5CCKL

Crystal structure of human anti-hiv-1 broadly neutralizing antibody 3bc315 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
210
structure length
210
Chain Sequence
b'ALTQPASVSASPGQSITISCSGTRSDVGGYDFVSWYQQHPGKVPKLIIYEVTKRPSGIPQRFSGSKSGNTASLTISGLQADDEADYYCCSYANYDKLILGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 3BC315 Fab heavy chain
publication title Antibodies to a conformational epitope on gp41 neutralize HIV-1 by destabilizing the Env spike.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cckL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cckL02
4UIMA 1NBVL 3DMMA 1UM5H 5KVGL 4KJQD 5I1LA 3T8XB 1MHPL 4MJIB 5JW4Q 1LO3H 1T6VN 4GW4B 2C4FU 1RZGA 2MQCA 3FO1A 1TPXB 5FGCB 4LCWD 4J4PC 4K7PH 4WY7L 5F9DC 1HEZB 5B8CB 1MJJB 4PJBE 4YAQA 1INQB 4EUPA 4R9HA 5D9SA 3KLHD 1EHNA 4OD2A 4HIHB 2MFNA 4OI7A 3WKMH 5DGRA 5E6IA 3VDCA 2PTVA 2R4SH 3ZE2E 5DYOA 4PLNC 1FORH 1J1OH 43CAA 3PNWB 4Y16C 5IM7A 4OZGA 1S7RA 1U42A 3O2WL 1RIVL 1NFDA 3FTGB 4R3SA 3DBXA 2ZOKB 1OARL 3STZB 4FXLA 4AEHL 5DJ2A 4KDTC 1E6OH 4X7EC 4NIKB 1MI5D 5EIIA 3FFCA 1GPOL 5B39G 4YQXL 5E24E 3ULUC 4HMDA 3UDWA 1QKZL 4BM7A 3L3JB 4I77H 5T1MB 4JDVA 4RSVA 2HYMA 3U6RB 4MJ2A 1J7VR 1JPGB 4O2EB 2V17H 1OSPL 4PJ7F 2CK0L 3BDYH 4P2YA 1BIIA 3FHAA 5HDBE 4H1LA 2P5EA 4MA1C 2ICWA 5BOZG 3K7UA 3P77B 5J13B 2NY2C 5J6GA 4U2YA 3V5DB 5IV2B 5HYJA 4AIZB 3B9KA 3CH1B 5HI3D 5JNYA 2Q1EA 3BEWB 5C0JA 3DX9A 4DZ8B 3L1OL 4RNRA 4PJGB 4ZS6C 5F8RC 2D03L 2YSSA 4KC3B 5F21B 4NC1C 1GZQA 3GRWH 4OT1L 3KPOA 4F7PA 3B5GA 5DTFA 3SDXA 1MHCA 1NGWA 4PP1D 3DUSA 3M17B 2R1WA 1EIBA 1OAXL 3LV3B 4OKDA 4YHIB 3QEHB 4YC2C 3MV7E 3SKNB 1XF3A 4IRSC 1P7KA 5TDPA 4OCXH 1NAML 1A3QA 4Z7UF 2BXZA 4ODXB 1U9KA 4HXBH 3UBXA 1I85C 4FTVB 3T0WA 1UB6A 5E1AA 4HD9A 4ZG1A 2V5RA 3BGFB 4Y4FA 3RWIA 2HFEB 4WW1A 2PTTA 2QKIA 5MEOB 3FRPA 4UTBL 5D72L 2Z91B 4Y2OA 3NFNA 4KAQL 3MOBH 3X3GH 5I1CL 5EA0L 2ADFH 5CHNB 1G7QB 4ZTPH 1LO5B 3KYAA 4LHUB 4P46A 2OP4H 3F5WA 2DQDH 3AC0A 2OJZH 4OQ1A 5E7FA 2AI0H 5EH1A 4KVCH 5DT1L 3MUGA 4JFXA 8FABA 2GEEA 2YUWA 2YPKA 1KN4H 1S7UA 3EJJX 1V3JA 2R1XB 3H9SD 3PG2A 5L2JB 2ADIB 4Z0XB 3TN0A 3DTXA 1CT8B 1GZPA 4PGDB 2G9HA 3UAJC 3JXAA 2OTUA 3NPSB 1QO3A 4MLIA 1A02N 3MO1B 4K7FB 5FGBC 3G5YB 4QKXB 4FQQB 3V6ZB 4XC3H 1K2DA 1M7IA 3H3BC 4HG4J 1NDMB 3TIEB 1X9QA 1D9KD 4RFNC 4G8IB 3BYTA 3FT3A 3H6JA 1AH1A 3HAEA 5EU3B 1NUDA 4C55A 1SY6A 4YXKL 3I6GB 3WFDL 1KTDB 5BV7C 4QYOB 3QRFM 3UTZA 3VXNB 3ULVD 1Q94B 2A6KB 4JFHD 4Y5VB 5KANI 2EO1A 1D6EB 4R96A 3BGMB 1XGPB 4AJ0A 5CEXA 4MAYC 3HMXL 5SWSB 2YWZA 1JVKA 4OFYA 5EUOA 3T1WA 1IEHA 5F89B 2X4RA 4WWKB 1I7RB 1YEHL 4WUKL 4L4VD 1AQKH 3NZ8A 3UEZA 4KK9C 3P11H 5I8CB 3WL9B 1PG7W 4XPBL 2FBJL 4Y88A 1JNHB 1FQ9C 3OB0H 1VEOA 4BK4A 3MLWH 4JO2H 2XT1B 1CLOL 5TE7L 3AU1B 1WEJH 2FX8H 3G6JB 2G60L 3IFPB 2R0KL 4DGIH 3MR9B 3UPCA 4K3DL 3CDFA 1FC2D 2VSDA 3ARTA 5ESVB 3D3VB 2DD8L 1PBYA 4PRHE 4XXDB 5TGBA 1WITA 4FZEL 4NQVA 2ORBH 5C7XH 1T7XA 3MUHL 4NO3A 5IFJB 4MDIA 3WJLC 2FX9H 2DLGA 2GJ6E 4HCRL 3TBYA 4Z7WB 4M7KL 3RGVD 3QUXA 5KVEH 3ARED 3KNBB 3SO3B 1W8NA 2W92A 4EOWH 2Z8RA 4X4YA 3MRRA 1UG9A 2FZ3A 1MI5A 3Q3GA 3ME0A 4WV1B 3AUVA 5C8JB 3DO3A 3UTQB 4PJHF 1U3JA 4FHBD 1YUHA 1SEQL 5KS9F 3VGDA 3OAUH 2XKNB 5MEQA 5JOPD 1HXYB 1NEZG 5BVJA 2FO1A 3EHBD 4YXLH 5D1QB 5D2LE 5DWUH 2EH8H 4WEUD 1BFOB 4HWBL 1OTTD 1G6RA 3ZKND 3J7HA 2C5DC 4ERSH 4H26B 1WBZB 1ITBB 1OQOA 4S1QH 3OKLA 2CKBA 1A6ZB 4UQ3B 5FUOL 5D1ZB 2WBJC 3FN3A 1JHTB 3L7FB 4OZIA 3GJFB 5DJYB 1JF1A 1ZEAH 4P23B 2V7HB 4YBQC 1HSBB 2DWEA 3GKWL 1RZIA 4LSQL 3KPNA 1INDL 5ELIA 4GRLA 1QOKA 2BJMH 2B20A 3KPQA 3RWHA 4F7EB 1FVDB 1BWWA 1IM3A 4HGWB 2HH0L 1YEKL 4ZUWB 5F3BA 1LO4H 2FWOB 4O58H 2E5EA 2BRRH 5ITBH 3VI3E 3BRFA 4LBEA 2BNRB 2LFGA 5GZND 3JV5A 2HJLB 4ZFOL 4GKZA 4XCNB 3H7BB 3L7EA 1OQXA 5IVOA 2P24A 1MUJB 1FNGA 1C8PA 3E8UH 1TITA 3BAEL 2NTFA 1T6WA 4XGZB 1P53A 4LNRB 4G3YH 4M61B 2YD4A 3CLFH 1HKLH 3NAAL 2V5SA 3WO3B 1PDKA 3KYMA 3D1MC 1QSEA 1Q38A 4OCWH 1FZMB 4RGND 5FCSH 3U7YL 5J1AB 1HDMA 3DO7A 5F1OB 3SN6N 1PVHA 1T20B 1ZT1A 5TJWK 3RI5K 1N6QL 4P2OA 1IARB 3MLXL 2X1QA 4MZ3A 1UJ3B 2DLIA 4G5ZL 4OCYL 1F6LL 1HNGA 2X4OA 4IHOA 1QG3A 3QEUA 4AMKL 1KN2H 2DQHL 5CGMA 3SPVB 1L9MA 1IAOA 3H9HB 2KUTA 4LVEA 4NUJA 4PJ8D 1P2CA 5DEFA 1L0QA 4YFEA 3LIZH 5GS0L 5JR1L 2YPLB 4UAOC 3P4NB 1IGCH 2D3VA 4IM8A 1UCTA 3GSXA 3GSUA 3WHE1 1YEJH 4NNYB 5JW3L 1WWCA 1E27A 4XHJD 4DVRL 3ILQC 2KZ1B 4PPTA 3MLUL 1RIUH 3JBG7 5IB4B 3I75A 1MFEH 5DQ9A 4KRPD 2EYRB 4JFFA 4Y2DC 2DQTL 3LKOA 4XVSH 3QJFA 1BQHA 1YC7A 5HVHB 2C1PA 3U0PB 4HLJA 1PQZA 4ODWA 1KIRA 4HFUL 1FNSL 3KPRE 1QSFD 4UQ2A 3O4LA 4HS8L 4PREA 2E3VA 2R1YB 1ZTXL 1DUZB 1FCCA 4M6OL 3L3DB 3F58L 1AD0B 1J5OH 1X6NA 2FO4B 4UTAH 4WIQA 1HH9A 1F3DJ 3SQOH 1JIBA 4U1KB 1N5AA 4OLXH 3QDJB 5EG6C 1REIA 3BQUC 4LSPL 3LMJL 5DD3H 4HW6A 1CBVH 4UIKL 5JLZA 3P4MB 1L9NA 2R2BB 4ISVA 4RDQG 4CJ0A 1HHKB 2DIBA 3SDXF 4N5UA 1PEWA 3JUZA 4ZOAA 2F53D 5IW1A 3T2OA 5MENE 3FO9A 5MHSD 1IAMA 3VD3A 5DJ6B 5DJXB 3JV4B 5DJDA 2PO6C 2EE6A 2BNQB 4MQSB 2OMBA 4L9LC 5EIVA 1QRNB 2WW8A 5KSAD 4CL7A 4XNYH 3GRWA 2FDBP 2CDFA 1MCNA 1DQLL 2VERN 5FA4B 1WBYB 2DMKA 4WFGD 1ADQL 4B7LA 2E27L 4QRTB 3PQYD 4MD0B 3MGOB 3AREA 1WIUA 1T0MB 1L7IH 3GSVA 4P5KB 3IDXL 3LEYL 2G5BB 1CTNA 4ZOBA 3V5KA 4JFDE 4KK5D 1QEWA 1V7NH 3SHSA 2LV4A 4UT9L 1DL7H 1YQ2A 2Y5TA 2Z31B 4JFYB 2MQ0A 3PE9A 4XWGH 5HD8D 1MJ8L 3RVXD 3GUTB 4Q0XL 4PJFB 5C0RH 2JIXB 5T3XL 2HFGH 3QWQB 1L0XA 4QCIA 4YR6B 4DN4L 5ACZA 4Z9KB 3TVMD 3LEVL 5JXEC 3NTCL 4MJ5B 3VMOA 3U48A 2C7UB 1IKFH 4LRIA 3MJ8A 4LSVH 4MWFA 3VG9C 3L5WA 3EFDL 1RJZB 2VXSH 2OSLB 3MJ7B 3EO1B 3VXUD 2G2RA 3HZYA 1A7QH 4FA8A 3KYOA 4LKXA 2FJHA 3LAFA 5C0AB 3VW3L 4F7MA 4R97B 1I9EA 3HZKB 1YEIH 3HC0B 2JB6A 2IPTL 3C5ZB 3G6DL 1VDGA 3WE6A 3SDAB 5I8EB 1MJUL 1SM3H 2NY3D 3ARGC 1S9WB 1ZVHA 1AGDB 1F6AB 5CJ8A 4EDXB 4I18B 1MLBB 3QHTC 2DJ4A 3F8UB 4AK1A 1WWWX 3AROA 1KEGL 4YNYB 3B9DA 4PTTB 4Z78A 7FABL 5INCB 5T5FH 4XNXH 1FAIH 3JTTB 3DV4B 1YDPB 4KU1A 3M1BB 5ALBL 5I74C 4LGRB 4LLMA 1MFAL 3RL1A 4XXCC 2I9TA 5E08H 5C09E 4FABH 3BIKA 1T89A 1S7VA 5JORB 3ARDB 3L5XL 1I75A 3QUZC 4TUJA 2CLRB 1XGRA 1VGEH 2E9JA 4BZ1H 4M48H 5H35A 2DI8A 1OM3L 4CW1B 5DUML 4UV7L 4J3UA 1X4ZA 1YEDB 3QNXA 4NQXB 4OLUL 4XC1H 4L3CB 3HE6D 3TT1H 2YBRB 5DURB 3BZEB 1DANU 2CIKB 3ECBB 2AEPH 2BHYA 1F00I 1I8KA 3ZYJA 2VZSA 3RHWK 3VXTA 4LL9A 2X9YA 1SHMA 2EZ0C 5IJKA 1BF8A 4OLWL 4PJ5D 2OX5A 1W0WA 1MRDL 1NCBH 3FQXB 4XNMA 1CF8L 4FZ8L 4LKCB 2CUHA 4M02A 5JA9A 1NJ9B 4WGVB 3V0WH 5A2JH 1ZS8A 1PZUB 1ZHNA 4X83A 5I1JH 4PJ8A 1UZ8A 4DKFH 4Y16D 1IM9B 4ZAKC 5C1MB 1A4JB 2Y25A 5KTEH 4U1HB 5MERA 4AENB 4PJXB 3OKKA 1FVEA 2X2YA 4PR5A 3OXRA 1IE5A 1GGIL 4QRRA 4JFZH 4R26H 1RV6X 3JWOH 5TDOA 1LP9A 3W5NA 1ORQA 4FRWA 4NRYB 1I7TB 2X9WA 3GBMH 3QXDA 3ULUD 2O5ZL 3RX8A 3OKDA 3TA3B 4K2UH 1BHGA 5B8CC 5FKAB 3NABL 5CP7A 4C56A 4UU9A 1WZMA 1KIUA 3BW9A 4JJHA 3PWJA 1EGJH 4HJ0C 5DMKB 2WWMC 5IMKA 3QWRD 4I5BA 1U58B 3MROA 1CGTA 4NZTH 4P4KD 4JQXA 4PY8J 1QSFA 2NY2D 1TJHL 1VB9A 3IXAA 4XPGL 5EU4B 2C3VA 1SBBA 4HBCH 1MQ8A 5I30L 3AMKA 4ZODA 4JDZA 3VXMA 4H25B 5I2IA 2EDFA 5IMMA 4Q74A 4OZIF 3IJSA 4M7JH 4A6YL 2NY7L 3GB7B 2XZAH 4ZS6D 1Z9OA 4I2XE 1UC6A 3KLSA 3QXWA 4L4TD 3C6LB 2IALB 4UT6H 4G8GB 3Q6GL 3IFLL 5CILH 4J3WA 4NM4H 4X5XB 4QRSB 1MCJA 4J1UA 4RAVB 3T3MF 3GBNL 2BFVH 2F53A 4GLRH 5IR1A 3KVQA 4WI7A 2R0WL 5F7EL 2EECA 4OV5A 2Q7YA 2CXGA 5KSAA 3O3BB 3G5VB 5I71B 5F44A 4MAUH 3KYNB 1SYVA 3DXAB 3U0WH 1UCBH 3S36H 4JPWL 2YR3A 2X1XR 3TGXA 1MEXH 2WIIB 3PXHA 1UQSB 4XX1E 4E41D 5I16B 3I3BA 2NY6B 1HZHL 4ZUTA 5IIEA 4X6DE 5EOCL 2D7TH 3C8KB 1HHIB 2D4DA 2Q87A 1C12A 2XZZA 4Z7VE 5IG7B 5IVXA 3S34H 1RHFA 3ULVL 2AJXH 5BVPH 4JO4L 3TT3H 1FFPA 4N1EA 1NC2B 1ZE3C 2YC1B 2AK4A 3RNKB 4DKEH 1I7ZB 1RJLA 2C1OB 1R3HB 4HEME 1J0IA 3GMNB 4XRCB 5IBTH 4L3EE 1OT1A 3TVMA 3V4PL 4XCYB 5JPNB 1ONQB 1TZIB 2UZYB 1R3LA 5DD5L 1OAKH 2AJZA 3N0PB 4ZTOH 3P2TA 1A1MB 2BSED 1J10A 3QDME 3QNYB 3MGTB 3FAXA 1NFKA 1FG9C 1LQSR 3O6FB 4AM0A 2M8XA 5EZIH 2CUMA 1EO8H 3MNVB 4JEGB 4S2SB 2W60A 5DFTA 4WEMB 5HVGB 5DVLA 2NXYB 5J8OA 4YZFE 1AFVL 3AS0A 1PSKL 1BF2A 3ULVF 4TRPH 2P1YA 4NRXB 4LEXL 4PJBA 3T77A 5IMOB 3EGSA 4XZUB 4MAYD 4LP4A 4NZJA 3NPSC 2UVEA 2X7LA 5EBGA 2GJ6D 4N0YL 1EFXB 2APTA 1N8ZB 1HI6A 4F9LA 3LKQB 2Q86A 2EIBA 3QXUA 1VEPA 4Q2ZB 1DQJB 5CSZB 1OB1A 4KK9D 1RMFH 4FTVE 4TSAL 3GSNB 2FATH 2Q8BL 2ZUUA 1YNTB 2UZXB 5E2UH 2VMFA 1EJOH 2QV2A 3D85B 3BZDA 2NY1B 2HRPL 2AERT 4U3XA 3EYQD 5DEGA 2A74B 4K8RL 5FUZH 1VKXB 1XR8B 3FQUB 3WFBH 1N6VA 1D5IH 5JHLH 2Y7QB 1U8JA 3HE6A 1XGYL 3QQ9C 3QFJD 1MCPH 3MQIA 1URLA 5HDOA 3WHXB 2FEDD 5ICXB 3K8MA 4O9HL 5DZOA 4UB0L 4OCMC 4WWKC 2EDOA 1OY3B 3P4OA 5E70A 1T1XA 5TDNA 4JZOB 2F74B 1LK3H 1BQLH 4MS8C 5AYUL 1XH3A 4JRXD 3OMZA 2CLZB 2W91A 4ZXBC 1GVIA 4AL8H 1IC5H 3RWFA 1U8NB 4YHPB 3DVGB 1AGCB 2J12B 1Q0YL 2XQYK 4PJCF 1BJ1H 1FO0B 2ED8A 5IEKB 3MRLB 1MCWW 3PUCA 4APQB 4PRPB 2HRLA 5I19L 4XMKH 1YYLH 1M71A 4J23A 3W11C 1IC4H 2WUCL 3HZVB 2Y06L 2FGWL 3VRIB 5CBEA 2CJUH 4MMZC 5D7LB 5T1LA 3MLTA 3MV7A 5DJAB 3EJYC 3VMPA 1R5WB 3EW3B 3CGTA 3NIGF 3QHZL 4GKSB 2CIIB 5D70H 1T66D 2ITCB 2P5WB 4JY6A 3GSWB 3VXSB 3QWRA 3U7WH 4NN6B 3Q48A 4P4KA 3BKMH 5IQ7H 2GJZB 1HNFA 1T7VA 1TJGL 4NN7B 4PRID 1FGVL 1U92B 2ADGB 4OF7A 4RGMC 3DSNA 3V6FA 1RZKL 3OX8A 2DIJA 3PWUA 2IFFH 4QRUB 2J8UA 2FECI 2WBJD 3HCVB 1R3JA 4O02L 3MV9D 3MA7B 4HJGB 1OVZA 4MHHG 3LN5A 3VXQA 4WV1C 3F7QA 5HBBA 4BZ2H 4ETQA 1ZT4A 3LKSA 3V8OA 4RMTA 4OZHF 2FSEB 4NQDB 2DYPD 2VXQH 3QUMH 2H32H 4JPVL 3D3VE 1P84K 5D1QC 5HDQL 5C07B 1K4CA 4R0LA 1Y6NR 3TBVB 3IS0X 5F7LB 2ZPKL 4RMQA 1SJEB 5E9DD 5C0EA 1BD2D 3UYRH 4JVUA 4JKPH 3RDTA 1A14H 3U82B 5AWNH 2VLJB 3MBXL 2AXFA 3TZVB 3LPGA 4G6JH 4W4NA 5I1DA 4FQXA 4XMLH 5CJBA 5TQ0L 2VISA 4P23C 5B3JE 1SJXA 4F3FA 1RK1A 1XGQA 2AK1L 3I6KB 4JG1L 1R5VB 2P48B 3PWPB 4HUVB 4JZJA 2P8MB 3CLEH 1JHKL 5GHWH 2CRMA 5IB5A 4LU5H 3HZMA 1BEYL 4YDJB 2I26N 2BSTB 4MXQC 4ODHH 1SMAA 3X13B 1II4E 3LPFA 4JR9H 1KB9J 5DD1L 4ZUUA 2GQHA 1SJVA 4MNQD 1LO0H 4K9EL 4K3EL 4PRAB 2FH8A 1VFOA 4R2GB 1FNEA 3T2QA 1G9NC 2H3NB 3VXPA 4LARH 5BRZD 3UX9B 1P9MA 2CLVB 4XB8A 1A9EA 3W39B 1K8DB 1UWEL 3WNLA 5HYFA 1U93A 1UA6L 2OCFD 2GTZA 3MYZA 4I3GA 4WWID 2LU7A 5E2VH 3TO2B 3ILQD 5F7FA 4PRHA 1C5BH 1E4WL 2A1WL 3W82A 1XF2B 1IEBA 4MVBC 4UV4L 1UJ3C 3MRHA 4Y2DD 2VLRD 3KPLA 3TCLB 5HYEA 1YECH 3WUZA 1FFNB 1N26A 2N4IA 2IAMD 3U4AA 2VDOH 1I1FB 3JWNC 1MNUH 2F5AL 2BNRE 3C2AL 1KELL 2N7BA 3O8XB 1NGYB 1UJTA 4XVUC 4RWYH 2PYFB 4W6XB 4LCUA 3EOAB 1ZGLA 5BQ7A 3VFNA 4M6AA 5DJ8A 2E8YA 4ONHB 4NBYB 3FB8A 4PGCB 1OGTB 3VFUB 1YPZE 1O7SA 3D2UD 3VE0B 1J18A 1FPTL 3VWKD 1EGJA 4JFDD 4P5TA 4HLZH 1FL5A 2V7NA 3LD8B 4G6FD 1MJ7H 2NZ9C 2OR9L 2HLFC 4IMLB 4YE4L 4M62L 4LIQL 3CC5B 1S5IH 3CZFA 4KK8C 5HVHC 1KNOA 5D2LA 3R8QA 1VESA 5JOEA 3BMVA 3MNWA 3NH7L 5B4MD 4I13B 2PO6D 5EZOL 4QHUA 2NY5H 4LVNB 4QTIL 1CZ8H 3QIWB 5HHOB 2G75B 3BPCA 4NQCB 2DQEL 3L3IA 3MGAA 1G0YR 5T3ZE 3MRJB 2OI9B 4PGEB 4GUPA 4N8CH 3EYVB 4LPXA 1RUKL 3D18B 1PX3A 3OR7B 2A83B 5A43C 3UPRA 1JL8A 3PV6A 4KY1L 4RCAA 1ZANH 4OFVA 4PV9A 3T1FB 1DQDH 5LAXB 3STLB 3LKPB 5JDSA 1ZHKA 3BPLC 2IEPA 2JCCB 3VFWB 3U9PH 1G7IA 2RCSL 2X70A 3VFMB 1WAAF 3G04B 4QWWC 3QIUB 5IVXF 2IQAA 3FCTB 5AZEL 5TE6L 1I3VA 4Q7DA 2Y36L 1N2RB 1WC7A 3HI1A 4N8PA 2R0ZL 4R90H 4NKDB 5C09D 1T3FB 1U8OB 5INDA 5EN2A 3QNZA 3EO9H 2NX5B 4I48A 2Y23A 2B7DT 3BEVB 3HNTH 4NZUL 5DHYB 4DCQA 2PF6A 1Q9KA 5L6YH 3NA9L 2XWBA 1RZJC 3IJHB 1JCKA 4TOYH 3OGOE 2X89A 1K3ZA 2FCBA 4GS7C 4LRNH 4JB9H 1SBSH 4HXAH 4RA0C 3KS0J 3LVEA 4WI5A 2Z31C 3QUYB 2BCKB 2O26U 5CJQL 3ELAT 4WI3A 3FQTA 1FVCB 3SE8L 1G7PB 3BP7A 3DGGA 3ARGD 3A6CH 4NCC2 2HKHL 1JN6B 3P73A 4NNPL 4U0RB 4WFFE 4FNLH 4YHYB 1PG7L 4GAGH 2GFBA 4IBLT 5TE4L 3QT2A 5HY9A 1H9VA 3MRNB 2W38A 2BNQE 2XA8H 3RX5A 4NKIL 4PB0H 4YX2H 1E28B 2YKLH 1B4JL 1NCWH 3E3QC 4P3CL 1E0OB 4LHUG 2ZG1A 1WZ1L 5EBLB 3RL2A 2A6DB 2EICA 3CFJB 5SV3A 3THML 3QUZD 4XPHH 3CDGB 4R97C 2Q8AH 1YMME 3OGCB 2A6JB 3I02B 2W9DL 4TNVK 4JM2D 1JZ7A 2IH1B 2R23B 3LN4B 3SDAC 1VFAA 3EIFA 4P99A 1G84A 1TIUA 2H8PB 3ARBA 3HR5A 3UTTA 1QHPA 5CMAA 3MLYH 3ULUL 5HDBF 2EZ0D 3KPRA 3HPJA 1VACA 3RRQA 2P43B 3V7MA 4OQTL 4JFOB 3TH3T 5GGUB 2DOCA 3HTLX 4OCRL 4OTXL 2R69H 4DTGL 1K8IB 2XN9E 3ARDC 2SEBB 5D5ME 1ZHLB 4GMSL 3VI4F 1I7UB 3O6MH 2VQ1A 4WFHD 1GAFH 4ZAKD 4EN3B 3W9EA 1ZV5A 1WCBA 4AIOA 5GJSL 3N1GC 3P0VL 3WIFB 1FJ1A 1UENA 2F8VA 2BSRA 2W07A 4MJID 3ZTJG 3P9MA 2YA1A 1IC7H 3IF1A 2ZSWA 2XQBH 5GRUL 5MENA 4KQ3L 4DQOH 3VWJB 4LGSB 1TCRA 3U4EA 2ZNXA 5F7DB 4M93C 4LSSH 4YDVB 4YGVB 4NGHL 2IAMA 4RDQF 4Z76B 3P9LB 4HJ0D 4PP2A 4PJIB 2WWMD 4NZRL 3NCCB 5E7BA 4LLUB 1MFBL 2RB8A 5LGHH 3S96A 5FHAL 3QPQC 4OLZH 3GM8A 4D94A 2DBLH 3LKRB 4L5FL 4U31A 3HR6A 3GMLA 1DDHA 3V52H 2V9RA 2ICEB 3TNNB 3HE7C 3VWKA 4JFDA 1PZ5A 1N6UA 5LWYH 2HFTA 1T1WA 5ISZB 1JGEB 4WU7A 3TA3C 3JWOC 3GO1H 4CADA 5F8QC 1GJIA 4UT7H 5EC1A 3CDYA 4ZPVB 3CAFA 1M4KA 12E8H 4P9ML 1CL7H 1D7FA 3DURA 3STBA 1I8MB 3IDIA 2HJFA 4B53A 4ZFOB 1ES0B 1OTSC 4ZS7L 2O61A 4F57H 3O6LL 4JLRA 4I9WE 1NMBH 1C08A 4OF3A 4PRNA 1MFNA 2XZCH 1CFQA 1CGWA 4I3SH 5GRYA 3ZKQD 3QUMA 2OTPA 2H32A 5DQJB 1S9YA 4ZSOE 4BH8A 2QHRH 4HUKB 5SV4A 5DD0H 3DYPA 4HUUB 5AUMA 3V79C 1AJ7H 1LK2B 4DEPB 5IESH 1V3LA 1RPQA 3ZYIA 4S1RH 4DW2L 1XR9A 4WTXA 5JOFB 1KJ2L 5BV7L 3BJ91 1H3PH 4FG6D 4L4JA 3T0AA 1VADB 3QRGH 3LKNB 1T4KA 1T0NB 2ZSVB 1JWSB 5J1SC 4FTVD 1DN0B 1JGVL 1WWBX 2DB8A 1FDLH 4KZDH 5I71C 3SGKC 3O9WA 5K9QG 5FCUL 3VGFA 5C09A 3UJTL 1OAZL 4XH2B 2DWDA 3GGWA 4OGXL 1EERB 4AG4L 2WLZA 4NWTL 3LQAH 5IGXH 4O51B 1KLUA 4LHUD 5IB1B 1CICB 1RVFL 5KG9A 1KIQA 2UVFA 1KPRB 4WCYH 1NCCL 4DGVH 1UXSA 1NMAL 3QA3A 2CO6B 5FO9A 2J2ZA 4IRZH 4G8GE 2C3WA 3ALWA 4P49A 5DRNA 1AXSA 1JV5B 1KTLA 1RHHB 2MJWA 4O4YL 4X0KA 3F65A 5FXCH 3S88H 1IQDB 1DE4A 3W9DA 43C9A 2AV1B 5CLTA 1S9KC 1FN4A 1GGUA 4PLKC 3NFPA 5F3HA 1MLCB 3MODL 2WSKA 5JHDB 5BO1L 4HULB 3VGHA 4OFPA 5C0DA 3DIFA 3TPKA 3SCMB 1MWAH 4H8WC 1JZ6A 1FGNL 1QFWL 3VRLE 1DBKL 1RUPL 3AM8A 1OGAE 3DXAE 3FHQA 2FJFB 4H20H 1QUNA 1MQKL 1K9TA 2P8PB 4M7ZB 3HS0B 4G9FB 3GDBA 4M00A 5IVZB 2NXYC 3LRSB 1FBIH 1IGMH 2YD6A 4HK0A 4JM2A 1H0DA 3A67L 1NC4A 5TH2A 3QQ9D 5IFHH 3NCYS 4PG2C 1YYMH 4F58H 1G9MH 2OMNA 4HH8A 2B5IC 5SWSD 2XRAH 5ILTH 2BHUA 1L6XA 3MYJA 1CK0L 3DPBA 1H5BB 3C8DA 4ENEC 3SGEH 5E2TH 4WWKD 3OKEB 3OKYA 3C5JA 4EZMA 5KBNC 3X11A 4XBPB 2JK5A 5FM5O 3Q2CA 4EQ2A 2BVQB 3DVFA 3TBWA 3NCBB 1Y0LB 4QY8A 1G6VK 4J3OC 2UZIL 4Z95L 5IHZA 1GHFH 4I2XA 1OPGH 3MXVL 1JGUL 1BM3H 5CKGA 5C0GA 2HT4D 4DVBA 3S35H 4YEEA 3B9EA 5EU6E 4QHLB 5GRVK 1N3NA 4L1DA 3GIVA 4RBPH 1UM4H 2EEDA 5CIPB 3T0BA 4GW4A 3W11D 1LO2L 1IAIL 3TV3L 3NBNA 5K9OB 3BKCL 3EYOB 1QFWI 1BVZA 3D3VD 3KXFB 3EJYD 3OPZL 2ZUWA 3F7VB 1QLRA 4X6BA 4GKNB 3V9FA 3X14A 2CRZA 4HK3N 3RGHA 3RIFF 1RURL 3RA7H 1F2XK 1P4LB 5FYKE 1DBBH 1TENA 4D9RE 4F7CA 4EIGB 1ZA6A 1X5XA 3VXOB 4J8RA 2X42A 5GGQH 5C0IB 3QCVL 2AQ3A 2F5BL 2ZOKA 3O45A 3L3HA 3STZA 4APQC 5IOPB 1DBMH 3BE1H 5D7KE 1U8HA 4X6DA 4F9PC 4C54A 3QUKA 1FRGL 4JFEB 1RZ7L 4NO2B 4R8WH 5ICYB 2VOTA 3S7GA 4XP4H 2H9GB 3CSYB 1TVBB 1ETZB 5F6IB 4U1SA 4FFZH 3VCLB 4M5YL 4Z7VA 4TUKH 6FABH 5T1MA 5EDXA 1F4YL 3I3DA 1SMOA 3E6FA 1I3GL 3LDBB 4OCNC 4F33B 3N9GH 2O5YL 1T83C 4U7SA 5KSUA 4L3EA 1A1OB 4IRJA 4DFIA 4NN6C 5D1QD 1TTGA 4IOIA 2QBWA 2VNCA 4NN7C 5E95B 2MHAA 4DUVA 5IV2A 5L0QB 4AIZA 1LDPH 1JGLL 3QDMA 4N90E 4HT1H 1X4XA 2AV7A 3BEWA 5D1ZD 4QLRA 4QHNB 5I1HL 3VFVB 4PG9B 5BXFB 3WXWH 4P23D 1JYNA 4UILH 1BZQK 3VFOB 2EH7L 5IP4A 4M8VA 4HX1B 3RWCA 4NRZB 4TPRL 1F3DH 4YXHH 5GGVL 4YPGA 1JYVA 1SYSA 4KTEL 1SVZA 3M17A 4YEFA 5D7LE 3JTSB 5D2NB 1BPVA 4ODVL 2BNRD 3BT2H 4YHKH 5FECB 1A7PL 2P5WE 2XPGB 4FTVA 4LFHG 3ESVF 3TZVC 4RX4D 1MHEA 2LTQB 5JIIA 5HYQA 3SKMB 4MA8L 1MCOH 2E9WA 1DSFL 1ZLVK 2Z91A 3VD4A 1MFCH 5DI8A 2FL5B 4MDJB 4PJDE 4QOKE 1KXTB 5CHNA 1G7QA 3TO4A 1RU9H 3EYUH 3UC0L 1YEEL 3OB0K 5KSBB 4P3DB 4XBEH 4JM4L 4IMKA 1DJSA 4Q6IA 2W9EL 2A73A 2K9UA 1KCVH 4HIIB 4LLAA 2ATKA 4GG6F 3V6OE 1XZ0A 2ICES 3UYPA 4MVBD 1XF4A 3AAZA 2ADIA 3KPMA 4Z0XA 4HS6B 2IADA 5CCKH 4PGDA 3C5SB 4R2GC 3MO1A 4K7FA 5BS0E 5CBAB 4LLDB 3RPIB 3V6ZA 5T3ZD 1J1XL 2EC9T 2QQLH 3AVEA 3WSQH 4XVUD 3TIEA 2IPUG 3WS6C 4MNGB 1UACH 1G9EA 2YPLD 4G8IA 1NBZB 4KMQA 5LXGL 1AY1H 2YZ1A 1MCHA 4UOW1 2DIAA 1P1ZA 3LQZA 5D1XA 1GGCH 3I6GA 2VZTA 1MCQA 3QISA 5F6HI 2DM4A 2F15A 2NW2B 4A6YB 2F54E 4WENB 5D7IB 1WUNT 3BD5A 2A6KA 2NZ9D 4Y5VA 1I9RL 1UKTA 2HLFD 3B2VH 1D6EA 2VDNL 4N8VG 4PJ9B 4BK5A 3FO2A 5DHVB 1G7LB 4A2LA 5IB2A 4KK8D 5A2IH 1R3IL 3L95A 5F89A 2HLAA 1CDUA 1PAMA 1EV2E 1X5YA 1I1AB 1IGIH 3C60B 5GRXG 4PJ7E 1XIWA 3MRMA 4DZBB 5I8CA 4MQTB 5CGYD 2IH3B 4MCYA 5I15H 4K55A 2AEQL 2X5PA 1HQ4A 5HGHA 4YWGL 1QR1A 5F7NC 3C6SA 5CD3A 1CVRA 3GJFK 1W72B 3QZWB 1U3HB 3RTQA 3QDJD 4H5SB 2EDNA 1IZJA 3PGFH 2AJVL 3KHQA 1G7HA 3SDCD 2DM7A 3V95A 4KJYA 1U8IB 4X99A 3FB5B 3D3VA 3CCHA 1OF2A 5LGKA 5HHME 1ACYH 4WFFD 4XXDA 3OBAA 3FQNA 3BSZL 3U1SH 1R24B 1R3KB 2EEAA 2HJKB 4QWWD 4QRPB 3HRZB 5F7KC 1NCAL 5C2UB 5HGAB 4G7VL 2BNQD 4YHOH 3K46A 1QRND 1M7DA 1IGJB 3QIWC 3WJJA 3VA6A 3IKKA 2CKBL 4MHHI 1CDCA 4MJ6A 1X5JA 3DYOA 4B5EA 2OI9C 1YN7B 2NY5C 2JF1A 1EUTA 4KZEH 3KNBA 2YD8A 1H3GA 4NP4L 2ZOLB 3M07A 3CK0H 5F1NB 2IANB 3OL2A 4KHXH 5F1SA 2GSGB 2VWEE 3TNMB 2Z35B 1B88A 4PGBB 5HTSA 2B4CC 2PXYC 3CVIH 3LH2L 1JRHH 3JWDH 2Z31D 2P7TA 3KJ6H 1U95B 2MOVA 2X1PA 1AGEB 3B9AA 2JIXD 3AGVA 2Q3AA 4YDKH 1BVLB 1F3JB 5DMJB 1RFDL 4S0TD 4H26A 2X4PB 2NY4B 4LFHD 2VDMH 3T65A 1A6ZA 4U33A 5D1ZA 4NQCE 3L7FA 2YPVL 1T2XA 4X9HA 1A4KB 3GSOA 2UUDH 1N4XH 3MJ6A 4HZAA 1S78D 2XXCB 5C0AD 1MSPA 1P7QA 5I6XC 4JRYB 4POZC 5F7HA 1T7WA 1FVDA 3QUYC 4GRWB 4HGWA 4IJ3B 3TYGL 3C5ZD 2B1HH 2XA3A 4NBXB 2FWOA 1DR9A 4JM2F 5K33A 3SDAD 1IAKB 4QO1A 2DQIL 5DJ0B 1VFUA 5GGVY 1GOGA 2OL3H 1MWAA 1XF5A 1VPOL 4U0RC 1S9VB 4JKMA 3ZE0E 4U7KA 2BNRA 3RUGB 4Y4KB 4XCNA 5HJ3B 1LO3L 3ALPA 3H7BA 3IAPA 3RWGB 5EO9B 2ARJB 4M9OA 4BFEA 2YUVA 2CMRH 4TQEH 5K59E 3U79A 1DQTA 4C83B 4K7PL 2RHEA 3UTSB 1YPZA 4XGZA 3I84A 1P4IL 3ARDD 4M61A 2YUZA 1ZLUK 4FQ2H 2DJSA 4X6CB 4S11A 2A6IB 3L3OB 4GSDL 5GJTL 1ED3A 4JPIA 1FORL 4HC1L 1DBAL 4TVPD 2AEWA 5F9OH 1BZ9B 2VXTH 1NCNA 2YMXH 1A6AB 5DRZB 4LAJH 4NYLA 5DURD 1HILB 4GRMB 1RUQH 1T20A 3GMMB 2R0LH 1JNJA 4G7YH 4J3TA 1MPAL 3OJ2C 4Q9RH 1E6OL 4WVRA 3T4AA 4OUUA 3U36A 2IG2H 1YY9C 2VQTA 1L6ZA 2YEZA 4I9WD 2Z8WC 1VHPA 4NT6B 2AVGA 2HN7B 2XACC 3SPVA 2R8SH 4I77L 2NY0B 1D5XA 3MV01 3BOVA 4NKOA 3GK8H 1QTYT 4U49A 1IM9D 1J8HE 1U8QA 3HFMH 3QPQD 5JDJA 3P4NA 2IQ9H 3QWOA 3OKOB 4MQ7A 5J12B 3UP1A 1FG2B 4EVNB 3T2NH 1I8IB 2CD0A 2AGJH 5FYKH 4FXKB 4N68A 5T1DH 1C5DB 1JZ2A 5D6DA 3WO4B 2F9BT 2VLLA 5J6HA 4JKKA 5IB4A 5DD6A 3RWJA 3TYFB 4RAUB 5GRVL 3VWJC 3TA3D 1I3RA 3CFEB 3MCKA 2PYEB 4PJHE 3FB6B 1S3KH 2HA1A 5KS9E 2Y1VA 2DKUA 1ZLSH 3GRWL 5KVFL 4EQ3A 1Z0MA 4LASH 5I0ZA 1NPUA 1G1YA 4HPYL 2E6PA 3IETA 1YQVL 2EO9A 3GJEA 3WN5A 1W2KT 1DUZA 1MCLA 4OCXL 4RFEB 2QR0B 3EKCA 3KJ4B 1PFCA 4HXBL 4BUGA 1DLFL 4J3XA 1YC8A 3PABB 1A7RH 4X7DC 3LS4L 5FKPA 2YXMA 5IBLC 3CXHK 4U1KA 5C08E 3H42L 4PLOB 2VLME 4LSTL 1JWUA 3C8HA 2VDQH 2NZIA 4EXPX 3SDCA 3C6LD 4G8GD 3P4MA 4Z6AT 2UWEB 5DS8B 2IMNA 2I5YH 3CFCL 1EMTH 1HHKA 1JHLL 4JHWH 2ADFL 3D0VB 3N1FC 3GMOB 2VUYA 1JK8A 3N85L 4MYWB 5DJ6A 2OP4L 2J6EL 4BH7A 2DQDL 1TQCB 1YJDC 3VRJB 2OJZL 2AI0L 3HMWH 2BNQA 4KVCL 2BY0A 2DTMH 5I17A 2R39A 5E4EB 3D39B 2LQRA 5BZDA 4PJIE 4ZPTA 5H2BB 3DXAD 3MRFB 3EO0A 1T1YB 4MD0A 3AXLB 1EAPA 1T0MA 4G6KH 1IKNA 1WTGT 2DL2A 1YMMA 2R9HC 4CVUA 2NY6D 1EXUA 4PLJC 4P5KA 1EH9A 4P2QB 5J06A 4DEPC 4XC3L 1UEMA 2HG5A 3ULSB 2J4WH 1F4XH 1F4HA 3CVHB 3MRCB 5AZ2H 1ZHBA 1EO7A 3QO0B 5CGTA 5ISZE 4JFYA 2WV3A 2JB5L 1F6FB 4AH2B 4BYHA 1JNNL 1ZWIB 1NC2D 5BMFL 1B0RB 2DQGL 1N59B 2JIXA 1BLNB 4MD5B 4YR6A 4CN6A 5DVKA 2E9IA 2QJDA 3L9RA 2XN9A 4FN0A 9CGTA 5D5MA 4PLKD 4LEOA 3BP5A 3DX7B 3D9AH 5E6YA 2C7UA 4YJZL 3O6FD 1QBBA 2OSLA 4QXWA 3EO1A 4LVHB 5ACMA 1CICC 1UB5A 4XBGA 5C0BE 1AQKL 2D7QA 1EVTC 3BH9B 3UJIL 1U8MA 5F96H 3WCYA 4KMTH 5IWLA 4BQ6A 3HHRB 2C26A 2NXYD 1Y18B 3C5ZA 5JUEH 3MLWL 4JO2L 4M1CC 4OGYH 1Q1JH 1F6AA 5E00A 2FX8L 2VL5B 3I2CL 2H26B 4I18A 1MLBA 1HIML 1IGTB 4ODSH 4DGIL 5C6WH 1EFXD 1U0QA 2WINA 1NBVH 4ENED 3N06B 4PTTA 3BX7C 3S37X 4X7CC 1MHPH 5LQBL 3ES6B 5FK9A 3HI6L 1AC0A 4YDLB 1ZT7B 2VSCA 3SCMC 4EIZC 4GT7A 3QEQB 1QFUL 3QG6A 1TVHB 4M7ZC 5C0FB 3MACL 3D85D 4K7PY 5C7XL 5IVNA 4I4WA 3B6SB 2NY1D 1A3LH 2FX9L 4KKNA 4CW1A 4JO3L 2V9QA 2XI9A 3HNVL 3HC3H 3S5LB 4NO5B 4U6VL 3ZL4L 1IGFL 2VH5H 5E5RB 5GIRA 5KJRH 4C59B 3O2WH 1RIVH 1EEYB 4FQLH 3KGRA 1H5BC 1R6VA 3EZJB 5D93B 4DGYH 1A6WL 1RUMH 1YEFH 3RZCA 5BJTB 4JJ5A 4GBXB 4N90D 1GPOH 4YQXH 1DLHB 1QKZH 3OAUL 2Z9TA 1AP2B 4X6EA 4HQQL 4Z7WF 5CZVL 2IFGA 4ZSOA 3IJYA 2RIKA 3H0TB 2VDKH 1CD1B 2CH8A 3CUPB 5TF0A 1IL1B 4TSCH 4R7DA 5B3JF 3ZDXE 2F58H 4YXLL 2YHGA 4APQD 4PRPD 5HI5C 5FIEA 3BISA 1CG9A 5IQ9B 2OYPA 4S1QL 5D7LD 1WFUA 2NYYD 2V2WA 2NXZB 4Z7UB 1I7TA 4KJWC 4IDJH 3N1QC 2YZ8A 5FKAA 3WDHA 1AQDA 2P5WD 1A6UH 4CMMB 5FA3B 3VXSD 3X3FL 1N0XH 4ONOA 3BIAX 3ROLB 4HAFA 5IMLB 4G6AC 4XP6H 1F11A 3TJEL 3B3IB 2EIEA 5GRWA 2BRRL 1U2CA 4LF3A 2JJTC 3SGJC 1OAXH 4Y1AB 5ITBL 3BWAB 5DJZA 1NAMH 5F71A 1CD8A 3ET9F 1G9NL 4LCYB 4L8CA 5IB3B 4LHQB 5F6IC 5J11B 3PWVB 1I1RA 3GMRB 4Y19E 3E8UL 4JN1H 4L29A 1YMHA 2MCPL 3C6LA 4WUUE 3LDBC 4G8GA 3BUYB 2X4UA 8CGTA 3K8LA 2EC9U 1JTTA 2VAAB 4G3YL 4NQDD 5I66B 1T2QL 3CLFL 3JUYA 1N5YL 4TUOA 5D7JA 4U2ZA 5EA0H 3MOAH 5IROC 1PKQB 5C07D 5C6TL 5K9QI 3V8CA 3PV7A 4HKZB 1H8OA 4OCWL 1TVDA 4WW2A 4UDTA 5EBWA 4G42B 5L0QC 1A2YB 5EU5A 1JFQH 3MMEB 3O3BA 4Y89A 5KSVA 3KPSB 1ORSB 4LK4A 5T3XE 3OF6D 2VLJD 3TZVD 1KXQE 4UUJA 3SJVB 2YUXA 1OGAA 3DXAA 4FQPA 4ONGL 3EDFA 4Q9QL 3ARFB 2OL3A 1UQSA 1AXTH 1BJ8A 4GAYA 1A64A 3WIIL 1WJ3A 3HA0A 5F1IB 3PWPD 4J6RH 1BECA 3C8KA 4RMWA 1HHIA 4D2NA 4MB5A 4GH7B 1IGCL 5IG7A 5D2NC 3OKMB 4X7TB 3EDDA 1AGBA 4MLSA 4Z77B 3ESUF 2XWTB 4OCSL 3S3PA 1NFIB 4MMXC 2DDQH 2YC1A 4YXKH 4HKJB 5GS2H 1DVFB 4KPHL 2FJGB 3B5TA 3ARVA 1G7JA 1MFEL 2VO5A 1J1PH 4W4OC 2XNAB 4R2GD 4YC2B 4YO0B 4LCWE 1ONQA 4HIJB 4IRSB 3RVUC 1Z5LB 5HVFB 2QTEA 4XVSL 2BOBB 4UZGA 1AHWB 4ZD3H 4NKMA 3PHOB 3MGTA 3LQMA 1WIPA 3MLRL 3O6FA 2C4FT 3HMXH 4I3RH 1QD0A 1L7TH 4GFTB 1UKSA 3ROOB 5EU6A 1YEHH 4D3CH 3MNVA 4X8JB 4S2SA 5ID0A 1ZA3B 1BP3B 3SY0B 1PYWB 2YD9A 1H3XA 1OAUH 1TZHA 4MCZB 2OR7A 3EBAA 3G5ZA 1K4DA 4HDIB 3HUJE 4MNHA 4WNQB 3KS0H 4ORGB 1J5OL 4GMTH 4UTAL 1CLOH 3DSFH 4L8SB 1AGFA 5ECJE 5TE7H 5HHPB 2WNGA 2G60H 5SWZB 2N1KA 1N8ZA 4EEEA 2ARJQ 1D6VL 2O5XH 5DD3L 5DJCB 1DQJA 1AIFA 1Y6MR 4K3DH 3O8XD 2WM0A 1I4FB 4ZO9A 4ESKA 4EI5A 1AD9B 2DD8H 1YNTA 4NQEB 1WZKA 4K94H 4P2RB 4FZEH 4I0PA 5LVEA 2A2QT 4N0FA 1IMHC 3IDJB 1JP5A 1VKXA 4AYFA 1G7MB 1QQDA 4X4ME 2HVJB 1FYTB 1JPSL 5KSBE 2Y7QA 4HCRH 5ENWA 4PJ9C 3Q5OA 3W2DH 5K9KA 3VMNA 1HOCB 1RJYB 2B39A 1RZJL 4G8EA 3WHXA 4XAKE 1R5IB 4DWHA 5JW4M 5BZWA 3N1PC 1X7QA 1CFTB 1I1AC 3C60C 3T3ME 2ED9A 1V7NL 3FKUS 2RFXA 4FQCL 4FQ1L 1NBYA 2BVOA 2EC8A 3QIWD 5HHOD 1SEQH 4NQCD 4YHPA 4AEIH 3QI9B 4PS4L 2ESVB 1U3HC 2APWA 4MNGE 3MRLA 3KPTA 4NPYB 1U8PA 3IFOA 4G80B 1H15A 1HQRA 1KCUH 2ZNWA 4OF8A 3WNOA 3E6HB 3EOBB 5HPMB 3HZVA 3QDGB 1S7WA 5BW7A 1KUMA 5D7LA 1NKRA 1O0VA 4OBRA 4N0UB 1H8NA 5MI0C 1IKFL 5D7IE 2ENSA 3T2PA 1OSZB 3PDOB 5FUOH 5AEAA 4GKSA 5HYSA 1A7QL 5D8JH 2AJ3B 3QIUD 4LVOB 5JZ7C 2ITCA 5T33L 2P5WA 4Y7MA 5A2KH 2NPLX 2H2PD 3GKWH 5DDHB 5MEPA 1DCLA 3MRDB 5KN5A 1TNMA 1P4BH 4PJFF 2GJZA 3MV8B 3JVGA 1DQML 2HH0H 1WSST 5E94A 2ERJB 2C3XA 1YEKH 1K85A 1U92A 1P69B 3H9SE 1JJUA 2ADGA 4TTGA 2E7LC 1ZSDA 1QFWM 3NIFF 1PX4A 2X6MA 5SX5H 4PJDA 1HHHA 4QOKA 2NX5D 1KGCE 4UIMB 3O81A 3MA7A 4HJGA 5T5FL 1FAIL 1RZGB 3G9VA 2R56H 1OP3H 2CSPA 3FO1B 4POZD 4CVXA 1KXVC 1QBML 4TTDC 5FDWA 3QUYD 3WFCH 3KPPB 3V6OA 1IQWH 4FABL 4TVPL 1T22A 4U7MA 4CVZA 4YAQB 1VGEL 1KG0A 4M48L 5D9SB 4WEBL 3ULVE 3NAAH 3PWNA 4OD2B 2EKSA 3TBVA 5E6IB 2IPKA 4XC1L 5BS0A 5DYOB 3ZO0A 2DQCL 4QRPE 2NY4C 5IM7B 3U7YH 1OAYL 2VC2H 4OZGB 4Z18A 2GYSA 3TEUA 1WFTA 2RAMA 5IK3A 3OF6A 3VFTA 5FF6B 5ID1A 1NFDB 2V9TA 3RKDC 1NAKL 3BZ4A 1CFVH 5DJ2B 4L4VE 3TWCH 1PLGL 2FB4L 1EEQA 1VENA 1V8HA 2V5TA 2WWKT 2F54A 4OCYH 5EIIB 3I6KA 2IANE 1R5VA 4HUXA 4IJ3C 3DVNB 4AMKH 4M43L 5I1AA 2BERA 3ILPB 4LMQE 3V0WL 5I1JL 3T0VA 4DKFL 3T0EC 5L7XL 1EEZA 1UWXK 3QCTH 1BIIB 4H1LB 2P5EB 3BKYH 4Y4KC 2ICWB 1INEH 3VU2A 4R26L 1EHLH 5DRXA 4PJ7A 5T5NG 3JWOL 3DUHA 5J6GB 2AXHA 1YY9D 5JW3H 5HYJB 4DVRH 1KACB 3B9KB 4X98A 4GAFB 5JNYB 1QLFB 1T21A 2QADB 4KVNH 5FYJH 5C0JB 5KZCB 4K2UL 1X4YA 4NQSA 3DX9B 2DQTH 4RNRB 3GM0A 1EGJL 5F88A 5EPMA 4EN3D 1DFBL 1A7BA 2VLMD 3ZHDA 2JJSA 4E42A 4PJCE 1GZQB 4FXGA 4N0CD 1JTOA 3KPOB 2W65A 4F7PB 5DTFB 3SDXB 4IS6A 1MHCB 2VR4A 4HBCL 4Y5YC 4CN1A 2OS7A 1T5WA 1ZTXH 1XF2A 1HXMB 4M1DH 1XF3B 5TDPB 4G43A 2W9LA 3VWJD 3F58H 3TCLA 4IOFC 1U8KA 5EIQA 3UBXB 1N64H 2XZAL 5E1AB 2JJWA 3QSKB 3NIGE 1JE6A 5HPOA 4Y4FB 3RWIB 2NY0C 1KLGA 2DI7A 4MD4A 4WW1B 4LSPH 3RUGE 2HT3C 3LMJH 3O8XA 5JOPE 2QKIB 4UIKH 4X80H 4NM4L 4WFEE 1RZ8A 2BFVL 4JGJA 5J12C 1EUUA 3WUWA 1Q9WA 3UTSE 4WI8A 3VFUA 4D9LL 4P46B 1FYHB 4DKAA 3F5WB 3WO4C 3BN3B 3O4OB 4GW1A 1QNZL 2EE9A 1BX2A 4FMKA 1P5VA 3PL6A 5IBLD 2VB5A 3MUGB 5E8NA 4JFXB 1JF5A 4MAUL 5ISZD 2VDPH 4IMLA 5H37H 5J3HC 3U0WL 2WP3O 4UBDC 2YPKB 3S36L 5EFIB 2E27H 4O2CA 2GTWA 3DTXB 3TN0B 1E4KC 4NN5B 2G9HB 1KJVA 1NAMA 2CRIA 3O0RH 4OZHE 1A6VL 4AZ8A 2ZKHH 4M7LL 3MJGX 4ELMB 2EXYC 1A7NH 3LEYH 1K2DB 5JIKA 1XCQB 3QB7C 3NN8B 3L3KA 3S34L 4R6UA 2AJXL 4GXVL 2BVUA 4NQCA 4Y4HC 4UT9H 5GRJH 3OZ9L 3KJ4C 3FT3B 3HB3C 3MRJA 3HAEB 5L9DH 3PP3H 2BNUA 3FRUB 4DKEL 2B1AL 1UWGH 3D18A 4KV5E 2L0DA 3UTZB 4JAMA 5T3XH 4DN4H 4H8WL 4PLJD 5HHQA 2A0LC 3O3UN 4H88L 3T1FA 3LEVH 3EJZC 1FFOA 1YZZA 5LAXA 3STLA 1IZKA 4ZMAT 4ZTOL 3NTCH 1OL0A 5CEXB 5EUOB 1WFNA 3EFDH 3G04A 5DGQA 2X4RB 3QIUA 4TVSa 3BQUB 3VXRB 4RGNE 3NZ8B 2PYEE 2X4QB 3VW3H 3IVKA 4RZCB 1N2RA 5E4EC 5CUSL 4LSUH 4JDTL 1YN6B 3LRGA 1U8LB 3MSPA 2IPTH 3G6DH 15C8L 1U8OA 3QQ4B 2P45B 3T4YB 5L88L 5GS0D 3T3PE 2F8OA 4L9LB 5EZLA 2EIZB 3BEVA 1MREH 5DHYA 5EOQL 2GK2A 3SKJL 5B38A 4CNIB 5E8DH 4YH6A 1CICD 1KEGH 3DV6A 4NDMA 7FABH 4KUCD 1SJHB 4KROC 1R0AH 2ZCHH 1Z3GL 5E2UL 5TGBB 4NQVB 1EJOL 3MREA 4M1CD 1FVCA 3CMGA 4JANA 2Q6WB 3L5XH 1G7PA 4KKCC 2BC4B 3HMXA 2IC2A 5FUZL 3OHXA 4MDIB 1RUAH 3WFBL 1HKFA 5C2BH 5DUMH 2YRPA 3TBYB 1CXKA 2FLRT 2W0FA 4OLUH 3MRNA 2Q76B 5JHDD 3RIAK 1J8HA 3QUXB 4Z0BH 5F7MC 1LE5A 4X5WA 3EYFA 3D39E 3JV6B 4JCMA 3SCMD 4YHNA 5I0DA 4LVHC 4X4YB 2APXA 3MRRB 5EBLA 2XTJB 3DHJA 1LK3L 1BQLL 4OLWH 2A6DA 2FZ3B 1UM6H 3CDCA 4G9FD 4F37K 1FO0L 2VRAA 3I02A 1IC5L 4MZ2A 2EYTB 4FZ8H 4HG4K 1HE7A 2HKFH 4P2QE 3VG9B 2IH1A 2R23A 3LN4A 5M95B 1WT5A 3QHFH 5MEQB 4CAGA 4PJHA 3MRIA 1C7SA 2W59A 3ZKMC 3TPUA 5BVJB 1S5HB 2GT9A 5DVMA 5KS9A 1OD9A 1YYLL 3LB6C 5FYLL 3SE9H 4Z8FL 5ITFA 4QEGA 4JQVC 2CJUL 1ZLWH 1I8LC 5GGUA 4HCRA 3OKLB 2CKBB 3MXWH 1FL3A 2O5ZH 5D70L 4ZQKA 2SEBA 1ZHLA 3RZWA 1JF1B 5B21A 1CFSA 5GGRA 4WRLA 3IU3A 5C08A 3H8NA 4EN3A 4D0BB 1MY5A 1RZIB 3KPNB 4GRLB 4Y19D 4LPVA 3RWHB 3KPQB 2CRYA 3BKML 4WFGE 5I74B 1IM3B 1A5FL 2YD3A 5HI5D 2LAGB 3PQYE 4NZDA 4MJ4A 5F3BB 4EI6B 1FSKB 4P48A 2BOCA 1X5FA 1TJHH 4OB5H 4P5MB 4K07A 3KYKL 1JNLL 4F2MA 5I30H 3KXFD 3UO1L 5D93C 4KJWD 3LZFL 4LBEB 2PW1A 4NFBA 4LIQE 2VITB 1QFPA 4GKZB 2XXMB 1TCMA 4BZ2L 4WTWA 1A6TB 4GBXC 4YGVA 1GRWA 4Z7QE 4A6YH 3L7EB 3ZHLA 2P24B 1WAAE 1X5ZA 4PJIA 1FNGB 4C57C 3VFPA 5I1KH 4Y5XA 4X4ZA 3RY6C 4JVPA 4G6AD 3QUML 2VXQL 5HXMA 4M1GH 3QZWG 4LSRH 5AAMA 3LKRA 2HP4A 1V05A 3ALXA 1TETL 5CEYA 3WHE0 4WO4A 4AT6A 3UROR 2ICEA 3S4SB 4QF1B 1QSEB 2R0WH 3FONA 3WLWC 4JFED 2BSSA 4ODUA 4UDUA 1F13A 1A14L 2MPAL 2QQKL 1HHGB 3IDYB 2NR6C 3DO7B 5ISZA 1ZT1B 4G6JL 4GAJH 1A3RH 3O3AB 3VXUE 4P2OB 1FL6A 4D8PA 3ARWA 4JPWH 2GKIA 1M05B 4XCFL 3QEUB 1HZHH 4KK6D 2H1PH 1AR1C 5SWQA 1IAOB 4ZFOA 1MHHA 1J87A 3C08L 4JQIL 5GHWL 1FNAA 4RRPG 1P2CB 5DEFB 4JG0H 2QLVB 2DRUA 3UCRA 3IS1X 4ODHL 4WDIB 3V5HA 2XWJA 4KXZI 4JR9L 3ULVH 3GSXB 5C0BA 3GSUB 1LO0L 2AS5M 2AXGA 1M7XA 2KH2B 5J11C 4HMCA 3F12B 3SE4C 4JGUA 1WV7T 3RVWD 5F9JA 3WD5H 5DQ9B 4QT5B 3WV0A 1KV3A 4JFFB 4LARL 3LKOB 5GGTH 3GNML 5JOFA 2VIRA 3QJFB 3ZZ1A 5L2KB 5IW3A 1BQHB 2OK0H 2C1PB 1PQZB 4OGAC 2J88H 2YWYA 3FT2A 4U1NA 1DN0A 3QP3A 4UQ2B 3O4LB 2YRLA 1B2WL 1PD6A 4W6YB 4PREB 5DQDL 1I9JL 1LNUB 1NGQH 1PSKH 1MCSA 3IAQA 3RVUD 3ARFC 4QXGH 4PJ5E 1VFBB 2Q20A 4D9QD 4LEXH 4CU8A 2BDNH 5J89A 1NUGA 1DANT 1N5AB 2VDOL 1IC1A 3FOMA 3REVA 4N0YH 3ZHKA 4OF0A 5IB1A 3DUUA 3VI4E 3O11A 1K6QL 3CX2A 5BCAA 1EHAA 3DJ9A 3Q1SL 5JLZB 4PJEB 2ZG2A 4ISVB 1CGUA 4XAKD 3BYYA 4S1SH 3QDHA 3MUY1 4HZLA 5IW1B 1A7OL 3FO9B 3QIBA 1SEBA 2GK0A 3KLAB 4RBPK 2R4RH 4P9HH 1DVFC 5DJDB 1JV5A 1RHHA 3HI5L 2I07A 4OSUH 3QEGL 4BFIA 4K8RH 4KQ4L 5FO7A 3ULUE 2CDFB 4M9PA 1AHWC 2VKWA 2YD1A 3OKNB 3VH8A 3KPSE 1XF1A 1PW3A 3IT8D 1QZ1A 1TTUA 3WYRA 3SJVE 5D7SL 1I9IH 2WP3T 2BY2A 5FUCC 1YEGL 3L5IA 1H3TA 3RP1A 3V5KB 5AYUH 1QVOA 1QEWB 2NY5L 3LRSA 1CE1L 4QGYA 1GCFA 4DFHA 3FN0H 1NMCB 2Y5TB 3EAKA 2XICA 1GL4B 4L8SC 4PJ9D 2UY7A 2FGZA 35C8H 4N8CL 5LCVL 2VTFA 4NNXA 3WIHH 2B4CL 2VR9A 1JZ5A 2UYLA 3HG1B 4NC1E 4CKVX 4L4TE 5I19H 3OKEA 5ACZB 4PD4J 1ZANL 3B2UC 3KR3H 4JHAL 1I1AD 3ETBF 3C60D 5AG9A 3BH8A 1I1YB 2FGWH 3U9PL 2FX7H 1ADQA 1KGCD 3L5WB 4YDIL 4BSWA 1ZXQA 3MBEA 3QHZH 3HZYB 5KW9L 4LKXB 4OZFB 4D0DA 4OFKA 1U3HD 4F7MB 3Q6FA 3O3DA 5C9JA 4Y19A 1E4JA 3UJJH 4KDWA 3EDKA 3LS5H 3OV6A 4WUUA 2JB6B 3MJ9L 4R90L 1F2QA 4LCCA 1TJGH 5J9PA 1FGVH 5E4IA 1JZ8A 3SDDB 5AD0A 4BQ8A 4E41E 1RZKH 4EBQL 4HEPG 4OIIL 5A2FA 2JCCF 5ALCL 2JJVA 5I1IL 5L6YL 3F6IA 4G8FB 4O02H 5F72S 3ZE0F 1HWHB 4QRPD 4NQUA 5JZ7D 2HT2D 4LRNL 5I73B 3PIQA 4JKWA 4MXWH 3FAWA 5SWZE 3DLQR 5L8KB 3QI9C 2I9TB 3RL1B 5K59F 1FHGA 1XGTB 4TUJB 1ITCA 1EVUA 1XGRB 3QO1A 5IOPA 2IAND 4FNLL 4NQEE 5H35B 4ZXBB 4GAGL 3B83A 3QQ3A 1V3MA 4NOBA 4O2FA 3U2SA 5ICYA 3QR2A 1YNLL 1B0GA 2XA8L 3CSYA 3CFDA 1TVBA 1ETZA 4PBWD 4ZUVB 1NEUA 1I8KB 3MBXH 4TTDD 5TQ0H 4LVOC 4WHYG 2AQ2A 1W0WB 4LQFL 1A1OA 5ANMA 2Q8AL 3MCG1 4XNMB 1Z0NA 4JG1H 5E8OA 4LCWA 2ERJC 5GQBA 1ZS8B 5DF0A 2NY4D 1UZ8B 2EDYA 5MERB 5IF0A 3MLYL 2DQFA 3DMMC 1FVEB 4UINL 4HUWA 3RKDD 4PR5B 3OXRB 5BXFA 5DD1H 4Z5RA 3IKCB 4QRRB 1VA9A 3VFOA 5TDOB 4K9EH 4RGMB 4HX1A 2FH6A 1LP9B 4K8RD 1ORQB 2A9NH 2EYSA 4NRZA 4JRYD 5GISL 3EOYG 3HUJA 3P30H 2R69L 2LVEA 4UNVA 3FO0L 3O6ML 1RJCA 2IBZY 5CP7B 4C56B 1GAFL 1WZLA 4UU9B 3WS3A 3BW9B 3PWJB 1AI1H 4JPKH 1MVUA 5E6IC 3RVTC 3HC4H 1C1EH 5IMKB 4I5BB 2P47B 1FCGA 3MROB 3D5OF 4Y4KD 2DQUL 3QFJE 5J56B 4WFED 2WMPA 3IXAB 1CQYA 2C3VB 2XQBL 4U3CA 3SKMA 2O93L 5HHXH 2ZUQB 2ZUSA 5JPMA 3VXMB 3UTSD 4M8QA 4U1GB 5I2IB 4UV4H 1MH5A 5IMMB 4JRXE 2FL5A 3IJSB 3MRGA 4X4MA 1X5HA 3R1GL 4OIBA 4JFQA 1FZOA 3UDWC 1Q72H 3TESA 3BRDA 3C2AH 5LGHL 1WCQA 4OLZL 2DBLL 5FM4A 4J1UB 3MRBB 2E7HA 5GGSA 1HCFX 4HIIA 5IR1B 3IDGA 4N9OB 1LD9A 3GHBL 3K2MC 3LEXB 4OV5B 2IMMA 4IOFD 2Q7YB 4HS6A 3R8BB 1FPTH 3B9KC 5DXWA 5A3IC 3C5SA 2EDBA 1LEGB 2QADC 2OR9H 3MCLL 4LDEB 3VDAA 1GGTA 2NY0D 3GO1L 4YE4H 4UT7L 4PJIF 2HT3D 4S10A 1FZJA 3GMQA 4LIQH 1YJDL 4MNGA 5ABDE 12E8L 1NFDE 4HUNB 2D0GA 2BX5A 4IDLA 1IGYA 2X9XA 1YNKL 3DWTA 1VERA 3AB0C 5IIEB 3S5LG 4PRIE 3NH7H 4A6YA 1BBDH 3RAJL 3AS3A 5D7IA 5EZOH 1C12B 5JO5A 4QTIH 2FIKA 3WFHA 1MFDH 3G6AA 3MV9E 1CLCA 5J3HD 4UBDD 3P3YA 1FFPB 4KJPD 2H2SD 2PYED 3D48R 1G7LA 2AK4B 3G08A 1RJLB 5FDYA 2AJUL 4Y4FC 4MB4A 1AJ7L 1I1AA 2QSQA 3H9SA 1R3LB 3L5JA 4X7SH 2AJZB 4S1RL 1DEEA 2EXYD 1DQQA 1H3PL 1KENH 2Y07L 4AM0B 4P46C 5EO0A 4FQJL 3O4OC 5CJOL 4PTUA 1JBJA 5E9DE 1BD2E 2W60B 3PGDA 5AZEH 1D9KA 5TE6H 4KZDL 4ACPA 1MRFH 3U30B 2R0ZH 1CGXA 2A0LD 1S7QA 5I8KH 4OAWA 2GW5A 2UUDK 4PJBB 2C3HA 3FB5A 3TN0C 3LQAL 3EGSB 4ALAL 3CX5J 4NN5C 4ZDHB 2QSTA 2X7LB 3RU8L 4ODTL 3KHOA 3SE3A 4QRPA 3NA9H 2Q86B 3TF7C 4WHTA 2EIDA 3BMWA 1OB1B 2Z0BA 2F8XC 4DGVL 3KG5A 1LE9B 3D39D 4YHZL 5EULV 2PW2B 3QXVA 1S7SA 2FRGP 2R29L 4L4VA 2V5MA 5GGTA 3AY4A 4R4BB 4MNQE 4FFVD 3SBWA 4AY0A 2EDEA 1VGKA 4GG8B 3R4DA 5F1NA 5DEGB 2HKHH 2ZJSH 4NNPH 4Q6YA 4OFDA 1EHXA 2Z35A 4P2QD 1AO7B 4PGBA 4HWNA 1B90A 5TE4H 1X5GA 5BRZE 3SO5A 5JIPA 4HFWA 4GJTB 4LNVA 4NKIH 4KUCF 4LPTA 3V0AC 4H20L 4P3CH 1T1XB 3GSRB 1A1NA 4ZOCA 1DN2A 1U3ZA 3BPLB 4RIRA 3THMH 1OAQL 1FBIL 5B39A 4GG6E 1IGML 5JQ6H 1MIEH 2VDLH 2W9DH 1N7MH 3RWFB 3CNKA 1BVLA 1JYWA 3BESR 5DMGC 2VLRE 4ELME 1YYML 3WKNA 4F58L 2ILLA 3P4LA 5T5NF 3CU1A 2XRAL 5ILTL 3S6CA 5HGDA 1LEKB 3ZDXF 5E2TL 4PJCA 3ULUH 4HWZB 1A4KA 1M71B 3RGVA 2DKMA 4AQOA 1CLZL 2OBGA 3QFDA 4AIXA 2BY3A 1MVFA 5CBEB 2K3TA 5T1LB 4OQTH 3MLTB 2QSCL 4HWEL 3MV7B 4HMEA 3V0VA 4OCRH 1W0VA 3IDMA 4OTXH 1VEMA 5CJXA 6CGTA 2WBKA 1GHFL 2D9CA 1F90H 1QLEH 4GS7B 2A9ML 3CXDH 4U6HA 1OWWA 3MX0A 3RUGA 3H3PH 3LB6D 3P0VH 5IHUH 5LBSL 5HJ3A 3VXRE 5CJ5A 1KTRL 1XGUB 4QNPF 3QUXC 3RWGA 5EO9A 2Z93A 3V6FB 3TP4A 3OX8B 2ZCLH 3PWUB 4LQ1A 2AP2A 3B43A 2J8UB 5GRUH 2XTJC 4KQ3H 2XQYG 3UTSA 3FQWA 3QEQD 1R3JB 1GGBH 3LN5B 3WIHA 3VXQB 4YFLF 3IXTA 3RA7L 3GI8H 3K1DA 1TLKA 4NGHH 4ETQB 1ZT4B 4Z7NF 2A6IA 3IGAA 1T03H 2ICCA 4S1DC 1DBBL 4NZRH 3BI9X 1WISA 4BSJA 1J0HA 1MFBH 3QCUH 1FLTX 1HILA 5FHAH 4IIQA 3X12B 4L5FH 1CGSH 3BP6A 3BE1L 4OZHA 1CFBA 3MRPA 1K4CB 2DM2A 5B3NA 4R0LB 3P40A 4YFLI 4CVWA 4M03A 2ATPA 1IEAA 1Y6KR 3IB4A 2FYYA 4XP4L 5C0EB 4GBXD 4FFZL 3RDTB 1B4RA 4TUKL 2AXFB 2QL1A 6FABL 5I1DB 4FQXB 1HSAA 4F3FB 5H94A 1I3UA 1IJ9A 1XGQB 4HV8A 4GRLC 1I8IA 3TIDA 3I50L 4HHAA 3CSPA 4JZJB 2CUIA 4FXKA 4ZS7H 1FSKC 1WFOA 4WJ5A 2ADJA 1BOYA 2L7UA 4HT1L 2NR6D 3HZMB 3BZFB 2NXZD 4X9FA 4RAUA 3FOLB 5DFVC 4I1NB 4ZUUB 4UILL 1CD9B 3BHBA 5ETUA 3W0WB 3BPOC 4X4XB 1LILA 1TMCB 1FZKA 1A0QH 4YXHL 1FNEB 1AR1D 4N8VB 4Q97A 3MA9H 4PY7B 3OWEA 4J4PD 3VXPB 1IILE 4DW2H 4M93B 1KJ2H 5BV7H 3DOSA 4NJAH 4Y1AD 4K71C 5CINL 1A9EB 4RFEA 1T1ZA 4OZ4A 4TSBH 1T80A 4PRBA 4ZYKA 1U93B 2GTZB 3IDYC 2AKRB 1JGVH 4PRHB 5SX4I 4P2OC 1MCOL 1IEBB 3PXJA 3UJTH 3HUJF 1CU4L 3MRHB 3NCMA 1MFCL 3HE7B 4OGXH 4AG4H 2HWZH 25C8L 4XPFL 3D0VA 4LLYA 1H8SA 3EYUL 1CXIA 3TBTA 4MXVE 4BKLA 3VRJA 4K3GA 4LCUB 3CMOL 3D39A 3KPSD 1ZGLB 5BQ7B 3SJVD 5DJ8B 3L6FB 3GHEL 1KJMA 3MRFA 1T1YA 4C4KO 3AXLA 3ARFD 1MCBA 3H9YA 4L8BA 4P5TB 1FL5B 2V7NB 4ETYA 2MWCA 2W1NA 4NUGH 4ELKA 1Q9OB 5KSBF 3ULSA 2QQLL 1QP1A 5BO1H 1UACL 3IU4H 4WFHE 4EUPG 1RK0A 4WU5A 1AY1L 5D2LB 1QFWH 4AH2A 1RUPH 4QHKJ 3MNWB 1MQKH 4MJIE 4NO0B 2BRQA 1DVFD 2HVKB 3SDYH 1BLNA 3FFDA 3VG0L 1BGXL 1KBGL 1BOGB 2V6HA 5FGCE 3A67H 4IRSD 3AS1A 4OLYH 3U0TA 4ZNEE 1NEZA 1KB9K 4XP1H 1KT2A 2GITB 1FLRH 4GUPB 3ZE1E 1ZKAA 2VABA 2X09A 5GS1A 1S7XA 1V5JA 1YY8A 3PV6B 3UPRB 1IGIL 3EYSL 3PQYA 2VZ3A 4PV9B 3BH9A 3RFZC 5JDSB 1W72L 1ZHKB 1G7IB 1Y18A 4H1LG 5BOPA 3QJHA 5D7IF 2X70B 4JFFE 4KGLA 1S8DA 4R4FL 5E8EA 5DFWH 2IQAB 1TJIH 4WTZG 1IGTA 1NLBH 3K80A 1WC7B 1WAAA 2P8LA 4Z95H 5F7YC 5SWZD 5L2KE 3MXVH 4B41A 2IJ0C 1E4XL 3ZKXB 4XVJH 3B2UD 1LO2H 2Q7NA 5EN2B 3AREC 3TV3H 3QNZB 1LMKA 1HHJA 1EFQA 3UAJD 5AG8A 4NQED 3U1SL 1L4IA 4P2RD 3CFBA 1CDGA 4DCQB 5LGJA 5DRWA 5GSVA 2XWBB 3B6SA 4CDGC 4YHOL 1SQ2N 1U6AL 1OP5H 5I1EL 1FYTD 1NMCC 4HJJL 1KB5H 1MELA 3S5LA 3VXUA 1IVLA 3GKZA 5DA0B 1BAFL 4OM0L 4PJEE 3FQTB 1KLFA 5EC2A 3UBXG 4JN2B 4KUZL 3BP7B 3DGGB 4PJGE 2VKXA 3K3QA 4KHXL 1QSVA 1RULH 1OTTC 1VCAA 1RIHH 1FRGH 5HY9B 3FRPG 1RZ7H 3CVIL 1JPST 2B5IB 4LRIC 4POYA 1JRHL 3ARRA 4OBSA 1F4YH 2CR6A 3QI9D 4MX7B 2PETA 3CUPA 2O5YH 3RL2B 5GSRA 1IL1A 2ESVD 2WANA 4YIQA 4X6FA 2R15A 2K7QA 1E4XI 5FGSA 3VFGH 2XKUA 3QDGD 2DLEA 3SDDC 1WBXA 2X1WL 3VJ6B 4RMRA 1ND0A 1KC5L 1JGLH 3ARBB 1OTUC 3HR5B 4HKXA 5CMAB 4PGJA 5I1HH 3FJTA 1N4XL 1NGZA 5FA3A 3KPRB 5I73C 2EH7H 1VACB 3KLDA 3SKOB 5MP6L 3HG1E 1PEZA 3RI5F 4LMQI 2B1HL 3MV8D 5ESQB 1MAMH 3HAEG 1T89C 4J4PA 4JY4A 4PJ5A 5GGVH 3B3IA 2AJYL 4KTYA 1UKQA 4HKBA 2VQ1B 3W9EB 3BWAA 1WCBB 5EO1A 3WFEH 2ITDB 3H7LA 4ODVH 1Q9LA 3K81A 1FJ1B 4Y16A 2BSRB 5IB3A 3P9MB 5HHVL 3IF1B 5ERWB 4F8QA 1CD0A 2GJJA 2X4SA 2X1OA 2ZSWB 2DLFH 2N7AA 5MENB 4MA8H 5IJKC 4GRWF 4KDTA 1TCRB 1NSNH 3W81A 1QYGL 5CEZD 3U4EB 2VXUL 5EORL 5ACLA 2XIDA 2EDTA 3DRTA 4PP2B 3UC0H 2NTSP 1YEEH 5E6ID 3RVTD 4DN3L 4G42A 5F9OL 4JM4H 2VXTL 4PJ8C 2YMXL 5HGBA 3RUGF 3S96B 4OQTA 3IYLW 2R0LL 1D5MB 3HLAB 4G7YL 4OI9A 5SWSE 5DR5H 4OD1H 2Z4QB 3DVIA 2AABH 1GC1H 3ARUA 4YK4B 5K9JL 2KBGA 3OJDB 4U1MB 4XWOC 3H3KA 2KDGA 1T1WB 2R8SL 3PJSB 4X6CF 4WU7B 3NCYP 2VUOA 4CADB 3CFKB 1J1XH 4YBQD 3G6JE 3T2NL 4L4TA 2P5ED 1HINL 2BVTA 3DURB 3MRQA 4P3WA 3IDIB 5FYKL 4JQXC 2R2EB 4HKJA 5T1DL 4L1HA 2O61B 1J8KA 2AJSL 1HH6A 2PR4H 5E6ZA 2KPNA 5HYJD 1C08B 4PRNB 4E5XA 1JWMA 3B9KD 5A3ID 2V2XB 2ZUQC 2ENYA 1K5NA 1KFAH 1I9RH 4HIJA 3HN3A 4IRSA 3UZQA 3CH8A 4U1GC 5KZCD 3QUMB 4EJ1C 4YHLH 3PHOA 1I85A 2DI9A 2OJEA 1TQBB 3OG4B 2VQUA 1GYAA 3I6LE 4Z7WE 1R3IH 3IFNL 5E56A 4KV5F 3WNKA 3DROA 5JMRA 2VDRH 5EU7C 4XPAL 1XR9B 4E41A 1LP9E 3G5XB 3BKJH 3TJHC 4HDIA 2AEQH 4DUWA 4YUEL 2W0KA 4ORGA 4YWGH 3REWA 3HPLA 4S0SD 4ZFGH 1A7RL 2H6PA 1MRCL 5CSBA 5KSAC 4LLVA 5SWZA 4OFIA 3NPZB 4Y4FD 3O9WB 3LCYA 4J3VA 3O2VL 1I4FA 2FD6H 4OJFL 1CR9L 4RQQA 4L3AA 4U6XB 3IDNB 3T3PF 4KGJA 3BSZH 1KLUB 4HIXH 5FGBA 1CDHA 4P46D 2D7NA 4NCC1 1CDYA 1QA9B 5DK2A 3BO8A 2DTML 5KG9B 4G7VH 2Y4SA 5SX5K 4L8DA 3QA3B 4NBZB 5FO9B 3BXNB 3ZLQC 4IOSD 4HF5H 1RJYA 2ID5A 1KJ2A 2UWEF 1U91B 3CVHL 5DRNB 1AXSB 1KTLB 4X0KB 4XHQA 3TN0D 2A77H 2WUBL 1IRAY 4NP4H 3K2UH 1DE4B 3U4BL 3TVMC 3W9DB 3LSOB 2WAHA 1FN4B 3I9GH 1BQSA 4C4KT 1F4XL 5F3HB 1IFHL 4MAYA 5C0DB 3DIFB 2GJ6A 3S4SG 3GI9H 1G0DA 2X4NA 5TQ2L 1C5CL 1D5BA 2VZUA 1CVSC 2HFFA 1X3DA 3RWEA 4HK0B 3U30C 3TM6A 1I1CA 1NC4B 2EDHA 5EB9A 3V4VH 5HSFA 1RFDH 2NY3C 3CIQA 2I27N 3D9AL 5DLML 3HNSL 4XVTH 1OSZA 2DL9A 4XPTH 3MYJB 4LDOB 4OFYD 4TULL 4F9LC 2YPVH 5KVDH 1FH5H 2AJ3A 3ARYA 4NWUL 3BQUD 3VXRD 2X4TA 3QFJA 2FBOJ 5F96L 3QYCA 4AEFA 4LGPB 4PJAB 4QRQA 1KYOJ 1PG7X 2XFXA 3RHWF 3RNQB 4NJ9H 3BD4A 4OGYL 1Q1JL 3TBWB 1CTOA 3BJLA 4JRXA 2WZPD 4QY8B 1KPUA 3VFSA 3WJLA 1VPOH 4CUCA 2YK1H 5IHZB 4I2XB 5IW6A 3BVNA 5C0GB 1JI1A 4DVBB 3HE6C 3I3EA 3ZTNL 1N3NB 1OW0C 3GIVB 1NH6A 3FT4A 3NZHH 2YPLE 1UGNA 1BQHG 3S3JA 5ADPH 3KPPA 5C3TA 5DVNA 4M6ML 1QLRB 2B0SL 4X6BB 3T0XA 1P4IH 3BP4A 3X14B 1A3LL 1X5AA 2UV3A 1PY9A 3VFRA 4XNUH 2PXYB 4GW5B 5JTWA 1JI2A 4JHZA 1FIEA 4Z7QF 4GSDH 5GJTH 3DX6B 3HC3L 4WGWB 4HC1H 3QH3A 1DBAH 4F7CB 2VH5L 2DJUA 1S7TA 5KJRL 1ZA6B 3QUXD 4J8RB 4D0CA 4FQLL 5FF6A 1M6OA 1MPAH 3O45B 3L3HB 4ZNCD 3KDMA 1QBLH 4DGYL 3PGCA 1RUML 2XTJD 4PRIA 1U8HB 1YEFL 3MFFA 4X6DB 3QUKB 5JXED 2V2TA 2C9AA 3DVNA 4U1SB 4Z7VB 3ILPA 4NM8H 2WBJA 1AO7E 1T04A 3MV9A 4S1DD 3E6FB 4KI5C 2VDKL 4U1IA 4PYGA 1KCRH 4TSCL 2F58L 3QDJE 1UVQB 5I6XB 4W6WB 2RGSA 4L3EB 5KSUB 4IRJB 5FFLA 5FOBB 4P4KC 4IOIB 4YBLC 5CS7A 2MHAB 2DYPA 2FR4B 3RX7A 5F7WC 2BVPA 1BBJA 4WTZA 5LG1A 1CFNB 3QDMB 2D0FA 5IKCA 1QLFA 3O6KH 5HDLA 2AV7B 1KB5A 4G6MH 1DBJL 4IDJL 4XP9H 4HPOL 1A6UL 5E9DA 1BD2A 3WEXA 4O5LL 3WLBA 1QRNE 2GHWB 1N0XL 1KEML 1JMXA 3BFOA 4GRLD 3RWCB 5I8OH 1EA9C 4P4RB 5KVFH 5IJVA 4XP6L 1F4WL 3D69B 2VLKB 4LAQH 2GY5A 4YPGB 3PP3K 1SYSB 4HPYH 5ESAA 1CE6B 4ZOEA 1YQVH 4N1CA 1HXMA 3GMPA 4R0LC 3V4UL 4KI5E 4ZUSB 4EDWH 1DLFH 5DFVD 3LS4H 3SKUD 3RDTC 4RISH 3H42H 2IBBA 1MHEB 4JN1L 4LSTH 1F02I 4FQXC 5HYQB 1LEIA 1BZ7A 2I60L 1RI8A 2BMKB 4MNQA 3TBSB 3QULA 4OZFG 1HYRC 3CFCH 4G9DA 4UOW0 5DI8B 1JHLH 4PJFE 2P44B 1UYWL 3MOAL 3O3EB 5EOTB 2J8UE 5JXAH 3TO4B 3INUL 3N85H 4JZJC 1QSED 2J6EH 2GSIB 3NIFE 1NDGA 5BRZA 1JFQL 4Q6IB 4LDLB 2F19H 2A73B 2M2DA 1KJ3H 2ATKB 3E3QE 4OLVL 4BSVA 4Z7OE 4P2OD 5J0BA 1XZ0B 5EFIA 4MSWA 1NGXB 1EDQA 1XF4B 3AAZB 1AXTL 3KPMB 5C0AE 4OZFH 3WBDA 2IADB 1CYGA 4GG6A 3RPKA 4J6RL 3B9VA 2OTWA 3ULUF 4Y2DA 4HIEA 2VLRA 4ELMA 4FP8H 4I0KA 1P9MC 4JZNB 1XCQA 3MZGB 3NN8A 4PV8B 1EJ6A 4FQHA 3D25B 2ZUXA 4KI1A 1S9XB 1P1ZB 2JB5H 2DDQL 3LQZB 5D1XB 3FRUA 4M5ZL 1JNNH 3LHPH 2OQJB 5BMFH 5FB8A 3ZTJH 2DQGH 5E2WL 1J1PL 4U6YA 2KQMA 4JFFD 3D2UA 2RBLA 5DHXB 2D31A 3DX8A 4ZD3L 2OXHA 3QQNA 3FO2B 4I3RL 5IB2B 5L2KD 1L7TL 1GSMA 3L95B 2HLAB 3BQUA 3VXRA 4D3CL 4TVPE 2L4OA 2B2XH 1ZLVH 2X4QA 5E5MA 1UFUA 3W0WE 1XIWB 1QPXA 3UJIH 4RZCA 3MRMB 3O4LD 1OAUL 3SGDI 1YN6A 4MCYB 5CWSA 5I18H 1U8LA 1HQ4B 5E03A 1NL0L 5DUPH 5HGHB 1QR1B 4GMTL 5IT2L 3DSFL 2ZZUT 3C6SB 4LPUA 3QQ4A 3T4YA 5CD3B 4KHTL 2PO6A 3EYQC 4P5TC 1ZLWK 5M94B 4L9LA 3RTQB 3I2CH 2EIZA 1HIMH 4BQ9A 4QHMB 5CP3H 2O5XL 3UTPE 4CU7A 4CNIA 1G7HB 3IDUA 1CLYL 1WGOA 5LQBH 2ZCKL 4KJYB 1SJHA 3HI6H 2FEDC 4X99B 3CCHB 3E2HB 5DA4A 5TPWH 1OF2B 4PJXE 4K94L 3B8YA 1J86A 3FQNB 5IUSA 1QFUH 2GAZA 2Q6WA 3MACH 3NGBB 2BC4A 3S98A 3V7AG 3EOTL 3ARQA 1ZVSB 1M7DB 4JO3H 2NNAB 3W2DL 3HNVH 5ADOL 3PHSA 4MJ6B 4U6VH 1MIML 2Q76A 4ZO8A 1IGFH 3ZL4H 4X5LA 3JV6A 2CXKA 4X9GA 1F5WA 3QPXH 5I1GH 1A6WH 3O41B 5JXEA 3QXAB 2IBGA 2MKWA 3WNPA 2EYTA 4AEIL 2XG4A 4FFYL 2P7TB 1T66C 4HQQH 5CZVH 5B22A 3RWDA 4GKOA 3ZT6A 1S5HA 4V1DB 3MPCA 4H0IA 3FMGL 3MLSL 4ZFFA 4N1HB 1KCUL 5C0NC 3HG1D 1E6JL 3ZKXC 2GIYA 3GJFH 1FFRA 3F7YA 4RFOH 3ARGA 1UZ6E 3T65B 3D0LB 2IGFH 4K23H 1B6DA 5D8JL 4RMSA 2XOTA 5KOVC 3VGBA 2D9QB 3GSOB 1CGYA 3NOIA 4XTRC 5A40E 4D0BA 1P7QB 3X3FH 4WHCA 1P4BL 1MCEA 3MLZL 5EUKB 4XXCA 3QG7L 2DMCA 4EI6A 3TJEH 5DMYA 2DQJL 4U6TA 1TZGH 3QUZA 4JCLA 4P5MA 3S37H 3SDDD 4LPYA 1MWAB 1XF5B 1OTUD 2YA0A 5F70A 5DUBA 3DNKA 1IBGL 2BHZA 2VITA 3P0YH 4CBPA 1G9NH 1A6PA 5CEZL 1A6TA 2PN5A 3U46B 2R56L 3R06B 3WFCL 1IQWL 3M8OH 2MCPH 5J7CC 1YPZB 5A16B 4LSDA 4DKDC 3ARXA 1T2QH 1N5YH 4MS8D 5KVMC 4HH9B 2NW3A 1HK6A 3S4SA 4ZXBD 1FP5A 5C6TH 3DRQB 4QF1A 1ED3B 2VE6A 4JPIB 3ZYZA 2CGRL 5DSCB 3P0GB 4KWUA 5TF1H 2VC2L 3ARBC 1HHGA 4NYLB 2LU3A 4OM1H 5EWIH 4ZAKA 5F9WC 3WNMA 4CJ1A 1OP9A 2EDWA 4MA3A 1RZFH 2E6JA 1CFVL 3O3AA