1MQ8A

Crystal structure of alphal i domain in complex with icam-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
184
Chain Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords intercellular adhesion molecule-1
publication title Structures of the aL I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mq8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mq8A01
3T0AA 2EXWC 3MXWH 3X11B 4PJ9C 2I60L 5AWNH 5JQHC 4NKMB 3JTSA 2EXYC 4Y16D 4JFEA 4ZAKD 2W0FB 4HIJB 5C08E 1FO0B 4FFYH 1MJ8L 5C0ND 4I48B 3QEHB 5CJOH 3MR9B 5FK9B 3BQUC 1ZT7A 3MRIB 1I3VA 1C7TA 3LQZB 4PR5B 2DI9A 3CFEA 3S3JA 4P2RD 1E27B 1YEKL 2HH0L 4HMCA 1T03H 1S7QA 3LKOA 5D96C 2J8UB 1G1CA 4YXHH 2H45A 4HWZB 4XCEB 4XB8A 2AXFA 2Y5EA 5DO2D 5GRUH 5LWYH 3EFFB 4P2OC 4M5ZH 5E9DD 4F15C 3F6IA 3K2UH 5FB8B 1CDJA 1NFKA 2F8XC 1KPRA 4QWWD 3HNSL 2XZAL 5IQ7H 5J13C 1KENH 5D7IE 3MV7A 1MLCB 1ES0A 2APXA 4KV5E 1G9EA 2I26N 3PGFL 5F1NA 3ETBF 5CEYA 2WUBH 3GSQB 1DEDA 3GJFH 4POZC 3FQNA 3CDGA 4ZAKB 4Y16B 4WTZG 1RHHA 2ZNXA 5DHVH 4HCRL 2K7QA 3V7AE 4Y4FC 5D71L 4KJWD 4TQEL 4LGSB 1LO4L 3U46B 2E9IA 2R29H 2I5YL 5ELIA 4P2RB 4JZOA 1X4ZA 4DWHA 3JXAA 3W39B 3U2SB 1AQKH 1ETZA 1A21A 5F97E 5IG7A 1G1YA 5DJXB 3PWJA 5D2NE 3SKOB 4R4BA 4F58L 5DLML 4HF5H 4U6XB 3RFZC 2J5LC 5E9DB 5IEKA 4OGYH 4APQD 2E5EA 3ALXA 1XCQB 5D70L 4KGJA 2AK4E 3STLA 3UBXG 4GRWF 1RUKH 4P5MB 1JYXA 3VFMA 3OKKA 4PJBB 1PGRB 4E5XA 2BHZA 3LRSA 2RCSL 1KTLA 1CGYA 2EIEA 2WIMA 2E6PA 4PJ7B 1EO5A 2FWOA 1CS6A 3KYNB 5SV4A 1OSZB 2D4DA 2FGZA 4C55A 2IMNA 2NY5H 3P2TA 4YEEA 2A0LD 4XXCA 3L3HA 1IC1A 4K7FA 3LKQB 4K3JH 3BI9X 1J88A 4DJMA 1R3IL 5GSVB 4PRDA 4XWGH 2WUCH 2N7AA 5SX5K 2VLJE 3QZWB 1DQQA 3HC0A 2XZCL 4B53A 3SKMB 1AIFB 1E6OH 4YXLH 1NGZA 4I2XA 1FN4A 2BY3A 4APQB 2HT2D 4GSDL 5HHOA 4JFQB 5DUPH 5IMKB 4U3HA 4F2MB 4LMQI 1MCRA 1CXKA 2E7LA 4XAWH 3U7YH 1FV1A 3QRGL 1BJ1H 4R8WH 5I17B 3I84A 3MNVA 2FJHA 1YQ2A 4GS7B 3QXUA 1I1FB 4ZAKC 4HZLA 3KHQA 5DI8B 1BM3H 4MB4A 1YMMA 3I6LE 3MACH 3KYAA 3QYCA 4HIHB 4OZGA 3RPKA 3KYOA 5MEPA 5I1IH 1UG9A 1UB5A 2RIKA 4R6UA 2DMCA 4I8DA 2AERT 3IRPX 2B4CH 5J6HB 3P73B 3E2HB 2BSED 1QNZH 1JE6A 1G7HA 4K3DL 3FQXA 4P5TC 5E6ZA 5I30L 4Y5VA 1WFUA 1MRCH 3DRTB 1OCWH 4K94H 4LEXL 3U0WL 4NZUL 3BMWA 1GC1L 2PO6A 4Y88A 2FX7L 3X3GL 1O7SA 1JP5A 5DSCB 5AAMA 3TO2B 1JFQH 3LV3A 3ZHKA 3O2WL 3CVHH 4OLYH 1BGXH 2GT9A 2ID5A 1FL5A 4KRPC 3GUTA 1QA9A 1DBBH 5INDA 3ARWA 3SE9L 1HCFX 1X7QA 1F6AA 3VRJB 1GZQA 3STZA 1EEQA 2ATPB 1WAAE 1KJ3L 1WT5C 5KW9H 1PQZB 1JRHH 4UT9H 5KTEH 5JHDA 2IQAB 2VLRE 2DQIH 2VISB 5HYJE 1IGIL 2Y07L 3VXNB 1K2DA 3SOBH 4Y19E 1YNKL 3HRZB 5IESL 3V6OC 5E8DL 3SCMC 1YEGH 3AREA 1A6VL 1VGKB 4HGKC 1IFHH 3FB8B 1X5GA 2XWBB 3H8NA 4LDOB 1ZHKB 3QEQE 4U2YA 3B5TA 3QG7L 1JBJA 5AZEL 2VQUA 2GY7B 2HN7A 3KPSD 5E5MB 4HKJA 1EHLL 2H2PC 2A9MH 2A0LC 3TA3A 4LIQL 3ULVC 5I2IA 3MLTA 4OQTL 5J7CC 3NAAL 1A7OH 3LPGA 1ZGLM 3BIKA 5ANMB 3TIDA 3KLAA 2OS7A 2P8MB 3Q6FB 1TFHA 4HXBH 3GMOB 1QSEA 4OIBA 1NAKL 1WZKA 1AXSA 2IH3A 1U8JA 2YN5A 3SKNA 4L1DA 4EQ2A 4X4ZA 3QIUD 5J0BA 2PW2B 4LCWA 1ZT4A 1N2RA 2J3SA 2VIRA 4WFHD 5H2BB 3RVVD 2Q8AL 2DTSA 5IVXA 1JPFB 5GGRY 1HIMH 3KPSB 3ARQA 4ZDHA 1OW0A 1U9KA 5K9OA 5CBEA 1EXUA 1KTRL 4G80B 3H3PL 2CK0L 4LARL 4NQEE 4GAFB 5ESQA 3WFHB 2X4NA 4PJAF 1OTSD 1NBVL 32C2B 2H1PL 1ZHBA 1RU9L 1EJ6A 2HFFB 5KN5A 3ULUC 5K9QI 3DX7A 3FB5A 4OLEA 3DUSB 2AABL 1W72H 1JGVL 3GBML 3RTQA 2V5YA 2VNCA 1KULA 4PLJD 3QIUB 1SMAA 1KTDA 2Q20A 1JHTB 1MI5D 4P2QE 4YGVB 1SY6A 3EOBA 3WXWL 5TPWL 3AUVA 2Q6WA 3SKJL 4G6KH 4HHAB 3LN4A 4Y1AE 3FN0H 1FZKB 3G6DH 4PRBA 2I07A 3BP6B 2JIXA 1MUJA 1A9BA 4R97B 2V2XA 4OV5B 4IS6A 3A0OA 2BDNL 4NRXA 3Q5TA 1XIWC 3THML 3T0VA 1X6NA 4NT6B 4ZOCA 4CVXB 3L3KA 4LCCA 5DQDH 4RMVA 3OF6D 3WHXB 2AJVL 4NRYA 2XG4A 5L0QC 2F9BT 3QIWA 3NH7H 4R90L 1ADQL 3UBXI 4K7PH 4G6FD 3A67H 2OP4H 1FQ9C 3HN3A 2ZJSH 1LO0L 1WEJL 1MI5B 6FABL 3IAPA 3EGSA 5IJKC 2XXCB 1RJLA 5E1HB 3QXAA 4WW2F 2P5EE 3K1DA 1RZ7L 2X4UA 4HLZG 4WNQB 1SJVA 5FCUH 3MJ7B 3MRDA 3V0VA 5C0BE 2AXJA 3MXWL 4N5EC 5EIIB 3MRNA 3GBLA 5AWNL 2CMRH 2Y5TB 1MNUH 3MRQA 2F5AL 2XWTB 4RDQG 2VL5B 5ESVA 3ARFA 4FFYL 3DIFB 4MS8D 5EUOE 1OP5H 3TH3T 3OV6A 2XPGA 3UEZA 1E6JH 1F4HA 4LPXA 4NDMB 2NX5E 3OXRB 4L5FL 4U1JB 5TH2B 3Q1SH 3RWJA 4YXHL 3QIUC 5GRUL 2Z93A 5ICYB 2UWEA 4PJIF 4YO0B 3BP4A 5D1QD 2R0WH 5DZNA 1JNLH 1M6OB 4GKOA 1WCBA 2VDPH 1KENL 2FBJH 4R97C 4HPOH 5CS7A 5ETUB 4RA0C 1M71B 4Z7UE 5KSBE 4G43A 2HTLD 2M1KA 4GBXC 3T3MF 5JHLH 4FQLH 3FRPA 2ZP0T 1QFWL 3C60C 4CADA 1OTSC 2X4RB 5DJ0B 4G6AD 3V6ZA 1KJMB 5CMAA 3MROA 2R29L 1I1YB 3DYOA 3P4LA 5HGDA 5HHQB 1NBYA 2RB8A 4NZTH 5HI4D 1ZOXA 5TE6H 4I3RH 1AQKL 1SJHA 3KJ4C 1T1XB 4Z77A 3VRLE 1ERNA 4IJ3C 1UA6H 2EKSA 4BZ2L 4NHUA 4JZNB 3OGCB 4HF5L 5DJ8B 4MXWL 2EYTA 4OGYL 4WO4A 2EDDA 2HVJB 4TPRH 2YUWA 3TBTB 4JRXA 3C8KB 1RUKL 2R39A 3HG1A 2G5RA 2P8LB 5GZOC 4ODXB 3K4ZA 4U6HB 1JGLH 1QZ1A 2C3HA 2JCCB 4HWUA 5TDNB 4X5LA 1CFTB 1S7RB 2ADIA 3EYSH 4MJID 1LEGB 1UVQB 2QKIB 1FNEB 4FN0A 2Q3AA 3WFBL 3BEVB 3EO9H 1T22A 2NTFB 4WJ5A 4M02A 4X83A 2VAAA 4OI7A 4XWGL 3HR5A 1P7KB 4A6YA 5KANG 2WUCL 2YBRA 5HTSA 5C70A 2G75A 4HUWA 1RURH 4YXLL 2OJZH 4EXPX 5MENE 2FIKA 5DUPL 1ZHNB 5E24E 4MQ7B 5SWZD 3UTZA 2C1OA 4PJHF 4GAYB 3HZVB 5LBSH 4PJFA 4X7SH 2DWDA 3GK8H 4U2ZA 1WWAX 1FVDA 2EDXA 3AVEA 3CFKA 5JMOC 4QOKE 4RNRA 4XVTH 3O3AA 2NR6D 2R0KH 3G5ZA 4YXKH 3GEWB 4U1SB 3SGDH 4U1IA 1BM3L 4KKLC 4MJIB 4QF1B 3B9KC 3MACL 3BKJL 3RDTA 4MS8C 5BVPH 3BH8B 3MRFB 4NPYA 1CE1H 3P9WB 1P2CA 1G9NC 4JGMA 4YJZL 2EDHA 4LCUB 5D2LA 1A22B 3OKEA 2NXZC 3E6FA 4UDTB 4KKAD 4BFIA 4ELMB 2H2SC 4Y2DA 4LPVA 5SWZB 2DQDH 1VKXA 1DVFD 4K94L 1LDPH 1OCWL 1KG0B 3EOAB 5FHBH 2CRYA 5EC1B 4ZUTA 4N5UA 3BKCH 4LU5H 4J3VA 3F12A 2VH5H 3GO1H 2CXKA 1FC2D 3JWOC 3RVWD 2DL9A 4FXGA 1G7JB 4HIXH 3CSGA 3CVHL 1EO7A 2QV2A 1K4CA 5EC2A 3BSZH 4L3CB 1DBBL 1H3TA 5GHWH 4N0FA 4MJ5B 4YQXH 3LKNA 3V6FA 2EKJA 1N6QL 5HI4C 1A7NH 4W6YB 1LP9F 4QRPE 5JPMA 5KW9L 2XACC 1JRHL 3D6GA 4UT9L 3VFUA 5FYJU 2NCMA 4H8WC 2DQIL 4QO1A 4HJ0D 2CJUH 3SOBL 1DVFB 3D18A 4HKZA 3DNKA 1BD2A 4PRPD 1MCNA 4FMKA 1YEGL 4QY8B 3QJFA 4FXKA 1NBZB 3HS0A 3BW9A 4MA1C 4WFEE 1PYWA 2ESVA 2Y7QA 1SHMA 2H8PA 2PYEE 3EOTL 3BPNC 1B6DA 4RZCB 4NKOA 3TWCL 1KPUA 1UCTA 1A9EA 1N0XL 4FMFA 1N5AA 2A9ML 2OL3H 3QNYB 4M62H 4Z8FH 5ALCL 1A6PA 1A7OL 5CINL 3BJ91 1RUMH 1I9EA 1PG7X 4I3GA 4G7VH 3N0PB 4JR9H 3P77B 5EU4A 3WKNA 5C8JA 1T3FA 2B5IB 1J9CT 4G8GE 1B4JH 5EFIB 5JW4Q 4U6TA 1ZGLA 4UUJB 5D6DC 3O9WD 1A7RL 5CSZB 5E1AA 4XAKE 1EVTC 4PRPB 3P4OB 3DHMA 1EMTH 1LD9B 4D0BB 1ACYH 3A6OA 5IKCA 5L2KD 1EFQA 1GZPA 1QRNE 1TPXB 1UQSB 2GCYA 3KYMA 2WSKA 1E28A 4FQ1H 4M3JA 1HWGB 1OAKL 4G42B 3ZE1F 4MLIA 1FFPB 2AK1H 2OBGA 1MCWW 1UM6L 4JJ5B 1OSPH 3TYFB 2HFGH 5SWQA 3VCLB 2FHFA 3LH2H 2EDFA 4X6FB 5CZKA 1MLBB 1ZTXH 1ZANH 3P11H 4FTVA 4YGAB 3I9GL 3T0ED 4FFZL 3GMMA 2ZUXA 2WP3T 3O9WB 3MNZB 5IGXH 3VXOB 5I8CB 3SEPA 5C1MB 1KPVB 1I9IH 5L2KB 5DHXB 3EFDH 1JGDB 5KOVC 4D9LH 4QRQB 5LVEA 1MCHA 3FN0L 1PX4A 3G6DL 5HD8C 1M1SA 5L8KB 1IGYA 3S35X 5DR5H 5F3HA 1KB5H 3BGAA 4WWKC 3ECBA 2P24A 2VC2H 2HFTA 3P40A 4HWBA 4UV4H 1CGWA 2VYRE 5FGCB 5HDQL 4K2UH 2OCFD 5DJZB 4PGCA 3OPZH 5CZXD 3U7AA 5C0FB 1TVHB 2EYRA 4IMKC 4YHYC 3NH7L 5D1XA 3TZVA 4JZJB 3T0EB 2VZVA 2ZG1A 4G8FA 3VXSD 5D7IF 2CLVB 4K7PL 4HJ0C 4KV5F 2B5IC 2OP4L 2WW8A 2ZJSL 3UJIL 4MNQA 3DROB 4TVPE 5I1GH 2HYMA 3TBVB 1S5IL 3UX9B 5DS8A 4JFFD 5JDJA 4KI5D 2H9GA 1IGJB 4OCWL 1T1YA 3TV3H 1RUAH 3GI9L 4LSSH 1Y0LA 4JM2A 4PJXA 2ADJB 4PLOB 1NCAH 5KANI 1LILA 2CMRL 5CILH 1MNUL 3FO1B 4PTUA 3WJJC 5HYSA 1M4KA 3RWHA 3CUPA 2BSRB 3V2AR 3LRHA 1HCVA 4D0DA 3VXSB 1QSFB 4NQVB 1E6JL 1KB9K 1CGTA 2MKWA 4ZYKB 3B4NA 3Q1SL 4P48A 3T2NH 3UTQA 1S8DB 3V4UH 5I15L 3LVEA 4KK8D 5JOEA 1IAKB 3CU7A 2CKBB 3K2MC 4JFFB 2WK2A 5DYOA 4V1DE 2R0WL 2Z9TA 3MLYL 4Q9CA 3O2DA 4W4OC 3RL2A 2D0FA 4OCNC 4E0RA 1BFOB 5T3XD 1ND0A 4PJDB 1GL4B 4UOW1 5SX4H 4HPOL 1XGQB 5E94A 3O8XA 3WLWC 2CXGA 5JHLL 1CD1A 1L6XA 3JWDC 4G6JH 3GIZH 4XH2B 5F9JB 1LDSA 1A0QH 1D6EA 1JRHI 3QWRA 2MCPL 4D2NA 2CKBL 1JF6A 4PJIA 5FYJD 4WI8A 3B9EA 2FSEB 3WE6B 4HXAH 2A6KA 4LLUA 5F6IC 4NZTL 2X4OA 5TE6L 2D2OA 4WUUA 4I3RL 4OD2B 4H1LA 5GGUA 5T1KD 1CFQA 1X5JA 5HYQA 4NQCA 1JHKH 1UA6L 2F53E 2P8PA 2PCPB 4HG4K 5I1LB 2D7MA 3SGKA 2MPAH 3PWVB 5DEFB 3VXUD 1CFBA 4JKKA 4L4TA 3HMWL 5KVEL 3MCLH 5JXEC 4JKLA 3MYJB 1JGLL 5ID0A 3K74B 5HHMD 3ESVF 4GMSL 3EYSL 5IROA 3HUJF 5B3JE 3IB4A 5C6TH 1C08B 2P44B 3BRGC 4HT1H 3L95B 3Q5OA 2IF7A 3G04A 5FM5O 1QLRB 3BUYA 3GSNB 2VLLA 5C0IA 3FRUA 4M1CC 1FZJB 2BRRH 5T1KB 5C0EA 3OSKA 3MMEB 1JF1B 4ZNEA 1RURL 1RZKC 4OZHE 5GGVH 3O6MH 1FP5A 5KSVA 2FZ3A 3KLHD 4JM4H 3EO0A 3SDDC 3G5VA 3VXUB 2ARJB 3GMQB 2P7TA 4DK6A 5LBSL 3VE0B 4KKBC 4X7SL 3GK8L 5IEHA 3MJ8B 3GSNL 3RJDA 1E0OB 4B41A 3PWNA 4MWFB 1CICA 5I8KH 4XVTL 5HHMB 1QBLH 1EA9C 2R0KL 3D9AH 5A3ID 4YXKL 3FB6B 3ZDZE 3AGVA 1GOGA 3C6LD 1ZGLP 4QYOB 2C7UB 4FA8A 4J8RB 5D7SL 1P9MA 4UIKL 5D6CB 5BVPL 1CE1L 2N56A 2B20A 3OKDA 3QEGL 3KR3H 1GXEA 1FYTE 4PJHA 4NQDD 2YUXA 1R0AL 1I9RH 3NN8B 4NUJB 1HNGA 2QSQA 2ZOLA 4HUKB 5CD5C 5ILTL 4KK8C 5TF1H 2DQDL 2EIZB 1EVUA 3RI5F 5FHBL 2VRAA 3QH3B 1BMGA 2DS4A 3BKCL 2OR7A 3RVTC 4LU5L 3IRZA 4PV9B 1CTNA 2VSCA 2VH5L 4NCDA 4F33B 4XP4H 4TNWK 3ULVH 4NOFA 5FV2A 1HHIB 3DSFL 3RRQA 1DLHB 3C6LB 4DKEL 1BBDL 4XHJD 3QIBC 3RZCA 1BQHG 4KQ3H 1FAKT 3IU3A 1EAPA 2GAZB 2UUDH 2O26U 4HW6A 3BUTA 8FABB 2Y1VA 4GFTB 3VI3E 5D93B 1CQYA 1A7NL 4NQDB 4QGYA 3BH9A 3L7FA 4F7CB 4Z5RA 3T4AA 3EJYD 3GJEB 3HI1A 3QFDB 3L3DB 3LSOA 4PGEB 4J2XA 4WU5A 2CJUL 5EWIH 1ZAGA 1I1AA 1VADA 4MA7H 4ZFGH 5DK2B 1J05A 1OD9A 1A02N 1F4YL 1KEMH 1HSAA 2F54A 3MLSH 5C0CA 3F7YB 1BVLB 5DQ9A 1EV2E 1G6RB 3QUZD 5T1MB 4NJAH 1SBSL 4JHAH 3CZFA 1TZIB 3ULUH 2AKRA 5DRXA 5F89B 1NCBH 1CL7H 2OL3L 3U36A 3ARBD 4TUKH 3QUKA 1RUML 3MLWH 4GKSB 4G7VL 3TNNB 4JR9L 4U1KA 1XF5B 3DX9B 5I71C 4I13B 3PQYA 1HHHA 2Z92B 1L9NA 1B4JL 1R5IB 2CDGA 3H9SD 4G9DA 3HAEB 4N90E 5GRZA 3KLHC 5EU6D 4OV6F 1FGNH 2LV4A 5I76A 1KCRL 5DQJA 3REVA 3AS3A 1EMTL 1A1OB 1ACYL 1TJIL 3OGOE 4X6EA 4NP4H 2F15A 3QUZB 5DWUH 2IG2H 1T04A 1TJHH 5A3IC 4MD5B 1B90A 4FQ1L 3R0MA 4PRID 4I3SL 1QUNA 4ORGA 5E00B 3MFGB 4GW1A 1L0YA 2AK1L 3ARBB 4JO4H 4BJLA 1BBJB 4YHNA 3OX8A 4NO2B 2VXVH 1OTUD 4O2CA 2DM7A 1BVZA 4J6RH 2PTUA 1ZTXL 3P11L 3HZKA 4ZSOB 3RWGB 3WLBB 1F6FB 4KROC 3H9SB 4XMLH 4JFDD 2IPKA 1CFVH 1OGTB 5EU6B 4D9RE 1PEZA 2FECI 4Y8DC 1RZIA 5IGXL 3MFFA 4LQFH 1JTTA 1I9IL 3TPUB 3EFDL 4D9LL 5JQ6H 3P0VL 4LLQA 5EUOF 3RVUD 2VXSH 2M2DA 4PRIB 5K93A 1KB5L 4ZUVB 1OAXL 2H32A 4DUVA 2DQCL 2VC2L 3FQWB 4Z7OE 4UV4L 4QRRD 5BVJA 3HE6A 4K2UL 3RZWA 1T20B 3PIQB 2YUZA 3OPZL 5E6ID 1OGAA 5DJAA 4R2GD 3H3KA 1BZ7A 3OAUL 3VFTB 1DQTA 4MA3B 1BX2A 4XVUC 4ZS6D 4JFDB 4M6NH 1HQRB 4TSBH 3SJVA 3NIFE 4DOHE 4Z7UF 5L8JB 3H0TB 5HVGB 1IC7H 5HI5C 2KUTA 2F5BH 2WNGA 3UZQA 4JO3H 3MCKB 1T66D 1T2QH 1RIHL 4ODUB 1CWVA 4J3TA 4XZUB 3CPLA 4KK6D 3SGDI 3WXVH 3QUZC 3VWKB 4RGNC 5FF6A 3QNZB 5DJYB 1RUAL 3MO1B 3QI9C 4JRYA 4TRPL 1I7TB 4TUOB 4N8VA 5T33H 3I75B 1HDMA 4QRRB 4O02H 2IWGA 4WUKH 3SE3A 3FAXA 1DEEB 1ORSB 2DQFA 1FVEB 3D39A 4WEMB 5E6IB 1AGDA 4R2GB 4ETQB 3RY4A 2OMBA 3MGTB 3UO1H 2EE6A 1KELL 1NLDH 1OARL 4L1HA 3V6BR 1WV7T 4ZXBD 5FA4B 2EDEA 1EAJA 1FGVH 1JPGA 1AKJA 2PXYD 3V4UL 1AJ7H 1AGCA 2NLJB 3M8OL 2FO4A 2VZ1A 4DGVH 1GHFH 2WBJC 3KPMA 3LKSB 4P4RB 2OK0H 4AT6A 3CSYA 5IJVB 2YK1L 1JWUA 2DLTA 4E41E 2XRAH 1BIIB 2HVKA 4JANB 1U92B 3VFGH 1FFOA 4ERSL 2FLRT 4Y5YB 1OF2B 5FDWA 9CGTA 4G6JL 2WLZA 3GIZL 1A0QL 2NZIA 2W0LA 1PZ5B 5HDLA 5BV7H 1HN1A 5MERB 3DURB 5AG9A 4NKMA 3V79C 4HXAL 2W0FA 4ZXBB 3LHPL 3D69B 4HWEL 4DVRH 4J23A 1F3RB 4I48A 3IKCB 3N1QC 3QEHA 2PXYB 2WIIB 3MR9A 2APWA 4X5WB 5FK9A 1QFWM 3LQZA 1HINH 3RPIB 4PR5A 1M05A 4M7ZB 1JHKL 3WFDL 1FLTX 1U8OA 1DBMH 1E27A 3LKRB 4DGIH 2N7BA 3PGDB 2APFA 3K8KA 2MPAL 5T1DH 4HCRA 4JO1H 2J8UA 3RX5A 2I24N 1KYOK 2OSLA 3VWKC 3WDIA 1RK1B 4WI2A 3MCLL 3IDYC 3L3IB 1KFAH 1IGFH 2R2BB 1V3KA 4H0GA 2ED7A 3O6FD 1KF9B 1MLCA 1JI2A 1MVUB 3TBSA 2LVEA 3CMOL 3GSQA 3AXLA 1CGXA 4Y16A 25C8H 3TO4A 4ODSL 4YHKL 3QQ4B 5L2JB 4ZS6C 1F3JA 3QZWG 3ZZ1A 2CGRH 1QD0A 2BRRL 3SN6N 3U46A 4P2RA 4YFLI 3EHBD 4JM4L 5BMFH 3JWOH 3WNNA 1RFDH 4G5ZL 5DJXA 5HVHB 4HX1A 3HUJA 1CG9B 4DW2H 3I3BA 4U6XA 5E9DA 2X1OA 3ULSA 3BRFA 4FOMA 5I8KL 3VGAC 1XCQA 2GI7A 3RA7H 1BQLH 3O6FB 5F7EH 4L8DA 3D9AL 3ZKNC 1KGCD 4P5MA 1IEBA 3EBAA 3VH8A 4JDZA 5IMMA 4OIIH 3NCMA 1HOCA 2QR0B 3KYNA 3VXPA 4L4JA 1OSZA 3TN0D 1UH3A 5BS0D 3BPCA 3KR3L 3TNMB 3EYQD 3GJFK 4O4YH 4X8JA 4M9PA 1FNFA 1JMXA 1I9RL 4P5KA 2D31B 5EORH 1ZHLB 3LKQA 4XP9L 5TF1L 5FO8B 4HSQA 4X80H 2NTSP 4LK4A 3FOMB 3QZWA 5HYJA 5C0AE 3SKMA 5T5FH 1DN0B 1T0MA 4APQA 4DUWA 2Q86B 1KJVA 1IARB 4F2MA 5E6YA 4QTHA 1S9YB 4KMQA 1SEBB 3K8LA 4PJBE 3EDJA 4MHHI 4KQ3L 4PJ7E 1S9KC 4UOJA 1DE4B 4LGRB 5CJQH 5FGRA 3TN0B 5BS0B 4ZO9A 4WI4A 4MDIB 2XKNB 4NWTH 4Q9QL 2FL5A 3LN5B 4U1HB 1NGPH 3F8UB 4MAYD 3TT1H 2YA1A 2BNUB 1KN4H 3FKUS 1GSMA 1QO3B 4PGDB 1MCKA 4GKNB 2CIKB 2X70A 2ZCLL 3FOLA 2BVOB 3RWEA 3LCYA 4TNVF 5EWIL 3PP3H 5C2UB 2NY2D 4ZFGL 5HGGS 3H42L 5HVHC 5ISZD 3DVGB 3CCHA 2WP3O 4Y4HA 1IT9H 5DJ6B 5MEOB 1Z9SA 1CF8H 1JGEB 3VW3H 4LOUD 3PWPA 3V6OE 3DRTA 1KSRA 3D87B 4JHAL 2WMPA 1EFXD 4ZFZA 3TO2A 5KS9F 3ULUL 2RFXA 1CL7L 1E4WH 5EB9A 2NY0D 2ATKB 4Q6IC 2WINB 1A7QL 4Z0XB 3ZYJA 4MAYB 4CJ1A 4NQEA 3FB7B 3ULVE 3PL6B 3FFDB 3QXDB 5D9SA 2B7DT 1MQKL 3INUL 4X4MA 1OAZH 4U31A 2NY2B 4HK0B 1PQZA 4EUPA 1FGNL 4BZYA 2CIIA 4MB5A 2H6PA 4K7PY 5ISZB 4NM4H 2VISA 5SX4I 4UIMB 3ARSA 4OZFA 2X41A 4NP4L 3BZ4B 4WV1B 4ELKA 3VXNA 1UZ8B 3D5OF 4BSVB 3FT2A 4OQTA 5DWUL 2FBOJ 2IG2L 1TJHL 2PR4H 2R1WA 3ZDXE 5EO0B 4DFHA 1EFXB 1VGKA 2OTUB 1NGYB 5FECA 3IDJB 3TCLB 2XWBA 4JQVA 1IL1A 2M8XA 3BP5A 1ZHKA 5E8OB 1AP2B 2NY0B 1LO3H 3MRGB 3C8DA 2W59A 3TN0C 1NFDB 5H35A 5DD0H 4RAVA 4LPWA 5I1JL 1YC8A 3MOQA 4QCIB 5E5MA 1VERA 3TYGH 4ZOAA 4QHKI 4OLXL 3SE4A 1TVBB 4EVNB 4XMLL 2XKUA 4PJ5D 1LNUB 1CFVL 3TVMD 3EAKA 3ULUE 3DI3B 3I6GA 2VE6A 2H26A 2X9YA 3KPOB 3GDBA 4F7MB 4LQFL 5DT1H 2ZCHH 2VDQL 5T5NF 1XF2B 1H0DB 2DLFH 2DICA 1JWSB 2IANE 2VXSL 3RKDD 1CXFA 4XMPH 3NCFB 3DX8A 3QQ3B 5EBWB 3MOBH 4X4XB 5IQ9A 2Z31D 1J0JA 1X9QA 2DQHH 3U30B 1CXLA 4WHTB 5I9QC 3PP4H 4NO3B 1ORQA 3NVQA 3GRWH 4JHWH 4KKCC 4EI5D 1QQDB 4H20H 1JPFA 4HUVA 1NC2D 4X5XB 2Q3ZA 1C16A 4MAYC 2HT3D 3U48A 3MV01 1FCGA 3WFHA 3NPSC 3PL6C 1INQB 4M6NL 4JFOB 3TVMB 3GHBH 4HS6B 2PF6A 5ANME 3ARTA 5KOMC 1IC7L 3S4SB 3PV7A 1JNHB 4KUZH 3UPRB 1UWXH 3TH4T 3DUSA 4UZGA 1T2QL 5ITBL 1TTUA 5FXCH 4WV1C 3K4DA 3JWDH 1JHTA 4XT1C 4AM0B 4JHZA 1SVZA 4YGVA 5KVDH 3W0WA 5AD0B 1I8LC 4XPBL 2B1AH 2Z31B 4IRZH 1I8IB 5A16B 1FNGB 2X1QA 1YEHH 4R7DA 3HMXH 3BP6A 1ADQA 5T33L 1N8ZA 1NC2B 1XF3B 1TQCC 5JA8B 1KIQA 4OV5A 4NNPH 3BPLB 3IFOA 3UO1L 2R15A 3G6AB 4L4VD 4NT6A 2GTWB 3V52H 4IRSD 3ARZA 1FGVL 4G3YH 2FEDC 3WHXA 3R1GH 4POUB 4P99A 4JY4B 2QLVB 2UV3A 5GS2D 3V8CA 3QXTA 4X9IA 2ORBH 5DJCB 4JQIH 4CAGA 1A6ZA 2BJMH 3N1GC 1NFIA 4DGVL 1MI5A 1NEZA 3UTPE 5C3LD 1MCPH 1TJGH 1JZ7A 1C5CL 2XRAL 4XXDB 2ICES 4NSKA 4UAOB 4RFEA 3V8OA 2IADB 1J1PH 4WY7H 4LPYA 1X5XA 3S37H 4YBQC 3HZYB 3JWNC 5BV7L 2Y5TA 1RZKH 2VL5A 4L4VB 1RMFH 3FO2A 1X5FA 4MNGB 2DM2A 5AUMB 4DVRL 2BVQB 3OF6A 2DJUA 3WO4B 5DJDB 3DIFA 3L9RB 4JY6B 4QNPE 3BZFA 1RIUH 2W65A 3ZDZF 3HPJA 2HRPH 2JJSA 1DBML 4LRIC 2IALB 4DGIL 3GJFA 1UZ6E 4NFBA 1XR8B 4NDMA 3OXRA 1S7UA 1T89C 1J1XL 2GSGB 3MLRH 3RKDC 3M17B 1MIMH 2V9RA 5ICYA 4U0RB 3FFCD 2OLDA 4XTRD 1KFAL 1CL7I 1IGFL 3Q2CA 5DFWH 4N0UA 3SQBA 2BNQD 3HB3D 3A6BH 1RSFA 1Z5LB 5EOQL 3HRPA 1ZLSL 4HMEA 1M71A 3BDYH 3QDGE 3D2UA 2X4SB 5DC0A 3UYOD 2X4RA 2CGRL 1KNOA 4LSDA 5FYKU 5B4MC 5AYQA 1KJMA 4MNHB 3QHFH 4N1CA 3QUYC 1I1YA 4PLNC 1M7DB 5HHQA 4HPYL 1V05A 1OP5K 4FFVD 3SBWA 1MRFH 3MRKB 1NMAL 4Z0BH 1RFDL 2EDQA 3G5YB 1T1XA 2DYPD 2NY3D 4WWID 3DGGB 4JZNA 3FFCB 1B2WL 3OGCA 3VI3F 1T5WB 4M6ML 5D1QA 5DA4A 2HVJA 1IAMA 2V5SA 5MP6H 4ONFL 2BNQB 3TBTA 2B2XL 3C8KA 2IFGA 3BISA 1YY9D 5TFSH 2BOBB 5FYLD 1XF1A 2P8LA 4C57C 1PKQB 3GSWB 3B8YA 2BSSB 4U6HA 4NZRH 3IJHA 4R26H 4NIKB 1CFTA 4JFED 5F3BB 2IAMC 4CN6A 1W2KT 4O4YL 4IOSD 1RUPH 3OR7B 1LEGA 4P3DA 1GGYA 3RL1B 1K85A 1Q38A 3WO4C 5IW6A 2W60A 1F4XH 1FNEA 3V4PL 4FQHA 4F57H 3BEVA 1KBGH 3VG9B 2NTFA 2OX5A 1QSVA 2NY3B 2DYPB 1K8DB 1G84A 4YC2B 2UYLB 3U9UB 1I85A 3TFKD 5IB5A 2NZ9C 3S9DB 1A4JA 1HHJA 3PDOB 3EJJX 3FQUB 4MQ7A 3OWEA 1K5NA 4J12A 4GG6B 1CGSH 4GAYA 3HZVA 4M93B 2ICCA 3BGFB 3G6JB 1G7LB 2LU7A 2JCCE 3JTSB 4ODBD 4JFEB 5LGJB 3D3VE 5JPNA 5JIIA 2FX8H 4MJIA 4UU9B 4KRNA 1CE6A 1NGPL 2DQTH 1ZT7B 4RMWA 4XCYA 3BH8A 3MRFA 1KN4L 3CFEB 4B0MM 4GXVH 3UZVB 1MVFA 4LCUA 5FYLL 1ZLWH 1NAMH 3QWOB 3MBEC 3IDXH 3LKOB 5CEZD 4G7YH 3CVHA 5BZWA 4KVCH 5J56B 2AXFB 4UDTA 3CX2A 4ELMA 1H3UA 4LVNB 1IT9L 1IC4H 2VO5A 2FX9L 4XTRC 4WHDA 1CF8L 5SWZA 2I9TA 1KPRB 3DBXB 3N1PC 5CBAA 1KG0A 3EW3B 3BZEB 3HB3C 3MV7B 3LMJL 5F1NB 4G9FD 5IMLA 5CEYB 1EH9A 4YHLH 3CDGB 1RHHB 4K71B 4HJJL 4D8PB 1E4WL 1SVCP 1PVHA 1B88A 2D0HA 3WIIH 4GQPH 1IKFL 3ARPA 5D5MF 3HE7D 1SEQL 4MJ5A 4JZOB 3RUGB 3U4BH 2IPUK 3GFUA 3OB0H 1SJXA 1JGUH 4I0PC 1OAZL 2AXGB 3ARGD 3VG9C 2P5WE 5IG7B 1OP3H 1EERB 1NGXA 4YC2C 4R4BB 4ZTOL 5KS9A 4Z7OF 3QCTL 4I0CC 2E7CA 5IEKB 3OB8A 1DSFH 3FQTB 1A7BA 4YFLF 5HHOD 3QISA 1DVFA 1MREL 1CYGA 2E27H 2A2QT 2PR4L 4FXLA 4XNXH 5I19H 3OKKB 1NBZA 4G9FB 1WZ1L 4M48H 3NIFF 4E5XB 4M93C 2X44D 3BGFC 3CMGA 4N9GA 2FWOB 2VKXA 5CEZL 1LO3L 4GJTB 5DD0L 1NMBH 2EH7L 3HE7B 2GYSA 2Y36H 2Q7YB 3TYGL 3QNYA 4K7FB 5HYIA 1A6AB 2YD7A 4GUPA 5FUZH 3IFPB 1YEJH 3AU1B 2VXQH 3ARGB 4PB9H 3B6SA 3HC0B 5D2NC 1F4WH 1FN4B 4FQPA 1A5FL 2ZCHL 4U7SA 5HHOB 4X4YB 5TQ2H 5CSZA 1BPVA 2DLFL 1Q0YH 2QHRH 3U83A 3P4OA 4H25B 4XMPL 1LD9A 4D0BA 5KJRH 4PS4H 1FV1B 4KUCD 4ALAH 2EZ0C 2DQHL 1VFUA 3MNVB 4HBCH 1UQSA 1V7NH 2FJHB 4JHWL 4K71C 2G9HB 2ED8A 3B2VL 3WJLA 3IF1B 5FYKD 4G42A 1FCCA 1V5JA 1WBZB 1FFPA 4RQQB 4EXKA 3BJLA 2P47B 1H3GA 4LLYB 2ADFL 3FONB 3TYFA 3KYOB 3PG2A 5MEPB 1UB5B 3VCLA 3UTSE 4X6FA 1EGJL 4Z7VE 1MLBA 4U1LB 4KUZL 5JHDD 3FZUC 3BAEH 1T83A 2O61A 3FQXB 5C07D 4Y5VB 4YDVA 3MNZA 4JPWH 1MPAH 1GJIA 3VXOA 4I18A 3JWDL 4MSWA 1HKLH 5KVDL 2PO6B 4YR6B 3V5KB 5L2KA 4WFGD 1JGDA 3MX0A 2B1AL 3ARED 1S7WA 1YEIH 2ICWJ 3UJJH 2DJSA 1YEHL 5IBLD 3LV3B 1H3XA 2JK5A 1FL5B 4YX2H 1GOHA 2JB5L 3IDGB 1IAIH 4OLWH 4Q97A 1X7QB 1F6AB 3NFPB 1QBBA 3CGTA 3GSVA 4PBVC 2ZG3A 4XXCC 3STZB 3ORJA 5C0FA 5JHDB 4JZJA 3T0EA 5B22A 1OLZA 1QSED 1U91B 1R3JA 2CLVA 2ORBL 4G8IA 4JQIL 5C07B 43CAB 4JFXB 4ZD3H 1HEZB 1MF2L 3RAJH 2EDWA 2E6QA 3C5ZC 5GGVY 1MCPL 4A2LA 5JW4N 1TJGL 4OZIF 3AREB 3TBVA 4ODTH 1MJUH 3WHE1 2E7LC 2GW5A 1TXKA 3KG5A 1I75A 1P4BH 1JYNA 4S11A 4JPKH 1MFCH 1J1PL 4WY7L 1FPTH 4WCYH 4YPGB 2VR9A 2HN7B 3S37L 2BVPB 1LWRA 4HKJB 4OCRH 1PSKL 1H3PH 1RZKL 4XVSL 1Z6JT 3WIFB 4CVZB 2BSRA 3BIKB 2AQ3A 3TIDB 1X5IA 3P4NA 5TE7H 2RHEA 3VXSA 1QSEB 4W6WB 4NQVA 2HRPL 2YD4A 1AXSB 2X6MA 1MAML 3RTQD 1I3GH 3SKNB 3VXMA 1WWBX 1DBJH 3OZ9H 4CKVX 1S8DA 4LCWB 1MIML 1ZT4B 2VITB 1CTOA 2PO6C 1N2RB 2VIRB 4JFFA 2CKBA 3HFML 2YRPA 3H7LA 3RHWF 2ZOKA 1CDGA 3MLVH 3C2AL 4HD9A 1XAUA 2JIXD 1BFOA 2YHGA 4PJDA 1YQVH 2N1KA 5DK3A 1EXUB 5AAWA 5DMIH 3IFLH 4NC0B 3IDIB 2FDBP 3DECA 4XH2A 3MLPA 4HEPG 4PGBA 3ZKQD 5IFAH 2GSIB 2BFVH 3QHFL 5CUSL 3QIWD 4AIXA 1C5DB 35C8L 1QSFE 3HC4L 3ZLQC 5EPMA 3PXHA 1MRFL 4OCLC 3RTQB 4GMTL 3DXAA 1KTDB 3B83A 4LRNH 2R9HC 3GKZA 1NGWA 2Q6WB 2PCPA 3AREC 1FE8L 4P9MH 3PWVA 3LN4B 1KIRA 4BSJA 5JZ7C 5MP6L 5EG6C 2JIXB 2WM0A 1MUJB 1A9BB 4NM8L 4ZFOB 4FS0A 5TFSL 4M5YH 2V2XB 2VWEC 4IS6B 1RZ8B 4NZRL 1S9VB 5BO1H 3BD3A 5D7LE 4R26L 3AS1A 4I77H 2P49B 4LNVA 5I6XC 3TA3C 5B3NA 2EDJA 3ARFD 3L3KB 4LCCB 1C08A 4NRYB 3L95A 1RVFL 3QIWB 1F4XL 3ZKXB 3S98A 4JPVL 3SGEH 5E56A 3T3PE 3GSNA 4PGZA 4U6YB 2BNRD 1FZJA 4OSUH 2W9EH 1NGQL 5K59E 4K9EL 4Z7NE 1CGVA 2KDGA 1R3KB 3EGSB 1JF1A 1X4YA 5GGTH 1RJLB 5K33A 3QXAB 3Q6GH 3VXUA 2ARJA 3MRDB 3GMQA 3ULVF 3V0VB 1CGSL 2R56H 5T3XE 2E9BA 4DN3H 1ZVSB 4Y5XC 3V95A 5T3ZH 1QFPA 3MRNB 4MWFA 1OW0C 3S5LA 3MRQB 2G60H 4UT6H 1GIGL 5ESVB 2FX8L 3ARFB 5CEXA 4QYOA 2C7UA 2DQTL 3BPOB 2VL4A 4AK1A 5FYJE 5D6CA 2EO9A 2HLFC 4GXVL 2AJ3A 3DVIA 2BNRB 2DLHA 1NUGA 1T1ZA 3NN8A 4G7YL 4NUJA 2ENSA 2Z93B 4KMLB 4KRMB 2CDFB 1D5IH 1IC4L 4JO2L 5IHBA 1PKOA 4GXUM 3W2DH 1WCBB 2APVA 4ODWA 2O5XL 1LEIB 2D03L 3HG1D 1FRGH 4OM0H 1H8NA 4PV9A 3ULUF 4YHLL 2ZUQB 3CVIH 3E3QC 4N9OB 1DLHA 1JPST 2J4WL 2C26A 2FHCA 3WIIL 2WAHA 4EKXA 4LGPB 4JY5L 3HAEG 5HGDB 3S36X 1NBYB 8FABA 3U4BL 4QHNB 1JGUL 3KPNB 4NQDA 2Y25A 1K3IA 1SJHB 4IIQB 4Z77B 3QEUA 5FGBC 2EKSB 4Y4KA 2EECA 2QSCH 2HWZL 5DFTA 4KQ4H 4AMKL 4PGEA 1S9XB 1OAYH 4WO4B 4EDWH 1CVSC 2OL3A 4F3FB 1S78D 2E27L 4JRXB 4XNXL 3AMKA 3HG1B 5D5MA 4Z6AT 4OGAD 4QXGL 5CAYB 3F7YA 1KIPB 4KK9D 1YECL 5T1MA 1A64A 2YD1A 2C3XA 1NMBL 3ARFC 4YHZL 5FDYA 4KDWA 3RDTD 4NQUA 2AEPL 5F89A 1AC0A 1XMWA 1NCWH 1YEJL 2UUDK 4YBLC 4OB5H 4A6YB 4H26A 4GRWB 1G7IA 2YBRB 2G75B 3P9LB 5B8CA 3TNNA 3DMMC 1XF5A 3O81A 5EH1A 1L9MA 1KXQE 1W8OA 2Z92A 4Y2DD 2FIKB 4RFOH 4Q58C 2HJLB 4PP1C 2JF1A 5KJRL 1A1OA 3WD5H 4PS4L 2X4TB 4HH8A 2E3VA 1YEDB 3MNWB 4PB0H 3CFKB 4HBCL 2YPLA 3G9VA 2IGFH 3O3AB 5E08L 3G5ZB 5IF0B 4MD5A 4K07A 1U2CA 2D9CA 4U1IB 2ZUQC 4HJGB 2D9QB 1CLYH 5B39A 4RMTA 2FD6H 4JCLA 5E00A 3SDXE 3RDTB 1DQDL 1CI5A 4EZMA 1N59A 3ARBA 4XGZA 5J1TC 2HRLA 4U6VH 5LCVH 1A3RL 3C9NB 5F72S 3UTTE 2C4XA 4RRPA 3V4VL 4PJ8A 1W0VA 1KB5A 4ZSOA 3RWGA 4BFIB 3WLBA 3BAEL 4PREB 1CCZA 4KHTH 3H9SA 4Y2DB 3JTTA 3NGBC 1R24A 4JPWL 4WO4C 4XX1G 4M1DL 1MPAL 4HC1H 4CVUA 3MREA 5CSGA 5EOCH 1BD2D 2VSDA 1QLEH 3L3JB 3TPUA 4AEFA 3F12B 5TQ0H 2ICWB 4FXGB 4RGNE 4QNPF 2A38A 3KAAA 5LQBH 4PRIA 3OAYH 4YX2L 4NBXB 5CP7A 1UZ6F 4PJEE 4X7CC 1IAIL 4OLWL 3VI4F 1PDKA 3FQWA 1MAKA 3CDCA 3JV4B 4RWYH 2VXUH 2ZPKH 4X9BA 1T20A 3D1MC 4KHXL 4J3WA 4Y4FA 2KPNA 5FKPA 3VXRD 3UYRH 1L6ZA 4OI9A 2XN9E 5EU6E 4ZD3L 5E2TL 5J11C 3RAJL 3D18B 4FP8H 4BZ1H 3WIHL 4HKZB 1BJMA 1T0NB 2R23B 4LSTH 5FCSH 5I8OL 3GNMH 1BD2B 4ACPA 2DQUH 4ODTL 3ES6A 1PYWB 1MJUL 4ODUA 4C56D 2Y7QB 4IMLB 4D0CB 4XZUA 2H8PB 2W1NA 3QNZA 3RKPA 1MFCL 3MO1A 3LAFA 1A9EB 5F6HI 1AGFA 4OCRL 3RDTC 1H3PL 4QRRA 3OKMA 2DWEB 1DEEA 2GFBB 1ORSA 1TVDA 1D6VH 1EBAA 4ETQA 4U1GC 3MGTA 4R9HA 4OZIA 4U1MA 3VXRB 5F9WC 2A9NH 1T3FB 5ICXB 2ZSWA 4FTVD 4Q9BA 4JFDE 3MA9H 1ZGLB 1RQ5A 4JREB 2ZUVA 1I3GL 2XIDA 1D5XA 1DBJL 4G6MH 5F1IA 2WWKO 2NLJA 4JN1H 3NTCH 4WEUD 5DGQA 4OD1H 4C56B 1FH5H 3IGAA 4KK5D 4NHCH 4CU8A 2GCYB 3LKSA 5CJBA 2J1KA 4XX1E 4WGVB 1YQVL 4JANA 3QHZH 2HLAB 2HTKD 3SDAD 5KAQF 2IJ0C 1OF2A 5EOTA 5DMIL 5GS0D 3IFLL 1I1CA 4TSAH 5DD3L 4OF5A 4BM7A 2XQYK 2CPCA 5ID1A 5IFAL 2BFVL 3J7HA 5MERA 3DURA 2KKQA 1NJ9A 4FTVB 1B4RA 3TZVD 4ZXBA 3BYTA 4RAHA 3GMMB 2Y6SD 4E9LA 2PXYA 2WIIA 3RPIA 4LRNL 4MNQD 4NOBA 4WRLA 3LKRA 4PLKC 4QTIL 4E42B 1KB9J 3PGDA 1T0PB 3TJHD 4PJAB 1UXWA 3E6HB 3P0YH 1IGYB 4M5YL 1U8MA 4LSUH 5HHVL 4DEPB 3L3IA 4ZS7H 2P24B 3SDAB 1MIEL 2R2BA 4LP4A 4UOW0 5BO1L 1DFBL 2YXFA 3GMNB 3SQOL 4PGCB 1S7VB 2ZG2A 3MOAH 1A14H 3TZVB 4HFUH 3QQ4A 1A2YA 1F00I 4PJGE 2W9EL 6CGTA 5SWSE 4MNQB 4P59H 4BA8A 1WT5A 3AFLA 5GGTL 2VDKH 4LPUA 4HIIA 4CU7A 1GGIL 2PKDA 1OQXA 4NCC1 4DN3L 4HG4J 1HHGB 4JJHA 1Y0LB 5T3ZL 1IRAY 4JM2B 5CJ8A 5JLZB 4KJQC 2P43B 3O8XD 2G60L 4UT6L 5HYSB 3KXFE 3G08A 3RWHB 3CUPB 4F7TB 3ALWA 3QUMH 3L5WA 1XF4B 2PTTB 2QR0A 4ZUSB 4RAUA 5JW3H 4WW2B 3ROOA 1UFUA 5GGRB 5CSBA 4JDTL 5E2VH 3OJ2C 1U93A 1L7TL 4WUUD 2NXYD 2R2HB 1AD0B 2C3VB 4L8SA 3QWQB 4YNYB 5HI3D 2D31A 3NZ8A 4CW1A 4NQCD 4X7TA 4MAUH 1D5IL 3GIVB 3AAZA 1IC5L 1MHCB 5DYOB 2GJJA 5BOZG 2WLYA 4NRZA 2XA8H 3SKUD 5J12B 5F7YC 3QUXD 3JBG7 4NGHH 4YUEH 2Z8VC 4WHCA 1XEDA 2XA3A 4X7FC 3RL2B 1UWGH 4AEIH 4EDXA 4E0RB 1ND0B 1FRGL 2OTWA 1IAII 3UTOA 4MQXC 4DEPC 3CFCL 5E94B 2Q86A 2JKXA 3O8XB 2HTKC 2VLKE 3NCYS 2CUMA 3GM0A 3CVIL 5GS0C 5K9KB 2YSSB 1SEBA 5I1HH 5E2WL 2PTVA 1JK8B 3O2VH 4PJIB 4RSVA 3VFWA 4X6CE 5BS0A 4K8RD 4XPHH 2A6KB 5D1XC 4LLUB 4MDIA 1TQBB 2XKNA 3CLEH 3TZVC 1D3CA 1EHAA 2X4OB 4U1HA 5ACZB 3TJEH 4WUUB 2NXYB 2Y6SC 3EZ8A 4H1LB 1J1OL 4OM1H 1UKSA 1QO3A 4NQCB 5L6YH 4HV8B 5JMRA 2CIKA 4PPTA 4MX7A 1OAYL 3C09B 4EDWL 4P9HC 4OLVL 4RMRA 3QUXB 3NIGE 4N1HB 4WEBH 3TJHC 3EYFB 1MOEA 3QDME 4M03A 3GMPA 2MFNA 4J4PA 5DJ6A 3I50H 4LHUD 1FNSL 5DTFA 5MEOA 1U2HA 1UJ3C 4JM2C 3MV8D 3ARYA 5ID0B 1CICD 4Z7VF 4N0YH 4LLDA 1KGCE 3UAJC 4O2FA 4TTDD 4UB0H 3UJTL 1DLFL 1T21B 3EO1A 3G04B 1YEEH 4P4KC 4KXZH 3BUYB 2ATKA 4Z0XA 3BVNA 4OB5L 3LQAC 2GJZB 2E7BA 3W11D 4JE4B 4OBSA 1XT5A 1Q1JL 2EO1A 2CH8A 1CU4H 5KSVB 3BESR 2FZ3B 3OG6B 4RFOL 2MKLC 3EO0B 3MUGB 5DMYA 3G5VB 4MD4A 5CIPH 2P7TB 2QADD 5MHSD 1P7QA 3WD5L 3PP3K 4LHUB 1MFNA 4K8RL 3K1KC 1A1NB 5IEHB 4YPJA 4OCYH 1MJJB 4Z7WF 3MV8B 5DRZB 4PB0L 5IJKA 4BSVA 1CICB 3VWJD 1CK0L 4XNZC 3O8XC 2IGFL 5JOFB 4HS8H 1IBGH 2MQ0A 2DQEH 2N4IA 4FZ8H 5EO0A 5TGBB 4HEME 1I4FB 1CLYL 1JHLH 2OTUA 2I9LB 1NGYA 2FJGB 4KPHH 2JB6A 2ARWA 1NDGB 5E8OA 2OI9B 4LEOA 1AP2A 4U6VL 1NFDA 1YYLH 2F58L 4PJHB 3S4SG 2P48B 1A6UH 4CMHC 1INEL 2ZOLB 1BHGA 4KHTL 2NY6C 3NCBB 4QRTA 1CBVH 2AEQL 1WZMA 3WEXA 1AGEA 3SGKC 3C09C 4HC1L 2QADB 3SO3C 5ISZE 4H88H 4RGMB 2F8VA 3DX6A 2VQ1A 1QLEL 3MRJB 5F9DC 5J6GA 2Z35B 3ZKMC 5C0CD 1XF2A 2H3NA 3P0GB 3VWJB 4NUGL 1H0DA 1JWSA 3RGHA 3AS0A 4X4XA 5IROC 3IU3B 1EAPB 1PY4A 4NO3A 3SGEI 2AVGA 1ZSDB 3ROLB 5BJTB 5J1AB 4ODHH 4RWYL 4X5XA 2ZPKL 2XZZA 3L7FB 1XGRB 4Z5RB 5DF0A 1D9KA 3UYRL 4PJ5A 3PQYD 4JFOA 2NYYD 1TIUA 3C8HA 2W0PA 4WU5B 2R2CA 4R4FH 4F37K 3O4LD 1J05B 4LSTL 3S4SA 2MSPA 3GNML 3LZFH 4YE4H 2DQUL 5C0CB 3S3SA 1KLUA 5IW3A 3CH1A 3R4DA 4AM0A 5AD0A 4JPIB 3PHOA 1MY7A 2Z31A 4GRLA 3CZFB 2AKRB 1Q9KA 4EI5A 3L6FA 2VDRH 1VDGA 5E70A 3KPRA 3IDMB 1NC2A 4TYUA 3CNKA 1MWAH 1B0WA 3QUKB 1UM4H 5JO5A 3GHEH 2A9NL 4MDJB 4U1KB 2F74A 2AJYH 3V5HA 3PQYB 2GTWA 2CDGB 4KMTH 1XFPA 2Q8BL 1YEFH 5JIKA 2A6JB 4AJ0A 3O4LB 1GCFA 1BAFL 5I76B 3QNXB 4G6ML 2C3WA 4JY4A 5DQJB 3GBNH 4LLWA 4JN1L 2CRMA 2NW3A 2Y06H 4X6EB 2HMIC 3NTCL 4OD1L 1FH5L 4NHCL 1UWXK 5GRYA 3TPKA 2V2TA 3CXHJ 1T04B 1WF5A 5MI0B 3OKYA 1RJYA 3GMRA 3T3PF 1WTLA 2B0SH 3B5HA 3HTLX 4GW1B 4XXDA 4MJ6B 3RZCC 5K59F 3P4MB 4TSAL 2DLIA 5I1AB 3OHXB 2IADA 1ZA6B 3HE6D 2XQBH 1J0IA 1MCJA 1J8HA 3B9KA 1VHPA 4L4VA 4ZMAT 5L7XL 4NNYA 4IRSA 4JQXA 5AUMA 1RJCA 5DJDA 1KJ2B 1NH6A 3JSSA 1ZK9A 1I1AC 3MFFB 4NC1C 1MFBH 2YC1A 3VFPB 3DRQB 4MJ4A 4Q2ZB 5D1ZD 2GSGA 3O11B 3BN9D 1IM3A 2FGWH 1N4XH 4LSUL 4X7DC 3TP4A 4IRJA 1C1EL 3FT4A 1MEXL 3TEUA 4JRYD 5I16B 1KJ2L 4UTAH 5BVJB 2FATH 1KLFA 1Z5LA 5HY9B 3HE6B 2DQGL 3D39D 2AJUH 1OAQH 1BZ7B 1F3DJ 3MOAL 1A14L 2VR4A 1SY6H 3JUZA 4HFUL 1BX2B 1PX3A 2WWMD 1MY5A 1FG9C 4MNGE 3CIQA 2NYYC 1KCSL 4HFWB 4AEHL 4MNHA 3GSXB 4P59L 3SDCD 4LSVH 4NN7B 2VDOH 2XTLA 3HNTH 1KN2H 2VDKL 1IMHC 3V5DB 3K81A 1YA5A 3BEWA 3CPLB 3G5YA 5D1ZB 3DGGA 5EN2A 1HK6A 4OD3L 3X3FH 1T7WA 2XTJC 3FFCA 1HQ4B 1DTUA 4YHOH 1F2QA 1T5WA 4JRYB 4PRNA 4IDJH 5D7IB 2AS5M 4N8VB 1HDMB 4F9PA 5I1CL 4EOWH 2YWYA 3U9PH 3D39B 1PKQA 1AGDB 3GSWA 5JOPD 3ARUA 2P1YA 3QUML 5CLTA 4MJ2A 1BOYA 1IVLA 1J7VR 4F7EB 4FQIH 1OWWA 3OR7A 1JVKA 4XNUH 1JN6A 1S7SA 4LCIH 4OFPA 3SDCB 3TH2T 1FZMB 1AGCB 1S7TB 3LDBB 3I02A 3QB7C 2O5YH 3IU4H 2X09A 4MAUL 3L5IA 5DGRA 1K8DA 1KCUH 4NGHL 4NQTA 3KPMB 4YUEL 3U9UA 3HPLA 3MYZA 1OD7A 1UWGL 4AEIL 1Z9MA 1JWUB 1PW3A 4I4WA 2VKWA 5GQBA 1FFOB 5ACLA 2HJFA 1FFQA 5E2JA 5FDWB 2BNQE 2OR9H 2XKSA 1VFAB 5I1HL 1KUMA 5J1SC 4LVOB 3G6JA 3I3EA 1G7LA 5EZIH 1YPZE 3IDNB 3O2VL 1DBAH 1F97A 5LGJA 5I0DA 3TO4D 4FQJL 3I6LD 5L9DH 4UU9A 5C7XH 5HXMA 2RQ8A 3RY5A 1VSCA 3WMSA 4ZOBA 1M05B 5J3HC 1U8OB 5ADPH 1UC6A 1INDL 3QWOA 3SDXF 1MCEA 4NZDA 4WEBL 3KLSA 4HLZH 2OSLB 3BN9C 4EIZC 2GJ6E 3RY6A 2ZUYA 5DC4B 2KQNA 2R0LL 4DQOL 3SDYL 3DBXA 4GG6E 5I1KH 5BOPA 3BZEA 3DV4A 1KTKE 1SM3H 3HA0A 4NO5A 3SE3C 3BGMA 3TBSB 4LAQH 2X9XA 5FM4A 3AXLB 1OOAA 1LK2A 5CGYC 1YEEL 4D8PA 4JFEE 3TO4B 4QHMB 1VEPA 2Q76A 4XHQA 2A6DB 2WWMC 1T1WB 5J06A 1F3JB 3EJZD 1LQSR 3T08A 5F96H 2FLBT 3KYKL 4FFWD 2FH8A 1IEAB 2AJXH 3LDBC 1X6LA 3RUGA 1CU4L 3JUYA 2AXGA 1ZS8B 2BCKA 4PJEF 2VLRD 2JLLA 4HX1B 3HUJB 4EN3D 4HUXB 5HYJD 1HSBA 1ZLWK 1G9MH 4Y19D 4OCYL 3X17A 3ULSB 3FQTA 5EU7C 1VA9A 4GRMB 4L8DB 1U6AL 1NMCC 1IBGL 2DQEL 3MV7E 1IEBB 3QG6A 4G9FA 3WN5A 3VH8B 2LFGA 4JDZB 4KPHL 4MVBC 5IMMB 5J4MA 3QEQD 2ZUWA 5FIEA 1HOCB 1UH2A 3QPQC 1HH6A 3VXPB 1MCOH 5FUCC 4DTGH 3B2UD 3BPCB 1CDBA 3UBXB 2DMKA 4X8JB 1YYLL 5BZDA 1EDQA 2MQCA 1QBMH 3HE7A 3QT2A 2Q7YA 1N6VA 4IHOB 1BJ1J 4P5KB 4Z7WA 5JUEH 4J3SA 1A6AA 3IFPA 3AU1A 3ARGA 3VFVB 1CBVL 4YAQB 5IK3B 2VLRB 1NBQA 2X89A 4EN3B 5HYJB 4P23D 1T0MB 4Y19B 4Y4HD 4ONHB 1OP3K 3SGJA 1YN6A 4X4YA 1KJVB 3OKNB 3S3PA 5IV2A 3PWPD 4QTHB 2E6JA 2LAAA 3MRLB 4H25A 4LKCB 3LEXB 2JELL 1RIVL 4MXVE 1FNHA 2Z91A 4W4OA 1EGJA 2GIYA 3AROA 3QEQB 3T0BA 5ECJE 4Y16C 2G9HA 2FL5B 3IF1A 5C0NC 3GSRA 5TE4H 5JA9A 4NQED 3DOSA 1WBZA 1ACZA 5LAXA 2KQMA 4RQQA 5A1AA 2X70B 4LLYA 3FONA 1IAIM 3FOLB 3AS2A 3RWEB 4U3XA 4R4FL 4U1LA 4I5BA 4J3UA 4P23B 3LZFL 3CCHB 5DO2C 4Y4HB 3O0RH 4I2XE 4JDVA 3UYPA 5HHOE 4P2QD 1N6UA 5CHNB 2L7JA 3PWPB 4ODVH 1U8QA 4QWWC 1VPOH 4YR6A 3V5KA 1L4IA 12E8H 3P30L 4Y1AD 4ZFZB 2RFXB 1LHZA 3ZTNH 2VDRL 1T80A 2FYYA 5JXEA 3MLZL 5AZ2H 5DC9B 1NCCH 1KACB 1MWAL 3LKPB 1HKFA 1YMME 4NQEB 1UM4L 4KJWC 3IDGA 4X6BB 4WI9A 5DVNA 3GHEL 3NFPA 4RISL 4DZ8A 4OF8A 5D9SB 4JCMA 4OKDA 4OCSH 2PYFB 4JAMA 4OZGE 4KMTL 2DI8A 1BOGA 1YEFL 4XBPB 4EUPB 2CIIB 2H6PB 1LGVA 1IM9D 4U49A 2DBLH 3QHTC 1A6TB 2VZUA 3VFRA 1U91A 4OZFB 2LTQB 2Y06L 3PHQA 5C07A 43CAA 4ELKB 4JFXA 3MUJA 3VXTA 1HEZA 4P2QB 4PFEA 4APQC 5DUMH 3FT2B 1DL7H 2EH8H 3PUCA 1Q94B 1AO7A 2R1WB 4Y1AB 5GS3A 3KDMB 2B0SL 4NC2B 4PJGF 5FECB 4DCQA 5C0BD 4WGWB 1IL1B 3BP5B 5F7MC 4YEFA 5F7KC 4GS7C 4KZEL 3B2UC 4LPTA 5H35B 3BO8B 2QQKH 5JTWA 4RAVB 2IBZY 2XQBL 4YPGA 2DQJH 5FYKE 2MWCA 1PLGL 5D7LA 4LDLB 3WV0A 2G5BA 2BVPA 3QQ9D 3LB6D 4OTXL 1FNLA 1GC1C 2VR5A 3WIFA 2EEAA 5JXAH 3FTGA 4ENED 4CVZA 1RUQH 1VFOA 2IFFL 1K6QH 4JFYB 3I6GB 1G7QA 2DMBA 2VE6B 2H26B 1IM9B 2DLGA 5JHDE 4FQCL 2H41A 4ZUWB 2NX5D 3E2HC 4U3CA 3RIFF 5GIRA 4N8CL 4LLMB 2HT2C 5CGMA 5E99L 2FGWL 1N4XL 2VITA 2XG5A 2YR3A 1CDUA 3DX8B 4JKPH 4WFGE 3W0WD 5IQ9B 5I0ZA 1D5ZB 1CZ8H 1LEKA 5C0BB 3RWDB 3CSBA 4PJCF 3U1SL 1ORQB 5DUBB 4KXZI 4P0DA 4OGXL 4OAWB 4IOIA 4HUVB 2VWEE 5EIVA 1YJDH 1C16B 4QXWA 3T4YA 2AJUL 1OAQL 1AR1D 1C12B 4TVPH 1LE9A 3SHSA 2R69L 3GZKA 3IDIA 3RNKA 1BLNA 2AJZB 5EUOB 1E4XH 3CFIC 4OIAA 2GSIA 4P46D 2JJUA 4DN4H 1C5DA 1QSEE 2NX5B 2VDOL 4EEEA 1KN2L 2LTQC 4WIQA 5DD1H 3UDWA 3RU8H 5CCKH 3L3GB 1ZE3C 4HWBH 2FR4B 4X6CF 3X3FL 3N1FC 4LCWE 4ZTPL 1JI1A 2EDLA 3W0WB 4YHOL 1YY8B 3VRIA 1OQOA 1Z9OA 4R7DB 4IDJL 1T6VN 3E1F1 5IVXE 4JQVC 1BEYL 1N8ZB 4ZFOA 5ITFB 2VZSA 3U9PL 2OQJB 1KIQB 5EZOH 2X42A 5AEAA 5E7FA 3VGGA 1RZ8A 3IFOB 3NIGF 4PYGA 1S9VA 2EYSA 2HFEB 2ERJB 5JORB 4P9HH 3MV9A 4XNUL 5C0GB 4LCIL 5IIEB 1NKOA 3WSQH 8CGTA 5J8OA 3IU4L 4U6YA 1A6ZB 1ODAA 1NFIB 1NEZB 4YDKH 1YUHA 5E5UB 1R3KA 4HK3N 4D3CH 5MEND 1IJ9A 3FRPG 3C08H 4XVJH 3AY4A 3RIFK 4NSKB 3GB7B 4RFEB 2OR9L 2ZUSA 3U82B 3VJ6B 3LQAH 1ZVSA 4QOKD 4OCMC 5DMGD 3FHAA 3QQ9C 3LB6C 1DBAL 3E3QE 1RV6X 5IHZB 2D7PA 3FO2B 3D2UD 3AM8A 5C7XL 5HPOA 5CJOL 1XGPA 2E7MA 3BZFB 5ERWB 1J18A 2W65B 3MTRA 3HPJB 3EZJB 3FT3B 4G6FB 2VTFA 2BNRA 4UDUA 3GJFB 4NZJA 1T03L 4LF3B 5DHVB 1S7UB 1JF5A 3ARDD 3V0AC 1JZ6A 4B5EA 1GAFH 5MENB 1S7XB 3BWAB 5LWYL 4W68A 1ZV5A 2CDFA 3BIBX 2Z8RA 4ZNCD 1UGNA 1ZT1B 3RVVC 4M5ZL 1U95B 4N0UB 3K2UL 4HIEA 2PUQT 5I1KL 5IQ7L 1NSNH 2EEBA 1LEIA 4QOKB 4BQBA 4LAQL 2WUBL 4L9DA 5HYFA 1AR1C 1I7RA 1X5LA 3D2UB 3SDXA 3WDHA 1KNOB 2UZXB 1U41A 1R5VB 5F96L 4XNYH 2YPVH 4C59B 5C6PB 2AV1B 2YXMA 4QRPD 4QHNA 3KPNA 4IIQA 2VAJA 3ARDB 4PLJC 1W0YT 5IBTH 3PJSA 2UWEE 3I85A 1G9ML 5D1QB 1S9XA 5D8JH 5GS1B 4F3FA 1RZGB 1Q0XH 5FO9A 4TULH 4WFED 2PYED 4EBQH 1KIPA 1LE5A 5IT2H 2V2WB 3QI9A 4CDGC 3RIAF 1U3ZA 3IJHB 5C09A 1MCOL 1M7IA 1J0HA 4X6DF 4PJEA 2NY5L 4P3DB 5F9OH 3ABZA 4JKMA 3PDDA 5IW6B 1BFTA 2W60B 5IB1A 1WFTA 1UEYA 4KTDH 4FQHB 5JUEL 2V5MA 4OI8A 4K3JL 2JJSC 1CIDA 1N0LA 5C6WH 1WISA 3P9LA 3MRHB 4EI6A 4WI5A 4S1QH 5IB5B 5E8NA 1E6OL 1FBIH 1A4JB 1HHJB 3WNLA 2QBWA 1OM3H 2HJLA 1K5NB 3UZEA 4JRXE 2PW1B 3HG1E 1QRND 4UQ3A 1NCNA 2X4TA 4XAWL 3U7YL 3LS4H 3I2CH 4R8WL 1YEDA 1ZWIA 3MNWA 3RWCA 5DMGC 5FUOH 1K9TA 3RVXD 5JPNB 5IF0A 4HJGA 1CE6B 3FAWA 3RNQA 3PABA 5TE4L 4XCYB 3UXFA 2L7UA 3C9NA 4I0KA 4NFDA 3SBWC 5I1IL 5F7WC 4LASH 3CVHB 5BZWB 5IW1B 2B4CL 1U3HA 3QDHA 1QNZL 4PREA 3O0RL 5F21B 1UEMA 3KS0J 5D1QC 2I9TB 1E4KC 4D9QE 1MRCL 1WBXA 2OMNA 4ODVL 5CBAB 5ADOH 3T1FB 3D85D 1QRNB 1VPOL 4PJFE 3L3JA 2BVYA 12E8L 4R3SA 5IMLB 1DDHB 1JFQL 4N0CD 3ZTNL 4DKDC 2HTLC 2ICWA 4LDEB 1GRWA 4OLYL 1BGXL 5AZ2L 1NCCL 2DTMH 3WIHA 4G6AC 4I1NB 1IAOA 4M7LH 3VFSA 1A3QA 3KS0H 2X4PB 3JV4A 3RIAK 4LQ1A 5D2LE 4BKLA 2V17H 1AGBB 5K9JH 3C5SA 1NGXB 1ULVA 5KTEL 2NY4D 5KS9B 1I85C 4RGOH 1CGUA 1LO2H 1ZEAH 4YIQB 4WU7B 4X99A 3JV5A 1S9WA 5DK0B 2EH8L 1SMOA 1T0NA 2R23A 3D85B 3WNOA 1OAUH 3FJTA 1EUUA 5KG9A 1IFHL 3VFOA 4IMLA 4OF3A 4D0CA 4R0LB 3PDGA 3O4OB 4AH2A 4N9GB 1X5ZA 4XCFH 3CFJB 3WYRA 4JVUA 4W81A 2X4QB 1DQMH 1CDYA 2B1HH 4K94C 4ZPTB 2J6EH 5EZLB 2E9JA 1UB6B 5JXAL 4GUPB 1B3JA 2DWEA 4KDTA 4M7JH 2GFBA 1RUQL 1YMHB 4MXQD 5DRNA 3F65A 4NKDA 2A83B 3B6SB 3S6CA 3VXRA 2NY4B 2X40A 4PJGA 2HKFH 4HXBL 5ICXA 3LEYH 1AFVH 1OT1A 4HGWA 3IS0X 1KXVC 1UT9A 1BD2E 5CWSB 1Q8MA 4V1DD 4L3EA 1R3HA 4C56A 1CZ8L 2ESVE 1GYAA 3WHE0 1W72B 2NR6C 1AI1H 2BC4B 4UILH 5HDBF 5FGSA 1HIML 1YJDL 2HLAA 4TVPL 4OF6A 4PRHA 4ZUUB 4UTBH 1Y6MR 4XBGB 1WFOA 4DN4L 1ZLUH 4KKAC 1W72L 4PJCA 2O61B 2H32H 5DD1L 1FDLH 1FFNB 4YDVB 3RU8L 3VGHA 1YPZF 4I18B 5CCKL 4MSWB 3FHQA 1DVFC 2F53D 4V1DB 2A1WH 1S7WB 4E42A 5HYSG 4NKQB 4G6KL 1EHXA 1FAIH 4PJAA 3RVWC 3E6HA 3UP1A 5BCAA 2JK5B 3ELAT 4CMMA 2YUVA 1KCKA 4ZG1A 4JFPB 5EZOL 5I74B 2P45B 3SDAA 1V3JA 1U8HA 5IUSA 2ZKHH 3N1MC 1DCLA 2O93L 3GSVB 4GAJH 2UY7A 2QHLA 3GMNA 3EYVA 4R4ND 3RQ3A 5DQDL 3IJYA 3L5XH 4WTXA 1S7VA 4MLSA 2KH2B 2APTA 3X14A 4FTVE 1WQVT 1JZ5A 1R3JB 3B8SA 4G8IB 3A67L 2CR3A 1QBAA 4BQ8A 1XGUB 2F53B 4S1RH 3ISWA 1D5BB 3PNWA 3VXMD 4GAGH 1WCQA 3MCG1 1OTTD 2R2EA 3T77A 3C08L 1N5YH 2OXGA 1X5AA 4XVJL 5FCUL 1TPXC 1CD8A 3WCYA 4C54A 3LQAL 3F58H 1HHGA 3DYPA 5JLZA 1MH5A 4FQXD 4V2CB 1FSKB 2I60H 4H1LG 1AHWB 4YK4B 1A3LH 4F7TA 5KVGH 3P4NB 5EBLA 1XF4A 1BECA 2ITDB 2PTTA 4ZUSA 2ILLA 1MJ8H 1FYTD 2IH1A 4FG6D 4WW2A 3CFBB 1I7UB 5GGRA 4GQ9H 5E2UH 5GSRA 1T83C 2GKIA 4HZAA 5E8PB 4BQ9A 3VXMB 2R2HA 1AD0A 2C3VA 3O9WC 3QXWA 1YEKH 4MNQE 2XWJA 3DXAD 4YNYA 1GAFL 5IWLA 1XH3B 3GIVA 5BRZA 1P69B 1MHCA 2ZOKB 1JNLL 4CBPA 4L3AA 2VDPL 1FO0H 2FBJL 2HG5B 2VN7A 2XZAH 3HNSH 4FQXB 4PJXE 1QSZA 4QHKJ 2VZ3A 4FQLL 3PGFH 5K9KA 1OWRM 4PGBB 2YSSA 1DZBA 5CJXA 4DZBA 4KAQH 1JK8A 1WBYB 4O51A 4XNYL 1FYTB 4JZJC 4LHJB 1CVRA 5EPMB 3DETD 3T0EC 5DFVD 4MXVF 5ACZA 4GG8A 3GM8A 4S1SH 4OT1H 4LHUG 3HKFA 3DXAB 3NA4A 3OBAA 2BVEA 4HV8A 1NGWB 5D8JL 4YHPA 3QUXA 4TPRL 1KIRB 2FECL 1Q0XL 3EYFA 2JJTA 3FO9B 2EDNA 3QFJA 2K9UA 1A6WH 1T4KA 4W4NA 4LLAA 2FEEI 2RCSH 5F9OL 3RWFA 4R4NC 1T21A 5CZXC 2CLRB 4PJIE 3VA2C 4GW4A 4UNTA 3EO9L 3K46A 2AP2A 4WUUE 2GJZA 1CD9B 4OKVB 2Y23A 4NQCE 1FBIL 1MHPH 2OJZL 3MUGA 2OM5A 4KI5C 4X6DA 4CVWA 1CXEA 5DVMA 1DQLH 4L4TE 4LHUA 4OZGF 1A1NA 3I2CL 1MJJA 3MV8A 2AGJH 1WAAF 5DRZA 5ENWA 1EEZA 3S5LB 15C8H 5FUOL 5FOBA 1GGBH 3VGBA 1E4XI 5JOFA 3L1OH 5TGBA 5CEXB 1I4FA 3BP7B 2I9LA 2FJGA 5DJ2A 4JVPA 1NDGA 1CLCA 2LQRA 1WGOA 2AJ3B 4XP5H 3TCXA 4F8QA 2ITCA 2BXZA 3CX5K 3JVGA 1T1ZB 1EPFA 1LK3H 1KIUA 4Y4KD 4D9RD 4ZNEE 2EDKA 2QQLH 4TTGA 4K3DH 1LDPL 4HQQH 1A7PH 1X3DA 5ADOL 1UKTA 3OKLA 4ODWB 5F1OB 4RCAA 1T89A 4Y89A 1JWMA 2R0ZH 2P42B 3MRJA 2Z35A 2FO1A 3VWJA 3GO1L 3X3GH 4HIXL 1A1MB 4S2SB 1F5WA 4OFYA 4ZFFA 3BSZL 2DTML 5IB4B 4Z7QE 3O2WH 5GHWL 1HHKB 1AE6H 3ROLA 1ZSDA 4XI5D 5BJTA 5J1AA 4YQXL 1I8KB 4K23H 5F44A 3KPQB 5DFVC 4PJHE 5FKAB 2V17L 4IOFD 1XGRA 3C5JA 3QEUB 4S1DD 4KRLB 4M1GH 2A6IB 4Y4KB 3DJ9A 4RGOL 1LO2L 1CIUA 4KZDH 2BK8A 2OL3B 2XI9A 5DHYA 3B9AA 5D5MB 3TF7C 2CDEB 3EYOA 5EBMB 4POYA 5IESH 2BHYA 3KHOA 2YPLD 1OB1A 1A6VH 4XCFL 1JIBA 1LP9A 1U8IA 2ARJQ 4JPIA 1Q9OA 1I3RA 2EXWD 2ZUUA 1R5WB 3QG7H 3U7WH 4PJ9D 2J6EL 3IDMA 4M62L 4Z8FL 2W9LA 1EHLH 2EXYD 4H26B 2MCG1 1JUFA 1G7IB 4LIQH 2BY1A 5B8CB 5IVNA 5IVXF 4PJ8D 4MDJA 3LEYL 1AFVL 3MQIA 1WIPA 2A6JA 3O4LA 1NAKH 4AIZA 4NC1E 3QNXA 2VDMH 5TDPA 2F54E 2ZCKH 4ZODA 1BVKB 1VENA 3K7UA 3MJGX 5C0CE 1II4E 5IP4A 2YPLB 1I3UA 4P2OD 4E41D 1AI1L 2HKHH 4GW5B 1H5BB 4QRSB 2EDOA 2Q8AH 3RI5K 3C6LC 1IE5A 4GOSA 5IVOA 5B39B 4MJ6A 2WV3A 4C83B 3P4MA 1N59B 4XGZB 5I1AA 3OHXA 1ZA6A 5CKGA 4POZD 1OSPL 4B50A 2HFGL 4UTBL 3H3PH 5D93C 2CK0H 4LARH 5IHUH 3WS6A 5LXGH 3LH2L 4PJ8B 5H37G 1D7FA 1W0VB 1ZANL 1KB5B 2H1PH 4Y4FD 3EDFA 1PAMA 3PQYE 3KPTA 4Y4KC 3JTTB 1R24B 1KJ2A 2AABH 4L29A 1JGVH 4PGJA 3GBMH 3MREB 4P3CH 3VFPA 3DRQA 2A1WL 4N8VG 5HHXH 1FAIL 1F11A 4P2OB 4Q2ZA 4E41B 3O11A 2XTJE 5E8EA 5DR5L 1HXYA 3EDDA 3QDJA 3U6RA 1HYSD 5CP7B 1EZVY 1TTFA 4XHJC 3O41A 3CU1A 2ZKHL 5I16A 4H0IA 3D25A 3GSUA 5HY9A 3BN3B 1U58A 1JCKA 5IMOB 4UT7H 2XT1B 5D7KE 5J57B 2XYCA 3THMH 4HKXB 3L5XL 2Z0BA 3B9DA 4Y4FB 1CQKA 5C08A 4S1DC 3EJYC 1Q9LB 5FKPB 5B8CC 2VLME 1E4JA 3NIDE 5EO9B 3EOYG 4HFWA 2E9WA 3WFZA 4R90H 5KSBF 4S1RL 1ADQH 3GSXA 4I0PA 2I27N 3CXHK 1I9JH 4QHUA 5C0DB 5I1GL 1BF2A 3ES6B 1LO0H 3QUMA 6FABH 1FC1A 1EBPA 1QHOA 1JL8A 3V5DA 2F8OA 3ZSTA 4ISVA 5D1ZA 3EYUH 3ZT6A 3TV3L 4LSSL 3N85H 1FZOA 1HQ4A 4OJFH 3BDXA 1AGFB 4Q7DA 1G0YR 1NCAL 4MMZC 5D7IA 1MCCA 5CILL 3VRLF 1IGMH 3OKMB 1F8TH 3ARBC 2UWEF 3CXDH 2AXHA 5IR1B 4F9LA 1A3LL 1N7MH 2YRZA 2F5AH 1OGAE 1JZ4A 5KVGL 4OZIB 4U1MB 2VB5A 4F7EA 4PJ8C 2ZSWB 1NUDA 4GQ9L 5E2UL 4ZOEA 3SJVE 5HGBB 1JYWA 1BF8A 4X8XA 1EEYA 1D5XB 3SDCA 3WNKA 3T2NL 3N50A 1FZMA 4S0SD 5F1IB 2YPKA 1AD9B 3MRBA 1S7TA 2LE9A 3GSOB 4L5FH 5KVFH 1J11A 3B3IA 2GHWB 3IGAB 4QT5B 5D2NA 5JIPA 4CN1A 1ZA3A 5C0AD 1UADC 3GGWB 4KGLA 4P5TD 1FO0L 3BDBA 5K9QG 4IDLA 4WFFD 3W5NA 3MLUH 2AK4A 4JRYE 4RDQF 4J3OC 2CQVA 1BWMA 5EOTB 1SYVA 1VFAA 3D39E 5HPMA 5ID1B 4KY1H 2CRIA 1OTUC 4KAQL 1QFWH 2DI7A 3IDNA 4KRPD 5FV1L 4BUGA 1NJ9B 3DARA 4WHYG 3VU2A 1B0GB 1HXMA 4S1SL 1MCIA 1UM5H 4OT1L 1CXIA 4DK3A 5GJSH 3H9ZA 1DJSA 2QEJA 2VLJA 5T1LA 1OL0A 2JTDA 5C0AB 2JJWA 5FA3B 4BZ2H 1UXWB 3RVUC 4XWOD 4P5TB 2FH6A 3VH8G 4MXWH 3LY6A 1U8MB 5LGHH 4X98A 2A73A 1HYSC 4NWUH 5EU7E 3SCMD 4KVNH 1A6WL 3KVQA 2PETA 1G9NH 4CL7A 5A2LH 5JOPE 5FM8A 1EJOH 5E6IC 5C6TL 5CIPA 1F2XK 4HT1L 4KRPB 4R2GC 3IXAA 5FUCE 2OXHA 3DHJA 3K3QA 4QHMA 1A2YB 2A6DA 2XFXB 4PJFF 1T1WA 2H2PD 3ULVD 2BOCA 3WFBH 2MNUA 4P57A 4WTZA 1IEAA 2P46B 2VABB 1XGYH 5GGVL 1T66C 3O6ML 1MHPL 1ZS8A 4HIIB 3HI6H 4JVWA 2EE3A 4KK6C 2J8UE 4HUXA 1DQLL 4TN9A 3C5ZA 5D2LF 3SCMB 2AGJL 4GRMA 15C8L 4Y5YC 1QBLL 4PV8A 1GGBL 5CKAA 1F6LL 3G08B 1J5OH 2D7TH 3L1OL 4O2EA 1T5XB 4EJ1C 1L7IH 1QYGH 1A4KA 1PJ9A 3OKOB 3MRMA 1JV5B 3P9MB 3CAFA 3L5WB 4H8WH 4RAUB 3ROOB 2D7NA 3KJ6H 4TOYH 3UBXA 3BKJH 4XP5L 5C2BH 3FL7A 1P4IH 4ZXBC 1EUTA 1FL6A 1U93B 4L8SB 2PXYC 1LK3L 4IHOA 2O5ZH 2YWZA 4BH8B 3NZ8B 3HC3H 4CW1B 4P2RE 4X9GA 1WAAA 4X7TB 4M7ZC 4ESKA 3ULUD 2ENYA 3AAZB 3VFVA 4YAQA 5IK3A 2VLRA 3NFNB 4NRZB 2QQLL 4EN3A 1DP0A 4HQQL 1A7PL 3HUJE 4EDXB 2R0ZL 4J4PD 4Y19A 2OTWB 2GITB 4ONHA 5E9DE 2IAND 4TUJA 4PG9A 3S7GA 4XP4L 3ULVL 3OKNA 5IFJA 3MRLA 4LKCA 3LEXA 1NUFA 4NKIH 5F7NC 3QP3A 4L8BB 3QEQA 2EC9U 3W9EA 3DO7A 4Q0XH 1AE6L 3VFWB 1H3VA 2V9QA 2RBLA 4K23L 4EUPG 4XCNA 1XIWD 4OZFG 1O0VA 4M1GL 1N6QH 2ICEA 1EK3A 4BYHA 1MCWM 5E7BA 4MX7B 3F7QA 4KZDL 4UNVA 4MA7L 4XWOC 3VD5A 1MWAA 1KEML 3GMPB 4P23A 4HUMB 4XNQA 1P7QD 2YD2A 2GUOA 2BMKA 3MLSL 4NO0A 4YHMH 2IANB 5DTFB 4PRAA 1K3ZA 3LQMA 5HBBA 2VMFA 5CHNA 3MRPA 4NJAL 4LLDB 3O6FC 4J1UA 4O2FB 3CFDB 3EOTH 2K7PA 4UV7H 3EO1B 2NQCA 5KSUA 4N5ED 1NCBL 3U7WL 4AQOA 3TWCH 3REWB 1N0XH 4TUKL 3LKPA 1XIWB 3BVNB 3MLWL 4Q9RH 4X6BA 3T09A 5ALCH 4L8SC 3RX8A 2B39A 5CINH 4OBRA 5L0QB 4WW1A 43C9A 1CLOH 2PYFA 3EHBC 4AY0A 5HVFB 4XBPA 4MD4B 4M61B 3HI5H 3ILQD 2HP4A 2VDML 1P7QB 2ZCKL 1A6TA 1A7RH 2AV7B 4P2QA 3UTPD 1IZJA 3SY0B 1J10A 3PWPE 4NN6B 3U0PA 1Q94A 2HKHL 1H3WM 4R96A 1K8IB 4Y1AA 3KDMA 2JB6B 3KGRA 4Y5XA 1P1ZB 4JO4L 4LEOB 3O3DA 1OVZA 1OAKH 3BO8A 3MLXH 3EYQC 1ONQA 2VXVL 4GBXD 1MRDH 4BFGA 5IHUL 5LXGL 2MHAB 3OL2A 3C60D 1UM6H 4J6RL 5GGQH 1PG7H 1D9KD 4QRTB 4X4ME 3WEXB 1AGEB 4JFYA 3I9GH 5DEZA 3TESA 4FFZH 1IM9A 3DX6B 2VQ1B 4ZUWA 1BP3B 4P3CL 3H9HA 5J6GB 5JQ6L 4J4PC 2V5TA 4UMGA 4LLMA 5EU5B 2H3NB 5HHXL 1FIEA 4BSWB 4LIQE 2L0DA 4TNVK 1SBBA 4Z9KB 4RIRB 2P5EA 1F02I 3IFNH 4GRLD 4HUNB 3T2OA 1D5ZA 5C0BA 3HLAA 3RWDA 5DUBA 5GZOD 1PZUB 3ZSSA 2NW2A 3JV6B 3KPRD 4OAWA 3Q0HA 5CLWA 1HZHH 4GBXB 2AEIT 4LVHB 4YZFE 4UT7L 3C60B 2EC9T 3QDGD 5HDQH 1C12A 4NQSA 1D9KB 5I1DB 4PJ5B 2AJZA 1FORH 4XNMB 5EUOA 1NEZG 4TSBL 4UINH 1ZMYA 4JM2F 4PJXF 4U0QB 2GTZB 2YN3A 2R4RH 3I6KB 2NY2C 1BFVH 3STBA 4O5LH 1I9JL 2F5BL 3KJ4B 4JO3L 2NX5A 3VGDA 3UJIH 4IJ3B 5FGBA 3IKKA 2VDLH 1KLUB 2XNAB 1KV3A 4LOUC 3L3GA 4PUBH 3CH1B 3WXVL 3EYUL 2FR4A 4NN6C 1S5IH 5ICZB 3WS3B 3N85L 3PHOB 3S35H 4GRLB 4OJFL 1YY8A 4OCWH 4HUUB 1Q9KB 1U8KB 5F7DB 3L6FB 4EI5B 5F1SA 3GI9H 3KPRB 1IGML 2HT4D 4O02L 1F8TL 4WUKL 5ITFA 4Z7UA 2NY0C 1GGCH 2OQJA 3CXDL 5KSBA 3T1WA 3KPSE 1N7ML 3B43A 4LL9A 3QDGB 3VG0H 4KKLD 1J8HD 5JO5B 3B9KD 2F19H 2F74B 1NLDL 2HFEA 3V5HB 1WUNT 5JORA 1MFDH 4LSQH 1NDMB 1WK0A 1KT2B 4P46A 5C0GA 5DDHA 5IIEA 2CSPA 5EUKA 2KZWA 4PG2A 3ILQC 1AJ7L 4LLWB 1PY9A 2NW3B 1TZHA