4Z0XB

Structure of hepatitis c virus envelope glycoprotein e2 antigenic region 434-446 bound to the broadly neutralizing antibody hc26am
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
VQPVQSGAEVKKPGSSVKVSCEASGGTHSNYVITWVRQAPGQGLEWMGGFIPDFRTAMYAQGFQGRVTITADESTSLAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGPGTLVTVSSGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody HC26AM light chain variable domain
publication title Structure of Hepatitis C Virus Envelope glycoprotein E2 antigenic region 434-446 bound to the broadly neutralizing antibody HC26AM
rcsb
source organism Homo sapiens
total genus 20
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2015-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0xB00
5D1QA 4K9EH 3SDXA 5M7QA 5FKPA 3AXLA 1BFTA 2HTLC 4JY4A 4NO3A 1ZTXL 4Z7UB 3PWLA 5C0RH 4IRSB 3P4NB 3NFPB 4WEBH 1XGTB 4NBYB 3GHBH 3PP4L 3GIZH 3EYFA 1NCBH 2UZYB 1S9YA 4XPTH 3VGAC 5SWSB 2NMSA 1RJLA 4X4XA 1FPTL 2X1QA 4WV1B 4XHJD 2A9NL 1EHAA 4IOFC 1A02N 1JNJA 3V4PH 4WUUA 1CDYA 4NC1E 2W91A 3TT3L 2C4FT 2NW3A 1HHGB 1A1OA 3UBXG 4LLUB 2UVEA 2EIZA 1CU4L 5BW7C 4OM1L 3MV8D 3MMEA 1G7IA 3L3GA 4JHZA 1JV5A 1YNTA 3K0WA 5SWZE 1LE5B 4NO0A 3QEQA 4J8RB 4WY7L 5GGRA 2A6DA 3ZL4H 4Y1AE 5F8RC 1SMOA 5IMMB 4UTAH 3S34H 3G5YA 5CAYB 3V0AC 4YZFE 1AGDA 5DUMH 2G9HA 2B4CC 1W0VB 4DAGL 1NFDA 2DM4A 4FQJL 4DGIL 2P8MB 2CIKB 1DVFA 2NTSP 3MGOA 3B9KA 3KPMA 2WBWB 4U31A 1WCBA 2EDRA 5EIQA 1AXSB 4LRIC 1IBGL 3QEUA 5DC0A 1IRAY 2H6PA 3BQUC 3MBEA 3IJHA 5HHOA 5J7CC 2ARWA 3DYOA 5DUPL 1XCTB 3LY6A 3L95B 3WN5A 1BFVL 1RUQH 5EZOH 2VXQH 5FEBA 2Q7NA 4P9HC 1LEIB 1F6FB 4PY7B 4QWWC 2Y5TA 1QBLL 4HIIA 1E4XH 3VFTA 2DM2A 1FSKC 4FS0A 1BVLB 3SDYL 4F33B 4HUWB 4YHZL 1X7QB 5IG7A 4Y5XC 3P0GB 4TNWF 4RGMB 4GRMA 4KKCC 3BP4B 1XF3B 3C5ZA 3WIHA 1A4JA 1S7UA 2FEEL 3BW9B 1QPXA 3P77A 1RULL 4XTRD 3O2DH 2HFFB 3GSNB 3QDME 1T03H 1ZLUK 2YK1H 3UTQB 1NCAL 2NZIA 3IU4H 3QG7L 4O58L 5DJDB 3WFBH 3WD5L 4PRNB 1KIPB 1NMCC 4HUMB 1IQDA 1J8HB 3UTOA 2VXSH 3BKYH 1KJ3H 3AS3A 3QPQC 3QUYC 3MRMA 4Z7UA 1FNSH 3VA6A 1CTNA 4QOKD 1CGVA 3D9AL 4ZTOL 4HWUA 2G60H 3REWB 3G08B 5C0GA 2IAMD 2LVEA 1RK1A 4LQFH 1D5IL 1TQBB 1U3JA 4PRID 4KI5C 5GXBB 1JMZA 1VB9A 2YBRB 5D7SH 1FO0L 1LP9E 1XR8B 1B0GA 4J3WA 4HPYL 1XIWA 1X4XA 2IPTH 5BRZA 1YA5A 2RB8A 2J8UB 1UA6H 1VGKB 4QYOA 4WV1A 5DJYB 3IB4A 3TV3L 4MD4B 5SX5K 4WFGE 1NCDL 4QT5B 3TPUA 5DMYA 3QB7C 5HVWA 3I9GL 1A5FH 4AM0A 4D3CL 4MQTB 4JZOA 2XWBA 3P4MA 3SDAA 5D1QC 4NOFA 2HKFL 2JK5A 4AJ0A 3T0AA 4FFYH 2CLZB 4NKDA 1A22B 4WUKL 1A14H 2FNBA 3U0TB 1UWXK 4WUUD 3FN9A 4XI5D 2IG2H 4AEIH 3MRLA 4JO3L 4DKFL 2GUOB 5SV4A 2BJMH 1IGTB 2Y25A 4X7TB 2QQKH 5T3ZD 2GK0A 1NUDA 4TQEH 4KV5F 4XVJH 1PFCA 5D2LF 2P8MA 2CIKA 2W9LA 3MODH 4OD3H 4NO0D 3QEQD 1A6VL 2VDOL 1DFBH 5D6CB 4GG6B 2DQCH 4UOJA 4LSSL 1YN6A 4MA1C 4Y4FC 1MEXL 3OAZK 1FLTX 2HLAB 3IAPA 2OCFD 3ULUE 5TDPB 1XCTA 3NFNB 3L95A 4RCAA 1BAFL 5CJXA 1DVFD 2PN5A 1F6AB 1FN4A 4MCZB 5MENE 2G75A 1QSFA 3B9KD 3ISWA 4NQTA 1ZHNA 4JDTL 4FN0A 1EX0A 1OGAE 1ORSA 1Q1JL 1T89C 3MBED 4UB0H 5HHOD 3IAQA 4HUWA 1EHLH 3A6CH 1MF2H 1RVFL 1X7QA 3BIAX 1INEL 2VDQH 1U8JA 4WWID 5E99H 1NCWL 5T3XE 1YEGL 5A2KH 1HN1A 2IALB 1MFDL 2OQJB 4G9FE 3S3JA 3BP4A 3QXTA 3RFZC 3B9KC 4WWKD 5D7JA 1R3LA 4IJ3B 3T0EB 4LP4A 4NGHL 3QIUC 4PGCA 4CVZB 2NYYC 4OF8A 4HGWB 3QG6B 3QIWB 4ZUTB 2E7MA 3WN5C 1VGEH 3ZDZF 4JRYD 1N4XH 3C5ZD 2W9EH 3KS0J 4GAJH 4ZNEE 1FBIL 5I66B 3D2UA 1DQTA 1K8DB 5IM7B 5C0AB 1CL7I 1CZ8H 1VPOH 2VDMH 5C2BL 1MRFL 3DVGB 5FYKH 2CRMA 1WLHA 1SY6L 3EOAB 4E41E 4Y2DA 3WNMA 3QQ9D 4HWEL 2WAHA 5BMFH 5FUCE 5C08B 1P4BH 4AEHH 1JGLH 1QLEL 2YBRA 1BVKB 5HPOA 2ED7A 1EFXB 3JXAA 1H3VA 2DQIH 3A0OA 4PJFF 5DJYA 4AK1A 1NGWB 3SKJH 1S9WB 3GO1H 1VADB 3O6LL 4LEXH 4MD4A 3V6FA 3QDGB 4BZ2H 4QT5A 3KYNB 2BP3A 4P5KA 3OHXA 5GGVL 2O5ZH 1A3RL 5SWSD 3UYRL 5GZND 3VRJA 5BRZD 1KJ2H 2CLZA 3DUUB 3CK0H 2WIMA 1XF5B 4NM8L 1HSBA 2DQJL 3ELAT 4HF5L 3U0TA 3IS0X 1BWMA 2O5YL 4E9LA 3BGFB 1HDMB 3V0WL 5LBSL 4EVNA 2GUOA 4HW6A 1U3ZA 1OAKH 1IGTA 3QAZC 3EIFA 3L3DB 4X7TA 4JG0L 3SDAD 3VD7A 1HIMH 2GFBB 3WLBB 2VLKB 2YWZA 4FTVB 1XIWC 1EVTC 1UM6H 2JCCA 1RHFA 3U82B 4M9PA 1ZGLP 4Z8FL 1F11A 3IKCA 3QCUL 4RAHA 4OCYH 2RCSL 5D6CA 1PD6A 4GG6A 4HJ0D 1HYRC 5JQ6L 1NFIB 1MHPH 3U83A 3MR9B 3IDIB 5EBLB 3NGBB 1Q38A 4K7FA 5FHAH 3C8HA 3LAFA 5D6DA 5DFTA 1ZV5A 5DRNB 1IEAB 2IBGA 3NH7L 5BZWB 4YGAB 3WL9A 2FEEI 1TTUA 4F7EA 2EDQA 1EMTL 2C1PA 1T0MB 4L9LC 4MCZA 3L6FB 2VB5A 4MJ5B 1BBDL 1YJDH 2PKDA 1ZT4A 4BK4A 1LO0L 2F5AH 4CRPA 1U8PA 1YYMH 1IT9L 4NHCH 3RIAF 1SJHB 5LCVL 2OM5A 5F93C 5EO0B 2BSSA 3F12B 1ZANH 4YHPA 3R8QA 4FOMA 3P9WB 1QSFD 5CGYD 3O9WB 1YEKH 2R69L 4FFWD 1S5IL 4ZPVA 3T0EA 5JMOC 5T1KB 5IBLD 5C0EB 3F5WA 5HSFA 1JZ5A 4R0LB 1YDPB 3IDGA 1Q9OA 3QG6A 3QIWA 4ZUTA 3BX7C 4IRJC 5CJXC 3K8LA 2H2PD 4G8GE 4ZUVB 1EZVY 2EO1A 3DSFH 1TFHA 1VEPA 3L9RB 3DMMA 3OBAA 3BE1H 1KB5A 3O3DB 5B4MD 2ICWI 5IM7A 2PO6C 4PBXA 1JHLH 1CE6B 3MNWB 3U0WH 5JW4N 5JZ7C 2DF3A 4RAUA 4BZ1L 1J8HD 3EOTH 5JXEA 1A1NA 2HJFB 3BPLC 2P42B 4HKBA 4UT6H 5E94A 4TNWK 5C08A 2H2PC 2CJUL 5J1AB 2VABA 1RZ7L 4WTWA 3HRZA 5D7JC 2ZOLA 4OZHA 1F4WH 2VISB 2X1WL 1EO7A 4HJJH 4NRXB 1NGWA 5HGAB 4Y1AB 4N0YH 1S9WA 4NSKB 3V95A 1PJ9A 3GMOA 4CDHA 3S35L 4Y2DD 5JR1H 3KYNA 4TRPL 5ENWA 4QHUB 4ZS7L 2Y9RT 2ZG2A 3VGEA 3VE0A 3PV6B 2WP3O 1FZKB 1JPTL 1UWGH 5BVJA 1A7NL 5DD0L 5LQBH 3CAFA 4FA8A 3KGRA 1XF5A 1T80A 1FL5A 1HK6A 5F9AC 1BREA 4OQTA 5CGMA 4CMHB 3F7PC 5J1SC 5F3HB 2D4DA 4YDKL 4NWTH 5HYJA 5I8EA 3L3DA 4CL7A 1FO0B 3FN0H 3SJVE 2GFBA 1M4KA 1I4FA 3H8NA 2F58L 4LAQL 2ZUSA 4KHXL 5KAQG 4X9HA 5B22A 1A6TB 2WWMD 4OT1L 3RVVC 3H9YA 1GGBL 1T4KB 4L4VE 1OAQH 4QRTB 1NAKH 3W39B 1YEIH 5FF6A 2VLME 4JFXB 4Y2OA 2HJLA 2NY5L 5EBLA 4TUJA 4HXBH 4D9QE 2OP4H 2B5IB 3OWEA 3SQBA 2Z93B 3TP4A 2XTJC 5ICZA 2R0KL 5BZWA 3GNMH 3CDGA 4M1GH 1KIRB 3PL6B 1T0MA 5CCKL 1KLGA 4UDUB 3CFBA 5C70A 3UBXI 1HILB 4J3VA 3QDMB 1D6VL 3P0YH 1WZMA 5IVXF 2DWDA 4RMUA 4HIXL 1SJHA 1U2CA 2VDLL 4P59L 1TJGH 4JN2A 4XNYH 1ZLWH 1DTUA 2X4SB 5HI4D 3MRHA 3X3GL 4H8WL 4LMQI 4Y7MA 2CUIA 2FD6L 3Q6FB 2ADGB 4KV5E 5GSRA 1MFAL 1ZE3C 2GAZB 3C60A 4WU5B 3DX7B 5D2LE 3JTTA 3RBGA 3LS5L 5GS0C 1IAKA 4FQHB 2JB5L 4S1QL 4I2XA 5D4QA 5EU4A 2HRPL 3WXWL 5I0DA 1LP9B 1J1XL 1HOCB 5EORH 4Z77A 4Q9RL 4DVBA 1G7LA 2MNUA 3QQ3B 3T0ED 5C9JA 2FH8A 4KPHL 1N5YH 1F4HA 4U0RB 3T0BA 1OGTB 3QFDA 3W9DB 4X6DF 5I1AB 1NDMB 3QIWD 4NQUA 1CLZH 2HJFA 4CW1B 1J0ZA 1FL6B 1OARH 4NJAH 2Q8BH 4ZUUB 2FDBP 2YPKA 3ZE0F 1CE1H 5F9WC 5SWZA 3VWKB 5C0AD 4KMLB 5HGAA 3GSRB 1EBPA 1U8HB 3KPLB 1UKQA 1F8TH 4OLYL 3DGGB 3VFOB 5JXED 4QHUA 4X8XA 1LQSR 2IGFH 5C08D 1KOAA 3QULB 5C0IB 4KJQC 3OR6B 5CUSL 5FGSA 2Z9TA 3H9HA 1FZKA 3AS2A 3DMMC 4IBLT 1CDHA 3EDFA 4WHTA 2AS5M 1EFXD 2NY0B 4FQXA 3ZHKA 4JFEA 2Z91B 3AREC 1NAMH 4OSUH 3ZDZE 4M7JH 1ZSDA 3QDGD 5F3HA 1ZHBA 2BVOB 1UM4H 4RFOH 1XMWA 4MD5B 5TGBA 1IILE 1DN0B 3P0VL 4HHAA 3THMH 1QFWI 3IYLW 2RFXA 3CDYA 5E8EB 2FX9H 4PLKC 5JORA 1UFUA 1T1WA 1U91A 5LXGL 4U1NB 2ZUQC 5MENB 1XGPA 2Y06L 3IFNH 1FFOA 4I3SH 5CSGA 5CGTA 4QRTA 2V17H 4JFXA 4F58L 2XV6B 3W11C 4XAWL 2Q3ZA 4MXWH 4PJFE 5I8OH 4H1LA 2Z93A 2FATL 4FTVD 3B2UD 5JO5A 1EGJL 5KSVB 2AXFB 4G9FB 3RVUD 4UDUA 3BO8B 5TQ2H 2GJZA 3MCKB 1EEQA 4I13B 3UROR 2FWOA 5IFHH 4DZBB 5FYJH 1G6RH 4MZ2A 4U6YB 1LK2B 5KSBA 4WI7A 1K5NA 2OMNA 2Y7QA 2C7UA 3RWJB 1EO8H 1UM5H 4K23L 2BY1A 3EFDH 2VH5L 1Q0YH 4ENED 3MLYL 1OAZH 4X5XB 2AP2A 4M4RA 1O7VA 1MREL 3ARRA 3GMNA 3HC4L 3UP1A 4YDIH 4PJHE 4WU5A 4E41B 1PX4A 1Z5LB 4APQB 1G0YR 1WIPA 3WJJA 2P46B 2GT9B 2CO6B 4WDIA 3HPLB 2YXMA 4ENEC 2G5BB 1HOCA 3ARDA 2NZ9D 3O9WD 5I2IA 4ONGH 3QQ3A 1DBBH 5T1KD 3RIAK 1GHFL 3C60D 3T4YA 3RU8H 2O61A 5DUBB 1CR9H 3LRHA 2OBGA 3HUJA 5KW9H 5DRXA 3W9DA 4KKBC 4R4NC 2DQDL 5A1AA 2BXYA 1U95B 4B7IA 2PR4H 4U6TA 3JBG7 4FQQA 1I85A 4Z9KB 4L3CA 2X4OA 4U2YA 1CQYA 3BP7B 5IIEB 1YEHL 1JFQH 3VWKA 2CDGB 5T1DH 3MNVB 5D7KE 1KTLB 2NY6B 5GISL 3MLZH 1U42A 3C60C 1MIML 3HAEA 3QCTH 1KTRL 3GSRA 1GAFH 2GQHA 3IDNB 3HMXA 1G7PB 3A67L 4AT6B 2XWTA 4OLWL 4L4TA 5AD0A 1OCWL 5C0IA 2ZUWA 3OR6A 4RZCB 1U6AL 3NCMA 3AC0A 4WCYL 3WNPA 4X6BB 4OFIA 5SWZD 2H2SD 2ZUVA 4YJZL 3FT2A 5KVDL 1KC5H 3VRIB 2W1NA 1I7RB 2ICWJ 3SE4A 1NUFA 5C6TH 1SM3L 3B8YA 5HHME 1RZGA 3BSZH 3R06B 2QBWA 4P3DB 2W0LA 1KGCE 5E8EA 2GKIA 4ORGB 4WHDA 1H8SA 2R0ZH 3EYQC 3F7YA 4P4KB 4CU6A 2NR6D 3DVNA 4MJIE 1U92A 2CR3A 3WNNA 3FRPA 4BZYA 3P30H 3QSKB 3MJ9H 5HHQB 2DI9A 3LKSB 1OGAA 1KIQA 2DWEA 4ERSL 1NGPL 1F2QA 3H0TB 2Q86B 2Q76B 1BPVA 4ISVA 1ZT7B 3I3EA 3U9PH 4FQXC 3VI3F 3B9VA 5CJ8A 2BC4A 4TSCH 3MGTB 5IFAL 4R6UA 3MCKA 1CFNA 4NRYA 4YHNA 2R2HB 3W82A 4U6YA 1LK2A 5KN5A 2BNQE 1P7KB 4OKDA 5F9DC 4Q97A 4G8GB 4BQ8A 2XG4A 3W0WE 2FJGA 1MCOH 4LCUB 2J6EL 1RFDL 1IGYA 4GAGL 4NPYA 5IQ7L 4X5XA 3QDMD 3QUMH 2DBJA 1BP3B 2V9RA 4PB0L 5DVNA 5HHPB 4E41A 2EKJA 4OF7A 4LSVL 5AZEH 4JZJA 2GT9A 5IHUL 1IC7L 3ARFA 3WIIH 4HBQA 1HSAB 5C6WH 1KG0A 2AJVL 2PW2A 1AGFB 3ZKXC 1U8IA 2EC8A 4TSAL 2NX5E 1CFQB 1RJYB 1U8LB 4G9DA 4XP6L 4BA8A 4WW1B 1BX2A 4XPGL 5J06A 2A9ML 4FZEH 5CP3A 4RA0C 1X5JA 2L7JA 4K07A 4RMTA 4NWUL 3BRFA 4G6KH 4EXKA 1LNUB 1U95A 4M5ZH 3QP3A 2HFEA 2MWCA 4ZFFB 3BKJL 3CFKB 5IVXE 2V5TA 4NNPH 5HBBA 3BP7A 1XGUB 3O3BB 4PRHE 5IIEA 4WRLA 3GIZL 2CDGA 3WJLA 1I9JH 4DQOH 2B1HH 3VU2A 4WFGD 3ZKND 3S35X 4EDWH 1D9KC 4PGDA 2J88H 2XY2A 4XZUB 1RUAH 5BOPA 1DQMH 1YN7B 2HT2D 4JQXA 3WJJC 1Z3GL 3MRNB 4AT6A 2UZIH 4L8BB 3OZ9H 3TA3B 1TIUA 3SJVB 2ITCB 4NNYB 4QRPE 3ARDC 1DEEA 4X6BA 3V4PL 5T1MB 2OX5A 3HC3H 3VWKD 1JRHI 3ZDXF 5FOBA 5TF1H 4GBXB 5CD5C 3LD8B 1I7RA 2YUXA 4L4VB 3OGOE 1UH4A 4JEGB 3RNKB 2FR4B 3R06A 3T77B 4P3DA 1I85C 1FIGH 4P9MH 2AJUH 4MNQE 4TULH 1QSZA 4ORGA 5IHZB 4LCCB 1AD9A 4F57H 2NY0D 4X6DE 2V7NB 3S34L 2KBGA 1FORH 1BFOB 5DUML 3QXDB 3ZE0E 4YE4H 3P9MA 3N1QC 3H0TA 3ULUD 4EUPA 4MZ3A 3WS6A 3HNVH 3NA9H 4GMSH 3X3FL 3MUHL 5D2NA 4ELME 5MEND 5JA8B 1AR1D 4M8VA 5DMKB 2P5WE 3SE4C 3MGTA 2YKLL 1P84J 4D0CB 1OGAD 1RUML 1KXTB 5D2LB 5IROA 2CIIB 3KPPB 4NN6B 1JZ3A 3PWVB 1DBJH 1SEBA 4M7KL 5T3XD 4MNHA 3EYSH 4UINL 4G9FD 4LCUA 1E4XL 3TZVA 4IMKC 1M7XA 4XMKL 4KTEL 2NXZC 3MUGB 5JXAH 5L8JB 3KYKH 3DV4B 4O5LH 4NYLB 3LEVH 2IADA 5ERWA 1HXMB 3SKNB 1QHPA 3PIQA 3C09B 3I6KB 3SE9L 3X17A 5F44A 3O2DL 1JWSB 3IFOB 5K9OB 3OXSB 4HS3A 2YK1L 4F15B 3WFBL 4F80A 1JUFA 4QRSA 2B1AH 1RJYA 1I8IB 2DN7A 4RGNC 4ZOCA 4WW1A 1G9ML 2R29H 1M1SA 1I1AA 4P4RB 4V1DE 4Q9QH 3BKYL 4E41D 4APQD 1O5DT 3EJYC 4NNXA 4ZFGH 2HTKC 1FNSL 2WMPA 4IOIB 5B38A 3ARFD 5IVZB 5HGHB 1KSRA 1VFAB 3DUHA 1XGUA 3LQAH 4OLVL 1FG2B 5DJ0B 4KQ4L 2OL3B 1ULVA 2DLGA 5LVEA 2JLLA 4PV9B 2AXJA 2EEDA 5INDA 1G7QB 2VLJE 1TNNA 4JZJC 1QACA 3SGKA 4RNRB 5CMAA 4Y5VA 4L8BA 4MA3B 5F6IC 3RPIB 1LK3H 2Z35A 4G6AD 3SJVA 4NNYA 3Q5TA 4WO4A 3ZDYF 2NY6D 3VGBA 4EQ2A 1YNKL 4PGEB 2PTUA 2P7TA 1J9CT 5E08L 3WO4B 1U3HB 3CSPA 2VRAA 1JHKH 4KUZH 2ATPA 4OUUA 1WIOA 4W70A 1OTTD 2VLRA 2DQHL 1BIHA 1NL0L 4PJFB 4FFYL 5D7LE 1PAMA 1A14L 3TPKA 1WC7B 3D0VB 5JPNA 1FZMA 2OZ4L 3BEWA 1IGFL 4UQ2B 3S88H 1ACYL 1N2RB 4AEIL 3OMZA 1WWWX 4NRZB 1IGMH 2CUMA 1UKSA 2QQKL 4JQXC 4KK8C 1UJ3A 5DMJB 3TJEH 3IDYB 4KK5C 1FAKT 2QADB 3MODL 2H26A 3FQNA 1ACZA 3O3EB 3CX5K 2F53E 4P4KD 5C0CE 4GUPA 3MLVH 5IJKA 1BF8A 5CWSB 3RWIB 1QO3A 4MWFB 5KSAA 2DLHA 4ETQB 5DMKA 3IJYB 5E5MA 3MNZB 2X09A 4PJHB 4O4YH 3KYOB 3Q1SH 5C3TA 3C08H 4ZS6C 5IR1A 3DIFB 1KUMA 1T5WB 2GSIB 3TIEA 4EEEA 4UIMB 1KNOB 1LILA 1T22A 5HXMA 3MUGA 4UB0L 2BVTA 3A6CL 3I2CL 1MCWW 3DV4A 3TCXA 4K2UL 5E99L 3CH8A 1VFMA 5DEZA 3WS6C 1R6VA 3T65B 3WHE1 3SKNA 5D2NC 2WLZA 2Z0BA 3ARYA 2P49B 3OXSA 5CJQH 5DHXB 4I48B 2Z31A 1E6JH 5H94A 3O6ML 1DEDA 5IROC 1V7ML 4P4RA 1VGEL 1TJHH 4LF3A 2X4RB 4XXDB 2W9EL 3FO2A 1CDGA 1PEWA 2GW5A 5IVZA 3TZVC 4MAUH 1VFAA 1WJ3A 1VPOL 2VDML 2DL9A 1J87A 1QA9B 2I27N 5HDBF 1NBQA 4S0SD 1PYWB 3ZKMD 5IBTH 5E6YA 1I1AD 2OL3A 3P4OB 1MAJA 1RZKH 2FEDC 3MV9E 5A43C 5HHMB 1WBYA 5BMFL 3TBWB 5C0DA 4NN7C 1JGLL 4MGXA 4TNVF 1G7QA 3RWFB 3I6GB 5DYOB 1AI1H 4RNRA 2CPCA 5CHNA 4UDTB 2DQIL 3RAJL 3QHTC 2P8PB 3SKJL 1WSST 4MJIB 4YGVA 2GYSA 5DR5L 4L8CB 4ZQKB 4JRXE 3BKCH 1CGXA 3GKWL 2I60H 5C86A 4EDXB 4HK3J 3CFJB 2ERJB 3N9GH 4PJFA 3TA3D 1U3YA 2X9XA 3PQYA 4XVSL 1P7QA 5D72H 3SJVD 5K59F 5C8JB 1N8ZA 1L7IL 1WC7A 4G6MH 1ZGLA 3RUGE 4WO4D 3NIGF 3SPVB 4ZSOA 5EU3B 3VFMA 2R4RH 3NCBB 3BWAA 3HNSL 4JFPB 3LPWA 3V5HB 1WTLA 1OAKL 5CSZA 4HV8B 1QZ1A 4LSQH 1IAIL 2VLMD 2DIJA 2VLRD 1T1XB 3QUXB 3SGKC 3CVHL 2BNQB 4Y5VC 4D9QD 4PJBF 1OY3B 1UM6L 5D70H 4UTBH 1TCRB 2A77H 2FO4A 4GLRH 4J3XA 2DLEA 1S5HB 3W0WB 4JHAH 4WO4C 1X9QA 2OJEB 1T04A 2AK4A 5F7LB 3FQRA 2C3VB 4ETQA 2OMBA 4UV4H 5KVEH 3MNZA 4LVHB 4PJHA 4GLRI 3KYOA 5HJ3B 1U93B 3KLAA 3LS4H 4HK3N 1S78C 4F7TA 2GSIA 3ZKQD 1U2HA 3E2HB 1MFCL 4UIMA 4BFGA 1GPOH 2NX5B 2DQEH 3DUSB 3FB6A 4XP1H 1UJ3C 3V7AE 4XP9H 5I1IH 4XBEL 5DMIH 1HYSD 3IDMA 4PS4H 5IVXB 1YEKL 5E2WL 3BKMH 3VXSA 2L7UA 1EZVX 5KSAC 2I24N 4JFOA 2ADIB 4PRHB 4G8IA 4HFUH 4I48A 3QHFL 1F58L 2X89D 4P48A 1D6EB 4I4WB 1MVFA 4Z7WE 3DSFL 3JV6A 4HDIA 1LWRA 3PGCB 5E7BA 3BE1L 3JSSA 4QRPB 5D9SB 2DBLL 4N8PA 1JHLL 4MX7B 3NTCL 3U0WL 2I9TB 3D85B 5EZLA 2YR3A 5IMLB 3P4OA 3L3IB 3U7WL 1FG9C 3TBWA 3KYMB 3EZ8A 4TPRL 5DYOA 5HDQH 2R9HD 2OXHA 2X70B 4UDTA 5DEFB 1HQ4A 4R3SA 1CD1B 4X6DB 2Z31C 4YIQB 5FHBH 4DKAA 3FT3A 2JJSA 5CIPH 2UUDK 1NMAH 1SYVA 3UJTH 5EBWA 5HI5C 5I1KH 4Z0BH 1S7RB 2VSCA 1UWGL 4O2CB 1R5WA 4M7LH 1MHEA 4YBQC 4PJGF 3UJJL 2ZNWA 4L8DB 4JFPA 2P5WB 3P11L 1B6DA 3DX9B 3V5HA 4OZFB 4JKLA 1UVQB 1RZIA 2B4CH 4HV8A 3REVB 1FVEA 1T1XA 3D69A 2BNQA 4Y89A 1T7XA 2F54E 5EOQL 4S1DC 5DI8A 1HEZA 1RZJC 2DQUH 1MSPA 1FNLA 3TO2B 5J56B 1CYGA 3W0WA 3UO1H 1SVZA 1ZHLA 2BVUA 1S7SA 1GYAA 4OCXL 4KTDH 2Y36L 3QWQB 4ZXBA 4P9HH 2FSEA 1RSFA 3QZWB 1KFAH 2FB4H 3B8SA 5TE7L 3RGVB 5E00A 1U36A 4G6JH 4ZOEA 1XT5A 4V2CB 5FKAA 4FNLH 3P0YL 3ZLQC 4LHJB 5JTWA 1OP5K 3DUSA 3I85A 4OB5H 1RJZB 1E27B 1CG9B 1JGUH 3T0DA 1GGIH 4V1DB 4Y8AA 1TJGL 4POYA 3S96B 4XNYL 2R4SH 1DE4A 4I5BA 3UTTE 1UG9A 3HB3D 1F5WA 4OAWB 3NZHH 3ULVC 1YY9D 3ETBF 5EA0H 5EU7E 4XAKE 4PRHA 2ZG3A 4UAOB 4Q6IB 3PHQA 4KUCF 12E8H 1XGRB 1X5XA 5KBNC 4JR9H 2XA3A 4ELKA 1D6EA 2VLJB 4I4WA 1JNLH 1V5JA 1UEMA 3PGCA 5LAXB 4XCYB 2P45B 4IRSC 2WLYA 4LSUL 3TH3T 2R1YA 3LMJL 3WIFA 1SEQL 2DD8H 1N5YL 5IB1B 1EAJA 2VDNH 3IGAB 4AG4H 4GW1B 1A1MA 3D85A 3M8OL 3UTPE 1RZ8B 3MRDA 2FZ3A 3KPTA 1CLZL 3L3IA 2E6PA 5GRVK 3RWGA 5BXFA 4HS8H 5D7LB 1MIEH 4GQ9L 4NCC2 4MNQA 1LE9A 4AL8L 2CDEB 2X70A 1F02I 1FVCB 3VFUB 3G6JA 3DETD 5IB3A 4PG9B 5CILL 5E9DE 4D0BB 4EN3B 3U6RB 2ZPKL 1F8TL 4Y19E 4JDZB 3RWCB 5HHMD 4EI5B 1CBVL 3DXAE 3DARA 1M05A 4G6FB 1KGCD 3L1OL 4FQCL 5F7DA 3BPCB 4O2CA 5DZLA 1RIVL 1QVOB 2F53B 2VYRE 4AIXA 1NAML 4L8DA 1LDPH 4MJID 4LQ1A 4ELMA 4M7JL 1D5XA 5IBUG 3LH2H 5FCSH 4RFOL 4P5TA 1ED3B 1INDH 4LLMB 5JOFA 1N6VA 1KJVA 3QJHB 4Q2ZB 4TNVK 5HDBE 3N1GC 5BQ7B 3LB6D 4YC2B 1R3KB 3VGGA 3MRGB 3OXRB 4OV5B 5HY9B 4WEMB 2EDDA 4LDLB 2R15A 5E6IA 4M1CD 1BIIB 3FFCE 4M93B 2NQCA 2FJFA 4LNRB 5HYSB 1R3IL 1EJOH 1KPUA 5LJYH 1EBAA 1CICB 2BNQD 4LGRB 2QTEA 1S9KC 1AHWA 5L2KE 3RX8A 4YDLB 3I02B 3MFFB 2NY3C 3Q5OA 3W0WD 3W9EB 1I3UA 1LD9B 5IFHL 4NZTH 1G6RL 3OJMB 4KMQA 5GRVL 2WUCL 2FCBA 2R0LH 1RJZA 3CVHB 1LVEA 4V1DA 3FAWA 2KPNA 3NIGE 2HJKA 2X44D 2DIBA 3OJVC 4B7LA 1CFTB 1DQDL 4L3EE 4RGMC 3QH3B 3VXPB 4OAWA 4OD1H 3CU1A 1U8NB 4PR5B 4E0RB 3GB7A 4PJBE 1EXUB 1JHTB 2DJ4A 4TSBH 4OM0L 1I7TA 4YNYB 4WW2A 1ZLVH 3MV9B 2ZKHL 1TVDA 4NC2B 3KHOA 4KRPB 4WI9A 4ZXBC 3FFDB 3AY4A 1BM3H 1FNGA 1JNHA 1MQKH 5LAXA 3MRIA 3LN5A 4PRHD 4OF3A 3RU8L 5T5NG 5HI3D 5I8CA 3VFRA 3CLFH 5KW9L 4GW1A 4JRXB 3M07A 2WIIB 2YA0A 3OKMA 1RD6A 1VERA 4PJDF 1TZIA 3L3HA 5I1LB 5CD3B 1NLDL 1F4YH 4MXQC 5BO1L 3VFGH 1AD0A 4XB7A 4MCYA 2MJWA 3RVTC 4IM8A 4U3HA 3MV01 1FVCA 3MLZL 3RUGB 4F7PA 1MHHB 5ITFA 1BQLH 1DQJB 3D85D 3G6DH 4PG9A 3UYOD 2L0DA 4JFZH 4D0BA 4ZFZB 3HPJB 4JDZA 4O9HL 2HT4D 4UU9A 1P5UA 2A74A 1N59B 3LKNB 2BOCB 1YEEH 3NOIA 4MNQD 1U0QA 5C0CA 1CGWA 1H5BA 1KC5L 5EOTA 3RKPA 3EO0A 5GGTL 1R3JB 3ARBC 5C6TL 1Q72L 5KS9E 2EYRA 1ED3A 3O3AB 4NZDA 4RWYH 1BMGA 1B6UA 2QKIB 3P3YA 4XMLL 4XCNA 4BSVA 4HG4K 4ONFH 4G42A 3EDEA 2IQAA 3QJHA 2AV7A 3MO1B 1MRCH 2XZQH 5IW6A 3HC0B 5HVGB 1H3UA 35C8H 2W59A 4N68A 1UZ6E 3VH8B 3PXHA 3A6BH 3P30L 3MJ9L 4KHTH 2H1PL 1NGYB 2H32H 3FO1B 1FYTA 3L5JA 3K4DA 4Z7VF 1J86A 4FHBD 3S3PA 5HYSA 5LWYH 2IBBA 4ZNCD 3SCMC 3U7AA 5IJVB 1AE6L 2KZWA 1A8JH 1OSPL 1KJ2A 4HUUA 1L0YA 2C4FU 5TQ0L 4Z7QF 4X5LA 3B2VH 2XQYK 3NCJH 2BCKB 2GEEA 4N8VB 4GKOA 4P5TC 1K3ZA 4P57B 4P5MB 2OI9B 3CX2A 1R3HB 4JFQB 5ESQB 4AENA 4PJGE 4LSTL 5DHVB 1F2XK 1P4LB 4MXVF 3UZVB 4LVNC 2XG5A 4Z7WB 1QR1B 1MCOL 2VTFA 4HC1L 5GJTH 5KANG 4S1RL 3RGVD 2D0GA 4Y4HA 5HHXH 5E6IC 4CU7A 1KF9B 3G5XB 4E0RA 3RPKA 1EXUA 1JHTA 3LKPB 2O93L 5E1AA 3KXFA 5F7UA 1T1ZB 4V1DD 4OGAC 5K9KB 4F2MB 1AHWC 2X5PA 3V0VA 3BPNB 5IB5B 2Z4QA 3HZKB 2OYPA 4Q74A 4BQ9A 3VXMB 2XN9A 3WE6A 2EXWC 4JQIH 4CNIB 4RDQG 4D94A 3MRBB 3KG5A 1G7HB 1GSMA 1CXHA 4Y4KC 4PJAE 1G9EA 4G6KL 5I9QC 4JRXA 4M6OH 2WIIA 4PJXA 2VR4A 4NKOB 5C3LD 4OZ4B 4M5ZL 3TN0B 4AZ8A 15C8H 2VLJD 1Y0LB 5I1LA 2FX7L 5DQ9B 1QKZH 4MNGA 4NNPL 1PBYA 3QYCA 4JKWA 1T2QH 1TCMA 5D7IF 2DJUA 1QP1A 5EN2B 1I9JL 3HR5B 3RUGA 1D7FA 3TVMA 3EFFB 3MYJB 5A2LH 4EDWL 4WW2C 1DQML 4ZFZA 2BRRH 4ONHB 5C0ND 1E4WH 5FV1L 4BSWA 4Z0XA 3MLTB 4XC1L 1IMHC 3IF1A 5D7LD 3CX5J 3T3PE 2R8SH 2BOCA 1JK8A 5DFVC 1WAAF 4TUKH 1T1YB 3HC3L 1NBYB 5TF1L 4XMPL 1R3JA 4YAQA 4MA7H 3QO0B 5AYQA 4HH9B 3RKDC 1F4AA 1LO5B 2QKIA 1C7TA 4EI5D 1KCRH 4P9ML 5AEAA 2ID5A 4G6FD 5FA3B 2A6IB 3QXUA 4N0CD 3RL2A 3FQXB 4D8PB 1IC5H 5FFLA 5C0CD 2AAVA 3PNWB 3DPBA 3HI6H 3VH8A 4I77H 1KEMH 1S9XB 2CK0H 1MCNA 3KPQB 4YE4L 4PLJD 2KUTA 2LVCA 4WI4A 2YEZB 5IEHA 3QWOB 3B9EA 3NA9L 1VFUA 3FO0L 3UTTB 3WFHB 2HMID 1NAMB 1NANH 3G9VA 1XF1A 2VAAB 5JNYA 1RURH 1HKFA 5ETUB 5L0QC 3C5JB 2CMRH 4Q6YA 1AFVL 1I9RL 5J9PB 2XY1A 4JFQA 1MFBL 2XRAH 4XCFH 4DEPB 5I73C 5J3HD 1XGYH 3SE8H 2EECA 3EYSL 3GM0A 1QR1A 4Z7WA 4P2RA 5E0QA 3CDFA 3LV3A 1JF1B 2EDXA 1NLBH 1AXTL 3FCTB 2XFXB 1EFQA 1HH6A 3NACH 3G5XA 3JWNC 3UBXA 4WHYG 1UXSB 3K81A 4MJ4A 3KYKL 2R39A 5I1HL 2FBJL 3WKMH 1AIFB 4H88H 1M7DB 4R0LC 2J8OA 1XH3A 5KJRL 2BX5A 2ORBL 4HS6B 4M6NH 5IV2A 3R0MA 4JN1H 4WI8A 5IB5A 1A9EB 3NPSB 4Y4HD 5B39B 3GIVA 5EOCL 3DROA 1ZVHA 1PLGL 3IFPA 5EZIL 1A0QL 1G6RB 2XWJB 3KAAA 4CNIA 3BIKB 2R29L 2GI7A 5E9DB 3MRBA 4Q9QL 1YQVH 4R7NA 4Y19B 5DD1H 4KJWD 4RMRA 3BEVA 1C08A 4U05A 1HHIB 3DXAB 4KRPD 3FL7A 1RUPH 2UWEA 5HD8D 2XN9D 4YBLB 4JGJA 3GMRA 2Y23A 4BH7B 1KN2L 3OKOA 1ONQB 4HKJA 4H25A 5F1IB 2ZSVA 5JLZB 2ICCA 4JRXD 3RVXD 1B2WH 1YY8A 4TOYH 3OV6A 3JWDL 4K3JH 3S6CA 5I30H 2AV1B 5ELIA 4KI5F 1I7UA 1CGSH 2XQBL 3P73B 2FH6A 2AKRA 4FQ2H 2F8XC 1YJDC 3HN3A 1C5BH 5F1NB 5T33H 1BZ9B 1RK0B 2F54A 3CVIL 5IB4B 1IFHH 1Q9WB 3TYFA 4POZD 1T1YA 3STLB 5DD5L 3TNMB 3JTSA 2E7CA 4N1EA 3DX6B 4B0MM 3FQUA 2IF7A 2JF1A 3FFCB 1BQHB 3ARSA 4KUZL 5L6YL 4KKLC 4CMHC 1K2DA 2APXA 2Q87A 3KPOA 4ODWB 4TTDC 5FA3A 5L2KB 2VOTA 1K4DB 5M95B 4P2YA 4PJDE 3PNWA 3VG9B 1N64H 3TVMC 5JHLL 3IFLL 1NQBA 3RVWC 4UIKL 2CKBH 3O8XB 5GS2H 5D93C 5CZXC 4PJ9B 3ARGA 3GZKA 3CSGA 3STBA 2GCYA 4OBSA 5DRZB 1G84A 3QWOA 3MRJA 5DVKA 1MCIA 3MLVL 4QEGA 4L3EB 3WFHA 1NAMA 3GSQA 4J1UB 5IMOA 5DO2D 3B4NA 3FB8B 1UB6B 3V52H 5ETUA 2VSDA 4PJBB 4ODUA 3VFWB 4HZAA 4LPCA 5ESVA 1CGYA 5GGRY 2VL4A 4G5ZH 2GTWA 5TPWL 1SBSL 2ZUTA 2VUYA 4P3CL 3WO3B 5FB8A 4LLDA 4FZ8L 5GRZA 1NGZB 4HUNB 3VWJC 1QBML 4BH8A 3EUUA 4PJCF 1SBBA 1T66D 3FCTA 3FB5B 5FV2A 1J5OL 1NEZG 4ODXB 1N26A 1QSEA 2BVEA 1AIFA 1K6QH 4ALAL 1ZXQA 5F1KC 1CGUA 3OKKB 3ZTJG 1NFDF 2LABA 1F6LL 2BVQB 4NZJA 5CJOL 1CDIA 5EIIB 3VFVA 1CDUA 4Z7VE 4HS6A 1LEKA 4HQQL 3BN3B 5I1CH 4NDMB 4JO2L 3C9NB 4KJPD 3VA2C 5FGCE 2XI9A 5B3JF 1S7XA 5A16A 3GBNH 1EJ6A 1ITCA 5CBAA 2XWJA 1G6RA 3HS0A 3LRSA 3EKCA 1YEFH 4Z7QE 3VDCA 1XEDA 3W2DL 4ESKA 3CXDH 1XR9B 3M45A 5GGUB 3BN9C 4B5EA 1HHIA 3DJ9A 4N5ED 3IKKA 3RNQB 1FGVH 4MAUL 4KQ3L 5EO1A 4KU1A 5CEZL 1ONQA 5KS9B 3WCYA 5MP6L 4HBCL 4S10A 4PJ8B 1AI1L 3TN0D 5DT1H 3P73A 1IGCH 4N5EC 1J0KA 4JM4H 3MZGB 4G8EB 1BZ9A 4KWUA 1KCVH 3C8KA 3LPFA 5IFJA 2WK2A 3QQ4A 3UCRA 4AIZB 5J11B 2V5YA 3MROB 1BECA 3WUZA 2F74A 2FJHB 1BJ1H 5J6GA 2I60L 3U9UA 2CKNA 3RJQB 4ODTL 3R1GH 4K7PY 1URLA 5IT2H 5CLWA 1WTGT 3N9GL 3OB0H 4ODWA 1A6WH 4UILL 2CDFB 5EU6E 3F7VB 2F54D 2WQRA 3BPOC 2EYSA 4Z7UF 1QYGH 5L2KA 3LSOA 4XH2B 2R4RL 4GKZA 4XCCH 4OFPA 2EICA 1WEJH 2Q6WB 5L88H 4KK6D 3S37H 5D7IE 4KZEH 4PJGB 1AJ7H 5ADPL 1MPAH 5JIKA 3MCLL 1INQB 4UTBL 2A77L 1DLFH 5DRZA 3L3KA 4XT1C 3QA3B 4JHAL 5SWQB 2NTFB 3GMPB 3DSNA 3NPZB 1T2JA 4GKNB 3ARUA 1BGXL 3FB8A 4UV4L 3VI4E 4LK4A 2IH1A 3RL1A 5FCUL 3ARGD 2I5YH 5A2IH 1OB1B 3T0WA 5CZVH 2DOCA 4LCIH 3RY6A 3ZYJA 5EBMB 1A6AB 3MLUL 3GK8H 1NGZA 4NCDA 3UTTD 1AP2A 3DRTB 5MI0B 3MJ9A 1L0XA 2M26A 2V2TB 3BZEA 2YD9A 5HYQA 1HZHH 1H3PL 4XP1L 3TO4B 4NQCE 3R8BB 5ICYB 4PFEA 4PJAB 5I1IL 4OCMC 4QRRB 2BY0A 3GJFK 1C5DA 5F70A 4JKPL 4FABH 3MOBH 1DBKH 3BKML 5L2JA 1E6OH 1Q9LA 2EDBA 2H3NB 3LKOA 5D1XC 2Q7YA 4HFUL 3T2OA 1KN4H 3F65A 4WI5A 3WHXB 3MV8E 1FE8H 3MJ7A 1MCPH 3GRWL 3UTPD 5TDOA 3QEGL 4WFHE 2YZ1A 3HFMH 4H20H 4NHUB 4DJMA 4E42A 3GUTB 1WBXB 4U1MA 5K9JL 3TJHD 3HCVB 3VCLB 3N85H 3QUMA 3MV7A 5T1LB 4IEFB 5EUKA 2VDPL 3QPXH 3U30B 1KPRA 4JLRB 4ZUSB 5E9DD 3G5ZB 5KS9A 4M00A 4U3CA 4QHLA 4Y19D 5E56A 1CQKA 5KANI 3AGVA 1KPVB 4PJ8A 3DXAD 4QXUH 4GW4A 4OI7A 1FH5H 1HKLL 1A4KA 4JB9H 5FHBL 1PG7W 1OM3L 3VXQB 2VDRH 2XPGA 3AU1A 3UTSE 1FZOB 4BKLB 3PWJB 4QF1A 1TXKA 1HINH 4XPBH 4GAYB 5TE4L 4LLAA 4Z0BL 2VR5A 4M7LL 2X4UA 2UZXB 5DJCA 2YD4A 2CDFA 4UT9H 3BUYB 4LEOB 4M3JA 4XH2A 2EE3A 2LAAA 3HAEH 2NNAB 4JPWH 5ACZB 3S5LB 3FOLB 1CTOA 4NBXB 4U1LB 2B4CL 2R1WB 3WFDL 2XT1B 3HMXH 5FAAA 2IPUK 1CT8A 3KPRE 4HX1A 4KVCH 5ANME 2HVKB 1YNLH 4N9OB 3BJ91 4QHMA 4U6HA 5D96C 4XVUC 1JZ8A 2ZSWB 1J0HA 2ITDA 5IB2B 4YUEH 3ORJA 5L2KD 3UO1L 2YD6A 1REIA 1NJ9A 1J18A 2LAGB 4PBWD 4KI5E 3MSPA 3BD5A 3WFCH 3TLRA 2AI0H 1ZGLM 5DD3L 3O8XD 4KTDL 1G6VK 4LPYA 4O2EB 4PJ9D 4PTTB 4QOKE 2P48B 3ZYOA 4P9HL 2Y6SC 4JE4B 2FB4L 3MLWL 2ZOKB 4UNUA 2J5LC 3BHBA 5F96L 3QIBC 3EYUH 4I18A 4N1CA 4FNLL 3T8XA 3C87A 2Y72A 4J6RH 1NBVL 2H8PB 4OJFH 1LO4H 3TIDA 5CBEB 1IVLA 4PJAA 5E8OB 3Q6GL 2IWGA 3BGMA 2DLIA 4XNXH 5EPMB 3NZHL 5C0BA 2JCCF 2WBJB 1JPFB 2Q1EA 2ZCHL 1C12A 3MX0A 2H3NA 2J4WL 2OJZH 2C3HA 4QHKI 3WDIA 1WGOA 2C3GA 4NT6B 3WHXA 4JR9L 3O4OC 5DHYA 1BOGB 3JVGC 4LU5L 1YMHA 5E8PB 2R1XB 5HVHC 3WFZA 4PP1D 3GM8A 3HCVA 4LOUD 3VCLA 2YRLA 4M62L 1F97A 4H8WC 2EXYD 2APFA 4L8SC 4LHQB 4J3OC 4HG4J 4DW2H 4KY1H 4PUBH 4PRAA 3QEQE 4HS8L 1NFKA 4PJCE 3IS1X 1DUZA 3LVEA 4KAQL 4FG6D 5IEKA 3RY5A 4KZDL 2E3VA 4PJDB 1X5AA 5DVOA 5BCAA 2IFFL 4RGOH 5CP3H 4U1GC 3D1MC 4GBXC 1G7MB 4JGMA 5KVFH 2NY1B 1HNGA 3BWUC 1NCCH 2JJTC 4I3RL 2G2RA 4R2GB 4PJ8D 1GZQB 1GC1C 4NP4L 1HWHB 4KK9C 3L7EA 4ODSH 1LDPL 1RAMA 2ICEB 1EHNA 3BUYA 4LCCC 4X6CA 3LH2L 3BZFB 3V6OA 1HI6A 5ACZA 3D6GA 3TBTA 1MJUH 3BP5A 1A7OH 3VXOB 3D3VE 2QLVB 2ZSWA 4MAYA 3QNYA 4OZHF 4JVUA 5JHDA 1I8MB 1I8LA 1S7WA 3Q3GA 1EJOL 4OCSH 4KROD 5ID0B 5J12B 2AJSH 3UC0L 3L5WA 4LSPH 4HUXB 1F3RB 2VC2L 2VUOA 2ZG1A 4NN6C 3TBVB 3L5XH 5JPMB 2OS7A 2JIXB 3RJDA 4PTUB 4Z7VB 2PW1B 4IOSD 3PUCA 4ZPTB 1W8OA 5I18L 1CDBA 4Y16B 3IRPX 5FGCB 2AEPH 2DQTH 3PWUB 4ZAKB 4ODVL 3O2VH 5CBEA 4C56E 4EUPH 4LBEB 1T21A 3H7BB 3RDTA 3LKRA 4XX1G 2IMMA 3RZCA 1PKQA 4X98A 1OVZA 3QO1B 3CC5B 3MLXH 1ND0B 2SEBA 5HHVH 1J1PH 4JY5L 3OAUL 2W38A 4JVWA 2CSPA 2C3XA 2WZPD 4NT6A 3MACH 3TO4D 3ECBB 1GGUA 1BOGA 3TFKD 5BRZE 3VXRA 2VKXA 2ZP0T 4W6WB 5BZDA 2DDQL 2VZ3A 4GMTL 3ESUF 2DICA 1BM3L 2F8VA 4DK6A 5E8PA 2R1XA 5C0BD 1V7NL 4I18C 3VG0H 2X4PB 5MERB 3EO9H 4F9PA 3NABH 2W9DL 2LE9A 5EOCJ 5DJZA 4R97C 4C4KT 4HWBH 4DN4H 1HHJB 3T2NL 1DQLH 2ENSA 1RQ5A 3U4BH 5KTEH 3NAAL 5GRWA 5DK0B 3O11B 3VGDA 5B8CA 3KPSE 4KXZI 1QLFB 3VFGL 4XWGL 4L5FH 4WHCA 1WWAX 3PJSB 5EU6B 4YHML 2Y07H 4NUJB 3HRPA 1XGQA 3JUZA 4KUCD 4X80H 5F6HI 4MQ7B 3BH8B 3OTTA 4LVOB 5INCA 5FYKU 5T1LD 4JFZL 1TVBB 2PCPB 3CMOH 5HHNA 1BEYH 3S4SB 2A83A 1ADQH 2YUVA 3VFPB 3M17A 4RIRB 3WO4C 1U3HC 1CIUA 1VKXB 4B53A 4FFVD 5D7IB 3FQTB 3D18A 1DZBA 3WLWD 4U1SA 1UZ8B 4FMKA 4K7PL 4U7KA 1C5CH 3CUPB 4J3SA 4M61A 1TJIH 2EIEA 1PEZA 2ICEA 1ZA3A 5F7EH 2OK0H 4M4PA 3VGAB 5MHSE 2AJYL 2WM0A 3AMKA 4ONFL 4I9WE 5E2UH 1QSFE 1P9MC 1FQ9C 5A3ID 3I50H 1FNEB 3K2UH 1F90H 1H8NA 1XF2B 3KWWA 1A9BB 2CUHA 2AJZB 1JF6A 1DL7H 5DZOA 2QADC 1NBZB 5DJAA 4KHTL 5I15H 5CIPB 1KBGL 4W68A 1I8MA 4HAFA 5FO7A 4AH2B 4G43B 2A6JB 4XBGA 3TCLB 3MZTA 4DGYL 5ID0A 4NQCB 3Q48A 1MFNA 1JWMB 2E27L 3QDAA 4ZUWB 1H15B 5IQ9B 4X83A 1ZAGA 4CAGA 3LQAC 5JPMA 5HGDB 2CGRL 4NQEA 4Q9BA 3V6OC 1IL1B 2HG5A 3GJFB 5DJXB 3CFDB 4LSRL 3MV8B 4F7CB 5JW4R 4FXLA 1CI5A 5I1DB 4LBEA 3AS0A 4MAYC 2N7AA 4JVPA 4IDJH 3KLHC 1WIUA 3IETB 3QO1A 1FJ1B 2I07A 2B7DT 1PVHA 1QFUL 3BQUB 4L1DA 3BDXA 1I7ZA 5J89A 2AABH 4K3DL 4HKZB 4LLYA 3DLQR 2XKNA 5E2JA 2EDWA 4KJYB 2EZ0D 1I3RB 3ECBA 3WNOA 2VNCA 4UI2A 3UAJC 1IKNA 3RZCD 3ARWA 2AGJH 4NQVA 2OTUA 3UZQA 2CRIA 2E7LC 5E2TH 2CLRA 5ILTH 5CKAA 3O6KH 4XP4H 1FSKB 4LLWB 4Y5YA 3HLAB 4K94C 1F00I 3T0VA 4O2FA 1UH3A 5DQJA 3WFEL 4M6OL 3UTSB 4I3GA 2XTJE 4Y5XB 2OTWB 3T4AB 2FX8H 5KSBF 3RDTC 4D9LL 1G9NL 3GSXA 4P46A 1QLFA 1QKZL 5ICXB 4JHWH 3RQ3A 1QRKA 1JTPA 4WENB 32C2B 3FOMB 4NUJA 1N6QL 1HHKB 3O41B 1NMCB 4K8RC 5DQDL 2LU3A 2HP4A 2PCPA 4QHKJ 1FAIH 3S4SA 5JIIA 2ESVE 2K7PA 5C0JA 2BRRL 1ZT1A 2JCCE 3QUYB 1E4WL 3VFPA 3BGAA 3GI8H 3WUWB 5ANMB 1VKXA 4D2NA 2R8SL 4OD2A 3H3KA 4NFDA 5GGQH 2MHAA 4F9PC 4PREB 1DSFH 2ARJA 5CSBA 2GK2A 4NQSA 1IAMA 1VCAA 1KLUB 7FABL 5CEYB 1YZZA 1KCRL 5B8CC 3PP3K 3HUJF 2NY1D 3MXVH 2LV4A 2B39A 3DV6B 4DKDC 4QOKB 5DJ2B 4R2GD 1FNEA 5MEOB 3QUXC 1IC5L 4XNMB 5GJSH 1DN2A 4LCYB 4YHIB 5DFWH 4YXLL 1RZJH 1P4IH 3HI6L 4GS7C 1VSCA 4I77L 1KEML 4JY6B 4WNQA 4AYFA 4JO1H 5CIPA 4Z78A 3SE3A 1TZHA 1R5IA 5D1QB 2A6JA 3AXLB 5BW7A 4JY4B 4NO3B 3PWLB 1EEYA 1JWMA 3WKNA 3S8WA 2RJMA 4CU8A 4ZO7A 3EYFB 1RURL 5DC9B 3K46A 1RZKC 3E2HC 2R23A 5D8JH 3EJZC 5GS3A 3BRDA 3WS3A 1II4E 3CFDA 5LGJB 1KELL 3ULUF 3LEYH 3QEHB 2MPAH 3GMLA 1AC0A 2JIXD 1QNZL 5CS7A 3ULVH 4NZRH 2A1WH 4LRIA 2AK1H 3GJEA 4MA1B 4Y4FB 2NW3B 1FJ1A 2EIZB 5DEGA 3BQUA 4ZAKD 3ARQA 3WKML 4H88L 5GS0L 3MMEB 1G7IB 1O7SA 4KJYA 1YNTB 4OZHE 2PXYA 3ZSTA 3QEQB 5GGRB 2A6DB 4PJCB 1MWAH 3EHBD 1MFEL 1TITA 2BHYA 3BZ4A 4JAMA 3SGEH 2WSKA 3M1BA 1AGDB 1FV1A 4LLWA 2BNRE 2G9HB 3MV11 5CP7A 5AZ2H 4PYGA 4MD0B 3UTSA 4Y5XA 1DVFB 2F9BT 4NZUH 5T5FL 2LTQC 3PE9A 3B9KB 3KS0H 3KPMB 1WCBB 1WFUA 3SDCC 1YYLL 5HYEA 3QEUB 32C2A 4FQPA 4RAVA 4M02A 5HYJE 2H6PB 1OAUL 3O41A 3IJHB 2OR7A 5JDSA 3WN5B 1B2WL 3H3BC 4TOYL 3GI9H 4LDOB 5I30L 1SYSA 1DLHA 4XVTH 2E9JA 1UGNA 1IKNC 1BD2E 4ODHL 3KPRA 1JGEB 1Z2KA 2Y5TB 3WNKA 3D3VB 1KB5L 3VFTB 4HWZA 1EAPA 4WI2A 2DQFA 4Y5YC 4TTGA 4YO0B 2XZAH 1KLUA 2YA1A 4XPFL 5CEYA 4EI6A 4GRMB 3VXNA 2YMXH 2HTLD 4YR6B 1A4JB 1S7UB 1IKFL 4P46C 3O6FA 1B88A 3TBSB 2Q8AL 5MEOA 4PV8A 3IVKA 4RX4A 3GMMA 4DVRL 1X5FA 1UACH 1TPXC 4MQXC 1CXFA 5FM5O 1IQDB 3TM6A 1KCKA 5TFSL 5F6HJ 2CKBL 5ACLA 5L9DH 5C1MB 1OF2B 5K33A 1ROWA 1CDJA 3MRMB 4RSVA 2JJWA 4M48L 5F1SA 2J3SA 4IOFD 4LIQH 1ZWIA 2EIBA 5C0GB 1HHHA 1RK1B 4OQTL 2QSTA 2BHUA 1S7TA 4I2XE 5TE6H 1WZ1L 3HI1A 1DDHA 4G5ZL 1B0GB 4NQCD 1XIWB 5BRZB 5LGJA 4QYOB 4U1HA 5EUOA 2OR9H 5AYUH 3QEHA 2FBOJ 4JPIA 1P53A 4JFDA 3TPUB 3V2AR 4AM0B 3LIZH 3NA4A 4JZOB 4Y4FA 2RQ8A 3SE3C 2XWBB 2O26U 1BJMA 3GSNH 3P4MB 5FYJU 3SDAB 2JK5B 2E7BA 1K6QL 2O5XH 3EOBA 4NKDB 4YFLF 1UQSA 2LU7A 4WFHD 3KPSB 4MHHG 1MY5A 1JN6A 3N50A 2XZZA 4PJCA 2WUBH 3MRLB 3ILQD 5F97E 1T89A 1B0RB 3BQUD 4OIIL 2GK0B 3MBXH 2C9AA 4E5XA 1GJIA 3CXDL 4C83A 1N3NA 2QEJA 1I3GL 4MD0A 1D5BA 3ZT7A 4JFEE 1Z9MA 4GRWH 3S3SA 4QWWD 1YECH 4WGVB 2AEQL 1ETZB 1RU9L 4ZTPL 3B5GA 1YN6B 3DVIA 4QCIA 5FA4A 5A2FA 3ILQC 3QIUA 4CN6A 3KJ4C 3CFEA 4NJ9H 1JYXA 3CPLB 4IRJB 3UTSD 1LEGA 2FL5A 1OPGH 2K7QA 4X7CC 3GSOA 1FN4B 5I75C 2DQGH 2PXYC 4KKCD 5DT1L 1JGVL 5F9JB 2G75B 1QSFB 2KH2B 3HR6A 1ZHNB 2PYFA 1NMBL 4JM4L 3V4VH 4K7PX 1JGEA 3NCCB 1KCLA 2NY4D 2DIAA 2W0KA 3D3VA 2PO6B 1I1YA 1ORSB 1JPSH 2IANA 3P2TA 2DTML 4MJ6A 4PD4K 4YO0A 1X5GA 4QXWA 3R1GL 5CZKA 1U8JB 3BPLB 1L6XA 5IT2L 1ZS8A 3LHPL 3QPQD 3QUYD 1U41A 3QCVL 2X7LA 3KPRD 1A6WL 4YR6A 5D7JB 3O4LA 1R3LB 4H0HB 3TBSA 2NY4C 1H9VA 4KVNH 3ARPA 4NUGH 2DAVA 4PGCB 4U6VL 5KSBE 4YC2C 5DMGC 1JPGA 4GQPH 5C0FA 3NCYS 4KI5D 4X0KB 1JWUA 4M93C 2EH7L 1OF2A 1AJ7L 1OTSC 3HNTL 1MPAL 4TUOB 4YK4C 3D2UB 3MOAH 4C56A 1GZPA 4RX4D 1WK0A 1Z9OA 1RIHL 4FP8H 4DN3H 3DNKA 3SO5A 3VMPA 4DGVH 1S3KH 4Y2DB 5E5UB 1D5ZA 3H9SA 5D1QD 3KVQA 1QHOA 1OTUC 3MJ8A 1A7QH 1IC4H 4LCIL 4X6EB 3O6FC 4XPAH 1CFVH 4F7MA 1S7VA 2DMKA 4LRNH 4YEEA 3V6FB 1QFWM 3HUJE 4P5KB 2H32A 3D39A 3IDUA 3OHXB 1QBBA 5IK3A 4HLZG 3VRJB 2XTJB 4PJ5A 3T3ME 4NOBA 2XTLA 1HSBB 2ZUUA 3BI9X 3KPSA 1UC6A 3MOBL 1DBKL 4L9LA 3TGXA 1N0XL 1E6OL 1BBJB 3SEPA 1TETH 4S1SH 4UOW1 4P23A 4EVNB 4Y4FD 4EOWH 5IF0A 5FDWA 4L4TE 1B0RA 3SOBL 1FE8L 2YD7A 1MCPL 3D5OF 1DUYB 2ESVB 2JCCB 4OBRA 2P5EA 1F11B 3U79A 3IKCB 2P8LB 4XXCC 2J8HA 4PJEF 1ETZA 1WFOA 4YWGH 2IQ9H 1J1OL 1P7HL 1AGEB 4GSDH 3CZFA 3N85L 1RJCA 4K7FB 3QPXL 4JO4L 2FECL 2WV3A 4OGXL 3FRUB 1KCUH 3CPLA 3VXUA 1IM9A 4IRJA 3WL9B 1JTTA 2C5DC 2R0WH 2VZ1A 4F7EB 1YMMA 2C1PB 2EE6A 5FM5M 5F9JA 2QHRH 4QXUL 3G04B 1ZT4B 1ZTXH 1U8PB 3EYOB 2EE2A 2B8OT 1G0XA 5GHWL 1F42A 2PO6A 1GVIA 3QIUD 4G7VH 5I16A 4RISL 3PP4H 3EAKA 2NYYD 5F9OL 3MPCA 2BSSB 1TTFA 1W0YT 4XPBL 1JYWA 1QPPA 1YC7A 4YHPB 3HE7A 3LRGA 1QG3A 1T6VN 5F9WB 3C2AH 3D3VD 4ZPVB 2V5SA 5GIRA 1NGQL 4JJ5B 4OTXH 2A9NH 4RGNE 3ZYIA 3F5WB 2P43B 4DUVA 2ZUXA 4Z6AT 2E9BA 3BIBX 1CL7H 3IDGB 1Q9OB 3ARVA 3HMXL 4X0KA 1EUTA 5E4EC 4PB9L 4UUJA 3R4DA 1YNLL 3DMMB 4TUOA 1KB5B 3AFLA 3AREB 3BDYL 2EH8H 4BM7A 2VQUA 1TZGH 4RAUB 1RY7B 1O0VA 3WFCL 1A1NB 2VR9A 4HKBB 5E94B 2HA1A 1QFHA 2OI9C 4JQVA 1QTYT 3ZHDA 2VABB 3ULUL 3HRZB 5GSVA 4HIEB 4C56D 4M3KB 2HLFC 4FQJH 4X6EA 2ZOLB 4OZHB 2HVJA 1FGNH 1L7TL 2ZUQB 4J4PC 1MNUH 3GMOB 3VDBA 2VZUA 5ENWB 2CKBB 1IBGH 2BNRB 3KDMB 4U1JA 1LO4L 3H9SD 4XP5H 1MOEA 4U2ZA 3VE0B 1IQWL 3L3JA 5JDJA 5KOMC 1DQQB 1V3KA 5BVJB 4U33A 1XIWD 1SMAA 1MJ8H 2HWZL 4K3EL 3CCHA 4MMXC 4QY8A 5DUPH 2B2XL 5T3XL 3UYPA 4OLZL 4U1KA 1CFBA 1FL5B 2X40A 4R96B 1BBJA 3BVNA 2OJZL 3VJ6A 2EDOA 4ZODA 1QSVA 5BJTB 3MUJA 5LGHH 1QBLH 5HYJB 1GH7A 5I8EB 4S2SA 2QQLH 2W60A 3SDYH 4PJ5D 3L5HA 4Z5RA 1DUYA 1I4FB 2ESVA 3CSYA 4YHZH 4PJHF 1PZUB 4W4OA 1B4RA 3KPSD 1W0WA 1BD2B 2JB6A 4Z76A 4M8QA 2P8LA 4LAJH 4RMWA 1XF4B 5E6ZA 1AGEA 3INUH 3ZT5A 5FF6B 2HJLB 3FQWA 1NCAH 4TUJB 1JGDB 2I9LA 3QG7H 3WD5H 1K9TA 3KJ6L 4PUBL 5ICZB 3FRUA 4EBQL 3CDGB 2YSSB 5J6HA 1FYHB 1KLGB 5EG6C 3CFBB 3E8UL 3G04A 1YQ2A 4N0UE 3MTRA 3EYOA 3VFNA 4P23C 1NKOA 2DWDB 1BLNB 5GQBA 2QJDA 4RGOL 3HI5L 3C6LA 9CGTA 4JN2B 1D5IH 1F45A 4IRJD 5MHSD 5D2NE 4I9WD 1T0NB 2I25N 3MRHB 2Y5EA 5HGBA 1FO0H 4HPYH 1GXEA 2PO6D 2WNGA 4JJ5A 5GSRB 2MQ3A 3C60B 2VWEC 5AWNL 3JTTB 5C2UB 2NY2C 5I1EL 1IAKB 5JZ7D 1NCDH 4I2XB 5EU4B 2RBLA 1N5AB 3HE7D 1HQRB 1A7OL 4Z77B 4DVBB 1G7LB 5D7JD 4KTYA 5C9JB 3DTXA 5KVMC 3UZEA 4WUKH 3AREA 1R24A 3QFDB 1SQ2N 4FXGB 3UDWC 4OCSL 4JO3H 4DKFH 5DDHA 3HE7C 2YPKB 5H8DA 4F9LA 4HIEA 3D2UD 1LO3L 4DEPC 2HH0L 5SWZB 4NN5B 3QUKB 1CXLA 2BVPB 4MS8D 1PKOA 1CF8H 4J23A 2VDOH 2AEPL 1MH5A 2R2CA 2DQTL 1AKJA 1MVUA 3I75A 1OP3K 1GGTA 1QRNA 2CKBA 4LSSH 2BNRA 3RA7L 3KDMA 3VW3L 1MEXH 4OCRL 3MJ6A 1T7VA 1OP9A 3X13A 4N5UA 2K1MA 3H9HB 1DQQA 4Z7NF 2W0FA 5D71L 1I9IL 4WHTB 4FQXB 1BAFH 4JFEB 3OKNA 4YHYC 3S98A 6CGTA 1QQDA 4MDIA 1M7IB 4MS8C 3RVVD 3ES6A 4R96A 5F1OB 4MDJA 4D9RD 1ZSDB 1ZHBB 1U9KA 5TGBB 1C16B 2FECI 5BJTA 4HHAB 3HG1E 2RFXB 5JW3L 3MACL 3U2SA 4JDVA 3IXTA 2QL1A 4R7DA 4JQVC 5E4IA 5JORB 2YPLA 2XTJD 4HIHA 1T1WB 1RVFH 1U91B 1INEH 1FZJA 1NCWH 1BD2A 1XGPB 3HZVB 1MFDH 3NABL 1CVRA 1FFOB 1XF4A 5SX5H 3TEUA 2GJ6A 4XNZC 1BQSA 4NGHH 5TH2A 2VLRE 4DN4L 1S7QA 1DQLL 1JGDA 1MJ7H 3U4BL 4H1LB 4TVPH 3ZSSA 3FAXA 2ESVD 4AQOA 4YXKL 2K3TA 5JO5B 4BQ6A 4L5FL 2YSSA 1CN4A 2BSRA 1CXEA 3MRKB 1T83C 2GJZB 1NKRA 4X80L 3VMOA 4PPTA 1P2CA 2FWOB 1ORQA 4XWOC 1U8OA 1BLNA 5KSBB 5C2BH 5GS0D 5JOEA 4MHHI 1JYNA 2Y7QB 1K5NB 1MRFH 2C7UB 2V9TA 4P2OC 1NDGB 4W4OC 1T0NA 2IBZY 3BT2L 1QLEH 4BYHA 2AJXH 5FUOH 2V2WA 3QRFM 3GMNB 3FB7A 1SJVA 3LEXA 3OAZH 4LFHD 4CVXA 3UPRA 3KNBA 1KENL 3S37X 5E2UL 4PJEE 4X7SL 1N5AA 3I50L 3JWOL 1A3RH 1HQRA 1JP5A 4WDIB 3UYRH 3ARDB 1OAYL 1MI5E 4M7ZC 3UTZB 1F3DJ 5I2IB 4GG8A 2V2XA 3V6BR 1GOHA 2O61B 3SY0A 3T4YB 3H3PH 3HUJB 4FXGA 5DRXB 3G6JF 1ZLSL 3C6LC 4XNUH 2O5YH 4N8CL 4ZFOA 4GRLC 3V0WH 2BNUA 4LLQB 4FQQB 4KJQD 4L3CB 2X4OB 3BDBA 3DMMD 4ZOBA 2ILLA 1A7BA 3O45A 3QUKA 4J7RA 3ARED 3HAEB 2BVPA 4Z8FH 3B43A 4RMSA 3KPNA 3QCUH 2HT3C 2RCSH 4ELMF 5IW1A 4OZGA 2YD3A 2XWTB 4L4TB 5I74B 5AD0B 4MB5A 4PP2B 3TWCL 5IHBA 3QBTB 4PLKD 4DKEL 1D5MA 4RMQA 4RFEA 1QFWH 4GXUM 1ZEAH 2EYTA 5SV3A 3FT2B 1W2KT 3SDDC 5J57B 1M7IA 1BBDH 4N0FB 3V7MA 1MCWM 1AKJD 4I0PA 1RZGB 5GS2D 1C16A 2BNRD 2AABL 3W11D 4Q0XH 1M6OA 1GL4B 3PG2A 5LCVH 3V6ZA 1IAOB 4QTIL 5K93A 4L29A 3RY4A 3F7YB 4Z95H 4F9LC 3Q5YA 3DVNB 1U92B 2D4FA 1JYVA 5E2TL 4LHUB 3HZVA 3O6KL 4I1NB 4XP4L 4G80A 3ZKSD 3EYVA 2NXZB 5EZJA 1OGAB 4YQXL 1KIQB 2DWEB 3QDJE 5HYJD 1FIEA 2BSED 1A7PH 4HLZH 4JRWA 3PQYE 2DRUA 4ISVB 1JPST 1CGTA 3GEWB 1Q0XL 3TH2T 3Q0HA 4ZSOE 1JJUA 1BD2D 4NO2A 2YRZA 2VQ1A 2BC4B 1IZKA 3NIDE 1LGVA 3MRKA 4XPHL 4F8QA 1CFNB 4NRYB 4RGNB 2GJ6D 5DTFB 3ESVF 4YHNB 5KN5B 3SO3C 4PJ7A 4U6XA 4BZ1H 1OAXL 1KEGH 4WW2F 1NDGA 2P47B 2FJGB 1AQDA 3MRRA 1IGYB 2CJUH 5JUEL 2AK4E 4ODBD 2XZCH 3FHAA 4NPYB 1RZ7H 4HGMA 1C8PA 2XXMB 3GSWA 4O02L 2NY7L 4KMTH 2M2DA 1WCQA 2OL3L 3HMWL 1D9KA 4KKBD 4R4ND 1Q8MA 4JZJB 4I8DA 4ZS7H 5F6IB 2IEPA 1JIBA 3ARFB 5C92A 5HPMA 4MLSA 3SN6N 3UTZA 1KG0B 2PW2B 1RZJL 1P4IL 1U8IB 1A7NH 4G9DB 3MLSH 3S9DB 1BX2B 3PWPA 1OT2A 4LASL 3SKMA 4JO1L 4P2QA 5FM4A 1RHHA 4YFLI 4XRCA 3KLDA 4YDKH 2HFEB 4LLQA 4TN9A 3VXSE 1VESA 5I8KL 4JPVL 1CLYL 2F58H 4LAQH 4CJ0A 4KHXH 4DZ8A 1HCVA 3VXTB 2GJJA 2ZCLL 4PGDB 3ROLA 3ROOA 1GGBH 1VFBA 3DRQA 4JKMA 4U7MA 2VITB 1MY7A 3G5VB 1J8KA 3X12A 4PP2A 3CXHK 2NY5H 5F89A 1MJJA 3KR3H 3EYQD 3MUY1 5DGRA 1DEEB 1Q94A 3ZT6A 1GIGL 4IS6A 2MQ0A 3QQNA 5FOBB 2R0KH 1F13A 2A1WL 4NZRL 3A6OA 2FIKA 1Q9KA 5CCKH 1T3FB 4N0FA 3DOSA 2BFVL 3O0RH 3UXFA 4NKQB 2E8YA 4HIXH 1D3CA 5KVGH 2XICA 1IAOA 1X6NA 4P59H 1AD9B 1MWAL 4FQXD 4JFED 5ADOL 1JI1A 2ZZUT 4IMKA 4N0UB 4LHUA 1FFPA 2ARJQ 1C1EL 4PD4J 3X3GH 4NO5A 2NXYC 4CJ1A 2UY7A 4H8WH 4X4YA 3P9MB 2FD6H 4EUPB 2CXGA 1MFAH 1RIUH 3EDDA 4POUB 1K4CB 4Q7DA 4NZUL 3WBDA 4LIQE 2CD0A 2ZNXA 1ZKAA 1JVKA 4OZFG 2JB5H 3BUTA 5I76B 1UXWA 4S1QH 5D2NB 5EWIL 3WXWH 5EFIA 3I3DA 4QXGL 4I0PC 5GZOC 4Z7NE 5DTFA 4KPHH 5D1ZA 3GI9L 3OPZL 5MEQA 1AY1L 1SHMA 4XVTL 1NSNH 4RFNC 1SEBB 3UEZA 4MNHB 4ZO9A 2VQTA 1GC1H 3TZVB 2ADFH 3CFCL 3MLPA 3QZWG 5E8NA 2IADB 4N0RA 5ERWB 4NN7B 1PQZA 1QFOA 1N7ML 3RWEA 4PGJA 2G5RA 3PIQB 1NC2B 4PJXF 4KRLB 3MUZ1 3V4UH 5ALBL 5CUSH 4HS3B 4WU7B 5GGSA 3T08A 1UACL 1JUFB 4QRSB 5C09A 3AMLA 1I1AB 2PYEA 1D9KD 3RUGF 4K9EL 4GRWE 4NNXB 4XX1E 3E6HA 2QR0A 5C0RL 4H0IA 1YPZA 2AQ1A 1I75A 3HE6C 5B38B 3DGCR 4LIQL 4WEBL 3ARDD 4WTZG 1RUKH 5BOZG 3GHBL 4EZMA 5DS8A 5GS1A 2XA8H 4OIAA 1NCBL 3PWPD 4BFIB 1BZ7A 4XB8A 5KG9A 5LXGH 5CD5D 4P2QD 2YUZA 3VXTA 4HIJB 4XPTL 5INDB 4A6YH 1JRHH 2IMNA 3SGJC 3HG1B 2VITA 3G5VA 3RWHA 5CMAB 4Y5VB 4X5WA 2Z35B 4F58H 4NC0B 4IIQA 4XAWH 1WFNA 2E8ZA 4CADA 1HXYA 3UPCA 2OR9L 4WO4B 1N6UA 3WYRA 3BAEH 1EGJH 3RTQC 3WXVH 2P7TB 4LNVA 3LIZL 2WBJC 3MREA 1T3FA 2ATPB 4OUUB 3D0LA 2R2BA 2VLRB 4L4TD 4MSWB 3SKUD 1OW0C 3DYPA 5I71C 5JPNB 1B0WA 1FZMB 1B4JH 3ZL4L 3BEWB 3G6JE 3Q2CA 4UTAL 4K23H 4O51B 4N0UA 3MLYH 3U48A 1NEUA 3MBXL 2PETA 1UJ3B 1B3JA 4JM2C 4A2MA 1K4CA 2H26B 3MJGX 3FQNB 5F7HA 5J13B 4X4ZA 4GUPB 5I76A 2VERN 1QO3B 5KSAB 4LHUD 4Z7WF 1YUHA 1UB5A 1G0DA 5E5MB 2NXZD 2HFGH 4OFVA 1GHFH 3MRPB 1RUQL 1OPGL 5EZOL 2VXQL 3SQOH 1JL8A 1ZVSA 2BDNH 4PJEB 5HYSG 5IR1B 3QFJE 1E28A 3OKYA 4UNTA 5EC2A 3TIEB 4GKSB 1MI5B 1ES0A 1T22B 3FMGH 5BV7C 1NEZA 2ATKA 4RGND 3V5KB 4ZDHA 2VZSA 4RWHA 4HWBA 3TESA 5GISH 5B21A 5E70A 3QHZH 3E3QC 3EJYD 4JKKA 3QNXA 2HTKD 5DRWA 3NBNA 1NC2A 4OLWH 5GRYA 1OCWH 1FP5A 3NCEB 1U6AH 1T03L 4WU7A 4NUGL 3OKLB 2UWEF 4K3GA 4WCYH 2Z31B 3IU4L 5H94B 2GTZA 1CD0A 5FXCH 5D1ZC 4HKXB 5KVDH 1ADQA 4LF3B 2VXSL 1KJ3L 3FO2B 4R90H 3MOAL 1KT2A 2FYYA 2G60L 2WINB 2DLFH 4FP8L 1Z0MA 3QI9C 2VE6A 4LQFL 2WBKA 2DTSA 4BFIA 4D0DA 1WBYB 2PYED 4HIJA 1UYWH 5C0DB 3NZ8B 3NCFB 3EW3B 3FKUS 4X9FA 1SJEA 3EGSA 3HA0A 3HG1A 5D7SL 2EKSA 4ERSH 1NGPH 2IPTL 4W81A 5CHNB 1IGJA 2C26A 1UA6L 1F3JA 4YGVB 1MHCB 3MC0A 5DD6A 3DI3B 2HN7B 5B3NA 2PF6A 1A5FL 3LDBC 3QDJB 4KK8D 4QO1A 4MSWA 4OUOA 1OSZA 4KK5D 3PQYB 1M71B 1P7QB 2P44B 3FZUC 1N8ZB 3LN4A 1ZGLB 2D7TH 5GS1C 4ZSOB 3VFMB 5IVNA 1TETL 2IG2L 3QUZC 3BWAB 2AXGA 4MVBC 2J6EH 4O51A 2BJML 3B6SB 5CSZB 4K94H 3AUVA 4TQEL 4XVJL 2X6MA 4OZIE 4IIQC 4OD3L 2FO4B 4PB0H 4ZS6D 4PGBB 3QXAA 3BMVA 1MLBA 1DFBL 3DYMA 5FYKE 1B9ZA 1T04B 1ZHKB 2AK4B 2DQCL 2GSGA 1IJ9A 3FQRB 2OTPA 4GSDL 7CGTA 5IHUH 2UY6A 2AJVH 3I6LD 2APTA 4K8RH 2DJSA 3VH8G 4XPGH 4HJGB 1OOAA 3MRPA 2A9MH 2Y1VA 2R0WL 3KLAB 4NWUH 1CWVA 3IU3B 4PJEA 1MWAB 2QHRL 4DCQA 5I17A 4F7TB 3T1FA 2X42A 4GKSA 2CK2A 3V7AG 3BKJH 5HYIA 1MI5A 2ADJB 1FYTE 4G7VL 1GGCH 1BHGA 5KSUA 3OJDB 3HHRB 3FB6B 3V5KA 1EHLL 1MF2L 3U0PA 2VDQL 4N8VG 3GSVB 5ID1A 2KQMA 3IDMB 2X4TA 2VXUH 1Z3GH 3VXSB 3C2AL 1X5KA 4JFOB 3TZVD 2C1OA 4OTXL 1V3JA 3OKLA 4G8IB 1IM3A 2DLTA 4FQ1H 2GY7B 1CL7L 5C7XH 3AROA 5DSCA 2FEDD 4HKXA 5HDLA 4K71C 2W65A 3N0PB 5JOPE 1N4XL 3JV6B 4HDIB 2D9CA 4GAJL 1NC2D 4N90E 2WINA 1CZ8L 4GOSA 2P1YA 4XHJC 1T7WA 2EH8L 5FYKL 1TZGL 3KXFE 5EZLB 5FIEA 1PX3A 1P4BL 2FRGP 3NZ8A 4AEHL 2ZJSH 1J12A 1MUJA 5I1JH 1FGNL 2XN9E 1NCNA 4HT1H 2AVGA 3GO1L 3I3BA 1HQ4B 1MNUL 4R3SB 1MHCA 1A6UH 1VENA 4LEXL 3X3FH 3ZYZA 4H26A 2XACC 3MRFA 4BZ2L 3FT3B 2X4NA 2HN7A 3DX8A 4PJXE 1WBZA 2O5ZL 1SYVB 4XP5L 2CQVA 5EBWB 2YKLH 1U58A 3HG1D 3QDJA 1RUMH 3VGHA 5IESH 4MNGE 1MJ8L 1R5WB 2IH3B 1KJ2L 1I9EA 1MHEB 3CK0L 5DXWA 1M71A 4QXTB 2NY3B 1LMKA 4K3HA 5I6XC 4M7KH 1FFNB 4WWKA 4UINH 3AS1A 4XBPA 5LGHL 4WJ5A 1RZIB 1H3TA 3B6SA 4XMKH 3FTGA 4KTEH 2QQLL 1JI2A 43C9B 1FVEB 1HIML 3D69B 5IOPA 1FL3B 2Z8SA 4C4KO 1I1RA 2C3WA 5DI8B 1HEZB 4PGBA 4JRYA 1S78D 1KJMA 1E4XI 4OCYL 1B90A 2YUWA 3SE9H 1ZHKA 3INUL 1CDCA 4YEFA 1MHPL 2DKMA 1ZHLB 4HPOH 3S97C 4ZYKA 1S7SB 5FHAL 1P6FA 3NMEA 3ZHLA 1PSKH 5IKCA 1G9MH 4HJGA 5ESAA 4ZXBB 2FSEB 3IU3A 1MWAA 5E00B 1YJDL 3MOQA 2F5AL 4QGTA 5FKAB 4IRSA 5KSAD 1YYML 2IC2A 2E9WA 4FFZH 4NHCL 2ZCKH 4XTRC 2ADJA 3P4NA 3NFPA 1XGTA 3OJDA 4OLVH 4PRDB 1ZANL 3DVFA 4KQ4H 4LVEA 3MCG1 2W07A 3GSVA 1A7RH 4GRWB 1DE4B 1H8OA 1WUNT 4I5BB 4OZFH 4BJLA 5SWSA 2ZWLT 1WQVT 2X41A 1Y18B 3X11B 3E1F1 1EH9A 1MI5D 5LKNA 4HMDA 5FO8B 3PHQB 2DI7A 1OLLA 3OAYH 3OJ2C 1YNKH 2IAMC 4ELKB 5F7KC 4W6XB 5E08H 5F71A 1YEDB 3GHEH 1HHGA 3CIQA 4LLUA 4GXVH 5KS9F 4P2RE 4PIRF 1P69B 2DQHH 1NL0H 2GHWB 1N0LA 2R1YB 3WIFB 1UCTA 4JREC 1LE5A 3JV0A 2Z31D 4J8RA 3ARBB 1A1MB 2OZ4H 1IGFH 4TVPE 3ALWA 5IMMA 3MRDB 1ACYH 2FZ3B 4KH2A 1HCFX 5B39G 3EOTL 1UZ6F 1LDSA 3RWGB 4UT6L 4OLUH 5BXFB 5HI5D 4M1DH 1W0VA 1L9NA 4MNQB 1LE9B 4YHOH 4YBQD 1F4WL 1ZLWK 4HJJL 3G6JB 4N0YL 1JCKA 1CF8L 5IB3B 2D2OA 4LMQE 5L8LB 4UQ3B 4XI5C 5JR1L 5DGQA 1AXSA 3SCMB 2QQQA 1DP0A 1TQCC 5M94B 1M05B 2NLJB 2UWEE 5F7DB 2EEBA 2IH3A 4S1DD 5LQBL 4QXTA 4ELMB 1LEIA 2QSCH 1WZLA 1X4YA 1D5XB 4PY7A 1FFNA 4P5TB 3O2WH 2X1XR 1J10A 4NWTL 5JOFB 5H35B 1KJVB 3OB8A 1AGBB 3QDJD 43C9A 3FN0L 2PTVA 1BVLA 4F33A 2VDKH 1FL3A 1BQHG 3I2CH 3PQYD 1P7QD 4LVNB 3QFJB 4K2UH 1DVFC 1XF3A 5E6IB 3BW9A 1OAQL 5CJBA 2FJFB 1NAKL 2HFFA 1KPUB 1YEIL 5IHLB 3GSNA 3UTQA 1MJ7L 4LARH 4HXBL 4Y0GA 1P84K 2OP4L 5DJDA 4TVPL 3EBAA 3O6MH 1F4XH 3MBEC 4PRNA 1KIPA 1AHWB 1V7MH 4H5SB 4YHKH 1J8HA 1ITBB 3GNML 4M1GL 4PJAF 4OGYH 4RRPG 4YFDB 4ZO6A 3ULVD 4BUHA 2MKWA 2AK4D 4WWKC 2AJ3B 3IAGC 3ZO0A 2IBZX 5EC1B 5C07E 5E5RB 4Y4KB 2AEIT 3H42H 5I9QB 3REWA 3G08A 4PRDA 2HJKB 5TJWK 4Z18A 4HULB 43CAB 4OLXH 1OWRM 2PUQT 2AJXL 5FUOL 1Y18A 3C5ZC 3F6LA 1XR8A 4IRSD 3X11A 3LCYA 3GB7B 5KAQF 2J8UA 1VGKA 3RAJH 3T3PF 2D7PA 5FO8A 4LGPB 1I7TB 3HKFA 5DR5H 2CO7B 4B41A 4WW2B 3CXHJ 3QQ9C 1YEDA 3WHE0 3GKWH 5EORL 1FNGB 1JNHB 4EIZC 2X4QB 4LPXA 2KDGA 3VXSD 1VEOA 3MRIB 3LN5B 4XVSH 5E1HB 5I8CB 1L7IH 1QSEE 3VFRB 3H3PL 3ARBA 4G3YH 3OKMB 4XNUL 3H2WA 3HNSH 1TZIB 3L3HB 4WTXA 5FM8A 1OARL 2Q8BL 4NJAL 1AD0B 3CSBA 4WI6A 1IAIH 1CE1L 1P1ZB 4MCYB 4PLOB 3CVHH 5GZNC 4U4BA 4F7PB 4WV1C 5ITFB 5FYJE 1RPQA 4ACPA 4UQ3A 1KTKE 4X6CF 1IAII 1KYOK 2YN5A 2IGFL 4UU9B 3SCMA 2EDJA 2A74B 2HLAA 3RX7A 3SDAC 2NLJA 5IP4A 1KXQE 1QFWL 4OZIB 1ZEAL 5TDPA 4HEPG 3NFNA 2A0LD 5C0CB 1F6AA 1H5BB 5EOTB 2QSVA 4OSUL 3EO0B 1U8QB 2EYRB 5L0QB 1UM4L 3FJTA 3K80A 4HJ0C 1MFCH 1MELA 4XCNB 3THML 4BSVB 5H35A 4Q0XL 4G42B 2IQAB 2AV7B 5I73B 1AGBA 2FX9L 5IW6B 4I0CC 4Z95L 4LCWE 3STZB 3QFJA 4XBEH 2A0LC 2NY3D 2IALA 3CLEH 2OQJA 3IFNL 4I3SL 5E2WH 1FYTB 2V17L 2WQ8A 2LFGA 1S8DB 4XNQB 1A7PL 4MXWL 3QHFH 4CVZA 5I8OL 3S7GA 1KJ2B 1MCHA 4HUUB 1F58H 1KACB 5K9QG 4HGWA 4H5SA 4QTHB 2NPLX 4LPWA 1ZMYA 2XQYG 5TQ2L 5CGYC 5I66A 2AJ3A 2YXFA 4FFWC 1K8DA 2DBLH 5EC1A 5C0AA 5FYJL 4AENB 5IBLC 3NTCH 4Y4KA 2RIKA 3DVGA 3EOAA 1EO8L 1UM5L 3BD3A 1KEGL 43CAA 1X5HA 4ZXBD 3U7WH 3EFDL 1Q0YL 1G9NC 2VLLB 3PWNB 2XZCL 1OAZL 4TPRH 4Y4HB 1BVKA 3GBLA 2AW2A 4NKMB 2QHLA 5DVMA 5B4MC 4OF0A 1BF2A 1EFXA 4YDIL 1JZ6A 4KMTL 5E1AB 4F8TA 3KXFB 1VADA 2MCG1 4JFHE 3V5DB 3QDGA 1X5ZA 1EK3A 5ITBH 2APBA 3V0VB 5CFHA 4MXQD 2D03H 4HCRH 2Z4QB 1NC4B 2X4QA 2XN9B 4ONGL 3RVTD 3MLSL 1DBBL 3WE6B 3DUUA 4DOHE 2Q3AA 3UJJH 1CR9L 1NPUA 3SKOB 4PJXB 3BFOA 4Y2DC 1TQBC 1HDMA 3P11H 2PR4L 5EULV 4MNGB 1FNHA 4QKXB 5DHVH 1XCQB 1P1ZA 3WLBA 1JFQL 5T1DL 2VLKA 4FTVA 5EOQH 4DWHA 2BZDA