4Z0XB

Structure of hepatitis c virus envelope glycoprotein e2 antigenic region 434-446 bound to the broadly neutralizing antibody hc26am
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
b'VQPVQSGAEVKKPGSSVKVSCEASGGTHSNYVITWVRQAPGQGLEWMGGFIPDFRTAMYAQGFQGRVTITADESTSLAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGPGTLVTVSSGST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody HC26AM light chain variable domain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of Hepatitis C Virus Envelope glycoprotein E2 antigenic region 434-446 bound to the broadly neutralizing antibody HC26AM
rcsb
total genus 20
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2015-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0xB00
1YMMB 1UB6A 5DMYA 2FX9H 1QFOA 1D5BB 3QSKB 4QHMA 4OSUH 1A7BA 1KT2B 2DIAA 4P3DA 4PRID 1WAAF 2CDGB 1MCLA 2W9LA 1HIMH 3VW3H 1FYTD 4ODHH 4JANB 1WF5A 3EFDH 1E6OH 4QWWD 4S1DD 4HMDA 5E4EC 4X9BA 1X6LA 3BH8B 1KN4H 4Y5YA 1UB6B 2PYEE 3HC4H 4X8XA 5DUBA 4LEXH 3MJGX 4IOFC 2DKMA 4QXWA 3M8OH 5J7CC 3K1KC 5B8CC 3KXFB 4K71C 4NGHH 3NCEB 3OR6B 4FQCL 4GAFB 4WVRA 5HI5D 1QBML 3SOBH 4QCIB 1FCGA 1JI2A 3OZ9L 3P4OA 3QXDB 1MVUB 4MNHA 4R3SA 3ETBF 2UUDH 4JM2C 4QT5B 3SGDI 3W5NA 1VFMA 4UU9A 1MH5A 1JP5A 2VXQH 1BJ1H 1QRNE 3FO2A 1FZKB 4QTIH 2OXHA 5FIEA 3L5IA 4YDVA 4K8RD 3VGDA 8FABB 1PBYA 1ZS8B 2HVJB 4JPKH 2L4OA 5T5NF 1BIIA 4OFKA 5GS3A 5I1LA 3RKPA 1F90L 4KH2A 4R3SB 4ZUVA 1AO7E 5HHQB 4LPXA 1MI5D 3U82B 3DX7A 2EICA 4O02H 4DAGH 1FIEA 3KYNB 4CVXB 1L4IA 2EYRB 4U3HA 1S9YB 2F58H 2OTWB 4MLIA 3BP6A 2DQGL 4X6CE 3TLRA 5I73B 1ZWIB 1ODAA 3PQYE 5EU4A 4JG1H 1O0VA 2OSLA 4XH2A 1GVIA 4KVNL 4EN3B 4P23B 3VFWA 4U33A 4JQVA 3ZKXB 1KPUA 3CFDB 4P2RA 3OV6A 2ARJB 3WUWB 3KVQA 3FRPA 3L7EA 5L6YL 1KB5A 3MLVL 1F6AA 2HWZH 2OP4L 5BZDA 4JEGB 2YN5A 4HUWA 4L9LB 4LLYB 5FDWB 3RWDB 4V2BA 1WZKA 1ZSDA 1CICC 5CSZB 4XT1C 3QH3A 3V5KA 4FMFA 3QNYB 2IQAA 4JB9L 3QCUL 4NQED 1L6ZA 3I50L 1PSKL 3SDXE 2F54E 1PZUB 5KSVB 5C7XL 1FLTX 2AW2A 4W70A 3D5OF 4RBPH 5CHNB 2AGJL 3OF6A 1DTUA 4LCCA 1CIDA 3T0EE 5DHYB 5IGXL 2YUVA 1E4WH 2Y5TA 1FN4B 3RPKA 4YZFF 5D8JL 4QRTB 4FQJH 3MLWL 4JKMA 4RGNE 4NUJB 5CD3B 5EFIA 4Y2OA 5J06A 1CS6A 2VLLB 1EVTC 1P1ZA 3VFSB 3DVNA 3ULVE 2EYSA 1GGBL 4U1IB 4BJLA 5C0JB 3IDGB 3GO1L 4KHXH 4RQQB 3ZE1E 2J8UA 4MJIE 4DKDC 1FLRL 3UJIL 5GRUH 3S37X 5D2NA 1AO7B 1HOCA 4XP5H 4Z76B 1HEZB 2V17L 3UBXI 4JZOA 4OLEA 3LSOA 1NUGA 1BPVA 4P2OB 1D9KD 3AAZB 2DQIH 2X89D 3ZDZF 3V6ZA 2J8UB 1IAOB 3DPBA 3JV5A 4N8PA 1GPOL 4CAGA 2HVKB 3VFUA 1S7TA 3CVHH 1HQ4B 2WUCL 3SKUD 1NDMA 1RZ7H 1V05A 4MD4A 1J11A 1NLBL 3T2PA 2BNQA 5GJSL 5DD1L 4LMQE 4OLUH 1DCLA 1B90A 4XCNA 3MJ8B 4UB0H 1RULL 3QFDB 3GI8H 4OGAC 4PY7B 3UX9B 5T5FH 2PR4H 3MLXH 4LK4A 1S5HA 2G5BA 4MXQD 5B39A 3PWLB 3EJYC 3ZYZA 1CFQB 2ADIA 2X44D 1H8NA 5HHMD 4HUMB 4OFVA 2GFBB 2A6JA 5I8KH 4ZMAT 1R0AL 3S96A 3SDDC 1NGXA 3KLAA 3DYPA 2WWKO 2P24A 5GJTH 1QSFB 3GHBH 4HAGA 5M95B 5E8EA 5FV1L 3E8UH 3QFJB 2NW2B 3KDMA 4M62H 1YEIH 5IW3A 4F33B 5IBUG 1RZKH 3LQMA 5HHMB 4HHAA 3F6IA 5EZOL 5ACMA 2LAAA 4O2CA 2A0LC 3LN4A 5JZ7D 1MWAH 4LLQA 4PJ9A 2X1XR 3RKDD 4WIQA 2R56L 3B9DA 4OF8A 4PYGA 1DDHB 3O2DH 2R29L 1U92B 1JGUL 2RAMA 1EK3A 2PW1B 3ARZA 1U3YA 3FN0L 2ZCLH 2PETA 2OR8A 1X5YA 3S34L 3MNWA 1TVBB 1FFOA 4OZIF 5FKPA 3H9SA 3RVUD 1DBMH 1WBYB 3T3PE 4K7PX 4HCRH 3MRCB 4QXGH 2AJSL 1IKFL 5E2UL 5DEFA 3TT1L 3CMOL 4JFYB 1W0WB 3QI9C 5CKGA 4R8WH 2H6PB 3TESA 2PW1A 5IJKA 5E9DB 3QWQB 5IF0B 5SV4A 5JO5B 1K6QL 4W4OA 4YQXL 1XF3A 4E5XA 5KANG 1QR1B 2OMBA 4LBEB 4XNQA 2JJVA 5DEFB 5MEOA 3UTPE 2XZQH 4TUJB 3OG4B 1VEPA 1WUNT 3WJLA 3QG6A 1UXSB 3GSUA 4MXVE 4D9QE 3F7YB 4PJ5B 4M7JL 1D5ZB 5JO5A 3T3ME 1NBYB 4UTAH 1K3ZA 1AQDA 2V6HA 1JFQL 4JFZL 3S37L 4RRPG 1UQSB 5T1KB 4IIQB 4D0BB 4LDOB 4OZIA 4BZ1H 3UTSE 3ARGC 4PRBB 4X7DC 2R2BA 3WFCH 3ZTNL 1WVZA 3PGCB 5HYJD 3HG1A 4Y1AA 3B43A 2BVOA 1FLRH 4RGMB 3QFJE 2YMXL 5CZXC 4H8WL 1BGXL 3GIZH 4G42A 3GO1H 4KHXL 2LAGB 5SX4I 3ZDYE 1XGPB 4ZO7A 1S7QA 2A9NL 4FFYL 1N6VA 4J1UA 3HCVA 4OV5B 4K3JH 1FO0H 5CD5D 4KJYA 4MVBC 1EFQA 1EJOL 4HV8A 1CF8H 4LHQB 4P0DA 4G6KL 2YA0A 4ZQKB 2OYPA 1FJ1B 4YXKL 3PGCA 1CTOA 4UIKH 3ILQC 3RWCA 3RWGB 3HNSL 1S7VA 1A7PL 1Q9LB 3FT3A 5DQDL 4WGVB 5DUPL 3VFGH 1NMBL 2GT9A 3HRZA 5ESVB 1WFNA 3WFHA 4EDXB 1RQ5A 3BO8A 3DMMC 4OLVL 3EYSL 4R7DA 4QYOA 5IVXA 3UXFA 3G5YB 4M7KH 1T66D 4KC3B 4MX7A 1MAJA 4X7FC 2WINA 3CCHB 4G8FB 4OCXL 3J8F7 4PGDA 4MJ6B 5FOBB 3MRRB 4NRYA 2OZ4H 1NAMA 4PRIB 3FT3B 3VD7A 5DJ8B 2DJUA 4PJBE 3OGCA 5CJBA 1D5MA 1LQSR 1SVCP 3VFNB 3VWJD 4L9DA 4OIBA 1FGVH 1G7LA 3REVA 3X12B 3C60B 3BGMB 2DWDB 3MLUL 3N50A 4AIOA 4NRYB 3ZTJH 2X5PA 2RQ8A 3H3BC 5DVOA 4XP4L 4MCZB 1IFHL 5IHZB 4YHNB 1UWGL 2HT2D 5C71A 2BCKA 3KXFD 1LE5B 1MFDH 3M1BB 5I8OH 4Y0GA 3KPRA 2VDQH 5JXEA 5KSBE 5J9PA 3GI9H 1Z2KA 3TBTB 1NSNH 4Y16A 3I75A 3O2DA 5HPOA 2JK5A 3QQNA 4UV7L 4U05A 3K2UH 4ZUWA 2DWEA 2Q3AA 5EUOB 4Y88A 1WITA 4WO4B 4YHYB 1LEGA 1JTOA 1CZ8L 1T4KB 4KK5D 1NMCB 4ETYA 4K94H 3DVGA 3IS0X 1RZIA 1HZHL 4HJ0C 1F4YH 4XMPH 3BI9X 4IRSA 2QTEA 2W1NA 5D96B 4X7TA 3RL1A 5HDBF 5D7IE 1YNKL 3MACH 1VHPA 2QKIB 1P7QD 1DUYB 3G04B 1T3FB 3SE8H 2V5YA 3GMMB 3Q0HA 3RNQB 1BP3B 3GFUA 1MY7A 1OTTD 3HE7A 5D9SA 2BVEA 1XR9A 2PO6C 4F57H 1YN7A 2V7NB 3BUTA 3TWCH 5D7LD 5FOJA 4M9OA 4Y4KA 2VLKD 1WBZB 4BFIA 3B5HA 3CDGB 5I9QC 3TYGH 3GSNB 4FZ8L 5C0CB 5KSAB 15C8H 4GJTB 5TPWH 1JGDA 5ALCL 5E7FA 1I9IH 5F44A 2DQEH 2VLMD 5MEPA 2JJTC 1WIOA 5HHVL 2X05A 3T08A 4NKOA 1GL4B 1L6XA 1LO3L 5EULV 4MS8C 4H0HB 4JN2A 4JY6A 4XNXL 5EOTB 2VDMH 4QRPB 3MRMB 2YPVL 2E3VA 3KXFE 3GRWH 3JWNC 2A74B 3QIUB 3RDTC 4QTIL 3SDDA 5J1TC 5JTWA 5D2NE 4C56E 1XFPA 1FORH 3TT1H 3GJFK 5C0ND 4WU5A 5FCUH 1H3VA 3MFFB 4KROD 2IBZY 5C0BD 1OARH 3BJ91 4JREB 1FO0L 5DMIH 4JDZB 4L1DA 1Q9WB 4TUKL 3V0VB 4C58B 3FN3A 3TA3A 2FJGB 1I4FA 3QDMD 3O8XA 1QSFD 2IAND 1RZJH 2GAZB 2VLLA 4WW1A 3CLFL 3LPFA 5EOCH 1A1NB 4CMHC 3R8QA 5C86A 5I8EB 4NJ9L 1B9ZA 4GW5A 4BZ1L 1A6TB 5DHVH 4ENEC 1EHAA 1FIGL 1PZ5A 2NY5H 3VA6A 1NGWA 2G2RB 4YHKL 1I7UA 2R9HC 3OXSB 3VXTB 3C8DA 2IJ0C 4D3CH 1V3JA 1M7DA 1BREA 3KYOA 1LK3L 5DLMH 1HEZA 1FVCB 4G6FD 5JQHC 5DZNA 2ZPKL 4MJ2A 4JCLA 3FQWB 1QUNA 3LV3A 1YQVH 5ISZD 1IAOA 2C3GA 2YHGA 3VXSB 4RAVB 1MFAL 4XPBL 5DRXA 2DAVA 4HT1L 5I1HH 4X99A 3HE7D 2UWEF 1W0VB 4NGHL 5DDHA 5GS0L 3MBXH 3ULVC 4LMQI 3FO9A 1P4LA 4C59B 2G75B 2AXJA 3QQ4A 5J1AA 5CD5C 2NY6C 3ZHDA 3ARDA 4Y19D 2R0WH 3P3YA 3HC4L 3A6OA 3MRDB 2FEEI 5ID0A 4E9LA 4LF3B 5DF0A 5GHWH 5JPNA 3LZFH 5I30H 4ORZC 2FNBA 4GXUM 3DUSA 4YC2B 4M6MH 4O58L 4FQIL 4R0LA 4EXPX 1A14L 4OAWA 4KWUA 4RNRB 4CMHB 2R69L 4UNTA 3O4LE 4JFFD 1ZLSL 1EPFA 3W82A 3VA2C 1VGKA 1PG7X 4QXTA 3UTPD 3MOAH 4KJPD 1IVLA 2AXFA 1U3HC 4MQTB 4OJFL 5F6IC 3TH4T 3HZYA 2GW5A 2J2ZA 4PREA 1V7NL 3CK0H 3T1FA 2ADJA 3BD3A 4I2XB 4HIJB 4TUOA 3W9EB 4PJGB 1MCPL 4Q0XH 3LRSA 4ODSH 4HMEA 5EBWB 4RFOL 5GJTL 1IEHA 2R1XA 1WFUA 4OCYH 1BX2B 3CFJA 1NC4D 5IROA 3ES6A 1VA9A 3MLTB 2CGRH 2ZCHL 1KJ2L 3PGFH 3RWEB 3BP5B 1ZLSH 4MWFB 1U8NB 4ZOBA 4LP4A 3ULUC 3O11A 1OAQH 1G9NH 2EDXA 2F5BH 3DMMA 3EYUL 5AWNH 3SO3B 2XXMB 3H9SB 2A73A 3FJTA 2H3NA 4Y2DB 5D8JH 1A9EA 4P4RA 2E6QA 2ZKHL 2FX7L 1KLFA 4U31A 1IAKB 1IM9D 1JTPA 5EBWA 2IMMA 3QULB 4JKKA 4I0PA 2Y07H 2NY0B 3L9RA 3PWJB 3RL2A 3C6SA 2BNUA 5DZLA 4X5LA 4MQ7B 1CVSC 1FH5L 2X4OA 4OLYL 2AK4A 3B2UC 1WWWX 1WWBX 4TTDC 2CRYA 5CGYC 1N7MH 3MCLH 5GRVL 3W0WD 2A73B 2AEQL 4IM8A 4XP6H 1AC6A 4E42B 3IJSA 3ZKNC 2P8PB 4CN1A 1X5JA 3SKMA 1EFXB 5KVDL 5B38A 4LKXB 4FXGB 5HXMA 4XVSH 4MAYA 3C6SB 2DOCA 4EBQL 1E4KA 1OP3H 5C2BH 4CN4A 2WNGA 3F7YA 3JWOH 1UXWA 5H94A 1RJZB 2PXYC 4WHDA 3B9AA 5JR1H 1UCTA 2VXTH 3MGTA 1I1AC 1YEJH 4FN0A 1SMOA 4MNGA 1KB5L 2VISB 4F37F 3QT2A 3WNLA 5IOPB 4JDTH 2XG4A 3ZYOA 4PJAF 1Q0YL 1K9TA 5D1QD 2ZUSA 3S4SA 4Z7WF 4I3SH 5DK3A 1QFUL 2I24N 4YHZL 1AHWB 5I15L 4P59L 2BNRB 4K7PH 4RGOH 5IMKA 5BZWB 2FWOA 1I7ZB 4X7SL 4G42B 2BXZA 2P7TA 3RHWK 3FO1A 4DKEL 1GXEA 3MRKB 1GCFA 2CLVB 5EOQH 2BMKA 3PDOA 3RWJB 2EYTA 3FT4A 5BO1H 4RAHA 3QDHA 5I1DB 4NRZB 2XTJD 1E28B 3AU1A 3BW9A 4HBCH 2BJML 5B8CA 2BNRA 5IMKB 1JNLL 3O9WD 3CH1B 4NRXA 3H9SE 1U8IA 2GKIA 2FHFA 1IKNC 3GSVB 2EXYC 2BDNH 3N1MC 1Q0XH 3ZE2E 3OPZL 4JFPB 4MX7B 4G5ZH 3T8XA 1C16B 5I73C 35C8L 4X4YB 5IHBA 1MCWM 3Q3GB 1AGDB 1OF2B 2X4PB 4EN3C 2IQ9L 3I6GB 3NPSB 4N1HB 5IG7A 4ODVL 5DMIL 3P4NA 1GGYA 2BVUA 3CH1A 4TPRL 4PJCA 2W0FB 2O93L 5CP7A 3GSVA 1B0GB 1G7LB 4P2QD 2VLKA 2XXCB 2F54D 3B9EA 3ZKXC 3L5WB 1CFSB 4TVPD 5IKCA 4KTEH 2H9GB 2ZNWA 5BOPA 4JGJA 3GEWB 1U8OB 4KPHL 2SEBB 2PYFA 1NCCL 5HYSG 3S35H 1FNAA 3Q6FA 5SWZD 2W60A 1J86A 3GSXA 4Q6YA 4W81A 1DE4B 5HPMB 1ULVA 2NX5B 1KXQE 4DKFH 3CXHK 2FIKA 1SYSB 4CADA 2P43B 4LPUA 2HFGH 1UA6H 4LSPH 5L88L 3MRPA 1U8OA 5IP4A 3OG6B 4M1CC 3X13A 3BXNB 1GC1C 3BRGC 4MA1C 4MS8D 2YD8A 1N3NA 2ARJA 2P5WB 3WUWA 2X1QA 3MRFA 4AY0A 4G6FB 3IDNA 2FR4B 2XY2A 3QXDA 3VW3L 1HIML 3C5ZD 1Q1JH 1DN0B 3QDGE 4R26L 4UU9B 2IANB 4LSVL 1E27B 1IC7L 3MACL 4G8GB 4NSKA 4U6YB 4AQOA 2WBWB 2AS5M 1FCCA 2P8MA 3BVNB 3QNYA 2YC1A 2VQUA 5D7KD 1IAMA 3IFLL 5DK0B 5D70H 4I3RL 1F42A 5HHNB 5A3ID 3KXFA 4ZO9A 4DEPC 1CD8A 5B21A 1HILA 3RP1A 1KG0B 2DDQL 4LCCB 3T0AA 2VLJA 5J6HA 1K8DA 2VDLH 6FABH 1KN2H 3NH7L 4TN9A 1QNZH 1KYOJ 1D9KA 4XXDA 1IMHC 2XA8L 4I0KA 5L2JA 4DKEH 4OCWH 4GXVH 3N0PB 4X4XA 4ZAKD 5CEZE 1PX3A 1HE7A 1U42A 3LKSA 4HD9A 3STZB 5C0GB 4NKIL 5TE4H 1XGRB 3MJ9H 2DBLL 4OCYL 4HH9A 3RIAK 3RI5K 3DI3B 3NFSL 1WICA 1QFWL 1KB5H 5D2LF 2FATL 2V5SA 2FRGP 4PJ7F 1HYSD 2BY2A 3QJHA 1ORQB 4OLYH 2WWMC 2Y25A 5EZLA 3ABZA 5AAWA 4YWGH 3LSOB 2ARJQ 1UJ3B 1CZ8H 4JLRB 5TE7H 5EU4B 1AP2B 1KCSL 4XP1L 4OGXL 1MHEB 3V8CA 3REWA 1G6RL 3W0WA 5EOQL 5E6ZA 2M26A 3BZEB 3ALPA 4U1LB 4P5MA 4M6OL 3DUHA 2X4SA 3MLRH 3MA9H 4OZIE 2AQ2A 4EN3D 4YBHA 1EJOH 3RWFB 3BDBA 4G3YL 4GKZA 2B2XH 5DTFB 5BRZE 1FL5A 1SBSH 3KPMB 3VDAA 2X2YA 3RWDA 4RFOH 5ERWA 1NGYB 4GRLB 4JDTL 3MMEA 5T1MB 2FATH 4WHTB 5IROC 1MAML 5DFVD 1SY6L 5IQ9A 4G8GE 3UJTL 3UPRA 2FX7H 3FQNA 1HKFA 2XTJC 1G9ML 4PJEB 4GKZB 5DTFA 3BHBA 4CJ0A 4PJ7A 1KCRH 4I0PC 1XF2B 4XVUC 3MV7A 5DURD 2X4RA 4CU8A 5SWSD 1UACH 5ICZA 2IAMB 4JZJB 1D5IH 1NCBL 4QT5A 2NYYD 3UPRB 5GIRB 3LS4L 3FQNB 2AABL 2A38A 4M1CD 4PJ8B 2VXUH 3I84A 5E2WH 3BHBB 4LRNH 4RQQA 1BQSA 1AKJD 1Z5LB 4GW1A 1K6QH 2XWTA 2NY2C 4OCNC 3V79C 1IGCH 4K8RL 43CAB 1QG3A 5C0DA 3C5SA 1FNSL 4YPGB 4JKWA 3SY0A 4WFGE 1A7PH 1P9MA 1YMHB 5DQDH 3WDIA 5JORA 3ZT5A 1U93B 5DGRA 4ZYKB 5E2VH 3BKML 5IB5B 4GLRI 4NNXA 4XPBH 3T4YA 3TFKD 3V5HB 4X6BA 4L3ED 3KYKH 5BRZA 5C0RH 2YD5A 3ZKND 1KTKE 2DTMH 2NXZB 4EJ1C 3FRUB 4OCMC 4NN7B 1PAMA 2XOTA 1TJGH 3DECA 5F1NA 2ENYA 3CK0L 4ZYKA 4BSWB 3U46A 25C8H 3V0WL 5EC2A 3FQUA 5CILH 1A0QH 2R2EB 2WLYA 4EIZC 3WJLC 3DVFA 4PJGA 4L9LA 2VXUL 3HC0A 3LKRB 5DJ2B 3QFJA 3CVIL 3GMLB 5FA3B 5D7SL 1AXIB 5HBBA 1RSFA 5FYJU 5I74C 3BUYB 2YPKA 1PGRB 1BZ7A 5KTEL 5KVEH 5ITBL 4MDIA 5JDJA 3ULVH 3FQUB 5FYKL 3FQRA 3MGAA 5I0DA 3RNKA 5HHPA 4W4NA 1A9EB 4NCC1 2J4WL 4LSSL 4NQXB 2HTKD 4XCEA 2VIRB 3HI5H 4PS4H 4X6FA 5D71H 1A0QL 3QDMA 3DXAE 3CVHB 1OT2A 5FA3A 4NUGL 2UYLA 5CLTA 3SCMA 4Y1AB 4QRTA 1IEBB 1FVEA 4F33A 2X42A 3QXWA 5J89A 5CD3A 5IQ7H 1H3XA 1N2RB 3DHMA 1EFXD 3T2QA 4J1UB 1JHLH 4JFEB 5C0AA 4ONFH 1CD1B 4QRUA 5C07D 3GBMH 3EJZC 4CVUA 1QTYT 1F4YL 1CDYA 5B38B 4PJ5D 1SJHB 3RTQC 1FG2B 2BY1A 3MRJA 4NN7C 1ZANH 5J13B 4XBGB 4D0DA 4FZEL 1L9NA 1OP5K 1M4KA 3UZVB 3ARQA 3VFPB 1DSFL 1A4KA 3AREC 4JFEA 1F4AA 3O4LB 3QG6B 3ZSSA 1ZOXA 3H9SD 1I9RH 3FFDB 3TVMC 4FQHB 1ZTXL 2NQCA 5ICXB 4I13B 5BVJA 4XWOD 3CLFH 1VADA 2WAHA 4NOBA 2HG5A 4BELD 3TYGL 2AJYH 3DXAA 2F9BT 3C6LD 4H1LA 4Z7WE 3T2NL 4KKCD 2COQA 2YZ1A 4XP4H 1J0HA 5IEHA 5D1ZA 4KGLA 1MWAB 3HE6B 4MXVF 3VGEA 2B5IB 3MNVB 4WEUD 2BVOB 4TSBL 3JV6B 2WSKA 5J0BA 4OGAD 1Q9KA 3O2WL 2EC8A 1S7QB 1KLUA 2HKFL 1MREH 4O9HL 5T5FL 4XCYA 4CL7A 5BCAA 3BN3B 5FYLD 1SEQH 5D1ZB 4PJGE 3KJ4B 2A6KA 4PRBA 2YK1L 4KUZL 3JTTB 3ARFA 2YXFA 1TVHB 4LCYB 4ZUUA 4LNRB 1ZGLP 1FHGA 4NYLB 4L8BB 7FABH 4Y1AE 2VAAA 4M4RA 4QYOB 5IVXB 3VXRB 2XKNA 1MY5A 2PO6B 3QUYD 1KUMA 1LP9F 4HHAB 4XZUB 5FYLH 2F5AH 1RIHL 3MV8D 5IGXH 4NOFA 4JFEE 5CJQL 5FCSH 1XR8A 4XPHL 5SWZA 3LKPA 4G6KH 1S78D 1QVOA 1T0NB 4M61A 1S7VB 2UVEA 3W5MA 3NVQA 3OGCB 3NCJH 3U83A 5IJKC 1I8IA 5ILTH 3RI5F 4FQ1H 3KNBA 4A6YA 3VG0H 3G5ZB 3NOIA 4KY1L 4U1MA 2DI8A 3EOBB 1VESA 4P2QA 2CKBA 3R4DA 1DBKL 3GMMA 3HC3H 2P5EE 4AM0A 3S88H 2OP4H 2Z31D 4JANA 4KUCD 3ZT6A 3VWJA 4WWKC 1LK2B 3LMJL 4FTVB 5EU5B 4YHNA 1IQWH 4OQ1A 3TIEA 4MD5B 2BC4A 3Q6GH 3VRIA 3F58L 3UROR 2BOCB 4GS7C 4P2QB 1XH3A 3V52H 4QLRA 3WE6B 3PDDA 5ITBH 4KKNA 1VENA 3PV6B 1OSPH 3ARGA 3D85D 3FONA 3TO4D 2C4XA 3C2AL 3MUGA 3V5DB 3PWPB 4BA8A 2AV7B 3SJVD 4WI9A 4ZSOE 1CLOL 3D2UA 43C9B 4XNMA 3GSUB 2QSTA 5E1HB 1YZZA 5ALBL 3RIFF 4KKAC 3G6JE 1FDLH 4NKOB 4WJ5A 3X3FL 4DGVH 5GZNC 4CW1B 1WQVT 4QGYA 3QP3A 3M1BA 4Z78A 3RZCB 1G7MA 4LVNC 8FABA 4IIQA 1ZS8A 3VCLA 1HH9A 1FZOB 3L3KA 2FLBT 3MZTA 2Z93A 1MCEA 1X5HA 3IKCA 3FMGL 4IOIA 5F7FA 4HKBA 2FO4A 2HFEA 4RMUA 2Q86B 3KS0J 1LO2L 3TA3B 3EYQD 4X4XB 3CAFA 4H8WH 4X98A 3SE9H 2V7NA 4QHKI 1F4WL 3D1MC 5F6HJ 5T1LA 3O2DL 5IBLC 4MCYB 5I8EA 3QWOB 4RGNB 4IOSD 3IJHA 3DWTA 5E00A 5F7KC 4JRXE 2DICA 3GSRB 4HWBA 1BMGA 3BPOB 3QIWA 5IB4A 1S9VB 5GGTL 3S37H 3SDAD 3BSZH 1Q94B 1A7NL 4PB0L 1MRDL 2DF3A 4HUWB 4NZJA 3LAFA 3FOMB 4PRHA 5C0FA 1ZSDB 2AK4D 1B88A 2KUTA 2IFFH 3RKDC 1PLGL 5K9QG 1AXSA 1ZT4B 1JMXA 2PTTA 4XC3L 3W2DH 2UZIH 3ARDC 3U6RA 5IQ7L 4G5ZL 5HHOB 4J12A 3C09C 2FD6H 2VH5L 4NCDA 2WBJB 5F7YC 4J3OC 3PDGA 2EKSA 3P9WB 1N7ML 3MCLL 1BECA 2ATPA 1I85A 2AEWA 1NDGB 1MF2L 4LLVB 5T1MA 2LABA 4YBQD 4Z7VE 2EDOA 4MCZA 3KLSA 3G6JB 3U48A 4OZGE 4ELMB 1CLOH 3BWAA 1N5YH 5FYKH 3L3IA 5FYLE 1JF1B 3SDXA 4JFHD 2VXVH 4L4TE 4XNUL 3X11A 4MXQC 4R97C 4AIZB 3C2SA 4TULL 1W8OA 4I9WE 1QSVA 1IAIM 5DJAB 5I15H 2Q7YB 3K80A 1RUKH 1U8MA 5TH2B 2R0ZL 1Z9MA 1BM3H 4C4KT 4AQ1B 4TNVK 5DRWA 2NXZD 3UTTB 2K7PA 3P11L 2VLME 4YHOH 2FECL 4E41E 3QO1B 3B5GA 4LHUA 3VXSA 2WP3O 1Z5LA 4ZUSA 5MHSE 5CLWA 5C6PB 4WEMB 1ZXQA 3U4BH 4GG8A 2FZ3A 4PGZA 5BV7H 5LWYH 5KG9A 1U8MB 1WZ1L 1N5AA 4JFOA 5I8KL 4GKNA 3QQ4B 2AXHA 1MELA 2ADFL 3VFRA 1IQDB 4W6YB 4N9GB 4WEBL 4YK4B 4UI2A 2RBLA 1RK0A 5IFAH 3OKOB 5TQ2L 4LPWA 5J6GA 3OAYK 3HUJF 4N90D 5HGAB 2OMNA 1QSEB 3WFEH 3CSYB 3PWJA 1CI5A 1CLZL 5DJYA 3D3VD 5F7LB 4OUUA 4P57B 3SO5A 3EFFB 4J3VA 3WLWD 4WTXA 1BFOB 4PJIB 1BBJB 1R3KA 1Q72H 3LH2H 5HHOE 4EI6B 1NCWH 2HLFC 2D9CA 3MRDA 1JGDB 4F7CB 1ZHKB 5DHVB 1BZ9A 2EIZA 4QNPE 1Z6JT 3OKLB 1DQJB 3QJFB 1IGYA 3DETC 4HIJA 4S1SH 3W9EA 4TSCH 3RUGA 3GK8L 1CICA 5IB1A 1INQA 5JOPE 2W65A 3T3PF 4D9RE 4ZXBB 4X7CC 4AZ8A 4LCWA 1QFWH 3QPXL 2XPGB 3MUHL 3RWEA 1T1WA 3JV4B 1T21A 3BPCA 4XXCC 2NZIA 2WIIA 2QSQA 5JMOC 3PWVB 1P69B 5IM7A 4OJFH 4HC1A 2JKXA 3DTXB 1U8KB 5DK2B 5LAXB 3IFOA 1R3LB 3TFKC 3QULA 3T0DA 4P2OC 4WW1B 2BSTA 1IM3A 2AV1A 4K9EL 4JFYA 4M6OH 3J7HA 2ZSWB 4LSTH 4JR9H 1MHPH 1CL7L 4JFDA 5CJOH 2IPUK 1J0JA 4JKPL 4M93C 5DVLA 1DLHB 5E2TL 2IPKB 4HWBH 4WUUA 4XBGA 4XWGH 1M7DB 5AYUH 1R24B 4F7TB 2VLKE 5T5NG 3HZVA 4LKXA 4YR6A 3GMPB 3GBML 2AKRA 4GSDL 1EV2E 4GH7B 1D6VL 2BVPB 3WMSA 4LU5L 4DGIH 1C5DA 3FFDA 1DQTA 5CEZL 5M94B 1YPZF 4QXUH 4AEIL 2KPNA 4K3GA 5DMKB 4YHML 5I6XB 2DQJL 1NBZA 3DGGA 1QYGH 2JCCB 5B39G 3QUZA 3K74B 2E9BA 3DBXB 3K46A 5FYJH 3KPPA 4ZODA 2EC9U 1EFXA 5GGTA 2NY6D 4OGZA 3MJ7A 1U3JA 4PJDB 4X83A 1EUUA 4X7EC 2IADB 4XRCB 4LF3A 3AXLB 4UAOC 1YY8A 2ZUTA 2BFVL 4GXUN 3ZO0A 5C7XH 1S3KL 2P7TB 1NL0H 1U58A 2Q20A 4ZNEE 2XV6B 1WSST 2VTFA 1RU9L 3GGWB 1YJDL 4MGXA 3VXUD 2KZ1B 2J88H 4KK8C 2D7TH 2C1PA 1MFBL 4NWTH 1U8HA 5E6IA 2W60B 4RNRA 1MNUH 32C2A 5SWQA 1RZFL 4G8GD 4Z95L 2O5ZL 5AUMA 4AEIH 3KPSE 4BKLA 2RGSA 3VMOA 2E7LA 1AHWA 1JNHA 4NM8H 4OZFB 4QHLB 1T0PB 4DUWA 3C08L 4ZXBD 3SKNA 1UJTA 2VSCA 4R7DB 2EDBA 3MXVH 4BZ2L 4K7FB 4HQQH 3EDKA 3LKPB 4RFNC 1CWVA 5I71B 1DFBL 3SKJH 1WBXB 2Q87A 5FF6B 4YAQA 1UM4L 2D4FA 2WWKT 4Z95H 3QIWC 5C0EB 3NBNA 1URLA 3QG7H 4F3FA 3VFNA 3GI9L 3DMMB 3QWRA 4Y5XC 1MI5A 3QIBA 1HHGA 4KPHH 1BBDL 3C2AH 3RVVD 1OM3H 3CX5K 4X0KA 2BY0A 4NDMA 3WIIL 3VXUA 5DA0B 5ID1A 3IXTA 4PGJA 5CCKL 1T04B 4M43L 3QDAA 4NO2A 1KLGA 2ERJC 4HEME 5F9OH 5AZ2L 2EDDA 3NIGE 1A6WL 4ZFZA 3BP7A 1VKXB 1OAKH 2BRRL 4HGWA 5CAYB 4C56B 3IJSB 4JHBA 1K5NA 4X0KB 2GK0B 1NKOA 4UQ3B 5KZCB 4LARH 2C1OA 3V6BR 3I02B 2GTWA 2ITDA 4RFEB 3BIKB 4LLWB 1H5BC 3TM6A 3LKQB 2PUQT 1D7FA 4JPWL 2YOCA 1UH4A 3WFDH 1N0XH 1LEGB 2RCSL 4ESKA 3AREB 5ISZA 3DROA 3GSNL 3RZCA 1OTUD 2I9TA 4MNHB 4LIQL 3WKML 1D3CA 1HXYB 5F71A 4QHUB 4OFYD 1I1FA 2VL5A 4N0UE 3SKOB 3SQOL 3RUGE 1NAMH 3KS0H 4RFEA 3AS1A 4PJBF 1MHPL 1KEML 3QDJE 1B4RA 1QBAA 1TMCB 2VUYA 2IBGA 3EOAA 3M45A 1WCBB 4P9HH 4C83B 4M5YL 1QKZH 2VDNL 3QUXA 5GSRB 4DVRL 1KSRA 4P4KA 4RGOL 5MERA 4L4TD 2GJ6A 4H25A 4Z7NE 5ERWB 5HVHC 4LRNL 5I1DA 4O2FA 1UWGH 3SBWC 3MRBA 3BQUC 4S10A 3X3GL 3WDJA 5D96C 2WBJD 3IF1A 3OAZH 4C55A 1IGFH 4GT7A 4DCQB 4P49A 1XCTB 2ZKHH 4N0FA 2FD6L 3HA0A 3GKWH 2P5EB 1JF5A 5KSAA 4HH9B 2W9EH 1R6VA 5C2UB 2DMKA 5F8QC 1EEYA 5J6HB 1T83C 1X6NA 4LFHD 1KJ2H 1KIUA 2H8PB 4RDQF 4XBEL 5KVEL 5F1KC 5D7JB 1CIUA 4PG9B 2QQKH 5DR5L 1AXTH 1OTSC 3H2WA 2QADB 5JNYA 5BZDB 3CSGA 2XZQL 2P5ED 2VXVL 1H3PL 1XIWA 4JLRA 1Q72L 1JCKA 1Z3GH 4Z7VB 4OZHF 4QRRE 5GGTH 3CH8A 3ULVD 3UBXA 1DVFD 2MCG1 5HDLA 1FFNA 2A6IB 1MLBA 1CGWA 2B2XL 1LO0H 4LKCB 4LLVA 2VJXA 4RGND 1ZGLM 2SEBA 3HNSH 2XI9A 3TA3D 4PRNA 1HK6A 3QUMA 4Q7DA 2APVA 3PNWB 4R26H 4O51A 1INDL 1V7ML 2GSIB 3GSXB 2J5LB 4WTZG 1MFAH 4XB8A 5EO9A 3V5HA 2ZJSH 3TPUA 4OZGF 3LPGA 3UAJC 2R0KL 1UCBL 2X4UA 1MCRA 1P7QA 4L4TA 4E41B 3ZKMD 1UB5B 1NC4B 3VXTA 3A6CL 1T1ZB 4HWZA 2UWEE 3GRWL 5EC2B 4ALAL 5B38G 4UTBH 1CU4H 1X4XA 5KSBA 2EH7H 1FYTB 1E4JA 3E6FB 4ACPA 4LARL 2V5RA 5HHVH 5GISH 3MRHB 3D39D 1JHTA 5LKNA 3V0AC 3GMLA 5C70A 2AJVH 3TVMD 1REIA 1DBBH 3CC5B 3GJEB 4DFHA 2IFFL 4JO3L 5DMGC 2P8MB 3BDYL 4XMLH 1I8MA 4LL9A 3TJEL 4XC1H 3D69B 2XFXB 4M1DH 5EO0B 5HGHB 4PJHF 3T65B 1LO2H 4RMWA 5K9OB 4F2MB 2F53E 1ZHNA 4NP4H 2HT3C 4PJ7B 4M43H 2NY0D 3OKOA 1YMHA 4XNZB 3TIDA 1QRNA 5ID0B 3TBSA 1A64A 2ATKB 3KWWA 2R15A 3QDMB 2LU3A 2MPAH 3VMPA 5FYJL 1FVDB 5GGUB 3O3AA 4X6EA 2YKLH 4NQUA 3G5XB 1P6FA 4BQBA 1MCCA 2NY1D 4OF5A 5EIIA 4NO3A 1PY4A 1RUQH 4PY7A 3P0GB 4KDTA 1IILE 3RDTB 3O41A 2VXSH 2GEEA 4S1QL 4ONHA 3OAUL 2EH8H 1S8DB 4LGSB 4QRRD 1CR9L 5JORB 2V2WB 5ILTL 3U46B 5IESH 1K85A 3C6LB 2HP4A 1FVDA 1S9XB 4FQLL 1FORL 3QJFA 3UTOA 3DSFH 3TV3H 1EEZB 4GG6B 2ZPKH 1U95A 2B5IC 3MUJA 2R1WB 4JVWA 2RHEA 1X7QB 3HAEB 4ONHB 2NW2A 3KDMB 3TBYA 2GTZA 3SGEI 4F9PA 1TTGA 5BXFA 4HS8L 3CXDH 3CFCH 4WHYH 3BN9D 3LD8B 2L0DA 3IKKA 3UP1A 3F7QA 4LAQH 4UINL 5IM7B 3C5ZC 4OZGB 4ELME 4PJFE 2C3WA 2AEPH 5E8OB 1KIRB 5T1LD 3WXWL 1WJ3A 1CXFA 3ZSTA 4Y4HC 1FL5B 5JA9A 1IFHH 4NN6B 5JUEH 2DYPB 3QPXH 5HYJA 1FFPB 2APBA 5E7BA 4BH7A 5DQJB 4MQ7A 2B7DT 5E6ID 4LDEB 3QCVL 5F7EL 3V2AR 3CFKA 4OZGA 5MEQA 3HG1D 3VFOA 3D25B 5E8OA 1L0QA 1PX4A 5FHBH 2W0LA 1YYMH 2QR0A 4WWID 5HGBB 1BWMA 1FDLL 4D8PA 2FBJH 1QSEE 3I50H 3VE0B 1VFAB 4ZUUB 4HFWB 3U7YH 3VG9B 4PJAE 1RUPH 4OD1L 3IFLH 1NBQA 4N1CA 4OD2B 5D5MA 2MTPA 4HIXH 5GIRA 2EDNA 2OXGA 2WZPD 2DQDH 2QV2A 2N56A 4RWYL 3QUMH 4KAQL 1LO5B 5C0CD 2BXYA 1T03L 1HH6A 3WFEL 4NQCB 1QHOA 4MQSB 5TDNB 1UXSA 5IOPA 3E3QC 1RZGA 3HI1A 5JW4M 1DL7L 4Y5VB 2I25N 3QCVH 4IRZH 4UV7H 3Q1SL 3TYFA 5F6IB 5KSUA 1QSZA 3KYMB 5IESL 4NO0B 4LSRH 3WFDL 4K3JL 4AK1A 2PXYB 2VSDA 2MHAB 3MJ6A 1I1AB 5C07E 4MA8H 1XCQB 4FFVD 1B0RA 1BJ1J 3RVVC 4L9LC 32C2B 5SWQB 4AM0B 5C0IA 3HI1B 4HWNA 1QPPA 2ITCA 3LDBB 5EORH 3WNOA 5F72S 3DUUB 2JJSA 3UAJD 4FP8H 4L8SB 4HGMA 2BP3A 3OHXA 1J8HB 3DYMA 2NZ9C 2OL3L 1LWRA 4PY8I 3PHOB 2PYED 4FFZH 4QHMB 5F96L 3P9LA 5LGJB 2NX5E 1U8IB 1LEIB 3K8KA 4LSUL 4PJ9D 5FAAA 5GRYA 1QFHA 1OTUC 4K7FA 4IHOA 4CNIB 5DSCA 4L8BA 4GRMA 3QUML 4PTTB 4RMSA 3TO4A 1RJYA 3HC0B 2OR9L 1N59B 1OPGH 1PJ9A 2CO6B 5HI3D 3DV6B 4PJGF 5IG7B 3CLEL 1N5YL 2EDKA 4V1DB 1YEDB 4WJ5B 1CFVL 4L4VE 3QDGB 5FOBA 5LGHH 4HS6B 1ZEAH 1FNLA 2MOVA 1I3UA 2Z4QB 3ARFB 2V2TA 3EGSB 3PWNA 4HJJL 4CU6A 4UTBL 4L4VD 1A7RH 1CFSA 2A1WH 5H37H 1DR9A 1ZVSA 4R8WL 1Z9LA 1O5DT 4KRLB 2HTLD 3VH8G 4IOIB 1YECH 3LKNA 3FT2B 2DKUA 2JCCE 2CGRL 1I9JL 2Z31A 3BDXA 3L95B 3DO7B 2IH1A 3T2NH 3INUL 3EYVA 4YHPB 2AAVA 3L5XH 4C56A 2I60H 1CLYH 3AVEA 3F12B 4ZS7H 2NNAB 4M61B 3T0XA 4A6YH 4GAJL 3EO9H 3T09A 3MRPB 3CFCL 1DBJH 4Q58C 3CFEA 4XHQA 1ZK9A 4I3SL 4YPJA 1N3NB 1OAYH 1FZJA 5K33A 4F58H 1TZGH 4PP2B 4PV9A 1CGYA 3N1FC 2XKSA 2EYRA 3F6LA 5CEYA 4JDVB 2ESVE 1ZLVK 1EXUB 3O4LA 3OR7A 2NNAA 4PLNC 4NQVB 2M2DA 4N5ED 5BOZG 1HXYA 2CPCA 3T4AB 4JZNA 4WO4A 5L7XH 4J8RA 5T3ZH 3L5XL 2BVQB 4R96B 3WKNA 4HX1A 4PG2C 1KGCD 1KPUB 4J23A 1IC1A 3BOVA 2A9NH 4FFYH 4PGEB 5C09D 4AT6B 3LQAC 4MQXD 4WHYG 1EXUA 3ARFC 1AQKL 3QQ3A 4QY8A 3NZ8B 3MLXL 4HKBB 4JN1L 4JRYA 4HUVA 3H9HA 3G04A 3BEWB 5BV7C 1KN4L 2ED8A 4GMSL 4K3DL 5FGRA 4XCYB 3HG1E 4MA7L 3UC0H 1G7MB 2Y6SC 2HVJA 4MCYA 4HS3A 1EH9A 3CLEH 4WNQA 2XNAA 4GBXA 4HKXA 3UTZA 2HFFB 1YQVL 1J0YA 15C8L 5E4EB 5HHQA 5T3ZL 1EEYB 3H3KA 4LCYA 4PD4J 4UILL 5DD0H 1IRAY 2XRAH 2AJ3A 4X4MA 3INUH 1ETZB 3SGEH 2R0LH 1BVKA 4X7SH 4OBRA 4F7EA 3U7AA 3CSPA 4Y8AA 3IGAB 2H1PH 3IU4H 3OTTA 4YH6A 4RMVA 4WNQB 4RCAA 4F57L 4O5LL 1DUZB 4B50A 3UJTH 4LCIL 3IDGA 3GSOB 4OKDA 3VWJC 2EE3A 3BPNB 3M07A 1V3LA 3VGAC 2DLEA 4TVPE 4LEOA 3CMOH 3QHZL 1T89C 5GJSH 2ED9A 1F6AB 5FUCE 2DLGA 2CLZB 2EKSB 1QHPA 3B5TA 4F37K 3PNWA 2W38A 1CFNA 2YRLA 1OP5H 1GGCL 3P0YL 1HHIA 2UWEB 3BIAX 4HSQA 1T20B 3PGDA 2W9DH 1F02I 3ARUA 5ANMB 3KYAA 3MTRA 4KMTH 2OS7A 4L29A 4YWGL 1KT2A 2Y5TB 1RZKL 5D2LB 5DJDB 4IIQC 3QFJD 2Q7YA 3AB0B 3MV7B 3PWPA 1HHKA 2XTJE 2AV7A 1JV5A 3GJFA 5DRWB 4ODXB 4PJ7E 4YDJB 2WP3T 3VI4E 2X1WL 2X1PA 4Y16D 1MCOL 5K9KA 1X44A 1C5BH 4MZ3A 4FFZL 4W68A 5F96H 3IDYC 3A6BH 4KDWA 3VD5A 1ADQA 2N7BA 2A6JB 2FIRT 1INQB 4KUCF 1FL6A 4PJHE 3SJVA 4ONOA 1U41A 5HYSA 3WIFA 2AJUH 4Y4FC 2NW3B 1N0XL 2YPLA 4JZOB 3JVGC 4KI5F 4M6NH 3H7BB 4EI5D 3RDTD 3HLAB 2OZ4L 4NNXB 5F1IB 1RZFH 3U0PB 4Y4HD 1UM6H 3UTQB 4R6UA 2YD2A 4NO5B 4FQXA 2JJUA 4APQB 1IC7H 5TF0A 1YYLH 1X5AA 3BX7C 4HFUL 3IS1X 3VD9A 4OGXH 2DQIL 4RZCA 5HYQA 1MJ8L 5CGYD 4EUPG 1EEZA 1S9VA 4G7VH 3QRGL 4M8QA 2R1WA 2YPLD 3RRQA 4MYWB 5FK9B 3MRLA 1BZ9B 4HK3N 3HZVB 4XAWH 5DJ2A 5IWLA 3ARVA 4JM4L 5KANI 3EO0B 1BVLA 1K8IB 3MBXL 1HCVA 1LO3H 1HKLL 1A3QA 3IT8D 3ARBA 4N0YL 1BFOA 5FUZL 2J6EH 3QRFM 3R8BB 1GHFL 5IV2B 5EU7E 4E5XB 1QR1A 3BRFA 1MRFH 4ZAKA 1I7TB 3DX8B 3D39A 1A6WH 5GZND 5D5ME 1U3HD 2ZG2A 1U6AL 2XTJB 5DRZA 2X1OA 2H2PD 2GIYA 3CDFA 4JJ5A 4JM2A 2DQUL 4Y1AD 3O9WB 3O8XD 5IT2L 5IV2A 4NQEE 1FBIL 2CK2A 4TPRH 3TNNB 1AQDB 5T3ZD 1U91B 3W9DB 1DDHA 5BS0B 3X11B 3U0TA 1KNOA 4YXHL 4WFEE 1IGIH 4PRAB 5DYOA 4KTYA 3QCTH 4L4JA 3TN0D 1S7XB 2WIMA 4NQCE 1Y18B 1MLCB 2EH7L 1MJ7H 3K8MA 2ERJB 5TH2A 2LTQB 1VFBA 2R23A 4NZRH 3VFPA 3FO0L 1AD9A 4XPTL 1ZVHA 4WU7A 4PJFA 4AEHH 2EYSB 4O00A 4U1IA 5MI0C 4XI5D 1PG7H 4YIQA 1RZGB 3HR6A 4JGMA 4OF6A 1UXWB 1PFCA 1QLFB 1TETL 3KYKL 5C0RL 3WD5H 3RWHA 4ONFL 2ZUQC 1B2WL 3B2UD 1DLHA 4LNVA 3GRWA 1RHHB 4HIEA 5IW1B 4XGZB 3NN8A 5MEND 5I1IH 1KOAA 2YMXH 1CXLA 5I8CB 4QGTA 2MCPH 4DEPB 2HJKA 2PXYA 1U2HA 3P30H 5KBNC 4DKAA 3HE6A 1RK0B 1I3RB 3RVTD 4JQIH 3STBA 4MNQB 1L7IL 1HHGB 3HZKB 5EZIL 3AS0A 1U58B 2X70B 4D94A 5GGRB 5B4MD 3D3VA 4TVPH 1NAMB 4LLUA 2VR9A 4FABL 5DHXB 5I17B 4NHUB 2K1MA 3NABL 5A2FA 3EFFA 1QRND 1J18A 3QUZB 4JCMA 4NKMA 1JPSH 4KK9C 4NRZA 4JO3H 3DYOA 4Y19B 2NTFB 3VXQB 3HMWL 1T1YA 4LCWD 4F7CA 4RMQA 4NC0B 3G5VB 4NRXB 4DTGL 5B39B 1VPOH 3QEQB 4U1HA 2CKBH 1WTGT 1YPZA 1CGUA 1S7RA 3OB0K 4I8DA 1RULH 3I6KB 4XAWL 5L9DH 1T1XB 1M1SA 5TGBA 3GK8H 1QVOB 3BEVA 1J7VR 5DUBB 4LSQL 2R0ZH 2ZOLB 4PFEA 3SKOA 1GZQB 4PRIE 1MCSA 3S34H 3UPCA 3U36B 4WFFE 1MI5B 2R69H 3LKNB 3BKJL 4U1MB 3DNKA 3DTXA 1F11A 4OQTH 3QEGL 4TULH 3NIFF 3TCXA 4XHJC 4M1GL 4OTXH 1TJIH 3KPSD 1T04A 2FDBP 4XCCH 3MRGA 4RGMC 3I2CH 3MOBL 4QF1A 2VQ1A 1WBXA 4UV4H 2QHLA 1FH5H 3TIEB 4MNGE 4MD5A 5L9DL 1AD0B 4RRPA 1KPVA 3WLBA 4Q0XL 1L0YA 1EA9C 1SJEB 3QUZC 1WBYA 3PL6B 1D5IL 3TEUA 1P53A 1CQYA 2AEIT 4K2UH 1VPOL 2H26A 4NC2B 4CADB 4DUXA 3PV6A 2HJFA 2OZ4A 1J0ZA 1JHKH 2YSSB 3GHEH 4NQVA 5C2BL 4JZNB 2DQTH 4M7JH 4U6TA 3QWRD 1I9EA 3QEGH 5AEAA 4Y4FD 1J1OL 4HZAA 5FKAB 4JM2F 4NT6A 3GZKA 4ZO6A 4XVTL 4P46B 1N8ZA 5EWIH 1X5KA 2DDQH 4WV1B 4NZDA 1UZ8B 4U6YA 3Q5OA 1HNFA 3U79A 5A2KH 1J05B 2Z93B 2CO7B 5GGVH 1WC7B 4U1SA 1JPTL 5D1ZC 5GSRA 3UCRA 3UTTE 2QL1A 4NJ9H 1EBPA 1NBYA 3LOWA 2VZOA 4LLYA 5FDWA 3MRMA 3LN5B 1GPOH 1CDBA 2D0HA 3B9VA 4GMTH 1ITBB 2NXZC 2R1YA 4QHUA 4XC3H 3SE3A 4NQEA 1LD9B 4A2MA 4P5KB 5TE7L 5DMJB 2ZOKA 4PGBB 3U7WH 3WN5C 1EX0A 4I3GA 5FCUL 4MA7H 3K4AA 5GGSB 5D9SB 4Z0BH 1S9WA 4OB5L 1FNEB 5HDQL 3GM8A 4H8WC 3N1QC 1FN4A 1I1CA 3GKZA 4R90L 2E8YA 1G7JB 4JN1H 4A2LA 1NUNB 3NIDE 5DD5H 1U0QA 2ICEA 3WIIH 5JIKA 4YEFA 3E6FA 4DOHE 2NY0C 2DQCL 3RGVB 1FJ1A 4MJ5A 5FO7B 4HXAH 4PGBA 5EBLB 2J4WH 3V6OC 2XKUA 2APTA 3SDAA 4MAYD 3CDCA 1AY1L 3QIWD 4UT6H 3ARGD 2B39A 3D85A 4CN6A 4Z8FL 4D9RD 4K9EC 1JZ4A 5D2NB 5L0QB 1TNNA 4MJ5B 2Y36H 4RIRA 1D6EA 5ID1B 3MODH 1IC5L 4PRNB 1AH1A 2NY5L 3IDUA 2H32B 1DBJL 5E56A 1NMAH 1OAUL 2AXGA 1KCUH 4LLMA 5DDHB 1N64L 1LILA 2E9WA 2YRZA 5F7HA 2K3TA 3RVWC 3SOBL 4YO0B 1B0WA 2ESVB 5GS0H 1G0YR 1P5UA 2GJJA 3LD8C 3A67L 3VFUB 3O41B 2DWDA 2LU4A 4N90E 3ZE2F 2OJEA 3PWUB 2ZUXA 4JFDE 4HPOL 3M8OL 3EKCA 4MD4B 3GJFB 1JV5B 2NXYD 2GTWB 3OKEA 1OQXA 4PV8B 2DJSA 2GAZA 3LKQA 1ADQL 1VACA 5KSBB 3G6DH 2VDPH 4K3EH 4GG6A 5K9KB 3G9VA 4HUXB 3PP3H 1L0XA 1TQCB 4RISL 3MV8A 1GYAA 3UO1H 1NGWB 4Q2ZB 2HT4D 3QEQD 3RVXC 1MJ7L 1UWXK 5EIQA 4HFUH 3GMQA 2BHYA 1VGKB 5F1SA 3EOTL 4P48A 3B3IA 1PVHA 4AL8H 1LHZA 1OGAD 4LQFH 1HSBA 4HUUB 2X4NA 3S96B 1FO0A 1YEGL 4HXAL 4XTRC 4YX2L 4JPIB 43CAA 3BZ4B 4QCIA 5D4QA 4DZ8B 1ZAGA 4PPTA 2ATKA 3KWWB 1EVUA 4FRWA 4E41D 1U93A 1D6VH 1ZMYA 2R1XB 3BPOC 3VGBA 3WFBH 1TETH 1BWWA 3G5XA 4WENB 1UENA 4BH7B 1KXTB 2KBGA 1FZKA 4DK3A 3C8KB 4N5UA 4OFPA 3D69A 2W92A 2XFXA 5HGHA 1BZQK 4ZUTB 4N1EA 2D31B 4OF0A 3LB6D 4JPIA 4UIMA 3SDDD 1RIHH 3QUZD 5JPNB 5CINL 5EU6D 5FGSA 35C8H 1Z9SA 3BGAA 4JFHE 2CIKA 1UKQA 4MA8L 2MQ0A 3MV9E 1DQJA 2D3VA 2G5RA 5I1KL 4MNQD 5J56B 4XMPL 2ZP0T 3O2VL 4BFIB 5D5MB 3ULUD 2O5XH 8CGTA 3FRPG 5FB8A 3CZJA 4XVUD 1W0WA 2CD0A 1L7TH 1UVQA 2FJFB 4G8EB 2QSCL 1UEMA 3OQ3B 4LCWB 4WI4A 4L5FL 2VKWA 2IG2H 4ODWA 1PG7W 1IAII 1O7VA 3VXOA 4IMKC 1AKJB 4P2RB 1ES0A 3O2WH 1CGSH 1KB5B 5FFLA 1F45A 2H45A 3GMNA 1UFUA 3R0NA 4TUOB 3O9WA 1HWHB 2EDWA 1U8KA 1A6AA 5DJZA 5DK2A 5LAXA 5FB8B 3IFPB 3ZE0F 5D7IA 5B3NA 1FFPA 3WIHA 5EBGA 2A74A 3QIUA 3SDDB 1IM3B 2YK1H 3U9UB 2DQFB 4ZXBC 4HKJB 1IEBA 1I7RA 2VISA 3QHZH 5AD0A 5BXFB 3H42L 2Z8RA 3KPQA 4JVUA 3MFFA 4I18C 4PJXB 2NY5C 2HMIC 2HTKC 1RURL 2E9JA 3I3DA 1Q9WA 5EC1A 1A6AB 5DJZB 2IH3B 3WLWC 5GSVB 2FJGA 5EU7C 2FGZA 5A2LH 1CGSL 2FEDD 5JA8B 2L7UA 1GIGL 4KGJA 4GAYA 4HK3J 5DSCB 1OOAA 3S3PA 5D6DC 3HMXA 5B4MC 5TQ2H 5KTEH 1KJ3L 4Y4KC 1JK8A 4WDIB 5KVMC 4KRPD 4FQIH 3QCUH 4L8DA 4G6ML 3PUCA 5DJXA 3TZVB 1CE6B 4DQOL 6CGTA 3OAZK 4K3DH 4GAYB 2V2TB 3QNXB 1TQBB 5CINH 2Q6WB 1N64H 3KYMA 1MREL 4NC1C 2VDKL 1ZVSB 2E6PA 2O5YL 2R2CA 1WGOA 4FZEH 2MHAA 4WDIA 1MCJA 3P11H 2X6MA 4BFGA 4X6EB 5T33L 1T2QH 4W6WB 1B4JH 3FT2A 4F7PA 4JG0H 5C0IB 3FO9B 5J1AB 1UJ3C 1TJHH 3AUVA 3MRRA 5E4IA 1DANT 1B0GA 3BQUD 5DT1H 1FAKT 2Q6WA 4NJAL 4ZPTB 5EZJA 4S0TD 1JGLH 2BNQB 2FX9L 3MZGB 2B4CH 3CZFB 3E3QE 4FQXD 4MXWH 3DMMD 3WFCL 3VXMA 3ZTNH 3X12A 4M7KL 1YPZB 4GMSH 4Y4HA 1JUFB 1ZT1B 3EOTH 2IGFH 3P0VL 3WEXB 3ZKMC 4C4KO 2UZYB 1RUKL 4HH8A 4LSSH 4I4WB 1NFKA 2FJHA 1Y6MR 3H9ZA 5IHZA 1IAIH 4CJ1A 4TNWK 3WN5A 1AQKH 2EDQA 2IPTL 4G6AC 4GOSA 5I18H 3FO2B 3MV7D 3SN6N 3P9LB 2I5YL 4FXKB 3C09B 4M6ML 1HDMB 3O3DA 5LG1A 3GBLA 2YBRB 4Y16B 3MRFB 4Z7QF 2VABB 3UC0L 1CD0A 4I4WA 4X5WA 3VXUB 2HJLA 5EN2A 4U2YA 4QF1B 4JRYB 2VZVA 3EOBA 4NIKB 2PR4L 4LCIH 4LGRB 2VKXA 3SDAC 5CP7B 5DJ0B 1DQLL 1WT5A 3QHTC 4YE4L 5KW9H 5DK0A 1FL3A 4ODUB 3O3DB 2VITB 4FQ2H 4FTVD 1YEEH 2Z4QA 3BPNC 4HBCL 1OVZA 5FUCC 1KTLB 2GSGA 4KVCL 4MXWL 2H9GA 4F15C 2VABA 2GK0A 1GAFH 3X17A 1G6RA 1EBAA 4NZUH 2Q3ZA 1FFQA 2NY1C 2M8XA 4TVSa 1TVBA 5IT2H 3VFMA 4XC1L 5C9KA 3ZDZE 1BFSA 1RVFH 4PJBA 3KGRA 1FL3B 4XP1H 4ODUA 3V5DA 1RFDL 3VXRD 1YN7B 5MI0B 1T2QL 3TH2T 4S11A 3ZL4H 4GQ9L 1TIUA 3B8SA 1Q0YH 4UQ2B 3RVXD 5GPRA 2Z8SA 2QQLH 5HVFB 1MRCL 4NWUL 3EYQC 3CFEB 3VWKC 3D0VA 1NGQL 4S2SA 4HIIA 3ZHLA 4LPYA 3OB8A 3NZ8A 2A6DB 2R0KH 4U6XB 5E70A 3WXVH 4CBPA 4MHHI 5MERB 4KDVA 4HUVB 3SGDH 4WW2C 3N85L 1CFNB 4M1GH 4G8GA 4NSKB 3RBSA 3OJ2C 1AP2A 1EGJL 2YC1B 1I3GH 1G9MH 3WV0A 4JN2B 2XZCL 3DURA 4JY6B 4JFDD 5A40E 1H3UA 4NKQB 2GCYA 5FA4A 4NC1E 5AZEH 3QZWB 5F7DB 5F70A 3WKMH 3MRKA 3CUPA 1TNMA 4Y4FB 1SBSL 2Z92A 4KZEL 3KPOA 4U1KA 4P46D 3ECBB 2VL4A 4PJDE 2OR9H 4OM0H 5JNYB 2OTWA 3DXAD 3CFBB 1U8PB 1XGRA 2XNAB 1IZJA 4Q9BA 1AGBA 1PEWA 5EG6C 1LE9B 1YQ2A 5E94B 2HKFH 4Y4FA 4OCSL 1ZV5A 4IRZL 4IEFB 2G2RA 4LEOB 3U9PL 3MUY1 5CJXC 5ESVA 1RPQA 5ACZA 1Y6KR 5C07B 1E4WL 5EORL 1BJ8A 2F53B 1XGQB 4EUPA 2H32A 3CFBA 1BAFL 5TQ0L 4LLMB 1PSKH 4WI5A 2ATPB 7FABL 4MJ6A 1Y0LA 1NDGA 3LPWA 3U0PA 3EYVB 4KZEH 3GSOA 3U1SH 4P3CH 5I75C 4Q9RL 2X4SB 4IMKA 1GH7A 1HWGB 4M93B 3Q1SH 3CVHL 4Z5RA 4BUGA 2N7AA 1W0VA 1AR2A 5L8LB 3MLSH 5I1IL 3CPLA 3KPSA 5CJQH 3LKOB 4LSUH 2X7LA 5DUPH 3VFGL 1I3VA 4X5XB 5DQ9A 2W91A 1VDGA 4RA0C 3WNNA 3KLAB 3TNMA 4QRQB 3QIUC 4OD3H 2G60L 2GITB 2J5LC 4PGCB 2BVYA 1HHIB 2UWEA 3ELAT 1H5BA 4ODXA 4PB9H 3OR7B 1K2DB 1BBDH 5C09B 1MIMH 3DX9B 3WHE1 2BCKB 2P5WE 3K7UA 4M03A 1J10A 2W0KA 2MFNA 4S1QH 5I1EL 4R4FH 4H88H 3ARFD 2F58L 1BGXH 3GIZL 4BSWA 2FSEA 4I48A 3V4PH 4ZFFA 1UWEH 1FO0B 4WTWA 4GRWH 4UDTA 4WGWB 1T0MB 1YYML 1R3HA 3TNMB 1FRGH 3EYFA 1ZTXH 4UAOB 3QQ3B 4ZPVB 4QTHB 4D9LH 3G9AB 4BQCA 3MLUH 3T0VA 2NY3B 1TVDA 1S7UB 1JGVL 3O3AB 5AYQA 2HLFD 5KJRL 4OM1L 5F9AC 4NQDA 2HFGL 2YPKB 4ZUTA 1RZIB 2C9AA 1X9QA 4RWYH 4K94C 1J5OL 3ZYJA 2HVKA 5C0DB 3AS3A 5EA0L 4XMLL 4R9HA 3MRIB 4OUUB 4P57A 1S8DA 5DZOA 5I76A 4C56D 3QXAB 5J13C 3BP5A 3U7YL 1T3FA 3FB6B 4CRPA 2DMBA 4LVEA 4ELKB 1UWEL 3T2OA 2IWGA 5KSAC 2P46B 1Z0MA 2FEEL 2F8VA 4P2RE 1EAJA 1LDPL 4UT7H 1QZ1A 3UTQA 2PXYD 3DIFA 4ZG1A 2X9XA 1YY9C 1RZ8A 4KV5F 5J3HD 3FRUA 3EO0A 1OARL 5FYKU 4EXKA 4EQ2A 1TLKA 3DSNA 1IGYB 4KXZH 5F88B 4LHUD 1XGUA 4UBDD 3CDGA 3TN0B 4OD3L 1D5ZA 3VFTA 4DN4H 3KAAA 1J9CT 5JUEL 4MA3B 2J1KA 1CL7H 1JJUA 3AC0A 5IJVB 3QJHB 4J7RA 4PD4K 2IAMD 4U6HA 4YXLH 5I1AA 3GUTB 2HJKB 1LP9B 4K9EH 4UT9H 1ZLWH 1MOEA 4NKDA 2K9UA 2YD3A 5ADPL 5I2IB 4TRPL 2YUXA 1OAZH 5HYJB 3HG1B 1UYWH 1I7RB 4XHJD 4JJ5B 1OAUH 3HZKA 2XWBA 1QFUH 3K1DA 2OCFD 5EOTA 3VFTB 5BW7C 1ZLVH 2VC2L 2UUDK 3RNKB 1G9NC 5TQ0H 4NHUA 4UTAL 4LLQB 2WUBL 3LB6C 3H9YA 4P4KD 1KF9B 5C6TH 1JNNH 1C7TA 2MKWA 4JFDB 4K71B 4YFLI 5D1QA 5HGBA 4WCYL 3IDIA 4L1HA 3PQYB 3JV0A 5FKPB 4OLXL 4AG4L 3WO4C 3TJHC 5IFHL 3I9GH 2R23B 1FNFA 1QBMH 3MPCA 1U2CA 2AKRB 1CBVL 3T0EC 2BVPA 4GRWB 4WI8A 5JHLL 3IFNH 1S7RB 2H6PA 3PL6C 1A6TA 3DGCR 3RU8L 4G8FA 3EZ8A 1CDCA 3QEHB 1T2XA 1LVEA 1A1OA 2BSRA 2ZNXA 3QPQC 1KB9K 4LOUD 5B22A 3UPAA 5IMOB 1Y18A 5GZOD 4ELMF 3QRGH 1UCBH 3UTSD 5JLZA 1FPTL 2NR6C 2I27N 5BO1L 3VXRA 1A7OL 4XRCA 4P5TC 5F1IA 4YIQB 3MLSL 4YC2C 4ZTPH 4JE4B 4FQXB 2HLAB 2EKJA 1A14H 1BLNA 2VWEC 3MV9B 4KTDH 5D6CA 3PWLA 3ULUH 3P4NB 2W9EL 1IJ9A 3VGFA 4X9GA 1I8IB 2ZUWA 2GJZA 3HS0A 1X5IA 1S5IH 1NGPH 3OXRB 5T1DH 1F3RB 3WJJA 1V7NH 3QXTA 3QB7C 2JJTA 5JR1L 2D9QB 5E8EB 4HZLA 1LO4L 2DWEB 5I66B 2DLHA 3C5ZB 4WEBH 3WN5B 2IFGA 4L8SC 1C5BL 5F1NB 1AHWC 2KQNA 3UYPA 4WI3A 4LVNB 4NKMB 5FDYA 3FN9A 3JTTA 4LCWE 4GUPB 4FQJL 3GKWL 5F9OL 1ONQB 2E27H 2NTFA 2FIKB 4KKLD 2V9TA 5AZ2H 3VXQA 4OKVA 5CWSB 3EHBC 1V8HA 3D39B 1MAMH 1LEKB 4NBYB 1FV1A 1QEWA 1YNTB 3C5ZA 4CGTA 4BSVA 3HFMH 1CCZA 5J12C 4OF7A 3MBEA 3VWKD 1U8QA 3BPLB 1VEMA 3BH9A 2DLTA 2Z8WC 3V9FA 2G9HA 4ZNCD 3P30L 3L3JB 3RVWD 1F3DJ 1CXEA 2VIRA 1TTFA 5CJXA 3NA9L 3BFOA 1HH9B 1FZOA 5FO9B 2ZOLA 3BVNA 2XYCA 2GHWB 1B2WH 2BSSA 3MLVH 1BQLH 1OT1A 1INEH 3JWOC 1FNHA 3P77A 4LPCA 1KIQA 2JTDA 3T1WA 1JPSL 1RD6A 1X4ZA 1KG0A 2YSSA 4PJFB 4NZRL 1OWWA 1JN6A 7CGTA 1S5IL 2BC4B 2XQYK 2VQ1B 1MHHA 2RFXA 1ZLUH 2X89A 1P4IH 3MOBH 4U1GC 3AGVA 5ICYA 1CK0H 4HIEB 5IW1A 1I8KB 4CDGC 3H8NA 3LKSB 5J9PB 3SKMB 4O2EB 4A6YL 4X6DA 2J88L 3SJVE 2CLRA 5C6TL 2C3VB 4XNUH 4PR5A 2RFXB 4JPVH 5CIPA 4C83A 4LLDB 3MXVL 1TQCC 5I17A 1I8KA 2HG5B 4PJAB 1UADC 1XGTB 3UYOD 4DK6A 2JB5H 2P42B 3L3KB 4IRSB 3PE9A 4RX4A 5I1KH 2P4AB 3X14B 4P4KC 2JJSC 3RL1B 4HG4K 5ADPH 1MQKH 5LGHL 4HDIB 1CBVH 3G08A 4QRSB 1HKLH 2AJ3B 2NY3D 2YS4A 3LIZL 3SE4C 1FNGA 4MJID 1YPZE 4I0CC 4JRXB 1NAKH 2V5TA 5D2LE 4PJAA 3RHWF 2EO1A 2DQHH 4HF5H 4NNYB 2V7HA 1GOGA 2ICWJ 3FQWA 2ICEB 1PG7L 5ESAB 3MSPA 4HUXA 3T0ED 2AVGA 5HI3C 1FGNH 1J0IA 2A6KB 1DQMH 4LNRA 1A6PA 4PUBL 2HRPH 5EPMA 4JFED 4Z8FH 4KQ3H 2E9IA 4PJEA 1IC4L 1GZQA 4MNQE 3P0VH 3U36A 1R5WA 4JQIL 5TDOB 3S5LB 3SDCC 1UM6L 1C16A 3MGOB 5CBAA 1F6LL 1JGLL 1MCBA 3ISWA 1F4WH 2X4RB 1BHGA 2MSPA 5DD6B 5DD5L 4G9FA 3ZZ1A 3HR5A 4DN4L 5CFHA 1F6FB 1BVZA 3G5ZA 2O26U 3Q6GL 1OL0A 1L9MA 1JBJA 2WBJA 1ZKAA 4AEHL 1G7HB 1UH3A 1VFOA 4GW1B 4K23H 1F58H 1CD9B 2FB4L 4X5XA 4YGVA 3DX6A 3P4MA 2H2SC 4L4TB 4E41A 3Q48A 2GITA 2F5AL 1LDPH 4G8IA 3OKEB 1MCOH 4QXTB 4LHUG 3U0WL 1OB1A 4F7MA 1G7PB 1JPFA 2YEZA 3BWAB 3K4ZA 2D7OA 2FYYA 2VNCA 4JQXC 4DW2H 5DURB 4XCFL 5LBSH 1WFOA 4UUJB 3VXSD 2WMPA 4K7PL 3NFPA 3OX8B 3QZWG 2VN4A 1RU9H 2YA2A 3N1PC 4I18B 4Z7VF 4OCLC 1MI5E 3ARGB 4KK5C 5BV7B 1RK1A 3O4OC 1RI8A 4XPHH 4G7VL 4ODWB 2PTUA 5EWIL 3RZCD 2Z0BA 3F8UB 4PV8A 4EQ3A 3JUZA 5I1JH 5DEGA 4B41A 3VWKB 1ZHNB 1MPAL 3VD3A 4YXKH 2V17H 4LCCC 5IR1B 1RURH 2RJMA 2DI9A 4P59H 5E5MB 5E5UB 3ZE1F 5KVDH 1XF4B 4APQA 2DQCH 4HKJA 4WTZA 2OM5A 4QRPE 1T1WB 3JV4A 3KPQB 4QKXB 4R4FL 3TCLB 5HHNA 3VFRB 1RZJC 1HSBB 4YDLC 5IVOA 4LQFL 4NQXA 3H3PL 1I9RL 1V5JA 3QEUB 1A9BA 1JZ7A 4YHOL 2VZTA 2XIDA 1SM3H 4MAYB 2J7LA 3IVKA 2DBJA 4K7PY 4BSJA 4LASH 3LN9A 4P9HL 1BVLB 1K8IA 5EBLA 3P0YH 3EYUH 4OT1H 1PD6A 3EO1A 3QEUA 3STLB 5SV3A 4Q9RH 3IDXH 1WZ1H 3VXOB 1SJHA 1I75A 2EH8L 4Q6IA 3GMPA 4JY5H 2O61B 1JGEB 3R0MA 5DEZA 1QACA 1N6QL 3O4OB 2DTSA 3NCFB 3NPSC 1PKQA 4NFBA 5IB3A 1ORQA 3T1FB 1CT8B 4OIIH 1J87A 5D7IB 2VR5A 4Y8DC 1MHCB 4LCUA 1HI6B 2DYPD 4AIXA 5ESQA 1KTRL 2AXGB 2CLVA 2E7BA 3MREA 1OAQL 2F5BL 3BN9C 4G8EA 5AWNL 1MQ8A 1T21B 5D7LE 4P5MB 3PP4H 3N9GH 5I1HL 2NLJA 4KROB 5C0BB 4IOFD 3NCYP 1VADB 3S8WA 4GRWE 3V6FB 5HYFA 5FEBA 3RWFA 2GK2A 2OQJA 4FQQB 4L3EE 5GSVA 3GMOB 3IRPX 3VXPA 4YDLB 3RX8A 1H8SA 3KPMA 1IAIL 3PV7A 2EXWD 4QRPD 4PJ9C 3BKCL 5LXGH 5DI8B 3OJMB 1QPXA 5IVXF 3T8XB 2NLJB 4JJHA 5AD0B 2H2SD 4YE4H 5KW9L 1KCLA 4YDKL 4KJWC 3V6FA 1JK8B 3GMQB 5A2JH 3NACH 2EZ0C 2OBGA 5GQBA 3JBG7 2ORBL 4OZFA 4QHLA 3LEVH 4Z6AT 3RGVD 1KEGL 3SE9L 4PRPB 3ULSB 2DQHL 4HF5L 3OL2A 1B3JA 2NY2D 3W81A 2P45B 5GHWL 1XF1A 1D9KC 3FOLA 4HLZG 4R0LB 2PYFB 4XVJL 2XKNB 3T04D 4EUPH 2JCCA 1MF2H 3SPVA 4JFXA 5IMMA 4JFQA 1TENA 3MA7B 2XTLA 4NM8L 3RU8H 3FFCA 2HAZA 1TZGL 2ARWA 3ARYA 2IADA 1MEXL 3RJQB 4UOW0 2NMSA 3S3JA 5HHXL 5IEKB 4HCRL 2X9YA 3HZYB 3GJFH 4J4PA 2EXYD 1QQDB 3O9WC 5D7SH 2F54A 1CDIA 4ZS6C 4H20H 5GZOC 4P2YA 4PTTA 2Y7QB 1RJYB 2CSPA 4F8QA 4JG0L 3V4UL 1YEEL 3AU1B 3BW9B 3QPQD 4FQ2L 2JELH 5F7UA 1ZHKA 5ABDE 3ARBC 4HEPG 4JHAH 1YNTA 1S7SA 1CU4L 4XPAL 4I77H 1F2QA 1YEDA 2A1WL 3VRIB 4U7KA 3FTGA 1JRHI 3IDMB 4ZAKC 4XVJH 2DL9A 1CLYL 2LE9A 3MROA 4UV4L 3HAEH 2A6DA 5CJ5A 3BQUB 2AK4E 1FAIH 1BQUA 2BNRD 1T5WB 5TPWL 1MJUL 4RBPK 3R1GH 12E8L 2MQ3A 3FQRB 3O6KH 2IPTH 5CEZD 5E2TH 1A7QH 5E2JA 1NANI 3F5WB 2Y6SD 3QIBB 4I1NB 4U6VL 3P77B 5EC1B 4LIQE 5CUSL 3OF6D 1SY6H 1XEDA 3RTQB 1NCNA 1MWAL 4HJJH 1NC2B 2Z8VC 1MVUA 1L7TL 3A0OA 4X6DF 5D7JC 4POZD 2ZSWA 3WSQH 4M48H 1J1PL 3TZVD 1YEIL 5I1CH 1HSAB 1HNGA 5DJ0A 1FBIH 5ICYB 2L7JA 1J5OH 4F7TA 3D87B 1A1MA 4R2GB 1SHMA 2P5EA 1TJHL 2C1OB 4OM1H 4LVHB 1UZ8A 3U2SA 3REWB 3W0WB 3BZEA 3QDGD 3GSRA 2QBWA 2CLRB 3TBWB 1P7HL 2OL3H 3VFMB 3DX7B 4WY7L 4I5BA 4OCRL 4MJIA 3BYTA 3IJYA 1KB9J 1R3JA 1JPGA 1T7XA 2VRAA 3BKYL 5CCKH 5EB9A 2F8OA 2DMCA 1XIWB 1XGTA 5SWZE 1BF2A 1ZWIA 2DB8A 4JAMB 2PKDA 1NGYA 4H88L 1C12A 3U2SB 3BEWA 4HIXL 4NFCA 4UQ2A 4JY5L 5DS8A 5ITFA 1E28A 5KVGL 3LS5L 2MNUA 1FZMA 1HZHH 3GB7B 3DXAB 1J8HD 5CBEA 1RZKC 1AE6H 2WM0A 3B83A 3QUXB 5GGSA 2MCPL 4JRXA 4P3DB 4ISVA 1S9WB 1F5WA 5T3ZE 3V7AE 1NMBH 5BJTB 1NAML 5ESAA 4Y4HB 1EERB 1OAXL 5ICZB 3I6GA 4FQLH 1ORSB 5EU3A 1MCWW 3O81A 5TJWK 4Y5YB 1NCUA 1U8PA 1FAIL 5HDBE 1CGTA 3SGKC 3SKNB 3KPRD 2VLRA 4U1NB 5JOEA 4HJGA 4DKFL 3O6LL 2WW8A 3IU3A 5IMLA 2VE6A 1DN2A 2O5ZH 5E1AA 3TBVB 5L2KD 1A21A 3SCMC 1CYGA 3BISA 1D5XB 3V8OA 4I77L 4RIRB 5EN2B 3VG9C 5E95B 1OHQA 1NCDL 5F89A 5HJ3B 2A83B 3E0GA 2ADGB 1T89A 5E9DD 5JHDA 2HRPL 4NPYA 4NQDB 1MFCL 1E6OL 2AGJH 2R2HA 2BNQE 2EDJA 4U1LA 3QYCA 4Q6IC 5IFJB 5DD3H 1T20A 1SYSA 1JZ5A 3KNBB 1SJXA 1JIBA 2OJEB 4XPGL 3KHOA 1A2YB 1YN6A 4JFOB 3ZTJG 2VZ1A 3QXAA 1G7PA 5D70L 3S6CA 2X7LB 1PW3A 1SMAA 3MV11 1UYWL 5EDXA 1OAZL 2ADGA 3CXDL 3E1F1 3L1OH 1PY9A 4P46C 5K9QI 4Q9QH 3OKNB 5EO9B 3V6ZB 4PGCA 5JHDD 2FR4A 3MMEB 4OBSA 5E99H 1G1CA 4EI5B 1CQKA 3LKRA 1QSEA 3DX9A 3CSYA 5EIVA 4Q2ZA 4LEXL 1DQML 1KCVH 3QDJD 5D71L 1I3GL 4P23A 5KAQF 2VXQL 2V2WA 1PYWB 3NCYS 4U1GB 5C9JB 3VRJB 1MFEL 2CDGA 3KHQA 3O8XC 3WE6A 5I9QB 2Y72A 1S9XA 4ZNEA 3HUJA 4S2SB 3SJVB 4TTDD 3MJ9A 3SQBA 4N8CL 3PHSA 1CE1H 4U6XA 1NGQH 4G80A 2YXMA 1LP9A 5E9DE 1RUQL 3QDJB 4XNMB 1MQKL 3CVHA 4KK6C 1OGAE 1IGIL 2Y5EA 2UYLB 3C87A 4LPVA 1KBGL 3RIAF 1FSKB 1R5VB 1ZVYA 5GS1B 5HHXH 1TCRB 3BSZL 2JB5L 1I1YA 2BVTA 2CK0H 4JHAL 4I48B 5BVPL 2NY7L 2XWTB 1WCBA 1KELH 1XAUA 3C5SB 5IB2A 4GG6E 2BFVH 4HW6A 1YEJL 1FG2A 1SVZA 4UILH 3IDIB 3Q5YA 4FQXC 3PQYA 1BOGB 3PABB 4KI1A 4O2FB 4H0IA 3NIFE 3ECBA 1A6UH 1YEHL 4S1SL 1DBBL 2E7HA 3CVIH 5TF1L 4D2NA 4LHJB 1JWMB 2Y23A 3DVNB 4ZS6D 3GHEL 3KJ4C 3OKMB 3RVTC 3ZDXE 2OI9B 2R56H 4LU5H 1EMTL 1MJJA 4XNYH 4NUGH 4ORGA 3U4EB 4K8RH 1QSFE 4ERSL 3VE0A 3ULUE 3KYNA 4CVXA 1OTSD 2VXTL 4PLKC 1CT8A 2J8HA 1CFVH 5EZOH 5I1AB 1J88A 5IK3A 1XGQA 4OLZH 3BKCH 4NKDB 5LXGL 3BP6B 3WCYA 1I7TA 3DJ9A 3DX8A 5C92A 1MWAA 3IFPA 1WAAE 4X8JB 1QO3B 5E8PB 3ULVL 1LO5A 3UDWA 4AH2B 1DBAH 5D7JD 2RB8A 5F88A 5DMKA 4XBEH 3AROA 3UEZA 3FZUC 1NDMB 4MA3A 4KK8D 3GSQB 1GC1H 3N06B 5J11C 3KPPB 4R97B 1OAYL 5DGQA 1X5ZA 4MMZC 4X80L 4JO4H 5I1GH 2WQ8A 5CILL 1NJ9B 4PTUA 4XPFH 2FCBA 5D1XD 5DQ9B 1IZKA 5CSZA 4QRQA 3QFDA 4ZTOH 3F62A 3IDJA 5KVFL 3G6JF 2AABH 2IAMA 3QEQE 1KPRA 1T5XA 1B6UA 3B8YA 5H35B 4F9LC 1QBLH 4WUKL 4DN3L 1MUJA 1X5LA 3GSQA 4U0QB 2Q76B 1IGTB 4WV1C 3MRJB 3DO3A 4J6RL 5ETUB 2Y06L 1KGCE 1EAPB 4NUJA 4ZFGH 3QNXA 1QR4A 3ESUF 3HB3C 5EFIB 1UH2A 1FV1B 3TPKA 4PJ5E 5C1MB 3GJEA 2AQ3A 5IB5A 1S7UA 5DD1H 1I3RA 1NFDE 2CKBB 1YUHA 4ZD3H 5KS9A 3FFCB 4V1DA 2X70A 2KDGA 4G43A 1JVKA 4IRJB 1P6AB 2BSRB 4JRYE 4XCFH 1QRNB 2E27L 5KSUB 4MVBD 4OT1L 5IBUB 2OJZH 4V2CB 4H1LB 5C0EA 5F9JA 3SO3C 4G7YL 5IEHB 4K55A 4OZFG 3VI4F 4Y2DC 3AAZA 1EHLH 4XP9L 3CJJA 1OAKL 3JV6A 4HQQL 3CCHA 5F7WC 3LQAH 5L7XL 4MAUH 2YD6A 2ENSA 3DHJA 1JNNL 2P49B 2BRQA 2OLDA 5INCB 3ET9F 4N0CC 4Z7QE 3MCG1 2FJHB 4HULB 2CKNA 3MV9A 5D6CB 2CIIA 2JIXB 1QLRB 3FB5A 1MHHB 1U8JB 4X6CB 3FZUD 3I6KA 1JF6A 4M5ZH 2FH8A 5HHPB 5DRNA 2CK0L 4XCNB 2EEAA 1TVHA 4LSRL 4IHOB 4CNIA 2VMFA 4G6JH 4DVRH 4L4VB 3MROB 4Z7UF 1MCIA 5D1XC 3O6MH 2F19L 2XN9B 1XMWA 2C3VA 3JUYA 1NL0L 4ZFOB 2B8OT 1LNUA 2BVQA 3GNML 1AGCA 4HS6A 4PRPE 3F5WA 3ULVF 3MRGB 1KIRA 1BD2B 2O5XL 4O4YL 3F7VB 4OKVB 3I75B 1FC2D 1NFIB 4A6YB 3NFSH 4JHWH 1EJ6A 4QY8B 3QG7L 1RUAL 5GGQL 4O2CB 4F80A 4DGVL 5T1KD 2WANA 3OPZH 3DO7A 1OCWL 1A4KB 5MEQB 2HJFB 2NTSP 3VFOB 1K4DB 2JB6A 2DIBA 4KKBC 3VGAB 2PCPB 4HS3B 4FFWC 2OSLB 4ZQKA 5I6XC 1NEZG 4XBPA 4EN3A 1U8LB 3BJLA 3KJ6H 3NTCL 4WUUB 2X10A 1DP0A 1AXSB 1ZT4A 1YEFH 4HXBL 3GSWA 1XT5A 1FZJB 3D6GA 4MJIB 3BD4A 3UTSA 4P46A 4JDVA 4HIIB 1CVRA 1YYLL 2V2XA 5BVPH 1NCDH 5HSFA 2FGWH 2DM3A 1C5DB 3WJJC 4NQCA 5TDNA 4JAMA 5FYKD 1DEEB 2M1KA 2AI0H 2R8SH 5MENE 2EEBA 5D1XB 3SDYH 3PIQB 3KG5A 1JRHL 4R96A 3DI2B 3VXRE 4CUCA 4B7LA 4FZ8H 5ENWB 4DGIL 2CXKA 2F74B 3G6JA 4I9WD 2XICA 3BT2H 5KN5B 4JM4H 4FOMA 5DWUL 2HA1A 4P9MH 4GRLD 5JDSB 1JNLH 2X41A 2NXYC 4JHZA 1U3HB 3VJ6A 1N4XL 2ZOKB 3IKCB 1ZE3C 4KZDL 3MQIA 3DX6B 1DL7H 1W2KT 3V7AG 3EFDL 4LKCA 2Z92B 4HZLB 4GLRH 2XN9E 2B1HL 3DUUA 3MC0A 1E4XI 3MNZB 4NNYA 3O6ML 2IALB 4XZUA 4QXUL 4O51B 1TPXB 5T1LB 5GRVK 5E6IB 1J1XL 3L6FA 2KL6A 1MCNA 5GRJH 2J12B 3TPUB 4FNLH 3X14A 3IJHB 2FO1A 5FO7A 1NMAL 3VFVA 1ONQA 1WWCA 2PTVA 5DUML 2GJ6E 4XXCA 3W11C 3QIWB 1BQHG 4P2QE 1IGMH 1CLZH 2UZXB 4Y5XB 4KJYB 5KJRH 2Q1EA 2F53A 2W9DL 3V6OA 4ZOAA 3MRQB 3TWCL 5JHDB 4UNUA 3QI9A 3VXMD 4GW5B 4APQC 3QDGA 5J6GB 2NY1B 1EHLL 3VFVB 1QA9A 1JHTB 1R5IB 2IMNA 4ODTL 5HGAA 5IFJA 2DD8L 3S7GA 1WZMA 1EDQA 1GOFA 1CK0L 4FFWD 1HHJB 1WT5C 3DV4B 1D5BA 4W4OC 1LO4H 5FGBA 5HHOA 4FG6D 3RFZC 3CDYA 3G5YA 1OGTA 4ALAH 2XY1A 2IEPA 3MX0A 3BIBX 4IJ3B 3QISA 1BEYH 2QHRL 3HHRB 1R3IL 2C3HA 2YD1A 2A77L 1KFAL 2YEZB 2APWA 1KLGB 1OAXH 3MR9B 3PL6D 4OLVH 3OKLA 4PJHA 3ULUL 4D9QD 3WFZA 5EUOF 4EOWH 3CFIC 4PRDA 5CUSH 1WK0A 4RWHA 1CFQA 2ADIB 4NZTL 1DEDA 3AMKA 3HUJB 5IFAL 1G9NL 1M7IB 3HPJA 2DM7A 4KKAD 3RA7L 3VCLB 3TC9A 3MRLB 2GI7A 4N5EC 5I1CL 1RUPL 3E6HA 3B3IB 2H2PC 1EHXA 4QTHA 3T3MF 4DN3H 3MLZL 2WIIB 4PJHB 5I30L 2VZUA 2HN7B 1MH5B 1ND0B 1R5VA 1PKQB 1WTLA 3BAEL 4EDWL 4NBZB 2I07B 1TZHA 2QQLL 3WS3A 3Q5TA 4X98B 4TOYL 5CMAA 3ARSA 5EBMB 2D7NA 4BQ8A 1EEUA 4HKZB 4L8CA 1GGUA 1G7QB 5K59F 2MMXA 1RK1B 5MP6L 4PBWD 4GAGL 1N5AB 2YR3A 1HXMA 4OLXH 4AG4H 3BMVA 3P9MB 2R0LL 5DRZB 1M05A 1AR1D 3IAPA 4D0CB 3ROOA 1R24A 2D7QA 4I2XA 4M3JA 5HDOA 5EBMA 3SGJC 3FOMA 4PRHB 3DIFB 5C0FB 1BX2A 4GRLC 4LAQL 4UINH 3I85A 1F8TH 4OQTA 1W72B 3EJZD 4HS8H 3SDXF 9CGTA 3VFWB 3RAJH 1HYRC 5JPMB 3TCLA 1IBGL 1CDJA 1MEXH 1I7UB 1P84J 4YGAB