3CMOL

Hiv neutralizing monoclonal antibody yz18
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
210
structure length
210
Chain Sequence
DIVMTQSSSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVELLIYYTSRLQSGVPSRFSGSGSGSDYSLTISNLVPEDIATYYCQQYSKLFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab light chain
publication title HIV neutralizing monoclonal antibody YZ18
rcsb
total genus 52
structure length 210
sequence length 210
chains with identical sequence X
ec nomenclature
pdb deposition date 2008-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoL01
3B5TA 1W0YT 5J1AA 3QPQC 4JO1L 1SMOA 3QIWB 1X5JA 3C08L 3MBXL 2EIZB 5DRWA 4GRLD 1T1ZA 1BQUA 1ZS8B 5JHDD 2HVKB 1KELL 2VL5B 1E0OB 2HJFA 1OAZH 1PYWB 1VHPA 4PJAE 1TIUA 1JRHI 3BKJH 4PB9H 3TBYB 3RZCA 3MRRA 3VE0A 4KKAC 2HG5B 4QEGA 1DEDA 2OTUB 1OAUL 5CEZE 3GMRA 2P7TA 4R7NB 4XC1H 5BW7C 1MFAL 4IHOB 3NACL 1CF8H 1SMAA 2ORBL 3VFWA 2YD5A 1R5WB 2CIIB 4WHCA 4WWKD 3AS0A 4NO0A 1KEGH 1U8NB 1D9KC 1FO0H 4P0DA 3MROA 1S9XB 4WFHE 4XNZB 1A2YB 2DM7A 1SY6L 1WBXA 1EEZA 3F6LA 4G8IA 2UZYB 3ULUL 3HI6L 3OAZH 4J3XA 1LK2A 1G7QA 5JPNA 2DM3A 3TIDB 3R0NA 2BC4B 2XACC 4W6WB 4WFEE 4M61B 4K9EL 4FXLA 5DMIL 5I1KL 1Q72L 1FPTL 4S1RL 5K9QI 2CK0L 1FIGH 1T1WB 4C83A 3OF6A 2APXA 3RIAF 1LEGA 3VG9B 5E2UH 3ARGD 3LKOA 1F13A 4YZFE 3TO2A 1JGVL 3GB7A 4U1HB 1OTUC 3QNZA 5F3BA 2Z8RA 2FH6A 4YH6A 3GBMH 5DC9B 4CKVX 2IPKA 4YIQA 5ETUB 2GAZA 1Q1JL 4PTUA 5E8DH 4XCCH 3JWDL 1D5XB 3IS1X 2EIBA 5E56A 3O3DB 4L9LC 4M93C 2CRMA 3GIVA 5I9QC 4P23A 4WDIB 5FYKH 4DVBB 4K23L 1JRHL 4KRPB 4CNIB 1GSMA 5FA3A 4NGHL 1ORSB 5ICXA 2KQMA 5IFHH 4WU7A 3TO4C 3IVKB 4UV4L 5H2BB 5T1LA 3N1PC 1BD2E 4JFOA 1DQQB 1Y18A 3QJFA 3GSXB 5HYIA 3UXFA 1SJEB 4RGNC 3KPTA 1GJIA 1KPUA 2WK2A 3QUXD 2J5LC 3A6CH 5IQ7L 4CVXB 3MNVB 1I7TB 1I4FA 1J8HD 3CU7A 1ZWIB 1HQRB 4M5ZH 4JPKH 1HHHB 1G9NC 3O9WC 4LMQE 3H3PL 5KAQG 4HPOL 4P2QA 2VDLH 3MLVL 5CIPB 2K1MA 3SGEI 2F54E 4CU8A 3C5ZA 5C08A 3JV0A 3BQUD 5E8NA 3SDAA 5DMGC 3FTGA 3WDIA 5T3XH 4GSDL 1TCRA 1FFOB 4YHNB 2YPLA 3LN4B 4U2YA 3L95A 5IFAL 4NQCA 4KK5D 3S4SG 2HRLA 1BQHG 1MCHA 5DD0L 1K8IA 4OZHE 3QQ3A 4ZD3H 4JHBA 1T22A 3ZDZF 1BFSA 1OSPH 3ZKMC 1E27A 3R0MA 4WI8A 4I5BA 1L4IA 4XGZA 1OAYL 5EA0L 3VWJA 3IJYB 1WFOA 4PYHA 3EO9H 5CINH 3RPIA 2VTFA 5HHNB 4JZJC 5D1XA 1T0NA 5DZNA 1R24B 3QEQA 4HC1H 2XWBA 4ODWA 2IADB 4I0PB 2Q6WB 4OLXL 4NWTL 2YPVL 4NRXB 5DJ0B 3VXSE 1G9MC 1FJ1A 2WUBH 3GSNH 1IEAB 3PHSA 4M8QB 5KSBE 5LGJB 4LVHB 1YY9D 3QIWD 2ZSWB 2DMCA 4KJYA 3B9EA 4O02L 3GMMB 2BVEA 3QNYB 4F9PA 3ARPA 4EDXA 3ALWA 4P2OB 1G0YR 3P11H 4K3JL 2C1PB 5F7HA 3C6SB 5M94B 1CDCA 4M02A 3NN8B 2VH5H 2XXMB 5KS9F 4JANA 4Y7MA 2ZUTA 3QI9A 4MXQC 3G5ZA 2AQ1A 2VZ1A 4GKNA 3QCVL 4H1LA 4ZTOL 3KPLB 5DR5H 2WIMA 4IIQB 2B5IC 2CGRL 1EXUB 3HG1B 5DQDL 1T5XB 3GGWB 3RIAK 5SWSB 4I13B 5D93C 4XCEB 3WYRA 1I3GH 3Q5TA 4HCRL 4JPWL 4AEEA 5DD3H 4KVCH 1X5LA 1IEBA 1ONQA 3MLXL 3FFCA 3WE6A 2EE2A 3VFUB 3ARSA 4KV5E 5C6PB 4U31A 4QXTA 2AJSL 2XKUA 2OYPA 5HPOA 5EC2B 5KVGH 4BZ2L 4YHPB 4LCCC 1CR9L 3ARFC 4DUXA 5ILTH 2ZCHH 5L8JB 1JCKA 1OGAE 3O2VL 5JOFA 4NFCA 1HWHB 5AZEL 3RWIB 1R3KA 1NDMA 4OCSL 4KUCD 2PR4H 3G6AA 3HI5L 3U6RB 1Y6NR 3ZTJG 3ULSB 1I7UA 1YEHL 5HYSG 4KRPD 5DDHB 3NFPA 5CILH 3C9NA 3ARYA 3VI4F 1MNUH 4CGTA 1G84A 3OR7B 2XNAA 2H32A 2IPTH 2WWKO 4NNPL 5DD1H 2WZPD 43C9A 1XH3A 3FQTB 3MZTA 1G9EA 1T21B 3X13A 1F4HA 1UWEL 3MRPB 1BGXL 3JBG7 3RNQB 4I1NB 3KLHD 5KSAA 2EO9A 4IS6B 4QWWC 4J4PA 3HUJF 3GRWH 3CSBA 4B7LA 5IEKA 4NM4H 3MXWH 4Z7VE 3M8OL 3U46B 3VW3L 2HFGH 2BRQA 4M1DL 3T0BA 5JQHC 2YA0A 1G7LB 3OZ9H 3TBTA 5HI5C 4F7CA 3FO1B 3FOLA 4M9OA 2ARWA 3MOBL 1UKTA 2GJ6A 2V17H 3VXUE 4WO4B 2H2SD 4XP9H 1ZMYA 1FO0A 2CR3A 3V6OC 3X3FL 2W38A 4LARL 1ETZA 2O26U 1WCBB 5DJDB 4N0UE 2MCPL 4WTZG 1DL7H 5AZ2L 4PRNA 1CDUA 4KDTC 5DJZB 3IRZA 4D0BA 3SPVA 3UPRB 3VXRA 1JZ4A 5JORB 1A1OA 4DKDC 3SKOA 3DPBA 4FQQA 3OKOB 3WFCL 4G8FA 5L0QC 1KJMB 5EIQA 1RSFA 4L8DB 2F9BT 4U7MA 5FV1L 2DQUL 5JW4R 5JUEL 1C12A 3MACL 4HH9B 3PV6A 2CLZA 4R0LA 3T0AA 2DN7A 4AT6B 2OSLB 3FQNB 1P6FA 5SV3A 3LPGA 4TVSa 3DX7B 3T2NH 3LKQA 3C8KA 3CNKA 4NHUB 5GRVL 4AZ8A 4G6JL 4YDIH 1JBJA 1N7ML 2E7CA 4ZUVA 4HJ0D 2CLRB 1CDJA 4N5EC 1NCWL 4P2OD 1DDHB 5GZOC 1CWVA 1SYVB 5FOBA 1P7QB 1I8MA 3HI1B 3QUMH 3QIBA 1DQDL 4MQTB 3GMOA 1UXWA 3BP5B 3QXAB 2EZ0C 4OZFB 1JGLH 3L3IB 3MTRA 4JPVL 5TDPB 3VXPA 5CD5D 3V6ZA 5CMAB 1HNGA 3VD5A 1CICA 3HG1D 1SVCP 3GKWL 1PKQE 5SWSD 4PG9A 4ORGB 2PTVA 2CH8A 3KPRE 2D3VA 4KHTH 5EZIL 4U1NB 2ICEA 1FDLH 4CAGA 3VXNB 3MOQA 3VRJA 5I0ZA 1BIIB 4ZOBA 1J05A 4D0CA 3P73A 4QRSB 4ODXB 1FRGL 3BZ4B 3EYQC 4M7KH 4ZPVA 3QUYA 3SOBH 5FUZL 3VXSB 5T1MA 5FKPA 2OXGA 1WQVT 3D48R 1XGRB 1RMFH 4JRXA 3O6KH 3FZUC 1YYML 1EZVX 4HKXA 5ERWB 2LU7A 3U4EA 3QYCA 4AEHL 3HTLX 4HPYH 4M6NH 3T2PA 3OJVC 3MLRH 3LY6A 2OQJA 3H7BB 2GSIB 3DXAA 2J12B 3FO9B 4Y5XC 4NKIL 1W72B 2CMRL 1FVDA 5IESL 4P5TC 1FYTB 5T3ZH 3S35H 4TVPD 5I1EH 4X9GA 1D6EA 3BIKB 1NL0H 4PLNC 1KLGB 5FYJH 1FZKB 4WFHD 4YXHH 3QZWB 5BXFB 5EIIB 1BJ1J 1G7JB 4QHKJ 3NIGF 4NRZA 3WUWA 4C56E 4HC1A 2GY7B 2BVOB 3B9KA 5EWIL 1JPFA 5ABDE 4GBXA 3AB0B 3V5DB 4WFED 3ROLB 3GSNA 4XX1E 2X4NB 2AJ3B 3FQWB 4UQ3A 5ITBH 5FGCE 3UPCA 2E7BA 1RZIA 3DARA 5EUOE 3RNKA 4C54A 2FSEB 3DHMA 1FNGB 4QF1B 4FXKA 3RWGB 4S0SD 3ULUC 2NZ9C 3UTZB 1OAZL 4AG4L 1H9VA 4PB9L 3BKJL 3JV6B 4K9EC 3U2SB 5JIIA 1HCVA 3U79A 4XC1L 1IAOB 1M4KA 4JM2B 3WLWC 1XF3A 3BWAA 1Q0YH 2D9CA 1Y0LB 4WUUE 1NFIB 5IJVB 2P5WB 3KYNB 3C5JA 1KEGL 3DUUA 4WO4D 1FO0L 1GVIA 4WI4A 2CO6B 3GIZH 2FBJH 2KQNA 5D2LA 3ROOB 4R2GC 3QWQB 3JWDC 1LO3H 1IGMH 3CXDH 1HEZA 4Q2ZA 4HXAH 3EO0B 4NN5C 5FK9B 3CPLB 1FIGL 2YN3A 4N1CA 2DJSA 5E2UL 3SDCC 5GS2D 1B0GB 4LAJH 5KSVA 5F6HI 4YDLC 3U83A 3UZVB 2EO1A 4HIEA 2HMIC 4LLMB 2YD3A 3GBML 1Y6KR 1NEZB 4XPTL 3T1FA 1RZGB 1RJLA 4OZIA 5E8DL 3ARQA 2G75B 4XCCL 1P7QD 5I1AB 4G7YH 5F6IB 1N59A 1MHCB 4L3EB 4WNQB 2DQIH 3VD3A 5KN5B 1OW0A 5FYKL 3AM8A 1PG7H 4NO3B 1K4CA 1LK3H 5D2NA 4J8RA 5C0FA 1TQCB 1P4IH 4N0UB 5IFHL 2EYSB 2DDQH 5DVNA 5T1KB 1GZPA 5C86A 1FIEA 2R1YB 3PDOB 3FOMB 1TITA 4AENA 1AD0B 5I74B 4E9LA 1P9MC 4PJ7E 5EU5B 4S10A 1BF2A 1YMMA 3RGHA 1KACB 4B53A 3VFOA 3O4OC 4PJIB 3OB8A 2JF1A 3O3EA 3T65A 5JDSB 1OM3H 2OS7A 4NDMA 2XTLA 4GW4A 3ZLQC 3VXSD 2F53E 4RGNE 4J12A 4M5ZL 4JPKL 2NNAB 4ELKA 2VDLL 4PRAB 5F96H 4JDTH 4PJFF 4YFEA 3H9SE 2JB6A 5F93C 2EH7H 1TZHB 5CBAA 5T3XL 4OD2A 1I3UA 3HR5B 1CFVH 1IGYB 1KC5H 4PLJC 4IBLT 3V79C 4TULH 5ACMA 2QJDA 2XA8H 2BNQA 3PABB 2ZUXA 4OLZH 1DLHB 1FYTD 3ES6A 2CIKB 1ZA6A 1OSPL 1CLYL 5JW5B 4YHYC 1YMHB 2ZSVA 1OP5K 4XXDA 1G1YA 5F7NC 4E41A 3CX2A 3JV4A 3OG6B 2ICWJ 4JFYA 3EO9L 1SJHA 5CINL 2FYYA 2VAJA 3BD5A 3OX8B 4IMLB 2Z31C 1HXMB 1KJ2H 4HC1L 2IPUG 3L3HB 1JNLH 1B0RA 1K4DB 3VXTB 3TA3A 1JNNH 1OAXH 2WUBL 2YC1B 3GSNL 4JFPA 5FM5O 4HUKB 1Q8MA 4JJHA 1F42A 1F97A 2YS4A 5F7EH 1MWAH 3KHOA 4YXKH 3VXOA 4DZ8B 4UILH 2W1NA 4C59B 5JXEC 2W60A 3H6JA 3PDGA 4X6CB 3P11L 1BZQK 3E1F1 4P9HH 4UUJB 1T66D 2EDQA 1K8DA 2A6IB 2Y5TA 1G7MB 3QUMA 4GRWE 5D4QA 2NYYD 5IEHA 4WWID 1IZJA 5JR1H 1MEXH 4JM2D 1U8QB 4ZPTA 3LRGA 4GG6B 5J11C 1L7TL 5D6DA 3EJZD 4L8CB 3P4OB 5DR5L 2BFVH 4XTRD 5F88A 2XFXA 4WV1C 4TTDD 4B5EA 1ZT7A 3L3JB 5IM7B 1S5HA 2KKQA 4MLIA 4KVCL 4FQLL 4ZO7A 4JQVA 2BSTA 4FFWD 2DLEA 2VXVH 4Y8AA 4GUPA 5FO7B 1GGUA 1LEKB 4O2FB 4M9PA 5E5UB 1P4LA 2EEAA 4RWYH 2R2BB 4H0IA 32C2B 1RZJH 1U8IB 2FHFA 4P4KB 3V2AR 5KANI 4JKLA 2P8LA 3Q5OA 5KVGL 3QDAA 3IGAB 3LPWA 5I0DA 2VLJA 1T5WA 4E0RA 4Y4HA 4G9DA 3RU8H 2ZCHL 2V9QA 1XF5B 2XPGA 3P4MA 1XMWA 5CKAA 2ZG1A 1F3DJ 3J7HA 2D4DA 5I17B 4I77H 3STLA 3IAPA 3PQYE 1UGNA 1TVBA 2PR4L 4I48A 4GXVH 4JRWA 5B39G 2AJZA 1IZKA 4LIQH 3SDXF 2OI9B 3B6SA 2CKBB 5EC1A 3RUGE 3QNXB 5CILL 1J1XH 1HHIB 2ADIB 3SKNA 5CFHA 4RMRA 3OXSB 4NJ9L 2AQ2A 1MNUL 3C5ZC 2I25N 3HC3H 3ARDA 3MCKA 4PJDE 3QBTB 3KWWB 5FKAB 2IPTL 4Y0GA 5DD1L 1EMTH 1A4JB 1O0VA 4CMHC 5D1QC 2J2ZA 1S9YB 2YD1A 5EU3A 3LN9A 3BEWB 1MJJB 3OKMB 3KXFA 4L4VA 4XNMA 3IDIA 1SVZA 4Y88A 3H7LA 5E94A 3VWJC 3GRWL 3PXJA 5IFJB 4QTHA 4XWGH 4NM4L 3MXWL 5D1XC 2WP3T 1F6AB 2HFGL 1FN4A 1A6WH 3BVNB 2NX5E 3S96B 4N0CC 3OZ9L 5INDB 3AGVA 1QFPA 4OZGB 2NY4C 1U8LA 3EOTH 1YJDH 1MFEH 3CFEB 4AY0A 1WCQA 3LB6D 1CGVA 4XPFL 1WBZB 2X4TA 1I1YA 3BXNA 1ZXQA 1HILA 1YEDB 4HW6A 4XPGH 3V0VB 3PP3K 4YFDB 3VDCA 3V6OE 5C9KA 5A16B 3K2UH 2ITCA 3IAGC 2ZUSA 1QLRB 1YNLH 1TMCB 3GMLA 1WSST 2F53B 2OTWA 1JV5A 3T2NL 4GLRH 4PJHE 3PWPA 3INUL 1ED3B 4YDIL 1HI6B 4TUOB 1HSAA 1QSEA 1KCSH 1QSFB 3RJQB 4HFUH 5E5MB 4CMMA 3DRTB 1A6AA 4IRSB 3QUML 2P5EA 3ORJA 3QUKB 1P69B 3I6KA 1GL4B 1DTUA 5MEPB 3UYOD 2AV1A 1NGYA 1JGLL 4YHMH 5DUBA 1UM4H 1NDGA 1OT1A 3ZHKA 1FVEB 3V4UH 3OKEB 3GSRB 1BPVA 1D7FA 3QA3B 4KHTL 3D3VE 5B21A 3VXME 1FDLL 3MLTB 3RDTA 2Q7YA 1WTLA 4ENEC 1Z9LA 4KK6D 4JHAH 5C09E 4ZFGH 5I18H 4HIHB 4V1DB 3BISA 2QSQA 4M7KL 3SOBL 2A38A 1AP2A 3A6BH 4ZSOE 1FAKT 3GZKA 4FA8A 4JKWA 4P4KD 4K7PX 1RPQA 3O6KL 2BJMH 5CP3H 5EO1B 1SM3H 5D5MF 3TBVA 3VFVB 1BOYA 5E5RB 5DFVD 4HPYL 4M6NL 3QPQD 5FUOH 4PJEF 2AW2A 5DGQA 2DWDB 4MD5A 4PUBH 4GRWB 1D5ZB 1BQSA 1I7RB 3MRGB 2QHLA 1YEIH 3MUZ1 4GAYB 1V3KA 1G0DA 4IM8A 4I18C 5T3ZL 5EOCJ 1BREA 1W0WB 4K94H 2WW8A 3QAZB 1J7VR 2I07A 2R1WA 3S35L 4F7TB 5I1EL 4HSQA 4Z7UE 1DQJA 3F12B 1CK0H 3EYFA 1NL0L 3WEXB 2G5BB 3VI3E 1CIUA 5FYJL 4YXHL 1X5ZA 4X5WA 5HSFA 5IB5B 2ENSA 5C0CE 1KJ2A 1IJ9A 2JB5H 2R4RH 4OT1H 1HYRC 3Q2CA 3Q3GB 4P3DB 4MXVE 3FT3B 4IEFB 2HN7A 1KNOA 5ITBL 3HCVA 1T6VN 4M6MH 1MWAA 2E3VA 5JXAH 5J12C 3Q1SH 4NQVA 1S7VB 4OCNC 3K3QA 4FQXB 3WS6C 1NFDE 2J8UB 4MD4B 1RV6X 5ANME 5KG9B 1U8JA 2EXWC 4HAFA 5TF1H 1BF8A 1T89A 1BZ9B 4WGVB 3MRLB 1X7QA 3S36X 3IT8D 5BVJB 1N8ZA 3DMMB 5I8CA 4RMWA 4R0LC 1Q0YL 5E9DA 5DMYA 4WENB 3ARWA 2Y6SC 3TCXA 5C0EB 3U0PB 5E6YA 2RJMA 4UOW1 4JO3L 4P2RE 4XCFL 3DX8B 2FBJL 3IDNA 2VR5A 3MV7A 4F57H 3ME0A 4PJDB 4YBLB 1LO3L 5TQ2H 2P8MB 3RX8A 4HZLB 6CGTA 3CXDL 4W70A 3VFRB 5HYQB 5BRZA 4HXAL 4WIQA 2NW3A 1CLOH 5ALCH 4P46B 4LVOC 3SJVB 3TO4D 1VDGA 5HBBA 1XGTA 3DO7A 3MOAH 5C2UB 2YUWA 1EEUA 3BT2H 1CE1H 2P24B 3WFDH 2O93L 1MCQA 2QQLL 2F53D 1DN0B 3PWNA 5LJYH 4PJCE 4U1IB 1WVZA 3VGAB 3WXVH 4ACPA 3CH1A 3BGFC 4LCUA 1WFTA 2HWZH 1QSFD 4KHXH 2NX5B 3DBXB 4KFZC 3Q6GH 4TN9A 4LF3A 1IAMA 5JLZA 5JO5B 4RGMB 1XGPA 2OJEA 1KTRL 4IRSD 3MMEB 4G80A 4HK3J 4MCYA 4NZDA 2DQIL 5IK3B 2CRZA 1JPSH 1PG7L 1Q38A 4Z7OF 1LK3L 2P43B 1OGTA 1OSZA 5JOPD 1P4IL 2C4FU 2DDQL 4QKXB 5D7IA 4HK3N 3RI5F 3RFZC 1QEWA 5EDXA 3WNKA 2DQTH 3QP3A 4JR9H 2HVJB 4Q6IA 4YGVB 4BM7A 1MCFA 3MUJA 3ZKMD 2NTFB 1UVQA 4V1DD 1OM3L 4LLQB 1XF4A 4QRUB 4DWHA 1U3HC 3MYJB 2CD0A 5IT2L 2OL3A 3EYSL 4ZUTA 4ZFFA 1AGCB 1YEGH 4HGWB 1LMKA 5F96L 1ORQA 5CJXA 4JDTL 2M26A 2XN9A 2EH7L 2BHUA 2H8PA 1BOGB 4EUPG 4RISH 1RHFA 4MVBD 4DEPC 3CSYA 4D9QE 2DYPA 5FEBA 5DMKB 1CFVL 2PYFA 1IC7H 4Z76B 1KC5L 3SY0A 5FECA 4TULL 2AXGA 2FCBA 4OLZL 4OCLC 5E8PA 4HWBA 2DM2A 5F7FA 2EYTB 2L0DA 5DTFA 4PGBA 3NPSB 3S4SB 3ULVF 2JK5B 4BQ9A 1LO2H 4HQQH 4ISVA 1FHGA 4NBYB 3V7AE 4BZYA 2V5TA 4EBQH 5FFLA 5CSZB 2PYEB 2GUOB 4QHKI 4LLDA 1KJ2L 1X5GA 3K4AA 4XPHH 5HGBA 3U4BH 1JNNL 2IAMC 2J7LA 5ESAA 1YN7B 2F8VA 3QWOB 4HV8A 4LPXA 5F7EL 1FL6B 2W0KA 4HWEH 4P2CG 4LSUH 1WFUA 1BVLA 4UILL 4FQXD 1QKZH 4BFIA 3TCLB 1A7QH 1CXFA 1FVCB 4P9HL 3QJHA 5E8EA 1XGUA 4LOUD 4N9GB 4JKPH 4JFQB 4KI5C 4QHUB 3C8DA 1BVZA 5GGUA 4WFGD 4DFHA 3TBSA 5JR1L 1JHKL 4MNHA 4QRQB 3IB4A 3DMMD 4MZ2A 3BRFA 2X9XA 1VADA 2BFVL 3TJEH 1F11A 3G5XB 2X4UB 4Y4FA 3T3MF 3N06B 2X4PB 2W9DH 4HDIA 4GFTB 4MNQE 5DJ8B 4NYLA 4LBEB 2QQKH 5HVHC 1X5XA 3L9RB 2VXVL 3V0AC 5HHQA 4L8SC 4DK6A 5EOCH 4Z7WB 2C7UB 5FM5M 1JP5A 2XQYK 4R6UA 1NMBH 1Z2KA 3DI3B 4G42B 1RZJL 4GRLA 4QLRA 1WAAA 1A1MA 5D2NC 4P46D 1DUZA 5JHDA 3RL1A 2XZAH 2E7MA 3SJVD 5CD3A 1WIOA 5CP3A 5FUCC 5I66A 3QUZB 5GRYA 3K46A 1S78D 5TGBB 4QNPF 3C5SB 1I9IH 4JGMA 4ONHA 3RU8L 2NY3C 4WU5A 3NZHH 1NFDB 2VISA 3I75A 5F7MC 4PJBE 5ANMB 3CUPB 1EIBA 4I77L 3E6HA 4PRBA 2NX5D 2A6JB 2Q76A 4QWWD 4GXVL 5GRZA 5B8CC 3ARBB 1U91B 5CEXA 1V7MH 2E6JA 1IKNC 3V5HA 1RFDH 3D39B 1J1XL 4HKBB 3REVA 4P2RB 4UDUA 1UZ6F 5GHWH 3IJHB 3BFOA 3BKCH 4H26B 1FE8H 1NLDH 2NY1B 2WUCH 3HC3L 3HE6C 3EJJX 3RVWD 3B8YA 3VG0H 4GLRI 1EMTL 2CDEA 3WNLA 4S2SB 3VCLB 2F19H 1IARB 4DUVA 2WBJB 2ARJA 1VERA 1XCQA 1NCBH 4LKXA 4ODUB 2X1OA 2A0LD 1NBVL 3ARGA 4RMQA 1EZVY 1VGKB 4W68A 2C1OA 1MRDH 2JJWA 5C9JB 4PJCB 1RJYA 4XWGL 3L3KB 1FNAA 4LCWA 3ZZ1A 3BP7A 1RUPH 4FTVB 1A6WL 3GMQA 1A9EB 3F7QA 1TPXB 2E7LC 1MFNA 2DAVA 3CVIH 3RTQC 3G08A 3W11C 3WDJA 1FFPA 3EOTL 1YJDL 4F7PB 1PEWA 1MFEL 3IETB 4ELMB 3VDAA 4HUVB 1F4WH 1KJ3H 2I9TA 2VRAA 1J12A 3KPQA 1EHNA 1T80A 3S5LB 3IDYC 3VMNA 1PX4A 1OB1A 4XPGL 2ICWI 3QUXA 5HHME 1I85A 4X4MA 3LV3A 4CW1A 1H3UA 3L1OH 1MH5A 1W0VA 3K2UL 3BP6B 3IU3A 1KIPB 2WWMD 3EIFA 1LILA 1YNLL 3L5WB 5I8EB 1PJ9A 3O3BB 2OCFD 3AXLA 1EV2E 5IIEB 5AUMB 2N56A 5EN2A 3RKDC 3IFLH 1PD6A 4X0KB 2JKXA 4QY8A 3QWRD 2R23B 1HKFA 4N8CH 1KCSL 3O4OB 4HFUL 1FCGA 5E70A 5SX5K 5MENA 2NR6C 5TDOB 2W92A 5CEZH 5JNYB 3OAZK 1HINH 2GTWA 5EZLB 4JY6B 4PJ8C 3IDJB 4NNXB 4EVNA 2YZ1A 3FO2B 1RK0A 4YHML 1XGQA 1UM4L 5MEQB 3OXRA 3IDGA 2R56H 4NPYA 5EBWB 4Y4HC 3MV11 3V4UL 2YD2A 3SE4C 1KLFA 1PQZA 2XWTB 4K3EH 5IV2A 1UJ3C 4JHAL 4ZFGL 5C0CD 5I18L 3D85A 3CCHB 5H37G 3MFFA 4PJ5E 3WN5B 2H9GB 4O2EB 2ESVB 4NQEE 5EH1A 4FOMA 4RQQB 3BI9X 3EZJB 2X4OB 2HVKA 1MIMH 2BJML 4IDLA 3SE3A 3QUZD 1SM3L 4KJQC 2F58H 1CXKA 2X4QA 3BWUC 5FUOL 3S8WA 4ONFH 3W5MA 1A1NB 1CTOA 4PUBL 4R7NA 1N6VA 2QKIA 4JDVB 4IHOA 4OLYH 4JPIB 3HB3C 5TDNB 2CIIA 3FRPG 1YECL 4K94L 4OZIF 3ARBD 1GYAA 1S9XA 2YN5A 4LLYB 2CRYA 4M48H 4Q0XH 4BA8A 1CK0L 1ZT1A 3D39D 1JNHA 4ZOAA 2CXGA 4PJXE 3TIDA 4P2RD 3EYOA 5IHBA 5SV4A 5J11B 3JTTA 4JKMA 4M61A 3CFKB 3QDGB 2NY1D 5DQ9A 2JB5L 2R4RL 4IOSD 4OT1L 5ESVB 1WZKA 5D1ZC 5DUPH 2WBJD 3MRHB 5CJ8A 1T1WA 5JMRA 2P8PA 5GS2H 1MCPL 4M6ML 3BKYH 3RY6C 5JXAL 4H0HB 2HT3D 2VNCA 4WEBH 3SGJA 3Q1SL 4XVJH 2ZWLT 4WI3A 3EJYD 2IH3B 4Z7QF 5TFSH 4G8EA 2CPCA 2BOBA 3QG6B 1WC7A 2DIAA 4TRPH 5TF1L 3UBXB 4OCXH 4KMQA 2V2TA 4FTVD 2AK4B 3FONA 3O3DA 4HIJB 4UQ2B 5J6HA 4WDIA 1DEEB 1I7ZB 1BMGA 1F02I 4U1LB 1I1AB 4CNIA 5HHPB 4HK0A 1ORSA 2VLME 3BIBX 3S3PA 1E4WH 2HMID 4IOFD 2AEPL 4ORZC 5F70A 3IVKA 1KT2B 4YDVA 2MCG1 3GSXA 2Y07H 1AH1A 4F57L 2HT2D 2X1XR 1SJEA 3W9EA 3F5WA 1K5NB 1M1SA 5TQ2L 4V2BA 4PRIA 2PTTA 4G6MH 5FDYA 2V2WA 1U2CA 2YWYA 3QFDA 2BXYA 1CLOL 5ALCL 3O4LE 5I19L 1I7TA 4JG1H 3IDMB 4CVZB 3MOAL 1CFBA 3HS0A 4WJ5B 3ZDZE 1HQRA 4ETQA 4OLWH 3BT2L 1CE1L 4PJ9C 3CVHB 5E4EC 3WFDL 2PW1A 5IVNA 4UB0H 3MV9E 1JL8A 1NAKH 4KROC 4NRYA 3UJJH 4HKJB 1DBMH 5ICYB 4LRNH 3T4AA 3X3GH 2HWZL 1OAQH 4KHXL 1JPGB 2IBZY 1FFOA 3LN4A 1QVOB 3Q6GL 3HRZB 3SCMB 3RA7H 3VD4A 3MLZH 3MQIA 1QHPA 3HLAB 4KVNH 5D6CB 1FC2D 4D9QD 4NO5B 3RVVD 3D18B 1V3LA 5DD6A 4PBVC 4WHTB 5DHVB 2R0ZH 3OKLB 1YPZA 1DQMH 3SKMA 1CD1B 3IJYA 2CUMA 3E2HC 1U36A 4HWNA 4WI6A 2RR3A 5HHNA 3P30H 4FQ2L 2VLRE 4QXGH 5ISZE 4PLJD 4KY1H 1R24A 5HHMB 2DQTL 4JR9L 2MQ3A 1T2QL 5KS9E 5F9JB 5ESQB 4X4XA 5CCKH 2ADGB 5GGSB 4GH7B 1FL3B 1IEAA 4LEXH 1PZ5B 5CZXD 4F2MB 4UNTA 4YEEA 4ZFOB 4LSQH 3QEUB 4N0RA 5IROA 1BX2B 4P2OA 2Z31D 4YPJA 2GCYA 2KPNA 4UU9A 5CKGA 2C1PA 3UROR 1N0XH 4ZUUB 3C6SA 1GPOH 5C8JB 3AC0A 4Q58C 4ZOCA 4U1SA 4YAQB 4FFZH 1CFTB 4RISL 4DKEH 7FABH 2DF3A 3UTTE 2JIXB 5IVXA 1IC7L 4QHMA 2VITA 2CK2A 1RVFH 3ECBB 3QIUA 3UMTA 1QUNA 4IIQA 2VDOH 1EXUA 3HG1A 3GGWA 3DX9A 3E3QE 4JM4H 5KSUB 4XCEA 1AXTL 5DJYA 1Q9KA 1ZA3A 2ZG3A 5I1CH 4NQSB 1EO7A 1KPRA 5ICZB 2A77H 5CP7B 3UTPE 1T89C 3O3AA 4EBQL 2WBKA 5JOEA 3DVNA 2W91A 5A2JH 4XPHL 3QDGD 5TPWH 3TH3T 1NBZB 1NC2B 3TWCH 1CFQA 4NWUH 5GSRB 2WINB 4NQEB 4TNWF 4ZMAT 3X14B 1PBYA 2PXYA 5EC2A 5BMFL 4HBCH 5KW9H 1CYGA 4YHPA 2GK2A 3T0DA 1NCTA 4HFWA 1BAFH 1F2XK 4HWEL 4LSUL 4UIKL 1S5IH 4PJAA 1WEJH 1QKZL 5IMMA 5J56B 1A7QL 3EGSB 1CDBA 3D69B 4OV5B 1CZ8H 4JKPL 3OQ3B 5ADOH 2APVA 1RZJC 1QO3B 3MLWH 5KOVC 1TJHH 4IRJC 1MQ8A 1IILE 1OLLA 2Y7QB 1I1AD 3TJEL 4KZEH 3GMPB 1IC5L 4L29B 4KI5E 1QFHA 3WKMH 3HUJE 2A9MH 1MCLA 2XQYG 2W9DL 3DIFB 5HGAA 4ZO9A 1KXQE 3FB7A 4LPWA 1C5DB 1ZGLM 2QQKL 3FL7A 2NY5C 4ZOEA 1BLNB 2VWEC 3WIFB 1CDIA 1ZOXA 2QADB 4OKVA 2BVPB 5EOCL 3FQTA 2W0LA 1BECA 1XF2A 3UX9B 3MRPA 3QFJB 1NMBL 5LKNA 3RWFA 3GSOB 5LCVL 3VGEA 3ZKQD 4H1LG 3OJDB 2XZAL 4P2YA 2IANB 2P4AB 4RAUA 1WUNT 1I9IL 1ND0B 4ZDHB 4PRDB 4NNYB 3NZHL 3P0GB 5LG1A 5D1QD 5DS8B 3L5JA 1G7LA 4IMKA 3HE7C 3TJHC 1A9BA 1CN4A 4RWHA 5FUCE 5L6YH 3T0XA 2Q3ZA 2FR4A 5GGRY 2K7PA 3G04B 4PY7A 4IOIA 1WZLA 4W6YB 3MA9H 2Z35A 1IAKA 2VAAA 3LKPA 1V7ML 5DJDA 1WCBA 4XB8A 1RFDL 3MRKA 5AAMA 5GHWL 3UPRA 2EYRB 3QCTL 1BD2A 5JORA 4TPRL 3BKCL 2Q8AL 4XWOC 3OKOA 5EZJA 1FE8L 1MRCH 1AQDB 4KPHL 3L3GB 4FFVD 1MFBH 1J18A 1KJMA 3VG0L 2Y4SA 2NZIA 2F19L 1NUGA 4F15B 1LDPH 5HHMD 4X9HA 5KVEH 2NLJA 1NCBL 4QHLB 1Q9WB 4YFLF 4K7PY 2BCKB 4JY4B 1YJDC 2YUZA 3O4LB 3ZKXC 5FA4A 1CT8B 3FQNA 4QTIH 3EO1A 4M62H 4MCZB 3ZE1F 4NHUA 4OCYH 1MRDL 3VA2C 5H35B 2Q86B 4PJIF 3MV9B 1S9VB 1A6ZB 5EU6E 5ACZB 5C0GA 3TYGH 4HHAA 2F54A 2J1KA 5C7XH 1RUPL 3HZMA 1ULVA 3W2DH 2NY6C 3HI1A 2G60H 5IB1A 4MA3B 4XAKD 3MZGB 3CVIL 4JN2A 3BP5A 4OZHA 5IJKA 1AHWA 1I9RH 5E1AA 2R8SH 4LRIC 5ITFB 1F4WL 5TQ0H 1KJ3L 5DQJB 3T04D 4QXUL 3W9DB 5EFIB 2VZ3A 3QH3A 4RZCA 4U6TA 5ISZB 4Y4KA 3O45B 4KJPD 1BIIA 4QRSA 3IDXH 3BZ4A 1RJZB 4Y1AB 2HTLD 3VXSA 5HDOA 1LHZA 2OX5A 5KSBA 1NC2D 3LQMA 4Y4FC 2Y36H 1ZE3C 4NQED 4Y16B 3AMLA 2IQAA 4KXZI 5C0RH 1A7OH 4MA1C 4NSKA 2YSSB 4QOKE 4GAJL 4ENED 4GMSH 4N8CL 4RMSA 2BHZA 4PV9B 1QOKA 3BEVA 5TE4H 3NIGE 2Y9RT 5L2KA 3B43A 2J8HA 4BSWA 3O0RH 1OARL 4YK4C 1CE6B 3TVMB 1MAMH 4APQB 4UZGA 4KQ4H 1IGFH 4GRLC 1HINL 1FGNH 2ADJA 2V9TA 4OFVA 3W82A 4TVPL 5D7KD 1ES0A 2MPAH 5DEFB 1XIWC 3BIKA 2R1XB 5IBTH 3RVUC 1KLGA 1NGXA 1FZKA 5D9SB 1WISA 5BXFA 4HG4J 5EIIA 1G7JA 4JGJA 3UTSB 3EFDL 2ZPKH 2N1KA 3BE1H 1CS6A 5C0AE 1TCMA 4K3EL 5INCB 3V5DA 4WWKC 3ROLA 2QADD 3O3UN 4LMQI 2X4NA 4EDWH 1CGXA 2AJ3A 3QXDB 5DEGB 3V4VH 1PKOA 3QFJD 2EC8A 3EDKA 2BNUA 1FNGA 1W2KT 3IJSB 4QF1A 4QGTA 5EO0B 5F7WC 3RWGA 3GUTA 1T20B 2E9JA 4NCC2 1N5AB 2VZOA 2F58L 3MNZA 1QFUH 3U2SA 2AEIT 3DECA 3U7YH 4BSVA 3I50L 4ONFL 2LV4A 1OGAA 1H5BA 4O9HH 2IGFH 3F7VA 4NFBA 3KLAB 5GJSH 4ZYKA 3HNVH 5FYJE 3I85A 1CXIA 3VFTB 5M7QA 3ARGC 4YHZH 2F74B 1S3KH 3RWEA 4LHJB 1NFIA 5IJVA 1KLUA 3KYNA 4IJ3C 4DGYH 3D9AH 3HPJB 4Q0XL 2GW5A 4M48L 4PJGF 2VLMD 3UCRA 3WIHH 3HUJB 3F7YA 4JFEE 4K71B 3DROB 3GO1L 4X7EC 5K59E 1FBIH 1NH6A 4JJ5B 4DCQA 2AERT 1EO5A 2X9YA 5HI4D 4J3OC 2OR9H 1E28A 4ZUSB 3C09C 1CTNA 5D7IF 5DUPL 1ZSDA 1YN6A 5I30H 1MLBB 5LBSH 3O4LD 3BKYL 5ALBH 1X4ZA 4WEBL 3RBSA 2VXUH 4XVJL 3S3JA 4L8SB 4RIRB 1BFOB 3MRNB 5TFSL 5I75C 4LLMA 4J3UA 4Z7VA 3RVTD 1I8LA 3MV9D 1EO8L 3U0TA 2FJGA 1NEZA 2YD4A 4LHQB 3WUWG 5C0JB 4TRPL 4Q9BA 4OCXL 2G75A 3HNSH 4M1CC 4WY7H 1UB5B 4OFPA 5KTEH 4WNQA 5E8OB 1JWSB 35C8L 1H3PH 1MY7A 3OAUL 3HPLB 3VXUA 4NO3A 4HUWB 4RAVA 4JFXB 1MELA 4ZS7H 3MV01 2ZUVA 1B90A 1E4WL 3SBWA 4N0UA 4NZTH 4JRYE 3A6OA 4WUKH 3PWLB 3BQUC 1SYSA 3PDOA 4OZGF 4OIIH 1AD0A 4C55A 4YDKL 3X11A 2Y07L 3QDHA 3RWDB 3ARUA 1Z0NA 1F3JA 1NGZA 5KVFL 4KK5C 1CLCA 1FQ9C 4CN1A 5HYJE 3WXWH 3T0WA 5ISZD 4G6ML 4LQFL 2HKFH 3QDJE 2RB8A 4HS6B 2GT9B 4HH8A 5JDSA 4Y1AD 2R69H 5C0IB 5IB3B 4JG1L 4NUGH 3PHOA 2PO6A 1NCDH 4EXPX 4OLWL 5CGYD 4Q7DA 1ZHNB 4MHHG 1F8TH 2NNAA 4UB0L 4XCYA 3VFNA 4Y16D 1NAKL 3OKKB 3UJJL 4TUJA 5FO8B 1DBML 1XZ0B 4LRNL 1G9MH 1JNJA 1TZHA 3X3GL 1OAQL 2CLVB 2ILLA 4N1HB 4GRWH 1IGYA 2DLFH 1FFNA 1YY9C 1U3HD 1JFQH 4LNRA 3TVMD 3RA7L 3QIWC 3MLZL 2IBGA 3MRBB 2WV3A 3MGOB 4OF7A 5EIVA 1W72L 4APQD 4TTGA 1DLHA 4M6OL 3EDEA 4X7SH 1KIQA 3UC0H 1YMHA 2R0ZL 1KYOJ 5GZND 4MB5A 4ZUWB 4XP5L 3BPOB 2J8OA 1DQML 1PKQA 2ITDB 3KPRA 2FIKB 1OWRM 3RTQB 3P30L 1I9EA 3NCJH 4TNVK 4XBPB 3OX8A 4KY1L 1HXMA 2DQJH 3UTSD 2VE6B 1TXKA 1AC0A 3UTPD 2D03H 3ISWA 3VXTA 1E6OH 5CCKL 5TH2A 2EDHA 3QDME 4BUHA 3P4NA 1JF6A 2QSCH 4LEXL 4LLWB 4PGDA 4PP2A 1BFTA 1AXSA 5F1OB 3BN9D 1U8OA 4XNZC 3TV3H 5L7XL 3QHFH 5B4MD 3ARTA 4LSQL 3JUZA 1BVKB 4ZG1A 5BQ7B 4QOKB 3V5KB 1P84J 4LNVA 3WV0A 4QYOB 1WAAF 1OTSD 5E2WH 1GPOL 2A6IA 4FFZL 1G7MA 1T83C 2AGJH 2IAMD 4DKEL 7FABL 2DL9A 5F1IB 2MNUA 3VXQB 4L8CA 3VG9C 1C8PA 1UKQA 1B4RA 1RVFL 4M5YH 3TIEA 8FABA 2VDOL 2YEZA 3PNWA 3RQ3A 4X6FA 3SGJC 1P1ZB 4EUPB 4JM4L 4YPGB 2C3HA 2VZSA 3WMSA 1G7PB 2D0GA 2Y5EA 5I1CL 4P59H 5KANG 2A77L 4XRCB 2QR0B 1MUJB 4C56A 5K9KA 2QBWA 1XR9B 4GKZA 3RL2A 3LSOB 1WTGT 1QBAA 4GKOA 2R2BA 5TPWL 1KCLA 4HMDA 1PZUB 2R0KH 4KRPC 4NBXB 4J7RA 4P4KA 4NWUL 5I2IB 1H8OA 1T3FB 8CGTA 4Z7NF 3RGVB 5EUOA 1F4AA 2BHYA 2OBGA 3D2UB 2R2HB 3LKRB 4HBCL 3CAFA 1H3WM 5KW9L 2I26N 5J13B 4HX1A 1UJ3B 1JWMB 5TE7H 1BAFL 4DGIH 1RD6A 1AIFB 3BH9A 4MA8H 1S5IL 1GXEA 1XF5A 3BJ91 1MHEB 2X2YA 3MSPA 15C8H 2YBRB 1OOAA 2V7HB 1CZ8L 4U1MA 1IGTB 1N64H 5I17A 1AY1H 3NVQA 4H88H 5SWQB 1X5HA 3ZTNH 3LKNA 5ADOL 4HS8H 3KLHC 3T2QA 4P9MH 3STZA 3PUCA 4M7ZB 5J1TC 1LO0H 3VD7A 1TJHL 4WUUA 3MRJA 3FQXB 2P1YA 4MQ7B 3I3EA 4KZEL 1HHIA 3CDFA 2ADIA 5IMLA 2WQRA 3MRCB 3WKML 2WP3O 2A9ML 4OGAD 5BW7A 1LE5B 4JFEB 2IALB 3C6LB 3TPUB 3P2TA 3KWWA 5E1HB 5K9OB 3GI8H 4OIAA 1A4JA 5EZOH 2H2SC 2YXMA 2PCPA 2E9BA 5CWSB 1S9YA 1T7WA 5FV2A 1VACA 1MJJA 2XYCA 2CO7B 4JAMA 2ERJB 1ZHBB 2V2XB 1RHHB 3GBNH 3HE6D 4Z95H 2EKSB 3FO0H 3PWJA 4M7LT 2FRGP 4QRPE 3N0PB 3MPCA 1U93B 3BPCB 4POUB 2BNRE 1IQDB 1T7VA 3S96A 2N7AA 4XI5D 4I0PC 2QEJA 1S7QB 4UINH 5E0QA 2A6KA 1MI5B 4FQPA 1MY5A 5FF6B 1XFPA 4I0CC 3B2VH 4LVHC 1RZ8B 2HJKB 3MA9L 3MA7B 1P7KB 2Z4QA 3NTCH 3CFEA 4BQ6A 4MLSA 1AGBA 4HJ0C 1RIVL 5DJAA 3WIHA 4JRYB 4P2OC 4Z78B 3OHXB 5C0ND 4QRRE 5IW6B 4L9LA 5EU4B 5DRZA 4FMFA 4X6DE 1MRCL 4NN6B 3NPZB 4PJFB 4PJ7A 2OZ4H 3RTQD 1NCCH 1MFBL 3FT4A 4PV8B 1C16A 4D9RE 2Z93B 3W11D 5HYJB 3BOVA 5A16A 5C0BB 1G6RB 3QDJB 1JWUB 3TO4A 1ZK9A 3IDUA 5C07E 2C4FT 4AIZA 3CMGA 4IIQC 4FABH 4P4RA 4N8VA 5IW1B 3R8BB 2F53A 4M62L 4JFDE 4K2UH 1IQWH 2D0FA 2DQHH 4S1DD 5E00B 4TUOA 5KVDH 3H0TA 1NAMA 1R3HB 4BSJA 3TYGL 3V6FA 4GOSA 4QOKD 5C7XL 3H9SA 1Q94A 4HKZB 3F65A 3T8XB 3W2DL 4IRSA 4JFFB 1YEEH 2W9LA 4HZAA 2G60L 1CGUA 3QUKA 5E4EB 4HMCA 2MKWA 3O9WA 3S88H 2A9NH 5ECJE 4GS7B 5MEPA 4MD0B 5C3TA 1YNTB 3SDDB 3DUSA 1I9RL 3CH8A 4HIIB 4UIMA 2DBJA 1GCFA 4JO1H 3OKEA 5TQ0L 4DKAA 5D5ME 1U8PA 2O61A 4L5FL 4PJEE 1A6TB 1RUAH 4JG0H 4Q97A 4LHUA 1FSKB 4PJ8D 3JXAA 5IR1A 3T3PF 3LN5B 1ITCA 1MCCA 5C0AD 4PRHB 2XOTA 3K8LA 4X99B 2Y36L 1FZJB 3RGVD 5C0RL 3D2UD 1A7OL 3PL6B 5DI8B 3V8CA 4ZS6D 1MHHB 3LH2H 2KDGA 3RY4A 4GMSL 1A64A 1C7SA 5TE4L 1HHJA 2G9HA 4L3CA 4LDOB 3O0RL 1D5ZA 4DZBA 1I7RA 1MAML 3MRGA 1SY6H 4GAYA 1LP9E 2H2PC 4O5LH 5HDBE 1JGEA 3HI6H 4KQ4L 1IGFL 3H3KA 1FGNL 3ZYZA 1W0WA 3TGXA 4KJQD 4F7TA 2MPAL 1ZAGA 1S7XA 3F12A 5IBTL 2B20A 2F8XC 5BJTB 5DUML 4LVEA 1TTGA 4UT6H 4MB4A 1R3IH 3ZTJH 5I16A 4JFED 2ZPKL 1HYSD 3C6LD 5F72S 3HB3D 5IQ9B 1H0DB 1TETH 1VFBB 2BMKB 4P3DA 4RDQF 4LLVB 1T04A 4EDWL 2A2QT 4WO4C 1QLFB 1FYHB 3V4VL 3T0EB 4JZNB 2RFXA 3LD8B 2MTPA 3SDXB 2X1PA 2O5YH 1MFDH 1S7VA 3JWDH 4F33B 4M4PA 3QRFM 2UWEE 4H20H 1AGEB 2C9AA 2AS5M 3RAJH 3AU1B 4F37F 4MX7A 1QFUL 4WW2F 3U7YL 4O9HL 4OFDA 2IGFL 3PQYA 2CQVA 3IF1B 5GJSL 4OFIA 3HNVL 4LCCA 4YJZL 5BVJA 3G5VA 3MLYH 3ARFA 4YHZL 4NIKB 1MI5D 1S3KL 3MRQB 4PG2C 1OPGH 2XWJB 3KYKH 5KJRH 4DGYL 2OXHA 1JI2A 1JYVA 3D9AL 5C0EA 3RUGA 1IAIH 4GW5A 3I3BA 3TN0B 2B39A 3LEXA 3DX8A 3WIHL 1J10A 4JRYD 1FBIL 3NIFF 5D72H 4PJDA 4YC2B 5SWZB 4IRJB 1KG0B 1IFHH 3MO1B 4HZLA 3NMEA 4X6BA 3GSWB 3VFRA 5HYQA 1YPZF 3HMXH 4UBDD 5FB8A 2JCCF 2OR9L 4DOHE 5HYJD 3DYOA 5HHOE 4F3FB 5C0BD 3HZVA 1UM5H 3O8XB 3QDJD 5IJKC 2RAMA 5I30L 3CU1A 2XG4A 3FQRA 5LBSL 1C08B 2P24A 5GS3A 3S3SA 2AXFA 3MRFB 1RUMH 4QRPB 4TUKH 4LGPB 5BZWA 1EHLH 4A6YB 4GG8B 1RU9H 3D0VB 3F62A 5HY9A 2E9IA 5GJTH 2BNRB 5B38A 5DRNB 2H41A 2NX5A 3HAEA 3LKSB 4UTAH 2W07A 1HH6B 3O6FB 4WY7L 3HNSL 4OCMC 4A2MA 4UAOC 5JO5A 4R3SA 3CD4A 3MMEA 1HNFA 4JFFD 5KTEL 2F8OA 2FJFB 1H3PL 1J1PH 1A6UH 1N2RA 2R0WH 2VXTH 2EDFA 4LVNB 4OSUL 5IG7B 3TP4A 2VXQH 4S1SH 1FNEB 3SDDD 4NZTL 4WUKL 2FD6H 5J1AB 1J8HE 3I9GH 5E2TH 5C92A 1E4KC 4PTTB 5GS0C 5DC4B 4O02H 5DRWB 3V6OA 1T1ZB 3WXWL 2HKFL 2LABA 2V5RA 2HJFB 2OJZH 1S7TA 4KKLD 4KDTA 2VSCA 5C07B 1A7NH 2WIIA 3RZCB 3MRRB 4QRUA 2R69L 1TJIH 4FQCH 3MYJA 4NUGL 2HLFD 3TNNB 2OMNA 1NCDL 1G6VK 3ILPB 2AVGA 2PN5A 3GMRB 2P7TB 2I9LB 4PJHA 1CQKA 3S37H 4ZNCD 1F8TL 1AGCA 5A2FA 3PL6D 1HXYA 3ULVE 4LP5A 4ZTOH 4YXLL 4HUXA 5JIHA 4NO0B 1BOGA 1YY8A 4KAQL 2X4SA 3AB0C 3MROB 5DHYB 2W59A 5EG6C 2DLFL 1WBXB 1JFQL 4G8IB 4PJAF 1LK2B 3T08A 4Y2DB 3TNMB 5JPNB 4X7SL 4AH2B 1G7IA 3L7EA 3UC0L 1F58H 1FGVH 1RK1A 4JFHE 1EDQA 2EYTA 3H9YA 4YDJB 5HGHA 2JK5A 4F80A 4AEFA 3D3VA 5D5MB 5FGSA 5DVMA 1CFSB 2AJSH 3NCJL 3VXMA 2OZ4A 4F37K 3CLEH 4PJEB 1LEGB 5CSZA 4WI2A 1Q9LA 2DQJL 3BUTA 3VFGH 4JM2C 3AAZB 3BPLB 3LKOB 5C09A 3TO2B 3EJZC 3GB7B 2YHGA 2D03L 5J4MA 4H8WC 1E6OL 3QNZB 4XTRC 4Y8DC 3EDJA 4ZSOA 2QSCL 1YN7A 4MAYB 4TTDC 3CFJB 3QWOA 1MSPA 4OIBA 4YIQB 4HAGA 2GAZB 5GSVB 3TV3L 1FL6A 1SEBA 4PTUB 3QHFL 1M71B 3OGCB 1EJ6A 3BZEA 3TYFB 1Z5LB 3OKNA 4YBHA 4PLOB 3TCLA 3PIQA 3GIVB 4P23B 5I73B 4YBQD 4X7DC 5E2WL 4EKXA 1U58B 3VGDA 2AGJL 5ICXB 2ZP0T 4JO4H 1A6PA 4WU7B 1BQLL 4MA1B 2CKNA 4JFOB 3GEWB 3QJFB 4NZJA 3QULB 4M5YL 3IFPB 3G5XA 2X4UA 1MCKA 1IRAY 4Z7UA 1KPUB 2X4PA 5DJ8A 5DT1H 2Q87A 2JJTC 4Y5XA 3CGTA 2Z8SA 2F15A 3TN0D 1I8LC 1HIMH 1KULA 4P59L 4P5TA 4HBQA 1I4FB 5C0CA 1CL7H 3I6LE 5SWZD 4IRJD 5FAAA 5F6IC 1Y6MR 2C7UA 2VDKL 4G42A 1T0MA 4QT5A 4P2QB 2R0KL 3FMGH 5C08B 1F00I 2A74B 1TQCC 2AXHA 5E8NB 3SDAB 3Q5YA 3FTGB 3QUZA 4R4BA 3MLUH 2CXKA 5FCUH 1TCRB 3AY4C 1R5VB 5HDQH 1X6NA 4DGIL 4JQXC 5TE7L 1L0QA 4NQCB 3WL9A 3MOBH 5I74C 1NFDA 3SQOH 3WCYA 4QRPD 5ANMA 1K8IB 2MHAB 3QQ3B 1T22B 2O5ZH 1N64L 1N6UA 1SY6A 2BNRD 1E27B 1AY1L 4H88L 4FS0A 4I5BB 4XGZB 3ZTNL 4HS8L 3KNBA 4W4OC 2MSPA 1Q9OB 3O6FD 3QEHA 1KF9B 1QD0A 5EOTA 4P9ML 1U91A 2MJWA 4RMVA 1LO0L 5EORH 5CEYB 1RIHH 1T0NB 3WFCH 5F7UA 3RWJA 5DHVH 1LEIA 3G6DH 2XIDA 2XWBB 2I27N 2DQUH 5JUEH 4P2RA 4KK8D 3MACH 3HE7D 1GIGH 5GGRB 3QO0A 4OZHF 1MCEA 4CN6A 4QRRD 2W9EH 3QEGH 4IJ3B 3SEPA 3VCLA 4OBSA 1DFBH 5EZOL 1HDMA 4KDVA 4EDXB 4DOHB 2XTJE 4S11A 5HHOB 5IB4A 1AR2A 2FBOJ 2F5BL 3JWNC 1ZHLB 5C07D 3RZCD 1YQVH 4JREB 1MVFA 4XWOD 3GBNL 4Z95L 1N4XH 4JANB 3FO0L 5IVZB 3EDFA 2BSED 4PJCA 3CZFB 5GGQL 5KSBF 3QI9B 4FXGA 2B7DT 1F4XH 4K8RD 4MJ6B 3SDCA 4UINL 4NO0D 1JZ3A 5C2BH 3B2VL 4ETYA 4X98A 1IEBB 3NTCL 4Y2DD 5FGRA 3WE6B 3IETA 1FNSH 4LSTH 4NKDA 1QPXA 3UAJD 3S5LA 4WW1B 4ZXBB 2OZ4L 3HMXA 3CDGB 1NCCL 3OF6D 1F3RB 3EYUL 1E6JH 2MKLC 4LSPL 12E8H 1WWBX 3BP6A 5JHLH 2V5MA 2YMXH 4U1JB 1IL1B 3O3BA 4FABL 1P9MA 2EDXA 4MAYD 5JOFB 2B4CH 1R3KB 5TF0A 4K2UL 4X0KA 1ZLVK 5KVDL 2R23A 1C5CH 3D25A 4U0QB 4P23D 5TDOA 3ET9F 3ZKSD 1CVRA 3HC0B 5SWSE 1N3NB 2APWA 3NFPB 5DURB 1YEEL 3D1MC 2DD8H 4GQ9H 5J6GB 3C9NB 4G8GE 3DRQA 4NOBA 5I1LB 5EZLA 3S88L 2A9NL 3IDJA 3K8KA 1KBGH 3B5GA 1J88A 4X6EA 2H32B 1D5BA 4Y19E 1QBLH 5DJ6A 5DFVC 1ZANH 5EBWA 1XH3B 5F3HA 4AIXA 3X13B 4UDTA 1BFVH 4WI9A 3DGGA 1FCCA 1RUAL 4JG0L 2Y72A 3RVXD 5DVOA 3CCHA 4AG4H 5IEKB 3WLBB 1XIWD 2XY1A 4Y5VB 2GJZB 4R96A 2OI9C 3RVUD 3WD5L 4HGMA 4RQQA 4P2QD 5LVEA 1FL5A 2X4OA 3TBTB 1TNNA 2IMNA 2Z31A 4LCIH 3FOLB 2D7QA 1LQSR 3GSQB 3TPKA 3LH2L 1MFCH 3EHBC 4UT9H 4TVPE 2AV7A 2GJ6B 3HR6A 3PE9A 2RBLA 1IAII 3ARRA 3BO8A 1ETZB 4HCRA 1P7HL 4O5LL 3NCYP 4PRNB 1NGPH 4Z7VF 1RI8A 5J7CC 4D0BB 3SPVB 1WLHA 3VXRB 5IBUG 5JXEA 4U4BA 3SKOB 1Z9SA 3BZDA 3IS0X 4G8FB 1EERB 5J06A 4MNQA 4XNXH 1C12B 2VB5A 4LPYA 4UT6L 3PV6B 2CLZB 1R3IL 4E42B 4BQBA 1ZT4A 4RFEA 5ESVA 3LKQB 1TETL 3C8KB 2AKRA 4WV1A 1I9JH 2GI7A 1IC4H 1FLRH 5FIEA 2IQ9H 5IMKA 1JK8B 4JO2H 4X8JA 4XXCC 2FWOA 1KPVB 3L7FB 3P9LA 4FZEH 4ZUVB 3VGBA 1KN4H 5HHOD 4XPTH 4OB5H 5HVWA 2VDNH 2O5YL 1MFDL 5DC0A 2FLBT 2IH3A 4FP8H 4OF8A 4H20L 5JQ6H 3QIBB 4NCC1 1H15A 4OLVH 3RAJL 1UXWB 3QG6A 4KZDH 1DVFB 4PJBA 3QI9D 3K0WA 3UBXA 3VXPB 3V6ZB 5HGDA 1JN6A 1CICB 1HZHH 2VQTA 4HIJA 4UQ2A 3MLYL 1I7ZA 1MCNA 4PG9B 2ICEB 3RJDA 3TZVC 1OPGL 3KYKL 4LCYA 5KJRL 3VRJB 3NFSH 1V7NH 1IAIL 3WO4B 4D0CB 3P73B 4ZPVB 3QUYB 5I1HH 4M1CD 5T1MB 3GHEH 5FKPB 5D72L 1K5NA 4IRSC 1IFHL 3AROA 4ZXBD 3HMXL 5IB2A 2XTJB 3U4EB 1UM5L 1UB6B 2FECI 2X70A 4H5SA 1PX3A 2OQJB 4HLZH 5T5FH 3QT2A 3L3OB 4X7CC 1RUML 5D1QA 5CZKA 4TUKL 5FHAH 2X9WA 1EHLL 1RU9L 5GJTL 1LD9A 2CJUH 2FX8L 3MODH 1CLYH 3ULVD 4Z5RB 4Y5YB 4UTAL 5DVLA 4HJJH 1D6EB 4NC0B 5A2LH 3HLAA 5D6CA 4P5KA 3D18A 1J1PL 1A6UL 1MCWM 2R0WL 2VXTL 3QXTA 4LLUA 3PXHA 4WHTA 5DHVA 3IKCA 5CZVH 2VXQL 4S1SL 1YNKL 3B9KB 1JPFB 2FD6L 1CD1A 4GBXB 4JFHD 4BKLA 3GSNB 1PLGH 4MVBC 3I9GL 4UQ3B 5HTSA 5E2TL 2D7PA 3I02A 2DL2A 4CDGC 4RBPH 5F9JA 2IPUK 1SJXA 1YC7A 1UM6H 3QCUH 5HJ3A 1FL3A 4J4PD 2OJZL 2D31A 1PZ5A 1A7NL 3QAZC 5F9OH 4FQCL 1TJIL 3TBWA 4YNYA 3LOWA 3UBXI 4ZFOA 5I15H 4FHBD 3S37L 1JMZA 4RDQG 1FYTE 1D5MA 4ZUUA 3BWAB 1L7TH 1OT2A 1YEJL 4NP4H 1K2DB 4KKBC 2I24N 2FECL 2ATKA 4K7FA 1CFTA 2VUOA 2GJ6D 3DUUB 4BQCA 5IHLB 4G8GB 1AE6L 4XVTH 1FP5A 1Z9MA 4FQLH 1F90H 3ECBA 4WGWB 1CL7I 4DVRL 2XRAL 3VXRD 1F58L 1FGVL 4FQXC 5KSUA 4JE4B 4Y19B 1HEZB 1JZ7A 4NQSA 4Z0XB 4LOUC 5MP6L 4G6KL 3BW9A 1FAIH 3CLEL 3R4DA 2AQ3A 1Z6JT 2OR8A 3VFGL 1SEQH 5KSVB 3DMMC 5CLTA 3I6LD 3EOBB 4PJ5A 1WT5A 2WINA 1P2CA 4NQEA 4OF5A 3X14A 4U05A 3RWCA 3T1FB 4OZIB 1T0PB 4KKCC 3VGGA 1ACYL 2MQCA 1QQDB 4D0DA 4Z6AT 1N59B 3BRGC 2NY7H 3QIBD 2XICA 4YBLC 2Y06L 2P5WE 4MJ5B 3D69A 2BVTA 1HN1A 4KQ3H 3HKFA 4BH8A 1K4CB 3VRIB 3WJLC 1DVFD 2HKHH 1A21A 5IGXH 5C0FB 4JO4L 4QXWA 4P46C 2R29H 1GZPB 4NJ9H 1IVLA 3FB5A 1CICD 1S78C 4JVUA 2Y7QA 3SKJH 1FZOA 4RFOH 4TYUA 3EZ8A 3VGAC 5DT1L 4QO1A 1HIML 1IM9A 1V3JA 4PJXA 1II4E 4NQXA 3T65B 3QUYD 4I18A 4GW4B 4ZO8A 1CL7L 1UWXH 4X7TA 1GHFL 3E8UH 3MV8E 1KB5B 3QO1B 4LL9A 4RGMC 4KJWC 3X12B 3OB0H 2EC9U 4JLRB 1KJVA 4KKNA 4JVWA 5CS7A 4ELKB 2MQ0A 1A22B 3GSOA 2FL5B 1JGUL 3FRUA 4PJ7F 3FMGL 2XTJD 5GRXG 5HGGS 2JB6B 4KH2A 3EYVA 1K3IA 1QLEH 3MLUL 2GHWB 4Z9KB 5FCUL 5HDQL 4OD2B 2A1WL 4L3EE 3RVWC 4ZDHA 4NNYA 1EA9C 3SQOL 5DEZA 1NC4B 5DS8A 2BNQB 3CDYA 2BY2A 3O41A 1CBVH 3NCYS 2VDQL 2O5ZL 5ELIA 1ZA6B 3Q48A 2A0LC 4XXDB 4XPFH 3M17A 4JZOA 4E41B 1MCJA 2PW2B 3WS6A 2XY2A 1SJHB 5EORL 1WWCA 4L4JA 1RIHL 1NEUA 5EB9A 2F5AH 2HJLA 1XF1A 3OG4B 4NZUH 3G6DL 3ZE1E 3N1GC 2CUIA 4BH7A 4L4TE 3V9FA 5GISH 4I0PD 3B9KD 1NGWA 4PJIE 1GIGL 2GJJA 1AQDA 3L3GA 3UYRH 2W9EL 4P5MA 2NXZB 3QEGL 1IC1A 3VDBA 1DFBL 2Q1EA 3INUH 1KCVL 4HIXH 3VXOB 1S8DA 4GW1A 4NN7C 2NTSP 2W60B 3O4LA 4RA0C 3VWKB 1UXSA 3D5OF 4MCZA 1K8DB 1YQVL 2Y5TB 4AL8H 5H35A 3NPSC 4ZFOL 1N4XL 5IEHB 3MV9A 3REWA 1A6ZA 1T03H 1JF5A 4EXKA 1UEYA 4ZPTB 4MNGE 3KYMA 3FQUA 4JKKA 1F4XL 2DLGA 1V3MA 5FDWB 2WWMC 5C0DA 1A4KA 5C2BL 1ZT7B 5I6XB 1S5HB 4EZMA 4U6XA 3CLFH 4ZAKB 3E0GA 4G8GD 1GGBL 4ZODA 2AI0H 2VO5A 2LAGB 1FNSL 4LSTL 4EUPH 1OP5H 2GITB 2RQ8A 1YUHA 4Y19D 4UAOB 3W9DA 1F45A 3M1BA 3I3DA 2VLRA 3KLSA 2IF7A 5ISZA 3O45A 2P8LB 3U48A 4LLAA 4NKMA 5KS9A 4MJIE 1E6JL 5E2VH 2VLJB 5KZCB 4F8TA 12E8L 1T5WB 4X6CE 2D0HA 4G9DB 1S7RA 5JHLL 2YMXL 2XPGB 4CJ1A 2DJ4A 3ALXA 3KS0J 3P4MB 3AFLA 1FG2A 3V6BR 3STLB 2B4CL 4ONOA 2YSSA 3IXAB 4QCIA 3LZFH 4RSVA 4I48B 1C5CL 4GG6E 5E9DE 2AJZB 3NBNA 4XAWL 4JGUA 1U3HA 3B6SB 4XNQA 3TVMA 2DLHA 2YD8A 3BH8B 3H9HA 4GQ9L 2DD8L 3UTTA 4APQA 3SKNB 2DMBA 1CD8A 3HA0A 2UUDH 2HH0H 4EI5B 3VRLE 1KBGL 3ARDB 3QUZC 4OQ1A 5DEFA 3UTQA 1U0QA 4KK9C 2MMXA 1QBLL 5AEAA 1ZANL 2HLAA 1VFAB 7CGTA 4OZ4A 3HFMH 1HSBB 1F4YH 1I75A 4PREA 2H2PD 1BFVL 2R2EB 5EU3B 3RUGF 2ARJQ 5B3NA 3KXFB 4XNMB 3IDIB 5L9DH 5E94B 4DK3A 1IKFL 3WFEH 3ARBC 3QXDA 2D9QB 4QTHB 5F7LB 1OQOA 3IJSA 3MJGX 4OAWB 4UI2A 3KPPB 2G5RA 1EAPA 4LCIL 1N5AA 1PW3A 3D87B 3VFPB 4PJGE 3WJJC 1WK0A 5F89A 3ZE0F 1MFCL 1IM3A 4CU7A 4UT9L 2NY1C 3CSGA 2FO4A 3DOSA 1GOHA 2IAMA 4PD4K 4DUWA 2V7NA 1U8LB 1L6XA 5A2KH 1NC4D 3PP4L 2WBJC 2BNQD 3OV6A 3OJ2C 4JO3H 3U30B 3O2DL 1YEKL 3NAAH 3ZMRA 4XCFH 1NGPL 2HT3C 3ZT5A 3KPMA 5B3JE 3W39B 4E41D 3EJYC 2Z9TA 4ODTH 3FCTA 3KPNB 3HPJA 3HNTH 4X5XA 3HUJA 1BBJA 3DROA 4XNXL 2ITCB 1SBBA 2BVUA 4DKFH 4JJ5A 3GMLB 4OGYH 1MCSA 2YA2A 3G5YA 1TPXC 2OTWB 3MRDA 3MV8B 5JTWA 2QQLH 3PWPB 1I9JL 3ESVF 1G6RH 1IC4L 1FLRL 1T1YB 2IQ9L 4OKDA 3I84A 1HSAB 4IOFC 4JO2L 3UZEA 4FZEL 4NJAH 1QSEB 4UOW0 1KN4L 4O00A 3BYYA 1L0YA 4OB5L 5ENWA 2VDNL 5DK2A 4CMMB 5JPMB 1MCBA 3VWKD 4L8SA 2HT2C 4FP8L 4GKSB 2P5EB 5ID0A 5JQ6L 2H26A 3MRNA 4FG6D 4OZGE 2LQRA 4OLVL 4GQPH 4P3CH 2C5DC 1DN2A 4KZDL 1B6DA 3B9VA 1NGYB 5D96B 2Z92B 5DUBB 1NDGB 1NCUA 1HZHL 1M7IA 3LS4H 1I1CA 2YKLH 4JQIH 4ZAKD 1OF2B 3VH8A 3JV5A 3NFSL 1V7NL 2B2XH 3F8UB 2DM4A 3PWLA 5CSGA 4L4TB 2LE9A 4XBEH 4XCNB 1AP2B 3ZYIA 5I1HL 1NBQA 3RWDA 3GHEL 5B8CA 4J3SA 5IT2H 3GRWA 3RVVC 1IKNA 1G7HB 3EYSH 1NBYB 4EI6B 3KLDA 4HS6A 2GT9A 1MAKA 1QSFE 3TBVB 2FGWH 5EULV 2VLJD 5KZCD 1GZQA 1MIEH 5IB3A 5E08H 4G9FE 5L2JA 3HE6A 4PGEB 1A5FH 3PGDA 4MD5B 5D70H 1ZHNA 5T5FL 5GS0D 1EPFA 3OKKA 1TJGH 4X8XA 5EU6A 4HXBH 2C3VB 5FHAL 1XT5A 5D7JC 1XZ0A 5FO8A 3ZHLA 5JOPE 1PG7W 2CJUL 2GK0A 4MNGB 3S98A 3MODL 4M03A 2I07B 2GFBA 1DQJB 4HJJL 5GGSY 5MEOA 3WN5C 5CZXC 4LSVH 3AMKA 3EYFB 3MRBA 3MGOA 4KU1A 4OJFH 4X5WB 5GIRA 4EI5D 1FNFA 3BUYB 5CZVL 5E03A 3QXUA 1OQXA 3ARDD 2NY2B 4V1DE 2G2RB 2ITDA 2E7LA 4FFYH 4LKCA 1PLGL 3RTQA 1KNOB 3KVQA 3F6IA 4MA7H 4XBPA 1EFXA 3CK0H 3C60B 3QHZL 1MWAB 1NEZG 2VE6A 1OCWH 4Z7UF 2ZKHH 3KYOA 4NQVB 1JZ8A 1FV1A 4MJIB 1UM6L 3QCUL 3O11B 2DKSA 4FQIH 5GXBB 4AK1A 2HA1A 5F9OL 1U8JB 1I1FB 1CI5A 5I15L 1DBJL 4MXVF 5E99H 4L1DA 4QOKA 3V5KA 1JHKH 5I8CB 5IBLD 4U1KA 2CDFA 1UWGL 5E9DB 4NP4L 1FFRA 1GRWA 3QQ4A 2P5WD 4MSWB 1V5JA 2HTKD 3PWVA 5HYFA 3BSZH 3VXQA 3MV7B 4XVTL 2BSSA 1F90L 3KAAA 2PTUA 1A8JH 2E8ZA 1OWWA 2BSRA 3ULUF 1J8KA 3TT3H 5BRZB 4NO2B 1X5YA 3S37X 1L9MA 1RAMA 5L88H 2EDWA 4K55A 5LAXB 2QR0A 4F7MA 4PJ8A 1FAIL 1MUJA 3DO7B 2EIEA 1XR9A 3ILQD 5C0AA 1BJ1H 5MI0B 1SEQL 5CHNA 3MV8D 4N9OB 4YO0A 2J8UE 1O7VA 1I1AC 2NPLX 4XP4H 2X7LA 5I2IA 1T3FA 3EOAA 1S7UB 1MJ8H 3SE4A 3CH1B 3D2UA 4LCUB 5H94A 2EE9A 4WFGE 3QQ9C 1UJ3A 2NY5H 4LF3B 4PJGB 3DX6A 5JLZB 1XGPB 4MCYB 2WBWB 4HMEA 1MHEA 1GGIH 2NY7L 2P5ED 1OD7A 4L3ED 2YBRA 4A6YH 5E6IB 5HDLA 2W0FA 4KQ3L 1IGTA 2HKHL 1OGTB 4N0FA 5I76A 5IGXL 1T7XA 2D4FA 2YPKA 2R29L 5T1KD 3GSUA 3BHBB 5D7IB 3IYLW 1UZ8A 1QEWB 1T1XB 3CFCH 4MQ7A 3WHE1 3SKJL 4YHKH 3HMWH 2EEDA 3DTXB 4RFOL 1LE5A 4JFEA 2IALA 1H8NA 1ZKAA 1NBVH 3SJVE 4FQHB 4FNLH 3TPUA 4L4TD 4TOYH 1XF4B 2UYLB 4N68A 1LNUB 1AGDB 4BFBD 3E8UL 1QACA 3SCMC 1TTUA 2OL3B 4PIRF 3M07A 2DTMH 4ZUTB 1IAIM 2DQEH 5CWSA 3BESR 3NIDE 1VEMA 1ORQB 3MNWA 2XN9B 4WFFD 4FMKA 1QLEL 2V2XA 5FCSH 1ZGLA 2EKSA 3RWHA 3CSYB 4YEFA 2PYFB 4FFVC 3SY0B 5D1ZA 3DURA 5FECB 1NUDA 1CBVL 4K8RH 4ALAH 2R9HC 5HPMB 5E8PB 1S7QA 3RY6A 4OGZA 5T33H 3K2MC 1KB9J 3B8SA 1KTDA 3G6JF 4PLKD 4XX1G 3V52H 4O2CB 1J87A 1L9NA 4CU6A 3OMZA 2FGZA 1P7KA 1VESA 1JF1A 3DJ9A 3HZYA 2B1AH 4ISVB 3NFNB 2F5AL 4LLDB 3MRIA 1GC1C 4NZUL 4JRYA 4Q74A 4Z78A 3OHXA 1FORH 5HGBB 5IW3A 4D9LH 2NY2D 5GISL 2QHRH 1U8KB 2BXZA 1ZHKA 2IH1A 2YXFA 3UYRL 4U2ZA 3QR2A 3TZVB 2Z93A 5HYJA 4U6VL 4DGVH 4J1UA 3C60D 3SO3C 1JYWA 2XXCB 1G6RA 1DQLH 3QDJA 4HIXL 4YWGH 1BVLB 2WM0A 1AKJA 1Z3GH 4YR6B 4MJID 5JZ7C 1HKLH 1FZMA 4TQEH 3QJHB 4G9FB 5ADPH 4MGXA 4AQOA 4AL8L 2VLLA 1KIRA 3MUY1 5GGUB 4KJPC 1T03L 3TBSB 4MNHB 2DQGH 4OBRA 1H3VA 2PF6A 2MFNA 4HKZA 5E9DD 5JW4Q 1P84K 2HTLC 1F11B 1DCLA 4PJ9A 2IMMA 5HD8D 3T3PE 1WT5C 3PGFH 4HDIB 4XZUA 3FFDA 4MD0A 1R3LB 4NYLB 4L8BA 3CLFL 1YNTA 4R4NC 2B4CC 1OTTD 2AI0L 2PYEE 5DZLA 5DRXA 3EAKA 3DLQR 2X4RA 4YLQT 5BRZD 1YEFH 1A1MB 1A6TA 1PEZA 1DUZB 1XEDA 3BP4A 5JA8B 3HC4H 3RL1B 5I66B 3LN5A 4HWZA 5E2VL 4XBGB 3QDMA 4ONHB 5JIKA 1CIDA 2VISB 3I75B 1WICA 1BP3B 4X99A 3WIIH 5BZDA 3TH2T 1YDPB 4OM1H 2QQQA 5DI8A 3KDMA 1JJUA 1FNHA 4PRBB 2X40A 4PRPE 3UDWA 3LZFL 4N0YH 3P0YH 3PV7A 3O2WH 1EUTA 1YECH 2OR7A 5IWLC 2D7NA 2LU4A 4R7DA 2QADC 4NKOA 4RRPA 4PR5B 3CFIC 5E6ID 3V5HB 3ZL4H 2C3GA 3VGHA 3LEVL 4UDUB 3ZE2E 2P47B 2HH0L 2BDNL 4PJBF 3X17A 4LGRB 3EHBD 4N8VG 1Z9OA 4PS4H 5BOPA 4Z7WE 5BJTA 2ARJB 1XCQB 4I2XE 3RX7A 4ZNEE 4LKXB 3HFML 4KUZH 4P57B 1F4YL 1R5IA 4B0MM 1MCPH 2A83A 1U6AH 4F9LA 5F6HJ 5IQ9A 2C1OB 1VFBA 1HOCA 2BMKA 5L9DL 4LLVA 3DHJA 3T0VA 3WFEL 5F7DB 2UY7A 1RJYB 2VIRA 4LCWB 2XKNB 3BP7B 5J9PA 1A7PH 4F33A 1NSNH 2E27H 2E8YA 2XN9D 3GMQB 1AGEA 4U33A 3ETBF 43CAA 1TZGH 4NT6A 3SN6N 1VB9A 5HI4C 5E2JA 4AMKH 3WBDA 2K3TA 2ATPB 4K7PH 5AYUH 5GGVY 2XI9A 4LHUG 2AEPH 4F15C 5DVKA 3D39E 2ED8A 2JCCE 3NAAL 4YHIA 3ZKNC 1BM3H 2I9TB 1F3DH 1LO4H 2BOCB 1I3RB 3KPQB 3MRQA 3ZDXF 2IWGA 2J4WH 3ZO0A 2KZ1B 4ODTL 1OB1B 2IFFH 1KCKA 4TSCH 2FNBA 3HNTL 3RVTC 1MVUA 1NMAH 3TN0A 1AI1H 4CW1B 1MH5B 1X4XA 2HRPH 3IU3B 5I19H 5IBUB 4DKFL 4IRJA 4OGYL 3GJFH 3ZSSA 4POYA 3QXWA 1R3JA 5EN2B 1D5IL 3TZVD 3CMOH 1VSCA 4F3FA 1G6RL 3WS3B 3PDDA 4QY8B 2XQBH 4NJAL 4YHOH 4FTVE 4XVSH 1W8NA 1C08A 5MENB 5F1NB 5DJXA 3IFOB 4G9FD 1D6VH 2H1PL 4QRPA 5HHVH 2XA3A 4UOJA 5C6TH 3DSFH 1TZIA 2FJHA 4H25B 2BNRA 4P3CL 3ULVH 3K81A 2AJUH 4JFZH 3LKSA 1RK0B 5K9JH 4ELME 1XGQB 3P77B 3OXRB 3IDGB 1DBKH 2YK1H 2FJFA 1X44A 4FQ2H 2FZ3A 4XHJD 5CGYC 3LS4L 2NW2B 5TE6H 2YKLL 4JQIL 4ZQKA 4Y16C 1DBAH 1FNEA 4X4YA 3S36H 5LGHH 1T2QH 3HE7A 5IV2B 1ADQH 2ZCKH 2B2XL 3D85B 4QRRA 3MFFB 3U36B 2X89A 4XBEL 1LE9B 4QHNB 4PTTA 2VQ1B 4X6DA 1ACZA 3TVMC 2EICA 3B3IA 3B9DA 3EFFA 1J0IA 5IMOB 4APQC 1QR1A 3WFHA 2VABB 5GZNC 5C07A 2X4QB 2FGWL 1MIEL 5E08L 5FYLE 5GRWA 3SE8H 3E3QC 3TNNA 4M3JA 1A5FL 3ILPA 4PY8J 5DJCB 5D70L 2I9LA 4JFDA 4PBXA 2QKIB 1JHLH 3W0WE 1S9WB 1TJGL 3NA9H 1QFWH 4HXBL 1KCRH 4NN7B 2H3NA 4P99A 5SX5H 5HYEA 1GOGA 3BX7C 3CXHJ 5GRJH 5DHYA 1AXTH 1GGCH 3ESUF 4N1EA 5MHSE 1ZT1B 4LSVL 4MS8D 1S7WA 3BN9C 1BQHB 2HFEA 4HUUA 4Y2DA 3TNMA 1JNHB 3GMNA 3NZ8B 4OJFL 3FAWA 4AH2A 5GRUH 5B4MC 3EYOB 3BDBA 5E4IA 2ID5A 1DE4A 3JTTB 3N85H 4WHYH 1HHGA 3MJ6A 5ACLA 5DQ9B 1OTSC 4YDJA 4G7VH 4KKBD 1KV3A 2ESVE 4OQTH 4FFYL 5D5MA 1CFSA 3V95A 1E4XI 2P8PB 4MA7L 5B38G 2J6EH 3CK0L 4PJEA 5BMFH 1OCWL 3HAEG 3LHPH 1VPOL 3AAZA 2VERN 4L1HA 1KXVC 2ZKHL 4LK4A 4LRIA 4UIKH 3VU2A 4Z77A 5I71B 2EE6A 3R06A 1ZVSB 4FQIL 4PJXF 4MAYA 4G8EB 1JHTB 3CFJA 2BOBB 1UQSA 2P42B 3FB6B 5GSVA 1WC7B 4U0RB 4LCWD 4QGYA 5GPRA 3MGAA 2V2TB 1M71A 3OGCA 4K71C 3SE9H 3TYFA 1Z5LA 3FONB 5E99L 3OGOE 4PRPB 5J6HB 2CDGA 1QHOA 1U58A 4HK0B 3PHQB 4RGOH 1IC5H 3AUVA 3NCCB 5C71A 1LP9A 3LRSA 3BSZL 4YDVB 1CVSC 4XH2A 3QULA 4KKCD 3U9UB 2XT1B 5CJQH 1JGDB 3W9EB 3L6FB 1IGJB 3F5WB 3FB8A 3IFPA 3QDGE 1VGEH 2H45A 3A67H 5GRVK 1JI1A 4PRIB 2PTTB 3TT3L 1N6QH 2V2WB 3DV6A 5J3HC 3QFDB 4I2XB 5L88L 1QFOA 5LCVH 2FO1A 2ICWA 5F1KC 3N50A 4N90D 4WW2B 3HS0B 3DO3A 4ETQB 1QBMH 1XIWA 1LGVA 2PW1B 3FT2B 4NRYB 4XP4L 1EHXA 4Z18A 5CIPH 3LCYA 1MJ8L 1WITA 2A74A 3K7UA 1BIHA 4MDJA 1E4XL 4G5ZH 4OGAC 3T4AB 1AFVH 4EIZC 2AK4E 1R5VA 2AJVL 5MEND 3FAXA 4GAFB 2UWEA 2NY5L 3DV4A 4WWKA 1AGFA 4KJWD 2R39A 1GGIL 2MHAA 4A6YL 5DD6B 4F7EB 3FHAA 1VFUA 2DI9A 1GOFA 4LDLB 2VJXA 1L6ZA 1YPZB 4BJLA 3T77B 2JCCB 1Q9OA 3SKMB 3C8HA 2FIRT 4GXUM 3QCTH 4GRMA 5E95B 4TPRH 2X6MA 2Q8AH 1YYLH 4DFIA 4KPHH 5CEYA 2EDLA 3MJ7B 5HYSB 3CFCL 2NY0B 2XKSA 4YHKL 5EBGA 3HMWL 4OGXH 2V6HA 4X4XB 4XI5C 5GGRA 2EH8H 1CFNB 4X9IA 5IUSA 3D85D 4FNLL 4TOYL 4D8PB 1NJ9A 1A0QH 1AXIB 4F58L 2ZOLA 4ZFZA 4DW2L 3K74B 4G43A 5BOZG 2DTML 2FH8A 3OAYH 4PGCA 5HHOA 2DQEL 2GCYB 1MF2L 1PGRB 4UU9B 1J0KA 4W4NA 1TVHA 1ZHLA 5L2KE 4U1SB 5C0NC 3BPOC 2JJSC 4JN1H 1HHKB 3CDCA 1B6UA 5IVZA 1KTLB 1EVTC 5IVXB 3CZFA 3VMOA 5JA9A 1QPPA 2EDOA 4QHMB 4MMXC 2Q7NA 2VITB 3BYTA 3QIUB 1VCAA 3JZ7A 4K8RL 4ALAL 4CADA 4MJ6A 3BPNB 3DX9B 5D8JH 4BZ1L 5T33L 4R97B 3CX5K 5DJYB 1Q9KB 1ZA3B 1UYWH 4QXUH 5EBLA 5C1MB 3V52L 1KPRB 2VDMH 2EXYD 4I3RH 3ALPA 2APBA 3BZFA 4S1DC 2B1AL 3S97C 3NCFB 2VN7A 1J5OL 3O3AB 3NGBB 3DVNB 9CGTA 2PYED 5EBMA 3VFMA 1FORL 4D9LL 1J8HA 2DTSA 4BFEA 1CFQB 2QHRL 4WW1A 3AS2A 3GJFA 4ZXBA 2PXYB 3CDGA 1I8IA 5F44A 4DGVL 4EN3B 2VXSH 4HFWB 1DQLL 4GAJH 4YWGL 3BQUA 1J1OH 1Z3GL 4PJAB 5IMMB 4U1JA 1IL1A 1HKLL 4TQEL 5ADPL 1OARH 4XAKE 2X09A 4O51B 5DK0B 3ZT6A 3MBEC 4POZD 1VEPA 3W0WB 4NZRH 1B4JH 2DQGL 4PRPD 4TVPH 4AEIL 3TF7C 5CJBA 4HUNB 3HC0A 3AREB 1N3NA 1JVKA 4PFEA 1U92A 3E6FB 4LDEB 5J6GA 5I1LA 3PGFL 3L3DA 1UADC 2FATH 4QRTA 1QP1A 3EKCA 2HAZA 3D0LB 5HGAB 1PY4A 3RGVC 3EFDH 2VZTA 4AJ0A 3FB7B 4ZS6C 5D7JB 5J13C 2UV3A 1ADQA 4LQ1A 2DQFB 3K1DA 4OKVB 1TQBB 3O6LH 1H3TA 2D2OA 4PRID 1XF2B 3QIWA 3QB7C 3RWFB 5D2LF 1YEFL 2EIZA 1TENA 1IEHA 3HC4L 1ZS8A 1BJ8A 2VL5A 4KI5F 1KB5H 4RAUB 4MWFB 5LWYH 1PYWA 3WLBA 4M7ZC 4Y5VA 1HE7A 2FLRT 2GJZA 4KK9D 3TBYA 4DN4L 2HG5A 2UVFA 3I50H 2OTUA 5EOQH 3WIIL 5IHUL 4M3KB 1CDHA 1A9BB 4OM1L 3GSQA 4KXZH 5DD5H 4FQJH 3JWOH 2FR4B 1JPST 5D7KE 1HYSC 4N0YL 3C6LC 3IFNH 4PY7B 4IOIB 2Z35B 3P0YL 3O2WL 1R5WA 3S5LG 1IAKB 1CG9B 5BV7B 2VAAB 1U8NA 3RY5A 3LKPB 1I1RA 1ZVHA 1A2YA 1SQ2N 3ZL4L 5F97E 5K9QG 3MRKB 4G3YL 3GO1H 4MYWB 5CAYB 3BGAA 1BD2B 2BC4A 4JCMA 1HK6A 3FJTA 2ERJC 5EZJB 1CQYA 4G6AC 1RZFH 5E6ZA 1JTTA 1T83A 4PS4L 3LDBB 2NY0D 1AR1D 4OQTA 3QFJE 2NLJB 3KJ4C 4LPCA 4KUZL 4NFDA 2DOCA 2J6EA 3MLPA 5FA4B 4E42A 5J8OA 1U6AL 3EO1B 3S35X 2IANE 4U1HA 3OBAA 2Y25A 4PPTA 1JK8A 3DWTA 4RCAA 1KPVA 3L7FA 1EO8H 5C0GB 5ETUA 4HHAB 2F54B 4YE4H 2APTA 3NA4A 3HZMB 1A7PL 2GTZB 1D5XA 4PGZA 1NSNL 2E27L 1U3JA 5IB1B 1TZGL 35C8H 4DVBA 3OAUH 5H8DA 2EC9T 1ZLWH 4NN6C 4JN2B 4OFKA 4UBDC 1DVFA 4UT7H 4AMKL 2Z8WC 4OZHB 4OZFH 5CJ5A 1AHWB 4K7PL 5AYUL 3V7AG 3KJ6H 3QIUD 1KFAH 5E1AB 2R15A 4XC3H 5H2BA 1DJSA 1DQQA 1BM3L 1N26A 4XPBH 4YDKH 1LO4L 2J4WL 3QH3B 4RZCB 2AABL 2OP4H 5KVFH 5HXMA 2IFFL 2VKWA 4Y4KB 4OD1L 4RBPK 4TSCL 1NPUA 4LQFH 1NMAL 1AI1L 1VEOA 4CVXA 5DA0B 2HRPL 3MNVA 3STBA 1U2HA 5TJWK 5AYQA 5KSBB 1ZWIA 1HHHA 1T7ZA