1MQ8A

Crystal structure of alphal i domain in complex with icam-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
184
Chain Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords intercellular adhesion molecule-1
publication title Structures of the aL I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mq8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mq8A01
2FO4B 5KVDL 4YXHH 3M8OL 2BNRA 1CFQB 5I1HH 3HN3A 1BWWA 4Q7DA 4XMKL 3S34H 3MRJB 2CXGA 4EN3B 1MLCA 1OM3L 1WWCA 5MENB 3TGXA 4OQTH 1LEKA 5FKAA 3T2NL 4EQ3A 5DD1H 4NDMB 1MCQA 4OZFH 5H2BA 2QL1A 5DJDB 4DK6A 4EVNB 4EI5B 1FZKA 4JDTH 3JTSA 4MQXC 4JY5H 2W92A 1FJ1B 1S7TB 3D85A 4OQTA 3TFKD 2Z91B 4LLMB 2FZ3A 4LU5L 4UI2A 3R06B 5TF0A 5IOPA 3NTCL 1PZUB 1MVFA 4HPOL 5CEYA 2YD3A 2C7UB 4OZFA 3VXUE 3WXWH 4JZNA 3HNTL 1MCJA 2NW3A 2GT9B 4JHAH 5BZDB 1DUZA 1HN1A 2DQJL 2EXWC 5KSVA 1U9KA 3E8UL 5GGQH 4C56A 2P24A 1XGTB 4JQXC 4LSQL 2APTA 1QACA 2A73A 3QI9B 1U8OB 5L8KB 3ISWA 3P9MA 1Z2KA 1CDJA 2FIRT 5B3NA 4GSDH 4I1NB 1F2QA 3NCYP 1JTPA 1EX0A 2DL2A 5GSVA 1U58B 4PJXB 4XCCH 5J1SC 1R0AH 1DUYB 4OV5A 3MRIB 3MR9A 4PRBB 2A74A 3QDJD 1RI8A 5IB5A 1FLRH 4Q97A 3ECBA 4OGYL 5DK3A 1UQSA 4P57A 1SM3H 4CU7A 1QD0A 3H2WA 3KHQA 4M1GH 3K8LA 4PJ5E 3IVKA 3ROLA 1H3GA 4LFHD 5IVZA 3ZDZE 1INDL 4DQOH 2VLRA 3BP6B 3QHFL 3SDDD 5HD8D 5JW3H 3X3GL 3RVWD 3EOTH 4KK8C 4DEPC 3VFGH 5ALCL 5GRJL 4JN1H 1EEYB 4IRZL 5DJ0B 5SWZA 5DC0A 1O0VA 3P2TA 4S1SL 3KLAB 5KSAD 1P6FA 4U1LA 2YXFA 5HGGS 3CJJA 4NWUH 4NBZB 4ODVL 5DYOA 4FRWA 5HDBE 1BOGA 1MNUH 3L3KB 4M5YL 4U1NB 3MV8B 4MSWB 4Z5RA 4JFPA 4I0PB 5D8JH 5T3ZL 4BSWB 3PL6C 1NKRA 3CDFA 4NO0A 3QFJA 1Z3GL 1XR8B 4X7SL 2V5YA 1D6EB 3TBSB 4N0UB 5CCKL 1V3MA 2E6JA 2CLZB 2ESVE 3BPCA 4FXLA 4J3XA 1I1CA 4XNZC 3HG1D 4W70A 2DYPA 2XN9B 3OKMB 3T8XA 4W4NA 4NUGL 5T5NG 3VFSB 4ZUTB 1MJ7H 5FF6B 1Q0YL 4IRSC 43CAA 1A6UH 1J0KA 3C2AH 15C8H 4QRUB 1NANI 1G9NH 1Q9OA 1TZGL 5GS0D 3C6LC 5I1KL 2XQBL 4UAOB 5J4MA 2BZDA 2P5EE 1F5WA 5DJAB 4JN2A 3I3DA 3WLBB 5KSBE 1A6TB 3T4YB 1OB1A 3MV7E 3QYCA 5GIRB 4XWGH 3EOAB 3L7FA 4EXPX 5JR1L 3CFEA 4WEBL 1U8MA 3V6OC 3SKJH 2QQLL 1N6QL 1KC5L 1S3KL 2ILLA 2QQKH 3TZVC 4EDXA 1F3JA 2HH0H 3QEHB 4OD3H 3V2AR 3U36B 3PUCA 1A6AA 1RUMH 3WFCL 4ZO7A 4N0YL 3H8NA 4O4YH 4PJGF 5ANMA 5HGAA 3VD7A 1ZTXL 5CWSB 4F7MB 1D5XA 4LSSH 3U46B 1IKFL 3V6BR 3SDCC 4X98A 1P4LB 1J8HB 2EKJA 1JWUB 4X80L 3MNWB 3BOVA 3TBYA 5J1AB 3LQMA 4L3ED 1A47A 2C3VA 3CX2A 3B9DA 4ONHB 2YR3A 4CVWA 2RHEA 4K7PX 1EAPA 2VDQH 4KJPC 1FE8H 3ZKXB 3K1KC 2CK0H 3PWJB 4PJ9B 3CIQA 4QCIA 5E8NA 2UUDK 4TUOB 1VPOH 3RWFB 5LGKA 4FQXB 4Y1AB 4QRPA 5BXFB 4Q6IC 1CN4A 4M7LH 2M2DA 2Q76B 3G08A 1WZ1L 3ESUF 4XHJD 3VWJC 3WN5A 2P5WA 4DUVA 1AO7B 4FFZH 3L5XH 4NHUB 1N5YH 1EEZB 1BX2B 3NABH 1T1YB 4RFNC 1S7SB 5JA8B 3RL1B 5T5FL 5MP6L 4GXVH 1BVLB 5FKPB 2YA0A 2V17L 3AGVA 5JLZB 3MNZA 2VDNL 2WBJB 5KANG 2CDEA 5EU6A 3QJHB 4DKAA 5J12B 4CW1A 5BJTB 3QIWD 4BUHA 1C12A 4MS8C 1MCLA 2EDNA 2EH7H 3MJ9L 5DA0B 2IC2A 4NQSA 4CRPA 4HIIB 1KTDA 1EERB 5L6YH 2JJVA 1ZLWH 1EHNA 3RTQA 5D1XC 4QRTB 3PF2A 1N5AB 1LE5B 3ULSB 5I1GH 5F70A 1T6VN 3NPSB 4YBHA 2QSTA 1DR9A 4I9WE 1IM9D 4XP6H 5KS9A 4MAYB 4KGLA 4BA8A 2VOTA 4ZNCD 3U0WH 4NN5C 1EJOH 2W1NA 5TFSL 1N6UA 2X70A 2VSDA 3FQTA 1E4XL 4ZFOL 2J6EL 3LD8C 3G9VA 4NT6B 3U9PL 3AS1A 4GMTL 4NKIL 3PXJA 4P48A 1U3HA 4B53A 4CN1A 5EC2A 1ZHNB 4KRPB 5BMFL 3NFSL 1KJ3H 4NN6C 4XNXL 5IQ7L 4B5EA 3S3PA 2XRAL 3O3BB 4YDJA 1SJHA 4YPGB 5F1NA 3VGBA 3IXAA 3HC4H 4HKXA 4AG4L 4F7CA 4OZHB 4MQXD 5CHNA 2BSRA 3B4NA 1A9EB 1T21A 1VFBA 3MGOA 3N50A 4KMLB 1B9ZA 2QADC 2H9GA 3UBXI 2OJZH 3DI3B 3L5IA 4L29B 2V7HA 1MUJB 4FABH 4MXWL 2FJGB 1NUNB 1LK3L 1T83A 5HHVL 1I7ZA 2IADA 1Q9LB 3HB3C 3BQUA 1LO4L 4JFDE 4QRQB 4KROD 1U8KA 3MLTB 3ZT6A 3BH9A 3IJYB 4XNMA 5C0GB 5B21A 3EO1B 1YMMA 4CNIB 3X3FL 3CLEH 3OXSB 1CTNA 2I07A 4Y5XC 4OLZL 1NGZA 2FGWH 3IFNL 2VDLH 3ARED 5DEGA 5FCUL 3BE1L 1CQKA 3DYOA 1T7ZA 4LSDA 2AJVL 4HIJB 3VJ6B 2X4PA 4CMHC 4WO4C 2ARWA 1MRFL 1IAIH 1FBIH 4U6XA 2B1HL 3GGWA 4U2YA 4WI3A 3BDBA 2ZUVA 2ZOLB 1NPUA 3S4SA 5GS2H 3QQ9D 1V7MH 2XQYK 2CO6B 3VXMA 3MUJA 3MRKB 4POUB 5BRZE 4E41E 1AD9A 1CDYA 5T33H 2P45B 5IT2L 2CDFB 4Y4FB 3FFDA 1GJIA 5DQ9B 1NFDF 3VGDA 3R8BB 1U2CA 2Q1EA 4UQ2B 4AL8L 3QISA 2LTQC 3D25B 5A2JH 3V7MA 5IWLA 3C5JB 5I16B 4PG9A 3TNNB 2DI9A 4P2CG 1NBYA 2Z35B 1ZLVK 2OTUB 3D39B 4NIKB 3WFHB 1EHLL 2ITCB 1SYVA 4JDZA 2Q6WA 5AZ2L 1BLNA 4OV6F 4PGZA 4JG0H 3KGRA 4R0LA 1KSRA 1XGPA 4PV9A 4HUKB 1BBDH 4K9EC 2VQUA 3RWJA 1U8JA 1U2HA 5DJCA 2R2EA 3UPRB 5D1QC 2C1PA 2YUXA 1YJDL 3OF6D 5DRZA 3V0VA 2CGRH 5A3ID 3CC5A 2X4QB 1MQKH 5I1EH 3QIBA 3KPQB 3W2DH 2EICA 4HT1H 3S5LB 3HI1A 5GS3A 4AY0A 3GMMA 2D03H 2QR0A 1JGUH 3ULVH 4PJBA 1WZMA 2AJYH 3ZE2F 3ROOB 1FC2D 4PG2A 5IW6A 2DQIH 1FNGA 1K6QL 3WBDA 4ZTPL 1RUPL 4LCWE 5JNYA 2YKLH 3U9UA 2GK0A 3KPOA 4PV8A 4ODSH 3HFML 5CJQH 3H7BB 4QTHB 4JQVA 4ODBD 3O4LB 2PTUA 3A0OA 4G8GA 3C6LD 5BW7A 5C07E 3GRWL 4JM4L 3RZWA 5SWSA 3MLZH 3VGHA 1OGAE 4PGJA 4DGVL 2MQCA 4BFEA 3LS5L 1HYRC 2NY7H 3PWNB 3JV6A 4UDTA 2HG5B 2JJTC 3ARZA 4GW5B 5KVMC 3D6GA 1NAKL 4QYOA 4UTBL 5E2UL 3SDAC 2EYSB 2O61A 3O45A 3KYKH 3OZ9H 4KKNA 5HPMB 3IF1B 2AJUL 4WW2A 4QWWC 4GRMB 4PRAB 4YHZL 4WTZG 3WJLA 5E03A 3TO4B 5IIEB 3RNKB 3NA9L 5E94A 1OT1A 4HG4K 5K9OB 3SDCD 3OR7A 2F5AH 1DVFB 1HHGA 4HUWB 3QSKB 1XF4A 1UJTA 3BPLC 1S9WA 3QEUA 1VGEH 4FZ8L 3I6LD 3ME0A 3U6RB 2G60H 5DSCA 2YA1A 4LLDA 3SE9H 4KJPD 4NO3B 2CK2A 4C4KO 3I50H 2AGJH 2VLJB 5T1MA 3DURA 3BZ4B 4JAMA 1T7WA 1WIPA 2ZCKL 1U8HA 3OKDA 1K8IB 3JUZA 1KBGL 2DQGH 3T0WA 2BP3A 3VFTA 3VWJD 1MIML 1DBJH 1IZJA 4LLUA 3QDGA 4E5XA 2IFGA 1FP5A 1Q8MA 2BCKA 4Y2DB 4V1DD 4LP4A 4Z77A 4XBPA 1XZ0A 4S1RH 3EUUA 3LMJH 3CDCA 3V52L 3HC3L 5LWYL 5DTFA 2ZWLT 1QSEA 4ZUWB 1RZFH 2OQJA 3UZVB 4DAGH 4R96B 4DFIA 3MROB 1FFNB 4MJIE 2J2ZA 3RNQA 5BVPL 5IMMB 2AI0H 5HJ3B 1CU4H 1IFHL 3RRQA 2EDRA 4TQEL 1B90A 4XRCA 3MRMA 5KSUA 4MS8D 4BFBD 4M3KB 1X7QA 2XG4A 3MRQA 3MRHA 1UFUA 1P7QD 8FABA 5FA4B 4PJGE 1AY1L 4MXQD 2CR6A 4APQC 4LHJB 1CD1B 4R7NA 1FAIH 5IROA 4GW1A 1I3RA 3UROR 4YQXL 2UZYB 4YK4B 5EOCH 4ZD3H 1MFAH 4P46B 2DI8A 4GXUN 5C3TA 2E8ZA 4HCRL 3EJYC 4DKFL 1IARB 5HHNA 1DQMH 1JTOA 1MRCH 3QG6B 3PQYA 1CBVH 4UNUA 2DIAA 5I71C 5CEZE 3FTGA 4WFED 4E0RB 1MJ8L 4AENB 1Q0XL 5K9KB 4DGYH 2XZCH 5FYLE 4KU1A 2XFXA 3CVHA 2BC4B 2DN7A 5C8JA 4G9FA 3I3EA 1ZXQA 3PWPD 4WJ5A 1FZOA 4RFEA 3TP4A 3KHOA 2AJZB 4ZXBB 2ORBH 3IDJA 1OHQA 4ZAKC 1A3LH 3WIHL 4J3SA 5IHUH 1ZLSL 4LQFH 4HZLB 3SJVA 1FDLL 1W0VA 4PTTB 1YY9C 1A7NH 1HHJB 2YN5A 4OB5H 3IT8D 5DUBA 2QADD 5JOEA 2BSSA 1CQYA 3NCBB 4KZDH 1G7HB 3WKMH 4WV1A 4J2XA 1VADA 5KVDH 1KUMA 3M8OH 4XMKH 2GITA 5JDSB 1BQLL 2WIMA 3FB7B 1QRNE 3GJEA 3HUJA 3T2NH 3GI8L 3D0LA 1K8DB 3MGAA 3W0WD 5K9QG 5ESQB 1UENA 4FQHA 1I8IA 4NC0B 5IJKC 4WW1A 5HYQB 1G6VK 1AGCB 2CIIB 3GMNA 1X44A 4XPFL 3PNWB 1LEIB 4XNUL 3WO4B 1K4CB 1TFHA 4PGBB 4EI6A 1YC7A 1Z0NA 2BY3A 2X4UB 3HNSL 3KLHC 1CGSL 4YDLB 4LU5H 1FVDA 1NCNA 4F58L 2FR4B 3GJFB 3NTCH 1RZGA 4HPOH 2GTWA 3WNKA 4JFEE 2R56L 4MNHA 1QNZL 2ADFL 4X5XB 3HNTH 5ETUB 4PB9L 3MRFB 4ONFL 5CP7B 3STBA 3B9KC 1JNLL 2DQJH 3K80A 2D0FA 5KS9F 4K7FA 4P5KB 5J8OA 3E8UH 4LSQH 5IM7A 3BIKA 1ZGLA 1DQDL 4GLRH 1LP9A 1E4WL 1S78D 3D3VB 5L0QC 3MACL 3L3IB 4HBCL 4L4TA 1JF5A 4RGND 3LKNA 5EIVA 1WWAX 5CKGA 4NUJB 5EU5A 3NBNA 4YC2B 3M1BB 2NY0B 1CGVA 3DYMA 4U1KB 4KDTA 1NSNL 4Z7UA 1G7JB 1BBJA 2QSQA 1I7UB 4G8IA 1A7RL 3RPIA 4ELMB 2H26B 3MSPA 1D5ZB 1FYTD 3MYJA 4OGYH 4MDIA 1QR1B 4YXLL 1DN0B 3IKKA 2VKXA 2UYLA 4KZEL 5DFVC 4P4RB 2EYRA 1UCBL 4QHKI 3S37X 5EZOL 3QHFH 2NW2A 3BO8B 2G75B 3X3GH 2GTZB 3EO0A 4N0CC 5IB1A 5ALCH 5GRJH 3ZE1F 4S0TD 3SQBA 2ADGB 4IRZH 1MFCL 5TE4H 2XKNB 1GVIA 2UZIL 3FB8A 4YHPA 4NO5A 4NQDE 4NNYB 4OZIE 4QEGA 1UJ3C 2FB4L 4FQ1L 5BVJB 3PGCA 1MCWM 1QQDA 4ODVH 4M5YH 5DDHA 1NFKA 1ZHKB 4NKOB 4TSCL 4L4VE 3JWDC 3WCYA 2UWEA 3X12B 1NFDE 2F53D 5IGXL 4F33B 3FO2B 1Z3GH 5CD5C 3G6AB 3TVMA 1RURL 2V2WA 2WBWB 5CZVL 1XGRA 1QVOB 4JFHE 5CCKH 1O7SA 4PJ7B 4ODHL 3MTRA 4ZQKA 5TGBA 1F6LL 1BIIB 3MRBA 5JXAH 3U7AA 3U7WL 2Z4QA 5J9PA 3FB6A 1VACB 4IOFC 3DGGA 2R69H 4PBVC 3PWLB 1E6OL 2WBKA 4NUGH 3SDAD 1X4XA 1FNLA 5AWNL 4LLAA 3NZ8B 1MHCB 1M05A 1Q0YH 4QWWD 3K46A 3MV9A 4XMLL 3K3QA 1S9XB 1TZGH 1PJ9A 2FJHB 1YQ2A 5I1KH 4UUJA 2XQBH 2LABA 4OLWH 3H3BC 3S6CA 5I66A 3CXDH 3RDTA 3QO1A 4LVOC 5TQ2L 5MEPA 2PW2B 2OL3H 1RVFL 5JR1H 1TQBB 4PJCB 5HHPB 3KYMB 1PW3A 4WEBH 4IS6B 5DJZB 2QQLH 1M1SA 2NMSA 1N6QH 1RHFA 3ZE2E 3STZB 3WFCH 4FQCL 3CU1A 4N0YH 4TVPD 1J1PL 5DHVH 2R1YB 2PO6A 2BOBA 4DKEL 5GXBB 3C8DA 5HYSG 1ZTXH 3N9GL 3VRIB 2OL3A 4XAKD 3EW3B 1TQCB 2NY6C 5IESL 4AK1A 2OTPA 2F54B 3KYOB 4C56E 4WTWA 1TJHL 3QEQE 4OZGB 3TO2A 4P3WA 3E3QC 5LCVL 2FIKA 3I6KB 1VERA 1W0WB 5ADOL 3X14B 5C0JA 5F89A 3RGVB 2R2BB 5DMYA 5DEZA 5DHVA 5EBMB 4U0RC 4P3CL 3WXVL 3WJJC 3G5ZB 5JIPA 1VEOA 4PPTA 4O9HL 5F93C 3ULVF 1TNMA 1S9VA 2CDGA 3GSXB 3ARSA 1AGBA 3HAEB 2Q7YA 4HULB 4CU6A 5H35B 3SGDH 1WZ1H 4GKNA 4C4KT 2XWJA 1EAJA 3HLAB 4APQD 3FT4B 1AXSB 1KGCE 5JPMB 4HWNA 3B8YA 4JRXD 3TN0D 5ENWB 2NY3D 4LSVL 2BOCA 5FYKE 5ACZA 5D7LA 5T5FH 5C6PB 3IDMA 2R0LL 3EJYD 4M1DL 4MDJA 4XGZA 5C0NC 2QKIA 1XR9A 2V17H 4Z9KB 2BDNL 2VZTA 4XMPH 2VDNH 1BFVL 4WW2F 5DFTA 1QBBA 2C3GA 1XGYL 5HHMD 4ZFZA 1J11A 2IALB 4QOKD 5AYQA 4Y19B 1FZJA 5ITFA 3DVFA 3OR6A 5L2JA 1QHOA 1UH3A 2H6PB 3QUXB 1AQDA 1PEZA 5JTWA 3MJ9H 2XWTB 4N0RA 2D9CA 4LGSB 3THML 2ED8A 4GG8B 1A7BA 4YR6A 3ARDA 2DLTA 1W0YT 4EIGB 3C2SA 4LOUD 1UXWB 3RWDB 4HG4J 3ULUF 4MNQA 4ZAKD 5AD0A 4OCLC 3KPPA 3OKEA 1K2DA 5TFSH 1AFVL 3MJ9A 4LPVA 4RISH 5C0IA 3U48A 2A6JB 3IGAB 4Z7OF 3MCLL 3EYSL 3LEXA 2J8UB 3V5DB 1E4XH 2J6EH 2OBGA 4F7EA 3MXVL 2AXFB 4GMTH 1OPGH 3T3PF 1SY6L 4EN3A 4NKIH 5C09A 4C83A 4W4OA 1HILB 3ZDXF 4GKZB 3I84A 5C6TH 5BMFH 3NFSH 4XNXH 5IQ7H 2EXYD 2XRAH 1MAML 4OIIL 2RQ8A 4AG4H 3CFKB 1B2WL 3VXQB 1WQVT 1FJ1A 1KG0B 1S7TA 2FEDC 4J3UA 3QXDB 3CGTA 2WWKO 1SJVA 1I3VA 4MXWH 1LILA 4WU5B 5CJXC 1WEJL 1LK3H 4HHAA 1ZHLB 2C7UA 5HHVH 2X5PA 4JANB 4PJHA 2GT9A 3P4NA 2P48B 3Q6FA 4RWYL 1SBSL 3X3FH 1TPXC 3EDEA 4OLZH 4QRSB 3BE1H 1XGTA 3QXWA 2ITDA 3GIZL 2AJVH 4I0CC 1CXLA 4OCSL 3RWEB 3H6JA 4FN0A 5HYJD 4Q9RL 3NACH 1U8OA 1MRFH 1N2RA 2B1HH 3VXSB 3WIFB 2AVGA 4M7JL 4HS8L 4P49A 1KOAA 4HGKC 5ESVB 1OSPL 3HR5B 5DI8B 4JE4B 4AH2B 3LN5B 2DKUA 4PJXA 3FO1B 3PV6B 3NCMA 3QUYB 4Y2OA 1DFBL 2PXYA 4AIOA 5CLWA 3H9YA 3HZMB 5C2BL 2ZCHH 1U95B 4WTXA 4QHNB 4GBXC 4PY8I 4LVHB 1XIWA 3R0MA 2W65A 5DFVD 1F02I 4PJAA 3FL7A 4HIEA 1NAMB 3BP6A 1Y18B 1NLBL 1EHLH 2YPLE 2PYFA 3GSQA 1WJ3A 5AZ2H 1OVZA 2WV3A 5J6GB 1EEYA 5DJ0A 4GRLB 4XB8A 4UNVA 4O5LH 3UTQB 4HDIA 1JI2A 5A43C 2R39A 3KLAA 4GG6B 1I9EA 4GKSB 1DEEA 4ODWA 4QXGH 5CIPH 1UVQB 2P5ED 3ZMRA 1JBJA 1HYSC 2J8OA 4WUUB 2IQAB 3EYFB 2ICWB 1YJDH 3VD9A 4MSWA 5JO5A 3BW9A 4I0PA 4LCCC 1JHTA 4KH2A 1AHWC 4QLRA 4QRRE 4YLQT 2CIKB 5CD5D 4LVEA 3KYNB 3CXHK 4LAQH 5KAQF 3TBSA 4N0UA 2RJMA 4LHQB 2XTJB 4X4MA 5CIPA 3K81A 1WITA 4RGMB 1PX3A 1N26A 1JZ4A 4TPRL 3ARUA 2NY1B 3MRPB 1CE6A 1ZVYA 3WUWB 1QO3B 1K6QH 4K07A 4ZTPH 2EEAA 1RUPH 4X4YA 5BV7B 4EBQL 5GS1C 1QSFD 5I1LA 5FF6A 1H8OA 5IB3B 3GUTB 3HFMH 5FUOL 5F6HJ 1LP9F 4RDQG 3TYFB 2IAMC 1CD9B 1CICA 1IAII 3WDIA 4JHZA 3GNML 3GRWH 4JM4H 5DJAA 3GSNL 1HEZB 2E9BA 2VN4A 4TULL 4AT6B 2YN3A 3O3DA 4DGVH 3OXRB 4KVCL 1UXSB 4Z7UF 4KXZI 4LK4A 4QGTA 3VD4A 3KXFD 5IFAL 4NZUL 3WS3A 4LAJH 2FHBA 5AAMA 1NAKH 5E2UH 2GAZB 3U36A 3ZE1E 4K3GA 4JREC 5DRWB 1Z9OA 4J3OC 2BJML 2AJUH 4AM0B 1JTTA 3BP4B 4YHZH 1C16B 5D1ZA 4F7MA 1HINL 1YMME 5CJBA 4ZO6A 5E99L 3LRSB 1UWXH 4JY6A 2NY6D 2RIKA 2FEEL 3RWGB 1JWUA 3MNWA 3CZJA 1B0WA 1U8IB 1YUHA 2ERJB 4OFIA 2ZUQB 5ICYB 1T03H 2CJUH 3MFFB 5FA3B 4TVPL 3O9WC 3VXOB 3F12B 1ZS8A 2X44D 4P2RA 2XYCA 5E9DA 3V5HA 2VQ1B 4R2GC 5SX5H 1UCTA 1TETL 3FFCA 3LN9A 4Z76A 3SBWA 5DEFA 3GSWA 4FQXA 3OB0H 2UWEF 1QBLH 3O8XA 5GRVL 2EKSB 1S7QB 4KQ3L 3MLXH 4P2OD 2F9BT 1KBGH 1QUNA 2JTDA 2W07A 5I76B 4CMMA 3EO9L 1MIMH 2BHZA 3P0GB 2EH8L 2WP3O 4NHUA 2P7TB 4MA1B 4KVNL 5JIHA 1BX2A 4XPAL 1T1YA 3FT3B 3D18A 1UACL 1M7IB 3SDDB 1IQDA 2GYSA 2EE3A 3V52H 5LWYH 5IW3A 5DD3L 4H8WH 5FKPA 5C0ND 2OZ4L 2W9EH 1QFUL 4R4NC 1N8ZB 2CKNA 5KSAB 1IFHH 4ZNEE 2H3NA 1U8PA 1WIOA 4TQEH 5D7JD 4Q0XL 3HC0B 3NGBC 3S35H 5E4EC 3O11A 1REIA 5J13C 3QCTL 1QYGL 4NP4H 1AY1H 5F3BB 5I8KL 5JA9A 2E6PA 1CD0A 1ZLWK 3MRGB 2VMFA 3CDGB 4MAYA 4YQXH 4LARL 4JFDD 2XZQL 3PJSB 3UDWA 2SEBA 4I13B 1UWGL 4BH7A 1YY8A 4XI5C 2M26A 1GSMA 2RBLA 2V5MA 4UNTA 4HCRH 4DKFH 2EDTA 2BNQA 3HG1B 4L8DB 1CVSC 1ZHBB 4U6HB 3UX9B 1AD0B 2AXJA 3JTTA 3ORJA 4HS3B 3OKNB 4I3SL 5ISZE 1RZ7L 1QLRA 1N3NB 3OJ2C 1MJ8H 1Q0XH 1ZHNA 1S7RB 1PYWA 4O2EA 2Z8RA 4ZFGL 5HDQL 4WEUD 5J6HA 1UA6L 5E5UB 3EFDL 5E70A 1JJUA 4HCRA 2NXZD 1YPZA 4L4JA 3OKLA 4YHLL 4LSRH 4D9QE 4OI8A 1JYVA 5IMLB 3HMWH 4OZHA 4RQQB 3WIHH 4OM1H 5C0CE 3H9ZA 1ZLSH 4ZS6D 2FEDD 3G6JB 5FO8B 1FDLH 2EE2A 4TNWK 5A2IH 4JLRA 4L29A 3TCLB 3WDHA 5IB2A 1FFRA 4NKMA 1R5VB 2FJGA 1HZHL 1U6AL 2CPCA 2WAHA 3FO0H 3OAYK 5JPNB 3SQOL 4CNIA 1BQLH 2P8PA 1VFMA 3LN4B 1T5WA 4NSKB 3GI8H 2VLME 4KK5D 5FIEA 1K3IA 3BGMB 5TDPB 4HIJA 5LGJA 1ITBB 4QY8B 4XPFH 4L3EB 4XNUH 1IGJB 4L8BA 4X6BB 4B41A 3IDXL 4Z7NE 3ULUE 3RVXC 3S7GA 1ZVHA 3NFNA 3MRKA 3UPAA 3HNSH 1NKOA 1SEQL 3VFPB 2G5BA 2R56H 5JIIA 1QNZH 2ADFH 1K4DB 3VI4F 4PB9H 4Z7OE 4ONFH 3QUZA 1MHPL 2WWKT 4XXDA 5I16A 3QDGE 3TNNA 3T3PE 5C71A 4GT7A 3ZDXE 4NQXA 3HMXA 4XPTL 1A7PL 1DQDH 1NL0H 4IJ3B 5DMIL 4NQEE 2ITCA 5F21B 3MACH 3GHEL 1IAOA 4PD4K 4CKVX 4KI5F 4DVBB 1F8TH 4HIXL 4MX7B 5I8EA 4YZFF 4RNRB 1H5BB 1T0PB 1JWMB 3U30C 1OLLA 3QNZB 4P5TC 3QJFB 4CVZA 1LDPL 4P4KC 4QHKJ 4UINH 1HYSD 1J0HA 3UPRA 4JPVL 1TLKA 4S11A 1A7RH 1CLCA 4HKZB 3QIWB 1OGAD 5I73C 4YXLH 4N1CA 4Z0XA 2CD0A 3KPQA 4OD1L 3U0PB 5CD3A 4QHMA 3S5LA 2XWBA 5ERWB 1G6RL 4XPGL 3CFBA 1UCBH 5MHSE 5E8EA 3QRGH 1UGNA 5EZOH 4GS7B 1IM9B 5GGUB 1HDMB 4RA3A 4IHOA 4TRPH 5KN5A 3ZYJA 1IGYB 2GJ6A 2UZIH 1AKJD 4I77L 1MI5E 5C08E 3P9LA 4RX4A 4I18C 2DQHL 2FB4H 4FQ1H 2E5EA 3IDGA 2X89A 3W9EA 5D71L 4P2QE 1BD2D 2BMKB 1FN4A 3U4EB 3KPSB 3NCJL 5EU4B 5ADPL 1VB9A 3GFUA 5D4QA 1MFDL 2IAMD 1BF8A 3HZYB 5IGXH 3PL6A 2P42B 1FFPA 1VCAA 2GUOB 1RURH 1B4JL 2OSLB 5F9AC 4ODHH 4N5UA 4PJXF 4Z7VB 1CFTA 3SJVE 1Q9WB 2HG5A 2XV6B 5F1KC 4J4PD 4LSUL 1E6OH 3OMZA 4KFZC 3LS4L 1Z5LA 5LVEA 3T0DA 1ONQB 4XWOC 5AWNH 5I1DB 5GZND 5EIIA 3IF1A 2A6DA 4KROB 4PJAF 5IFJA 2APBA 4LPWA 3MJGX 5IIEA 3RNKA 4U1SB 5TDOB 1UM5L 4LHUA 1T0MA 2CUMA 2Y7QB 4XMLH 5HSFA 5K9OA 4UTAL 4GLRI 3QXTA 2KDGA 3PHQA 3AREB 3JV4B 4HUXA 1DVFA 1PY4A 4MJID 4Z78A 4JPIB 3T1FB 3CFCL 5TQ2H 3P0VL 1S7VB 3H0TA 3G5YB 5FXCH 4OIAA 4BH8A 1OTUC 1RVFH 3K8MA 3UTPD 4R2GD 3Q3GA 1H15A 4BFIB 1K3ZA 4EIZC 4X0KB 2Y06H 3V6OA 4UT9L 1NGQH 2AP2A 3T0EE 3E2HC 4J12A 2YD7A 4FQCH 4GRWH 4NM4H 1J1PH 4WY7L 5E6ZA 3DSFL 5A16B 1KTLB 5ITBL 3UAJC 4POZC 1X5AA 4DKEH 4KMQA 5IVOA 2R9HC 3FN0L 4JDVB 3N9GH 4YBQD 5GRYA 2AJ3B 5IESH 4NO2A 4PS4L 1TJHH 1TXKA 5I6XC 1UKQA 4Z95L 3IJSB 5C0BD 1LP9E 5LCVH 3Q5OA 4R7DA 4DEPB 5ADOH 4N5ED 2ZSVA 4ZUWA 1U92A 2YZ8A 4OI7A 1CDIA 1D6VL 4R96A 4P3CH 3WXVH 4R4ND 2PYEA 1C5BL 3QO0B 1CCZA 5E24E 4TUJB 3KPLA 3DX9A 4YHKL 5FGCE 3QXAA 3REWB 4ZUSA 1EO7A 1QFOA 3VDCA 4UILL 3UTSD 4X6CE 3O2WL 5I15L 3QR2A 1A9BB 4Q6IA 3QDMD 5B8CB 2O5XL 2GFBB 1FIGL 4O2CB 1FL3A 4OT1L 1TVBA 1CD1A 4HMDA 2IH1B 1MCPL 4PTUA 5MI0B 4LSVH 4CADB 1NCBL 1MAKA 2AAVA 2WP3T 1MRDL 2R0LH 1QSVA 4M1DH 3VA2C 2BDNH 2ZUSA 3E0GA 5DC4B 1BFVH 3QG6A 3WL9B 1PQZB 3L7EA 4ALAL 5FGBC 2ZPKL 4E0RA 3ARBA 3TBWB 1T3FB 5SX4H 3UTTD 4PFEA 4OAWB 4PJEA 3RFZC 3THMH 1NCWL 1PBYA 3OTTA 4XBGB 3HAEG 1BFOA 3C6LB 3VFMB 4MXVE 5DVKA 2W0PA 4JFED 3FB5B 3U0TB 4JFXA 4PRID 4MQSB 4IRJD 4PTTA 3DBXA 4XPBL 5ACMA 2V9TA 1AFVH 4DTGL 1G7HA 1KCSL 4GAGL 3MA7B 3MCLH 3EYSH 3DX6A 1BQHA 4PRHD 4CJ0A 2QQNL 4KUZL 1GHFL 3MXVH 3AM8A 3QWRA 1SY6H 2DWDA 3TT3L 1WSST 5KVEL 1IEBB 1W72L 3SDCB 5HYQA 1AGCA 4ZSOE 1PKQB 2CIIA 2MKWA 4OIIH 4L3CA 1K4CA 1B2WH 1FCCA 3LV3A 1SY6A 2F19L 4H26A 3RVXD 2R2HA 1XF3A 4O51A 3LRGA 3WN5C 1WEJH 4OCYH 1RSFA 2F74A 4L1HA 4LSPL 3MRFA 4XNQB 4WI5A 3KPRE 5C0AA 1F13A 3V0AC 4RWYH 1SBSH 2Z31C 4M1CC 1NBZB 3VWJB 4P5KA 3DMMD 4YWGL 2N1KA 3GIZH 4YGVB 2DBLL 3C9NB 4OCSH 4V1DB 1T04A 4Q9RH 4H20L 3WD5L 3OKKB 3L3IA 2XACC 1NMBL 4WO4A 4EZMA 1OARL 4M7JH 4HS8H 4PY8J 3R0NA 2VL5A 2QQQA 1OSPH 3LH2L 2D9QB 1XT5A 3TJHC 1S9YB 4P4KD 1A1MB 2VDPL 5ESAB 3F5WB 1DFBH 5ICXB 2A9ML 1I7UA 2GJZB 3BDYL 2HWZH 5INDB 1PG7L 3BEWB 2VH5L 3W39A 4OI9A 4Y5YB 2P49B 1VGKB 5J7CC 1P7QB 4OZHF 4HUUB 4I4WB 4P4RA 2ZSWB 4PY7B 4HLZG 3HI6L 4IOIA 3RX7A 1JYWA 3EGSA 3EDDA 3BO8A 3V4UL 5E6IC 2G75A 2BNRD 4FQQA 2EEBA 3TJEL 5J57B 1AQKL 1NLBH 4D9RE 2EDDA 1U3HC 4RMSA 4XH2A 2JLLA 2XKNA 1RULH 3ILPA 2ZG1A 2AERT 3O6KL 2ATKA 1KXVC 2E3VA 2BSTB 5CILL 5F71A 3FZUC 3WUZA 5FDWB 3BESR 1TJIL 5CJ5A 4TTGA 4HEPG 1UADC 2E7CA 4X7FC 5BS0A 5FHAL 4W6YB 4M6ML 2JELL 4I48B 1I85C 1DQJA 5D1QA 3X12A 4MD4B 4NN6B 1P4IH 3AU1B 1M7XA 3D85D 4YHNA 4Z7WB 1NGXB 1XH3B 5GGTH 2DLHA 1T83C 2MQ3A 2F8OA 3BN9C 1KJVA 1AGEA 1ZA3B 3BQUC 4TPRH 4HH8A 1B0GB 5F7KC 3A6OA 1VACA 3ARFA 4P5MA 3V6FA 2C1OA 4S10A 3QUKA 2IFFL 4FFWC 4EBQH 2E9IA 5KW9H 5GGTA 3DRTA 5L88H 1SMOA 3IXTA 3DXAA 1J05B 1MWAL 3G5XA 4YZFE 2DM4A 2EE9A 3RUGB 4YBLB 1BP3B 3IFOB 3L3DB 4K7PY 5MENE 4Y16D 2VZUA 2HVKB 4Y5XB 3B3IB 4M6AA 3ZKMC 2AXGA 4R97C 5KZCD 1RQ5A 2FJHA 5CP3A 3BUYB 3QZWB 3OJDB 1K5NB 5IEHB 2VNCA 3PHOB 2KPNA 2Q86B 3GNMH 1G84A 1L7TL 2FX7H 4G8EB 1OQXA 4POYA 3BD4A 4TULH 2C26A 1D9KB 4M61A 1OTUD 5C9JB 5JQHC 2YS4A 4KVCH 4E42A 4IS6A 5DJZA 1A4KA 4JFOB 5IFAH 4NZUH 1X5IA 2B5IB 5IWLC 3VXNB 1AGFB 2JJTA 3AMLA 2Z93A 2FX8L 3STZA 1QFWI 1FL5A 2VLRD 1DN2A 3JBG7 4KDVA 3UAJD 4Z18A 4POZD 5GRWA 5B4MC 1AP2A 1HINH 4Q9BA 4AYFA 5E99H 5SWZD 4LPXA 4R0LC 4JO3L 1I1YA 2DLFL 2F54A 1MJJA 3KYOA 1LGVA 2XTLA 3D5OF 3QUMB 3ZSTA 2AQ1A 4XAWL 1U91B 1JZ5A 4OFYA 3DHMA 2COQA 2R8SL 4XBEL 1I4FB 2FLRT 1ZA6B 5EBMA 5HY9A 3X11B 1A21A 3ARWA 4RGNB 4R90L 1J0JA 5SWQB 4JRWA 3RY5A 1TETH 4OGAC 4NO0D 4PJXE 1FRGL 3QFJD 5GSRA 1E4JA 4FP8L 3GSXA 1K9TA 5CEZL 1IGTB 3L3HB 4EOWL 4GQ9L 5H35A 1NJ9B 4JM2D 2NX5A 4KQ3H 2FH8A 4A6YB 4OCRL 1G7PB 1FYTB 5FYLL 3EO9H 3DUUA 1E4KA 2EH8H 4J6RL 2DYPD 5TDNB 3HLAA 3DVNB 4PG2C 5EA0L 1GGCL 4H25B 4KVNH 3L1OL 2NY2D 4XPAH 4XVUD 4BQ8A 1BPVA 4X4ZA 4P23A 1UC6A 2XKSA 3RX5A 2GI7A 2KBGA 5JPMA 3WNNA 5CBEB 1IM3B 1FG9C 4PJDB 2H8PB 5GQBA 4MCZB 3VXTB 5DD3H 4QXUL 5J89A 3DHJA 3MREB 4QTIH 3EZJB 2OZ4H 3ULVC 1LE9B 1GZQB 1QFUH 3SDXA 5L2KA 4PRNB 2V9RA 4Y19A 2FBOJ 4DN4L 1YEDB 3RKDC 4JO4L 5J56B 4Q0XH 4XXCC 1NGYA 3MV8E 4NQCA 5T1KA 1MAJA 4GG8A 2J1KA 4ODXB 4MJ6A 1X4YA 3QCTH 2AK4A 1QYGH 3MJ6A 1AGDB 5FYJE 1UXWA 4K71C 6CGTA 3E6HB 3FQWA 4N9GA 2F53B 4X6DA 2OZ4A 3RWDA 5I8KH 1C5CL 2JCCB 3B9EA 1YA5A 3HRZA 4LARH 4N0UE 3HTLX 5FV2A 1S8DB 4JRYB 1TTFA 5LAXB 4PR5B 4LFHG 1EXUA 3BMWA 1KNOB 2VIRA 4ZMAT 4K8RH 2A6JA 3IGAA 1T5XB 2XN9E 3N1GC 2J8UA 3V5DA 4U1GB 2OTWA 4UQ3B 3QAZC 1FL6B 4CBPA 4DUXA 2AXFA 3GSNB 4LKXB 2X4OB 3GSUB 4N90E 3LKQA 3VRLF 1HQ4B 3UPCA 1TVHA 3OKYA 4ZFGH 1HI6B 1KJ2L 5HDQH 3ULUC 2B2XL 1UA6H 3EFDH 3CU7A 4G5ZH 4QO1A 5BCAA 1YC8A 4N0FA 4L5FL 2J12B 3BPLB 4JFZH 4MVBC 3U1SL 4JFQA 5JOPD 4P9HC 5M94B 3I2CL 1CDUA 2EDXA 4QRPD 5FM8A 1FNEB 1KG0A 3QFDA 4WEMB 1RJZB 1TNNA 3VXUA 3QXDA 43C9B 5IK3A 4UU9A 2P5WD 5HVFB 3VI3F 3C5ZD 4WU5A 5D93B 2FJFA 1U6AH 3OQ3B 1J5OL 3Q0HA 2NY5C 4K3EL 2ICEA 4M9PA 4ZYKA 3F7VB 1HSAB 3K8KA 3SQOH 5HBBA 4L9LB 1C5DA 2VITB 3B2VL 3VFNB 3DSNA 4Z8FL 4M1CD 4PREA 4QRSA 4X7TA 5IMOA 5F88B 4MJ5B 2ATPB 4KKAC 2UVFA 5IHLB 1J8HE 3T4AB 2MOVA 3DIFA 4MGXA 3ZKNC 2UUDH 1GH7A 3ZKQD 5EU6D 3VXSA 4B50A 3OX8B 3SEPA 3OG6B 3IDXH 4CJ1A 2QHLA 3BZFA 5DI8A 3LN5A 3TJHD 3RTQD 1SEQH 5EOCJ 3DX7B 5DJ8B 3PV6A 3QUYA 1RZJL 1HSBB 4PJEF 5B39G 1RU9L 5KG9A 4PJ5A 3IJHB 2J4WL 4Y1AE 5IROC 1OY3B 2DAVA 2W60A 1IC4L 1NUDA 4JFFD 1U95A 4QHNA 2R23B 1WTLA 4UIKL 2VDMH 1AO7E 3B9KA 1JWSA 3BZEA 2P4AB 1NAMA 4XPTH 4APQB 5DD5L 4HV8B 1A7PH 4PYGA 5DMIH 1QA9B 1BZQK 3TN0B 1R3JB 4JRXB 4JR9H 1CFVL 2NY3B 3VH8B 2X1PA 5JQ6L 5HPOA 2ZUYA 4NPYB 4OF5A 4HIXH 1JGEB 1FFOB 1WCBB 1E27B 2RCSL 1URLA 2WM0A 1ADQL 3EFFA 5FCSH 1LDPH 1UVQA 1TZHA 1MH5A 5HHMB 4QOKB 4JPVH 2IQAA 3EYFA 4M7ZC 2HFGL 2I60H 3MCG1 3ARVA 1HQRB 1I9IL 4CVUA 2ESVA 3H9HB 4OD1H 2Z9TA 1JPGA 1KB5L 4WV1C 5EBLB 2CLVB 1DBKL 2MHAB 4ZAKB 3BQUD 2VAAB 4K23L 1WBXA 3WNMA 4URTB 2BVPB 4GAJH 1YMHB 3HZKB 3KR3L 3WUWA 4D0BB 4AEHL 3BVNB 4G7YH 4I77H 1FSKC 2DQHH 5EUKB 4CVXB 4HJGA 5MERA 1UJ3A 5E95B 1XEDA 3GUTA 5D71H 3TM6A 5E56A 2VR4A 3MV7A 3C6SB 3NCJH 2VXUL 4Y5VC 4HD9A 4KY1L 3VWKD 3TYFA 5ADPH 1UM4L 3VXMD 3FONB 5HI5C 1I8LA 5ID1B 4AT6A 1B4JH 4EKXA 1OAYH 2XIDA 1G7IA 4XVJL 1L0XA 4OZHE 1NUGA 1UXSA 3O2VL 4DN3L 5I17A 1IGFH 2Y4SA 4ELMF 5GS2D 4ERSL 2GAZA 5GZOC 3LS4H 2LAAA 3BHBB 2DWEB 1NANH 3U7YL 4NOBA 3BP4A 4RMTA 1MHEB 3U79A 3FT2A 3GMOB 5B4MD 4RSVA 1UM5H 3HHRB 1C08A 4KGJA 4UTAH 1OAXH 3RWGA 4EUPB 3WHE0 5T3XE 1MCOH 1UWXK 3IKCB 4J3VA 3CFCH 1D3CA 3P0VH 4KDTC 3VXOA 5CBAB 5HYJB 3IU4L 5L0QB 2LVEA 3C60D 5FYKL 4R6UA 1G1CA 2EDEA 1TCRB 2VQ1A 3IFPA 2ZZUT 2ZUUA 3QIBD 4DJMA 1HXYB 1FV1B 5FOJA 4UT9H 3DX8B 1MCBA 1ZLVH 4YX2L 4WY7H 3DSFH 2VXSL 5ITBH 1ZMYA 4LCUA 1C1EL 1ZSDB 4AQ1B 4S0SD 5F9OL 3FN0H 4U1MA 4PJ7F 2YPKB 3VFGL 3CH1B 3GKZA 3BXNA 4PS4H 3K4ZA 2JIXA 1GOGA 4Z95H 1M7IA 5I0DA 3D39E 5FO9B 3DV4B 1KCKA 2HN7A 2R2CA 5D7KD 4NWUL 3IAQA 4D0DA 4PB0L 5I0ZA 3ULVD 1D6VH 5DO2C 4BZ1L 2PR4H 1N8ZA 4G8GD 5IHZB 4D9QD 3WJJA 2A83A 3T2QA 3TVMC 2QHRL 5SWSD 3HC0A 4UILH 3O2WH 5I15H 5DVLA 2AJSH 4ZPVB 2O5XH 1FIGH 2YSSA 4OT1H 5F3BA 3N1QC 2VLLB 1GXEA 1MCPH 4DW2H 1RJYA 4CGTA 2OK0L 4KK6C 2X4NB 4LLVB 4OKDA 1NCBH 4AIZA 3K1DA 3OGCB 5GISH 5FOBA 3RA7L 1MRDH 3RJDA 1MJ7L 4J8RB 3W9DB 3ZHKA 3J7HA 1ZHBA 2C4FT 5E1AB 15C8L 1C7TA 2VB5A 3KJ4B 1BZ7B 3AUVA 2VO5A 2AJXL 4ODUB 4ALAH 2ZPKH 1QSFB 1N3NA 5KOMC 3SE3A 4H1LB 3RDTC 1JPFA 1I1AC 3STLB 4M6NH 4OTXH 4KRNA 1NCWH 2AKRA 2D31B 4ETQB 1G7LB 3O4LE 3BSZL 2HH0L 4OD3L 3GSRA 3UTOA 4NC1C 1RUML 5DK0B 4HK3N 5TE6L 1H3TA 4DTGH 1EO5A 3RVUD 3TCLA 1KCSH 4GAGH 2L0DA 4R9HA 1R5VA 3DO7B 1ZV5A 3KXFB 3FQRA 4L9DA 2HT4C 4YGAB 3MBEC 2QQNH 5EWIH 1RJCA 4KUZH 1GHFH 1R5WB 6FABL 2V2TB 5JPNA 1P1ZB 1G7MB 1L0QA 3KPNB 4F37F 4M4PA 2Y23A 1WIUA 1MCDA 1ZT1B 1QSED 1ED3B 1MFBH 3BGMA 5KVEH 2Z8VC 4KKAD 5TDPA 2NY6B 3S96A 2VDQL 3VFOB 3ZKND 1I75A 2DB8A 3RVTD 4QY8A 4BK4A 4UT6H 5HGHA 5BRZA 4B7LA 1OD7A 1IGJA 1LWRA 4X6BA 3S98A 2DLIA 3SDXF 5EUOB 3LKSB 3RKPA 1IL1B 1I8MA 5JW5B 2KZ1B 4U0RB 5DJ6B 3C87A 4M7LL 3PABB 2VLJE 1U42A 1S9KC 1JNHB 4OQ1A 5E5MB 5E7FA 3MRCB 4X6DF 4P2OB 2MCG1 3NABL 4JY4A 4KV5F 4WWID 1QKZL 4J7RA 4FTVD 2CKBL 2HJFB 4WDIB 1N59B 4YWGH 2DMBA 1L9NA 3VRLE 3PQYD 3NFPB 4H20H 3WD5H 4PJFB 1DBBL 2IBGA 2J8UF 4LNRB 4PGDB 3O6FC 4U05A 1E28A 4RMQA 3L3GB 3VFUB 1OARH 3PXHA 4RNRA 1H5BA 4G9FD 1EIBA 3QJFA 3LH2H 4RWHA 1LQSR 4WI9A 4J3TA 1SEBB 1J8KA 2A9MH 4LPYA 4RRPG 5I1GL 5D7JB 1UT9A 3MYZA 2ED7A 4MNGB 2BRRL 1KIRB 2VH5H 1M7DB 1SVZA 5ERWA 2QEJA 3U0WL 2DM7A 4FZEL 4M93B 4AIXA 3IETB 5DMKB 3KWWB 4KI5C 3V4UH 1K85A 5T1LB 3TJEH 4LCWA 1AQKH 3KDMB 4EN3C 5A2KH 4L8CB 1A2YB 3HNVL 3DPBA 4PUBL 2I9LB 5KJRL 3B5TA 1XF5B 3ARXA 3C09B 4WFHE 2HLFD 3KLDA 3FO9A 1AR1C 3O6KH 1A8JH 5CILH 3MNVA 5FK9B 1T22A 1TJIH 5ICZB 4EI5C 5C07A 3WHXB 5FGRA 5DGQA 1T20A 5FHAH 4M6MH 2JELH 3KPSA 1PFCA 5EU4A 3BP5B 3GEWB 2W0KA 3EAKA 5HI5D 3X13A 2NXZB 3E1F1 5C0EA 1AHWA 3S3SA 1KCVL 2GUOA 2P44B 3GHBH 2WNGA 3BFOA 3GMLA 4KTDL 5E00B 5I1CH 3DI2B 3T77B 2ARJA 2JB5L 1PKOA 1MJUL 2DS4A 5EU3A 1F6AB 5FV1L 3F8UB 3MLSL 3WDJA 1Q9WA 3LRHA 5IKCB 3ZDZF 3WLWD 4OBSA 1X3DA 1DLHB 1W72B 3EYVA 3MCKA 5GZOD 4LL9A 5TH2B 1XCTA 1ONQA 2IFFH 3MOAL 3PWUB 3HZVA 1HHKA 1MWAH 4L4TD 3DARA 3UBXB 1A0QL 5INCB 2E27H 1IAIL 4I3GA 4F3FA 3AREA 5JHDE 3MGTB 5HDBF 4U31A 3HPJA 1S7VA 3LSOB 3G5YA 1J9CT 1F6FB 3UMTA 1MWAA 3GMPA 5DT1H 1U8LA 2BVQB 2W38A 4G6KL 2R0WL 3BDXA 4X0KA 4FFVC 3VGEA 4G43A 4OFPA 3MJ7B 2CQVA 2FX8H 3LKOA 1AJ7L 1WBYB 5A16A 1T1WB 5I8CA 1I9RL 1RZ8A 2G9HB 4GH7B 4JDVA 1DP0A 2DQEL 4QF1A 1NGWA 4JO3H 4IMLB 2DLFH 4X6FA 1KLFA 4JG0L 3F62A 4S2SB 4XAWH 1IEHA 2R8SH 4HWBL 3D3VE 3QZWG 5IQ9B 2ZUTA 3OKOB 3LB6D 1VFOA 1I1FB 1YEFL 4I0PC 5DO2D 2DD8H 1F4XL 4XC1L 2GEEA 1DBMH 1RMFH 5LKNA 2OS7A 1FRGH 3P73B 4PJGA 4TTDC 5ELIA 4HT1L 1HHHA 5CEZH 1CG9B 1H3XA 4GQ9H 4PBWD 4ELME 3OF6A 2APXA 1A9BA 5FYLH 4X7DC 1YJDC 1OWRM 5DZLA 3QPQC 2RFXB 1T4KB 2AJYL 3CCHB 3L1OH 2IH1A 1MF2L 3QNYB 4RZCA 3FMGL 3FRPG 4OUUA 4KK6D 5E6YA 3BP7A 5AYUL 4YAQB 5EIQA 4QXUH 3S97C 3NN8B 2WMPA 3MV9D 2OI9C 3ZHDA 1AKJB 1OF2B 3WL9A 2E7LA 4LVNB 3BYTA 2X1WL 4UAOC 5F3HB 4NNXB 2YUZA 3TBWA 1ZLUH 3RDTD 4DN4H 4FXKA 2DF3A 1MVUB 3GI9L 1BD2B 3DGCR 1G7QA 2G2RA 5TJWK 5DUML 3V5KA 1VFAA 4XBGA 3KJ6L 4GXUM 4LLQA 2IAMB 1P5UA 1A3QA 3PDOB 1MHHA 5IF0B 5F6IC 4XCEA 4KK9D 1C5CH 3U0TA 3L3JB 5BZWA 2QBWA 1R3HB 4PJ7E 3RGHA 4F57H 2PO6D 3Q5TA 1A6PA 1TTUA 2CMRL 3QHTC 1F11A 4Y4KD 3OZ9L 5D1ZC 1N0XL 3V8CA 3ULUL 1LD9B 1QRNA 2BX5A 2HT4D 4LBEB 4KHXL 4KJWC 3PP3H 3EDFA 4U6YB 3RWHB 5TPWH 4P9HL 5IR1B 2ZG3A 3MO1B 3G6DL 1CLOL 3N0PB 1DZBA 4TOYL 2E6QA 1KJ2H 2V2XA 2B2XH 3K4AA 1ERNA 2G60L 3IFLL 5MEQB 2A9NL 3QNXB 3EJJX 4MCYA 4WHYH 3U1SH 2NY5L 1CGXA 1LEGA 3SBWC 4F2MA 4FQXC 2N4IA 3RZCB 3O8XC 1OTTD 1C8PA 2R1XB 1NCDL 1CK0L 3KYAA 2XT1B 3CUPB 2WK2A 4PJCE 1ZOXA 4R2GB 2W0FA 1PAMA 1OAZL 1KJ2A 1S5HB 1J5OH 2P47B 4K3EH 3GM0A 4D9RD 3RY4A 5D7LD 3B2VH 1X6NA 4Z8FH 1IRAY 5ID0A 3EYOB 4YGVA 1J86A 3GBML 3H7LA 1CDCA 2F54E 3UZQA 3B6SB 2WBJC 2VQTA 3C9NA 1CVRA 4OZGE 3OKKA 1BFTA 4WHDA 3GSVA 5C0BB 2YBRA 5J12C 2ED9A 3I02A 1A6VL 4M02A 3QQ4A 4MB4A 4CUCA 2YEZA 4H8WC 3C5SA 5HTSA 4LF3B 3ARDD 5ESAA 2H2PC 1RZJH 4ORGB 5ICXA 3NPSC 1WBZB 1ROWA 3H9SD 3BWAA 2J4WH 4MNQD 1IC4H 4MAYC 5FB8A 3CZFA 3UTSB 2X41A 1VGKA 5E4EB 5EOCL 5J13B 4UIKH 4KKBC 1UB5A 4HUUA 3CVHL 3QDMB 2ZSWA 1ZT7B 4PY7A 3VXRD 3ZYIA 4LMQE 1FO0L 1ETZB 4KI5D 4KTYA 4JCMA 4OZIA 1HWGB 1IKNA 4S1DD 1JK8A 4EN3D 4X6EB 1CFVH 5C09D 5JQ6H 5HYEA 5J3HC 5T3ZE 1U41A 2OP4L 4L4VA 2RCSH 4R3SB 1ADQH 3QQ3B 1MCRA 1NFDA 1F4WL 2XI9A 4P5TA 5EU7E 3KNBB 5EO1B 3V6ZB 2ADJA 2DICA 4I48A 3QIUD 3HS0A 4HGMA 5B38G 1I9IH 3CFDA 1NCTA 3UTTB 4WWKA 1KTRL 3PGDA 1WV7T 1JMZA 1XH3A 2EC8A 1YEKH 1KB5H 1R24A 4ZOBA 1WAAA 1WFTA 1ADQA 3OHXB 1DBKH 4F7PB 4GQPH 1ZA3A 3HE7B 3QEGH 3QBTB 4PRIB 4K23H 4NWTL 5FDYA 4IRJB 2DM2A 4OLVH 4U3HA 2J3SA 3KR3H 1YDPA 4BQBA 4AEHH 4DCQA 2J8UE 4BKLB 2GKIA 3VH8G 4PRHB 2I26N 1J05A 4LASL 1XF2B 4NN7C 1KB5A 2IG2L 5CSBA 4I18A 1UZ6E 1JN6A 3IFOA 1J18A 5F72S 5J11B 2BY0A 4PGCB 4QHUB 1I8KB 2VXUH 4KY1H 1UM4H 1K5NA 1BJ1J 5IEHA 1IAMA 3D0VA 4LDLB 3TBVA 2PXYD 1KLUB 4Q9QL 1D9KA 4XVJH 3GBNL 1RHHB 1BWMA 1NC2D 2CUIA 3QUZC 3O2VH 4DN3H 1D5MA 4HS6B 1XIWD 4FFVD 5LGHL 2LU4A 4ERSH 1UYWH 5CGYC 5IJVB 3U83A 1JF1A 3ZT5A 1FFQA 1A1NA 5EOQL 3U7YH 2DQDL 3VE0B 3QEQA 1PX4A 4C57C 1DDHA 3FQXA 3LY6A 2H32B 4WFFD 4O02L 1A14H 2ICWI 5AUMB 1VEMA 5FEBA 2BK8A 4XP1L 3WEXB 5JZ7C 3DMMB 3TIDA 4HIHB 4TSBH 2IMMA 3I6GB 3QULB 3D9AH 5F44A 3IU4H 3VXSE 1Q94B 1KPRB 5FYKH 5C0FB 3LPFA 2FCBA 2HFFA 2NY4D 2WLYA 5TF1L 1MCKA 5DQJB 1JV5B 4F37K 2VUYA 4O00A 1CL7I 2M8XA 3FAXA 4P4KB 4Y8DC 4TTDD 1IGTA 5EBWA 4L8SB 4YX2H 2NLJB 4Z0BL 4A6YA 3MLVL 2VXSH 4JQIL 2VABB 1C1EH 5GRVK 4G6JL 5F9OH 1HKLL 3ZT7A 1OWWA 1KIPA 3ALWA 5EFIB 5JOFA 4Z7VF 4HKJA 5TE4L 5HGDA 1VEPA 1EBAA 2BNRB 2H8PA 2VR5A 2NPLX 4EUPG 3BPNB 1MLCB 3MREA 3LKPB 4PB0H 1JZ7A 4HKBB 1YYLL 1LEKB 1WUNT 5FKAB 4BZ1H 2A38A 3ZTJG 3I3BA 1CICD 4PRNA 4ENEC 4GG6E 3RL2A 1DLFH 5H37H 2P8MB 4WUUE 2QHRH 3AFLA 4UDUA 3BN3B 2R1WB 1FZKB 5I75B 3JTSB 1KACB 4X9IA 4ODXA 1CR9L 5L8LB 2PTTA 5F1SA 4MD0B 4G8FB 3D85B 5JXAL 2FZ3B 1B0RB 4YHIA 4QHLA 1F3RB 2R69L 3VU2A 2DQTL 5CEYB 2XTJE 2OK0H 4JRYA 4OZFB 1V05A 3QA3B 2NW3B 5HYSB 3RA7H 5D1ZD 3TO4C 1BGXH 1T5XA 3HKFA 4G6ML 3WIIL 1DUZB 5KSVB 4DWHA 4UQ3A 1FL6A 5HI3D 4KJWD 5D9SA 1DVFC 2AJXH 2P24B 4LKXA 3E6FB 4HX1A 4JHWL 5FGBA 4HFUL 1HQ4A 4OLWL 4YEEA 3DTXA 4P2RD 5E9DD 3CXDL 3P9MB 4Y16B 2EIBA 5KZCB 2A6IA 2OL3L 3FFCD 5L9DL 3BSZH 5GSVB 1KPVA 5F1IA 2QV2A 2VKWA 3DV6A 4FQXD 3DECA 2NYYC 3MFGB 3O8XD 4OV5B 3N85H 2A74B 5IB5B 5CUSH 3ECBB 4PJIB 5TE6H 3AB0B 2DKMA 2EIZB 3IB4A 5D2LB 4HK3J 4ZUUA 1UQSB 4P57B 4X8JB 3AS0A 1WLHA 3IVKB 2IWGA 4Y2DC 4HK0A 5IVZB 2HT3C 1HSAA 6FABH 4ESKA 3VXPA 2VLRB 2BNUA 2XA8L 2AEQL 3VFNA 5GGVY 3IDYB 3FHQA 4MJ5A 4H1LG 5SWZB 4MA3B 5C70A 4GUPB 3FQNA 1ULVA 4U1LB 1T66D 2Z8WC 3LVEA 3NCCB 5DYOB 1NBVL 4OKVA 4JJ5B 2GQHA 3DROA 4Z5RB 2E7BA 2H2SC 5GJSL 1IGCL 3DX7A 3NZHL 3EJZD 4HFWA 1HSBA 5JXEA 1R3KB 4N9OB 5EPMA 5FECB 4NO0B 3IJHA 3QFJB 1NFIB 1PLGH 2XQYG 3F7YA 3BJLA 1TENA 4MAYD 4YK4C 5A2LH 2JB6A 3L5WA 3BPCB 2R23A 4JM2B 4P46C 1OSZA 2YPLA 1QKZH 4KKBD 2CKBH 1PSKL 2BNQD 2Z31A 5IP4A 3MMEB 3T8XB 2NY2B 4KTEL 4XMPL 4AZ8A 4JRXA 2J7LA 2Y5TB 3L6FB 4UB0L 1DBBH 1TJGL 3ARBC 5I30L 1XGQA 4OCWL 3SE4C 2O5YL 3ILQD 3FQUA 1LVEA 1Q9OB 1DL7H 4OFKA 2Q8AL 1IBGL 3DYPA 3B5GA 1CT8A 2CKBA 4GAYB 1G0DA 3QT2A 4QRRA 4CDHA 4QOKA 4NFDA 1RUKL 2BVOA 4JN2B 1RIVH 1LNUB 2BRRH 2OJEA 5IBUB 3PHSA 1UZ8A 4OF8A 2NR6D 1YEJL 1Q9KA 1U8MB 4I5BB 4F15C 4FZEH 5F7MC 1KELH 1RJLB 4EDXB 4WI6A 4RISL 2EDHA 3MODL 3QXUA 1KB9J 3AM8C 1A6AB 2B20A 2VAAA 5DRXB 4FXGA 1JPTL 1V3JA 4XVTL 5ANMB 5E6IA 4CL7A 1MCFA 3HNVH 2BVPA 4PUBH 5KJRH 1OPGL 3HZKA 5D7IE 4GW4B 3NIGE 4D0BA 1PZ5A 1NC4A 3LDBB 3HG1E 4WVRA 1D5XB 4HLJA 1VSCA 5E4IA 5C6TL 4CVXA 4X98B 1M6OA 2AABL 2V7NA 1CDBA 2NTSP 3TBYB 2I9TA 1CFNB 4CN4A 3WO4C 2C3VB 3AAZB 3CNKA 4XP4L 1I85A 3FONA 1FZMB 5F7DA 2NQCA 5DS8A 4DFHA 1IAIM 1KCVH 4M43L 5IBTL 4PLKC 4QCIB 5E8NB 4KTDH 1BHGA 1MELA 3OAYH 2MCPL 2JB5H 4QRPB 1NCAH 2CLRB 1MJUH 3QUZD 3G6JE 3MLSH 4OLEA 1DEDA 3WN5B 1J12A 2P5WB 1A6WL 1YNTA 2EXWD 3C5ZB 3Q48A 3UEZA 3MOAH 5DD6A 4XCFL 5M95B 1MCHA 4M9OA 1RY7B 1SHMA 3GMOA 2J88L 2VDRH 5LG1A 1A0QH 3NACL 4OZIF 1OD9A 3N1MC 4PGEA 5IW1A 3WHE1 5IG7A 1U3YA 3VCLA 2EO9A 3IDIB 3WSQL 2X1OA 35C8L 3MLWH 2CDEB 4L3EE 5EU6B 5GHWL 4DKDC 4CW1B 4KXZH 2WUBL 1C12B 1X5HA 2ZUXA 1SJXA 2ADIB 4NQSB 1KTDB 1I7RA 3VD5A 4G6KH 2R0WH 4OD2B 3UJTH 2ZCHL 5BO1L 1QFWL 3RTQB 3SGEI 5IBLC 3SCMA 1XAUA 1AJ7H 5KBNC 1D5BA 2KQMA 1PEWA 1JE6A 3UJJL 5KS9B 1I9RH 2C3HA 1ZSDA 1JUFB 5I8OL 1NQBA 4JFFB 2GJ6D 1WAAF 4KK8D 1ND0B 2DQEH 3CH1A 4LDOB 3O3UN 5FYJL 4M6OL 2EYTA 1V7NL 3UBXG 3AXLA 4O5LL 1GOFA 1NDGA 3FQTB 4RX4D 3WV0A 4M7LT 1Y0LA 3BX7C 4HWBH 2X89D 2HYMA 2DQCL 2HVJA 4QXGL 2EE6A 4ZNEA 2HFEB 1YEFH 5EC2B 4HW6A 3LEVH 4NQVA 1F4XH 4ENED 4XC1H 1EEQA 3L5JA 3PL6D 2D7NA 4LLWA 4YDJB 1SJHB 4XT1C 4EJ1C 3IXAB 4HKXB 4F7CB 4FFYL 4Y88A 4ZPVA 4YDIL 4LAQL 2AQ2A 4HWBA 5CHNB 2BSRB 3M17A 2OMBA 1OTSC 4DZBA 3HE6A 4YDKH 1JNNL 2H9GB 5K9JH 3ARFC 1OT2A 2X7LB 4Y8AA 1RPQA 2V7HB 4PJ8A 1MF2H 2XPGA 3FMGH 4TSAL 5IEKA 4WENB 1I7ZB 3JVGA 2IADB 4LLVA 5AYUH 3TPUB 3L3OA 3BQUB 3O3AA 5ISZA 3WKNA 1TZIA 3BH9B 4XNMB 4Y4HA 4J8RA 2GSGB 4IRSD 4LHUD 3W9DA 3N06B 2I07B 1BZ7A 5DEGB 1DVFD 1OAQH 1EFXA 4U6XB 4UMGA 3GI9H 4NCDA 3GGWB 4PIRF 3WNLA 4N8VG 3KPSE 1TQBC 1G7LA 5C0CA 3S4SB 4XXCA 5DUMH 5BQ7B 3R8QA 5E8PA 4NBXB 3KJ6H 3QWOB 2ZOKA 1FNFA 4ZPTB 3VWKB 3VXMB 3T0AA 2IBZX 5EOTA 5F6HI 4NFBA 1AD9B 2HT2C 32C2A 3TZVD 5LXGH 5D2NB 5D70H 1QZ1A 5DK0A 4LEOA 2CMRH 4Z7VE 1YN7A 4RMUA 4LRNH 1N0XH 3MPCA 2NZ9C 5E2TL 3ULUH 3MLRL 2JK5B 3TH4T 4KHXH 2HRPH 1R5WA 2IPTL 2HT3D 5DGRA 4IDJL 4P9HH 1NBYB 2WWMC 1P1ZA 1T89A 1AXIB 1U8NA 3KPNA 3G6DH 1CLOH 2VJXA 2HJLA 3RGVC 4JDZB 2Q6WB 1T03L 2CJUL 1BLNB 4TOYH 4IIQA 4R0LB 1NH6A 1B3JA 3RWCA 3IFLH 2PYED 4X9BA 2A9NH 2X4RA 4XZUA 2NY5H 1NEZG 3RWJB 4F8QA 2IH3A 4X5WA 5DJCB 2R2EB 1NCDH 2C1PB 2CRMA 1IL1A 1CK0H 3C60B 4D8PB 5JW5A 1QBLL 4MQ7B 5DRZB 3T04D 2MFNA 3CC5B 1ACZA 3WNPA 3MLXL 1E4KC 3PABA 3QIBB 1OAZH 2N7AA 4X83A 1W8OA 1KXTB 4RIRB 4XTRC 1JNHA 4P23C 2IPUK 4K2UL 2H45A 2AEIT 3MRCA 4P2OA 4NQEA 2OXGA 4PJBB 2ENSA 3T0VA 4WFHD 2UVEA 1HIML 4WDIA 4YDVB 1N59A 2CXKA 4H8WL 3GBMH 1FNGB 5F7NC 5IMKB 1CWVA 1I7TA 4BSVB 2XXCB 2W9EL 1H3UA 2AW2A 5EU7C 3ARBD 3U9UB 1MY7A 1ZAGA 2PCPB 2GK0B 3TPKA 3TA3A 1KT2B 3GMQA 3L3GA 3QUXC 1YYMH 3TNMB 5IHBA 4JFYB 1A6VH 3P4OA 3S35L 1JZ2A 5I18L 2VC2L 3RPKA 2FL5B 1SEBA 4G8GB 4C58B 4YNYA 4NP4L 5D1XD 4WGVB 1A7OL 4DZ8A 1F3DJ 5I2IA 5SWSB 1KIRA 1WFUA 4PYHA 3JSSA 4LLYB 2XZAL 4TN9A 1M7DA 4NM8L 5M7QA 3G5VA 4X99A 1QBML 3CVHH 4U6TA 4M48L 3IETA 5DMKA 1JL8A 1FO0H 3KWWA 4QYOB 3LPWA 1MI5A 5C08A 5T1LA 3O45B 2I9LA 4WW2B 4ZO9A 3PGFL 4P2QA 2OP4H 1WICA 3DVIA 5GPRA 2VLKB 1II4E 5E94B 5FK9A 2NXYB 3QAZB 4K8RC 3OR7B 5ICZA 1HHGB 1F4WH 1OGTA 3SKOB 1XF4B 1FO0A 1S9WB 3WHXA 3BD5A 2LQRA 5FM4A 4LSRL 1VKXB 2IPKA 3HMWL 1CXIA 2OR7A 3BP5A 5I19L 1Q72H 3LQZA 4D0CA 2DI7A 4LLDB 4OM1L 1CE1H 4ZOCA 1JF6A 4MJ2A 4N8CL 3O6LL 2Q7NA 5T3XL 5TE7L 4PLKD 4TVSa 5T1MB 3DURB 2XICA 2HLAB 4JAMB 5F7WC 3MJ8B 2O5ZL 2VUOA 4ISVA 2AQ3A 5EO9A 3P40A 2VAJA 3VW3H 5DD0H 5C0AD 3EDKA 4NWTH 3HB3D 3P11L 1CGUA 3FO0L 5EG6C 3OKDB 1ZGLM 1XCQB 2X4SB 4HWEH 3VFTB 4X8XA 4LLUB 4E5XB 5JW4R 2BCKB 1ORSB 3SKNA 1IEAB 3V7AG 5JHDB 4LASH 4Z77B 2IG2H 3PDGA 5CEXA 2LU7A 1ZKAA 1XZ0B 4WO4D 5INCA 1CFSA 5MEOA 1JP5A 5DTFB 1QSEB 1LO5A 4P9ML 3MGTA 2OQJB 4Y5VA 5K93A 1PKQE 3SO5A 4EQ2A 3D1MC 3LSOA 3RNQB 3QUYC 3HMXL 3B43A 4Q9QH 4ZOAA 3I6LE 1MLBA 4XRCB 3GBNH 3MRMB 3WE6A 5KSUB 2BFVL 3T0EA 3VG0H 2BVQA 1BJ8A 1A1OA 3MRQB 2ICWJ 2FX9H 3L95B 4WFGD 3ZKSD 1OLZA 5LGHH 4WU7A 3FOLA 5IBLD 1LO0H 4PLNC 1FVCA 5DJXB 5EN2A 4R7NB 2E9JA 5EOQH 2DQDH 4QT5A 1I3RB 2G9HA 1HH9A 2X2YA 2BXZA 4KC3B 1NL0L 3QH3A 1JRHI 2DMCA 4O02H 4NKDA 4IMLA 4XP1H 4FTVB 5HHNB 4ONOA 2NTFA 1F8TL 1BMGA 1T7XA 2GJJA 5IV2A 4V1DE 3ARGA 3P30L 3PQYB 2HJKB 3R4DA 3BRGC 3FTGB 5BS0D 1CLZL 4UINL 1S7XA 4MLSA 5D1QD 4X6CA 2AEPL 2IF7A 2MQ0A 5TF1H 5C8JB 4G9FB 1FZOB 4RFEB 2FDBP 2XTJC 4Z0BH 4OCXL 4WCYL 5DK2A 3RJQB 3IDJB 3MLVH 4JQIH 5D96B 3QRGL 1PY9A 4G6JH 2NY1C 1OTSD 1HKLH 4M7KH 5DUBB 2BSSB 1T4KA 3ARFD 3CCHA 3TF7C 4TRPL 5GGRA 1KCRL 4FMFA 4RAHA 5BV7C 1VADB 3OWEA 4G6FD 3DXAD 4WTZA 2GITB 4XB7A 2W91A 1LK2A 2EDKA 3GJEB 1YYLH 3GM8A 3HUJB 3QB7C 5DMGC 3D0LB 3SOBH 4FQHB 1GCFA 4WW1B 1I8LC 4Y0GA 3GMNB 1BD2A 4WFEE 2VDKL 5FO7A 5LBSH 5FFLA 2B0SL 4HQQL 1ZLUK 1FGVL 1CR9H 4AEEA 2A6KB 3PIQA 3CAFA 4D3CL 4EI6B 3PDOA 1KPUA 4Z7WE 3B2UC 1NCCL 3PWPE 3L3JA 2HT2D 4NYLA 2W9DL 1WAAE 1RZGB 3CFIC 1PG7X 2DQTH 3OPZL 2GTWB 1QLEL 5F1OB 4AEIL 1UEYA 1GZPA 4H0GA 4FQ2L 4XCNA 3BH8A 2NZ9D 4G6MH 3WIIH 5EZIL 4LKCA 4U6YA 3I9GL 5IM7B 2WWMD 2ERJC 4OFYD 2H41A 3BIKB 2OX5A 1ZGLB 2L7JA 5DFWH 5T5NF 3SY0B 4JHWH 4JGJA 3RUGE 4ZSOA 3PP3K 4HFUH 2CRYA 2NNAB 3OL2A 2IAND 4L4TB 5E8OA 4R4BA 1GGYA 2DDQL 1I1AA 5JW4M 3LKNB 3W0WE 5EU5B 5L9DH 2FATL 4HJJL 3RZCA 3VGFA 2YUWA 2Z8SA 4Z7UB 2R1XA 2Y06L 4AEFA 4G8IB 3ZYOA 2WSKA 2NX5D 3CUPA 3RPIB 3U2SA 1NGQL 3K74B 4NM4L 3MYJB 5JHLH 3KPRA 5ILTL 4OZFG 2UYLB 5EZLA 1KJMA 5H8DA 2EYRB 1KEGL 4P23D 1J0YA 3GZKA 3OJVC 3MBEA 3SDDC 4DVRL 2XA8H 2NW2B 5HD8C 2AEQH 1DQLL 3EO0B 1SYSB 5ABDE 2MSPA 3FB8B 4NO5B 2APWA 4F7TA 5L2KD 1KLGA 1EA9C 4Y19D 3PGCB 4ZOEA 1QQDB 1QP1A 2B4CL 1NBVH 3RY6A 1QLFB 1YECL 4NQCD 1T1XB 5DDHB 5T1KD 4RGNE 4JVPA 5GJSH 1FVEB 1IGCH 2AK4D 2UWEB 3NZHH 1Y6KR 4X4XA 2FSEA 5HHOB 5SV3A 2D4FA 3ZE0E 3CSBA 2V2WB 1XGRB 3MRLA 2R4RL 1FYTE 4H5SA 5K33A 2K9UA 5HGBA 3MRBB 4XX1E 1PSKH 5H94A 4U1JA 3FB6B 5J9PB 1U8QA 5JMOC 4KTEH 3NPZB 4X6EA 4UB0H 1TJGH 3O2DA 4PJDE 5I30H 4OCWH 3SE3C 1M05B 2O5YH 2VL4A 1EZVY 3O6FA 3MV9B 1MFEL 2FNBA 4R3SA 4LCYB 1Q38A 2Q8AH 4K8RD 1IBGH 1U0QA 5I1AA 1N0LA 4UIMA 5GS0C 2MNUA 2X6MA 4PLOB 4UUJB 5D6CA 5EO1A 3V6ZA 5CSZA 5I66B 1G0YR 3MUGB 1RUKH 4C55A 3QO1B 1FG2B 1QPPA 2AV1A 4Z7NF 1RIHL 2WUCL 3VXUD 1IGIL 2Y1VA 4YHYC 1YEJH 1X5YA 1YY9D 2F53E 1WZKA 1YNKL 2JCCE 1JZ3A 3IDNB 3KS0J 3MODH 1J7VR 4U49A 2FO4A 3HE7A 2BVTA 1JPTH 4XVTH 4JRYE 4IRJA 1CFQA 2PO6B 2BOBB 2VXTL 3MRJA 4Y4KB 3LZFL 1WC7B 5MENA 2OL3B 3TYGH 4ZTOL 5EDXA 4PRHA 4NDMA 1F2XK 3FCTB 2D4DA 2AABH 5DUPH 4ORZC 3TO2B 3B8SA 1KIUA 2FIKB 1AXTH 3BRDA 5DJDA 4EVNA 4EI5A 4XP4H 5F89B 1NBQA 2OLDA 5KVFH 5DHVB 1MCWW 1FGNL 4K55A 4BQCA 1JGDB 1X5XA 4M43H 3QUYD 2Z91A 5IBTH 5IBUG 4LLMA 1LHZA 4CDGC 3KLHD 1CZ8L 3S8WA 4PJ5D 3R06A 7FABL 1JIBA 2V9QA 1S9VB 2CDGB 3GIVB 2MCPH 1XMWA 1AGBB 4OCYL 1IC5H 5FAAA 2VE6B 4GKNB 4N1EA 1YEGL 5BZDA 2XWJB 3RWIB 3B9KD 5IJVA 1A6WH 2WZPD 4WI8A 2X4TB 4IJ3C 4CAGA 1FNSL 4XCFH 2FGZA 2R0ZL 1QFWM 4TVPE 4KUCD 1CXEA 2J88H 3QI9A 2H32A 4GAFB 5ACZB 1CGYA 5D7LB 1F42A 3CK0L 4HXAL 5AUMA 3IDMB 4KJYB 3DUSB 4XGZB 1MCEA 1P2CB 3DMMA 1NMCB 1H5BC 1XR9B 4HIHA 4XAKE 4OLXL 2DBJA 1N4XL 4ZS7H 3WSQH 35C8H 1U58A 5GHWH 5C0FA 1DUYA 1FZJB 3QIWC 5ITFB 3OR6B 5L2JB 2WUBH 3MRIA 1AQDB 1VFUA 4MQTB 2HWZL 4PRBA 2ESVD 3V9FA 1T0NB 2PN5A 1JI1A 5BO1H 1QFWH 3KLSA 3ARDB 4PRPB 2BXYA 4L8SA 3H9SB 2NLJA 5LQBL 1D7FA 4LIQE 2X42A 2X1XR 4MNQB 3UJJH 2E8YA 5I8OH 5AD0B 5F9WB 3RBSA 4HF5L 3KPPB 3RQ3A 3OKEB 1K2DB 3IYLW 4N0CD 4U6VL 4WI2A 2GW5A 5C0IB 5FYJH 4M6OH 1RULL 1V7NH 3LEXB 3VXRB 2AXHA 3AY4A 5HDLA 4X9FA 1HCVA 2YRZA 4F7EB 4OLUL 4JRXE 1IAKB 3LIZL 2DLEA 2DQCH 5C09B 3LKPA 4C83B 5ACLA 2J5LC 4HKBA 3MV7D 1H9VA 3L3KA 5DMGD 1A5FL 4U1NA 3MV8A 2GCYB 4HWZB 2RR3A 2WQ8A 1JMXA 4BSWA 1HCFX 1P4IL 5HHME 2P8MA 1SJEB 4QOKE 4U1HB 5GGTL 1XR8A 2R1WA 4ZFOB 5C86A 3QDHA 4FFYH 2PUQT 3QIUB 4YDIH 1D6EA 3BGFC 2CLZA 4MD0A 4G8FA 1KYOK 3B2UD 1UM6L 1JNNH 3BPOB 1B0RA 2XN9A 4FQJL 3F6LA 3OKMA 4XP5L 2J8HA 4IOFD 4TSAH 1HHIB 2GHWB 4HHAB 3U4BL 3CX5J 3QA3A 4PJHB 5HYSA 4KROC 4RFOL 3VFSA 5KW9L 5L88L 4ZUTA 3P4NB 3Q6FB 4QRUA 1L7IL 3OSKA 3AREC 1KCUL 2VTFA 1GC1C 2ITDB 1ES0B 5CSGA 3TBTB 3E6FA 1G1YA 4HGWB 4KQ4L 2NZIA 1N2RB 2DM3A 2FX7L 2AS5M 3WLBA 1A6TA 3T4YA 4EDWH 3FJTA 4Y16A 5CMAB 2BVYA 3D2UD 3QQ9C 5GIRA 3UO1L 4XNYL 4ELKB 3EOAA 2N56A 4X6CF 4FQIL 2PXYB 5HI4C 3S36L 3QEHA 5F8RC 4NNPL 2W9LA 4JPKH 4PJIA 1NC2B 2EIZA 5D2LA 4X8JA 1KN2L 2XXMB 5E2TH 3MLRH 1DQTA 1XIWB 2YA2A 4FG6C 5CWSA 2W65B 4PJAB 3U46A 2IPTH 2Q87A 2JIXD 4ONGL 4LSTL 4IDJH 4HIEB 1P4LA 1J8HA 4H0IA 2PKDA 3VFWB 1N64L 5J1AA 2PYFB 3GSQB 3BT2L 2VWEE 2KH2B 3NIFE 1IC1A 3HI5L 1DE4B 4ONHA 3V4VL 4MA3A 2EZ0C 4GUPA 4HDIB 2YMXL 4RGOL 3ZL4H 3VFVB 4Q2ZB 3PWJA 4PJ9A 4ODWB 1DEEB 3S4SG 5HYJE 5DR5H 4CU8A 4TUOA 3HCVB 1JGLL 4I9WD 4JJ5A 1NGPL 4IMKA 4Y1AA 3RWFA 5A3IC 5JO5B 3BW9B 5BXFA 2NY4B 5B8CC 3QDJB 4MXVF 1JHTB 2Q76A 1R3KA 5FECA 1NFIA 1AO7A 3F7RA 5MI0C 4K2UH 1EEZA 4JM2A 5B3JF 5CIPB 3UYOD 1S7SA 4HXBH 1HIMH 3RL1A 1CE6B 1BVLA 3MMEA 2X9WA 2E7LC 4F9PC 4QTIL 5JLZA 3CFJB 3QCUL 2Y5TA 3L6FA 5T1DL 1HXMB 4X4YB 2WBJA 2YD2A 3A6CL 5I1LB 2B1AL 4XPHL 2CO7B 2UV3A 3QJHA 3W82A 3SHSA 5BJTA 1M71B 2OI9B 4BELD 4GAYA 4HIIA 5I18H 2VC2H 1CICB 4OGXL 2HKHH 2KUTA 3L9RB 1N5AA 3LCYA 4QRTA 3ULSA 4F8TA 3GDBA 1LE5A 4Z7QF 1UEMA 1A7OH 2O26U 1MPAL 1LNUA 1EVTC 4LCIL 4OF0A 3CSGA 2D7TL 1KCLA 2XZAH 4NM8H 3O3DB 1EPFA 1QBMH 2XG5A 4I5BA 4M48H 1RJLA 5F6IB 5D7IB 4K8RL 3WS3B 3T65B 5KANI 5DRXA 3SO3C 4JB9H 4NT6A 4GW4A 3PGFH 5D1ZB 4OCMC 5GGVH 3ZYZA 2P46B 4JY6B 1W2KT 1QSFE 4J3WA 1YUHB 25C8H 3O3BA 1CFNA 4G5ZL 5BRZD 4E41D 4YPGA 3AAZA 4JFZL 3VG9C 4RA0C 1ZS8B 1GOHA 4P2RB 5E8DL 5E9DB 5I19H 3C8HA 1FZMA 3V5HB 1MEXL 2YD5A 1OP3K 1IQWL 1A9EA 3FFCB 4N8CH 5B39B 3O6LH 5T3XH 1RUQL 5TE7H 3SGKC 1MUJA 4Z76B 5DEFB 3GSWB 2O5ZH 3O8XB 4NRYB 2CLRA 3KG5A 2PNDA 1X5KA 1CGTA 1Q9LA 3P11H 5I74C 4QRQA 3MLTA 3IJYA 5C0GA 4CMMB 5HHQB 1XF1A 3EO1A 2CUHA 3KXFE 2IQ9L 3OXSA 3C5ZA 1FHGA 4ODTL 3VJ6A 3D18B 4QNPF 2KKQA 1IQDB 1U93B 5AEAA 1HK6A 2F5BL 2ZOLA 4P9MH 3IDIA 1KENL 1KN4L 1H8SA 1ZEAL 1NAML 1MCIA 3HMXH 2Y36L 3E3QE 4KMTL 4HBQA 4OSUL 2H3NB 3P3YA 1U8PB 5HHXL 2CDFA 4Y4FA 1PVHA 5DQ9A 2BFVH 5EUOE 4M8VA 1BJ1H 4Y5YC 2ADIA 7CGTA 4UQ2A 1RZIB 3O11B 4OD2A 1FAKT 3QCVH 4YHML 3D25A 4GBXD 2VDML 4MXQC 3C5JA 4UT7L 3TV3H 1L6XA 3WFEL 4JO1L 1IKNC 4LCWD 1RZJC 2APVA 2Z35A 1JUFA 4JFFA 2SEBB 4BH7B 5IVNA 2OTUA 4MHHG 1YY8B 3D39A 4HEME 1BJMA 3WFHA 4TYUA 1ND0A 1ITCA 4JR9L 2BNQB 1BIHA 4I2XB 2P8LB 4N1HB 3JTTB 2C4FU 3P30H 4PJFE 1DBAL 5C07D 1QLRB 1BEYL 2HFEA 1CLZH 3SGJA 3KPSD 5HDOA 5GRUL 4G9DB 1PYWB 1YEEL 2I60L 2AEPH 4O2EB 4WWKC 1CL7L 5J6HB 2X4QA 1YPZB 4MZ2A 5BV7L 3CVIL 3OKLB 3O81A 4OCXH 4WCYH 4MNGE 1JZ6A 4JZJB 3MOBH 3JWOH 5C6WH 4ZODA 1S5IL 2X7LA 2EDYA 4JLRB 1KCRH 5IB2B 3ROOA 4GAJL 2C4XA 4K94C 4NKMB 4PBXA 4G7YL 5HYFA 3TPUA 1P7KB 2YHGA 4IM8A 1RK1B 4YBLC 1FNHA 2GSGA 4N68A 2P8PB 2JJUA 3H7BA 1T5WB 4QTHA 3SKMB 5CFHA 3NOIA 2DMKA 3O4LA 3GO1L 4KPHL 5LGJB 2Q20A 4NN7B 3M45A 4JZOB 2VDKH 4OFVA 1D9KC 1MREL 4L8BB 3ZHLA 2CR3A 2B0SH 4HQQH 2I25N 5BQ7A 1FGVH 1OAYL 3VWKA 3QWOA 1J1OL 4ZPTA 4D3CH 3NFNB 1NCCH 3PWNA 2B5IC 3WFBL 1L4IA 2G5BB 1IGFL 4GW5A 3H3PL 5D2NA 2W9DH 5HI4D 3OPZH 1P5VA 2EYSA 1QLEH 3ZZ1A 3QG7H 4AEIH 2A0LC 4FQ2H 3QUZB 4WHTB 3ETBF 5HPMA 1P84J 1D5IL 3SN6N 3QP3A 2JK5A 4GRMA 4PRAA 2DJUA 4FG6D 5F8QC 3TO4A 4XXDB 4DGIL 5EZIH 5DHYB 3NH7H 3I9GH 1H8NA 4NQXB 1OAXL 5FM5O 4HUWA 3TESA 1S78C 1MCOL 2BVUA 1IAOB 3BKCL 3O9WD 2DDQH 3U6RA 2EZ0D 4RGNC 2X1QA 2RB8A 3JV5A 5I8EB 2BHUA 1OCWL 1UB6B 3R1GL 4NO3A 4CVZB 1EGJL 2FATH 4HJJH 2VLJA 5KAQG 4X5LA 3C60A 4D8PA 3BZ4A 4YO0B 1QTYT 1DSFL 4JCLA 5EORL 4MQ7A 5CLTA 5ILTH 1K8IA 4Z0XB 5CD3B 5A2FA 4QHMB 4JKPL 1DJSA 2XWBB 4RIRA 3CFBB 1KEGH 4HJ0C 3RIAF 4ACPA 5E8EB 1KIQB 4Y2DA 4DVRH 4YHOH 5EZJB 2VISB 3MRDB 3INUL 1DQLH 5CEZD 4IHOB 4YDVA 5KN5B 2GJ6B 5J06A 5D5MB 5FYLD 5IMKA 1EHXA 4BSVA 1KYOJ 1GGIL 3P9LB 3BYYA 4TNVF 1ZK9A 3MROA 1FFNA 2PCPA 2PR4L 4R4FL 5IMMA 5HJ3A 1KT2A 2B4CH 3IDGB 3W9EB 2ZUWA 3TNMA 4U4BA 1FN4B 1YECH 4JFYA 3ABZA 4BQ6A 2AJSL 2DQUL 2FL5A 3EDJA 5IFHH