3CMOL

Hiv neutralizing monoclonal antibody yz18
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
210
structure length
210
Chain Sequence
DIVMTQSSSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVELLIYYTSRLQSGVPSRFSGSGSGSDYSLTISNLVPEDIATYYCQQYSKLFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title HIV neutralizing monoclonal antibody YZ18
rcsb
molecule tags Immune system
total genus 52
structure length 210
sequence length 210
chains with identical sequence X
ec nomenclature
pdb deposition date 2008-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoL01
5DFVD 2DBJA 5GGUA 3PWUA 1J1PL 5J13B 4FMFA 3CDGA 4FQCL 1YEHL 1Y6NR 3QEQE 2R39A 4X8XA 4LHUD 5E2UL 1ZSDA 4HWZB 4FQXB 4PTTB 1INDH 1KJ2B 3W9EA 1DQLH 3EGSB 1F4WH 2ZG2A 5GRJL 5GGQH 3OXSB 4NT6B 2FL5A 3K8LA 3V0AC 3WEXB 3G5ZA 5EA0L 2AEQL 5JDJA 1HYSC 4FQLL 4LOUC 1K6QH 3IS0X 3STZA 4KI1A 1XH3A 1VFOA 3MACL 2BSTA 5DJDB 3S4SG 1LP9E 5KG9B 5GGVL 2XWTB 1MFDH 3UYRL 2DQGL 2M1KA 4NQEE 3GMNA 2PW1B 2HVKB 1K4DA 1J1PH 3O41A 1QLEL 4OZIF 4FQCH 1YEHH 3TNMB 2R2BB 1KLGA 3EYVB 5E2UH 2XKUA 1OQOA 1XIWB 5FCUH 4PJ7A 3WHXA 1G6RB 1OAKL 4FHBD 1R3KB 1QR1A 2EDHA 5IG7A 2DI8A 2EDTA 3P9LB 4NOFA 3ROOB 5GRJH 2EIBA 1TTFA 2UY6A 2X4RB 3ZDXF 4LNRA 1U36A 1E28A 1NFDA 5EA0H 5EUOF 2Z8SA 3SDAA 1N4XL 4GSDL 1UKTA 1ZT1B 2EEDA 4AEHL 3S3PA 2W38A 3GSWA 1HEZB 4W68A 3PGDA 4N68A 3CD4A 5T1MA 5HVWA 4WWKA 5C71A 4ODXA 3W81A 1U95B 3U36A 4G7VH 3MACH 2FH6A 5GGVH 1HILB 1F00I 2B2XL 3TH4T 3MRIB 2DQGH 1L7TL 3V9FA 4PLOB 3QJFA 3G5XA 5EIVA 5KSAD 5JW5A 2R0KH 3QWRA 1QLEH 5BXFA 3RTQD 4NQVB 4QOKE 4AM0B 5I1AA 4OI9A 1OAKH 3ARUA 2VB5A 1X7QB 1URLA 3WNPA 4D9QE 4PJ5E 1LEIB 3GM0A 3W9DB 1NDMA 2XN9A 4LARL 5J6HA 5EO1A 2VN7A 1T6WA 3FZUC 1J12A 4DN3H 4G6AC 4GSDH 5HYIA 2NW3B 4TSCL 4AEHH 5C0EB 1P5VA 3F5WB 1QLRB 5IB1B 4UAOC 4RRPA 1FNSL 3IXTB 5DDHA 5IMMA 5GSVA 1IAKA 4ODUB 1C16A 2B2XH 4EUPG 4D0DA 4XH2A 1L7TH 1OTSC 1J10A 1J0JA 1PDKA 2DKMA 4LVHB 2ZUQC 4F15B 1EAPB 4LFHG 4EDXB 3U4EA 5E2WL 4V1DE 4HUUB 4FXGA 3VRLE 3G5VB 2IALB 1YMMB 3BO8A 4N90D 1OSZB 2JF1A 3H9SE 3T3PF 5AEAA 1TPXB 3VGFA 1XGPA 5CSZA 4OFPA 3QUYD 4ZUSA 1BIIA 3MX0A 1H5BB 2RJMA 5EORL 2LE9A 4XP6L 3VJ6A 4LARH 1PKQB 3N9GL 5CLTA 1RK0B 2OZ4L 3K81A 2FCBA 2V7HA 5D1ZB 4TSCH 2GT9A 4WU7B 4MJ2A 4FXKA 3CH8A 1CTOA 3C08H 1FNSH 2XKSA 1U2HA 5AAWA 4F8QA 4Q97A 3KXFB 3FOLB 1KXTB 1PYWA 4MXVF 5I8EA 4U6VL 2COQA 3CFBA 5C09D 4B7IA 2H41A 4X5XB 5SWZD 2HFFA 3QO1A 4PV8A 1JHTB 3VI4E 1JPFA 2VXQL 4JKKA 5E2WH 5ESVA 4UBDD 5DR5H 4UNVA 3LEYH 3O0RH 2X4QA 4WV1A 5J12C 5EC2B 3MLRL 1MRDL 1XGRB 3OKOB 5EORH 4JLRA 5K9KA 4HXBL 1NPUA 4ENED 3BJLA 4WUUB 4QXGL 1BFOB 3N9GH 2OZ4H 1MRFH 4HKBA 4DOHB 2WWMC 4C56E 5E2TL 4GFTB 4HH9B 2FJFB 2XWJA 1BZ9A 2IBZY 3QP3A 3VGAC 5GS2D 3MZGB 4MJIA 5TDNB 2MFNA 1OHQA 2HLAA 4MJ6A 1FORL 3FQXA 4Y4HB 4K9EL 5DJYA 4CU6A 4DUVA 1HHHA 5C2UB 3FL7A 3EO9L 3CVIL 1E4XL 2XTJB 5LG1A 1VHPA 2M8XA 1MCOL 3MLRH 1MRDH 2NY2B 3QDJD 4PLJC 2FR4B 2WIIB 9CGTA 4HG4K 4WTZA 3AROA 1PBYA 4HXBH 4BH8B 1MEXH 2GK2A 4PJHB 4QXGH 4N1EA 1BEYL 1JGEB 3OF6A 1F11A 1G7HB 3VFVA 4O2FA 3MLSH 1KB5A 1T0MA 1T1YB 3RVVD 5B38B 1A7QL 5E2TH 2J8UB 1CT8A 4PJEF 4F7EA 2EDRA 3H2WA 1T0PB 1R5WB 4IS6B 3SE9L 4UMGA 3MLZH 1Q9KB 5HGAA 5HYQB 3C8KA 3H42L 3FQNA 1EGJA 4XBGA 35C8H 3QEUA 1I8LA 1RJCA 5C0BB 4IEFB 5I16A 4PJBF 1NUFA 5BZWA 1FORH 2NW2B 3BZEB 1MAJA 3SHSA 2X1QA 2CLRA 2P5WE 3VXSB 2EXYD 2W0FB 3EO9H 3CVIH 2AJUH 4J8RA 3EOYG 1S78C 4KFZC 3KPMB 5F1NB 1AGDA 3RWHB 3SDYL 3V2AR 1S7XA 1MCOH 3ECBB 4NZJA 1QA9A 5JXED 5ITBL 3U9PL 3BWAA 5LCVL 2GW5A 5JORB 1BEYH 4QHKI 5HTSA 2CR6A 2XN9E 5E8EA 1P7KA 3AY4A 1A7QH 4QHNB 5HYSG 3IRZA 1TZHA 2Y1VA 3SDDA 3SE9H 1ZLSL 4XPHL 4BFEA 3H42H 3WS3A 2YUWA 5C08A 3MYJB 1YUHA 1YEGH 1FG9C 1G9MC 3IGAA 2HTKC 2KZ1B 1A21A 2FH8A 5IBLC 3QDME 3WN5C 4LQ1A 4PRPD 4WUKH 4FQHA 1N64L 1TZGL 2OJZL 5B3JF 5DVOA 3SDYH 4PJ8A 1RQ5A 3TPKA 3RNKA 4YIQA 2YSSB 5ITBH 3IJSB 4MQXC 1L9MA 2UY7A 4XTRC 4I0PC 3MMEB 3UJIL 3U9PH 1A4JB 5IM7B 3WJLA 4N1HB 3ZYIA 5C07A 3ZTJH 2HJLA 1C12A 4X4ZA 3DLQR 1GZPA 1EFQA 1MLCA 1XR8A 5CBEA 4CJ0A 3FMGL 3GJFK 2X4TB 3G6JA 4RMTA 4ZG1A 2C1OB 1ZLSH 4XPHH 4PJDF 5FXCH 3V0WL 4GMTL 4XNMB 3O6FC 1JZ4A 4NQCE 2VLRA 3STLB 4S2SA 1D6EA 4L8SB 3WFBH 2W9LA 3KPTA 1VSCA 5F1IA 3HC0B 1JNHB 1C1EH 1T7XA 2Z8RA 3BISA 2I26N 3W11D 1N64H 3HI6L 3NFPB 1TZGH 3NIDF 4FTVA 2ICCA 4NJ9L 3RVTC 1HOCA 1NC2A 4JAMB 4GAFB 5H2BB 4YX2L 3P0VL 1MCFA 3X11A 1OP9A 1EDQA 4KKCC 3UJIH 4RAUB 5HHMB 3VA2C 2WQ8A 4C4KT 1FJ1B 5D2NB 1ZWIA 2ZSVB 1J05B 4TNVK 1IEHA 3HUJA 4YHZH 1EJOL 2AEIT 3FMGH 5EZJB 2Y7QA 3F12A 1I1AB 5KVGL 4RISL 3ORJA 2Y25A 4K7FB 3V0WH 4GMTH 3P9MB 4KDTA 1B0RA 3BMVA 5FK9A 3ARTA 3T0BA 1RZJC 5HYSB 4A2LA 3LQZA 3HI6H 2IAMC 4QNPE 4OFYD 2HLFD 3ALWA 2FWOB 5BJTA 2BNQE 2CH8A 4YX2H 2Z93A 4ZYKA 1B0GA 2H3NB 1X5ZA 3QT2A 5EBMA 3HRZA 2CPCA 4WW2C 3WIFB 4ZQKB 1DN0B 3OKKB 4HMEA 5A16B 1P7HL 2SEBA 1TQCC 4X98A 1QFWH 3VI3F 5HGHB 1EJOH 1CGXA 4Y16A 4P3CL 4GO6B 4U7SA 2NXYC 3HNVL 4UU9B 5KVGH 4RISH 1NANH 5EUOA 3QQ4B 1LP9F 3MRJB 2I9TB 4JFEE 4XZUB 3H9ZA 3CK0L 2W65B 3JVGA 3QG7L 3MUGA 3RGVC 3BEVA 4IDJL 5DRWB 5CD5C 2DYPD 4KZEL 1JF6A 1EERB 2G5RA 1UYWL 3LRGA 4LSDA 1UM5L 3W5NA 2QR0B 1YPZA 4ZTPL 3T0EB 5IJKA 4OZFA 1TVHB 4JO3L 4KRPB 5CWSA 4LSSL 1D9KD 2CO7B 4LLDB 3PWNB 5JNYB 3E6HA 3AC0A 1I1YB 3DXAD 5ETUA 4P3CH 2CGRL 3BKYL 4LLUB 2WUCL 1T1WA 2ZNWA 4IRJD 4JPWL 4JR9L 3IXAA 3QI9B 1IBGL 3T0WA 4WGWB 3VWKA 4ZFGL 1RIUL 4OUOA 3CK0H 3QG7H 4X7EC 5I1EL 3L5JA 1RIHL 3KPOA 4JFQB 5B8CB 2EYSB 4JY4B 1UQSB 4OV5B 4CVZB 1FFNA 2F54D 3R0MA 1L9NA 1M05B 4DFIA 4KZEH 5E5RB 3OKDB 1J11A 4JRXD 3GJEB 1OSPL 3U2SB 2OR8A 1I85A 1P1ZB 2BVYA 4KXZH 5CJ8A 1UM5H 5D1QB 4ZTPH 1ZLVH 4L1DA 1HHKB 4JO3H 3HS0A 2A77L 2IWGA 4LMQE 4PD4K 4NNYA 5F7FA 1QLFB 4PJ9C 4JKPL 3UTSB 1G7MB 2IMMA 3ZMRA 2CGRH 3OAZH 3BKYH 3GMRB 4H25A 2WUCH 4XWOD 1AP2A 5TF1L 4JPWH 4PGEA 3G6JE 2XA8L 3W0WA 4JR9H 5HYJA 3X13A 4WNQB 1WBYA 1IBGH 4QRRB 4ZFGH 4MNQD 5EPMB 2E9JA 1RIUH 3T77A 3QDGA 5D7LB 2DI7A 4MDIA 2C7UB 2H32B 1R3JB 5T33L 4G8FB 1T03L 1D5BA 1RIHH 2NY0D 1UZ8A 4B0MM 2VAAB 4L3AA 3KHOA 3UBXG 4GKNB 1EIBA 3BZ4A 4QRSB 4OFDA 3O4OB 4ONOA 1WAAA 1OSPH 1OTTC 4JFOA 4LKCA 3CC5A 4LRNL 5E8DH 4OZGA 3HFML 2ICWA 1KTLA 3BIBX 4AH2A 4NHUB 3TNNB 3S34L 1A9BB 4WI2A 5MERB 4XVUD 5MEPB 3R8BB 1NBYB 3RX7A 4JKPH 3REVA 3U30B 3O3EB 4X7FC 2VTFA 3S97C 4BKLA 1AD9A 3QXVA 3QZWA 3HUJE 5TF1H 4L4VB 4EVNB 1RJYA 2XA8H 3KPSB 1KB5L 4KTEL 1N6UA 1CD1A 2R2HB 4P2OA 4NNXA 5T33H 1T03H 4U1SB 1RY7B 3AM8C 4LLMA 2NY4C 4CUCA 1EGJL 3EFDH 2VERN 4L3EA 2XQBL 3RVWD 2BFVL 4K7PL 1QSFA 3H3PL 4LRIC 4QF1A 4LQFL 1YN6B 1KNOA 1VFMA 4LRNH 5H8DA 1S7VA 3ARSA 2DLHA 5FB8A 3HFMH 1FZJB 3BYYA 3S34H 1J7VR 1TCRA 1YN7B 2EE9A 4JDVA 3LVEA 1S5IL 3TN0B 1V3MA 1DANT 2BC4A 2XXMB 4JVWA 3WDIA 4DKFL 2LU3A 3C5ZB 1EPFA 3O4LD 3MNWA 1A6PA 2J3SA 4DZ8B 3LEVL 3I75B 2LTQB 4HFWA 3LB6D 5B21A 1KB5H 4P9HL 1E6JL 4U1JB 4BFGA 4X6FA 4W4OC 1N7ML 4OM1L 3MFFA 1U8KA 5D8JL 3O8XC 4PJIE 8FABB 3QIBA 1E4KC 1EGJH 3U0PB 4BFBD 2XQBH 1FYTB 2PTUA 4OFKA 2BFVH 4K7PH 1T21A 4ESKA 4PB0L 3H3PH 4GW4B 4LQFH 5GS1A 1OL0A 5D6CB 3S3JA 1DBML 3SGDI 1GGBH 1YPZE 3NCMA 1WSST 2YPVH 2D7PA 3FN0L 4PBWD 3RVUC 5B3NA 1Z3GL 5HI5D 1S5IH 4KPHL 3D25B 4G5ZH 1KXQE 3UBXB 2F58L 1KIPB 4X7TB 4PY7A 5MHSE 2HYMA 5TDOA 4UQ2A 3ETBF 3LEVH 1W2KT 4XGZB 1MHHB 1L7IL 4Y5XB 1EV2E 2VLLA 4UNTA 5F1KC 1DQJB 4TULL 3GSRB 1CD9B 5F6IB 5HHOB 4WHTA 1N7MH 4OM1H 5C9JB 1UCBL 3DGCR 2JE8A 5D8JH 3KPQB 32C2A 2CMRL 5INCB 4MSWA 3BZDA 4RGMC 1MCKA 2ICES 3ARGC 4TRPL 5C6WH 4PS4L 2PN5A 4LSQL 1DQQA 4PB0H 5FGCB 3BQUC 1WEJL 1JTOA 4K3DL 4I13B 1UA6L 5KSUA 1J86A 3ZKMC 4KZDL 4MQTB 2GJ6A 2BHZA 3FN0H 5IOPB 2PKDA 5L7XL 3RIFF 1Z3GH 1AHWA 4KPHH 1A3RL 4P2QD 3DMMA 1GZQA 1AIFA 1KTDB 1YZZA 1G9NL 2F58H 1DBAL 4WFFE 1QFWI 5SWSE 4X5WB 3CDCA 2R2EA 1MQ8A 1NCNA 1J0IA 1CFTB 4N9GA 4R96B 1RHHB 1H3PL 3TYGL 4RAHA 1L7IH 3C60C 1QQDA 4PJGA 4TULH 3W0WE 5EU3A 1UCBH 3QXDB 1P4LB 1AGCA 1ZHNB 4F9PC 4YFLI 2CMRH 5CJ5A 5LKNA 3SDAD 1VACB 3CFKB 5EOTB 3PUCA 2EECA 3VE0A 1IRAY 1FVCA 2EH8L 1A14H 1PG7H 2XPGA 4TRPH 3UTPD 2DRUA 4PS4H 3QNYA 4LSQH 1YNKL 3HPJB 3TBVA 1Y0LA 1WEJH 4G9DB 4K3DH 1UA6H 2BNRE 1WAAE 4KZDH 4UIMB 5I73B 2M2DA 3MSPA 5F89A 3NCEB 3BDXA 2QHLA 4OZGE 3MLXL 4KK8D 5L7XH 3FB8B 5F1OB 1A3RH 4P2RE 3QWRD 5I2IA 2EE2A 1OOAA 4P59L 5I17A 1AQDB 3C6LC 1DBAH 1WWWX 2FEEL 1KJMA 2EO1A 1ORQA 1QFUL 3K8MA 3H7BA 3NGBB 5TQ2L 4BELD 3ELAT 1H3PH 4IBLT 4ONFL 1CF8H 4ZOCA 2YN3A 3TIEB 1XF3A 4LKXB 5LAXB 3VXMA 5E2VL 1F3RB 2Q87A 4QRUA 2XFXA 3L9RA 2W60B 1T1ZB 4F7CB 2FGWL 3KLDA 2KQNA 4UDTA 1YNKH 3GKWL 1K4CB 3L95B 2FEDD 1HWGB 4KMTH 4Z18A 4IIQB 3RQ3A 1CLZL 3QUXB 4KXZI 3B9VA 3CPLB 4OLZL 5DFTA 4W70A 4HWUA 4Z95L 1IEAA 1WTGT 3MLXH 3EZJB 2OLDA 2DQHL 2D9CA 3QJHA 4U3CA 3EO0A 2J88H 1JVKA 4P59H 1ACYL 2E7HA 2APWA 3Q48A 3DIFA 2OL3B 3MBEB 5TQ2H 3MV11 4MNGA 5DSCB 4ONFH 5CZVL 1ZK9A 2V7NA 4NZTL 3RBSA 1K5NB 4LPXA 5FOBB 5I0DA 3SCMD 1JF5A 1FFOB 1IEBB 1IM9A 3F8UB 3PL6A 5E2VH 1UZ6F 5IF0B 5E6YA 5K59F 1W0WB 2CKBB 2W59A 1FO0A 2JK5A 2UV3A 3S5LA 3VXRB 4POZC 1BJ8A 1G1YA 3EJJX 2X89D 1YEKL 4QNPF 4PJAA 1IC4L 2IPKA 3TM6A 5IEHA 3ZE0F 3GKWH 1E27B 5IHBA 2EKSB 3SEPA 3QFDB 5C1MB 3SDXE 1CLZH 3D69A 3KPRD 5DHXB 1T0NB 4OLZH 5DJ6B 4RGNC 2EDDA 2JTDA 3UC0L 2V5TA 1M71A 3CU7A 2DQHH 4Y5VB 3PWLA 1S7RB 3SGKC 1ACYH 1U8LB 5JW3L 1AY1L 4OZFH 5BVJB 4WEUD 4C83A 3LRSB 3V6OA 5DJ2B 2NLJB 2FSEB 3ULUC 4M43H 5CZVH 5BZDA 1CFSA 1AGEB 1MWAB 1YNTB 1YDPB 3PDOA 4N8PA 5DTFA 4GG8A 4CW1A 3SY0A 4TTGA 1AKJD 4GXUM 1OP3H 4ZOAA 4WHYH 2PO6A 4BQ9A 3HE7B 2BZDA 5IVOA 4NQDD 1YEKH 4JANA 3TVMC 1CLYL 1IC4H 3EYOA 5E5MA 2XRAL 3VGDA 2NX5E 5D5MA 5IMKA 5CP3H 4PG2A 4KJQC 5DJ8A 5JHDA 4PJXF 4MJID 1HSBB 4JFFB 1V8HA 4Z7QE 3IFLH 5DGQA 3UC0H 4ETQA 3U0TB 4OQTA 4P3DB 3WIIL 5JW3H 5J3HC 2ZUVA 1TVBA 3REWA 2P5EE 3E6FB 1IGJA 5BVPL 2DQJL 1BP3B 3MO1B 3DBXB 5T1KD 3PNWB 4O51A 4K2UL 4N0UE 5C0RL 2ZUXA 4HFUL 1A6VL 4KROC 1MY5A 4Z0BH 2ICWJ 5C0AB 2DWEA 3DO3A 5CHNA 1QEWA 1CLYH 2P8LB 2XRAH 2XZCL 3HG1B 3VGEA 3TJHC 1OB1B 4X6DE 1IE5A 5GGTL 2NY1B 3BPCB 4JO1L 5FYLE 5KVDH 4K8RC 3FT4B 4EI6A 2DQFB 3WIIH 2ADIA 1NUGA 1RZ8B 4E41D 3ALPA 4XP4H 2ZJSL 2DQJH 2OBGA 3PWJB 2WINA 4Z7VF 2IBBA 1XMWA 4F7MA 1U8NA 3Q6GH 3C6SB 4K2UH 4DFHA 5A43C 5C3LD 3RWGA 3NFNB 5C0RH 4ZO9A 4L29B 1DBJL 4HFUH 2J8HA 3MA7A 4YDLB 3X12B 5DWUL 1A6VH 1FZMB 1DVFB 3TT3H 3RIAK 3ULVE 3F7YB 2ENSA 4YO0B 2IQAA 3FT3A 4TVSa 2YD8A 4M8QB 3SDDD 5KN5A 2XZCH 4FQXC 1UKSA 1RPQA 5GGTH 5FO8B 3HR5A 4E42A 3OB8A 3M45A 5E1AA 5DK0A 2PW2A 3ARYA 5KJRL 3RWJB 3DX6B 4S0SD 1NSNL 2BRQA 4WHCA 2O5XL 3VA6A 4KVNL 3GSQB 3O3AA 3JV4A 3VGGA 4Z76B 4HV8A 3QFJB 1KLUB 4ZFOL 3SKMB 1T20A 3RPKA 1EUUA 4OKVB 4Z9KB 4G43B 4LAJH 1CICD 5HBBA 1X5HA 4PJ8D 4P4KC 5ESAB 4UQ3B 1AFVL 4HSQA 4MNGE 1KN2L 4HWEL 5B22A 1DBJH 4KDWA 3AMKA 3P40A 5DWUH 2Q6WB 1RJLA 1JUFA 1PZ5A 5C07D 4NQSA 4M93B 3VGHA 3CUPB 2OR7A 5DVKA 3V5DB 3X14A 1FH5L 4L4TB 3IDNA 4ZAKD 4A6YL 1XIWC 2A74A 5IK3A 2D31B 3GMQB 4CNIA 4PJAE 3B6SB 4P5MA 4RFEA 1MUJB 5KJRH 4O58L 2VLRD 3QQ9C 2XYCA 4EN3B 4PFEA 1NSNH 5D7SL 4HZLA 1IC7L 1CWVA 1S7SA 2O5XH 3L3GA 4KVNH 5D7JA 1KOAA 3QUMB 1GCFA 3CFDB 1G0YR 4KJWC 4TUKL 4WW2F 3MV7B 5BRZA 3BT2L 2Q20A 4RGNE 4FTVD 1FRGL 4LCYA 1NC2D 4LCIL 4IOIA 1OGTA 3V6OE 2JJTC 3ARZA 1C08B 1KN2H 2QSTA 4HWEH 3KPLB 2ZCHH 1RAMA 1SQ2N 4EI5B 2IBGA 4ZPVB 1AXSA 4PJIF 1BFTA 1S7UA 3PWPE 3CSYB 3H9HA 2AKRA 4OD2B 4OM0L 4UDUB 5CMAA 1FH5H 1CI5A 1VFAB 4U1KA 4A6YH 5LBSL 2V9QA 5FO9B 2YC1A 2LU4A 1MJ7H 1NGYA 2K9UA 5IW1A 3BD4A 2DAVA 3MLPA 5D7SH 3D5OF 1IC7H 2CK0L 2RQ8A 1D5MB 3BPLB 3RWDA 3DTXB 3MRQB 4RBPK 2EIZB 3NIGF 1MCWM 4JZNB 1QACA 3IKCB 2V5YA 3BT2H 4KKNA 2BVPB 2FX8L 1FRGH 3G04B 4LCIH 3I9GL 1U92A 5D72L 5CAYB 3VD4A 4NDMB 1TJGL 3HA0A 4JCMA 4F9LA 3ARQA 3KPNB 3TGXA 4LVHC 3INUL 4F15C 3P9WB 4FMKA 3NCFB 4G6FD 4OM0H 2X6MA 5M95B 1OD9A 3BMWA 5T3ZE 3U6RB 4YHPB 5LBSH 4HPOL 1DFBL 4XMPL 3VXUA 1CFBA 1GOGA 2I07B 3PXJA 1M7IA 1TPXC 4U1LA 4FFWD 5DRNA 1YEDB 1H5BC 4QXTB 1JK8A 3VXQA 3PHQA 4NSKB 4U6YB 2CK0H 1I7TA 3PF2A 1HXMA 3OXRA 5DEFA 4CMMB 1KPVB 3GSUA 4XXCA 4MAYA 2EDEA 3JTTA 2DI9A 2H8PB 5D1ZC 4RNRA 3FB6B 4F2MB 2FX8H 2HVJB 4ONHA 2I9LB 3JV6A 4WFHD 2R9HC 5FYKL 1F6FB 2R1YB 2NNAB 3I9GH 4Z7OE 2Z8VC 5D72H 3OR7A 2D4DA 1IC1A 5JDSA 2Y07L 4IOSD 3X3GL 5K9JL 1CXEA 1R5VB 4OZHE 4WI8A 3INUH 4OGYH 3TA3C 2ITDB 3QNZA 3Q6FA 3IAPA 5EOCL 4JZJA 1AJ7L 1N59B 4IHOB 4PB9L 4PRBB 5EBWB 3DROA 1J1OL 4HPOH 3BH8B 1DFBH 4XMPH 1KC5H 4QT5A 2F15A 2ESVB 3EIFA 1FO0L 5EU6B 5FKAA 1JV5B 4WO4A 3OX8A 3C09C 1GGIL 1BD2A 2DLIA 3VWKD 5HVHB 4PGCA 2ADGB 4S10A 1HINL 2GITB 3OKEB 1OT1A 2BXZA 4CMHB 2XXCB 5EOCJ 5J7CC 1LE5B 1HSAA 3ILPA 4WFGD 3N1QC 1EX0A 1J8HA 1DCLA 2AV1A 1FL6A 4PJEB 4PRPB 4PP1C 5AD0B 2R0WH 3B9KA 3K1DA 5E1HB 5FYKH 1U3HB 4NO0A 5JR1L 5EO9B 4FG6D 25C8H 4MCYA 4CAGA 2CO6B 2Y07H 3EHBD 3AS3A 3L3OA 3X3GH 5K9JH 1I7UA 2F5AL 3FOMB 4FQPA 4GBXA 4RMWA 4Y4HC 4JN2A 2GCYA 5DJZA 3D3VA 1AJ7H 4PB9H 1N5AB 2CD0A 4P23D 7CGTA 4LLYB 5T1LD 2UZIL 2ARJB 4XPGL 2R2CA 1KSRA 1F6LL 1FO0H 2NY2C 3KYNB 1WFNA 3O45A 3V7MA 3ULSB 3H0TA 4ZUTA 1ZLWK 3MR9B 4JFHD 1GGIH 4PRAA 1IAIM 3BVNA 3QDGD 2CDGB 2FIKA 1DE4B 4OGAD 2AV7A 2X44D 3L3KB 1T66D 1KGCE 1AGBA 1T7ZA 4HCRA 5IB4B 5DMGD 5HHPA 1K2DA 3VU2A 3EYQC 4S1SL 2QSQA 2KH2B 3SE3A 3DGGB 5FKPA 5L2KB 2HKHL 1UH2A 4AY0A 4U0RC 2F5AH 4J4PA 2MNUA 1A8JH 3MROA 3L7FA 3IDYB 4OTXL 5GZNC 3V95A 3QPXH 4M61A 2CRMA 2HN7A 2VLKA 2APVA 5MP6H 2UZIH 4XPGH 4KWUA 4TYUA 3SDXF 2VR9A 4OLYL 1H15B 5ICYB 4IOFC 4Z7UB 3IETA 3HLAB 4UILL 1J1XL 1IKNC 2BVEA 1ZT4B 1WCBB 3G6AA 5I66A 5IVNA 2R56H 2MCG1 4H0HB 2YPLB 2Z0BA 4EEEA 1UFUA 4OF7A 4Y1AA 4YNYA 1A6AA 1HWHB 2NYYC 4PP2B 5F9DC 2AXGB 4PRHB 3UDWC 1QSFD 4HIJB 3V4PL 1JL8A 3QO0B 1HHIB 3RZCB 2HKHH 3V6ZA 3GB7B 5E6IA 5CEZE 1WZKA 1PZUB 2YA1A 5DA4A 2CDEA 4YR6B 5EBLB 1WC7A 2VNCA 3IF1A 4BH7A 4OTXH 1U93A 2XNAA 4XCNB 4L1HA 2EDWA 1NFKA 3B9EA 4OLYH 1CDCA 4B41A 1I8MB 1RZGA 5D7IE 3VXUE 4NKMA 5EZLA 2JJSA 1YMME 3BP7B 3CDYA 3FB5B 1J1XH 4UILH 3W82A 4Z7QF 3KJ6L 5SWQB 1UXSA 1CD0A 3T2PA 2PR4L 2ITCB 2Y4SA 4XP1L 2XG5A 5CD3B 1T83A 2OK0L 1HN1A 2A1WH 2NY6B 5L2JB 4D8PB 2J1KA 3ARDB 3SDCC 1PKQE 5EUKB 3B3IB 3V4PH 2MPAL 3MV9B 4F37K 4NC2B 3OBAA 1W0VA 4RMVA 2IANE 1NCWH 1V5JA 1B3JA 5FGBC 5IQ7H 3DX8A 2PYEA 4QGTA 2EE3A 1BAFH 1FVDA 3KXFE 3QEQB 5DLML 1GAFL 3VFWB 4LVOC 4TUJB 2HT4D 4X6DF 1EVUA 5AWNL 5TPWL 1C5DB 1Q94B 4KVCL 4YBLB 3WD5L 4H26A 1T5XB 3D39A 1Q0XL 3V8OA 1NJ9A 2CDFA 5C0FA 1I4FA 4JRYD 4L8CA 3KJ6H 5C8JA 3D2UA 2BVQB 5D2NC 1BD2E 2E9WA 5IQ9A 5IV2B 4XP1H 2OK0H 1DEEA 1DBKL 4L9DA 4FQQA 2JKXA 1EHLL 5D96C 1P6AB 1I1AC 3BP4B 5J1TC 4HIHA 4MDJA 4PRID 1A7NL 3LKNB 1A1NA 3EAKA 2MPAH 4DOHE 2AJXL 2DD8L 3DUUB 2HMIC 3EFFB 4G6ML 2XZAL 3TFKD 1H3XA 2CIKA 3CMGA 3LRHA 4NQEB 4FS0A 4XMKL 1W72B 4AQOA 3T0DA 3BW9B 3C5SB 3O6LL 1UB6B 4ZUWB 2WBJD 1MFAL 4YPJA 2DWDB 5DLMH 3HI1A 1GAFH 1F4YL 2D7MA 2PCPA 3STBA 5E56A 3VFTA 1GHFL 1WT5C 1V7NL 1FHGA 3QUZB 4KAQL 2KPNA 1TXKA 4W6WB 3K4AA 3V5HA 3WD5H 1VEPA 1XR9A 1Q0XH 1JZ3A 3QPQD 4OF8A 4M7LL 5AUMA 4J3TA 3Q2CA 5IBUG 2ED8A 3ARFB 4AT6B 3TZVB 2LFGA 3JSSA 3WLWC 4DCQB 2OTUB 3WFDL 2Z91B 1DBKH 3O2WL 3LKSA 4Y4FA 4PV9B 1A7NH 4HIIB 1J0ZA 3CIQA 5IB2A 1NKOA 2AJXH 2DD8H 3JUZA 1N8ZA 4G6MH 2XZAH 4C54A 1H3GA 4XMKH 2UWEE 4QGYA 4YDIL 4ZNEE 1XF2A 3O6LH 3S96B 3D85D 3T0VA 1UH3A 3P77A 5ID1A 4MNHB 2R69L 2VE6A 3HMWL 5D9SA 1I9JL 1F4YH 1P7QB 1GHFH 2I60L 3PABA 5KANI 1OVZA 1V7NH 2YOCA 4WI9A 4KAQH 3BUYB 4ORZC 4QO1A 4HDIB 4QTHA 3WDHA 1FZOB 1CVRA 3RKDD 2VLKE 1Q0YL 3SBWA 3QQ3B 3FFCB 3IU3A 3MGAA 3T0EC 4EXKA 4PJ5B 4M7LH 5C0CE 3OWEA 2Y23A 5JOFA 3VXMD 4IMKA 1T1XB 3DVFA 3RJDA 1QSEE 4APQB 3MNZB 3WFDH 3L3IA 3KS0J 2YRZA 3HE6B 3O2WH 5J9PB 4KU1A 1IC5L 5DHVA 1VEOA 1BF8A 1ZGLA 3QI9C 5FM8A 1IM3B 5F9JB 4PGBB 5F71A 4YDIH 1A4KA 1TQBC 1CLCA 3ULUF 4NZUL 2VZVA 3MLTB 4MWFA 3N50A 5EBGA 5B8CC 2IH3A 5FYKD 3BGMB 3QIUA 2R69H 5CZXD 1H0DA 4GRLD 4V1DB 3T0AA 1I9JH 4G9FA 1JJUA 2ATPB 4OSUL 4JHWL 2I60H 5IR1A 1U2CA 3H9SB 5FF6B 1KPUA 3ILQC 1A6UL 2X70A 3H3BC 4G42A 2VXSL 3O9WA 2OQJA 3Q3GA 3LEXB 1A64A 3G08A 2D7TL 4CVWA 2CLVB 1BF2A 3V7AG 3AAZB 4MX7B 4TQEL 4MD0B 1IC5H 3LKOA 4UB0L 4GAYA 4HS6B 3H3KA 5JPNA 4MA7H 3TO4D 4Y2DB 4EKXA 1UJTA 4W81A 1YECL 4KQ4L 4U3HA 3KWWB 5IBUB 4NZUH 1LO5B 4EQ3A 4KHTL 3VFRB 5HHVL 5GGUB 3PWUB 3CDGB 4X7SL 4OSUH 4JHWH 2PXYC 1JWSA 4NM8L 4AL8L 3OKMA 1T04B 2BOBA 3BIAX 4Z78B 1X5XA 1ZSDB 3O4OC 4RRPG 3RP1A 3BAEL 1PKOA 1A6UH 5EG6C 3W9EB 1ZE3C 3D39E 3RHWF 2ED9A 4BA8A 2VXSH 2FL5B 5A1AA 3G5ZB 1MCLA 2FHCA 2HTLC 2D7TH 3CGTA 4GG6F 4TQEH 1UGNA 1T89C 4UB0H 5HHME 4ZUUB 3MGTA 4R2GC 3EOAB 5FUCC 2XY2A 3STZB 2BSRA 4HCRL 2BSTB 1YECH 4KQ4H 2DBLL 4N8VA 1P4BL 4PJCA 1S7WA 4OZHF 4QOKD 4RX4D 5F6HJ 3GMNB 1BIHA 4EJ1C 1AXIB 4KHTH 5GS3A 2DKSA 3M07A 3FQUA 3O41B 3F65A 1AO7E 4X7SH 4D9QD 4NM8H 4AL8H 3CFEA 4AENA 3JWNC 4KK5C 4PJ7B 3WHXB 1BZQK 1PG7W 3PE9A 4YHOL 3BAEH 3OHXB 4FZ8L 3B2UC 1OP5K 1NQBA 2DQTL 2X4PA 2AXFA 4D9LL 5A3ID 4LNRB 3DV6A 4WTWA 3TN0C 5GXBB 5F88A 1E28B 1T2QL 4JFYB 4J1UA 3ARBD 3AS2A 1GSMA 4F58H 3C5ZC 3MRFA 3AGVA 3ZKXB 3GSWB 3RZWA 3RDTA 3PGDB 4OAWA 2LTQC 5T1MB 4WWKB 2FECL 3RL2A 5DI8A 2VDOL 4HCRH 1MI5A 2DBLH 1SMAA 1P4BH 1BFSA 2PETA 3UTTA 1IGML 1PGRB 4HK0A 3G5XB 3IDUA 4P5TA 5JW5B 1T22A 5ESQA 4HJ0C 3U46B 4WCYL 4XNYL 3R1GL 5I1LB 5IIEB 1G0DA 3MV8A 2A38A 5I1AB 4U33A 4XC1L 5IFJA 4NZDA 3IDIA 4U7MA 3NACL 4FZ8H 3DUSA 2DQTH 5F96L 4D9LH 3T08A 3IRPX 2XN9B 1NFIA 5CCKL 5J6HB 5EO1B 2HT2C 3QWOB 1ZMYA 1T2QH 2YD2A 4ODWA 3VH8A 5FV2A 1FNFA 3G6DL 4OCMC 1EFXD 3LOWA 4NO2A 1VDGA 5T3XE 2Y72A 5DDHB 4Y5XC 5IMMB 5GSVB 1IAKB 3HPLB 4G3YH 2BY1A 1F6AA 2VDOH 2BERA 1VA9A 4MGXA 4KKLC 4D0DB 3LZFL 1IGMH 4WTZG 4XH2B 3CSGA 1FNGA 3RWEB 5CP7B 3T4AA 3QDMB 1JWUA 1RIVL 3IAQA 4WCYH 4XNYH 3QH3B 3SJVE 3O11A 3R1GH 3WBDA 1GGUA 3KJ4C 4MD4A 4FXGB 2VLME 3L3HB 2ZUQB 1TETL 3CZFA 5E94A 1OQXA 4XC1H 5CSZB 4C56D 3NACH 1A3QA 1BIIB 2JCCE 4NRZB 3OSKA 5F96H 4ZUVA 3WNOA 2Z31A 1QG3A 3VJ6B 3OGCA 3ZE1E 2R4SL 3O3UN 4NZRL 5EULV 5LJYH 1MCIA 2FZ3B 1HYSD 3IVKA 4LOUD 1G9MH 3ARGA 3DV4A 2V7HB 2KKQA 3G6DH 2GT9B 1NGZA 3E2HB 4FXKB 5JXAL 3GRWA 1H9VA 3BQUA 1T7VA 5HD8D 1OM3L 3BGFC 4M4RA 1RVFL 4NQCB 2NTFA 2R1WA 3GSXA 4UUJA 1KJVB 2V5RA 1CZ8L 4PJFA 1PYWB 3FCTB 4XRCA 1X3DA 5I8EB 5JHLL 3CFBB 1KFAL 5A2FA 3SPVB 4QRRE 1RIVH 5E4IA 1OPGL 3QO1B 4PV8B 1XF5A 2W0LA 1EH9A 1JPFB 1WZ1L 2BCKA 2NZ9C 1OAXL 4IRSA 1KCRL 5GJTL 2DMKA 4M6OL 1BJ1J 3JXAA 4WV1B 1VGKB 3D18A 5EZOL 4JLRB 1NBZB 2R4SH 5CJBA 3VXOA 3I85A 1GGCL 3LY6A 1UM4L 3MJ9H 3MOAL 4GT7A 3CZJA 5JXAH 4WW1A 1G6VK 1NUDA 2BMKA 3OR6B 5DYOB 1OM3H 2P5WD 3CMOL 5EFIB 4G8GA 1RVFH 2KZWA 1BQSA 2F53A 1BZ9B 3CVHA 2G5BA 3QA3A 2UYLA 5JHLH 1K3IA 2BDNL 4JPIA 4P4RA 2HLAB 4MJ6B 3FQXB 1KFAH 5EU5A 2DQDL 5DJYB 1OPGH 5DHYA 4R0LA 5D2LA 1JHKL 1WZ1H 5ICXA 3V52L 1OAXH 2BNQB 4TUOB 1KCRH 5GJTH 4M6OH 4P46A 2OTWA 4Y4KC 4D9RE 4IIQC 2GTWB 3VFUA 2EC8A 4QYOB 3DHJA 2V2WA 5EZOH 3WIHA 4M7ZB 3RPIB 4YGAB 2AABL 1GGCH 4G6AD 1UM4H 3HAEA 2J5LB 4NPYA 5EO0B 4O2FB 2P24B 1JYWA 4OB5L 3NCCB 5MEOA 1EBAA 5C0DA 3MBEC 1CT8B 3FB7B 4Z0XA 1QO3A 1MREL 1RZJH 3CMOH 4ZO8A 4R6UA 5HGAB 4UINH 3C8KB 1FL5A 2VQUA 3FQNB 3ZKNC 4XBGB 4XCFL 4QRPA 5I16B 1OTSD 1AR2A 2BDNH 5BZWB 1MI5E 3WCYA 5KSVA 2H1PL 4BSVA 3UTTE 4LCWA 2DQDH 4KK9C 4BUGA 3BESR 1LVEA 2UZYB 2Y9RT 1JHKH 3U7YH 4GW1A 3V52H 4J8RB 3GI8L 3WLBA 2GJZA 4GRMB 1PQZA 5I71C 1IGYA 5ISZA 5JIKA 3M1BA 3EJYC 5BS0A 5DQJB 1YJDC 2I24N 2AABH 1I7RA 4NFDA 2DQUH 3TESA 1CL7I 4Y5VC 4PGZA 1Z0NA 3N1PC 4ZPTA 4KJYA 5E8EB 4PJHF 3DWTA 4OB5H 3MREA 3O2VL 1U8HA 1CGVA 1MREH 3AREB 3OB0K 1BVKB 4LHUA 5IEKA 2J8UF 1HQRA 5FHBL 5C08B 4XCFH 1YUHB 1MCNA 2BY2A 5DHVH 1OT2A 4LPTA 2CRZA 5I76A 1MHPH 5EU4B 2MKLC 5I1IL 2H1PH 3QIWB 5SX4H 2IGFL 3HE7C 4HC1L 5JO5B 1J8HD 3L5IA 5DC9B 5C0IA 2XZQL 4FQHB 5GHWH 1CIUA 1U0QA 3KR3L 4NO0D 3JWDL 4AMKL 1XZ0B 3BXNB 3RNKB 4YIQB 3WHE0 4NN6B 4JM2B 2WBKA 3V0VA 5HVFB 3F6LA 2APFA 4S1DC 4YDJA 3FO1A 4U2YA 1DUYB 2ZOLA 2GYSA 5C07B 2HJLB 1C12B 2WWMD 1GZPB 3D3VD 1AGFA 1MLCB 1XR8B 3O2VH 5KSBA 5MENE 1QYGH 3G6JB 5IB3A 2YKLL 3UXFA 3F62A 4ISVB 1IAOB 12E8L 5FHBH 3Q5OA 4QCIA 4UNUA 4OZFG 4S2SB 1D6EB 4M9PA 5I1IH 4PD4J 2IGFH 3ARRA 4HC1H 5KVFL 5E99L 1O5DT 5IVXE 4OD1L 2IC2A 2XZQH 4N1CA 1HOCB 2NY1C 1XGTA 3KR3H 4Q9CA 3EDDA 4PLJD 4AMKH 4HS3A 3KLAB 1GIGL 2WANA 2AJZA 3GMPA 4HUWA 3X11B 1LEGA 4NYLA 4OCRL 5ALBL 4WRLA 1GRWA 3FONB 2XKNA 4O2CB 5CJQL 1ZWIB 2WWKO 1NC4D 3O81A 2VQ1A 4JFED 5KSAA 1X5JA 3RTQC 3TBSA 3HUJB 2YKLH 1NAMA 3HC4H 1ZLUK 12E8H 4LCCA 3RU8L 4GG6A 2F53E 1H3UA 4YDLC 1A6WL 1ZVYA 2O61A 1DVFC 1B0RB 3WUZA 3RJQB 5FK9B 2G9HA 5KVFH 1ITCA 5E99H 3RUGE 4Y1AD 4OD1H 3QXAA 4TVPE 5D2LE 5IROA 3IJYA 1EXUB 3K46A 4KRLB 3UJTL 1VGEL 5GSRA 4P2CG 5EC1A 1GIGH 2MQCA 4MVBD 2IAMB 4WI5A 3RWFA 2Z93B 4ZYKB 2VSDA 4FP8L 3HRZB 4K71C 5ALBH 5HGDB 1H3VA 2QQLL 1G9EA 4WGVB 4BSJA 5CJQH 4CN4A 2C3XA 5DUBA 2SEBB 4X98B 1K3ZA 4HWZA 3PHOB 4H0GA 2AXJA 4Y16B 4PTTA 1RUKH 2EDXA 4I0CC 1CGSL 1GYAA 4PGDB 3OXSA 3WS6C 3RU8H 4BK5A 2NXYB 2HTKD 2RCSL 4YPGA 4PJIB 1A6WH 3WEXA 4LMQI 3QUYA 4YAQB 1OW0A 5HHNB 5IBLD 4M93C 2J12B 2D0FA 1OP3K 3SGJC 2YHGA 4YXKL 1Z6JT 2C26A 2UVEA 4ZOEA 1CK0H 4ZMAT 1D5ZB 3VXRE 4HUVA 3QZWG 3UJTH 1VGEH 2X2YA 2XWTA 4MQXD 2WLYA 2E9BA 4XTRD 1YPZB 4I0PD 5CGYD 4EN3C 4FP8H 4TOYL 5CWSB 2QQLH 3HZVB 2AK4D 2PYED 3LPGA 3T65B 1CFNB 3S36X 4PRNB 4TNVF 2R8SL 3E6HB 3DRTA 5C09A 3EYVA 5SWZA 1KLFA 2E5EA 1R3KA 4X4ME 3P9LA 4L8DA 2DM4A 2LAAA 3RY5A 1WVZA 1CGSH 3ROOA 3O6FD 2X4RA 3IXAB 4K3JL 2RCSH 1A9EB 5K9QG 3GRWL 3DI3B 5B39B 2AP2A 3PV7A 3KPOB 3BP6A 3L5XL 1ZT1A 5CJXC 4X8JB 2EDJA 1YEJL 4JREB 4JY5L 1NEZB 4LEXL 3RVTD 4YXKH 5KAQG 2YWYA 4WI7A 2R4RL 4CVXA 4JVPA 4Q6YA 1ZEAL 4RMSA 3RWIA 2ED7A 3WO4C 4KKCD 1J5OL 1DQDL 1CDYA 4TOYH 2H2SC 3IDJB 3V6FA 1BZ7B 3HS0B 1SM3L 3BPLC 3HC3L 3SOBL 4J23A 1BWWA 1CXFA 3B9DA 5SWSB 4R7NA 4WFED 4NQVA 2I25N 4EDWL 2CR3A 4AM0A 3ARXA 2APBA 2QADB 4JFDD 3ZSTA 1QZ1A 1X7QA 1AP2B 4E9LA 1FL3A 4PGEB 4KUZL 1KIQA 3W0WB 2HH0H 5HYJB 2VAJA 3X13B 3GMOA 3W9DA 3SE8L 3T77B 3QDJA 3GRWH 1NMBL 4MDIB 3L5XH 2A0LC 4K94C 1ETZA 1YEJH 2MQ3A 3F5WA 4JY5H 4QHMB 1KF9B 3CVHL 2DM2A 4LBEA 4LEXH 4KMQA 4Q9BA 3BZ4B 2R4RH 4ODUA 2QSVA 5J89A 4NO3B 2BNRB 1ZEAH 5C0AE 2YMXL 1ULVA 2BSED 2P46B 4JFOB 4LKCB 1J5OH 1DQDH 3CC5B 2CXGA 2HT3D 4OZGB 3ZE1F 2ICWB 1KTLB 4AH2B 1SM3H 1A5FH 4P2RB 4TPRL 3SOBH 1LO2L 4YUEH 3G5VA 3QXUA 3REVB 4NC1C 4EDWH 2F8VA 4BKLB 1XAUA 5D6DA 1AD9B 1JN6B 1SBSH 3VFSA 4KUZH 3T0XA 3P0GB 1CD1B 3SE8H 4OCSL 2VZ1A 5ELIA 1NMBH 3RGVD 5JXEA 1IVLA 4P2OB 4J7RA 1TVDA 2ZUYA 3PDDA 4LCUB 1ZXQA 4HD9A 4LLMB 5CD5D 4L3EB 4HLZH 2JB6B 2V6HA 3CVHH 1IAII 2NY4B 4LLAA 3UJJL 1CXIA 3QCUL 4WWID 3E1F1 2YMXH 1KNOB 2Y6SC 5TFSL 1S7VB 4O4YH 5MHSD 4XVJH 4JO4H 4TPRH 4CMHC 4FQ1L 4LK4A 1LO2H 1WZLA 4M5ZL 5CIPH 1S9XA 1KB9K 1LDSA 1I3RA 3MNWB 1U3HC 4YBHA 2X42A 4ZODA 1A7RL 4JE4B 4JJ5B 2C9AA 3VCLA 3HAEH 3OKOA 3EOBA 1OLLA 1VENA 4DVBA 1LNUA 3BPNB 4X6FB 2X1PA 2WBWB 3MFFB 3O9WD 1U8KB 2WV3A 1JZ6A 2AJ3A 4R90H 3QIBB 4UOW1 4DKAA 1JZ8A 4PBVC 4HH9A 3FQWA 2C3WA 1T3FA 3KLHD 3WFHA 3UJJH 3QCUH 1T21B 1G7QA 3QQNA 5HPOA 1L4IA 1MLBA 5E00A 2ARJQ 5TFSH 3A6OA 3ULUL 4U6HA 4KJPC 4RMRA 3LQAL 2WMPA 2EYTA 3B4NA 4FQ1H 4PJ9D 1ZGLM 2VITA 1KELL 4NQUA 4M5ZH 4QXWA 4HKJB 3T8XB 3TWCL 5C09E 4PY7B 3WFZA 1WLHA 5TDOB 3C2SA 4UQ2B 1A7RH 5SWZE 1HH9A 5KVMC 2WIIA 2VXUL 2VLLB 2AAVA 2APTA 4PJHA 4WHTB 3NVQA 2Y36H 1JGEA 2WSKA 2YD3A 1Q9OA 2JELL 1NMAH 1G7HA 3T04D 3O3DA 1JGLH 4X6CA 5I6XC 2LAGB 1NCTA 5B38A 2J8UA 4MSWB 2H45A 2EH7H 1KG0A 1NL0L 2HP4A 3KPPB 3GHBH 1OTTD 1DQQB 1YYLL 3LN5A 5ILTL 2NW2A 5HI3C 5GS0L 1S9WA 4X9HA 3ULUH 1CDGA 3UEZA 1ZS8A 3VXSA 2NY5L 2GJ6B 4HK3N 2CK2A 2W0FA 5BO1H 3GKZA 3PWVB 1NLBL 4RDQG 1AHWB 1JWMB 3DMMB 1GZQB 1AIFB 1KELH 2P5EB 3S5LG 2VDLL 3RWHA 3TWCH 2R23B 1JPGB 4P5KB 3DUHA 3ECBA 2R2EB 4N9GB 5F97E 2VXUH 3CFCL 5HHXL 4N0UB 4OFYA 1QQDB 3RZCC 3M8OL 1K9TA 1ERNA 3SKNA 1QRND 5JORA 1BLNB 5EU3B 1X5IA 3C60B 1Q9LA 2JELH 4RMQA 1NAML 1AGCB 4U1MA 3QDJE 1EZVY 3UPCA 3TBTB 3VE0B 1FVCB 1M7DB 1NL0H 2XPGB 1A1MB 3QNYB 5D4QA 1Z0MA 5DUML 1BX2A 1JI1A 3TBVB 1Y0LB 2W1NA 1LQSR 1JRHI 5ILTH 5GS0H 2NY5H 5F89B 4NBYB 1D5IL 4P5TD 1NLBH 2AK1L 2DF3A 4D2NA 3AMLA 4M00A 5I2IB 4MCZA 2NY6C 2VDLH 2OYPA 3ARDC 1KJMB 5D93B 3ZYZA 3UZVB 3CFCH 5HHXH 3AU1A 3IJSA 4LPUA 1ZTXL 4Y19D 3Q5YA 1INEL 2RGSA 3M8OH 3MMEA 4K23L 3U48A 1A4JA 2CUMA 1XF3B 3MTRA 3O8XD 1ROWA 1KJ2L 1NAMH 2A6DB 3OKLA 5FYJL 4DGVL 2DJUA 4L3CA 4ZNCD 1MCEA 4HMCA 1D9KA 5IVXF 4U1NA 1Q9WA 4DVRH 4K8RH 3MRHA 2DICA 5JOPD 4YBLC 4K07A 4UDTB 4G6JL 5A2KH 3JTSA 2E9IA 3HZKB 1WCQA 4NJAL 4L8SA 5IMLB 2ZKHL 1JNHA 3HC0A 4C4KO 5IFHL 2OZ4A 2C1PA 3RVUD 2GKIA 1D5IH 1IEAB 2AK1H 3OZ9L 3AFLA 3QJHB 3EO0B 4M1CC 1U41A 1HXYA 1YMHA 2BRRL 3DIFB 3GFUA 1MSPA 2F54A 3QSKB 1OGAD 4MNGB 5DQDL 2V7NB 5K9OB 2QJDA 1INEH 4MQ7A 5IGXL 1MQKL 4PRPE 5FCSH 3MNVA 4JRXA 1FJ1A 1IM9B 1A7BA 1G6RL 2EDOA 2OMNA 3LPFA 3AUVA 2CUIA 2NX5D 3PL6B 4XBEL 5DEGA 1KJ2H 5FYJH 1QBLL 4DGVH 4OLUL 2X9WA 1J05A 3PG2A 1CIDA 2JK5B 3S5LB 5ANME 4Y0GA 5IWLC 5EZJA 3ARGD 4UOW0 4D0BB 1EAJA 1Y18B 2YR3A 4RFOL 4EOWH 2A6KB 4PJAB 2IPKB 3LKRA 5IEHB 3BQUD 2CJUH 1B4RA 3MGOA 4G6JH 5F7NC 2NZIA 2FJHB 3ZKMD 4KH2A 4NJAH 2P43B 2YA2A 3D69B 3ET9F 4WENB 2ZKHH 3LD8B 3ARFC 3KNBA 3TZVC 2NY0C 2VDQL 1M71B 4LDEB 2BK8A 3PWLB 4RGNB 2VR4A 2AQ3A 2BRRH 2VLJD 1BQLH 4ZXBB 2W0KA 5DQDH 4K9EC 1BOGB 2H3NA 1CFSB 5BZDB 5IGXH 1II4E 1FNEA 1MQKH 5F70A 2AI0L 1CDHA 5DRXB 1G6RH 5DO2C 4MYWB 1J0HA 1QBLH 3PWPB 5DTFB 5B4MC 4OLUH 5A16A 4CW1B 4HZAA 3SY0B 4XVUC 5BOZG 5HGHA 1R24B 2PO6B 1F4AA 4G6KH 4RFOH 4JANB 2AERT 2BX5A 5FIEA 5E5MB 5JQHC 3I3DA 1Q1JL 3MRJA 4TN9A 5IMKB 4XZUA 4H8WC 1RD6A 5JHDB 2ZUSA 3QEGH 3UMTA 2Q3AA 4APQC 4CJ1A 1DSFH 3TBWA 2VDQH 4MZ3A 3SN6N 5J6GB 3C6LD 2W9EL 3RA7L 1TVBB 4LVNC 4FFVC 3PQYD 1IGJB 5GS2H 2BOCA 2FJGA 3TH3T 4O51B 4U6TA 2AI0H 4K3EL 5GRVL 4AIXA 3PWNA 1N5YH 1I1YA 1HIMH 3LS5L 4P57B 4WU5A 2DWEB 1FNHA 3NMEA 4U4BA 5CHNB 3OJ2C 3QI9A 1CD8A 1Q1JH 1L6XA 2FX7H 2MTPA 5CEZH 2VXTL 3DURA 4HBCH 3P4MB 4OLWL 1X5YA 5EN2A 1IKFL 5LGKA 3QNXA 5MEQA 4EI6B 2ADIB 2W9EH 3RA7H 5D1XB 2YD1A 3GJEA 4ODHL 3UAJC 3U2SA 5D1QA 2WINB 4BSWA 4Y2DC 4F7MB 1CQYA 4YZFE 1FG2A 4K3EH 3RWGB 2P7TA 3SE4A 4QTIL 1S9VA 3VMNA 3MA7B 4X4XB 1YEFL 5BS0D 2YUVA 4HAGA 5FUOL 3BZFA 3VWJA 1G7MA 1SEBA 3LS5H 4YBQC 3SGEI 4PREA 3TYFA 4RA3A 5KN5B 4KKAC 4WNQA 2B4CL 1V05A 4U6XA 5EPMA 3HR5B 3QHTC 3DXAE 5FCUL 4E42B 4XX1G 2VXTH 2C7UA 2H32A 2PW2B 1FYHB 2HRPL 1X5LA 2J4WL 2YXFA 4OLWH 5E9DD 1IKFH 1OWWA 1KENL 3FQTA 3O3AB 4K7PY 4NGHL 5CFHA 4GKNA 3BYTA 2C3VA 4HV8B 4J3SA 3WYRA 4QRSA 1ZHKB 1T20B 1YA5A 5DC0A 3ULUD 4ODHH 4ZTOL 1EJ6A 2I27N 1VADA 3FRUB 4RWYL 2F54E 3PP3K 4PUBL 4UTBH 5ENWA 3TNNA 4P4KB 5F7UA 4QTIH 5MERA 4G7VL 1YEFH 5MEPA 4JRXE 2UZXB 5FUOH 1RJLB 1JUFB 3L3JA 4C58B 4NQSB 3O3EA 4QRQA 2W92A 1N2RA 3JV5A 1T89A 4XPBL 3TCLA 3TVMD 4F7PA 3X14B 1QPXA 4P2QA 2L7UA 2R0KL 3FAXA 5DMJB 4L4VA 3OJDA 3KPSA 1EO8L 4NBZB 2A74B 1B6DA 5IK3B 5FA3A 2B4CH 4KJQD 1SYVA 5CS7A 3ZDZE 2Z35A 3HB3C 1ZA6B 4JFXB 4TTDD 1QKZL 2L0DA 4P5MB 4TSAL 4FFZL 1WGOA 4RFEB 5FAAA 2HRPH 2J4WH 4JFPA 1NGWA 1S5HA 1I9IL 4HZLB 1KENH 1FLTX 3L3GB 4GQ9L 5D7JB 3SDAC 5J3HD 4NGHH 3C8HA 1XGUB 4MNQE 5I74C 1NBQA 5BRZB 2ZUWA 3ZKXC 5GS0D 3GZKA 4LCYB 4DN3L 2XWBA 4WWKC 4ZTOH 2W91A 2AQ2A 4NRXA 4IOIB 1WV7T 1OGTB 4RWYH 1BMGA 1X44A 3NIFF 2EYRA 4PUBH 3BPOB 1IMHC 1PW3A 4KROD 3RIAF 1BQHA 1AXSB 4KK8C 1DJSA 1ITBB 5ITFA 1S7UB 1QBMH 3H9HB 2AKRB 4HBQA 4XPBH 5CMAB 3TJHD 2OCFD 1EO8H 4MA8L 4KTDL 1H8NA 4YHNB 5IW1B 1J9CT 1QKZH 4PYGA 4TSAH 4FFZH 1RK1A 5CBAA 4AK1A 5DURB 1VESA 4K8RD 8FABA 1I9IH 4GQ9H 3FFCE 5FECA 3U0PA 3S37X 1A22B 1FYTA 3GO1L 4MHHI 5F9AC 1REIA 3MRCB 3SKOA 4GW4A 3ZKQD 1K8IA 3GHEL 2R15A 1QFOA 1YNLL 3C08L 1HK6A 5FEBA 1INQA 1BOYA 5AZEL 3D25A 3NH7L 1KUMA 1WK0A 5H94A 3VRJB 1F3DH 1G7JB 3T4YB 2H26A 4FQXD 4XAWL 4KV5F 5FYJD 4MA8H 4KTDH 1DQJA 2DTML 5D7IB 3VXUB 3GSRA 5HHOA 1VKXB 1MJJA 4FRWA 5C9JA 3NFSL 5DR5L 1P5UA 2GAZB 5DRNB 3S35L 4JQXA 3PGCB 3LEYL 3O0RL 3O4LE 3VXQB 1JZ7A 3PHQB 3MOQA 1LO3L 3S4SB 3KHQA 3SCMA 1I7TB 5DJ0A 3PP4H 3B8YA 5HI4C 1MY7A 1HXMB 1MCQA 2WQRA 2EDNA 3GSUB 4MAYB 4XI5D 3GO1H 1HHJB 2IMNA 3DHMA 3JTTB 1TJIL 3NABH 1GGYA 2DB8A 3E2HC 3LV3B 5HDBF 3IFNL 1MRFL 1WICA 2E7CA 2X89A 4S11A 1KEML 4HXAH 2IANB 3GHEH 1YNLH 5GGRB 3OR7B 5JDSB 3FO2A 1V3KA 5JQ6H 5IOPA 5AZEH 1KTRL 3KPRA 3NH7H 3UTZB 1WWBX 3DECA 1J87A 5GGSA 4N0CC 2DM3A 3Q6FB 5GJSL 5KS9A 3DO7A 1XIWD 3TA3B 4CN6A 4OF3A 2DLEA 1Z9SA 4KY1L 4XAWH 3PHSA 3MCKA 4QT5B 2DTMH 4WV1C 2FLBT 1KGCD 4HGMA 4LPCA 1G7LA 1ORSA 3NFSH 3QQ9D 4WO4B 4Y89A 3QXDA 3OX8B 3S35H 1P4LA 4ZSOA 1BD2B 3BH9A 5JIIA 1LO3H 4LDLB 5JOEA 3P4LA 4LIQL 3O2DL 3L7EA 3C09B 3CFKA 1U8QA 4Z7NE 2YD9A 4KJWD 2EC9U 2YD7A 1MEXL 4V2CB 4Z7WA 7FABH 1TJIH 3MV01 1YC8A 1MHCB 3ILPB 1AKJA 3QXWA 1FL6B 3HPJA 3IFNH 1ZVSA 3MLSL 3B9KB 1UCTA 5E7BA 1KEMH 4NQDA 3Q0HA 4NWUL 4MCYB 4XC3H 5SV4A 3MLZL 2HFTA 1OD7A 3L3OB 5KW9L 2R1XB 3FB8A 1I7UB 4GBXB 35C8L 2QQKL 5IFAL 4JN2B 1AQDA 3MJ7A 1KCVL 5ID0A 3V6BR 5GJSH 1TMCB 5I8CA 4YHML 5DJZB 3D3VB 1EZVX 4XT1C 5TF0A 4KY1H 3JWOL 2AJUL 1P2CA 2E7LA 4LKXA 4D3CH 4ZUTB 2NR6C 3IKKA 1NH6A 4M7ZC 5I9QC 4PRAB 3BVNB 5T1KA 4PJ7E 2VDNL 4FN0A 4LIQH 3O2DH 4EUPB 3AS1A 4QHUA 2FIKB 2W60A 1T1ZA 2J5LC 2Q8AH 4F7CA 1NGPL 5DZNA 5CEZD 5HHPB 4LHJB 3L95A 5F7EL 1K2DB 5F72S 1NFDE 3QUXA 2GY7B 4XHQA 2UWEB 4NWUH 3CPLA 3BE1L 3BJ91 3ISWA 1I8LC 5FKPB 5E8PA 5KW9H 2GEEA 2W0PA 3VGBA 3HZYA 1YEGL 3EW3B 2QQKH 5IFAH 1KCVH 3WNLA 3MRPA 4U0RB 4YHMH 2P45B 1YMMD 5IT2L 4HJJL 4M61B 2HN7B 5DSCA 2E7BA 2VLKB 1EO5A 5EOQL 2D7QA 2EDKA 3WFEL 1K5NA 4E41A 3JWOH 5FOBA 4WUKL 3V7AE 1IEBA 5C0CB 5IF0A 3PJSA 3IETB 2A6IB 4RAVB 1QSEB 2CKBA 2VDNH 4D0CB 4IDLA 3G6AB 4Y5YA 5EIIA 5FOJA 5I66B 5D1ZD 1NGPH 3AY4C 4LP5A 4P9HC 2EDFA 3FJTA 2R9HD 1E27A 5F7EH 3AREC 1HCVA 1A2YA 3IJHA 3FO9A 3KXFD 1FGNL 3BE1H 1FSKB 2AEPL 3V6ZB 4XHJC 4BJLA 5E6IB 15C8L 3QIWC 2BY3A 1U8LA 1WC7B 3N1MC 3IF1B 4BH7B 3WFBL 1U93B 4BM7A 2XNAB 1CGUA 5IT2H 4HJJH 1C1EL 2FSEA 4JJHA 4X5LA 3W39A 5EOQH 4ELMA 3WFEH 3DX7A 5DD3L 1RZGB 4JM2C 1CICA 3FO0L 4NN6C 4NKMB 4R4BB 5BOPA 1LE9A 3EOTL 5ADOH 4OCXL 4WUUD 2BSSA 3QR2A 3WJLC 5IBTL 1UXSB 1EUTA 1MH5A 4Z7UF 4FABL 4PP1D 1NEUA 1OTUC 4CGTA 2AGJL 4QY8B 4YHZL 1FGNH 1VCAA 4ZAKA 3WMSA 4YDVA 3SDCB 4JQVA 1MNUH 4PY8J 5F6HI 2AEPH 2H9GB 2FO4A 4JVUA 4Y4HD 15C8H 3DX8B 4JDTH 4YJZL 1Q38A 4YHIA 4L9LA 3U0TA 4P3DA 1MFCL 1FVDB 3ME0A 4GRWB 4I3RL 3C9NA 2XTJD 3TJEL 5HSFA 5HPMA 4KKBC 4HHAB 4BFIB 4DGIH 1EEQA 3PNWA 2NY2D 4LVOB 2X4OB 1HHGA 1G7IA 5DD3H 3D39B 3FO0H 1F5WA 1G9NC 3EOTH 4U0QB 4OCXH 5C0FB 1I4FB 3SGDH 4LFHD 5IBTH 5C8JB 3D2UB 3QUKA 3BIKA 4XXDA 4FABH 5IQ9B 1W8NA 3GJFB 1WWCA 2H32H 3VFPB 1DEEB 1U9KA 3BP5B 5HVGB 5DJAB 3HG1A 1OB1A 4FQQB 3EYSH 1QFWL 3WSQL 2AGJH 4HIHB 3EYQD 4MDJB 3BPCA 3MLWL 3P4NB 1J0KA 3C2AH 5C0BD 2HJKB 1HYRC 1UXWB 4LSUL 5D96B 2K3TA 4NQDE 2CIKB 1RUPH 3NZ8A 4KDTC 1UJ3A 4HEPG 4OCLC 1FFQA 1X5KA 5KZCB 3VXSD 1U8IA 1AO7B 1MFCH 5GZND 1RZ8A 1S8DA 4I3RH 5INDA 4MJIE 1SY6H 1UWGL 2KL6A 3TJEH 2VJXA 4WVRA 3NZHL 3V5HB 1HE7A 5I1JH 4UIKL 2MCPL 3GBNL 3NFNA 1XR9B 4IOFD 4YHLL 2B0SH 4YGVB 4OZIA 1JCKA 5JLZB 2MHAB 1XGQB 2VRAA 4M8QA 5LGJB 3BUTA 4Y16C 3LKSB 5FO8A 4F7TB 3TO2A 4Y4FB 3WSQH 4F37F 3MLWH 4R4FL 4FFWC 5IB2B 3DX6A 4LSUH 5DXWA 5HYEA 1S9YB 3JVGC 1XF2B 4HX1B 3GSNB 5ID1B 1BPVA 1KYOK 2VE6B 5D9SB 5JW4M 3MRKA 4LF3B 3PABB 1UWGH 3WJJA 3L3DB 3TF7C 3NZHH 2VABA 4QTHB 3ZDZF 3QRFM 1HNFA 2FRGP 3BEWB 3WS6A 2MCPH 4UIKH 3ZT6A 4LLVA 3GBNH 5BQ7A 4NN5B 4XBPA 1FIGL 1HKLL 4YHLH 4E41E 2ZP0T 5IJKC 4XB7A 4XNQB 1R3HA 4N8VG 1ZANL 4I3SH 2PF6A 1YY8A 2D7OA 3L3IB 2BVOB 4X7DC 2D31A 3GMQA 1TZIB 4K7PX 5DHVB 3B6SA 4M1DL 1ZGLB 4OLEA 4R4FH 4HW6A 4B7LA 1I1FA 1UM6L 2VXVL 3VWKC 4LSVL 1A4KB 2D2OA 4MWFB 1CG9A 3DSNA 4X80L 3RL1A 3QIUB 3SJVB 3CFDA 1JMZA 2AVGA 5C08E 1H0DB 1TQBB 5F1SA 3UX9B 4JREC 4G9FB 3EYUL 4LHQB 3MJGX 3TLRA 5IR1B 1JGDA 5FDWA 5CP3A 3WV0A 5EU7C 2BNUA 1GC1C 3D0VA 1KPUB 3L5WA 3KPLA 2JCCB 1I85C 1FIGH 1HKLH 3EHBC 4EI5A 4ELME 2X70B 1XCTB 5HHMD 1CU4L 5DC4B 4G42B 4GAJH 4I5BB 3CSYA 2OQJB 3Q3GB 5E8DL 5CJXA 5JW4R 1ZANH 4UDUA 3BDYL 3G08B 2L7JA 4M3JA 5TDPA 1KIRA 1I1AD 3CCHB 2QADC 3LKOB 2GK0B 4M1DH 4GAYB 2HA1A 4NUJB 5C07E 3MLVL 5JPNB 3NN8A 4P23A 3UPRA 3FQRA 5T1LA 4XCYB 1UM6H 2VXVH 4WDIA 4LSVH 4B5EA 1D5MA 2GY5A 3DTXA 2GFBB 3MRQA 1GL4B 2PUQT 4OGAC 4X80H 4JZNA 3IKCA 1HNGA 1NMCB 2Z92B 1F58L 2BVPA 3MXVH 3P30L 2VLRE 3EYUH 3T1FA 5DMGC 3VH8G 3G04A 3OKMB 2BOBB 3VRLF 3EFDL 5CSGA 5CEXB 2PXYB 2A9NL 3DVNA 3MYZA 3OKNA 1CU4H 4FTVE 4OCWL 1F2XK 1WF5A 3S8WA 4GKOA 4X4YA 3BDYH 1S7QA 1DZBA 1JZ5A 2R29H 4KK6C 3FTGA 4ONGL 2I07A 5ACLA 4RIRB 1Z5LB 4KHXL 3MLVH 4Z5RB 1YEDA 2BSRB 4DK3A 4NSKA 2QEJA 4R2GB 1OF2A 43C9A 4N8VB 1NGXB 4PJCB 5IESL 4P2OC 1S7WB 2ZZUT 3I02A 2OMBA 1F58H 3FQUB 3P30H 3CX2A 2I9LA 1FFPB 4IJ3B 1XT5A 5GGTA 2R1YA 3VI4F 3CFEB 2K7QA 4UT7L 4P9ML 3U7AA 2O5YH 3UTQA 3GUTA 4GH7B 1DDHB 3T0ED 1ND0A 2A9NH 4KRPD 1R5VA 1KJ3H 4OCWH 2FBOJ 4BK4A 3S36L 1U91A 4IHOA 4XNXL 1GGBL 3CX5J 2JJWA 4J1UB 4I4WB 2YPVL 3BH8A 1AQKL 4ONGH 4TVPH 2CKBL 3EDFA 5EU6A 4G5ZL 3QI9D 2VKXA 1F3JA 4KHXH 4OAWB 3RDTB 1SJHB 4JPKL 5H37H 5DI8B 3RL2B 2GSIB 3BPNC 2LABA 2VLMD 1MI5B 3ZDXE 2NXZB 1QNZL 5IESH 3UTTB 1XGYL 5HY9A 4ODVL 2EDYA 1LE5A 5EUOE 3QIBC 3R4DA 5ESQB 4PJEA 2G60L 2AQ1A 2WIMA 1L0XA 1X5AA 1RZFL 4UT7H 4OT1H 2LQRA 2V9TA 4P9MH 3WNMA 3MV8B 4RQQA 5D1QD 2VWEC 5L8JB 4YHKL 5GS1C 5IFJB 4PJBA 2OL3H 1TCMA 1MCCA 4ZFFB 4PJ7F 4WFHE 2FHBA 4KC3B 5GZOC 4ZFOA 1NFIB 3S36H 3VWJD 3UTSD 4XNXH 2P8PA 4ODWB 2X7LA 5HGBA 3LN9A 3K1KC 4LLYA 3VH8B 1AQKH 3CXDL 2CKBH 1NFDF 1KACB 4NO2B 1VEMA 3ULSA 4QRRD 2VN4A 1MCSA 4JPKH 1F6AB 5D7LD 43CAA 2CDGA 1QNZH 3VG9C 1XGYH 3IDXH 4ODVH 5CKAA 1FNGB 1QTYT 3BGAA 2F74A 4JRYA 1TNMA 3T4AB 5IB4A 1JWUB 4A6YA 2G60H 3HAEG 4PYHA 2OXHA 5C92A 4HJGB 1YJDH 4RZCA 1RZFH 3WXVL 1WFTA 2X10A 2WNGA 2X4UB 5C9KA 4JM4L 1ADQL 3L5HA 3SO3C 3GNML 4YHKH 3DGGA 1A14L 1PG7L 3KJ4B 5L2KA 4WFGE 3V4UL 2A9ML 4PRIA 3VXPA 1JPTH 4F3FA 5CILL 5EU7E 5IP4A 4ZUVB 2VZ3A 2Z31B 1MWAH 1R5IA 1A7PH 2DLGA 2YWZA 2HTLD 3OGCB 1AHWC 3T2QA 3DMMC 4DUXA 5MENB 2WBJA 5IKCB 1C5CL 2YRLA 2AJYL 1EEUA 4EZMA 3DV4B 3CXDH 1NGZB 5IMOB 2VQTA 4L4VD 3KPSD 1WZMA 4MJ5A 4OQ1A 4G8IA 3T3PE 2NTFB 1KPRB 2R1WB 2V17L 3GSXB 3QPQC 5ECJE 3RVXC 1YYML 1ZT4A 1CDUA 2E7MA 5CINL 4PJFB 4J6RL 3BGFB 1C7TA 2BHUA 5DQ9A 1CF8L 2XICA 4XRCB 2YPLA 5HYJE 2K7PA 4JFHE 5IVXB 1I3VA 2A6JA 3O3BA 2E3VA 1XF5B 4PP2A 4I9WD 3QDGE 2AXGA 2BCKB 4PRHA 3WXVH 1U58B 4KK5D 4PJDA 4JM4H 1TDQA 2QHRL 4XCEB 4IRSB 1ADQH 3QO0A 4ELKA 4YHYC 3GNMH 3GB7A 4LHUG 3V4UH 2A9MH 1LK2A 4MXVE 5CILH 2ATKA 4GS7B 4KMTL 3EDJA 4H0IA 3TN0D 2FX9L 1OAZL 3TH2T 3VXOB 4XCNA 3RKPA 2CKNA 3G5YB 4R7DB 5TQ0H 2YS4A 3C5ZD 3D85A 1C5CH 2X4SA 2AJYH 1BBJA 5D93C 3KGRA 4WW1B 2HRLA 2J88L 2BMKB 3MRBA 3RKDC 1P9MA 1OWRM 4NKQB 4G8GB 2F53B 2V17H 3BP7A 1X5GA 1YYMH 2MOVA 3CLFL 5CINH 5CJOL 1WQVT 2G75A 4R4NC 4J6RH 2G5BB 1HI6B 1JYVA 3QA3B 3GSVB 2UYLB 4I18B 5IUSA 3ULVC 3RNQA 5CD3A 3VFNA 5EU5B 2V2XA 3RUGB 1I9EA 4IMLB 1FYTD 5DHYB 2R0ZL 5D2LB 3QG6A 2OX5A 4U05A 2QHRH 2GTZB 3I3BA 3MV9A 4P46B 1QPPA 1R0AL 1QFWM 2NY3B 4GW5A 3UBXI 4L3EE 3VFUB 2V2WB 1IGTA 2VH5L 4MA3A 2QQNL 4Y4KB 2J8OA 1E0OB 1QSFE 2HT2D 2FX9H 1OAZH 3VFOA 3VFWA 3QRGL 1HH6A 3H7LA 4NPYB 5D71H 1B6UA 2R0LH 3K7UA 4GRLA 5C0DB 4QWWC 1T5XA 4Z0XB 5HJ3B 1QO3B 3GIZL 4XPFL 5C86A 1CS6A 5HHOD 3ZHDA 4X9FA 3CLFH 1T5WA 1H3WM 4KKLD 5CJOH 4M43L 2BVQA 1MHEB 4Z6AT 4ORGA 3PL6C 4QRPB 1ACZA 5DEZA 5IJVA 5IV2A 5KSVB 4X99A 4BSVB 5JA9A 4LCWB 4DEPC 4LVEA 4JHAL 4HMDA 4BQ8A 4HUKB 5E0QA 2R0ZH 3BP4A 4GW1B 4XVTL 1LP9A 1X4XA 4WEBL 1BBDL 3WLBB 4HKXB 1MJ8L 1R0AH 4NQTA 2GJZB 5FO7B 3VXTB 3BW9A 1UB6A 5ISZB 2VH5H 4JHZA 2QQNH 4Q9QH 3SO5A 3LD8C 4XNUL 3TO4A 2JJUA 2H6PA 3M1BB 4W4NA 5I71B 1U8MA 2VWEE 3QRGH 4U49A 4FXLA 1DQTA 4OUUA 3LN4B 5ADPH 1EHAA 3QUZA 4KJYB 3IFLL 4AIZA 3V6OC 1U8HB 3U7WL 1TTGA 4ZXBC 5J4MA 3GIZH 1FIEA 4XPFH 2VDRL 4LHUB 2V2TA 1B9ZA 2GSGA 1IZKA 1MAKA 4U1IA 3CSPA 4PR5A 4DCQA 2Z91A 2PO6C 4JHAH 3ABZA 2NZ9D 5DZLA 4Q2ZB 2MWCA 2CXKA 4XVTH 2C3HA 4HIIA 5C0IB 4Z0BL 3QUMH 4WEBH 3DYMA 1BBDH 1MJ8H 4PG2C 3RFZC 1GOFA 4NKDB 5GRUL 5GGRY 1AR1D 3S96A 3V0VB 3K0WA 5AYUL 4XNUH 1YY9C 4YDJB 2AS5M 4PRIE 4MNHA 1ES0B 4O2EA 1P7QA 3V79C 4QOKA 4RX4A 5KVDL 3BUYA 1AGFB 5KSBB 1FZOA 2GJ6E 1Y6KR 1EEZB 3U7WH 5IB3B 4K94L 1DUZA 4XP4L 2A73B 2VDRH 4PJ5A 2ZCKL 1JTTA 3I6LD 5EB9A 1MF2L 1T1XA 1MVUA 3RHWK 4QCIB 4DTGH 3Q6GL 4TVPD 1FNLA 3HE6A 4JDZA 4PJGE 1NBVL 2IFGA 5DK2B 4JFZL 3WL9A 3TT3L 2ZG1A 4EQ2A 2VYRE 2HJFB 2GHWB 3ARBA 2OS7A 1YEIL 3D1MC 3GI9L 1XGTB 3QUXD 4PJDE 4BQCA 2FO1A 4JB9L 2BVUA 5BV7B 5GRUH 4U1GB 1WBXA 2AJZB 4HUWB 1LEGB 4NYLB 1SYSA 5ERWB 5AYUH 4RFNB 2PTTA 3GIVB 1HDMB 3PIQB 4JM2F 3MRRA 2Z4QB 2VQ1B 5I1DB 5KSAB 1ZA3A 2A2QT 5D1XC 5ACZB 1XCQB 4K94H 1NAMB 3RTQB 4KGJA 1UT9A 2ZCKH 5C0NC 4WI3A 2IF7A 2JIXA 3G6JF 1MF2H 5DD1L 3LEXA 1RURH 4RBPH 3CNKA 3VXRD 1P84J 4JKLA 2P8MA 3OAYK 3B2VL 1NBVH 3ZT5A 4HLJA 2G9HB 3FFDA 3IS1X 4W6YB 3I3EA 4JFZH 3MODL 3MUY1 3VXME 3QXAB 2ZG3A 1YEIH 1UWEL 1LD9A 3IJYB 4Y2DA 3GI9H 3MRDA 5H35B 1EFXA 1UKQA 4JB9H 2BXYA 5EC1B 2G2RA 3RWFB 5C0GA 5DS8A 5JW4N 1LO5A 2CLZB 4YLQT 1DQMH 3EJYD 4QRTA 5TGBA 4AYFA 3VFRA 4NCDA 1CE6A 2LU7A 1UENA 4LLQA 1JPST 1RJZB 4JN1H 2VOTA 1SJXA 1N3NB 4K71B 5DUBB 1WIUA 1T04A 4Z78A 3QCVL 1U8PA 5F8RC 4I48B 5FYKE 3C87A 3U82B 3LKQB 2VR5A 3HUJF 3PV6A 4ZO6A 1CFVH 5DD1H 3S7GA 2EXWC 3CAFA 4YPGB 3RBGA 4C56A 3D0LA 3QUYB 2ZCHL 3HE7D 3B2VH 2C3GA 2VUOA 3VI3E 2DIAA 4ZUUA 3GK8H 3MODH 3EOAA 1I3GL 2B5IB 2VIRA 4OV6F 5HD8C 1F02I 1UWEH 1KB9J 4HUVB 5CSBA 3LMJL 2DM7A 4JFFD 4S1DD 4ODSH 5IHZB 4OI7A 1IILE 1MJ7L 3BX7C 3FT2B 3LKPA 4K3HA 3MZTA 5D7JC 2BY0A 3DRTB 5C09B 3QCVH 4CU7A 5SWZB 4L8BB 2IH1B 2Q86A 5MI0B 2EZ0C 1WBZA 3OHXA 4L8DB 2J6EA 4PRDA 2O93L 2OP4L 1FVEB 4XMLL 1QVOA 3BPOC 1P6FA 2ZOKA 4JFYA 4PLKC 2AEQH 1LGVA 3BP6B 5C0AD 4FQLH 3P73A 2RFXA 4G80B 3WNNA 1I3GH 3QEHB 3HG1D 1P4IL 4F33B 4YEFA 2NY1D 2X1OA 4O9HL 2Y5TA 2D03L 4CVXB 4NRYA 2I5YL 3RWIB 3LMJH 1H8OA 3UYRH 2P5WA 2VO5A 4ZS6D 5I8OL 5JTWA 3MRLA 3A67L 3K4DA 3V6FB 3GMMA 5D5ME 3U46A 3WO4B 2BHYA 1RUML 1YPZF 4FZEL 5JHDE 4MB3A 4R7NB 5I1LA 4Q0XL 5IIEA 1C5BL 3MFGB 2IEPA 4Q6IB 3J8F7 2OTPA 1ZLWH 3ZYOA 1FL3B 1LHZA 1MCJA 1KIQB 2OP4H 4XMLH 3DARA 3CFJA 3GMOB 5GRVK 1FC2D 4JY6A 1DVFD 5F3HA 3QWOA 3QDJB 4F9LC 3H8NA 1N4XH 1RHFA 3QULA 4I3GA 3AXLB 3DVGA 1ZHLA 3L6FA 4AEEA 3BHBB 1ETZB 3GMLA 3F58L 1T4KA 3V4VL 4OGYL 1KBGL 1P4IH 4LBEB 1WIOA 4O9HH 3HPLA 2D03H 3DI2B 5DT1L 1I75A 1LDPL 2I5YH 2X9YA 1KC5L 2IJ0C 5I8OH 3KVQA 3A67H 3RWEA 5CP7A 5F93C 3QDMA 3P2TA 1FAIL 1D6VL 1RUMH 3QH3A 3QFJD 3CSBA 4M8VA 4XXCC 4MAYC 2IPTL 4FZEH 3L3HA 5B38G 4Q0XH 1SJEA 3OQ3B 5TJWK 1C5BH 2ZSWA 3RAJL 1RU9L 1NGQL 3ESVF 3RX8A 2EDBA 4LAQL 3VFSB 2DIJA 4NRZA 2QTEA 2R0WL 2DQIL 4MS8C 4OGZA 3RI5K 3HCVA 25C8L 2FZ3A 3LQMA 3S98A 1MCRA 4L4TD 3F58H 4JZJC 4NFCA 3V4VH 1KBGH 4H5SA 2JJVA 4NQCA 5EWIL 5D7KD 1KJVA 5AYQA 3HNTL 5DT1H 2X40A 1LDPH 3FCTA 4WO4C 1I7ZB 4EN3D 4P99A 4FA8A 4KRNA 1XEDA 1EA9C 3SPVA 1WAAF 1FAIH 5C7XL 3C5JA 1D6VH 2IPTH 3MV7D 1W72L 4OZGF 1ONQA 2EC9T 2YPKA 3RAJH 1RU9H 1S9XB 2Q76A 1NGQH 3B9KC 2E27L 3WKML 5L88L 1I3RB 1VGKA 4LAQH 3VCLB 1UWXH 4LEOA 3EOBB 2DQIH 4EI5D 1NBZA 1G0XA 4DVBB 4XP6H 1K8DA 1LNUB 5JPMB 1NDGB 1Z9MA 4HUXB 4R3SA 4GBXC 2FBJL 5ANMB 2AJ3B 4D94A 5GRYA 3EBAA 3OR6A 3KAAA 5DYOA 1TJHL 3FQWB 5EFIA 1T3FB 5EWIH 3LSOB 3QPXL 1RZIB 3WFHB 4OFVA 1G7QB 3HNTH 2DS4A 5MP6L 5L0QC 1MLBB 5E00B 4CADA 4U6VH 2H2SD 5GRXG 4OIIL 1FCGA 4LPYA 5C7XH 4U6HB 5LQBL 3S37L 2EYTB 3WO3B 2VXQH 1W72H 4HEME 2VITB 2BNQA 1HZHL 4TUOA 2R56L 5L88H 2E27H 3DETC 3WKMH 2GTWA 3GEWB 4QYOA 1HH9B 5KAQF 1C8PA 2E6PA 4HH8A 3DYPA 2HFEA 3SE3C 3RPIA 5BRZE 5C0JA 3PXHA 4MB5A 4J4PC 1Q9OB 2FBJH 2A0LD 5EO0A 1M1SA 2YA0A 3O3DB 4FQIL 4H8WL 2P24A 4X6CB 2FB4L 3RY6C 4QHLB 4YE4L 3FB7A 2F19L 1NC4A 1TJHH 3E3QC 4JG1L 5I6XB 1KG0B 1LO4L 4GKSA 4JFEA 5DJXA 1FFRA 3QDAA 1WJ3A 5F7YC 3LN5B 2VKWA 1I8IA 4OIIH 4HWBA 1S9WB 4K9EH 1ZS8B 5LQBH 3S37H 4OGXL 4UZGA 1S3KL 1E4XH 1CXLA 2EIEA 4PPTA 1HZHH 5HDQL 3UP1A 5DVMA 3IFPB 3U9UB 4GRMA 4PJXA 2A1WL 4U31A 3TBYB 1FSKC 4MVBC 1M6OB 1UEYA 3I6KA 2DKUA 1J88A 2D3VA 5DQJA 5E6IC 3SKNB 2YBRA 1U8JA 1WIPA 1Q9LB 4Y8DC 4H8WH 1NCWL 4FQIH 4I77L 4U1MB 4XX1E 2FB4H 5IQ7L 4M9OA 3HHRB 1WWAX 4X6EA 4YE4H 1HQ4A 2F19H 1BAFL 1CFQA 4JG1H 3AREA 2ESVD 1BVKA 1LO4H 5EU6D 1MJUL 1BX2B 2Y6SD 3QISA 2IFFL 3UO1L 5EU4A 2JJSC 4JG0L 2NTSP 3QIWA 3V5KA 3NBNA 4WJ5A 2DL9A 2VL5B 5JO5A 3B8SA 4OGXH 5ICZB 1S3KH 1T83C 4MCZB 5HDQH 1U3HD 3WN5A 5DMKB 4E0RB 5A2LH 3Q1SL 1XZ0A 3BXNA 3DX9A 1UB5B 1FQ9C 2CSPA 2DYPB 1S7TA 4JM2A 3AU1B 5CGYC 5T5FL 3OAUL 1DUYA 5LCVH 2D4FA 3OKLB 4BZ1L 4PJGF 4I0PA 4I77H 4L3CB 4MD5A 3MLYL 2AK4A 1D9KB 4WY7L 1VFUA 1D5XA 4U1NB 4Z7VA 1Q9WB 4ISVA 3MRHB 4XP5L 1MJUH 4M7KL 1IAOA 4HK3J 3DXAB 2FYYA 2DQEL 3KYOA 3JTSB 3UO1H 2IFFH 5DJCB 2EIDA 3NPSB 4IRJB 4JG0H 4OCNC 3O6FA 4URTB 4YFDB 4KJPD 4LU5L 3MJ9A 3VDCA 4Z77B 2C1PB 2VSCA 5AZ2L 4F57L 2OJZH 2UUDH 1YMHB 1HXYB 2A83B 2H2PC 1MCPL 3Q1SH 2F54B 3KLAA 2QKIA 5L2KD 3NCJL 3CH1B 3MRGB 1J8HE 1JF1A 3DNKA 4MQ7B 3MNVB 4LDOB 3FONA 3OAUH 5T5FH 4O2CA 3B5HA 4JRXB 4RA0C 3ZTJG 5DEGB 5IW6B 2J6EL 4BZ1H 5K93A 5DMYA 4ZS7L 3H6JA 3MLYH 4X0KB 4WY7H 1X4YA 3KYMA 4EBQL 3ULVF 1AC6A 1IQDA 4XP5H 4M7KH 1ZOXA 2P44B 3LKRB 5ABDE 3MGOB 3TC9A 2DQEH 2DN7A 4NCC2 3EDKA 3MCG1 2DLTA 3HNSL 3D3VE 1NCCL 5HI3D 2ORBL 4JFDA 3QHFL 4N8CL 3WUWA 1UZ6E 4LU5H 5K59E 2YPLD 3BDBA 3RWCA 3KNBB 5AZ2H 4MNQB 4BZ2L 1MOEA 4NJ9H 4F57H 8CGTA 2YZ8A 2X4NB 4LP4A 5E8OA