ETYA 2FJFA 1MAMH 2VLKB 2E7LC 4ZFFB 1ZHLB 4IRJA 3UX9B 1JF1A 4HJ0C 5D1QB 4P9MH 2B0SH 1VEMA 1E4WL 3MLZL 2VDPL 3IXTA 4OGAD 4E9LA 1T2QH 2YKLL 4R7DA 2F15A 1H15A 1IEBB 4RRPG 3OAZH 4NNYB 4BZ1H 3O3DB 3TPUB 3DVGB 1CK0H 5T3ZD 3PIQA 3O0RH 1PAMA 3MLUL 1Q1JL 4J3UA 3QH3A 3WNOA 3ECBA 4HV8B 5KN5A 3HI1A 1CVSC 1I9JL 1TJGL 3BXNA 4GS7B 4U0QB 2WANA 1QRNE 2NY4C 3RGVC 1MIML 5DWUH 4UU9B 2X1WL 3X12A 3MJ7A 1HHKB 1A5FL 1T1ZA 5DRWB 2XA8L 4UDTB 1FL3A 5LWYL 3O8XA 1YY9C 1R3HB 4R96B 4M8QB 1HKLH 4MGXA 3BFOA 1DQDH 4WFEE 4JHZA 3BN9D 1CT8B 1EJ6A 5D4QA 3HNSH 3VXSD 3PHQA 3U9UA 5SWSD 1S9KC 2E27H 4RGNE 4PJ8A 1UM6L 1CTNA 4J6RH 1TZHA 3QFDA 4Y1AB 1I85C 4AEEA 5EU3B 3QBTB 1CD1A 4BKLB 4I1NB 4W81A 4P2RA 4R7NA 2XWBB 2CR3A 1FZKB 3NPSB 5EO9B 1HI6A 2P8PA 1UH2A 1NGWB 3HA0A 4ORGA 3DUSA 2IPKA 3M45A 1ULVA 3PWUA 1CLCA 4C57C 3MV8E 1YNKL 3MV9B 5IHLB 2IMMA 5C07D 1DBKL 5I8CB 1U92B 2N56A 3ARDB 4GKSB 3LKPB 4PRNB 1NFKA 3GSVA 5IHUH 5KTEH 5F7EL 3JWOL 4LLQA 3SGDI 3VDBA 3VFUB 4GUPB 3HE6B 3DV4A 3IDXL 1KJVA 1BJ1H 4HBCL 1CLYL 7FABH 2Q8AL 1RZJC 3QDMB 4QOKE 3AFLA 2IQAB 2EZ0D 3CH1A 4PGZA 2NX5A 2ZUWA 5LGHH 3BDYL 1LO0L 4OGAC 3HUJE 4XXCC 4HGMA 3T0WA 5JORA 3QHZH 1U2CA 1K5NB 4Q74A 4JHAL 4FFVD 5HHME 1GIGL 4NC1C 5HVHB 4YX2H 4XC1L 2QSTA 4C83A 3LIZL 5BQ7B 3QNXA 3DRTB 3X13A 4X6DE 4MXVF 3C2SA 5E2TL 1XEDA 4URTB 1NBZB 5IB4A 4QHMA 4AMKL 4NJAH 3O6LH 2EDDA 4NNXB 3SN6N 3IU3A 3K2UH 1FN4A 5C0DB 2CGRH 1QSEE 3QUYB 5HHXL 4W6XB 5K59E 2GJ6B 5C8JA 8CGTA 2J1KA 1YEFL 1Z9OA 5F1NB 1KLGB 4FZ8H 1LD9A 4NT6B 2JJUA 4XWGH 2K3TA 5T1LB 2J8UB 2E9WA 3BN9C 4HG4K 1M4KA 1FVDA 3BUTA 1CL7L 5E70A 3TO2A 2DL2A 2NTFA 1HHGA 3MYZA 4FTVA 4TOYL 3MRHB 2X42A 1M05B 4AM0A 3DPBA 4AG4H 3NACH 1CVRA 4JO2H 4ZYKA 4KH2A 2EDJA 3ZHKA 4PBVC 4FNLH 1BWWA 1IC4L 3MGAA 4P49A 2FX9L 3VFRA 3RX8A 4RAVA 1IEAA 2H32H 4RGMC 1UG9A 4KKBD 4XP4L 5F1IA 2RQ8A 3UTOA 1GGUA 1PY9A 4DGYH 1NC4D 3C60D 4P46B 4QT5B 4P5MA 4WO4D 1FNFA 3CFCH 5I74C 4D0CA 5IMOB 3MV7B 3B9EA 1SEQH 4G6KH 4LNRB 3REWA 2FYYA 4X6BA 1LE5B 5F6IB 43C9B 5DR5L 4FABH 1I7ZB 3E3QC 3M1BB 3DTXB 4G8EA 4OZHB 5GRYA 4PJDA 4IIQC 4I77H 3QI9D 2Q8BH 1BQHA 2BRQA 4PJGB 2QHRH 5IFJA 2EE2A 2YMXL 3VXME 1QRND 1YECH 5AEAA 1UYWH 3V4VH 3KPPA 3P0VH 3WFHB 5F9OL 1T7VA 2EZ0C 1U8JB 5E8OB 4M61B 2LU3A 4XNYH 4GRLA 4MD4A 4DCQA 5I8EB 3CC5A 5C70A 2X4UB 5DUMH 3OKDB 4YZFE 4NZTL 4LSVL 3VMOA 1FCCA 4N0FA 4P0DA 3UO1H 4WFED 3FFCA 4KMTL 3QP3A 4FFVC 4DKFH 5JQHC 1ZSDB 1PEZA 5F7HA 3TNMB 4Q6IA 3RTQA 2VLJE 1MCPL 4OCWH 4U1HB 5CEXB 5K9KB 5C3TA 2L7JA 4X7TB 3P4MB 4LSQH 3T77A 4ZSOA 4OQTL 4RFNC 2GITB 4C4KO 3OZ9L 3IXAA 3KYAA 4YDLC 1RURL 2DM2A 4PRPD 5IVOA 4DEPB 3KPSE 4FN0A 2OZ4H 15C8H 4U1GC 4ELMA 5D7IF 4JFFD 1FIEA 1HQ4B 4XNUH 2XICA 4JFXA 1NL0H 2ZUSA 4OI7A 1CFVL 2B2XL 4O2EB 5TF1H 3MBXH 1XF5B 4DVRL 4KTEL 3JTSB 1OGAD 3L1OH 1U8OA 2E9BA 4OZIA 1HILA 1MFBH 4PG9B 1FC1A 1XZ0B 5HGGS 5I1AB 3ULUH 2R0KL 3IDJA 4NN5C 1A9EB 4HXBH 4L29A 4YR6B 1MCHA 1WCBB 5EUKA 5FF6B 1UJ3A 3VD4A 3LD8C 2Z35B 2BSTB 2P1YA 2XZAL 1AHWC 3B2UD 3H9ZA 3BDBA 5DEFA 4HIJA 4QTIH 4UTBL 4N0UB 3TT3H 2BNQA 3FOMA 1F4YH 1X5GA 2APXA 2BRRL 4KKBC 4Y4HA 4YHIB 2ICCA 4HUUA 2UVEA 3QT2A 1BX2A 2D31B 2DIJA 2Y7QB 2EH7L 4U05A 2Q1EA 3S4SA 5JIIA 4OZFH 4WO4C 2VDML 5J1SC 4IRSD 1JNLH 4IJ3B 1UCTA 4HC1L 4Z95H 4X7SH 3R4DA 4IMLA 3GI8H 4Y7MA 2ZOLA 2B4CH 5FM5O 2ZNWA 4XWOD 3TNNB 3CU7A 4OD3L 2DKSA 5J13B 5IT2H 1OAKL 1A2YB 3QI9C 4OI8A 3TIDB 3KXFE 1AIFB 1AQDB 4E42A 2ADGB 2X70B 4PR5A 1FVCA 2WMPA 4X6FB 4HDIA 3VH8B 2BNRA 1B4JL 2C5DC 5MEPB 5IEHB 1LEIB 3PABB 1DQLH 4UTAH 1QSED 2PTUA 3E2HB 2R69L 2VDRH 3W0WA 4LLVB 1JNNH 2FCBA 2EDOA 4UIMB 2X4NB 3G9VA 5HHOA 3F65A 4Y5XC 1IKNC 3CDYA 4L4JA 4BH8A 4WEBL 1KG0A 1S9WB 4HLZG 4K7PH 2EH8H 2IPUK 2R15A 1CDIA 4NN6B 3I6LE 3P0YL 5DQ9B 1VFUA 4JKMA 1LK2B 5ITBL 3MLRL 3QAZB 2C26A 3QQ3B 3EJZD 2L7UA 3B9KC 4RCAA 4P59L 4KUZL 1E4WH 3CGTA 3MLZH 3SEPA 4KQ4H 2YKLH 2WWKT 1L6XA 5EPMA 5HYSB 1BQHG 3VWKA 1IQWL 2ZWLT 4HQQL 5I76A 1FYTB 2GCYA 4RNRB 1PVHA 5BMFH 3ARBB 4NIKB 4KJWD 4Z7UA 3O6MH 5DMYA 4NOBA 1TJHL 3DX7A 4I8DA 4DGVL 3FO9B 1G7MB 1I9JH 3GMNA 1TJGH 5C0RH 2GHWB 3S5LB 4WTZA 1CD9B 1NCAL 4QRPA 3UTSE 3OJVC 1X5JA 1TTGA 3LMJH 2VIRB 4ODXA 1MCNA 3PXHA 2HLAB 3PWLB 5E9DA 4M3KB 5IIEB 1J88A 4XNQA 5FOBA 3VXMD 1FFPB 1LEKA 5LWYH 2IH3B 5J9PB 4R2GD 5AG9A 5DHVB 5IFHL 3LVEA 4XB7A 3B2UC 4PJDF 5EIVA 2QQLL 4QHKI 5E24E 3EUUA 1SJEB 3ARQA 4JKKA 3ULSB 4BSVB 2XFXB 3GGWB 3S7GA 3ARFB 1N7ML 4MNQE 2PO6D 1I9RL 3HCVA 1NJ9B 3Q3GA 4XVUD 1VACB 4IRSC 3GSWA 4KKLD 5INCA 4KKCD 5IW1A 3LKNA 5TGBA 1R5IA 1KYOJ 3UAJD 4CU6A 4XWOC 2VLJD 3NAAL 1C5CL 4RSVA 3S96B 4XNXL 3D3VB 3OGCA 3WLBA 5DJXB 1W2KT 4EVNB 4TTGA 3L5IA 5I1EL 1XH3B 3BPOB 4V2BA 1QVOB 5KW9H 4I5BB 2GYSA 2YC1A 3W2DL 2XV6B 3PWNB 5EULV 1MRCL 3GJFH 5FO9A 2J7LA 3CVHB 2B5IC 3VRJB 4BQ9A 2VXUH 4PJIE 1PX4A 4DZ8A 5EO1B 3PGFH 3VGAC 2I26N 5DD6B 5DMKA 1OL0A 3KPMB 4B5EA 4X8JA 1F13A 3RWDA 2JKXA 3TYFB 2J88H 5SWQA 5KS9A 5F7EH 3SDXE 3ILPB 3AROA 1MFCH 4I2XE 3MRBA 2YPLB 3IDXH 3ZYJA 4HBCH 1CLYH 1QBLH 4E5XA 2Q8AH 3S4SG 5K9OA 2PYFB 2DQHL 2WW8A 5DVNA 5CJXA 4PTTA 1KFAL 4W70A 5IQ9A 3LRSA 3EJZC 2CK0L 3Q6FB 2J8HA 4XNZB 5GRUL 1Q9KB 3BDYH 2R0WH 1LO0H 2FH6A 1MCIA 1KIUA 1HHIB 4M6AA 1HKFA 2P7TB 4CMMA 4EQ2A 4JFED 3T4YB 1S7RA 2FSEB 4R3SA 1G6RB 4WU7B 4BFBD 1I3GL 1PLGL 3ALPA 2AS5M 3AS3A 1GIGH 2BVTA 3V2AR 4WI2A 4X4XB 1IAII 3LIZH 4KJWC 2Z31B 2JF1A 4POYA 4XTRD 4U31A 3HC4H 4NWUH 1IGJB 4HK0B 2VLME 4MNGA 2FZ3A 2BY3A 4XBPA 3QUKB 4JHWL 5IBUB 2P5EB 3QQ4A 4WEUD 4LSDA 3P77B 1PSKL 3X3FL 5HHXH 1TQBC 1PBYA 2IADA 4R0LC 5FGRA 1BVLA 1YPZB 2HRLA 2HT2D 3KXFD 4NHCL 1YEFH 4YXLL 2VITA 1T7YA 3SDDA 1CR9L 3WNKA 4R2GC 2J8OA 4PJEA 5EC2A 3HZKB 5M94B 1IM9A 1LP9E 3QEGL 5IB3B 5GGTA 1QBML 4UQ3B 2IFGA 4FMFA 2A74A 3U4EA 1DN0B 4DTGH 4KQ3L 1CL7H 2X4SA 1CICD 5BZWB 1GAFL 4LFHD 4TOYH 2PO6C 5JMOC 1QLFA 1HCFX 1WCQA 1N59A 3UTQA 3VE0A 4JZJB 4XVUC 5DDHB 3IJHA 5I1DA 1IFHL 3TIEA 2FECI 2IGFL 4DJMA 1J1OL 4XPAL 5LJYH 3E6FB 4KKLC 1J8HB 3K0WA 4KKCC 1E4KA 3BQUA 3QZWA 5F8RC 3I6LD 5IM7B 1IC4H 3ARGD 3UAJC 2BZDA 3O6KH 4D2NA 2DAVA 3OXSB 4M1GL 3DBXB 4G3YL 3QPQD 4HIHA 2BVPB 4WTZG 4XP4H 4I4WB 1MJ7L 4XHJD 1KSRA 3WN5A 2XTJC 1AFVH 2HT4D 3QUML 5I75C 4JFQB 5DJCB 3SDAA 2B1HL 5HTSA 4HWEL 3LKRB 4JJ5B 1N5AA 2F53D 1Y0LA 4P4KD 2RIKA 3G04B 1AGCB 4LKXB 3AUVA 5ETUA 3E6HB 1LK3H 1S7QA 4NSKA 4WW2A 1XGUA 4JRYB 3UTSD 5KJRL 5F9OH 3U7WH 2X4RA 1XGRA 3D48R 5C08B 4Y2DB 5JR1L 5E8EA 1TZIA 4Y4FA 1RJLB 5CINL 1J1PL 5D6CA 4YHKL 1FV1A 4MYWB 4JM2B 3K8KA 3ULVF 1JI2A 4NZTH 3KYMB 4LSVH 4F9PC 1ZGLM 3ETBF 3VFOA 1T7WA 5F9JA 3F7YA 3VRLE 1NANI 2UWEE 4GW5A 1R0AL 1TXKA 1RVFL 3MJ9L 5F6HJ 3L3OB 2D3VA 5EU6E 3OF6D 4XNMB 2X4OA 1AHWA 4G42B 4I9WE 5TDNA 3PWPA 4XTRC 4WUKH 2CLZA 4NQCB 1EPFA 1MVFA 3STBA 3STZA 3CZJA 1QPPA 5DD0H 1EERB 3C08L 3FRPA 3OZ9H 5DK3A 5KAQF 2ADIB 3I6GA 2D4FA 3T2NH 3JTTA 4M7LH 4WO4A 3MRCA 1CIDA 3VG0H 3QUXB 4RDQG 3WYRA 5I71C 2HT2C 2CDGA 3O4LE 2PW1A 3LH2L 4HWBA 4O2CA 3FKUS 2JCCB 3I2CH 4IMKC 3UTZA 3SKNA 2ERJB 4M6MH 4OI9A 5GGSB 4PIRF 1VFBB 3RJQB 1CFVH 2B2XH 4K8RH 1UWXK 3ARWA 4KTEH 4KUCF 1CICC 4G7YL 2D03L 2X40A 5FDWA 4Y2OA 1K4DA 3WD5H 3O11B 3EYOA 1MLCB 2R0KH 3O3EB 5DXWA 1S7VA 1I3RA 1BEYL 5F7NC 2DQJH 2VZSA 2E6QA 3C6SB 1UM5H 4JFYB 3ARGC 3IFOA 3QXWA 3CXDH 1LO4L 2XZAH 4UTBH 5L2JB 1AD0B 3BGMA 3DMMA 3QPQC 3OJDA 2BRRH 1ZKAA 2WUCL 1T89A 4XHJC 4KROD 1A7NH 1G6RL 3UPRB 4J3WA 1A64A 2VDMH 3SDYL 4IS6A 1UQSB 3B9KA 1T0NB 3EGSB 4LLMB 4XC3L 2AJ3A 3WXWL 3HFML 1S7SA 2X7LB 4P4KC 2A83A 1LQSR 4OD3H 1R3JB 4QRTB 3MRMA 4E41E 3IVKB 1BOGA 5EFIA 1XF2A 4P99A 1AD9B 1F2QA 5C0CB 4H20H 4AIOA 1B4JH 1XGPB 1IVLA 1K8IB 3MV01 1TIUA 2R69H 3RWFB 2AV1A 5F1KC 4RMRA 3QZWG 5E2VL 5E8DL 2MMXA 1M7DB 1I1AB 3UDWC 3WDJA 3VI4E 5IK3B 3D0VA 4ISVB 3VXPA 2DLFH 2PTVA 4ERSL 2R2HB 1XIWD 3BISA 4PRAA 4ZXBB 1EFQA 4MX7B 1JZ6A 1CDYA 2E9IA 4MJ5A 3P0YH 4LVOB 5CJQH 1WBZA 3LQMA 5ITBH 4MDIB 5E00A 3L95B 3EDEA 3TZVA 4LL9A 4KUZH 2OXGA 3T0EE 1ZA6A 1M6OA 1U3YA 1P7QB 1UADC 1MOEA 2IH1A 2Q3AA 1CN4A 1IQWH 1HIMH 4PBWD 5CGMA 1PG7L 1U8KB 4DW2L 3RU8L 4LLYA 1BREA 5KZCD 4DAGL 1AI1H 1EMTL 1MCDA 1X5HA 1MCFA 3FO2A 3GSXA 1PJ9A 4JB9H 1D9KA 4U1SB 1TJHH 5B39A 1UXSB 1H8OA 3WJLC 4DGVH 5GJTL 3B4NA 3H9SD 1F6AB 4QRRA 3EYFA 3GIVB 4Z5RA 4K3EH 5IMMB 2ZCLL 4FMKA 4OLZL 3AREA 1DUZA 3ARZA 5ALCL 5EBGA 3BJLA 5MP6L 4R8WH 4F7CA 5CEZE 3V5HA 1HOCA 4HGKC 1W0VA 1DE4B 2OQJB 4P23A 3U9PH 5HYJB 5TFSH 2YUWA 4AENB 2QQLH 4HEPG 4Z7QF 3KPNB 2APBA 4WWKA 3DO7B 4OUUA 3FRPG 1NBVL 1JPFA 5IVZB 4RZCB 3FT3B 4PJXB 4KROC 1AO7E 5D6DC 4GBXC 5B38A 1YY8B 2CK2A 2OM5A 4TSAH 1I8KA 3PV7A 1EHLH 5FYKH 1P5UA 3X3GH 2JELL 3PDOA 1T0MB 5GS1A 2QJDA 1KN2L 5ANMB 1JHLH 3ILQD 3MSPA 1YEGL 3NAAH 1C5CH 3F7VB 4G6AD 4HUXB 5EU6D 1K4CB 4AIZA 1CZ8H 1YJDH 5I1EH 4K94L 3RWEB 1EK3A 2IPTL 3MR9A 5EUOA 3O9WA 3WEXA 3ULUD 3U30C 5GHWH 3W2DH 4LHUD 3KHQA 4MQXD 5TH2A 5EZIL 4OZGB 3ZKXC 1EBPA 4KI5F 3TBVA 1P1ZA 4I0CC 5TE6L 3NIDF 3EOTH 1WGOA 5J4MA 5EA0L 2FB4H 2Z91B 4JFHD 1WISA 4KK5D 5HI4D 5HXMA 3CZFA 4U1JA 2XT1B 5D2NA 1H5BB 2Y1VA 4OT1L 4R4ND 4EIGB 2XNAA 5IHZA 1XIWC 4O51B 2F58L 2V17L 2HVKB 1V3LA 2DQHH 2ZKHL 3MGOB 4HKXA 3FMGL 4M7ZC 4FQCL 3PF2A 2CK0H 3VWJD 4JRXA 3FRUA 4PD4K 3NH7H 1YNTA 2V7HB 4KY1L 3NN8A 2PO6A 2P5WB 4HW6A 3QFJE 4DOHB 1I3GH 1PLGH 1CG9A 5BS0B 2HTLD 4PV8A 5E7BA 4PB9L 4KDVA 2MCPH 1WUNT 2HFTA 3JV4A 3IJYB 1OF2A 1S5IH 2ADFL 5AYUH 1FO0L 3HI5L 4L4TB 4D9QD 1GL4B 3LPGA 4JHWH 5EZLB 2RFXA 3U36A 2VLKE 4CJ0A 4O02L 1FE8L 1PSKH 3IDYB 3QQ9D 4KZDL 5FA4B 4BZYA 5E8PA 3X3FH 3V52L 3TFKD 4N0YL 4JCMA 4RIRB 5CWSA 2WNGA 5D93C 1N64H 1DQML 2LV4A 4E41D 1Q8MA 5T5NG 1EEZA 1BZ9B 1CR9H 4ODWB 3IGAB 3IDUA 1AXIB 3ZKMD 4MJ6B 3L7EA 2FIKB 3QEGH 1MWAB 3JWDL 3DRQA 4HFWB 1NAKL 3OHXA 4NO5B 5DUPL 1S7XA 4XAWL 2BNUB 3THML 5DD1L 3QIBB 1T6WA 1KIRA 4PJHB 4P57B 1OPGL 4I3SL 4YWGH 1J1OH 4XPAH 1Z5LA 3DUHA 3QA3B 5B39G 1OP3H 3ILQC 4U3XA 5AWNL 4YDJA 4G6AC 3MRPA 3V8OA 4M1GH 4HWZA 4EI5B 1ETZA 4N9GB 5D7IE 3CFDB 1MJ7H 3RZCD 2GAZA 3ULUC 3L7FB 4OD1L 1WT5C 2XI9A 4KRMB 4MQXC 5BZDB 1J12A 4ZFGH 2B1HH 2FJFB 3G6DL 2NXZB 5AYQA 1BD2D 2Y06H 4IRJB 5DMJB 1B4RA 4GAFB 5T1KD 1JF1B 1U8NA 1I75A 4KK5C 4LIQL 1HSAA 2LTQB 3IXTB 3FHQA 5I9QB 4R7DB 4J8RA 4R4NC 4G80A 1KGCE 3M17A 4Y1AE 4MWFA 4X7EC 4LVHB 3D2UA 1HYSD 3RQ3A 4LEOA 4MAUH 5KJRH 2B4CC 3DI3B 4XVSL 3PIQB 4BZ2L 3OKYA 1A1MA 5SX4I 4P4RA 1C8PA 4KK8D 3QH3B 1T83A 3ECBB 5CINH 4XZUA 3VWJC 5DHVH 1H3XA 5KN5B 4PJ5A 2XWTA 3HI1B 5KSUA 1YEHL 3VFNA 4NZUL 3QXUA 4NYLB 3MV9E 1MHPH 3CK0L 4B0MM 3X12B 3MJ7B 3ZSTA 1R0AH 1KACB 2HTLC 4KHTL 3BH9A 3MJ9H 1I8LA 1AO7D 2AXGA 1T1ZB 4LCYA 3F7PC 1UZ8A 4EEEA 1FL3B 4L3AA 5L9DH 3O8XB 1U58A 2NY6B 3QEQA 3MRIA 4F2MA 3SHSA 3C08H 2DBLL 3PHQB 3QQ9C 4O9HH 3U9UB 1RY7B 1FSKB 3TFKC 1PDKA 3FN3A 4HCRA 1FL5A 4OJFH 3SGKC 4JPKL 4Z77A 4PJ8B 4NWTL 5T1DL 1TZHB 2LU4A 3QFDB 4P4KA 1T04A 1A7OL 3ZKMC 5BO1L 1CD1B 2HFFA 4YHPA 4PLKD 2V2TA 4J3VA 4O4YL 4P2RB 4R7NB 5C0AA 1VKXA 3SE3A 4G7YH 1KTLA 2LU7A 2D03H 4MDJA 5JDSB 1HI6B 2P8PB 3FO0L 3N1PC 1DN2A 4ORGB 4Q6YA 3DUSB 3ZT7A 2IPKB 4D8PA 1KIPA 4XX1G 3F6LA 3KHOA 3PWUB 1BEYH 3AM8C 4PRIE 5DJZA 3RA7H 1G7HA 5DMIL 1S7TA 1CFQA 2EDBA 2QEJA 1LO4H 2C3VA 3SBWA 2DQFA 1W72L 2WUBL 3S36L 4P2QA 5DJ2A 3V0WL 5D1XA 3GSVB 4LU5L 2CUMA 4LLQB 3RZCC 1G6RH 2ZZUT 3T1WA 3DV4B 1KJVB 1S7WB 2J8UE 2VXVL 1IKFH 3CH1B 1GGIL 2EDEA 1RUPL 3EYSH 2NX5B 3VFMA 2W65A 5JO5A 1VSCA 2EDFA 4M43L 1R5VA 5CEYA 5JORB 4JANA 1ZT7A 5HGDA 5L2KE 2VLKD 3OGOE 1HYSC 2VJXA 4C83B 3VFSA 3FB5A 3QNXB 4L8SC 3U4AA 1Q0XH 4XP5H 3X13B 3MFGB 2MHAA 5E8DH 4KK8C 4NOFA 1X7QA 5IB4B 5CKGA 4QHMB 2H3NA 1I3VA 3RPIB 1G0XA 3MV7E 4YLQT 3IU3B 2XG5A 2IBZY 1FN4B 1K8DA 3VXOA 4PP1D 3O4OB 4P3CH 4WFGE 4OFVA 3GSNA 5C8JB 4OZHE 1YEDB 3QXVA 4QXTA 1U3HA 4X9GA 4NKMA 3KR3L 1B6UA 5DK0A 4BA8A 1FGNL 1LD9B 2NXYB 4PJGE 3K1DA 3B9DA 2R56H 5JHDA 1FVDB 3TO2B 4GBXA 2NTFB 1HHGB 4FTVB 5ACLA 4AM0B 5GRXG 2AVGA 3TJEL 4DW2H 4ZYKB 3QJHA 4KVCL 3RU8H 4MA8L 3KGRA 5AUMA 4DAGH 1EMTH 3HI6H 1A4KA 4XBEL 2MKWA 3CPLA 1QFUL 1MJJA 1EEQA 1T7XA 5GJTH 4PLKC 3VFRB 3GBML 3KLAA 4RAVB 1SJHA 4HGWA 5FYKE 1IEAB 5BXFA 4RX4D 4MJIA 1JWMA 5F1IB 1P5VA 4N90D 4OLZH 5EWIL 4GRWE 3BIKA 4P5MB 4D0CB 1BAFL 4LGPB 4YHML 1UZ6E 3LOWA 1MJUL 3REWB 2FYYB 4X6BB 5BRZA 5EOTA 3U83A 5D70L 2WLYA 4KVNH 4G8EB 3NIGF 4XT1C 4L8CA 4L4VA 4PJDB 4CW1A 1IMHC 1D5IL 4ORZC 1BQHB 2YWZA 1WFOA 5I1HH 4JY5H 4TYUA 3MV9D 4XVTH 3KLSA 4CMHC 2JELH 3KPPB 3BX7C 2PETA 3ARDD 4W4NA 4K8RD 5DQDL 1QHOA 5DC9B 1YEGH 4NP4L 4GRLB 4DCQB 3CC5B 1D3CA 4YHZH 5LGJA 5DI8A 4N0FB 3P73A 3HE6D 1U0QA 5C09A 4NCC1 3FFCB 4PJFA 3QDMD 4Q6IB 3T08A 3JBG7 4N0UE 5GGUA 4IDJL 3RTQB 4OLWL 5TE6H 2X4TA 3KPRA 1I1RA 4JQIH 5EA0H 5BV7L 4C4KT 2HG5A 3T77B 1B9ZA 4ZSOB 4OT1H 2ENYA 4WHTA 1UWEL 3IXAB 5ESQA 4PP1C 2F58H 1LDSA 1I1YA 5JMRA 2V17H 1TITA 4X0KA 4ELMB 5I1IL 3FMGH 4JN2A 1NGYA 2NLJA 4PJBF 1NCCH 3A6OA 5E94A 4JY6A 4GS7C 3BKJL 4AJ0A 1ZHKA 4RBPK 5HJ3A 2OZ4A 3DARA 4JQXC 2ZCKL 2HFGL 3KDMA 5IVXA 4OZIB 1U8OB 3QUYD 1HILB 1RZFL 2GJ6D 4MCYA 5C1MB 4EDXB 3IDJB 1ACZA 1X9QA 4PB9H 1UCBH 1RD6A 4L29B 4DK6A 3QHFL 2AEWA 5EUKB 5T1LD 1H3TA 1UJ3B 4AQOA 3JWNC 2ADFH 1FO0H 3HI5H 4JPIA 2BXYA 1IAKA 1CD8A 5DEFB 4HIJB 2PXYD 2BNQB 3FOMB 5HD8D 4O02H 3DROA 4Y4HB 4KZDH 4HUUB 3V52H 1C08A 1U91A 1BX2B 1OARL 4APQD 1DQMH 1RK0A 3PL6A 3S4SB 1NMBL 3GSOA 1ZAGA 5CHNA 3BYTA 5DYOA 5EDXA 2ZOLB 4GJTB 3JWDH 1FYTE 3NPSC 4GLRH 4FQPA 4MQ7A 4XAWH 3WO3B 3THMH 4E42B 4PR5B 1FVCB 2EICA 3HMXH 3MV7D 4HDIB 5FFLA 2BNRB 3ZYIA 4I3SH 1G1CA 4WU5A 4WFGD 2AABH 3ARDC 2V5RA 3AY4A 3QIWD 4K8RC 3T2QA 3W0WB 3AGVA 5AWNH 1CDCA 5GRJH 5HGAA 5HHOB 1U9KA 3RY5A 4EDWL 3HE6C 4BH8B 1KG0B 2F74A 1L6ZA 2R1WA 4ODSL 5GZOC 5KSBA 2I9LA 3JV0A 1MCEA 3UJJL 4XP9H 2DI7A 5I8OL 3G6DH 1D6EA 2FDBP 2VZOA 1GOHA 2WK2A 3C6LA 4U33A 3DSNA 3PHOA 2BP3A 2FGWL 3KPQA 4LIQH 2F5AL 4NQTA 1QNZL 1UENA 4ZAKA 3CNKA 5M7QA 2NZ9D 2VXSH 1W8NA 2ITDA 5AZEH 5EPMB 5HVHC 3VWKB 5FYKD 5ADOH 4KDWA 1MCWM 4BK4A 3CSYA 4EXPX 1AC6A 5I76B 3EDFA 2GCYB 1FAIL 4X4ZA 4QHKJ 4TQEH 3D3VE 4LASL 4Z7UB 4BZ2H 4GXVL 1CDUA 3DX7B 3QDGA 4NPYA 1N6VA 4LSUL 3GMNB 4Y19E 2ZJSH 1YEHH 2UZYB 4QRPB 3QUYC 2W0FA 3CK0H 3SQBA 1F6LL 3CDCA 2N7AA 4KHTH 1CXEA 1GYAA 3GJEA 5E9DB 4PYGA 1ZEAH 4XNQB 5FOBB 2RHEA 1LEKB 3PWJA 2B1AH 2XQBL 2OLDA 2PXYC 5HD8C 4HPYL 3NCMA 4PUBL 4YJZL 1P4BL 3HCVB 4APQC 3ESVF 1J9CT 3Q3GB 3QIUA 4YK4B 4JPKH 3HB3D 3GSWB 2QQKL 1ZVYA 5T1DH 4JR9H 5T1KA 4DZBA 3JSSA 2CKBL 5INCB 5IW1B 3LKNB 5TGBB 1R5IB 3MACL 1S8DA 3VGDA 5IR1A 1EUTA 4O4YH 1A3RL 3ZYOA 3OGCB 3WLBB 1QLRA 2OI9B 5AAMA 3FQNA 3GIZH 1ZANH 1P53A 2YC1B 1A0QL 5FO9B 4H1LH 2MKLC 5F6IC 1G84A 4X80L 3QIWC 4WENB 4DZ8B 2E7HA 4JZOA 5DMKB 5ESVA 1W72H 4D3CL 3S36H 4X8JB 2BVYA 3RWDB 3RL1A 3V0WH 2YRLA 1XF4A 5ISZE 1YPZE 3GJFA 4DUVA 4Z76A 5KS9B 5SWQB 1ZWIA 4RWYL 3LS5H 4WFHD 3MRBB 5A2JH 3ZT5A 2YUVA 1DUYA 4IEFB 3ZDYF 3NBNA 1NFDF 4E5XB 1JGEA 3D5OF 3WHE0 5K9OB 2EDNA 2VXVH 3BD3A 4PTTB 2N1KA 4K9EH 3L5XL 4PJ7E 5IQ9B 2ZUXA 2YA2A 3WLWD 2FL5A 3NCEB 1A7PL 3VXSB 5ECJE 4C59B 3T3PF 1DBAL 4OM1H 4OZFG 1AXSA 4CMMB 4Z7WF 1J8HE 1S7RB 1KBGL 1QQDA 4R3SB 1C16B 3LDBB 1NDGA 1QFWM 1Z3GL 3X14A 3IAPA 2LVEA 4HZLA 1BF2A 1IC5L 4GT7A 4ODVL 1YJDC 5GGRY 1KC5L 4LDLB 4MNGB 2FZ3B 1EUUA 2VSCA 4XBPB 1U42A 4X6CA 4LCWA 1JZ7A 3KYOA 2DYPA 1FYTD 3RWIA 5D5MF 3O2WL 1MY5A 2AW2A 4HEME 3ARBD 3W9DA 4UQ2A 2IADB 4LOUD 4JEGB 1BVLB 5H2BA 4TUKL 1BFTA 3KR3H 1C1EL 2VITB 3NTCL 3SDDB 1FGNH 3C8HA 4PJEB 5EC2B 1IM9B 3MRKA 4JRYE 1FJ1A 2H8PA 2A74B 3U4EB 4G9FA 3NIFE 4XB8A 2X4SB 3WS6C 4FQLH 3J8F7 5J12B 1LO2H 2X4PA 5C08E 3CFEA 1F3JA 1QLFB 5FUZL 3TJEH 3GO1H 5A16A 1N59B 3HNVL 4MA8H 2VNCA 4HKZA 3UTQB 3VE0B 1T6VN 3HB3C 3IJHB 3SY0A 5I1DB 3TIEB 4WWID 1RV6X 4XBEH 4ZNEE 1QFUH 2XXCB 5F3BA 3BQUB 1RJYA 3QZWB 2K1MA 4DKEL 3GBMH 1HXYA 1R6VA 3T3ME 3ARFD 4YBQD 4JRWA 4HIHB 5F1OB 5C6TL 4ODBD 5JDJA 4UOW0 3HRPA 5EWIH 3WN5B 4IJ3C 4FQ2L 5EH1A 5DVMA 2VLRA 4NQCE 3SDAB 3ZE0E 2X9XA 2XZCL 3TWCL 1MCOH 3EO1A 3LZFH 4NQSA 3V5KA 1N5AB 2A0LD 4M5ZH 3D3VD 1Y0LB 2VR5A 3BAEL 5D70H 5J13C 3E8UL 4QNPE 1PEWA 2JCCE 5ETUB 3ULVL 4HJJL 1S7QB 4NSKB 2W9EL 4WW2B 4JE4B 1XGUB 2ZPKL 4PY7A 3VGGA 5CSZA 1OW0A 3LV3A 4Q97A 3RVXD 2JJTA 3VW3L 3IF1A 2X4RB 3MODL 1XGRB 3N1FC 3BKYH 3WLWC 5E8EB 1TZIB 4NP4H 3M07A 4UV4L 4Y4FB 5D6CB 4KTYA 1FV1B 2AK4D 1MCQA 1OT1A 3Q5OA 5FHBH 3WFBL 5CSBA 3L3KA 1DLFL 2VXQH 3VFOB 5F9JB 2YPLD 3F7YB 4FA8A 5EORL 1GGBL 4IOSD 1M7IA 4J2XA 4U4BA 3JUYA 3F58H 4GW5B 5DC0A 3QAZC 2O5ZL 3OKMA 2X4OB 5KVFL 5BV7H 1AHWB 5TDNB 1GHFH 1HEZA 3PWPB 3H3BC 3A0OA 1ZHNA 2CLZB 2VC2H 1JFQL 1CE1H 3STZB 4IRZL 5FGSA 3HZYA 3I6GB 2EDHA 2VDOH 3JTTB 2H6PA 4HFUL 4WO4B 3MRCB 3ARBC 2Z31D 5TQ2H 4FS0A 4LOUC 4A6YL 3HPLA 3DI2B 4OQTA 2CDGB 5FM5M 4O2CB 2PW1B 2OMNA 3UTZB 3SKNB 7CGTA 4UAOB 3BKJH 1N4XL 5C0CE 3WUWA 3D18A 2ORBH 3FQTA 4M4PA 4UV7L 1QTYT 3L3IA 5E6IA 1FZJA 1N8ZA 2AV7A 2P5ED 4WHYG 1PY4A 4ODHH 5FDWB 1J05A 4CADB 4U1LB 1K4DB 1G7JA 3B8YA 3EYOB 5FAAA 3MUGA 4ZOBA 1FIGL 1S7VB 1I3RB 4Z8FH 1E4XI 4GAGL 1OWRM 4NDMA 4ZTPL 3TEUA 1CFNA 2ZUVA 3UMTA 3WL9A 1JWSB 3IFOB 5IFAL 5D71H 4YBQC 3BGMB 3DMMB 4XP1L 1RK1A 3OJDB 2X1QA 4LMQE 2G60L 1OARH 4ODUA 3PQYE 1NMBH 4WEMB 4QGTA 3T4AA 1J8HD 1A4JA 2YD3A 4IS6B 5J89A 1JMXA 3B9KB 1A22B 1TNNA 2AJ3B 2NNAA 3MNZA 2VL5A 1S7SB 3K7UA 4QO1A 1U93B 3W81A 1T22A 2A83B 3BPOC 1NCTA 4I0PA 5GISH 2J2ZA 4X5WA 5I66A 4HC1A 1IC7L 3MRMB 1BOGB 1P6FA 1QSZA 5EFIB 3G5VA 1XF2B 1B0RA 1BFOA 1OD9A 4C58B 2WQ8A 3RVXC 5FYJU 1INEH 3O45A 5B3JE 4X99A 1NAMA 2CMRH 2AV1B 4CNIA 1KULA 3FN9A 2ZG1A 1DL7H 2NY5L 3D0VB 5EU4A 3VXPB 4EDWH 1OM3H 1II4E 4HT1H 2DICA 2AEPH 4JRYD 1FVEA 3EFDL 3AS2A 2HWZL 4PRAB 4YFLI 1REIA 3UJJH 2AK1L 4MJ5B 2P48B 5I8OH 1G9EA 3R06A 1T2XA 1WBZB 4Y2DD 1LMKA 3MV8A 2VE6A 4XNZC 5E00B 2HP4A 2B8OT 3BPLB 4PJXE 4ZUWA 4JM2D 2PXYA 4OAWA 2FGWH 3TZVB 1DR9A 1QNZH 1GZQA 1ZA6B 1M6OB 4P5TA 3VD3A 1BWMA 3OX8A 4APQA 2IH1B 2NQCA 2Z8SA 5ANME 4F7MA 2CJUH 4LLYB 1FAIH 1TVBA 5CUSL 1YZZA 5CJOL 1J0YA 3RKPA 1V3MA 3GSXB 5DT1H 4GXVH 1WEJH 1XCTA 5E6ZA 3SKOA 4YC2B 1D9KB 4QOKA 5B39B 2B20A 1AJ7L 3QUZA 2ICWI 5I1JL 4LSUH 5IGXH 2YR3A 4OZGE 3G6AA 2VXTL 4MAYA 1YYMH 1OY3B 1U95A 1S9VA 3HUJA 3QYCA 4H88L 2X4QA 4QRRB 3QUXD 3QDJA 4XRCA 4Z5RB 5LQBL 4LGSB 3GSQA 4K3JL 1U8QA 3AREB 1DUZB 5GZND 3BIBX 43CAA 4HAGA 4F7CB 3V5HB 1HOCB 1W0VB 3EOYG 2LABA 4P23B 1GZPA 4BJLA 1A7BA 2XQBH 2YZ8A 4NHUA 5T33L 4LAQH 5DS8A 4HPYH 1MIEH 4OUUB 5E0QA 1JPFB 2KZ1B 2EYRA 1VESA 4JZJC 5ID0A 1DP0A 4PUBH 2CPCA 4GLRI 4YHLL 5DA0B 5B38B 2JTDA 1I8KB 1NMAL 4WI3A 2QQKH 3FQXA 3FQUA 3KS0J 3RUGF 4PGEA 5EU7E 3PDOB 1GOGA 2P5WE 4OTXH 3TN0D 3U79A 1ORSA 4Q9CA 3PDDA 1TJIH 5GS1B 4GG6A 4DOHE 1KN4L 3MACH 3L3JA 3WUWG 5BS0E 2KPNA 3BE1L 3D0LA 4AIZB 5JW4Q 4S11A 2YPKA 1FAKT 3SE4C 4FFYH 5EUOB 3O9WB 3WEXB 4ENED 1A0QH 5TH2B 2Q87A 4WDIA 2MFNA 1A7RL 4L4TE 2PCPA 4YHOH 3MLXL 1KB9K 1UKTA 4KPHH 4OV6F 1P1ZB 4HWBL 5JHLL 2OJZL 2W9DH 4DFIA 4D3CH 4OCYL 5D2LF 4L9LA 3CZFB 4U1JB 1U41A 5D2NB 3QO1A 1D6VL 5C0CD 4LCUA 4AEIL 3BPCA 4P2YA 2XNAB 4OLYH 5IHZB 4HH9A 1MVUA 3STLA 5E8NA 4XCCH 3WJJA 1H8SA 1F3DJ 4ZFOL 2D7MA 4HKXB 4Y2DC 5INDB 3L5XH 1I1AD 4Z0BL 4JM2C 4KGJA 2DLEA 1HNFA 5JXAL 4JRXB 2GK2A 1A6VL 3FRUB 1A7PH 3WS6A 5JQ6L 2DF3A 3ALWA 1JVKA 1K85A 1J0KA 4K3DH 1YNTB 1DBAH 5FV1L 3NN8B 4JPWH 2PO6B 2MCG1 2IBZX 4ZXBD 1CG9B 1BGXL 5FA3A 3IJSA 1KEGL 1Z3GH 4PV8B 2R29H 3JV4B 3O2VH 4ODVH 1OF2B 1KC5H 2WINA 2W59A 4KAQL 2AJUL 2XTJB 1AGFA 2RFXB 3U36B 3QUXC 2DMKA 3O2WH 1QZ1A 4JN1L 4K71B 5E8PB 5CWSB 1H3WM 1ZS8A 5GZNC 3PV6A 2OXHA 4TUKH 3SKJH 1FNGA 1EEZB 4UMGA 3TBYA 4EN3A 3L7EB 2CIIA 2DWEA 1N5YL 1MLBA 3DRQB 5DJYA 3OHXB 1S7XB 3Q6GL 2H26A 2FJGA 1F11A 1X6NA 1KIRB 2OTUA 3EDJA 1VGKA 4KDTC 1KF9B 5IMKB 3DGCR 4YPJA 5F72S 3RPKA 5HYJD 1Z5LB 3TN0C 2FEEL 1CGVA 2Z92A 2CRMA 2OS7A 4YDJB 2R2CA 2X1PA 3MRPB 3CCHA 3WNNA 4HWZB 2EEAA 3LRHA 5C6TH 1ETZB 4KKAD 2IFFH 4XCFL 2GAZB 1KPVA 5J57B 4ENEC 5JIKA 2RR3A 3U1SH 3MUJA 5MEQA 1RFDL 4YEFA 4Y88A 3TWCH 1OAXH 1FPTL 5F7YC 3OB0K 2GY7B 4OKVA 3BAEH 1U8NB 5DJ6A 2VB5A 3QUMA 4OF3A 5AZ2L 1HSAB 4J8RB 3ULVH 4HJJH 4G80B 2W9EH 3M17B 4FQXA 5I71B 2ZPKH 4MWFB 2VKWA 1X5IA 3D2UB 2YD6A 2ATKA 4LEOB 4P2RE 4XMKH 5DJ0A 4JO3H 1I1AC 3MODH 3JWDC 4MQTB 2Q86A 3FCTA 1A1MB 1PW3A 5JOPD 4P4RB 1X4XA 2BVQA 4UV4H 4JFPA 4XZUB 2X9WA 5LXGH 4GFTB 2XWTB 4PJ5B 3NMEA 3OKLA 2UUDK 3HUJF 2C3HA 3WFBH 5KSUB 3VFNB 4ZXBC 4LVOC 3M8OL 4UZGA 1R5WA 2CO6B 1F45A 2XKSA 1OCWL 3BH9B 2AXGB 4PJAA 4X6DF 4LCYB 1UZ8B 2XZQL 4WNQA 1U58B 3EBAA 3QEQB 3MRIB 4XMLL 4F2MB 4MXQD 2P5WD 2P8MA 1X5ZA 1F4XH 1KENL 3D39D 4GMTL 4LDEB 5BS0D 1SYSA 4HFUH 5K59F 1KCUH 2C3WA 2NX5E 5DF0A 1FL5B 4KRLB 3U0WL 1MELA 4KV5E 1L7TH 4Z77B 1GC1L 1JZ5A 4P4KB 1T04B 4L4TD 4QEGA 1N4XH 4HUMB 3BW9A 2AEQL 2HFFB 4UV7H 4YHPB 2V2TB 1VKXB 5C0AB 5E08L 5C9JA 4I3RH 1KTLB 2X6MA 3N85L 3ZHLA 2WIMA 4MDJB 4N5UA 5F88A 1OD7A 1UWGL 3DX6A 2XRAL 3RWCA 4D8PB 1AQKL 4UOW1 1KIPB 3R0NA 1MCCA 4JJHA 5HVGB 1FIGH 2VKXA 2EKJA 5HDOA 4DN4L 5DJZB 4GAGH 1G7HB 2DOCA 2CSPA 4ZTPH 4QTHB 1S7TB 2AK4A 1CFQB 2R2EA 2C3VB 1Q38A 2DQFB 1QYGL 5DC4B 3HR6A 4P2QB 3MXVH 3QIBD 5D1XB 1OB1A 4KKAC 2A9NL 4PJCA 1A9BB 3ZSSA 2L0DA 4X7CC 2G60H 2PUQT 1CWVA 5D7LA 4F33A 3U6RA 4BK5A 4CVUA 1ND0A 5F9DC 1IZKA 3B5TA 2V2WA 2DQGL 4FTVE 4R26H 1HH6A 4EI5D 3RBSA 1RUQL 2DMCA 3VFMB 2W65B 4CU8A 1IC7H 2L4OA 5JO5B 3MLVL 1R5VB 3H42L 4Y4KA 5CEYB 1WLHA 4JANB 2Y36L 4U3HA 1ZT7B 4MNQA 4OFDA 4NQDA 3C87A 5HGDB 2NXZD 3TBWA 1KEML 4NUJA 4M1DH 4Z7OF 2GY5A 1RIUH 3G5YA 1HHHA 4IRJD 3VFSB 3FB5B 1KV3A 2ZP0T 4YUEL 1AE6L 1HINL 2MHAB 4HH8A 1X7QB 3ZO0A 5SX5K 2H3NB 4YZFF 2NY5H 5GGTH 4MA1C 1MPAL 5J56B 1K8DB 3VXOB 5CCKL 1MHCA 2AK1H 3FT2A 2JLLA 4NM4L 4QXTB 1U3HB 3EYUL 3MRLA 4NKMB 3FAXA 5ABDE 2IJ0C 5DK0B 3VFWA 1BFVH 4FXKA 4NZRH 3HTLX 1A6UH 4MXQC 2BOBA 4OLVH 5FUOH 5JHDB 3QDAA 4X7FC 4UOJA 5IROC 4GBXB 1WAAA 4R97C 2EXWD 3QJHB 2DIBA 1OSPL 4K9EC 1MREH 5AUMB 3QNZA 1A4KB 3WSQH 3O8XD 2NY6D 5D1ZA 4IHOA 3S5LG 3CPLB 4HS6A 1F4WH 1MJJB 1HSBA 4RFOL 3ZTJH 1MCJA 3RWJB 1ROWA 3FFCE 3WIHL 1CYGA 1GRWA 3KLAB 1SJHB 4HGWB 2WLZA 3IDYC 5F1SA 3ZDYE 5BXFB 3UJIH 4TVPE 2DQEL 4MJIB 3PGCA 1JWMB 4K3JH 1LEGA 4PJ8D 3SGDH 4M6OL 1IC1A 2XQYG 3BIKB 3I9GL 4NC2B 4KHXH 1TCRA 3UJTL 4IM8A 3U0PA 5BVPL 3T3PE 5BRZB 5EOTB 4P2RD 1JL8A 3TJHD 1YEKH 3FN0L 4G5ZL 3B2VH 3QIBC 4ELME 3VGFA 4L8CB 4L4VB 1U8PA 3LAFA 1YN6A 4CW1B 3JV5A 5DHXB 3UTPD 2IG2H 1GH7A 4QGYA 5T3XH 1NMAH 3BEWA 2G5BA 3OKOA 4XPGL 3PWVA 4OZIE 1KN4H 1IAIL 2MNUA 4XPTL 3HRZA 4EI5C 3IB4A 3UZQA 6FABL 3G6JF 3LPWA 5LGJB 5DI8B 2ESVE 3P73B 3B83A 5CZVL 1RZ7H 5C09B 3LHPL 3W11D 4PJFB 4XBGA 2NXZC 4LLUA 1A7RH 4PGDA 1OGTA 4BUHA 3MLXH 4U6TA 5GGUB 4IRJC 3MBEA 4HWBH 2BNQE 1ZT1A 2X4TB 3KPRB 3CDGA 2OJZH 1DSFL 2NX5D 4NQEA 4NJ9L 1F02I 2LTQC 2E3VA 2Y07L 3OAYH 4P5KA 2HG5B 1DFBL 4LQFL 3HG1E 3OAZK 5I9QC 4TUJA 4ZOCA 4AEIH 3HC3L 2BY0A 4WHTB 5ESQB 3QPXH 2XY1A 1I1YB 4JDTH 3LKSA 2Q76A 1F90L 2X9YA 3CXHK 4X0KB 5DLMH 4JN2B 5F6HI 1NGYB 2NLJB 4M1CD 1XAUA 2W0KA 5EBMB 5E94B 4JY6B 1NCDH 2FECL 3U48A 5J3HD 1ZHKB 5JXAH 1IGFL 4NM8H 5H35A 4LEXH 5HJ3B 3I50L 1X5LA 4RMWA 1JGUL 3KDMB 5IVXB 2J5LB 4DUXA 4N8CL 1ZLSL 4MCYB 3NZHL 3W0WE 4CN6A 1BGXH 2PTTA 3TT1H 3S9DB 3TN0A 3OV6A 4YE4L 2NXYD 3O8XC 4F57L 2NY6C 1DANT 2A38A 2A6KA 2MWCA 1JPSL 5ENWA 1IJ9A 4OFYA 2CXGA 4JPIB 1IAKB 4AL8L 3O81A 2PR4L 2ICWA 1FSKC 4F7TA 3DROB 1FYHB 4JN1H 1EAPA 1C08B 1U91B 4JLRA 4P9HC 1FL6A 4PJ8C 3KG5A 1QEWA 1RK0B 3VG9B 1NLBL 2UWEA 3GSOB 1HWHB 3FQRA 1FO0A 5CHNB 5ACZA 5BV7C 3A67H 1PKOA 1JN6A 4WFFD 5IHBA 4R90L 5DYOB 1L7IL 1N5YH 2CD0A 5JLZA 4JFOA 1N26A 3TJHC 3DGGA 2XZZA 4MQ7B 2OP4L 4I18A 4Z7UE 2ZUQB 5L8JB 1ORQA 1MFAL 4GG8A 4HLJA 4S1RL 3GSNL 4RFEA 3VD9A 4WU5B 3O4LA 3B6SA 1S9YA 4QRPE 4ZOAA 5GS0L 4BQBA 3WIIL 3GK8L 2XG4A 4OF6A 2DBJA 5HGAB 1DBJL 3IS0X 3BZ4A 4X5XA 2AGJL 5E9DE 4S2SA 4NCDA 2F74B 4UIKH 2AXJA 1VENA 2R1WB 5DUBA 3W11C 4KZEL 4NBYB 2R1XA 2I9LB 5KSBB 2YN5A 1RFDH 1D6EB 4PJIF 4ONFL 5FGBC 2FLRT 2AXFA 4GRLD 5TQ0H 5E5UB 1BIHA 3PHOB 3KPQB 1AGEA 1OLZA 5ADPL 5HHNA 2CRYA 4JKLA 4ZAKB 3SDXF 4PRHA 5JA9A 2GIYA 3FFCD 2ITDB 3KJ6H 1U8IA 3HN3A 3ZKQD 4G6ML 3CSYB 3K80A 1AP2A 1NCUA 3RTQD 2IALA 3GMMA 1K2DA 5C71A 2ED7A 1JJUA 2PYEA 3BT2L 4M1CC 4HIEA 4NC1E 3QDGB 4NPYB 3G9AB 1DCLA 2C9AA 4PFEA 5IG7A 3GB7A 4P2OA 4M7JL 5D7JD 3O4OC 1HNGA 2W0FB 4XCEA 5HHPA 3FB8A 4OLEA 2DM4A 5SWZD 3S35X 1A14L 1OCWH 2NXYC 3GJEB 1PX3A 5KS9E 2XZQH 1X3DA 3WXVL 2XYCA 3RWGA 5FO8A 3PWJB 3Q5TA 2QQNL 4XMLH 3OMZA 4S1SH 4U6HA 4YFEA 1FNEA 2SEBA 1EO8L 5BOPA 1KENH 4GMTH 4YIQA 4QWWD 3OKEA 3P3YA 1CE6A 1X44A 4RGOL 3WE6A 3BZFA 3QIUB 3VXSE 1BD2B 1H3UA 1GC1H 2FBOJ 4OCRL 5F7FA 5T1KB 4DZBB 2ED8A 3ARTA 3WFDL 1WTGT 4ZO8A 1LP9F 3JVGA 5DQJA 2FO1A 1IL1A 2AEQH 1BVKA 4E0RA 4Z18A 1V3KA 1S8DB 2BNQD 1MHHA 5IR1B 1CF8L 4FRWA 4Y4HD 5E08H 5FHAH 3T0EA 1T1XA 1BJMA 1QLRB 3N85H 5ACMA 3FQNB 3S34L 1Q94A 1UFUA 1P4LA 4F9LC 1UWGH 3GHBH 1CLOL 2XRAH 1AQKH 5IESH 1DBML 4JG1L 4XPBH 4MNGE 1S78D 2R4RH 5C6PB 5GRWA 4DN4H 4F37F 1F8TH 2DQCH 1SVZA 1XGQA 2ZCHL 4F37K 4JZOB 2AAVA 5ESVB 3IDMA 4QYOA 3RL1B 1XF4B 3GJFB 4L3EA 4Y16A 4Z76B 1Z0MA 4H1LA 5J11B 1D7FA 1ZWIB 3RDTA 2ZUUA 2A9NH 3T04D 4GSDL 2BNRD 1DUYB 1E6OH 4PJEE 2DQUL 3S3PA 3MLSL 3RJDA 1VFMA 1JGEB 1W72A 4LCIL 2FRGP 3LEVL 3EOAA 3W0WD 4Q58C 2DQDL 1ZA3A 3RIAF 4DWHA 4S0SD 4GRLC 4U6VL 4LF3A 5HHOD 3F7QA 3SDCA 1YNLL 2FL5B 3RIAK 3D39A 1RUQH 2AQ2A 3FHAA 1EO7A 1YEJL 2Y72A 4NNPL 3VFTA 3NFSL 3GRWL 1AXSB 3MLVH 1BBJA 4AH2A 3H42H 1TQCB 2Y36H 5CMAA 1QQDB 4P3WA 3GI9H 4Q6IC 2DKUA 3RTQC 3BKML 4M6NL 3V0AC 1NDGB 3AC0A 4JREB 4P3DA 3X14B 3N9GH 3B3IA 4HJGA 2YK1H 1X4YA 4YUEH 4Y8DC 1FNHA 1J7VR 4HZLB 2ARWA 3W39A 1XR9A 5IBTL 4XP6L 2NY2B 2VERN 1MPAH 4UUJA 4F3FB 2WBJA 3MJ6A 3VWKD 4X6CB 5D7JC 1TTUA 1PZUB 4LCWB 3KYOB 3ARYA 2DYPB 3NFPA 1ACYL 3VRLF 3RWIB 2DB8A 2UWEF 3OKKA 2JJSA 4UQ2B 3W9DB 4NM4H 2YA0A 5C86A 4ZPTA 1XR8A 5H2BB 3EYUH 1YMMA 5F7DA 3MRKB 4QRPD 1FJ1B 2H8PB 1H9VA 4XPHL 1CDBA 2IBGA 2VDQL 3EW3B 4G9FB 1FQ9C 4OCXH 4QWWC 1OP9A 1LO3L 2X4PB 2A1WH 3CFEB 1F3JB 5E9DD 5A16B 4HKZB 5E4IA 3DX9A 4JM4H 3SY0B 1Q9LA 1UJ3C 2QQQA 1QFPA 4RFOH 1RJYB 4ETQA 1WJ3A 1E27A 2YBRA 3U82B 3WIHH 2WWMD 5T3XE 4Y4HC 1HXYB 2ICES 4RMVA 3OPZL 5K9QI 3VA6A 5C0ND 4MA3A 5C2BL 1KLFA 3PWPE 5I19H 3VD5A 4M6OH 4BQ8A 2VLRB 4KI1A 2C1OA 1S78C 3IT8D 3S8WA 3V79C 3HR5A 4ZUVA 3EO1B 1EX0A 1G7IA 4NQSB 3V5KB 1VEOA 1FNSL 1A1OA 3BUYA 1VHPA 5DA4A 2IEPA 4G5ZH 1IARB 3OJMB 1FH5L 5CGTA 1NUFA 2RCSL 4QLRA 1JI1A 3LKQA 1JYWA 5FCUL 5GGQH 2Z8VC 3MCLH 1NKOA 2R4SL 3AS0A 4PY7B 4PB0H 5CSZB 3EOBA 2DI9A 4L3CA 4XPGH 3IF1B 1U2HA 2F5BH 1XF3A 2I24N 1D5MA 1IAIH 4Q7DA 1NLDL 3P11L 4XPTH 1GSMA 2GSGA 1DJSA 6FABH 3L3KB 3P40A 1M7XA 5CZVH 4JQVA 4LP5A 4JDZA 3RNQA 3CH8A 3LHPH 1M7IB 4HCRH 1EH9A 4AEHL 4CKVX 5LCVL 1TLKA 5C0FA 2JK5A 1ZMYA 1DSFH 2BVOA 3OKMB 5C0JA 3KLHD 2Y07H 4X6EA 1HEZB 4LQFH 3AS1A 1ZHNB 3VI4F 4RBPH 2NY1B 4DKDC 5A43C 5JOEA 3VWKC 3MQIA 3HC3H 4MB4A 3WV0A 4H1LG 3HZYB 4HK3J 3VFVA 1R3KA 5D7IA 2H6PB 3KNBA 3I02A 3HPLB 4PRPE 4KC3B 1FLRH 3HAEA 4LSSH 3WUWB 1IGFH 3D18B 3T8XA 3S37H 3FQTB 1WC7A 3L3IB 2XN9A 4JFFE 5E6IB 1FZJB 1N8ZB 2AV7B 3CUPA 2QKIA 3EYVA 1JGUH 4MVBD 1I9IL 4WCYL 3WFEL 4B7LA 3IDIA 1J05B 1ZLSH 4JVWA 5I1LA 3HLAA 5J1AA 1G7JB 1R3IH 3IS1X 4YE4H 1OGAE 3MUGB 5T3ZL 3SDDD 1P69B 4UT9L 4F57H 3QRFM 1NPUA 4NDMB 1IM9D 1NMCB 1CFNB 1KB5A 3WL9B 5IB2A 1NH6A 1X6LA 5HPMA 1T4KA 4AL8H 1G9MH 2WP3O 2OL3L 2WWMC 3LKOA 2A77L 4ODTL 1U6AL 4HMDA 1RK1B 5JOFA 5C0NC 1OSZA 1LNUA 2C3XA 4YK4C 3MOAL 4YQXH 2P45B 1QFWI 4ODUB 5J6GA 2K7QA 5FGBA 3T4AB 1A4JB 1HHJA 3BQUD 1GVIA 4P48A 3TBTA 5MEOA 4R90H 2OX5A 1L7IH 4D0DA 2NNAB 1J86A 3MNZB 4OCLC 2VL5B 4NO0A 3Q0HA 4Q2ZA 3UYOD 1T21A 1ES0A 2OI9C 1T22B 3I3EA 5TJWK 4HK3N 4I0PB 4X5WB 5I66B 4KRPB 5F7LB 3G5VB 3SDAD 3F12A 1B0RB 1BFOB 2I25N 1FLTX 3GSNH 4M02A 1NANH 3O45B 4QRRE 4X99B 1NAMB 2UZXB 5GS0H 5E5RB 3WIIH 3GK8H 3LEYL 4HPOL 2AGJH 4K23L 5EU4B 4LLDA 4JPVL 1F42A 1FVEB 4KZEH 3TVMA 2ICWJ 3MJ8A 5CJXC 2FR4A 1GGTA 5JXEA 2GTWA 5FGCB 1C12A 1A3LL 3R06B 4ONFH 4PRIA 4Y4FD 2VE6B 3MV8B 4NC0B 2AJYH 4ZMAT 4M9OA 3KLHC 1RIVL 4ZUWB 2PXYB 4OAWB 5I18H 1NBQA 1T20A 4WTXA 3CJJA 1GZQB 4P5TB 3LDBC 4JG0L 3OX8B 4APQB 5DGQA 4YHNA 5T3XD 5KSVA 4G6MH 4OB5H 5GRZA 4F7MB 4HUWA 2NY3B 1TVBB 4AZ8A 3TCLA 1SY6L 2DIAA 3WDIA 5LBSL 3PWPD 1XCTB 3SKOB 1IGCH 1ONQA 3U0TA 4QOKB 5EUOE 4F8TA 3SQOL 3QUZB 3KAAA 1SM3H 3TH3T 4KMQA 5EIIA 4F9LA 3G6AB 2AP2A 4MAYB 4MVBC 1U95B 1S9VB 2GTZA 2X4QB 4XRCB 3K3QA 3QDJB 3GSQB 3MLYL 1FFRA 1U8QB 4FQQA 1A14H 5HHMB 3SDDC 5L2KA 1EDQA 35C8H 1SBBA 3CMOL 3QIWB 43CAB 3RNKA 5D2NE 1OAYL 2HH0H 4WUUA 2NY5C 1GZPB 2E5EA 3U4BL 2Q3ZA 4NHUB 1BQUA 2QSVA 3ZLQC 5DS8B 2O5XL 4RA0C 5J12C 1MAKA 8FABA 1A3QA 4Z7OE 2VQ1A 2EYRB 1DVFA 5ID0B 4POUB 1A7QH 4RGOH 4WTWA 1J0ZA 5HBBA 3QRGL 4JRXE 3WKMH 2X89A 3FQXB 3FQUB 1E4KC 1KJ3L 3BQUC 4Y5YA 3VXRD 3MNWA 4PGEB 1ORSB 1EHXA 4GG6B 1UACH 4XX1E 3L3JB 1Q0YL 3DMMD 5EOCJ 4J23A 1JGDA 3D0LB 2F8OA 2FEEI 2YPKB 3WN5C 3BP6A 3S34H 5FYJL 4HIXL 1EFXA 4UB0H 1CLOH 2CKBA 3SDAC 1JGVL 3WKNA 1QA9B 1DBMH 4JG1H 5KSAA 4WDIB 3B9KD 5JW3L 4M62H 2PCPB 1F00I 1IRAY 1RUKL 1ZE3C 2V5MA 2NY7L 4OF7A 4YBHA 3SOBL 2XTJE 2ZCHH 1NKRA 5DVOA 2D0GA 1DDHA 1Z6JT 3BSZL 4L9LB 5D7JA 3QO1B 4WW2C 1WIUA 4LCUB 3BPCB 4YDIH 5SWZA 4HH9B 2DQUH 1MVUB 4B41A 3STLB 5E8NB 4H0GA 5L7XH 1IT9H 3RX7A 3LEVH 3ROLA 1P7KA 4MMZC 4Y4FC 1J1XH 1VFAA 3HS0A 2ZG2A 3MXWL 3QCVH 1YEJH 1T5XA 5DHYA 3NFSH 3GRWH 4RMTA 2P44B 1KCLA 4U49A 2IQ9L 3MO1A 5KVEH 4KFZC 3BKMH 5ICXA 1ZOXA 5FA3B 3IJSB 4JFEE 4JO1L 1JF6A 3TZVD 4H26A 1FC2D 5EOQH 2I9TA 3CVIL 2AJXL 2A6JA 2V7NA 3KPOA 2WINB 2IPUG 3WHXA 2VDNL 5M95B 1AGFB 1BQSA 1A9EA 2ZSWA 3KPLA 4LVNB 4XAKE 1ZS8B 4TPRH 1D9KD 4UAOC 3PV6B 1FNGB 4FXGA 5GJSL 3G6JE 3TBYB 2VH5L 1NAML 3V0VA 4EN3B 3L9RA 2Z8WC 2CIIB 2DWEB 3VFGH 1MLBB 4QRRD 5DJYB 4XPHH 1KJ2L 1FCGA 2H26B 2FJGB 1F11B 1LO3H 1UA6H 3ARED 2QADB 1H3PL 5KVDL 2OTUB 1VGKB 2DTSA 4HXAL 4OGXL 4PJ5E 1EGJL 5F96H 4P23D 5JNYA 3UYRH 4C56A 3P9MA 2Z92B 3GM0A 3U7AA 1AQDA 4WWKD 3DMMC 5FIEA 3CCHB 1DBBL 3OPZH 1T89C 4NBXB 3PABA 1M1SA 4XPFL 2J6EL 1KPVB 5C2BH 5D96B 3KS0H 5EN2A 3QEQE 5DD5L 5MEQB 1OVZA 3IFLL 2M8XA 2VZVA 5GS2H 4CVWA 2VDPH 2UV3A 3JV6A 4BUGA 2J4WL 4OKVB 5IQ7L 4MSWA 1A8JH 5FUCE 5DJ6B 3EO0A 4HG4J 3HPJA 3QUMB 4YO0A 3TGXA 1FH5H 2RCSH 3O9WD 1SBSL 3S37X 2F53E 3G08A 3MLUH 4FQXB 1Q1JH 1YYLL 3BP7A 2J8UF 3OB8A 4GAJL 1KTDA 2FJHA 1K3IA 5DJ0B 2BHZA 2Q86B 1MIMH 3FCTB 3P11H 2BVQB 2C4XA 4JFPB 1WFUA 2VQUA 4MS8D 3MZGB 4U1MA 2VAAA 1B88A 3OKLB 4H8WL 5K9JL 1A5FH 4LSRL 1F3DH 2XA8H 3LQAC 5EZJA 1K9TA 3VGBA 1R5WB 5FO7A 4AEHH 4P2QE 5LCVH 3BPLC 4PJAB 3TZVC 1UH4A 4WNQB 4JRXD 1QRKA 3TC9A 1O7SA 4XMPL 2A2QT 2P8MB 4PY8J 1VA9A 1SYSB 1UM6H 4WY7L 3R8BB 2F19L 4L9DA 3WNLA 4OZHF 2XIDA 1FZOA 4YC2C 1D9KC 5B3NA 5IF0A 4OCNC 1RUML 3MRFA 4PJGF 5D72L 1XMWA 2DDQL 3BW9B 2JJVA 2XTJD 5ALBL 1PG7W 4JKPL 4A6YA 1B90A 5C9JB 2N4IA 4WCYH 2KQMA 3WFEH 4HHAA 3VFPA 3AREC 1YNKH 5F88B 3DX6B 2X1OA 2OTPA 4YDKL 4ZPVA 2XWJA 3RWCB 1DBKH 1JHTA 4O5LL 2EYSA 3VXTA 3HHRB 2AQ3A 2EEDA 4P23C 1GCFA 2YEZA 2A9ML 3JWOH 4LQ1A 2AK4B 2R2EB 5F93C 1UM4L 2R1YA 1T1YA 2BK8A 4WWKC 2OL3H 1BM3L 2A77H 4WHYH 4ODTH 3V4UL 1U6AH 1OB1B 4D9LL 4Y19A 2IWGA 4U7MA 4PJCB 5AG8A 3MOAH 4GRWF 5D7LB 2APVA 4F33B 4TNWF 3U6RB 1ND0B 1UZ6F 5GS1C 3AMKA 1B3JA 4TNWK 5JHDE 2V2WB 1Z9SA 2NW2A 1KJMA 1HH6B 4JHAH 5SX4H 4NCC2 1A6ZA 3O9WC 2EE3A 3PNWA 4XC1H 4NGHL 4Y4KB 5IJKA 5HHQA 2Y5EA 3VGHA 1GC1C 5E2TH 4NQDB 3TBWB 5HSFA 4NUJB 4GKZA 3LQZA 3G5YB 2CRZA 1HHHB 4AMKH 3DIFA 2P7TA 4MJIE 1S9XA 4XAKD 1FG2A 1A6AA 4NUGL 2HJKA 3LEYH 5SV4A 4J3SA 4MS8C 4WJ5A 5D2NC 1I9EA 4HPOH 3Q5YA 3RY4A 4Q9QL 1AC0A 4K23H 1KCRL 4JPVH 2R0ZL 4CBPA 3D2UD 3RZWA 4OFPA 4L5FL 2NW3A 5BRZE 1MHCB 2VDLL 3FT2B 5DSCA 3SJVA 3MRLB