5CCKL

Crystal structure of human anti-hiv-1 broadly neutralizing antibody 3bc315 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
210
structure length
210
Chain Sequence
ALTQPASVSASPGQSITISCSGTRSDVGGYDFVSWYQQHPGKVPKLIIYEVTKRPSGIPQRFSGSKSGNTASLTISGLQADDEADYYCCSYANYDKLILGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 3BC315 Fab heavy chain
publication title Antibodies to a conformational epitope on gp41 neutralize HIV-1 by destabilizing the Env spike.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cckL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cckL02
2R4SH 4Y8AA 4AQ1B 1CLYH 4DVBA 1ZVSB 1RZ7H 1CGSH 2XQYG 4ZFGL 5GJTH 4DN4L 4FQXD 1U3HB 4I3SL 3EO1B 4NQEB 1U2HA 2NXYD 3MV9D 3G9AB 3SDAD 5BXFB 4YX2H 4MAYB 4HGMA 1HXYA 5C0AD 3DURA 2D9QB 5C0BB 5CS7A 4ZUWA 3V52L 4JPKL 1VDGA 5ANME 2OZ4A 1UEMA 2Y25A 4G6JH 1P7QA 3VH8B 3RY4A 1JPTH 1T66D 1T7YA 1LO5B 2CKBA 5D8JH 1P4BH 4UUJB 4X80H 4PB9L 3HLAA 2R4RH 4XPBH 1XIWC 2UWEE 1IM9B 2F54D 4NNPL 4DWHA 1FNGA 3NN8B 5C6TH 3L7EA 3QFJA 5INDA 5LGJB 1ES0A 5DJYA 3FB5A 3PP4L 3BOVA 4PJ5E 4OF5A 3FT2A 4YBQC 2IQ9L 2V6HA 5CZVL 2A6IB 2H2SC 4U1SB 5CBEB 2EYRA 3F58L 3UTTE 5EA0L 3RVXC 5CHNA 4D0BA 4JANA 2H41A 3EUUA 4X98A 4QXUL 2GCYB 1MRFH 3ROOA 2WBJB 2IG2H 2V5SA 1DQML 3PWJB 4O4YL 5DFVC 4FMFA 1U3HD 3GMLA 4NQED 1JCKA 3VGDA 5FECA 5IV2B 4Z18A 1U41A 4PRNB 2XXMB 4XGZA 3FQTB 4MA3A 4E42B 4ZXBC 2VLRE 2YWZA 1NGYB 3I9GH 2B1AL 1R3JA 4U7SA 2XZQH 1Q9LA 5DD6B 1TQBC 4FNLH 4RFNB 4CU8A 1GHFH 1EGJA 3ZE0F 4WUUA 3NAAL 4HWBL 2C1OB 5E8NA 4RGOL 2UZYB 3R0NA 2NR6C 5HI4C 3O3EB 5GS1A 3HPJB 1I8MA 3OWEA 4IRJA 1IM9D 1R6VA 4I48B 4YWGH 3O4OC 1FVEA 1NEZA 2Z9TA 2OL3L 4LHQB 4F33B 3RWJB 3LS4H 4YFLF 2FH8A 2MQCA 5TH2A 1F00I 2Q1EA 4AEEA 1HN1A 2C4XA 2ZOKA 5F1NB 5T1LA 1XT5A 4WNQA 4XWGL 5IW1B 4WU5A 2WLYA 2PW2A 4XP6H 3JV4B 3ALWA 5I66A 4L5FH 4W4NA 1CDGA 2PO6D 3IU3B 3KNBB 1SYVA 3N9GL 3V4VL 3EYUL 2VLJD 3DXAD 2QHLA 5HHPB 2Z31D 5E00B 3ETBF 4GAJH 4OI7A 3KPRB 1QG3A 2H32A 4F7CA 5IROA 2PXYB 4IHOA 4ZAKB 2R0LH 3CXDH 3QNYB 5FGCE 1FGVL 1PY9A 4I3RH 4RMVA 3RUGF 1GCFA 2VDNL 1G7QA 2BP3A 4GXUM 4KJWD 2QQLH 3QDJE 2OLDA 3PGFH 4JM2C 4ODXA 1J10A 4GKZB 2ZCHH 2QEJA 1CLCA 3F8UB 4MXWH 5T1DL 3GIZL 1UXWA 2EDRA 3B5TA 3QUZC 2DQUL 1I75A 1KTKE 3B6SB 5E2UH 3LEXA 4J8RA 1NGWA 2CDGB 4NP4L 1S7TB 2H1PH 1QACA 4IIQA 4XTRC 5E2VH 3U0TA 4P46B 1YPZE 3EBAA 4H1LH 5ESAA 3S34L 4M61A 4PRIE 4XBPA 5JDSA 5DJ8A 2A6DB 3FHQA 3T09A 1D3CA 5CP7A 2GAZB 5IBTL 4Y16C 3PV6B 4GH7B 4HX1A 1M4KA 2VLLA 1WTLA 3MV11 1GC1L 1EHLH 4XP4L 3H9SE 1BLNB 2R23A 1U58B 1R3LB 3M8OH 4JO4H 4OF0A 4D3CH 2Q6WB 1VGKB 3QEQD 5C0ND 1K4DB 2KKQA 1BZQK 2KBGA 5LCVL 5CD5D 1JJUA 1W0VB 4KZDL 4NKMA 4KRPC 2R1YA 3T0WA 3T2OA 43C9A 5TE7L 5T5FH 1HOCB 4G6AD 3WN5B 5J3HD 1KTLA 3HRZA 3TEUA 1W8OA 1DFBH 1QFWL 3D2UB 3TH3T 1X7QB 1GGBH 1QD0A 5T1MA 4JRXA 4XVSL 1VENA 3V2AR 5BVJA 3IXAA 4NZDA 5DQJA 4NCC2 4DVBB 5I1JL 3UTSA 2BXZA 2NCMA 3D3VE 1EEQA 4G8IB 1F3RB 4XHJC 4V2BA 4XXDA 1WZLA 3H6JA 3QWRD 2P8MB 1UKTA 2ZPKH 1BFTA 1HXYB 2YN3A 4UT7H 2NYYC 2F19H 4ZUWB 3MNZB 4LLYA 4OZHB 3U4EA 4NWUH 3WD5L 5KOMC 4IDJH 1BVLA 3KLHC 3WO4B 1N4XL 4HJJL 3KYNA 2EDFA 4RMWA 2VR9A 3QUXA 2R2EB 5GJSH 4MQXC 4GAGH 4P59L 1J0HA 3F62A 3TA3D 3QFJB 5FDYA 4K55A 3L3HA 1IARB 4JHBA 2IH3A 1ES0B 5DJYB 1QFUH 3FB5B 3FT2B 1KIQA 1A7NH 1CD8A 4U6HA 4YBHA 2C3HA 1H8SA 4GQPH 4C59B 4TUJA 2EYRB 2D7TL 3QI9D 4JKPL 3TVMA 5CHNB 4D0BB 4JANB 2FWOA 3I85A 4JRYD 5E94A 3ROOB 1F58H 2A9NH 4JGJA 3TT3H 4UIKH 4HUMB 2LU7A 1OT2A 4KJQC 4NNXB 4Z95H 1UKQA 4KVNL 2ZWLT 4X7SL 4J4PD 2MPAL 1MFAH 3QUMH 4JDVA 1Z9MA 4MJ4A 5ANMA 1K4CB 4XNUH 3GSOA 4XGZB 5D7KD 5CD3A 5I1EH 4MA3B 3MRGA 1ZLUH 2VB5A 3FT3A 1MQKL 3QDME 3QQ9D 2C3WA 4Y1AD 5A1AA 4MJID 3HI5L 2QBWA 5HHQA 4WUUB 1KEMH 1Y0LB 2YR3A 5HDOA 5I9QC 1TCMA 2VE6A 1XIWA 4JN1H 1A02N 4L8DA 1I8MB 2BOCB 4IRJB 3RWHA 5DEGA 4K8RC 4EOWH 5JXED 1FVEB 5CINH 3WFDH 4X9FA 3QAZB 5TH2B 3VXSD 1QQDB 1FNSL 2VDQL 2QADB 4ETYA 1BJ1J 2XZCH 2ZOKB 3P4OA 5T1LB 3L3JA 3BKYL 2IANA 1UJTA 2EH8L 4WNQB 2W1NA 4WU5B 2PW2B 4Y4FA 5I66B 1FHGA 1FO0A 1OLZA 4JM4L 3ZT5A 3GBNL 3KVQA 5EIVA 1SYVB 1UM5H 2DLEA 1W2KT 2ZCLH 3ZKQD 4F7CB 2VL5A 1BQUA 4G6KH 5HYJE 1LP9F 2XY1A 3SDXA 3MRJB 4OZIA 4IHOB 4GAYA 3VH8G 1EFXA 4PRHA 2P49B 1ULVA 1R3KB 3OF6A 1FCGA 5C08B 5AD0B 1UACL 1YPZF 3CDYA 1A6AA 1H3GA 4ODXB 1OHQA 4UDTB 5CGTA 4UNVA 1UXWB 3DV4A 4MZ3A 1LHZA 3O2VH 4PJFE 2MHAA 4J8RB 1OVZA 1D6VL 4HS6B 3VD9A 5DVKA 4KZEH 4NUGL 1NGWB 2LVEA 2W91A 5IQ7H 4MLSA 4IIQB 3U0TB 2ZKHL 1B0GB 2Q3AA 2WUCH 1IGIH 2A6JA 5EUOF 1RJLB 1JWUA 2NPLX 2IPTH 5FHAH 4M61B 5DJ8B 4GMSL 5F1OB 1YYLL 3T0XA 1HCVA 5CP7B 3QQ4A 1AGDB 3ARGA 2VLLB 1SEQH 2XA3A 2UUDK 3CVHL 4QYOA 1KN4H 5L0QB 4C54A 1P53A 2I5YL 1BWWA 3GMPA 4G9DA 4DEPB 3OR7A 4X6DA 3MJ9H 3QHFL 4NKMB 2E9JA 5C08D 2MNUA 1VACB 1KTLB 3HRZB 3NCMA 3W0WB 4TTDD 4JRXB 4M7KL 35C8L 2X09A 3IXAB 5DQJB 2NY4B 4CJ1A 1CBVH 5E2WL 4JG1L 4M8QA 1U8HA 4L1DA 3ARBA 3OGCA 4U1HA 5A2JH 3K8LA 4I1NB 3WKMH 4U6VH 3C5ZB 3W2DL 3UJIH 1NANI 5I15H 1HCFX 4JY5H 2R2BB 1VESA 2BDNH 5JOEA 1CDCA 3VJ6B 4KV5F 3U4EB 2AJXL 2OTWA 2W9EL 3MLUH 3EAKA 4L4VD 3IDYC 2WUBH 4Z7WE 2VQUA 4R90H 3KYNB 4M6OH 2GK2A 4DGIL 2NY3D 4X7DC 3UC0H 3WNPA 1VSCA 3AREA 3NGBC 4Y89A 3MZGB 3ZE1F 5T1KA 3PHSA 5T3XL 3TBTA 1FORL 1C5BH 1KIQB 1XGQA 4OM1H 3AS3A 5HI5C 4U6HB 5FDWA 3K4AA 4LEXL 4TUJB 1IFHH 3W0WD 3TVMB 3P30H 2FWOB 4Y5XA 1TLKA 3VD4A 4EUPH 3QCUH 4X9HA 5IB4A 3D3VA 3CX5J 3UPAA 4U1JA 3SDCC 2GTZA 5J4MA 2IALA 3MUY1 5TF1H 2VTFA 2GW5A 4NRZA 2JB6B 5K33A 3IJYA 4PG2C 3T0EC 2B20A 3C5ZD 5TDOA 4JDVB 4YJZL 4K8RL 5ANMB 3GSOB 4JRWA 5CD3B 3ARSA 1N8ZA 3E0GA 3MRGB 4Y4HD 5J56B 1HDMA 3FT3B 1RFDL 5JR1H 1ZKAA 4O58L 3MNWA 3QDAA 5I17B 4E0RA 5HHQB 2H45A 2VE6B 2UWEB 3LRSB 3RWFA 3IFPA 4LIQL 3QDGE 4L8DB 4QRSB 5DJCA 5DEGB 5L2JB 1HYSD 1QLEH 4WDIB 2IFFL 1IGYA 4TRPL 3LAFA 1I1AA 3LSOA 5GIRA 3P4OB 4H0HB 4ZPVB 4APQC 3HI1A 3EYVA 2IANB 4LSDA 4RGNC 2OP4H 3CH8A 3F7VA 1CICD 3SKOA 4N0UE 1FO0B 1MWAL 5IEHB 4R0LC 1EAPB 5C07D 4NKDA 4NT6A 1OAQH 3EOTH 2YPVH 1P6FA 1JNHA 2VDRH 3FN0H 4PS4H 4WW2C 4FQLL 2VO5A 4N0CD 4X8XA 1NAKH 4DN3L 2CK0H 3KPOA 4K3EL 2FX7L 4HIIA 4RWYH 1LEIA 3SDXB 2DQHH 4PJFF 5CEZD 4OZIB 4GAYB 4IRSA 1EFXB 3QFDB 4PRHB 5C0DA 2VSCA 3P3YA 4OGAD 2VLME 5D1ZB 3SPVA 4IDLA 1F5WA 4QTHA 1QFOA 2DI8A 3PHQA 4ONGH 3R8QA 1BM3L 1A6AB 2P5EE 4K7FB 1MHPL 2X1QA 3MODH 3U83A 4E41E 1VFAA 2F53E 5T5NG 4R8WL 3IFOA 5FYLE 3DV4B 4OLVL 3RJDA 3EJYD 2MHAB 3U6RB 4PJ5D 4DUXA 4FFZL 2ESVD 2X1PA 5I1KH 4AIXA 4LLWB 4I0PC 3UTTD 2MTPA 5J12B 2H2PD 4YR6A 5DUMH 1A6VH 4RAUA 1SMAA 2AEPH 3OV6A 3U7YL 3UX9B 3HAEA 4JZNB 4PREA 3VXNA 5F7HA 5D70L 4WHTA 3TO4C 3KPMA 3QQ4B 1NPUA 4J6RL 3ARGB 2YRPA 1F4XL 1IM3A 1MI5E 3GJFK 1RUPH 5SWSE 2VLRD 4QYOB 1OP5H 5I74B 1FV1A 1X5JA 1GZPA 5EZLB 5FGCB 1RURL 4HS3A 4N9GA 3AS1A 2VXTL 3JWOH 1OOAA 4XPTH 3CMGA 2QLVB 4PB0H 4G9DB 2IBBA 4OBRA 4WHYH 3V6OE 1OPGH 1P4LA 2N56A 4X6DB 5D1ZD 2AERT 4KK9C 4RSVA 3QDJB 5EU7C 4MVBC 4P5TD 3ZYJA 3MRKA 3OPZL 7CGTA 3TBYA 3BWUC 1NEZG 2Y23A 3B9EA 1AGCA 4X6FA 2KPNA 4OCWL 1BGXH 1MRCH 1XF2A 4HF5L 3RA7L 1BFVL 4M8QB 1U8HB 3ARBB 4U1HB 2QJDA 4L3AA 4X6BB 2HG5A 1KCUH 3R06A 3RI5F 3FHAA 1OAYL 1CDJA 4QHKJ 4ZSOA 2F58L 2OMBA 2BVUA 4EQ2A 3G5YB 3Q5YA 2OTWB 2O5XL 5F7KC 2HJFB 2IEPA 5F7NC 4GMTL 2A6KB 1J05B 1D7FA 4GG6A 2FJFA 2GK0B 4NO2B 4XXCC 4NOFA 2GY7B 3G08B 4Y2DD 3X12A 2A77L 1H5BA 3EOAA 4G7VH 3W5NA 4OQTA 3AREB 2EDTA 5EOCL 1I9RL 1MRDH 5T1KB 4YH6A 3ZKND 3TBTB 5KW9L 3RX7A 3QDJD 1XGQB 3GSNB 3UJTH 1CXEA 4JDTL 2DN7A 3TT1H 2R1WB 5FDWB 1AE6H 4P57A 1QNZL 1C12A 2DDQL 1YZZA 4UB0H 5HGBA 5BVPH 3BMWA 4LASL 4RZCA 4XMLH 4KI5E 4Y5XB 5IB4B 3D3VB 4U1JB 1YEDA 5EO1B 4KVCH 3MACL 3VFMA 2IALB 3L5JA 4BFIA 4NRZB 1B3JA 4L3EE 2Q8BL 3IJYB 2UZIH 4LKCB 5CEXA 4AK1A 4QRUA 2R0ZH 4PRID 1KB5L 3FRPA 4C58B 4U3HA 1N8ZB 3HNVH 3P4MA 1HDMB 1YYML 4ZTOL 5JW5B 5B38A 2R4SL 5JHDE 3LDBB 1CLYL 1RZ7L 1CGSL 3LEVH 4PBXA 3DUSB 3W9EB 2OXHA 4E0RB 3H9SD 4F15C 5GJTL 3D9AH 2FX9H 3D0LA 3VA6A 5E6IB 2ZCKH 4YX2L 3IETA 3RWFB 3IFPB 1TVBA 1CG9A 4CAGA 3G5ZA 1N7MH 4ISVA 4NZUH 1UC6A 1GOHA 2R1XA 4GRWH 4RQQA 2EH7H 4G6JL 3GRWH 1IGYB 4JFOA 4LRIC 3KAAA 4HGKC 5DYOA 1I1AB 3LSOB 5GIRB 3UTPE 1JPTL 3GJFA 4LGRB 2UY7A 4JDZA 3HI1B 1UZ6E 1WITA 3EYVB 5D8JL 1P4BL 4X80L 3F7VB 5H37G 4L3CA 4KROB 3SKOB 2R4RL 4JCMA 4XPBL 4CVWA 3SCMC 4NKDB 4NT6B 4O2EA 1QKZH 1W8NA 5I1LB 2P5WE 3BH9A 3ROLA 1JNHB 1ONQA 4P3DA 5BMFH 1FFPA 3KPOB 2X40A 4XPGH 1RVFH 3JV5A 4HIIB 3WHE0 1LEIB 1IGMH 5F3HA 4S11A 2XFXA 4AH2A 3VXTB 2RIKA 4JFHE 5DK2A 1I3VA 1UA6H 4IRSB 1Q94A 5C0DB 1MRFL 3MRDA 1S9KC 1CQYA 4FXLA 3SPVB 1T2XA 2BSTA 4QTHB 2IG2L 3PHQB 3TFKD 5A16A 4Z8FH 3AM8A 3GHEH 4QWWD 5E6ID 3RY6A 5DVNA 1VFAB 2NXZB 3IFOB 5H8DA 5B39A 1AH1A 1J9CT 3ESUF 5GRXG 1A2YA 3I9GL 3SOBH 4KHXH 3QZWA 1EHNA 3K74B 1QSEA 2Z8SA 4LP5A 3BDBA 4BH7A 3RWCA 2XZQL 4K9EC 1BIHA 5KVMC 2EDBA 4NM8L 5GGSY 3L7FB 4FNLL 3OB8A 1CE1H 1GHFL 4JHWH 1NEUA 5DK3A 3SGKC 1CFQA 1MFDH 5IJKC 5E08H 4YR6B 4RAUB 3SGJC 2GY5A 1A64A 4YWGL 1AI1H 4ZD3H 3LS4L 4I0KA 3ES6A 4WHTB 2PTTA 3KPMB 1T83C 4RGMC 1T03H 5C1MB 1IM3B 1UGNA 4WW1A 4EDWH 1ZGLP 1KJVA 4XP6L 1FV1B 3H7BB 3QDMD 4YDJA 4HS3B 4LVHC 4N9GB 2FH6A 1W72H 1I9EA 1ZT1A 1P4LB 1I8KA 2Y06H 3T3ME 2AK1H 4Z9KB 4GAJL 4J7RA 2PW1A 3MRKB 4E41A 1JP5A 3TBYB 5FCUH 5AEAA 1NCDH 2NXZD 1G9NC 2E7LA 1AGCB 4X6FB 3S8WA 2R0LL 3CXDL 2IPUG 1ZAGA 3STLA 5KS9F 4DZ8A 4I3RL 1IILE 5JIKA 3R0MA 4OCRH 5EC2A 2PCPA 2QQLL 4MJ5A 2MQ0A 4WV1C 3PGFL 3MRFA 1HZHH 2ZCHL 4MXWL 3OKMA 4ZSOB 1CLOH 2APVA 2DOCA 4FQCH 4ESKA 5I0DA 3BAEH 3NCCB 2YEZA 1N0XH 5E2UL 1YN7A 4QNPF 1YY9C 3WS6C 2FJFB 5HYJD 2APFA 1OL0A 2H1PL 1CDYA 3X12B 4K71C 5E2VL 3LZFH 2A74A 4KI5F 1H5BB 3EOAB 2P8PA 3HMWH 3VXRE 2AK4E 5FGBA 5F1IA 5D93B 2JIXA 5JA8B 3U0PA 2LQRA 2LVCA 4OCMC 5EZIH 2VLKA 1GOFA 4S1DC 4H88H 1S78C 5IHLB 1EHLL 1C12B 5HGBB 4LVNB 3O8XA 1DBJH 2VN4A 1S5IH 3M8OL 4JO4L 1SVZA 4L8SC 4RZCB 4B41A 4BQ8A 4D3CL 3ZHLA 2EZ0C 5J57B 4JJ5B 1MELA 1YEDB 4HT1H 5MEOA 3QJHA 3FKUS 1YUHB 4BFIB 5CEXB 4ONOA 5T5FL 1HWHB 3P9WB 4XBGA 4PFEA 4GG8B 1DFBL 1PYWA 4LGSB 1FYHB 1GGBL 43CAA 1S3KH 3P4MB 5B38B 4Z7WB 4X0KA 5TJWK 5DEFB 4P2OC 5CCKH 3VGBA 3GSQA 4MAUH 3U79A 1AR2A 3C09B 2ZPKL 3IETB 1TVBB 4UT7L 4XPFH 4YXKH 1WAAF 3CNKA 5D2NC 1CG9B 3S5LG 3G5ZB 2F19L 4ISVB 1UWEH 2R1XB 1B9ZA 4PLKC 4RQQB 3MFGB 4JFOB 4NWUL 3E3QC 1NCCH 1JWMA 4IDJL 1LO4H 5DYOB 3E6FA 1MJUL 5IB3A 5C8JB 1E4XI 3GJFB 4JCLA 4RX4A 4JDZB 4XCNA 2OQJA 1HIMH 2FSEA 4U31A 1PQZB 4H0IA 4X9IA 5GJSL 4GAGL 5I30H 4O2EB 3V5KA 1R0AH 3BH9B 3ROLB 3T8XA 1N59A 1P9MA 5I8OH 4L3EA 1ONQB 4P3DB 1QFUL 5C6WH 3INUH 4HBQA 1A7NL 5F3HB 4UOW1 3DARA 4AH2B 2ADJA 5DK2B 3AUVA 1T22B 3M45A 2ATPA 1Q94B 3A67H 3BQUD 3MRDB 1F58L 1FNLA 2A9NL 4U1GB 1KJ3H 3TT3L 2BSTB 4UIKL 4K23H 4Z95L 3N1MC 1AGBA 4WO4D 3B9VA 4PJIE 4PJ9A 2XN9A 1C16A 1RULH 1MFAL 2J2ZA 3QUML 1JIBA 2BCKA 1WZKA 3KWWA 4XNUL 3TIEA 3H3PH 5I1EL 4LCUA 1A2YB 4NQCA 3QZWB 1QSEB 4BH7B 2EIBA 5T5NF 2DM3A 4O2FA 1CFQB 1KEML 4JN1L 1DP0A 1S7RA 4KAQH 3ULVC 3HKFA 2VZUA 1YEIH 1VFUA 4EOWL 5DI8A 4NCC1 5CINL 3WFDL 3ES6B 2PTTB 4K7PY 4OFKA 2XZCL 1X4ZA 3HS0B 1P84K 1UJ3C 3BIKB 4HH8A 4NFDA 5KSAD 1KJVB 1MQ8A 4MLIA 2J1KA 4NHUA 2P42B 3Q5TA 3KG5A 3K3QA 4YDJB 1I7UB 1CGTA 1CDBA 4KWUA 1ZT1B 5HDQH 4YLQT 4FFWD 3DYMA 1UM5L 1I8KB 2PW1B 2ZCLL 1OTUD 4E41B 2DJSA 3QDGD 1AC6A 2R39A 1MSPA 4H8WH 4G6KL 1OCWH 1OY3B 3FMGH 4R2GC 3X14A 4YHMH 2DICA 3RIFK 4S1RL 3STLB 5DMIH 1JRHH 4HW6A 4UT9H 3SGKA 1U8QA 5EC2B 4K3GA 4LBEB 4MJ5B 3SGJA 4P9MH 1ZLWH 2APXA 3MRFB 4EVNA 4M93C 4KUZH 1JGEA 3O6KH 4YHYB 3OKMB 3DETC 3OAZH 3O6FC 3O2VL 2YEZB 3KPSE 4JHZA 1T83A 1YN7B 1CT8A 1S7WB 1MI5B 4KZEL 3WLBA 5F9WC 5F72S 5IQ7L 5SWSB 2CJUH 1X6LA 4AMKH 4LFHG 2A74B 2AQ1A 2P8PB 2WUCL 2GSGA 1KB9J 1IGIL 1Z3GH 2IPTL 5FHAL 2AXHA 5F1IB 4HK3N 4RBPH 5IMLA 3RTQC 5GGVY 2JIXB 1IT9H 2DQFA 3QRFM 1XGPA 1CN4A 3U0PB 2P5ED 5CEZH 2VLKB 5B4MC 3CFJA 4OF8A 3MJ7A 2F53D 5CP3H 3O8XB 4P2QD 1BJMA 1KN4L 3FB7A 5EBWA 1NBYB 3QJHB 4QY8A 3VG0H 8FABA 3MJ9L 2P47B 2OR9H 2V9RA 3LKNA 5BRZE 4XBGB 1PY4A 3HAEG 1PYWB 5D72H 1N3NA 4PJ8C 43CAB 2ILLA 3VE0A 1WICA 2PYEE 4F2MA 4X0KB 5EH1A 1CBVL 2VL4A 4YE4H 4NNYA 4L4TD 2YUWA 3VRJA 4N0FA 3WKML 5J9PB 4U6VL 5SWSD 5JNYB 4NCDA 3UJIL 3O11A 5I15L 3BVNB 2BDNL 3A0OA 1M71A 1ACZA 3MREA 4QRQB 2EDEA 4H0GA 1JWMB 2APTA 3NOIA 3E6FB 2WUBL 4R90L 3OMZA 1FDLH 4PJAE 4XCNB 2OQJB 4M6OL 4X6CF 5TQ0H 1JGUH 1V3KA 2FSEB 2AJUH 3UC0L 3DVFA 2IQAA 2WSKA 3FQNA 3ULUF 1WIUA 1IC7H 3T8XB 1N59B 5F7WC 4L3EB 3BP5B 3QIWC 4P4KA 5I75C 2E7MA 2JB5H 5L6YH 1C5BL 4OM1L 3ABZA 1VKXA 3QCVH 1MY5A 1IFHL 3DIFA 3P30L 3WNOA 1Q72H 3Q2CA 3QCUL 3FQRA 2ATPB 4BZ2H 4JPWH 4JO2H 1OP3K 4DTGH 1HHIA 3LPFA 5TF1L 1AGBB 5JW4M 2XN9B 1ZTXH 3NA9H 4HPYH 1C16B 4Q6YA 2BCKB 2BSSA 4QXWA 4U1NA 4ZDHB 3KWWB 1LEKA 3TIEB 1H3PH 4LGPB 4DKAA 5HVGB 4KRLB 4LCUB 4PJCA 4EJ1C 1CQKA 5E5UB 2BJMH 3GK8H 3FN3A 5JR1L 1RIUH 4XNQA 3I6LD 1SYSA 2OL3A 4UTBH 3V6ZA 3PL6C 1G7MA 4MZ2A 3KXFA 5LKNA 1S7RB 2GKIA 4KI5D 3FB8A 3RHWF 2P5WB 5A43C 4XX1E 5DI8B 4Y4KD 3AMLA 1QLEL 1NBQA 5DLMH 5FEBA 3WHXA 4WFGE 1WZMA 3FRPG 3HMXH 2OP4L 4JFDA 4FFYH 3FFCE 4NHUB 4PD4K 4F7PA 4AT6A 1RZJH 5JHDD 4F7MA 4S0TD 2UV3A 2HFTA 2CQVA 1OAQL 3EOTL 2YPVL 5JQHC 2HFEA 2VDRL 1NBZA 3FN0L 4PS4L 4PJIA 3FOLA 2I60H 4HZLA 2FBOJ 1NAKL 4OLEA 2CK0L 4ZFFA 1KF9B 4P23B 4RWYL 1KPRA 1AO7E 3IYLW 4LCIH 3O3BA 2DQHL 1WCBA 2WIIA 2EEDA 3IDJA 3UTPD 3QUYD 3SE9H 1KPUA 5F7YC 4CKVX 4GS7C 6CGTA 1A47A 1U8QB 4QO1A 4ONGL 1XGRA 1KTDA 2JJTA 1E4WH 1U8PB 3MODL 4EVNB 2QR0A 5D7IE 2GEEA 3EDEA 1JFQH 2DQEH 1J86A 3BIBX 3C6LC 1CT8B 3CPLA 3VXUE 3WLBB 5I1KL 1M6OB 3UYOD 5DVLA 3K8MA 2W07A 2IAMD 5C92A 4JFHD 5DUML 1A6VL 2GSGB 1CI5A 2AEPL 2RBLA 4G6FB 3F7RA 1OF2A 3LMJH 1EAJA 3VRLE 3HZMB 4OZIF 1XGPB 1MH5A 5A3IC 3DLQR 3CFJB 4KXZH 3MJ7B 1X5LA 4P23D 1GIGH 3ZDZF 1JZ3A 5B39G 1RUPL 3MXVH 1J1OH 2YRLA 5T3XE 1BD2A 4Y19E 3FB7B 3QZWG 5EBWB 3TBWA 3JV6B 3JWOL 4Y5YA 1KULA 4XPTL 4PB0L 5D1QC 4QY8B 1RU9H 5BV7C 1OPGL 8FABB 5IT2H 1HH9A 1CFSA 1IZJA 3LKNB 1A14H 3O45A 1A9EA 5SX4H 4GRLC 4HK0A 1F42A 5E56A 1N3NB 1H15B 1G9MH 4ELKA 5K9OA 3VE0B 1BGXL 1DBAH 3K2MC 4OGZA 4F2MB 2BERA 1MRCL 4J3SA 1FRGH 1GYAA 1FGNH 4NNYB 1KCUL 1AHWC 3VRJB 4RFOH 4NQSB 2BNUA 3O11B 2JCCE 5F6IC 2JJWA 3EIFA 4G3YH 2AK4B 2HVKB 1F6AA 1M71B 4CJ0A 3MREB 4G6FD 2H8PB 2DF3A 4NRYB 4AG4H 2FLRT 4KTDH 5F7MC 4IMKC 4JR9H 3L1OH 1NFDE 1HINH 4LIQE 4PP2A 4WY7H 3REVB 1ZE3C 3ZYZA 4JKWA 1T89C 2FIKA 2IQAB 4G7VL 3FQNB 3DVIA 4L9LC 4NJAH 1MRDL 4IEFB 5BRZA 3KPTA 5ICYA 2FEDC 3GEWB 4NUJA 3UJTL 3IGAB 5DMJB 3TT1L 4C56E 4OD3H 1VEOA 1AE6L 4Z77A 1VKXB 5MEQA 4UB0L 5BVPL 2PYEA 2YD8A 2AJVH 3DIFB 1PJ9A 1NCWH 4XMLL 4HXBH 3ME0A 4PJ7E 4K7PH 3FQRB 3NCEB 4ZUUA 2F15A 5FO7A 2R29H 1HILB 5CJXC 5IHUH 5SWZA 4KVCL 1NMCC 1URLA 1K3IA 4M7LH 1HHIB 4NYLA 5CJOH 4GBXC 1WTGT 2UZIL 1A6PA 1KELH 3U48A 5EORH 3VXRD 1WBZA 2BSSB 2AK4D 2E6JA 2R0ZL 4LHJB 4U1NB 1LEKB 3HNVL 1AD0B 1KOAA 1J8HA 3SDDB 3LEVL 4PJAA 4XNQB 4EN3D 4JQXC 2BY3A 2OL3B 4HWZA 1UWXK 3V6ZB 3D9AL 5JXAH 1G7MB 2FX9L 3KXFB 2YOCA 3OAYH 2ZCKL 4X9GA 4DUVA 1N7ML 3HE6C 4NZUL 2NY1D 3O9WC 1O0VA 2EH7L 5EZJA 3GRWL 3J7HA 2C4FT 3MGOA 1VA9A 3RVTD 3EDKA 4CW1A 3V5HB 3WHXB 1T6VN 4K94C 4JFDB 4F7PB 1SJHA 4AT6B 3C60C 1F45A 1U8OA 1QKZL 3MGTA 3GIVA 4JFFA 2FHCA 3EYSH 4PLNC 1NBZB 4PJIB 4HZLB 2PYFA 5DDHA 4ZFFB 5BMFL 4XPGL 2HLFC 1RVFL 4PRPD 4KKBD 1CIUA 1FFOA 2W0PA 5DHVA 2IFGA 5DF0A 1IGML 1KPRB 1N6VA 4EIZC 3O3BB 3U7WH 5GGVH 4NO0A 1WCBB 4OZFA 2WIIB 5DK0A 1B4JH 1FZJA 1UA6L 2ZUSA 1OGAA 3IDJB 5H94A 3SDDD 1CF8H 3ARFB 1KPUB 4K3HA 5F88A 3U36B 3S98A 3PL6A 5I73B 4U6YB 2V9QA 1XGRB 1KTDB 5DTFB 4Z8FL 4JVWA 1RV6X 3GHEL 3ZDXF 2QR0B 1ZHBB 4P49A 2K3TA 4QCIB 3IRPX 1KNOA 1ZXQA 4M5YH 4DOHE 2X2YA 3SOBL 4KHXL 3U9PH 3CPLB 4JHWL 1A7RH 1CE1L 4DQOH 4ZS6D 2NQCA 1MFDL 4M1CD 5E08L 4EXKA 3BYYA 1EUTA 1MCKA 4L4JA 3ULUD 1OF2B 4HKZB 1IAOB 4F8QA 3ARUA 3CVHA 1AI1L 4ZD3L 4O02H 1KXQE 1H0DB 5F93C 4EBQH 1J11A 1AO7A 3UTSD 1T03L 4YFEA 4EDWL 4NPYB 1K2DA 3MNVB 5E4EB 4P3WA 3T0EE 1BD2B 3IDIA 3IJHB 3TBWB 1UZ8A 3P0YH 4Y5YB 5D7JB 2VKWA 5EU3A 1W72L 2R0KH 3ARFD 4P2YA 5DJAA 4JKKA 1HH9B 2Y06L 2JCCF 3QEHB 2AK1L 3O45B 1A9EB 5LGHH 3B83A 2R2HA 5FCUL 2Z35B 4HK0B 4M5ZH 4QGYA 1NCDL 2IWGA 4BH8B 5MERA 4ELKB 3KPSB 5K9OB 3CDCA 3PV7A 3GNMH 3C6LA 4LPCA 2E5EA 1NFDF 2ZUQC 3SJVE 3WIIH 1EJOH 5J6GA 4OCRL 3F5WA 1A4JB 2BNUB 3HZKA 2EE3A 4NRXA 1JHTA 5GZNC 1N5YH 1HZHL 3TZVC 2WV3A 4NZTH 4M6AA 1EPFA 1CLOL 4NN7B 4RGNE 4UILH 2AVGA 4FQCL 3B9KA 3BAEL 1N0XL 4RIRB 2WANA 4PP2B 4UQ3A 2J5LC 3MYZA 2HMIC 1TPXC 1F2XK 3LZFL 3TYGH 2FEEL 2FIKB 4OCLC 2OX5A 3SHSA 3TBVB 3HMWL 1EBAA 1SM3H 1NAMH 5KOVC 3VFRA 3KJ4B 3DV6B 5D7JD 1JVKA 5BRZB 2W9LA 5HHOE 5ICYB 1U8LA 4HUUB 4NUJB 5EZIL 3D5OF 4U3XA 4Z77B 3B5HA 5MEQB 1DBJL 2XWBA 2PYEB 1MF2H 1S5IL 2P1YA 3S35X 1FYTE 2AJZA 4UAOC 5E1HB 1YEGH 4ZUUB 5FO7B 2I27N 4BM7A 5I6XC 4HT1L 3BEWA 5IBLC 2V2TA 1BEYH 2EXYC 5EC1A 1MAMH 5I19H 3BP7A 4QHNA 4YC2B 4YBQD 1S7VA 1IGTB 5F89A 4GG6F 2H2SD 3T2QA 3MO1A 3RVXD 1S3KL 1EEZA 1J8HB 1HEZA 2FLBT 4U3CA 5K9KA 2QQQA 4PJAB 1YJDH 4QRPA 3MRCA 1QYGH 4KQ4H 4HWZB 3OB0H 3LEYH 5CCKL 5DFVD 4MAUL 5JOPE 4MNQD 1JPGA 3UTQA 4XPFL 4YXKL 4LSUH 4UOW0 4IS6A 3KS0J 1UWEL 4ZXBD 5EZJB 3P4NB 5GHWH 1JK8A 1NCCL 1MWAA 1LO4L 3UEZA 4CW1B 1T5XA 2ICWA 1HIML 5EU7E 4JM2B 3ET9F 3S3SA 1VFMA 2NR6D 5HI4D 4K07A 1OD7A 3L3KA 5I30L 3BPLB 3FONA 3MGTB 1OT1A 3GIVB 1R0AL 4UDUA 4XWOC 5I8OL 2X4RA 1DVFC 2PYFB 1RZKH 5DDHB 3RWGA 2ARWA 3INUL 2YS4A 5D71H 3ELAT 1FFOB 5DHVB 3PWPA 4WI3A 5KJRH 2MCPH 4URTB 4OZFB 1KT2B 5DK0B 5H94B 1EMTH 3A67L 4WWID 5F88B 1KJ3L 2COQA 2D31A 4K23L 5E8EA 3VFUA 1FNEB 3BGFC 3NIFF 2Q20A 5C0EB 4PJBA 1RULL 3FAWA 4YDIH 2GUOA 3HE6A 2VDOH 3NCJH 1D9KA 1KNOB 3O9WA 3H3PL 1R3IH 4P5MA 4KY1H 2GITA 2X1XR 3EYQC 4XC3H 2HT2C 3S4SB 4QXTA 2BMKA 3EFFA 4YDLC 2DAVA 1Z9LA 2M26A 4JM2D 4KAQL 3T2PA 1FP5A 2HJKA 1YEIL 1CYGA 5E9DE 3CVHB 3QUZD 4ELME 5DQ9A 3WFEH 1PLGH 1AO7B 5KSBE 2DLGA 1CDUA 4CADB 1K2DB 4XTRD 5E8DH 4GW1B 4QRTB 3IDIB 1P5UA 1UZ8B 4AEFA 1P69B 5EU3B 1XH3A 1LE9A 5HDQL 3NZ8A 3Q1SH 2VYRE 1A7QH 3RKPA 5CLWA 2R2HB 4Y16D 5JPMA 1QRNE 4H8WL 3MRLA 5BOPA 1OCWL 3FMGL 5MERB 5CUSH 1B4RA 1IGJA 3I3EA 3BZDA 2BRRH 5MHSE 5TE4H 4J3XA 2C1PB 4GLRH 1G7IA 4FXGA 1MNUH 4KDWA 5DMIL 4WFHE 2G75A 1JRHL 1WWCA 2R15A 4WFGD 5H35B 5J6GB 5MENE 3F5WB 4UT9L 1YEFH 4KRPD 3QXTA 3FFCD 1UH2A 3HZKB 5I16A 4OV6F 3WJLC 1JHTB 4C55A 3O6KL 2MSPA 4JO1H 3RGVC 4GOSA 3B9KB 32C2A 1IQWL 3O4LD 2YXFA 3BZEB 1IKFH 1F3DH 4BFGA 4UQ3B 1JWSA 4LEOA 2PN5A 1OQOA 1KIPA 1QOKA 2CJUL 3BPNB 5D5ME 4U2YA 4AMKL 4QEGA 5KTEH 3U2SB 3MJ8A 2NYYD 1Z3GL 3GSXA 4H26A 3CFIC 1J8KA 1IT9L 4QT5B 2EYTA 4MSWA 1R5IA 5AG8A 1T20A 3QHTC 2O93L 1B0RA 1EV2E 5CEZL 2L4OA 2BVQA 3MA7B 4UOJA 2XWBB 5KSVA 3SJVA 4MQXD 5IR1B 1H8OA 1U92A 3VXUD 1KB5A 3UO1H 3VG0L 2R69H 3ARZA 2V2TB 3BP7B 3RIAK 2OR9L 4QHNB 1A1OA 1S7VB 3HG1E 3LN5A 3VRIB 1UT9A 4JREB 1BFOA 5D72L 2WINA 3CUPA 4WJ5A 3MO1B 1EEZB 1X5ZA 2QSQA 1HEZB 5GRJH 4PJEA 5DHXB 5K9KB 4OUUA 4NQVA 4KGLA 3LN9A 4FG6C 4YE4L 2VZOA 5AUMA 4CNIA 4X7FC 3WFZA 5JIHA 3DTXA 2AV1A 4WU7A 4XC1H 5T3XD 4Y19D 3UTQB 4GKSA 3QWQB 1PKOA 4O51A 3MBEA 1RQ5A 4IS6B 3K81A 1Q38A 1MHEA 3JUYA 5DJXA 1JK8B 1MWAB 1JGDA 3EO9H 3CXHK 2YXMA 4C56B 1QFWM 2ICWB 5AYUH 3U4AA 1FDLL 5TQ0L 1JGUL 4ODHL 2AJUL 4Y5VA 3GUTA 5JLZB 4PJ7B 2X89D 5GGRA 1S9WB 5DJZA 4UBDD 3FONB 3V8CA 1NCAH 4YHIA 4UDUB 3EW3B 4K8RD 1IC7L 3AB0B 3R8BB 3B5GA 2Q86A 3W9DB 1NUNB 2XTJC 2CKBH 2JLLA 5L6YL 2JB5L 4M3JA 3RWGB 1F97A 2HTLC 3PWPB 3QCVL 4XNZC 1Q72L 4BZ2L 4JPWL 3UPRA 4OLUH 4JO2L 3WFBH 1O7SA 4DTGL 3VFUB 1HI6A 1EEYA 2VAAA 4BKLA 3DO3A 3IKKA 1CWVA 1ZTXL 3KPQA 3NA9L 4HPYL 4PJBB 1HHJA 2GUOB 5B8CA 1D9KB 5DQDH 1H3PL 1AXIB 3BP4B 5EBMA 2QKIA 1RIVH 4P5MB 3UCRA 3QXDA 2GITB 1JNNH 2BJML 3GK8L 5D1XA 5KSBF 4C56D 4QXTB 1RIUL 4P99A 4JFPA 4NN6B 3MX0A 1D5XA 2NY7H 3TN0B 3D69A 3VI4E 2HJKB 4OCNC 4N0RA 1PKQA 3OZ9H 3GMRB 1ADQA 1DVFA 5JO5A 5IB1A 1P2CA 1ZHLA 3OX8A 5DLML 4GUPA 4LU5H 3HMXL 2GSIB 3UTZA 4FFYL 4KKAC 4Q9QH 2J8UA 4LCWE 1IEAA 3QEUA 1XH3B 3QYCA 4I3GA 3NZ8B 4WWKC 4ZOAA 1ZMYA 4R4NC 1FJ1A 1Z9SA 2I60L 1FZKA 1QSFE 4PTUA 3PGDB 4LHUA 3DMMA 2KL6A 2DMCA 1L4IA 1GZQA 1ZSDA 5JPMB 3P0VH 4DOHB 1U6AH 3RDTA 3MRLB 4LCIL 3SQBA 1IGJB 3AXLA 1NGXA 5CZKA 1MY7A 1G7IB 5D2NE 2G75B 1HYRC 3SE9L 5J11B 4AEIH 2BNRA 4OSUH 5D5MF 2H32H 5C0CE 3B9AA 1CCZA 1OSPH 3E3QE 5I16B 1E4WL 5IESH 1HHHA 4MMXC 4KJPC 5E9DA 1ZLUK 4ELMA 1JFQL 2ENYA 2XICA 2DQEL 1RI8A 5FA4B 2DYPA 32C2B 4AEHH 2G2RA 3SDCB 4H1LA 3ILPA 4DFHA 1QBBA 2G60H 4TSBH 3OKEA 1JWSB 3I75B 4TQEH 4JGMA 4LEOB 3P40A 4PJGE 5F96H 2QV2A 4OZFG 4U0RC 3MJ8B 5EFIA 3GSXB 4H26B 4I9WE 3LMJL 2EYTB 5IW6A 3VWJA 1R5IB 1TZGH 3CD4A 1T20B 1B0RB 2XZAH 3C5JA 5K9JH 1CFBA 2NTSP 1RPQA 3RZCC 1GIGL 2BVQB 4PY8I 3BPOB 1V3LA 5DWUH 5KSVB 3MXVL 1J1OL 3SJVB 3FO0H 4AENA 1U92B 3DX7A 4RMSA 1KB5B 4PGCA 1SY6A 2HRPH 3W11C 4Z5RA 1RU9L 4R4BB 1YMME 4R6UA 9CGTA 3MC0A 5IT2L 4OFPA 1VGEH 1A14L 1A1OB 4LARH 5HI5D 4PJXF 3LN5B 1INDH 3V0AC 3T2NH 1BFOB 2BVEA 1BF8A 1XGTA 5F9AC 2CXGA 4JQIH 2HJLA 2WINB 4WJ5B 1ED3A 3RGVA 4PV8A 1G9ML 1CTOA 5ISZA 3I02A 2CDFA 4U1LA 1DBAL 1G0DA 4PJEB 3QXAA 4OUUB 1FRGL 2KQNA 1GGIH 4NQVB 3SDCD 3GSWA 5FXCH 1FGNL 2HRLA 1KCRH 4CNIB 3DTXB 2AV1B 4WU7B 2E7CA 3UROR 3ULUH 1J0KA 4RFOL 2CRZA 4IRZH 3T0ED 1LQSR 2ZUXA 3NPZB 4EI5C 1HQ4A 4GKSB 4G3YL 5HYSB 2ZUVA 5GRUH 5CBAA 5FA3A 4ZODA 5H37H 4O51B 3MBEB 4RWHA 1D5ZA 4LDLB 3VXME 1I85A 5MI0B 1ZT4A 1C1EH 5HHOB 5DJXB 4AG4L 2AXJA 2DQIL 4KTDL 4Q9RH 1WWAX 1JGDB 4JR9L 3L1OL 3MLRH 1HINL 3GMQA 4WY7L 1YDPA 5KANI 3D48R 4YXLH 2MFNA 1MCEA 3GUTB 1L9MA 1JNJA 5SWQA 4HEME 3QIBA 3ARQA 5GGRB 3WBDA 5DJZB 5DRWB 1K8DB 4TOYH 4MDJA 4NJAL 1A3QA 2Q86B 4NQXA 4O9HH 2X9YA 2FX8H 5TPWH 4P2RA 5FYKU 1U42A 5DJDA 3GB7A 2X4OA 4OD3L 4APQD 2VXSH 3K1KC 2B39A 4I0PB 1VCAA 4RGND 5CGMA 2AJVL 3B9DA 1NCWL 4HXBL 2EECA 4K7PL 3QUMA 3UPRB 2BY2A 3IFNH 2R29L 1LK2A 5IHUL 1VERA 2ZUTA 4M7LL 5D2LA 5CJOL 2OJZH 3PWNA 5ADPH 4BKLB 1I8LA 3VI4F 4OAWB 1KELL 5EORL 1HHJB 3H9ZA 5B8CB 3MUZ1 4QOKA 3MV9E 3D39E 3DECA 1NLBH 2JJSA 4FOMA 3GBMH 4QGTA 1NMAH 5C0AE 2QKIB 3E8UH 3QXDB 1RK1B 2NW2A 1DCLA 2VZTA 5D1XB 2YN5A 1ZS8A 4ZTPH 2H6PA 4JFPB 4TULH 1U2CA 3RWDB 5JXAL 1D5XB 1XR8B 1FYTD 3D69B 5ID0A 5HYQA 1AP2A 4LOUC 1EBPA 2AKRA 4F80A 1PKQB 5C0GA 1NLDH 3OGOE 3QP3A 5JO5B 3LIZH 5ETUA 3V4UH 3SGDI 2F54E 5M94B 5IB1B 1P2CB 3OX8B 4MB4A 4UTAH 4GUPB 1CFNA 3QIUC 1AGEA 3G5VB 1YJDC 4I0PD 4NC1C 1CVRA 2NY2B 5I71B 4OFYD 2J8UB 2R8SH 3EYSL 4WVRA 1UENA 4PV9A 1FJ1B 1FZKB 4GKOA 4PJCF 3SE4A 2ED7A 5JOPD 3TO4D 3DMMB 1ZSDB 1K85A 3EGSA 3WV0A 3MPCA 3RDTB 2AQ3A 5AAMA 3U7WL 4MAYC 5GGVL 4A2MA 3NIDE 1B4JL 1BBDH 4NQDE 3WIFB 1CF8L 3TWCH 2BNRB 1QZ1A 2EE6A 1NMBH 5HGGS 4MVBD 1IGCH 2BRQA 1HHHB 5E9DB 5C6PB 4ELMB 2Y7QA 2Z8WC 1ZGLA 4M5YL 5FUZH 4PGBA 1EVTC 2WMPA 2F5BH 4HUNB 1RZ8A 3BESR 2CLRA 4MQTB 1P7KA 2G2RB 4DVRH 2W38A 3ILPB 4H1LB 3U9PL 1PD6A 1JF1A 1A7RL 4DQOL 2AXGA 2F5AH 4YHOH 5FK9B 2NW3A 5EFIB 5I8KH 3GFUA 4CU7A 1JPST 4O02L 4ZUSA 1U95A 3RKDC 5IW6B 3VWJB 1OSZA 5BW7C 4UMGA 5C9JB 2WBJC 2YPLA 3C5JB 4EBQL 3FN9A 3DX9A 3S36X 1AIFA 5HHME 3OJVC 4NBYB 4V1DA 3SE3A 4AENB 3ULVF 4QHMA 3LN4A 1T7WA 2Q76A 3FQXA 3P0YL 4Y0GA 4PGCB 1HHKA 2R0KL 2X4TB 1WFUA 1D5IH 2EH8H 5LGHL 1U8NA 4OF6A 4RFNC 3GMMA 4M5ZL 2HJLB 4R9HA 1ED3B 5CFHA 3I02B 4JM4H 4BQ6A 5ISZB 2CDFB 2GJ6A 1KJMA 3DPBA 4U1LB 3SCMB 3GNML 3SEPA 5J13B 3WIIL 3G6JA 1X5YA 3LRGA 1CL7H 3GSWB 1EJOL 4XRCA 4O2CA 25C8H 2ZNWA 1IBGH 4FZ8H 1HQ4B 5CZXC 5CBAB 1N5YL 5FA3B 2XOTA 4NZTL 1D5ZB 3HC0A 2NX5A 4P2CG 4UILL 4N8VB 5IKCA 3U0WH 3RNKA 2K1MA 5TDPA 1QRND 3JUZA 4YHZH 5B3JE 3GMQB 3VWKA 1YDPB 3RZCA 4ODSH 3NACH 4GRWE 1S9YB 3TNNA 5SWQB 5MHSD 3QIBB 3TYGL 4WGVB 2PXYC 2FIRT 4WFHD 1SM3L 4PGEA 1NAML 4OCSH 4FTVA 4MDJB 4N9OB 4E5XA 5MEND 4ZAKC 5ALBH 4NQXB 5C0NC 2X4OB 3KHOA 1OP5K 1M7XA 4U05A 2J12B 3Q6FA 1J88A 1RUKH 1MF2L 5DD0H 2APBA 2X5PA 1KIUA 5FUOL 1WIPA 3SCMD 1YEGL 3QUMB 4PP1C 3UDWC 1F6LL 1LK2B 4OKDA 2BX5A 2OXGA 1C5DA 5E6YA 4OKVA 1BEYL 5I19L 1MAML 2IADA 3PWNB 4BELD 3AY4C 1VPOH 1MHHA 1SJXA 4QHUA 1I1RA 3CK0H 3KLAA 4H5SA 5GS0C 4P46C 3K46A 4R4FH 5DUPH 3HE7B 4OZGE 1NC4A 1RHFA 2NW2B 1ZS8B 3HUJE 1YJDL 2H6PB 1QYGL 5JW3H 4KQ4L 1ZEAH 1V8HA 3LEYL 1BQHB 5IWLC 4JAMB 4M7KH 5HYQB 1AP2B 4LSUL 2AKRB 2JKXA 3WNKA 4LDOB 4N68A 4KDTA 5ETUB 3TCXA 1I8IA 4ONFH 5GHWL 4JG0H 3A6BH 1CFNB 3HG1D 3CH1A 1AGEB 3GKWH 4PJHE 4LCCB 3T0DA 1IC4H 3NIDF 1N0LA 2X4SA 3QO0A 1U93A 2ZUYA 2LTQB 4KFZC 4HCRH 2E6QA 2E8ZA 3ZE2E 4OLYH 4PV9B 3WE6A 1RZKL 5B21A 4FQXA 2NY0B 5D71L 3QO1A 3MV9A 5HJ3B 5DMYA 3SDAA 2YUVA 3BHBA 1MHCA 3IXTA 4NIKB 5KJRL 2MCPL 3CSPA 5C0AA 4WUKH 1XGUA 2CKNA 5D7KE 3EJJX 1EMTL 1C08A 4S2SB 3LQAH 5DUBA 3WO4C 3O6MH 1EA9C 2X4NA 3X11A 5DZNA 5CSGA 4YDIL 3S97C 5IMKA 1M7DA 2VDOL 3NCJL 5DJ6A 2Y7QB 1ZGLB 2W9DH 2F54A 4PGBB 1R3IL 1RZ8B 3W39A 1MREH 5DSCA 4KY1L 2CLRB 7FABH 3L5HA 4WTZA 1IAII 4XC3L 3FOMA 3VU2A 4JQVA 2PR4H 1JF1B 2HTKC 1MCLA 1KCLA 3MLPA 2CDEA 2EEBA 2AXGB 3CSGA 3BUTA 5GRYA 2MQ3A 2EDDA 2NW3B 4G5ZH 4NOBA 1BJ8A 2N4IA 4ZUSB 1U95B 3N1PC 1OSZB 3WFEL 2YPLB 1P6AB 1PLGL 1U3HA 1YY9D 4DKEH 4NQEA 4Z7VE 1PDKA 3DX9B 1AIFB 4YPJA 5EDXA 3OTTA 1UYWH 5E8DL 3OKKB 3HAEH 4V1DB 4UNUA 4QHMB 3LN4B 2Q76B 3FQXB 3DOSA 1HHKB 1RZGA 1QR1A 1UH4A 4CDHA 5C0CB 3Q1SL 4RRPA 4PR5A 5J1SC 4HAGA 1A7QL 1A6WH 1ZLSH 1WT5A 3NFNA 1E27A 4S1DD 1FVDB 1BECA 3GMMB 4RAHA 5CUSL 1IM9A 5IW3A 4BQBA 1WFTA 2DLTA 1KJMB 2BRRL 5TE4L 3FB6A 4IRJC 2EZ0D 4LSTH 3G6JB 1MNUL 2DMKA 3T0VA 4YXHH 5LGJA 4ODTH 4XRCB 3LKSB 1T4KA 4O2CB 3QAZC 1YEFL 4R97B 2QADC 1I4FA 2A6IA 1T7VA 4U1SA 5CBEA 2J4WH 4LCWD 3X17A 3MUGA 3HC0B 2NX5B 3QXUA 4JO1L 4WI7A 2PO6A 1QSFD 2ARJB 5IKCB 3QPQC 4LHUG 3RNKB 2VLJA 3DXAA 2Z31A 1V3JA 5TDPB 3NMEA 1IKFL 3VWKB 2FHBA 4LLUA 4ENEC 5D9SA 4P2OD 2LU3A 4ZQKA 3TNNB 4PRNA 5IROC 5KTEL 4BFBD 3LB6D 1NGYA 4JKMA 4PLKD 1YMHB 4Z7UE 3VMNA 5C0CD 1B6UA 4EUPB 1EO8H 3DRTB 4JZJA 4WFFD 2RQ8A 4GAFB 5FO8A 4CMMA 2NY5C 3Q6FB 3O3EA 3V9FA 5JORA 4OZGF 3WIHA 1DQJB 2AEIT 2FO4A 5EZOH 3HUJF 4WEBH 1ORQA 4HC1H 3QG6A 3RWJA 2RAMA 3UO1L 1C5DB 4F37F 5DR5H 2R69L 4MD4A 4HH9A 3JVGA 2IADB 2X41A 2Q87A 3DUHA 1LDSA 1MHHB 4M1GH 5SX5K 1CLZH 3FTGA 2EDWA 4QHUB 4I9WD 3KLAB 4IIQC 3ARRA 2DLFH 1I3RA 4YUEH 4X4MA 3V0VA 2IH1A 3KNBA 2AEQH 5HHPA 3AROA 4LPUA 3WEXB 2YUZA 4NN5C 1W0YT 3GRWA 2ERJB 4XC1L 3WDJA 2PXYA 5D6DA 2VDMH 3SKMA 3ZE2F 1NGPH 3D85D 3QEQA 1YMMD 5L0QC 4U6XA 4D2NA 1I8IB 1AKJD 5EULV 5F1KC 4BUGA 4TNVK 3EO9L 1Q0YH 5AYUL 4DEPC 3CH1B 3DHJA 4JEGB 1MCJA 2C3XA 1A3LH 3VCLA 4GKZA 2MKLC 2X4SB 3QO0B 1U93B 3VGEA 3RY5A 3ULVD 3UDWA 1XGYH 4I18A 3B6SA 1NCAL 4Z0BH 2NY4C 5DGRA 3WE6B 4FXKA 2CKBL 3AY4A 2WAHA 4FQXB 3QWRA 2NXYB 3QO1B 3MV9B 3SDAB 3RUGE 1MHCB 3D39B 3RX5A 3C5ZC 3BZFA 3MOBH 3O2DH 4P46A 3VXMD 3WL9A 1ZHNA 5C0AB 2FR4B 2CLZB 1UM6H 3BXNA 5F9DC 3MROB 1C08B 3PWVA 2DJ4A 2B7DT 3WFBL 2A2QT 2GAZA 3IF1A 5DUBB 3BIAX 3K0WA 4HEPG 3HNSH 3S37H 5IFHH 5ITBH 5IWLA 4X99A 2X4NB 5E1AB 3X11B 4YHKH 1GXEA 5IMKB 1M7DB 5DJ6B 3QUXC 4R2GD 2F54B 4M7ZB 2Y07H 1K4DA 3TA3A 3W39B 1RIVL 5DSCB 2KH2B 1JNNL 3FOMB 4R26H 3ZKXB 5TGBA 3WN5A 4YDKH 2CDEB 4HG4J 1SBBA 2NY7L 3D2UA 3QI9A 5FHBH 5GQBA 1NSNH 5BCAA 4JRYA 4LAQH 3TVMC 3DETD 3OZ9L 3O6FD 5C07E 2FYYA 4KPHH 1KPVA 4G8IA 1U3YA 3VI3E 1CZ8H 1NCUA 2ICES 4J4PA 1W72A 2C4FU 4LU5L 2P8MA 3D18A 1UG9A 2WBKA 4EQ3A 3D39D 2J6EA 2VNCA 1NKRA 3WDIA 3MNZA 4Q9QL 4XAKD 4OZHA 5CEZE 1J0YA 1CE6A 1KYOJ 1RZGB 1QR1B 3RTQD 2I07B 4PR5B 4Y1AA 3VGHA 4M7JH 4MJIA 4U2ZA 1INQA 4YHPA 3NFNB 3RBSA 1E27B 3T3PF 2XACC 5B4MD 5C09D 4A6YH 3P0VL 2R2EA 3EYOB 1U6AL 3BI9X 2ZP0T 3ZL4H 5JXEA 2EDOA 3FB6B 4RISH 3VXSA 1KGCE 1LGVA 3K4ZA 4M48H 2OM5A 1WQVT 4U33A 4AEIL 5I75B 1T4KB 1GGYA 1EUUA 5F71A 4OSUL 2ESVE 2I25N 1I4FB 1OSPL 3MV7E 4YIQA 5IESL 1QLRA 2B4CH 1E4KA 1GH7A 4OLWH 4Y4FC 3MUGB 2ED9A 4Z7UF 5I1IH 4PJ8D 2PO6B 3BMVA 3MA9H 5BS0D 2VLJB 3DXAB 4V2CB 4AEHL 2Z31B 4NNXA 4Z7VA 2G60L 1F4HA 4LLUB 4TSBL 5D7SH 3N06B 3ILQC 4TQEL 5C3LD 1Q9KA 5D9SB 5B22A 2DTMH 3MOAH 4ZQKB 5F96L 3EO0A 3WDHA 2HP4A 4Q97A 5L7XH 1K4CA 3UZEA 4NQDD 1J0JA 5LGKA 3TJHC 1JYWA 1QHOA 1PX3A 1L9NA 3QDHA 5FF6A 1TZGL 4NM8H 3WJJA 4TYUA 5D1ZC 1HKLH 4HUWA 2XZAL 2XY2A 3PIQA 5DRNA 1Y0LA 3SO3B 4BSJA 5K9JL 4JZJB 5FO8B 4CMMB 1AFVH 5JORB 5DWUL 3I3BA 2BOCA 3FO0L 4UQ2A 2FO4B 1ORQB 3UAJC 3QG6B 1DEDA 2HRPL 1QBMH 1ZGLM 1QQDA 3QNXA 3QIWD 4MD4B 4HH9B 3VGGA 4U1MB 3CLFH 3WO3B 1VGEL 4LARL 1MJ7H 1INDL 3FTGB 4LKXA 3T2NL 3EFDH 4IOFD 3NBNA 3OR6A 4AY0A 5J12C 4JQIL 4OGYH 1I3RB 2LV4A 3UJJH 3JTTA 3V0VB 2IH1B 2DTSA 2HT3C 3PE9A 1GGIL 2VDLH 5LAXA 1ZLWK 4PIRF 1KCRL 4GRWB 5HHMD 3LH2H 2IF7A 3ULUL 4IRZL 3ARGC 4PRBA 3OAZK 4OIIH 3VD3A 2D3VA 3MRJA 1INEH 5F9JA 5GRUL 3SKMB 3CFEA 2YSSA 3K7UA 3QEQB 1CDIA 4W4OC 5I74C 4U6XB 1C1EL 4NO0D 3D1MC 1R3KA 4Q9RL 1UB5A 3B3IA 3REWA 5C08A 5JZ7C 3MLRL 5AD0A 5EU6D 4YXLL 3I6KA 3VCLB 3PL6D 4UDTA 5CSZB 1UM4H 4RBPK 1LP9E 4I18B 3T4YA 3CLEH 3GDBA 4TOYL 2AXFA 3QT2A 1YN6B 4HS8H 4KK8C 3BD4A 4HS6A 4FXKB 4O9HL 1BOGB 4PJEF 3ARBC 2FX8L 5TPWL 1F3DJ 2BK8A 2VXSL 1B0GA 2ICEA 3BZFB 3WL9B 5KVFH 1ZHNB 2JK5A 1RJLA 5I8EA 3FQWA 3BXNB 1GPOH 5DA4A 4Y7MA 3IFNL 3PGCB 4L4VA 3PWVB 3IF1B 1FNFA 1AGDA 2OJZL 1UADC 4X99B 3BKCH 5ADPL 5FYJU 2M1KA 2CR6A 1DN2A 1GL4B 3CDFA 4H25A 1KIRA 4W81A 3IT8D 3C6SA 4P48A 1NLBL 3GBML 1NMAL 5EUOE 3TA3B 1BIIB 3E8UL 3VI3F 3AREC 1T21B 4MB3A 4ZTPL 2EYSB 1XF1A 1UH3A 4LQ1A 4ODVH 2X1OA 1VACA 2EDHA 4TULL 5TGBB 1QPXA 1ZT7B 3IKCA 3QI9B 3W0WA 4JRYB 3PNWA 3ZO0A 1NLDL 3IDUA 3RVVD 3V4UL 3LIZL 5D7LE 4Y5XC 2FYYB 3VGAB 1KLUA 2PF6A 4GQ9H 1KPVB 4UTAL 1FPTH 1W72B 3C5ZA 3D18B 2R2BA 2X4UA 2EDNA 1MUJB 1WEJH 4HMEA 3VJ6A 2BOBA 4Y4HA 5FIEA 1CE6B 2R8SL 1WC7B 3L5WB 5DD5H 4KI1A 4WHDA 1NL0H 1MJUH 3LDBC 4Y1AB 3NH7H 1G6RH 1QFHA 4MJIB 1INQB 4YHPB 5A3ID 1KXVC 3H0TA 3VFNA 5E6IC 3NTCH 1EIBA 1NCBH 3BD3A 1BBDL 5F7EH 2FBJH 1AGFB 2NZ9C 1XFPA 3OBAA 3VXSB 3TWCL 4KV5E 5D1QD 1JHKL 1WSST 4F9LA 1HSBA 4JHAH 4Q0XH 1NMBL 1YY8A 1I1AC 4YIQB 1BPVA 4YEFA 4JY4A 1VEMA 4CVXA 1IGCL 4L1HA 4MNGE 3BP6A 3L3DB 4GRLD 1QLRB 1RMFH 3KYAA 4KROC 4K9EH 5FUZL 3AU1A 2F5BL 4G8EA 1S7QB 4AZ8A 4DVRL 4Z7VB 3ZE1E 2JB6A 1Q9KB 5EBLA 2XTJE 3EO0B 3LQAC 4G9FE 2F5AL 2H9GA 4YHOL 5INCA 5I8KL 4FN0A 5CP3A 2RGSA 2YZ1A 3WS3A 5FF6B 4IRSC 5L2KE 3BPCA 4PJDF 5I17A 3QH3A 4HUWB 3PIQB 5DRNB 3LRSA 2UWEA 4QRRE 4QRPD 2Y72A 4DK6A 4QRSA 1NANH 1S5HA 1FL5A 2NXZC 4UQ2B 3SKNA 5L2JA 2EXWC 4WTZG 4PJ5A 4WDIA 5DO2C 1S8DA 3NFSH 2YD9A 5FM5M 1T0NB 1X4YA 1PG7H 3QNXB 2ESVA 5IK3B 4P0DA 1D5IL 4OD2A 4ZPVA 1J12A 1G9NH 3NPSB 3T1WA 2FEDD 4DKFH 3UTTA 2XYCA 4S1QH 5F3BB 4LKXB 4WCYH 3OR6B 3HB3C 5L88H 3MLXH 5IEHA 5CKGA 1EAPA 3JTTB 3TLRA 1HNFA 2OK0H 3HFMH 1P7HL 1JTPA 5LAXB 4TVPE 1CL7L 2VIRA 25C8L 4GBXD 4GFTB 4PRBB 1SJVA 1OTSD 1IBGL 4FZ8L 4JFEE 4HKXA 2XI9A 2P8LA 2VLRA 5F9JB 3CFEB 2YSSB 1JV5B 3WFHB 5F9OH 4RRPG 4S1RH 1ROWA 2W0KA 3QFDA 2NZIA 3U0WL 4WI9A 5D1ZA 1UB5B 3B3IB 3REWB 4WEUD 1WFNA 4YHZL 4P5TA 4ODSL 4K7FA 3I6KB 4OJFH 1JZ7A 3RNQA 3NACL 4IJ3B 3ZZ1A 3KLSA 3T4YB 5ESVA 4LSPH 3HE6D 4OCSL 2AXFB 3U6RA 2X7LA 5ALBL 4YK4B 4G8GE 3G5XA 4LLWA 4PLJC 4JFYA 4OCYH 1B90A 2ICEB 4J3OC 2JK5B 3EKCA 1RUKL 5EN2A 5I8EB 5DD0L 2AJ3A 3C60D 3FQWB 4M00A 4JZNA 3MRMA 5AZEH 4L4VB 2YD2A 4GXVH 4XNMA 3IRZA 3BH8A 4X5XA 4QTIH 5E7FA 2NY3B 4Y2DA 2DMBA 1VPOL 2HLFD 4S0SD 3V79C 2L7JA 4F9PA 4H25B 4W4OA 3CK0L 1KIRB 3PP3H 3PQYE 1H5BC 3C6SB 3MLWH 5EZLA 4R4FL 3L3OA 1GGCH 5DUPL 1EZVY 1WV7T 2R0WH 5D93C 3QDJA 5JW3L 1ZEAL 5HYFA 3IKCB 4X6EA 1LP9A 4G80A 4LVNC 3PNWB 2W60A 1KLUB 4ONFL 2IBZY 3B2UC 4X6BA 1TNNA 4JG0L 5DFWH 1U8JA 3A6BL 1PW3A 1YPZA 3GKWL 1F4WH 3MQIA 1IC4L 5D2LF 2X4UB 2A73A 4PRIA 3BJLA 3THMH 2GJZA 2BOBB 2H3NA 4Y4HB 4I2XE 1ZLVH 3G5YA 1EZVX 1IKNA 4HCRL 1FIGH 2HJFA 1VEPA 4OLYL 5FV2A 3TYFA 2A6KA 1J05A 3H9SA 4XP9H 4O00A 2GK0A 4NO2A 3G08A 3H0TB 3BWAB 4LCYA 5HDBF 3VFNB 3C09C 4PGZA 4WUKL 3PDOA 1Y6MR 2IBZX 2P4AB 4NC2B 1HSBB 3GSNA 3X3GH 2FD6H 3LQAL 1SVCP 1YY8B 3GSVA 2R1WA 4JY4B 3O6ML 4M02A 4CVXB 3BP6B 1CICB 1A6UH 5ALCH 1FG2A 2MMXA 3BUYA 2ZUUA 2JELH 3FZUC 4DGYH 1AQDA 5C07B 2W9DL 4CMHB 4XZUA 3UBXA 3AU1B 4G8EB 2BHUA 5EO1A 1MREL 1TZHA 7FABL 1MEXH 2XT1B 3OAYK 3QB7C 3ULVH 2PR4L 4LKCA 5EBLB 3ZT6A 3F6LA 4Q74A 3SQOH 3TJEH 1OTTC 4CBPA 3D87B 2H9GB 3TZVD 5INCB 4G5ZL 3RVWC 3MV8E 5JW5A 3TBSA 3WS3B 1VFBA 1DDHA 3OKLA 4N8PA 3BPCB 1EXUB 3DUSA 3W9EA 4U1GC 1HKFA 3QH3B 4DKEL 1DQQA 5E6IA 1ACYH 2HMID 3AM8C 1UYWL 1S5HB 1FL5B 3RY6C 3SKNB 1MIMH 4PJ5B 5HHVH 1S8DB 2OI9B 1P1ZB 3QR2A 2ESVB 4MCZA 1LE5A 3JSSA 4ONHA 4OD2B 1A6WL 4HLJA 1ZLSL 2VQ1A 4PGDA 3UTTB 2DI7A 4X5WA 2D0HA 4LSSH 2VOTA 4KJYA 3KLDA 4XI5C 5I1LA 4X9BA 4LSTL 4BK5A 4XVJH 4YXHL 5GISH 4OB5L 2VIRB 4ODTL 1MCOH 2DLIA 3V6BR 5IBLD 2EXYD 4I0CC 2BVOB 4HKXB 2P8LB 2J4WL 2VLRB 2WWKO 3VXTA 3QDMA 3TESA 4NC1E 4WI2A 1ZV5A 3BE1H 4BFEA 3RU8H 4RDQG 4Z6AT 3P9LA 1BX2A 4P5TB 5GGSB 3VDAA 2JJUA 1WCQA 2HH0L 3VW3H 3RNQB 5GRVK 4M3KB 1CFTA 4PUBH 2CUIA 4JY6A 1MCRA 1KEGH 3ORJA 4BUHA 4L29B 2E7LC 4P2QE 1KGCD 4Q6IA 5ESVB 3MCKA 2B4CC 2X7LB 4GW5A 1RUMH 1TMCB 3LV3A 3MV7D 3G5XB 3SY0B 3L7FA 3BGMA 4JFYB 5C0BE 1EO8L 5IP4A 3O3DA 1UXSA 4XMKH 2CSPA 2PNDA 5CIPH 5DRZA 5EN2B 3RI5K 2AJ3B 2KZ1B 4YHYC 5EZOL 4MD0B 2CUHA 3EYFA 3MRMB 4WEBL 4CVZA 4HC1L 2Y36H 4XNMB 3VMPA 3MRHB 1LEGA 1XCTA 3BH8B 4X5XB 5DR5L 2O61B 3DVGA 3N85H 4Z7OF 5HYJA 4L4TE 4Y2DB 4M1GL 1CLZL 2ZNXA 4LF3A 4CGTA 3SBWA 3H7BA 2DLFL 1P4IH 4YUEL 3L3OB 2AEQL 1T1WA 2W0LA 5FGBC 2WM0A 3HPLB 1ZHKA 3V6FA 3MV01 5CJ8A 5KANG 1J1PH 3MLVH 3QEGH 4NZJA 2AEWA 1U3JA 4X6EB 1LP9B 1KG0A 2VDML 3KS0H 4PJFA 1A21A 4G80B 3O8XC 4X4YB 3W5MA 2VKXA 1NGPL 1X9QA 2W60B 1CU4H 5DT1H 1FL6B 5DVMA 3EZ8A 1XF4A 3EYQD 2YHGA 1Q0YL 1U8JB 2HT2D 1FAIH 4LAJH 3BRGC 3R4DA 1YPZB 3U1SH 2HKHH 4ZPTA 5E8PA 1A3LL 1C5CH 1F90H 1G1CA 2A73B 4PRIB 1DN0B 4X7CC 3OKYA 2GJZB 3RX8A 3X3FH 2H3NB 1XGYL 5ACLA 2FNBA 2FATH 4Z0BL 5KZCD 3TYFB 4RFEB 2W0FA 4ZO7A 5KS9E 1R3HA 3H9SB 4KGJA 1DR9A 4ZFOL 1MCFA 3BKJH 4LCYB 1A9BA 4XMPH 1QFWI 3O2DL 3MOBL 3VFTA 5F44A 2HLAA 4JVUA 4YBLB 1UM6L 3OKDA 3PDOB 1I7RA 3DNKA 3FT4A 5F6HI 3IDNA 5IFHL 5ITBL 3HNSL 3S37L 4QNPE 5IVXF 3GSVB 3I6LE 4YHKL 5GGTH 5JW4Q 1FG2B 3BUYB 3GM0A 5D7LB 1AQDB 4XZUB 5CILH 3UBXB 1OAUH 2Y07L 3K1DA 3KPRE 4JJ5A 5I2IA 1NGZA 5DJ0A 3OB0K 1TZHB 1YUHA 3EOYG 1P9MC 5E8OA 4R26L 1Y6KR 4YDKL 1T04A 4GG8A 2XWTA 5FHBL 4ETQA 1NSNL 4ZG1A 1T7ZA 5GGRY 3TBSB 3HRPA 1VFBB 3BQUA 1KJ2H 4LAQL 4Z7WA 1DDHB 4MS8C 3OKLB 3IAQA 5DEFA 4QXGH 4KPHL 1F4YH 4WO4A 5CGYC 4HWUA 4ZO6A 1CZ8L 2ADIB 2LAGB 1DQQB 4ZUTB 1LO0H 4PJ9C 2D0GA 1DLFH 1T1YA 2P44B 5IVOA 4OZ4B 1S7SA 3JWNC 4MCZB 1LE5B 5C8JA 4M7JL 4MNGB 4ONHB 3LHPH 3BW9B 1B2WH 2B2XH 2VQ1B 4PGDB 4DAGH 4DFIA 3OSKA 4X5WB 1JMXA 5BZDA 4KJYB 4ODUA 4A6YL 1PQZA 3RAJH 5D7LD 2A0LC 3QXVA 3ZL4L 1WAAE 2E8YA 4RISL 2DBJA 2NY6B 1K3ZA 4M48L 2FO1A 1MCBA 2AABH 3S7GA 5FOJA 4X4ZA 5C2BH 1WFOA 3SE8H 4P2RD 3M17A 2B4CL 4OLWL 3QDMB 1T22A 5I1IL 3KJ6H 3LKOA 2OR8A 5DJ2A 3MA9L 4DW2H 1G7JB 3P9LB 4QRRB 1NAMA 1BX2B 4FG6D 1JI1A 3SDYH 5D7SL 4MJ6A 3LVEA 3QDGA 1UQSA 2DTML 3MOAL 1T1ZA 3LKQA 5L7XL 1CFTB 3IVKA 4KMQA 4JY6B 4P23C 3CGTA 4Y2OA 5HTSA 4Q6IB 3MCKB 1BMGA 3MFFA 4GW5B 4HGWA 1UEYA 3LV3B 1O7VA 4P5KB 3BGMB 1HKLL 3O3DB 1UXSB 4Z7QF 5AG9A 4N0UA 3LD8B 1ZWIB 5FB8B 1AFVL 5DRZB 5BV7H 5J89A 5TDNA 3EYFB 4CVZB 4LLAA 4Z7NF 4BA8A 2VITA 1QBML 2NY6D 1LEGB 1XCTB 5EIQA 1TQCB 2XTJD 3DVGB 4TN9A 3HS0A 4JFEB 5HYJB 4G9FD 3CLFL 5D96B 2CK2A 3BIKA 4TNWF 5HVWA 1E4XH 1PGRB 1U9KA 1TDQA 4ORZC 1MJ7L 3EFDL 4LF3B 3MLTA 4OGYL 3UJJL 1I7UA 5L2KD 4MWFA 4NDMB 2UZXB 1T1WB 5EG6C 5IFAH 5L8LB 1Y6NR 2VDLL 1ZHKB 2P5EA 1MFNA 4QRRD 5E5RB 3V6FB 2F53A 3LH2L 1KG0B 4OIIL 4P2QA 1INEL 4PJFB 4OI9A 2CD0A 3JTSA 5T33H 1KCVL 2KDGA 2X4PA 4G8GB 4U6TA 2VDKH 2GYSA 1DEEB 1DUYA 1RUQH 3KYOA 1OM3H 1XF4B 4S1SH 3CCHA 2G9HA 2DJUA 1R5WA 4LBEA 3PDGA 4ZPTB 4POZC 5E8PB 3E6HA 1UM4L 4NGHH 5EPMA 1ZOXA 4J3UA 4Q2ZA 4YGVA 4TVPD 3CLEL 4HS8L 1S7WA 1MI5A 2W0FB 3CZFB 4L4TA 1R3HB 3BJ91 4JFED 5SWSA 4PBVC 5KBNC 1A9BB 3PQYB 4DUWA 1NUFA 5KVFL 2V5RA 3VFTB 5HPMB 4KKAD 1TVHB 2HLAB 3V6OA 5FAAA 1GPOL 3OKDB 1I7RB 3FT4B 4WWKD 5IG7A 4R4ND 1QA9A 1KSRA 3IDNB 4N0YH 3VDBA 3BKCL 5DC4B 3QCTH 3LY6A 1YC7A 2E7HA 1NBYA 1EX0A 1FC2D 4G8GD 5I2IB 1NGZB 5DJ0B 15C8H 3SGEI 2A83A 3BT2H 1JUFB 2MWCA 5MP6H 2EDJA 4HHAA 4P4KC 5E8OB 1I7ZA 4KKCC 3MUJA 4ODVL 1A0QH 2ZZUT 1T04B 1MLBB 4NWTH 4TTGA 2XWTB 4ETQB 4NQUA 1OAZH 3BQUB 4IMLA 4MA7H 2OCFD 4GQ9L 4K94H 4WO4B 1FPTL 5J9PA 5JNYA 4PGJA 2E6PA 3PQYD 3BVNA 4PRPE 4JFXB 4U4BA 4TSCH 4QRQA 2Q3ZA 1WEJL 1T1YB 2YK1H 3E1F1 1FNHA 1CGXA 3BN9C 1S7SB 2BNQD 5DD5L 3PUCA 4AM0A 3CFBA 4B50A 1NL0L 1J0IA 4G8FA 3S96B 3X13B 3NH7L 1G6RL 3OKNA 5LXGH 4AYFA 2EICA 1HHGA 1JZ8A 2E3VA 4XP1H 1YQVH 5BZDB 4ODUB 4OIAA 3WNNA 3I6GB 4H20H 1I7TA 2IMNA 3NTCL 1NCBL 4Y4KA 5F7EL 2VDPH 1BF2A 2FBJL 2YZ8A 3BP5A 4BZYA 4D9RD 3W11D 4JHAL 4Q0XL 4PRDB 1G0XA 5KSAB 3NABH 1A4KA 4X6CE 1G6VK 3MV8B 1CGVA 3M17B 1RMFL 3JXAA 5JHDA 1IAIM 1H8NA 1QR4A 3OJDA 4JE4B 4K9EL 3LKOB 3MBXH 5DJ2B 3ULUE 1J5OH 4FA8A 3JWDH 2K7PA 4OZHF 1NAMB 4JRXE 4MJ6B 1X5FA 3QDGB 1UQSB 4XP5H 1T1ZB 3LKQB 3IVKB 3UTSE 4N1HB 4RDQF 4ZDHA 4KMTL 4EI5D 5GSRB 2QHRL 2ICWI 3MFFB 3ZKMC 1CXKA 4HGWB 3QUYA 1LO3H 2ITDB 3O3AA 3KDMA 3ARFC 1NC4D 2LAAA 1I1YB 1QBLH 5JUEH 3D0VA 5I73C 4N0UB 4HFWB 2JJTC 5F70A 4RMUA 2P5WA 1FCCA 5I8CB 3AMKA 4HSQA 3KHQA 3S6CA 5TDNB 3FFDA 1XCQA 5DD3H 2EIZB 2VITB 2PUQT 3NFSL 5TFSH 1PG7L 4TUKH 2YA0A 3MMEA 4LSVH 1G9NL 4K2UH 2YC1A 2DM2A 4DKFL 4S1QL 2IAMA 3MV8D 4WCYL 3MLTB 5EIIA 5L88L 1GSMA 3LKPA 3L9RA 3MLXL 4MD5A 2OK0L 3HFML 4MWFB 1MCSA 1GC1C 2Q7NA 1X6NA 2P5EB 1Z6JT 3CMOH 2L0DA 2F53B 4P23A 3FO9A 1FSKB 4P2QB 4MA1B 2VH5H 2VZ1A 5E4EC 3JTSB 2CGRL 5F9OL 1A6TB 2X4PB 4LLVB 4Y5YC 1DUYB 3KYOB 1TFHA 2XWJA 5D7JC 3ARDB 1A5FH 3CCHB 1T3FB 2G9HB 2BSED 1R5WB 1XEDA 3P9MB 2B5IB 2HKFH 1U8PA 4KUCF 1TJIH 4OJFL 3QA3B 3E6HB 2X1WL 5EPMB 4MXQC 2BZDA 2OJEA 4ODBD 4Q2ZB 4LOUD 4YGVB 1ITBB 3TGXA 4LSPL 2DL2A 1IQWH 4HD9A 1NC2D 1CR9H 1OP9A 1L6XA 4L4TB 2F74A 1M6OA 4MXVE 4OCYL 3QIUD 2QSVA 1UFUA 2XIDA 4OIBA 5DMGC 1NUDA 3ZMRA 5K59E 3P77A 3QRGH 2FJGB 4F7TA 3HZMA 2IANE 4NN7C 5AZEL 3IDXH 4GXVL 3GI8H 5IG7B 1QA9B 2ID5A 4QTIL 4HBCH 4HJGA 3DJ9A 5AYQA 1XZ0A 1FC1A 4OD1H 3QULB 4XAWH 5JPNA 3T04D 1N6QH 1DSFH 2YD1A 4MB5A 4MNQE 1EO5A 3MLWL 4MAYD 3JV6A 1A7BA 1EHXA 1GGCL 5K93A 3C5SB 3WLWC 3ZHDA 5C0BD 5HHNA 3KJ4C 2A83B 2Y6SC 2R0WL 3ARDD 3SDXE 3VFPA 4NKOA 4HHAB 4HQQH 1I7ZB 3BDXA 4OZIE 3WHE1 2DQTH 2QSCH 5BJTA 1T1XA 4PRHE 3ZDZE 1H15A 3B8SA 2NLJA 4IMLB 4PY7B 3A6CH 3QQNA 5KS9B 3GGWA 3BN3B 4M43H 4XBEH 2VZ3A 3T4AA 4NQSA 1DTUA 1F4WL 3VXRA 1MPAH 1F11A 2IPKB 2AK4A 2HVKA 4YC2C 1H3WM 2IGFH 3U4BH 3THML 1ADQH 2H8PA 3VG9B 4NRYA 5A2IH 2X70A 5EU5A 1FIGL 1HH6A 4AM0B 3CFBB 1DJSA 5FYJE 4G8FB 3RKDD 2IMMA 3OKNB 4EN3A 3REVA 3V0WH 1HHGB 4PRAA 4XP9L 2WBJD 4ODHH 1I9IH 3CX5K 2ZOLA 3ARXA 2F8OA 1FVCA 3KGRA 1YEHH 1SJEB 1I7TB 2FHFA 5C86A 4XPHH 4NO5A 5CSBA 1DUZA 3DSNA 4Y4KB 3RHWK 2CRYA 3DBXA 1T5WA 4JZOB 5LVEA 1DE4A 4LK4A 4HPOH 3OG4B 3X3GL 2FD6L 3IGAA 1SBSH 1A4KB 3WSQH 1A6UL 5ALCL 4X6DE 5JHDB 2JELL 5CJQH 4DGYL 3OJDB 2FDBP 1HILA 2FGZA 3BPLC 3S3PA 2EC8A 4HAFA 1MEXL 4XCCH 4PRPA 2G5RA 3ULVL 1C7TA 3MXWH 3SQOL 3TJEL 3QUKA 5CZXD 1TITA 2WP3T 1MLCA 4HWBA 3TM6A 2LFGA 3Q5OA 2BY1A 1N2RB 1AD0A 3SDDA 3QUYB 4JFQA 1G7PA 3O3AB 3KDMB 1MCPH 3D0VB 2GJJA 2YMXH 1OAXH 1ACYL 2ZJSH 3KPRD 4OFVA 3MRIA 4UNTA 1MVUA 2IPUK 1MIML 2PXYD 3FFDB 1U8IA 1XCQB 5HHVL 1OW0A 2YPKA 4HKBA 4ZAKD 4U1KA 3VFSA 5I1GH 3DGCR 3MMEB 3V5HA 5JDJA 4D8PA 4X6CA 2YC1B 2IAMB 1X44A 4LSSL 3L6FA 1H9VA 5B38G 5EIIB 3ARTA 1FNAA 3LKPB 3L9RB 4MD5B 4MX7A 1GJIA 5DD1H 3TCLA 1SY6H 4UIMB 1V3MA 3CSYA 4PP1D 4XVJL 3PJSA 5GISL 5IF0A 2C5DC 1MCOL 3O4LE 3OAUH 2WWKT 3FO9B 4J12A 1JF5A 2A9MH 3DROA 2UWEF 5IB5A 2Z8RA 3MCLH 5GS0D 4P46D 5C0RH 2VUYA 3BE1L 4HJ0C 3RU8L 3DURB 3ARFA 2HYMA 3U36A 4MXVF 3RBGA 3VFWA 2XWJB 4XB8A 4U6YA 2E27H 1P7QB 5EU4A 5DTFA 5K59F 3VW3L 2CKBB 2R9HC 4KK6C 4PUBL 1ZHBA 4S10A 4QCIA 5L8JB 4JJHA 5DRXA 2C9AA 5FM4A 1KEGL 1FL3A 2OJEB 3BKMH 2Y5EA 3HLAB 4NZRL 2OMNA 1CD1A 2QSTA 1RUML 1FNGB 2F74B 5INDB 3L7EB 4M62H 4XMKL 1IAMA 3P77B 3ZDXE 2DQDH 4HKZA 4POUB 1DQLH 1IAOA 3D2UD 4F7TB 3SDXF 3MLYH 3PHOA 5BZWA 4LPTA 1E6JH 4ERSH 2Y36L 5ABDE 1H0DA 4X98B 3B9KC 4N5EC 1JL8A 3N85L 2QQNH 4HJGB 3RPKA 1XZ0B 1EEUA 4NPYA 3MNVA 3F7PC 3GMLB 3BPNC 5JPNB 5FECB 3IJHA 2A38A 1P4IL 5ELIA 5D7JA 1IE5A 3L3GA 4KU1A 5HHNB 2W59A 3VFPB 4NKOB 1XF5A 3QEHA 1P7QD 3WMSA 1R3JB 4CDGC 4BZ1H 1SMOA 5BJTB 5HD8C 1T1XB 1J1PL 1Q9LB 2Z35A 3MLVL 3QEGL 1O5DT 3WFCH 4BH8A 2NLJB 3KPSA 4LSQH 5E8NB 4OCXH 5GS1B 4UBDC 1CU4L 3GGWB 5DT1L 1NEZB 4M4PA 3N1QC 1TENA 3QFJD 3T4AB 1A4JA 1FAIL 3U1SL 2HTKD 2HKHL 3VXRB 1F11B 1NKOA 1C5CL 1F90L 4AL8H 1OWWA 3X3FL 4JREC 2EIEA 4KK5C 2DQIH 2BSRA 2X70B 5EU5B 1HH6B 2CO7B 2FATL 4RIRA 1NBVH 4EN3B 4R7NA 4JN2A 4PRAB 4EIGB 4X6DF 2XA8H 2ZOLB 3BKJL 1WZ1H 4MNQA 1FVCB 3UYRL 4XMPL 3TBVA 2H32B 2HA1A 1G0YR 4NO5B 2NY1B 1DUZB 2XG5A 1JGLH 3DV6A 4ZXBA 5ITFA 2IJ0C 3DBXB 3U46A 4LMQI 1T5WB 1P84J 1LWRA 1DE4B 2YWYA 2HWZH 4HUUA 4J3VA 5DS8A 5GGTL 1G7QB 5D4QA 4WUUD 1I3UA 2V7HA 5CILL 1OAUL 4KKLC 1F2QA 3V7MA 5HI3C 4IRJD 4DCQA 3AB0C 1JYNA 1AR1C 1U3ZA 4OF7A 3BISA 4PRPB 3LEXB 5GGQH 2V5MA 3IJSA 4LVOB 1IGTA 1E0OB 4TVPH 1TIUA 2QADD 4KUCD 5T1LD 3QUKB 1F8TH 2I9LA 4OFDA 4HIJA 5E99H 2VXUH 1MLCB 1JTTA 4FQ1H 1TETH 1KJ2L 3K4DA 5ESAB 5JDSB 3QPQD 4JFQB 4QXGL 1G7PB 4XBPB 4X7EC 4CN6A 5GS2H 1F4YL 5HVHB 5DFTA 4ZSOE 3O81A 5IQ9A 4ENED 1LO0L 5KVDH 4NN5B 4HX1B 4J3WA 3MRIB 1DLFL 4Z0XA 1KC5H 1MVUB 4GG6E 2R23B 1D9KC 4OQ1A 1U8IB 3GBLA 2VRAA