2GEQA

Crystal structure of a p53 core dimer bound to dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
193
structure length
188
Chain Sequence
QKTYQGNYGFHLGFLQSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*CP*GP*TP*GP*AP*GP*CP*AP*TP*GP*CP*TP*CP*AP*C)-3'
publication title Structure of the p53 Core Domain Dimer Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2geqA00
3KZ8A 5BUAA 5AOMA 5AOLA 4AGNA 4L18A 4HJEA 2WGXA 1H9DA 1YCSA 2BIQA 1IO4C 1EAOA 3D05A 3D0AA 2VUKA 1EANA 2P52A 2RMNA 2J21A 5G4MA 2J1ZA 4XR8C 5ABAA 1E50A 3Q05A 3D09A 3WTYA 1TUPA 4IBSA 2BIPA 3VD0A 5G4OA 3QYNA 2OCJA 3EXLA 2XWRA 3IGLA 3US1A 2BINA 2J6WA 2IOOA 2ADYA 1CMOA 4LOFA 4GUQA 4G82A 1HJBC 2IOMA 4IBWA 5LGYA 3D07A 1CO1A 5AOIA 2BIMA 4AGQA 4AGMA 1HJCA 3IGKA 4G83A 5AOJA 4AGLA 5KBDA 3D06A 3Q06A 5AOKA 2GEQA 1UOLA 3US0A 2FEJA 4IBYA 5AB9A 4AGPA 2IOIA 3WTTA 4IBUA 2XWCA 2YBGA 1GZHA 3WTUA 2AHIA 1HU8A 3WTVA 3Q01A 3ZMEA 1EAQA 4KVPA 1TSRA 4IBVA 4IBQA 2PCXA 2X0VA 3VD2A 1KZYA 5G4NA 4QO1B 2X0UA 4L0ZA 2AC0A 4LOEA 3WTSA 5A7BA 4IBZA 2ATAA 3D08A 4GUOA 4L0YA 1GZHC 2BIOA 3KMDA 1T4WA 4AGOA 3WTWA 3EXJA 4IBTA 3VD1A 2MEJB 2J20A 5LAPA 4MZIA 4LO9A 2J1WA 3TS8A 4MZRA 4IJTA 2J1XA 2H1LM 4A63A 2X0WA 3WU1A 5ECGA 1LJMA 3QYMA 2J1YA 3WTXA
chains in the Genus database with same CATH superfamily
5AOZA 1AXTL 3SGEI 1XL6A 3K74B 5FECB 4V1DA 1UURA 3K1KC 2I07A 2IGFL 1HYSD 5F9JB 1E4KA 3TBYA 1USZA 3KG5A 3L3OA 5CZRA 5ISZD 1CXKA 4U1JB 2Q6WA 3FCSB 4FQHB 5GQBA 1KIQA 2EE0A 1F11A 3TO4B 1KGCE 1MCOH 3MRDA 3P3SA 2RA1A 4YSOA 2E9GA 2XV0A 5LGJA 2EVFA 2P48B 3FB5A 1YC7A 5GS1C 4X7SH 1QFWM 1A6VL 3QEUB 1A4CA 1A6ZB 2X1XR 3T0AA 4G9DA 2VRKA 4GUQA 2QHLA 3LN4B 4H88H 1F45A 3PIQB 4BCXA 3AY2A 4IK6A 1ZLUK 3KLQA 4D0DA 2FBJL 3DI3B 4K8RC 3MA9L 4LEOA 1L9TA 2VZ1A 1CIUA 4XCYB 1BVKB 3FO1B 3KL5A 4P59L 2X4PB 4GAYA 2OR8A 3BIKB 4Y4HD 3S9DB 1KIPA 3QFJB 5PAZA 2Z8WC 3L5WA 4XP5H 4PP1C 5A6IA 3MYZA 1JGVH 1FFPA 5I1DA 1IKOP 3QPQC 3DOHA 2PXYD 2F54D 3B7YA 2CIKA 5FCUL 3JV5A 2A9MH 3DYPA 4P2OD 1BZDA 5ESVA 5B1BB 1JNNL 4U1SA 4U6TA 5KSAB 2B7DT 4PBXA 4FA8A 5F1KC 5FOBB 4XMUA 2CU9A 1ZA6B 5D7IF 4HS8L 4P2YA 2AK4D 1E5BA 3FCTB 1I3RA 4Z7UB 4X80H 4N8CH 4FD0A 4YH6A 4BFBD 5CU9A 3TZVD 5HHMB 3OKKB 3EOBA 1ETB1 3PWNA 3VJ6A 5C70A 2DD8L 3U46A 4K9EL 3WMSA 2OSXA 2GT9B 1MEXH 4JPKL 1PD6A 3U0PB 3IFOB 3TV3H 4AL8L 3FN0H 4MD4A 2M83A 2XVBA 3K6NA 1P7QA 2NOYA 4LPWA 4TF4A 4UM8B 4WK0B 5DZ9A 3S96A 3SDXB 5IM7B 1IKFH 1ZS2A 3I74A 1S5HA 1SYVB 4W9DC 3UTSB 1N4XL 4KI5D 4MGXA 3MODH 3WFZA 3G6JF 2AEQL 3QUKB 3AU1A 1BJ1J 3GPSA 3ZYIA 4F15C 1OHZA 1NANI 4R7DA 1M05B 3LKSA 4MZ3A 2J7LA 3LKOB 2P8MA 1KIPB 3G9VA 5CBEB 4GRLD 1UH4A 3N42B 1U42A 5HVWA 1KBWA 2XX1A 1X44A 3N43F 4L4VE 4PJEF 4L4TE 1J0YA 4FQXB 2NNXA 5FYKL 2WTRB 3O2DL 3VFRB 5EBLB 3IU3A 4PMEA 3UGXA 2GSGB 4G7VL 1KNOB 3EUUA 5T3XL 4MTMA 3T8XB 5CZVH 3UJTH 4MB3A 1X7SA 2WXHA 2GG1A 3QCTH 2EH7L 3BAEH 5KVEL 1K9TA 4EI5C 4XCNA 4G8IA 1IBGL 4NI3A 3FS9A 4G7RB 3S98A 2E74C 2VR8A 5C2BL 3WFCL 1RZJH 1V7ML 3BQUA 3O3BB 4FG0A 2XN9A 1ILUA 5KVMC 2MCPL 3TNNA 1BEYH 1OVZA 1Q0YH 2XG5B 5DQDL 4HCRA 1DN2A 3BZ5A 2YPLD 3V0IA 3O4LA 4Z7OE 5HGAA 1QI3A 4FQIL 3RA7L 2QPUA 1PY9A 5FOJA 4M61B 1AD9A 4W4OA 2JK5B 2QGDA 5ENWB 2BCKB 2FZ3B 2DQGL 3GT6A 3Q2VA 4PV1C 2WINB 5HJ3B 3TGXA 5JNYA 4H7VA 1KLGB 2E5EA 4BFIA 5CF3A 5F0PB 3H9SA 1KPVA 5DJZB 3H42L 4PGCA 2P5WD 5IEKB 3GSUA 4F2ME 1OALA 2HRPL 4Y19E 4DK5A 3BMVA 5C9JA 4GKLA 4G42A 2HSIA 2AHIA 1R0AL 4X5WB 3LIZA 2HPTA 4EZMA 3UAJA 2GCYA 3ARDB 4Y4FB 1E28B 4GY4A 4S1QH 1CR9H 3HIZA 3O2VH 5D5MA 3RY6C 3UO1H 3EYUH 2YWYA 3MUJA 3EBAA 3QO1B 3D85A 2E8YA 3VYNA 3WD5H 4ZX6A 1IFHH 1MI5B 3MRGA 3F6JA 2MQ0A 1OO2A 1U8IB 3AT9A 1AG0A 1O7DE 1Q8MA 3DX4A 3EJSA 2X6CA 4U49A 4WQOA 4QJ3B 4D9LH 1AGDA 5AVTB 3ZYJA 1RL1A 3C60B 4X8GA 1FZJB 3O11A 4I0PA 3SPVB 2WIIB 1CXEA 3BEVB 3P73A 4YUEL 4U1GB 1MCOL 1S7QB 2V2XB 3QJXA 1YDPA 2OYMA 3GSQA 2QQKL 3MAWA 2VQTA 4MCZA 4XBEH 5T1MB 3GI8H 4DO4A 2YGVA 1IAKA 4DZ8A 2OMVA 4CKQA 4MNQB 1A6AB 2YN3A 2GAZB 4LMQI 3QR2A 5D55A 4YHZH 2D0HA 2VR6A 3BUPA 2L7UA 2H32B 4TKWA 5D4JA 1XBRA 4H88L 1JN6B 3NN8A 3A4FA 4ZSOE 5DEFA 1RJZB 4DT2A 5A6LA 2X4SB 2IH3B 5I1KH 3HE7C 3KWTA 1KGYE 4MRBA 8FABA 1VCAA 1JJUA 2EINB 2YQ2A 3T4AA 2IV9A 4ODVH 5BXFB 2JLLA 1YCSA 4ZS6D 2NSXA 5HYQB 4JREB 1MVFA 1XGYH 1LE5A 2AJVH 2YJQA 1LEIB 4XP5L 4N90E 4MRCA 3N5AA 4L8BA 2DWDA 2BSCA 3K6DA 3WFHA 2XC8A 3K4DA 1SJEB 4GLRI 1HILA 3KXFA 4LL4A 3DSFL 2GTQA 4QNPE 3C8HA 3US1A 2WB7A 3CBRA 4CNIA 4Q14A 4XTRD 1PNCA 1JGUH 1JWUA 2DI8A 1QP1A 2MCMA 2R0LL 3RL1A 4DGUA 2BNRE 1DQLH 2KHAA 4X80L 3V7AE 4N8CL 1AGCA 3GS4A 4BCYA 1A5FH 1MXGA 2VQ1A 1MWAL 4MB4A 4P2QD 3F7RA 2IBGA 3DARA 4F9PA 2DQFB 4YOKA 2PLTA 1MEXL 4MCZB 1YEGH 3TV3L 4LSSL 3SZ6A 2XLLA 3NIGB 2XIBA 3NSJA 1DQDH 3KS0J 4PRID 4PP1D 4X6DE 3W3BA 1NPNA 2JKXA 5CZXC 4YHPB 4XHJD 1KTLB 4PCTA 1EZVY 4QOKA 2JQZA 5ESQA 43CAA 1KJ2H 3HUJB 3VXOB 4XVJH 3MJ9H 4ZTEA 4ABWA 2VL5A 5CILH 5ITBL 1G7JB 1GKEA 3GSXB 3S3DB 2OMZB 1ZVYA 1I9IH 1XZWA 3PQYA 1X9RA 3ESVF 3QEGH 4BHUA 3BVWA 4L8BB 1ZSHA 3O8XA 1QEXA 1JDDA 1BBJB 5CEZH 3ASWA 1L9QA 1M3IA 4GW1A 4LDOB 4PJ5A 4EF3A 2PTTB 4MCNA 3SQOH 4RDBA 1BLNA 4PRPB 2DW5A 5ITFA 3DX7B 3S7GA 4PD4J 4QHLA 1WBYB 2ADJB 2BS71 3AWFA 5CZVL 2VDRH 3QCTL 3QRGH 2O30A 3LY6A 3BAEL 5HHOA 1N12A 4UQ2A 1C12A 4I1RA 1IIIA 1IAIM 1FI8C 3L95A 3AITA 2V0AA 1V55B 2XFXA 1J0ZA 2VL4A 5AWNH 1CN4A 5I8CA 3QEHA 5JOFA 2XWBA 1BEYL 2VQ1B 5IMLA 1G9NC 5DQJB 1VFAB 3FL7A 3ZYZA 3RL2A 1SN2A 1FNEB 5E5MB 3FONA 3MGTA 3BP6A 3G5YA 3T8MA 5I76B 1MCNA 1OF0A 4JGJA 5F9WC 2X12A 3KPQB 4GUPA 1ET8A 3ILDA 4RGOL 1LDPL 5KVDH 1VACA 5D1ZI 1KCWA 3MNMA 4PV9B 4NRXA 4G8FB 2YRLA 4PRBA 2XQYK 3KWWA 1MCPH 1J8RA 4OBSA 3F7VB 2HT4C 1TTCA 5CSZB 1TLMA 4FC3E 2L0DA 5IK3B 1Z32X 1MREL 1CWVA 1P7KA 2CMRH 1L9OA 4IYKA 3PDOB 1MCWW 4XX1G 2EO1A 5I16B 4WCYH 1QO3B 1A47A 3QUZC 4NM4L 1JPST 2PP9A 4S1QL 4Z6AT 1CR9L 1UH2A 1NM9A 5ID0A 4Z0BL 3O2VL 3UO1L 3FQ2A 5HDWA 1LLAA 4LLMB 3WJJA 1NKRA 4Q9CA 4IKIA 2C9QA 2WW8A 3SCMD 1IFHL 3EYQC 4WK4B 1JWMA 4W6XB 3C8DA 4ZFOL 3LKPB 4FZEH 4DP8X 1J1PH 5CEYB 1F8TH 4FNLL 2VXTH 5T1DH 2K7QA 4Q9QH 1CD1B 2OMYA 4PJBB 2DF3A 3QEHB 4FG4A 4K71B 4NPJA 4MLSA 4UNTA 2DBLH 1KV3A 1U8PB 1KIRA 2E75C 1OPGH 2I69A 1KTCA 3BO8A 3G5VA 3I2CH 1A4JB 4HWBH 4QIRA 3QPXL 5DHDA 5EOTB 4J3OH 3N91A 4AQEB 3GI8L 1TQCC 4OLVH 5IUCA 3BXNB 2ZOTA 1U6AH 2QSVA 3GJFB 3I6KB 2HTKC 3CFCH 1LWJA 3MPCA 2BSBA 4XMVA 5CP7A 2DQHL 1VJSA 5KS9A 2VLLA 2FGZA 4HJSA 2VLJA 3JSSA 1S4IA 2MPVA 4OKVB 2OV0A 5C0ND 3SHSA 1FAKT 2A5UA 5DS8A 4YHOH 1RIVL 2PCFB 1GC1L 3CVDA 3D08A 2AQRA 3EH1A 4ODVL 1IIKA 5I1AB 4YS4A 4WW2C 2UXGA 3MUGB 4HC1H 3FQUA 2Z93B 6FABL 1XGYL 3PF2A 4P9HC 2WWOA 2B3RA 4XMPL 2ZUYA 2A38A 1PZ3A 4I18B 4ZUUA 4LEBA 5BS0E 2VJ0A 3AUVA 3L3JB 3C09B 2Y7NA 5FYLD 1M71A 5BJTB 3E3QE 5DK3A 5JYLA 4NENA 2MTAA 2A4EA 2A73B 3EGXB 1JFQH 3UTTA 3RIFK 1ECYA 4FCHA 1A1OB 5ICZB 4G5AA 4Y1AE 4C55A 3SGKA 3SDXE 1JYXA 5JPMA 3I84A 4EI5B 3UTSE 4JFWA 2NYKA 5EULV 5KOVC 4MDJA 4YAQB 4X5RA 3D39D 4JW3A 3T0EC 1A5FL 5K1JA 5CGMA 4NXSA 3HE7D 4XNZC 2ICWB 4GG6E 4JO3H 3VA6A 1FBIH 1WA1X 3QWQB 4QTHA 1J0KA 1RVFH 1FZKA 4Z7WE 3DVGA 1E4XI 5IQMA 2D8KA 2ZXWB 1YEGL 1YNLH 4HULB 5IOPB 3ATDA 2APVA 4MXVF 4UT7H 2PW1A 2GHZA 4NUJB 4NO0D 2DJSA 2Y69B 2Y7SA 2DYSB 4DGWC 1UCBH 2LLLA 3TIEA 1RPKA 5H2BA 2AGJL 1SHXA 2CNYA 3VDBA 1AE6L 5IHUL 1KJ2L 4XVJL 3P9MB 3MJ9L 2YAQA 5LGYA 4AM0A 4A1RA 3R06A 4UIMB 4OCWH 2CO1A 5CILL 1TR7A 4TNVF 1R3JA 5AVSB 1BQ5A 3U2SA 2EXWD 5FYJD 1I9IL 4FXKC 2LAAA 3ZW3A 1GHFH 2X9YA 3VI4B 4AT6B 3MNVA 1WGOA 5C09B 3PV7A 1YQVL 3O6LL 1Z9LA 4JPVH 1DN0A 2A9NH 2G75B 4G8EB 3TV8A 3C2AH 4LSPH 1N3NB 3QQ3A 5DS2A 3QGVA 2YZ8A 3ARSA 5D1ZD 2NPLX 1GTFA 1XFPA 3FQ4A 4M5SA 4HETA 3ZDYB 2J55A 1FJ1A 3S3CB 3AAZB 5IHZA 2AF2A 2VDRL 1JSYA 2WM0A 3QRGL 2P7TA 4WWKA 1UTDA 3HA0A 4R7XA 3RTQB 2UXVA 3MV11 3DIFA 4NKOB 3QWOB 3WEXB 5I30L 2XT1B 4U31A 3G5XA 3QNZA 1U9KA 4WTXA 3UXFA 2YGOA 5CZXD 2ZYIA 1XGTA 5I18L 1T83A 4K3JH 3PY9A 1BVLB 4A2DA 3GXNA 1VDGA 1QVOA 3VDAA 4XTRC 3IJSB 5HD8C 3KPNA 4RFEA 3BZEB 3NCYS 3GSNH 1A2YA 3GHBL 5KVDL 2PW1B 1CGVA 4LLAA 3V5KA 4UT6A 5ESAA 3S3PA 4HSQA 4KI5E 4O51A 2OSYA 4A04A 4J2QA 4IM8A 1NCGA 3KJ4C 2FE0A 1PZ5B 1F3DH 3BWUC 1EK3A 5BRQA 3CZEA 4JUTA 1MI5E 2KMWA 3ZHKA 1AANA 4Z7AA 4WFHD 5IHBA 2W0PA 4KK6C 2K3TA 1TO4A 4K94L 2CMRL 3IGAA 5L4MA 2R2CA 1HAUA 4WCYL 3PL6C 3VWJC 2J1KA 5GJSH 4NHUA 3U7AA 1THAA 1R5IA 5HYSG 1V05A 3Q1SH 1C08A 3RWEB 2BX5A 4GKNA 5T5FH 5E00B 3CFDB 3K2IA 4TLSA 1YY8A 3GF8A 5H4ZA 1O9VA 3VXMA 3Q9QA 4M7JH 1BHGA 4K15A 4P2CG 4PWEA 3V6ZA 2WNXA 3FUFA 1S9WB 4MA3B 1QFWH 1SVZA 5IBLC 5ACZB 2OL3B 4FZEL 3OBAA 4AYMC 2P7TB 1OAXH 1E4JA 2H41A 3W5NA 3WUZA 1F8TL 4XN7A 2VXTL 3C5JA 3G6AB 1FFTB 3ZUCA 4JY4A 1I1AC 5T1DL 4Q9QL 5EU4B 1UT9A 3SDYH 4B9JA 5J9PA 2Z1PA 3D0VB 3NPSC 1QSFD 2V33A 3BH8A 2B20A 2DBLL 2W5PA 3RURA 4UTBA 1OPGL 1Y6MR 3KPSE 1GGTA 1S7VA 2K3HA 1I8IB 2BSDA 3WV0A 1MCSA 3ALPA 2OW7A 4OLVL 5EIVA 4RFEB 1KBVA 1U6AL 1U8JA 1A7NH 2DLGA 5AW7B 4H0HB 4AIEA 2X42A 5EO1A 1DZ0A 2D31B 5DSCA 1TT6A 1CZ8H 5D96B 1VZHA 2IBZX 3D52A 5EO0A 5AZUA 1RK1A 1L6XA 4FQJL 4N8VA 4WFGD 2H3KA 2I85A 3DXAA 5D7JD 1ZHKA 1BIIB 4DPRA 3JWOC 1B3IA 5EU6A 1NAMB 3RVUD 1JOIA 1BFOA 1FG2B 4XPHH 2EUWA 3HAEH 5HYSB 4I0KA 4IGBD 1ZS8A 5ECJE 4HD9A 1DFXA 3RDTA 3THMH 1VA9A 1CICB 4L4JA 3TA3C 5KYWA 2YKKA 3CFKA 1E6JH 3QZLA 3B9AA 2V9UA 4NQQA 3QRBA 5I5RA 5HDOA 4B5EA 1I8LC 3T6VA 5F7MC 4OF0A 4YHNA 1MFUA 1WISA 2KYIA 1JRHI 2OJEB 1GAFH 1CGSH 1JFQL 3HR5B 4Q52A 4MS8C 4XBMA 2OMBA 2ICWJ 1CFNB 3O81A 1OTUC 4ZXBC 3U82B 3ZZSA 2Y72A 5I2IB 3ULVL 4U4IA 3LKNA 4OJFH 3A67L 1A0QH 4LLWB 3OAUH 2HTKD 4X4YA 4MAYA 1S7RA 2B9AA 4PJ9A 3WSQH 5B38G 4Y5YA 3UG3A 3HUJE 4YN3A 3LZQA 3MRLB 1RPUA 3P0GB 3C6SA 4L3CB 5G2NA 1QLFB 5D6CB 4PJ8C 1FBIL 1COBA 2ED9A 1RVFL 4H0GA 2VDPH 3LNEA 4LO9A 1YNLL 1SQMA 2VAJA 4O00A 3LH9A 5F9WB 3V5HA 4PFEA 1QKZH 4UT7L 3DYMA 4OZHB 5CP3H 3B4NA 4Y2DA 1UCBL 4Z78A 4GAGH 5CJXA 1R5WB 3NA9H 2J8UB 1R24B 3QDAA 3ULSA 4HUCA 2X1WL 4QRPD 1J05A 2QKIC 4PRPE 1F3JA 4HIIB 1BAGA 1JHTA 3AS0A 2AJUH 3NT0A 2EXYD 4JEGB 1IEAA 1YEWA 2ESVD 2OI9B 4O9HH 3F3HA 2RIKA 1WT5A 1X6NA 3DTXB 3QUZB 4JPVL 1I3VA 2A9NL 2DAVA 3D9AH 3T04D 3C2AL 5CIPA 2AITA 2NY5C 4LSPL 5ABAA 3T8VA 2VT0A 1NUNB 3I3DA 4CMMB 3T0ED 3WS6A 1J0HA 1MQ8A 2PWFA 5EBMB 5DFVC 2XQYA 1P5VB 2P49B 2ENYA 3TC9A 4UQIM 1FL5A 1O9WA 3CSGA 1A9EB 4LGSB 2B3IA 4U1MB 3OX8B 2K4AA 5B38B 4F33A 4ZUTB 1JP5A 3WELA 4TNWK 4PJIA 2FVNA 1I8KB 4P2QE 1B0RB 1BX2A 4K3JL 4P46C 1F58H 3MRQB 3MTXA 4B60A 4HOWA 3CFQA 3NVQA 3BJLA 4YK4C 1ODAA 5TTRA 3WS3A 4TTGA 2QMJA 1TQCB 4PRIE 2WBKA 5F44A 4F7EA 1QX1A 1T3FA 1BBDH 1AQHA 4QHPA 1VF5C 4J6RL 4NQEA 1FGVH 3BPNC 3UGUA 3H6JA 3T0DA 5CINH 1F3JB 3MLWH 2HJFA 5DHVA 2E7LC 4HKXA 4AITA 4AQOA 4JFPA 1AI1H 5FS5A 3CFJA 5MEQA 1IEAB 4YL4A 2FBOJ 3V0VA 3QH3B 1YN7A 2HH0H 4PJBE 5GJSL 2BNQE 4TUKH 3U2JA 4AH2A 2B0SH 1JUFB 1QLRB 1UD8A 2ZSWB 5T5FL 4NNXB 1U33A 4WJ5A 2CGRH 4NBZB 3LVTA 1S7WB 4PJ7B 1N68A 4M7JL 1AYOA 3V10A 3MRHB 1FL5B 2EILB 2AXGB 2XJKA 3QXDB 4N0YH 3NESA 1QFWL 1BJ1H 2X3BA 1TO5A 3A4AA 3DURA 3LVEA 1AACA 1OAXL 4WEBH 3ZYOA 1JGEB 2F7PA 4CVUA 4EVNB 5D2LA 4PBWD 1XR9B 2WLLA 3VRLE 1WSST 2A74A 3L2LA 4TOYL 1ETZB 3VU2A 4ELMB 4PGDA 3SDYL 4HW6A 5JIPA 5HSFA 4KZ0A 2WQRA 3MUZ1 1GZPA 1E2ZA 1IGTB 4XNZB 1ZVHA 1ZT4B 4MMXB 4JFQB 5JOPD 4K3GA 3JWNC 4XMXA 3TCLA 2VNCA 1KB5L 4LU5H 2RQ8A 3AM8C 5DJ2B 1T3FB 3IT8D 4KDVA 4HJEA 3PL6D 1F4AA 1QRND 1GGIH 1QSEA 1CZ8L 3D2TA 4NQEB 2E6PA 2O5YH 4IKNA 1DBBH 3AXHA 3NK3A 1LO0H 2J71A 4MYPA 2CG9X 3BVNA 1E30A 5T1KB 1MCKA 2OXGB 4XNBA 3QDGA 1JF1B 4QRUB 3HG4A 4E41D 4B9IA 4PLNC 3KYNA 4PJHB 5C0BB 3OZLA 4HK0A 4IIQB 4K4KA 5IBLD 5K9JL 2OZNA 2WKLA 5DMJB 2IOOA 1E6JL 4P06A 5F9OH 3JVGA 4R26L 5CN1A 4Q6IC 3VXSB 4AMKH 5K1NA 3HFFA 1U93A 3MJ8A 1P6AB 4C47A 2F19H 2CGZA 2PO6C 4AJVA 4OJFL 4FQ2H 4KFMA 2XXCB 3HHSB 5EN2B 1JHLH 1S9YA 3OAUL 4EI0A 4TNEA 5TQ2L 4C58B 4NLAA 5CWSB 3WSQL 4DFHA 4IOSD 4UTAA 3BPLC 5LGKA 4ZAKA 5C92A 4KZCA 5I17A 5T8IA 2G3MA 1MHHB 2CKBH 4JPIA 5MENE 1FUNA 1CFSB 4DP9X 2FT6A 2WNWA 3I75A 2X88A 2VDPL 5GHWL 2DMCA 2DQTH 1NCBH 2CDGA 4PRNA 2CCLA 2CXGA 1QKZL 3FDWA 2YD2A 1Z5LB 1ZV9A 3GLEA 4FG6C 4WWOA 2Z8SA 4GAGL 3NA9L 4PLKD 4WHCA 2KKQA 5D1QA 4Y88A 5F7DB 3FFCD 3L7FB 1CYGA 2A9DA 4MA8L 4L2YA 1KY7A 4M8VA 3WTSA 4GI6A 3U25A 3ECVA 1AIZA 2AJUL 1DR9A 1TITA 5LO7A 5E6UB 4MS8D 5CLZA 3OXSA 2DH3A 3HZMA 1E7UA 3BGMA 1ASOA 3WJLA 4URKA 2YD3A 1IAIH 5L9DH 4Z3HA 4WTZA 4ZFZB 1O75A 1VCBC 5FYLE 3VXRE 2K8QA 4NFDA 4WU5A 4QNPF 2GSMB 1N0LA 3TYFB 3M86A 2R7EB 5IEHA 3QW9A 1NOLA 2EEAA 1SBBA 2QBWA 2P44B 1HESA 2OQJB 4NUQA 4P5KA 2YUXA 3CLFH 4X42A 4PU2A 4I3SH 4JZNA 4UM9A 4Y2OB 5DJCB 1ZHNA 2EP6A 2ICEA 5IF0B 4E0RA 5F72S 2J5LC 3CZFB 4U6XB 4CBPA 5JHDB 1RMFH 1LK2A 5AW0B 1I1AB 2PP8A 5E8EA 4BV1A 2NX5D 2V9RA 3SDAA 4MS6A 1EWHA 1H6UA 4FFYH 1F58L 4JFYA 4P9MH 3JV4A 4JPIB 4N5UA 5DTFA 5EC1B 3V2AR 3ZBMA 4CW1B 3C5ZD 2N3JA 1I4FA 1T22A 3MV7D 4OLYH 4HDIA 3Q05A 5E8DL 4L0PB 2W38A 2ZXDA 4X6DF 4ANWA 1Y18A 2NTFA 2AW2A 3SJVB 4L2LA 4M1GH 4BZ2A 3BFQG 2DMGA 3ISYA 3W57A 3H2PA 4K3EH 2ZWKA 2YIHA 3NEXA 4HKZB 1AI1L 1EFXA 1E4KC 4YZWA 3HZMB 1U58B 1FIGH 1UXWB 3EO1B 2HH0L 2XTJB 3OLEA 3VFMA 4TUKL 4YLCA 5I1GH 3EJUA 2EDNA 1KCVH 4PJGF 3DGGB 4QXUL 4XN2A 4L8DB 1N0LB 3KS0H 4FKHA 3D2UB 5JLZA 2KZBA 5JXED 1G7MA 5KYYA 1RIHL 3TONA 3B2MA 1NEZG 1UOVA 3L7EA 4LB8A 5DRNB 3JZ7A 1OE2A 3BVVA 4ZXBB 4G7YH 3SKMA 3PWJA 4JZNB 4WEBL 1BQHG 3F7YA 4E9XA 3M46A 1EZVX 3W9DA 3Q2LA 3X11A 5B21A 4WV1A 1WZKA 3NZSA 1IQDA 2PPDA 4IBQA 1D7DA 1IGCH 4UV4H 4XPFH 4WHYG 2Y06H 3SDAB 3FQXA 1KJMA 4GMTH 3CK0H 3ZSTA 5HYJB 2K6ZA 2O5ZH 4PJ8B 1U3HA 3CXFA 5B4MD 4F20A 4HDIB 5F3HA 5D7LA 1XSIA 2H0JA 3AW5A 4WO4D 2ZYSA 1OD7A 4LLQA 3WO3B 4A6YH 1ZHLA 4HZAA 3TJHC 4X6BA 2O5YL 3OXRA 1EDYA 4C57C 1RZIB 1LO0L 3GSOA 3OMIB 2XI9A 1I7TB 4DUXA 2QKIB 1WEJL 2KDYA 1RSFA 1KEMH 3DRTB 1I1YA 1G4RA 3Q5TA 4JQVA 4L8CA 1MWAA 5F7AA 5I1JL 5EEWA 2JCCB 3UTPE 4C8XA 1CGUA 3KPMA 3TS8A 1NCJA 4HLZG 1SMAA 4EZLA 1B4LA 4DGIL 1N5YH 1Y6KR 3VFMB 3FCBA 1Q90A 2AERT 3TN0D 5F9OL 4LCIH 1NEZB 4JFED 3C5SB 1OP3H 5B3NA 3AQYA 1LXMA 2IF7A 3IAPA 2VXQH 1KYDA 3FOMB 2GBAA 1C5DA 1NJ9A 2XN1A 2YGPA 1BQHB 1L6ZA 4G2AA 1FDLH 1RJYA 2N1TE 4AYFA 4WNJA 4KKBD 4O02B 2B4CH 3CSTA 4ALAC 2IXQB 3BAKA 4FQ2L 4MCYA 4JAMA 2DQJH 5DR5H 4YSEA 1JHLL 3Q6FB 2J8UE 1X4ZA 3AMKA 4DVBA 3BFOA 4UUJA 3KAAA 5C6PB 3DV6B 1QSFE 1TUPA 3LXBA 2X3CA 3X1GA 3UG4A 4RESB 3LTVA 2CKBL 5G4OA 4BDVA 3BPCA 4ZUSA 1TQTA 1LQBC 3QJVB 3A3YB 1OWWA 5E8PA 2DQTL 4XPTL 1NCBL 1DZBA 5CJ5A 5C07B 2EDMA 1TXKA 5C0AD 4B9PA 1OP4A 5MEPA 3L1GA 3P30H 4JFDA 4Y9EA 2IC2A 2DWEA 5C6TH 5IJVA 1FRGH 4WFGE 1UZGA 1WFNA 3HZVA 2VJXA 2BDNH 1D5ZB 2V9TA 3NJGA 4NYLB 2YA2A 3DVNB 2RB8A 3FH7A 2MRYA 3QT2A 5GGSA 2LFGA 4DP7X 4Z7UF 3UX9B 5KVFE 2GHWB 3QNYB 1IAIL 4JRYD 3J8F7 5L9DL 4N85A 2Z0UA 4KOBA 5FKPB 3VFVB 1WG3A 4XO3A 2VR7A 3PAZA 3PV6B 5FM5M 2XPZA 2JJUA 3TU6A 1X3DA 4GG8A 1CGWA 3VACA 4NT6B 4GBXB 4U7MA 3WKMH 2AQTA 4W4OC 5DA4A 9PCYA 1OGAD 3VQ2C 1XIWD 4YDLB 3HVDA 4JHBA 5FM8A 4P05A 3SGEH 1RJYB 3EYFA 2QADC 3SDXF 2V17H 3P4OB 3KPTA 3CLFL 4HOZA 3CU7A 4I3SL 5KANG 4X6CB 4F1ZA 12E8H 1TZIB 4OF7A 3RIKA 1JFHA 1U3NA 3WN5C 4MHHG 4A39A 4FG6D 1RMFL 2WSPA 2HRHA 2LVCA 3ARPA 3CN0A 1RURH 3BRDA 5IG7B 5H35A 3NFPA 4Q89A 1JV2B 1ANUA 4FFYL 3B5TA 3S36X 2A3TA 4P9ML 2LU7A 4Z7WF 3N42F 1BIHA 4G1EA 5FO9B 2WCSA 5EPMB 4N26A 3H3PH 3OG4B 5FA4B 5GIRB 1B0IA 4OLYL 2RR3A 4M4PA 4QO1A 2EYTA 3ZE0B 4KXAA 1U8LB 1LEGA 4MJIB 1CGXA 5L88L 5T5NG 3RFZA 1FYTE 1WE5A 3PJSB 4M1GL 4HGKC 3BIBX 4KUZL 1A1MB 1ZAGA 1GYWA 2J73A 4AC2A 4NZFA 1XF2B 2OMWB 2C26A 3W2DL 2H3NA 1FE8L 4K3EL 43C9A 5B3JF 1SUHA 5BCAA 1NGYB 5TDNB 2X87A 3GTNA 1OCCB 1PD1A 2HUEA 5DFWH 1CG9A 3CZKA 4AK2A 4HH9B 1X7QB 2KLSA 1FIGL 1LYQA 1PLCA 2Q86A 4Z7NB 1OY3B 5E7BA 4I0PC 3FT3B 4ELME 1NFAA 3EJZD 4W9IC 4IRJD 4Z3FA 5I1GL 1RZKC 3K6SB 1KCVL 3T0EE 5IJKA 4J3VA 2MJWA 3EFDH 3L08A 4OM1L 1QR1A 3E6HA 4Z3IA 4YPGA 1SJMA 1VPOH 3QFJD 4AYSA 3DJTA 2UZPA 4TV3A 1MHEB 4JO2H 4XVUC 1P4LA 2VDNH 3EYFB 2PO6B 4G7YL 1P7HL 4M6NH 3NABL 4N2OA 1OQOA 1N0XL 1GVIA 4UV7H 4BA8A 5JQ6H 3PABB 1YEIH 1NBYA 3HMWH 1CCZA 4UCFA 5FV1L 4D9QE 3T4AC 1R6VA 3IBEA 3P4LA 1K5WA 3VGFA 1IGCL 5EF0A 2Y06L 3BPLB 3RVVC 4LPUA 4GMTL 5LBGA 3CK0L 1IEBA 3BIAX 4V1DD 3L1EA 3B37A 2O5ZL 3VDCA 3TIDA 5TH2B 2AJXH 5IB5A 3A23A 2XPGA 3RU8H 3UADA 3VH8B 2DJMA 3NH7L 3FRPA 2CR6A 3KD4A 2PCYA 1BVNP 5HHMD 3DUUB 4A6YL 4AVIA 1CFQB 3LN9A 3QG6B 3VXSE 1WPCA 5GRVL 5BZXA 3EZJB 3H7BA 2CM5A 2HJLA 1KEML 3UP1A 2JIXA 3ENEA 1NANH 1H0DA 4LARH 1IKNA 2R0ZH 3QIWC 2UXFA 3EYOA 1RZ8A 5HBBA 2D03H 5LN8A 2FSEA 3HE6A 1CG9B 3V4PB 4FA7B 2WANA 3KDMB 4AQ1A 2B2XL 1N5YL 3ARBB 5IKCA 3ZR6A 3LRLA 2Q76A 1KZYA 5DWPA 5EEZA 4F9PC 3CN3A 3CZLA 4OD2A 2QGCA 2X05A 4AZUA 1N59B 5I0YA 4UILH 5BUGA 4A2LA 2B4CL 3RUGB 3HBGA 4IRZA 4WUUA 1AXIB 3UPRA 3G08A 3VWKC 2DQJL 4HP5A 5F0JB 4BSVA 1QI5A 5D93B 4NC2B 2NQCA 1I3UA 2Q9OA 1T0MA 2I60H 3CQPA 5DMKB 1W72L 5JW5B 3QQDA 4M00A 3O3AA 5JOPE 4HHWA 4U3HA 1K5NA 1ZMYA 4YPJA 3T3PB 4D0BA 1ET5A 2VDOH 1N26A 2ISDA 1SDDB 3O8XC 4NGHH 1RZGA 5HGGS 4H8WC 5HHQB 3R1GL 3I85A 1T1XA 3P30L 3CDCA 3FHQA 3DHPA 3BLPX 4RQQA 2FBRA 3GO1H 2W80C 1MPAH 3CLEH 4HIXH 4QRRB 1FRGL 2C9RA 3K0YA 4Z7VE 3SE3C 1Z9SB 2BDNL 3S34L 4XXDB 1MFVA 3WMPA 3K81A 1HX0A 4E41E 3QUYB 3ES6B 8PAZA 3DSNA 3WY2A 4UWQB 4GW5A 5E1AB 3B1UA 3B9EA 1NC2B 4E42A 1P7QD 3GMRB 4CSZA 5A6MA 3WTYA 2ZKMX 4AQZA 2FO8A 4NI6A 4BBWA 1W0WB 3T6WA 4YSRA 4NJAH 3I9GH 1BVZA 1ND0B 2GUYA 3HZYB 1MWOA 5ILTH 1FQ9C 2FJHA 4ZUWA 4ZX4A 1R3KA 5EORH 5DZAA 3FUIA 2WBJA 4XH2B 3ME0B 4OD2B 3FB6B 3WKML 5C1MB 2NR6D 3NIGF 4TM9A 4FHJA 1EUUA 1EEZA 1MCCA 3FRUA 1IVTA 3RHWK 3V4LA 4Y4FD 1IGML 5DO2C 2QQLH 3RVWC 5DJ6A 4DQOH 5IBUB 3VXQA 2H5UA 2GUOB 3HUJF 3HI6L 3CFTA 3ZVVA 2CUHA 4PW3A 3O3UN 3NZHH 1KCSH 4WI6A 4KV5F 4PJCE 3FU9A 2CO4A 5A2FA 3RVXC 4N0UA 4B0MM 3H3PL 2CRZA 5L8KB 3EF4A 2CR3A 2VLRB 3C60D 2AAVA 3BQUD 4X6FA 5FHAH 4B50A 1FHGA 2XZQH 2XN9D 1T4KB 3K2UL 1EXGA 3M1BB 1ET7A 3ZKXC 3WJJC 4EI6B 5E8OA 1AGBB 3CH1B 5DD5H 2H8PA 5CKAA 1A7PH 3KCWA 4FFWD 3O4LD 4BHUI 1I31A 1XF2A 4X2UA 2X2JA 1HHIB 3GZQA 3LPOA 5E2WH 4ONFL 5SWQA 3GIZH 3P9WB 4JCLA 4BFEA 1Q1JH 2GK0B 4LPTA 1PF3A 1FL3B 3H9SD 3C9NB 3GBNH 7PCYA 3FQ1A 4KO5A 4RAVB 4GLRH 1HHHB 4G6FB 4UAOB 3QJHB 5HYJE 3HHRB 1R75A 4IDJH 4J3XA 4BZ1L 3FFDA 4NS0A 2XBZA 1ULVA 1NWOA 2VDNL 3UAJD 4OZGA 4M6NL 2E56A 4UV7L 3O3EA 1ECZA 5JQ6L 1YA5A 3U30C 2X4UB 1YEIL 2D3VA 3HMWL 1RZPA 2VUYA 4KKLC 4TNFA 3D50A 5AZ2H 1CTOA 3EO0A 4BKLA 2ZXGA 1BYOA 1MFMA 4LOVA 4NBXB 1I7ZA 2JCCE 3BP7A 1K8IB 1HHJA 1T89C 1VGEH 4OCRL 1PX8A 1VB9A 4PGZA 5JIHA 4NKIH 3QORA 3CDZA 5FYLH 4M6ML 3RU8L 1ESOA 1G6VK 5DT1H 3RIAK 3L5IA 1G7HA 4OM0H 1KBGH 2QVTA 2O6DA 4F8NA 1OT4A 5F8RC 1H15A 1Q72H 4Y4KA 2YD1A 4HWNA 5F97E 4GQQA 1PS3A 5BQ7A 1TJXA 1TMQA 5AKVA 3NYKA 5ADOH 3SGKC 4LARL 2YMTA 1AZVA 4KRMB 3P0VH 3VSQA 3G04B 3TXAA 2D03L 2IWGA 4U1IB 1SF5A 4LLDB 2BIHA 3ECQA 1OAZH 2UVFA 4PJBF 3UYRH 1KCRH 4IS6A 3VTTA 2P5EB 3SY6A 3BVTA 2R0KL 4F92B 4QWWC 4X4XB 3IJHB 2LFEA 5L2JB 4HQQH 5IB4B 1JHKH 1QPPA 1SRDA 2ZOLB 3QUXA 2ZXBA 4PHZA 1DE4A 3SDDC 1BDYA 5C07E 1O6TA 3AROA 5I0XA 4LSRH 4FTVB 3CVHA 2ZUQC 5IVZB 2W0FB 1GZHA 4RIRA 4L1SA 3WN5B 4JFUA 4DJMA 2I60L 1MLCB 1ZV5A 1U30A 2CDFA 1NBQA 4N2KA 4ONHB 2HFEB 4WFFD 1MW1A 3WIFB 5E51A 2UZYB 3RWCB 4QHUA 4R7NB 4RGMC 4R96B 1KJVA 4M1DH 2DWTA 4N2MA 1JV5B 2J57A 2X89A 3CX2A 3D4YA 1JF6A 5EHFA 4NGHL 4KROB 4WI3A 3GRWH 4K5PA 3W0WB 3FU3A 1XF3A 3NZUA 2YAOA 4WKZB 2Y36H 4HSAC 4Y9FA 3GO1L 1RJLA 4HIXL 1NKGA 2UWEE 5I15H 4YE4H 4DKDC 2MMXA 1RUKH 4CADA 2VRAA 1ID5I 4WWKC 1NOFA 3NCJH 3MV8B 4P5TA 3DMMB 1GKOA 2IWKA 4TQ8A 5CBAB 5BVJB 2FRGP 4NJAL 1L3NA 3WNNA 2X4RA 4JFEE 5ILTL 2R23A 4QOKD 4DUVA 2BXZA 1AP2B 5EORL 3G5ZA 2I26N 5I0DA 3SKUD 1SYSA 1VGKB 1CQYA 1FN4A 4JM0A 4HX1B 5CEXA 1K8DA 3QQ4A 3F5WA 3SOBL 1KENH 3JWNE 1U91A 5B7MA 2ITFA 4WW1B 3WFBL 3O8XD 2XNAA 3GUTA 2QQLL 1AO7A 4X5XA 4DQOL 1UD2A 3TJPA 4PJ5D 5I28A 5E99L 1HKFA 1FFOB 4U3SA 4CKVX 4GAFB 5TD4A 4XP9H 4DFIA 3EFOA 4RNRA 1KCSL 3KPRA 4E9TA 3OR7A 3EUDA 2I9TB 4HUWB 3I9AA 3WNKA 2EQDA 5HHOD 3VI4F 1FC2D 5IROA 5IVXB 1GS6X 4AQAA 1WFIA 2IANA 3VXUB 2JJSC 4FADA 1XGPB 2AMUA 5FHAL 3FT0A 3FUNA 4QR7A 4FE9A 4KDTA 4OFYA 1A7PL 1UWGH 2NY3B 3ZDYF 1PFCA 1C16A 5LXGH 3JT0A 1JS4A 4FKKA 1YNTB 4P0DA 1KSRA 2EEDA 3GIZL 1SLWA 3QIWB 5IOKA 5I8EB 4DAGH 4JRYE 2Z9TA 1KOAA 3QRFM 2JI3A 4KGJA 3ESNA 4F2FA 1AD0A 1CVRA 3GBNL 3D0LB 1YMHA 2X4RB 3LQAL 1KB5A 1B88A 1BM7A 5J11C 1ZT7B 2FLBT 4BSJA 4M7LL 4EE2A 2F7RA 2H6PA 3GXIA 1OGAE 2WUBH 5IW1A 1M4KA 3VI3A 4AYID 2WJ5A 3AC0A 2X4NA 2YD8A 4RSVA 4Z7IA 4JG9A 3LMJH 1P69B 3VWKB 1LD9A 5BRZB 3STZA 4FMVA 5DK2B 1CC3A 4BXVA 4RSYA 4JBSA 2XSKA 5KYXA 3ZTJH 1EHKB 3NIFB 2EO9A 5KVFH 4U7SA 4ZMNA 2WZ5A 4KNQA 1E4XH 1P84K 1NSNL 3OKLB 5F7EL 3RDTC 1S8DA 3OTTA 3QZPA 5FYLL 3QIUB 5ELIA 4ZQKA 5C0GA 3SBQA 5DT1L 4PTTB 4WFEE 1KBGL 1XB8A 4PD4K 5AVVB 1MNUH 3QEQA 3P3RA 1F4WH 1Q72L 1UKQA 1Z66A 5GRVK 3SDCA 5CGYC 4R97B 5ADOL 1D5XB 5C0EA 3P0VL 3VX0A 3QNXB 4MAYC 1F56A 1RHHB 4HJGB 2EE9A 4PJ9C 1OAZL 3UYRL 5BZWA 1AD0B 4H13C 1KCRL 4Y5YC 4ZO9A 5I5JA 4UOZA 3D48R 4G9FB 2VLJD 2K7PA 4DO5A 4Z7QE 2WGXA 4G43B 1D3CA 1DSFL 4Z3GA 4F8TA 5EWIH 2XXMB 4FQCH 1DVFB 1EANA 1JXGA 4HQQL 4KWUA 3WLBA 4RZCA 4P9HH 1LNUB 1JK9B 6CGTA 3MCYA 5FR3A 5F7NC 5C09D 4XNQA 1NIBA 1A21A 4ZUVA 5CJXC 2FT8A 2J88H 2O6PA 3EYSH 4HEPG 5D1XA 4ZMWA 1NMBH 4M93B 4QRRE 1AZCA 4LCUB 3R8BB 4ODXA 4MDIB 1KFGA 3BDYH 4ODTH 4ZW7A 4I87A 2YAHA 2YMXH 3UTTD 2LVEA 5K9QI 5FYJL 3ZKSD 4V1DE 1J5IA 1E5CA 3U36B 1ZWIA 2DWYA 3QFGA 4TN9A 3VD9A 4OBRA 3CFNA 3NACL 4OLWH 5TFSH 1WWCA 1AQDB 1E4WL 1HWWA 4MBRA 5I1LA 2NW3B 1E65A 2MHAA 3B2UD 3BWAA 2Y36L 3ZKXB 4TUJA 5JW4R 4ZFGH 3OR6B 1CI3M 3NSYA 2EYSA 3DO7A 5I15L 2ARWA 5GRJL 1OANA 4V11A 1UQSA 3VGEA 4X8XA 3NCFB 1QA9A 1FLRH 4ZPVA 5FA3B 4GSRA 2CHXA 2LU4A 3NCJL 3NDZE 4WWID 5HI4C 4Z5RA 5JW4Q 3FO0L 1UA7A 1MCBA 3BPOC 4LBAA 2DB8A 5I6LA 4BJLA 1XV8A 5G55A 3TBCA 3OWRA 3MROA 5HHXL 3FU6A 4NDMB 4GW4B 5AYQA 3G3LA 4HV8A 5DZNA 1ZCRA 2EIDA 1KBPA 3IDUA 4N2LA 1BZ8A 1UD3A 1SY6H 3PXHA 2EH8H 3B7TA 3WLBB 4M43H 4AV5A 3W39A 5K93A 2APBA 4OZHF 4ES8A 2YEZA 2WB1A 4ZMXA 1O7SA 2VLRE 3GEWB 4MJ6A 1P2CA 1DBJH 4ZX3A 2J8UF 5FKAA 2YFNA 3RRQA 1NC4B 1MRFH 3U9PL 2E4FA 1PLBA 4I9WD 1UWEL 4OLZH 3FU7A 2HG5A 3TBTB 1RJCA 4ELDA 3NBNA 1JCKA 4XP9L 1ZGLB 5IV2B 1UGKA 5HDLA 2DZEA 1KLUA 3IXAB 4WWKD 5L4JA 1RXLA 1DJIA 2DKSA 4QLWA 4LP5A 1Y0LA 2EDWA 1T5XB 2CHDA 2F2HA 3SQBB 3WHXB 4KQ3H 4H0LC 4PJ6A 2UXTA 5IESH 5T33H 4XCCH 1UWGL 3MYJB 1NKOA 1G7LB 1U3YA 3EOYG 4LHQB 4QT5B 4JJOA 1UKSA 5LXGL 1MVUB 1V3JA 2P8LB 1JGLH 3DBXA 4ICXA 1M6OB 4LSQH 2R1WB 3PGCB 4FI7A 4JO5A 1OW0A 4LLYB 3WKQA 2VDLB 4PJFB 2X9XA 2YC1A 1LO5B 2PR9A 1NGZA 5LNDA 4JMXA 1JZ7A 1E8XA 2EVGA 4DP4X 4HU8A 2EIZA 3QFDA 4P4RA 3EO9L 3U6RB 5T1LA 5H37G 5DCCA 2WUBL 3U4BH 3I6SA 5J56B 3VUAA 1MH5A 1OAKL 1TIUA 4DOHB 4HFWB 3MN8A 1U8NB 4WLCA 3SDDB 3WHE1 1CFBA 3A24A 3CSYA 1DLHA 1CICD 2ZWLT 3DDGA 4G59C 1AS8A 4TLKA 5GSRA 3LMJL 3ARGA 4ISVA 4IRSA 3DROB 4FKEA 4DSYA 4G8GB 2WZ0A 3CGTA 1XTMA 3DOIA 4JQIL 2IH8A 3VXMD 5IR1B 2WZPA 1FYHB 4WW2F 3DIDA 3TPUB 2AQSA 4RGMB 5KVFL 2YPVA 3GMOA 4L9LC 1X7TA 2GY7B 3GM0A 1T0NB 3VA2C 1YYCA 2OSLA 1IC0A 2KI6A 2VMDA 1L9MA 2XN9E 1DQTA 4WJG3 3MCLL 4X7TA 3IJ9A 4AL8C 5HYEA 4YHKH 4W81A 1X5MA 1MCIA 3KNBA 4FMKA 1MNUL 2X9WA 1BREA 1F4WL 3O4LE 4PJ7F 2CO6B 4HHAA 2FLMA 1S7XB 2KLTA 4F37F 4UQDA 5FX3A 4FTVE 2PCXA 4LPVA 3IFLH 2R4RH 4N6RB 4KITB 1HSAB 4ELMF 2KPNA 4R5VA 4O2FA 1NGZB 1CFMA 4ZAKC 5GGQH 2A83B 4XPAL 3HG1B 3T0VA 3Q3GA 3V4VB 3JWOH 2WLJA 5EO9B 5EWIL 1HHKB 4PJXA 3WEMA 2I7SA 1B9KA 2BHYA 5EU6D 3S4SA 4KKNA 1E42A 2QV4A 3MTRA 5LN4A 1U8KB 5C0CA 3W0WE 1J10A 1TYRA 3C12A 3L9YA 3RDTD 2VXUL 2Y1VA 5D2NA 2F8IA 3EYSL 2J88L 2V5MA 1JGDB 1VADB 5D1QC 4BK8A 4YZFF 4J12A 1NMBL 3WXVH 1TZHA 2IVFC 3LS5H 2CHWA 3C08H 1AGEA 2HT3C 2P80A 4MJJA 3E8UH 3U4EA 5HGHA 3BUBA 4ODTL 1XAKA 3MJ7A 1SVCP 4PJHF 2X2YA 3VGDA 2X1OA 3GMPB 4ENZA 4P23B 3WJLC 4N8PA 4RMSA 5I1IH 2BOBA 2BO0A 1HQRB 3RWDA 4JL1A 5TFSL 4OLWL 1JXJA 4QTIH 1H9DA 4DCQA 2D7TL 4NO3A 2PN5A 1PKQB 2G5RA 4OLUH 4QHNB 4X5QA 3Q2CA 3FKUS 3QUMH 3S2AA 5GRWA 4ZFGL 5IMKB 1OGTB 1CYXA 3O6FA 3QBTB 3UAEA 3FCUB 2XWEA 4W9ZA 3EFFA 3FQWB 4BFFA 1E9QA 2ICEC 1D9KA 1EIBA 3OKNB 5DYOA 5LG6A 4XBPB 4APQA 5E2TH 1WUNT 3GBMH 4Y2DD 4GEIA 1DTUA 4JO4H 3CFMA 2N56A 4O2FB 2GJRA 2KL6A 2EICA 4A38A 4DP5X 5GRXG 1SEBA 2IBBA 3NJVA 4GRMB 1ES0A 3Q5YA 3MNZB 4K23L 5ICXB 3N6YA 1SY6L 3QQXA 1WUZA 2GJ6B 3VXUE 3KPPA 3SPJA 1EV2E 3RNKB 5KVGE 2NY5H 1DBJL 1BG1A 3SE9L 3EG9A 3VE0B 1JXDA 5ISZA 5DUML 3KXFE 1TOXA 1MRFL 4J2XA 2VDQB 3BWUF 4YGVB 4OLZL 4IBUA 2Z3FA 1OCWH 4FNUA 4AZ8A 1OE3A 1WAPA 1WFTA 3I6LD 1QUNB 4LCCA 4LHUA 5EOQH 1OV8A 4OQ1A 5CN2A 3TEZA 4JRXB 5EZJB 1WF5A 2P8PA 4JHWL 4NQXA 2VABA 5F6HI 1HE8A 3I3EA 2B9BA 3H6AA 1KGJA 4NP4H 3L3KA 3RP1A 3EHBC 2BVOA 1FC1A 3KPLA 3NUKA 1PDKA 5DYFA 5T33L 4XCCL 4OCLC 1PAZA 1MHCA 2F53A 2PYEB 1HL9A 4FNQA 4HPOH 1YECH 1NFDA 2BIOA 1JGLL 2RGSA 4LSQL 4Y4HA 5GGUA 3QWNA 3VVVA 1FV1B 4LBEA 4AJ0A 4WV1C 1CT8A 1W8EA 4NQED 2IDCA 4FOMA 4OFQA 3L9RB 2PXYA 3LX9A 5CU5A 2B1HH 4WHDA 2YR3A 5FPIA 1H5BA 3KLAA 1SEBB 3BGAA 4KJPD 4P2OA 4DZBB 5EIIA 4TUOA 5GZOC 2JVUA 3UEZA 5IB1B 2F58H 3PQYE 4KUCD 1KXTB 2XACC 4R9HA 4L5FL 3CIQA 2H4EA 5BMFL 3ZE1B 2YA0A 5FGCE 1ACXA 5TDOA 4OFIA 3GMNA 4UYPA 3TZVA 4MWFA 2K9UA 1MCHA 4PJCF 2OCCB 3CDGA 2H26B 4JQVC 4MQSB 3OJDA 2H1XA 3IS1X 4ATTA 4B7LA 3LRSA 2R2EA 4D0CB 3UG5A 3GS0A 4N2NA 2X2UA 1GJWA 1RY7B 4OIBA 4LLUB 2P5PA 4MMYA 2ZUWA 3QZWA 1YLBB 5JIIA 5SWSA 4M7ZC 2A6DA 2HJKA 4HXAH 4YHKL 1JVKA 2NUPB 4POUB 3QZWG 5I66A 1G94A 1HZHH 5JA8B 2FWOB 3SO5A 4JJ5A 4OLXH 3MREB 4GEJA 5LBSH 4HS3B 2Q5BA 1NFDB 4FFVC 1W72A 3IFLL 2R4RL 3L4YA 1JYWA 4D9RE 5IIEA 3BPOB 3QIBA 4M5TA 1K6QH 1QSED 2E9BA 5FEBA 5KYUA 3WYRA 2A6KA 1KELL 3ZXAC 5GGQL 2IPKA 1HXYA 4HJIA 4LQ1A 3BD3A 4F58H 1MOEA 3KLAB 3VCLA 3PWLB 4PW9A 1EEQA 4WY7H 4BQBA 5FO8B 4Q74A 2IOIA 3FF8A 4UDTA 2NDGA 4YGAB 5FYKU 3MRKA 3R7RA 1IZJA 4KKCC 2D2OA 5DZOA 4JFTA 4HIEB 5IMOA 3KM2A 4YSCA 1XGUA 4ODWB 3C08L 4BD4A 1DBMH 3E8UL 4P5MA 2BZ7A 4YDJA 3FBQA 3MRJA 5ERWA 3VFNB 2JCCF 2X0UA 2YPLA 2DYRB 4ZW3A 5HPMB 3LEVL 2B5IC 4RFNC 3TVMA 1E6OH 2GJJA 4FLSA 4JZJB 2ATAA 4D3CH 5JHLL 4JFOA 1Q1PA 4QTIL 2W07A 3OKMA 5JHDD 1V3LA 2WMPA 1PY4A 1J11A 1F6LL 3H2WA 1R4XA 4OLUL 5FB8A 4ICWA 1RLBA 4ZAKD 3E2HC 3MACH 3OLIA 3QUML 2QJDA 3ARYA 4N2CA 2YFOA 4LPYA 32C2A 1HNFA 4FFZH 4KVNH 4JFXA 1AS6A 2CALA 3QULA 5FLVA 25C8L 4OJAA 3M88A 1EEYB 5ETUA 3N9GH 4IMLB 4LLVB 5E2TL 2YAMA 3GBML 2Y23A 1A1NB 2VLJE 3OB8A 2ZOKA 3WTXA 1P53A 4JO4L 4W70A 3KZ8A 2IPKB 1IGYB 1JPGA 1FNGB 3A0OA 1MRDH 3RDJA 1RZFH 4HIJB 5E8NA 4FGMA 5IFHH 1W0VA 4W9GC 2OR9H 4F57H 4JKPL 3K4ZA 4P4KB 3GEFA 3MRKB 1GW6A 3JV6B 2W88A 3RFZC 2XTJD 1U8OB 1ED3A 4HUUA 2MNWA 4U1LA 1MW0A 3UEQA 2DEYX 3ESPA 4G1MB 2J8OA 5I8OL 1OAQH 2NYZA 3BQVA 5IB3B 3UTTE 1OCWL 1WBZB 3MLTA 3G6JA 1F4XH 1IBYA 1SJVA 2J4WL 4U2YA 2DV6A 4QY8B 3MFFB 5EOQL 1J8HB 1G1KA 5LNEA 5L2KB 1R3LB 3OKDB 5J8OA 2EIEA 4TTDC 4QYOB 4UM9D 3ILPB 3UBGA 4PJFE 1KTDA 3WOVA 4L9LB 1D5MB 4RISH 4X8JB 1KV7A 3HBPA 5I74B 2EAEA 4HT1H 4BZ1A 5DS1A 4ETQB 1VKXA 1JZJA 4R5TA 5IJKC 4LKXA 3QI9A 4IU2B 4JM2C 4W9LC 4PJEA 1SOXA 2AJSH 2UWEF 5IQNA 3SDAD 1MFDH 2NZ9C 3E0GA 3HTLX 3QO0B 3B2PA 1XF5A 2IH1A 2AI0L 2NYYD 4DOHE 2ROXA 2VMFA 4J6IA 5I0VA 1AXSA 1GC1C 5C0FA 4X6CF 4L3EB 1EAPA 2Q2LA 1YECL 4AGPA 2X4TB 1G6RH 5D7IB 3WY1A 2IPTH 1ROWA 2ZSVA 4G8GE 4HFUH 4MVBD 3T0WA 2B1HL 3BFWA 1MFBH 1N10A 3B3BA 4I85A 2P3YA 3S35X 1F5WA 3C5XA 2G2RA 1RULL 5A43C 1Z5YD 4BEIA 4A7SA 4TNVK 3TH4T 1R47A 1EFXD 1ORQA 5J6HB 2F58L 3ZE0F 4L48A 1RK0A 1R5VA 3ATBA 2C1OB 5CJOH 4RLDA 5LQBH 2KQNA 3R19A 3MRPB 3L4ZA 1CBJA 2H9GB 4AXWA 2KUTA 3QAZC 4KRPC 4HKJB 2BP3A 5KSVB 3EHBD 3L3GA 5L4FA 3W82A 5BNXD 1IKNC 1SN5A 3K0WA 3EJQA 3HE6C 4TVPD 3ZK0A 3MLUH 4UTCA 4OAWB 3NJKA 3DK2A 4Z7NF 1M2VA 2BM3A 4JDEB 4JR9H 5FO2A 2N7SA 4AQ1C 5DZJA 3WI9A 2DJUA 3QDMB 5SWZB 3NGBC 2VM9A 1FO0B 4ACPA 1XH3B 5IREA 4Y16B 3O9WA 5FC9A 1DQMH 2DN7A 1IC4H 1HZHL 3FB8B 1K85A 2XN2A 3TT3H 3NJNA 1XF4A 1U3HD 3H9HB 4OLXL 3NJMA 5E1IA 2TSBA 1SPDA 4KO6A 5D7LD 3ELQA 4JGUA 1TTUA 1RAMA 5D7EA 2Z31A 1K6QL 3LH2H 1P4BL 4B9FA 4EKJA 4QRQA 4F3FB 1TDQA 1ADWA 3VRIA 3VGBA 3O45B 3T1FB 4J8QA 3FPXA 3DNKA 4U1HB 4F58L 1AHWA 3MX0A 3L5XH 1DQQA 1PG7H 4R3SB 3EW3B 4IBSA 2WQ8A 3LV3A 4YBLC 1UC6A 1AMYA 3ZHLA 2V7NB 4L37A 1QEWB 2N4IA 4OVVA 3LCYA 3GZOA 6PCYA 1T7WA 2EYRB 1PKQE 3W81A 3BVDB 1T7ZA 3PNWB 3AXIA 5K39B 2HTLD 4Y5VC 1A6WH 2FHFA 4LT7A 3K71B 3S48A 1J5CA 3N1PC 4LQFH 1DBML 2GFBB 1URZA 3GPEA 4LSVH 2JKJA 2YPKA 3AUWB 5KBDA 4L3AA 1RCYA 2D0FA 4D3CL 4FFVD 4PV8A 1WBXB 2X4QA 4KJYB 3ECBA 5C71A 2YD5A 3X13B 1QMUA 3ARXA 3MACL 2GI0A 4KMLB 2QVFB 1MAJA 3DYOA 3WJMB 2Y1AA 1A4KA 3MGOB 1OIOA 2Y5QA 4FFZL 4KVNL 3L1OH 3KYMA 3TFKC 4BH7B 2C34A 5SX5K 3RUGF 5BOZG 3RZCA 3N9GL 2X1QA 4RAUB 4K94C 1PLGH 2HFGH 4MJID 2D73A 3LN5A 5IQ9A 2AAAA 4KK5C 4XX5A 3MA7A 1N9PA 3CSBA 4RGND 2AC0A 1HHGA 3DXAE 1FZMA 1LO2H 3AB0C 5F7UA 3S88L 2AJZB 3T3PF 1RZFL 1T20A 3Q13A 5EU6E 3ALXA 5DJ0A 4OGXH 4GKSB 3SCMA 1N6UA 1HL5A 2OR9L 4JRXE 4R2GB 4FNRA 4F57L 4TULH 3ARRA 2VXSH 2VISB 3RGVB 5EF2A 4HCRH 5DJ8A 4HWEL 5HY9A 1WO2A 3AACA 3E1ZA 4M7KH 2G5BA 1VZGA 4Z77A 4F8QA 5FF6B 1Q9KA 1NDTA 3EGDB 1MQKH 5CM1A 5DD0H 4U4BA 1F4XL 4BUGA 2PYEE 1I7RB 3DHMA 1F02I 1KMGA 2P26A 5F3FA 3F83A 1UG9A 3INUH 4YLQT 1X5GA 2PTVA 1OB1A 5ANMB 2IQ9H 4J3OC 4FG2A 2D7OA 1KIUB 4L18A 4XI5C 1WZMA 3BUIA 1EGJL 4M7ZB 2AJSL 3X12B 1AKJB 1MFDL 3LIZH 1C1EH 1RIUH 4PGBA 4CU7A 5EU7C 4S1DC 4N9GA 5JDSA 5ID1A 3ZU8A 1YVLA 4MAZA 4ZS7H 4C56B 3V9FA 4JPWH 1HQ4A 5HHVH 3T5WA 1EJ8A 1G6RL 5HVHC 2IPTL 3HI5H 3T2QA 5ALCH 2H47C 4G6JH 3FQRB 4HFUL 1U8CA 4G5ZL 4OZ4B 3IDYB 2R59A 5LAXA 4RETB 1D6EB 1ACYH 4GMSH 5D70H 5F6HJ 1WA2X 3OSKA 4OV5A 5DD6B 4PG9A 1BFVL 3UC0H 2NNFA 3K8LA 4PJDA 4ZPTA 3ULVC 5AW3B 5CJOL 3Q8EA 3SQRA 1RZKH 2MNUA 3SKNA 4U6HA 4Y4KC 2VKWA 4P2RA 3T77B 4YFLF 1KT2B 4JLRB 3UZVA 4U33A 5MI0C 3DV4A 1XCQA 3D39A 3C2SA 3WY4A 3I6LE 4IHOA 4QRTA 5EZPA 2NZ9D 2O6CA 3MLUL 3GSWA 2UY6B 2X7LA 4RFNB 4PJIE 4IEFA 4JR9L 4CJ1A 3FW6A 1S9KC 1CB4A 4CJ0A 1QABA 3PUCA 2ADIA 2XDHA 4EDXA 1I8UA 1WIUA 1KYFA 3BYTA 1MIMH 3H85A 3FB7A 4GSQA 3EDEA 2Z35B 4QXWA 4HJTA 1OWRM 4H20L 3U1SH 3UBXA 4K5MA 1SBSL 4S2SA 4ADIA 3B9KB 4F8LA 5HI3D 5KVGH 4L29A 3UBXG 4FI8A 4R4FH 5FO7A 1BF8A 2VSMB 1GZHC 2ZCHH 2WVUA 2APFA 2AKRA 4ABQA 4CVZA 3IFPB 4Y1SA 3RNQB 3TH3T 4OF3A 2YWZA 2GBUA 3V6FA 4IBTA 1E9OA 1ZVSA 4J39A 3L5XL 3QUYD 4F7CA 3NCWA 4N2IA 2W60B 3HE6D 2XWDA 4P3DA 4H8HA 4HLJA 3ZTDC 4M1CD 2C9UA 1MFCH 2BK8A 3LKQB 4ZFOB 3IMBA 1CDBA 3ZE2B 3PAUA 4GS7C 3TFBA 4JFFA 4EUPA 5IJBC 2YBRB 4EIGB 5C7XH 2OULB 2ADFH 2FB4H 1CFVH 2VO5A 3JYCA 4KTDL 4NIYE 5SV4A 3SODB 4BYHA 2YUVA 4LQFL 4EUPG 1T5WA 1P5UC 4GOSA 4ORZC 3B3IA 4P5TC 3GXMA 4LSVL 3D0AA 4Q2ZA 4QDGA 3DX6A 2VUKA 5D4IA 4TSCH 1ZJAA 1AZUA 2F6AA 2LHAA 1KWKA 2JJVA 4L1LA 4W9HC 4WUUD 1AQKH 5IBTH 3WIAA 3HJ0A 5I6NA 2HFFB 3PP4L 3DPBA 1ZGLP 5KW9H 3MLSH 2HT2C 2XWRA 1XGZA 4JM2B 4R7LA 3E1F1 3JQOB 4NO5A 5TGBA 1UATA 5CJBA 3RFRA 1U3JA 2B77A 3L1OL 3OAWA 4ZOBA 5EU3A 5B8CA 4H8WH 2ZJSH 4N28A 4L29B 4YQXL 3TNMA 1F2XK 4R4NC 1D6VH 1TCRB 2HFGL 4RDQG 2PCPA 4W9EC 3WNLA 2NW2A 1G7QA 3RWIA 2QQNL 1LO2L 2DIAA 3QDGE 2YSTA 1DJWA 4QGTA 5F71A 2IGTA 5L2KE 5J6SA 1ONQB 4OGXL 4LVNB 4HD5A 4M48H 4J1UB 4XWGH 3DUSB 1BFSA 4TULL 1XCTA 1VFUA 2VXSL 3UJIL 4LNRB 4HCRL 5A2BA 1V54B 4IIZA 5F2FA 3VFSA 2A6JA 3GMQB 2APSA 1CF1A 2HZHA 3G7TA 3I6GB 4KDTC 1A8ZA 2V5YA 4M7KL 3BKMH 5CHNA 2WBJD 1UJ3B 1MQKL 3D4ZA 2H0PA 4IJ3B 1EVUA 4PS4H 5DD0L 5G5DA 5IFJA 5HDBB 2YQBA 1ZHBA 1FZOA 1M57B 5GGTA 1OD9A 3INUL 3CZSA 3PHOA 5E9DA 1O7VA 2E6JA 5HHPB 1U92A 1LP9A 4U1KA 4U6YB 3K2KA 4HVBA 1KC5H 2BZCA 4KK5D 4K2UH 1J18A 3DGDA 4WDIB 1B4JH 3MRBB 3T08A 4Z76B 3IPBA 1L5GA 3D3VB 1G87A 1U8QA 4L23A 5FYKE 4L1TA 1C1EL 2AV7B 3IN2A 1RIUL 4IBLT 4NO5B 4P48A 5D7JA 3RI5F 4AGOA 2ILLA 4X9HA 2ZKXA 2KH2B 5DFTA 4JQIA 1KJ2B 5T3XE 4ZS7L 5D9SB 2CHZA 1QACA 4JPWL 4XNYL 2VLME 4NAQA 5HHVL 4HCGA 1KJ3H 2BSRB 5EU5B 5KVEE 3UABA 3HI5L 4N2AA 5D1QE 3MRIB 1EJOL 5ALCL 5F7FA 4G6JL 3PGFL 2OAAA 4BQCA 5AD0A 4WKXA 4OCMC 4Z3TA 4I2XB 3WUWB 2IALB 4GMSL 4GP8B 4N4YB 5IVXF 4BQ9A 3MKGA 1B2WH 3FH8A 2NRDA 1PNDA 3D30A 3HPLA 4NQCA 3RWFB 5F1IA 4LF3B 1XCTB 3QDME 1CLYH 2MTPA 4PG2A 5JHAA 2VDRB 4FNSA 2A6JB 5KN5B 4PTUA 5J12C 5DJAA 3SDCC 4Y5VB 3VFOB 2QSQA 2W65B 4HIQA 1YNTF 4LAQH 3TBWA 3CSPA 2D3NA 2UV3A 4MDRA 3QYNA 1OARH 3QG7H 5DURB 2GW5A 1K4DA 2EO7A 2OTUB 4BUQA 2XA8L 1FNSH 1CTNA 5E94A 3SGDI 2X6BA 4JHZA 1U92B 4IU3B 2YKLH 1N19A 2YXMA 4FXGA 1FH2A 2NY1B 2OMXA 5I6KA 1MIML 3BRGC 4NUMA 35C8L 1YMMB 5EZLB 4LIQE 5E08H 4E9LA 2A99A 3U1SL 4QF1A 3OKOA 2FO4B 4IKLA 4EQ3A 1BD2B 4J4PA 3ROOA 1LM8V 3QORD 4LDLB 5KVGL 3FQNA 1AC0A 5D1XC 1JZ8A 4R4FL 2OX5A 3SBPA 2N0MA 1N6QH 3ULVD 2ZCHL 4KZEL 4MD0B 2ESVA 2Z7UA 3O41B 1HOCB 1PFOA 2XKUA 2Z1KA 5ABZA 4Y4KD 1NQBA 3H4HA 5KG9B 4UQAA 2PPAA 3NIFF 5EBWA 4HZLB 1K2DB 1VFBA 1EAQA 4URTB 2B59A 3DMMD 4KJQC 3UBHA 1IM9A 1OF2A 5MEOA 3O3DB 5HDQL 1MFCL 5INCA 1UACH 5TK4A 3TBVB 3OAZH 1OSZB 4FJZA 4CC1A 4KTEH 5C7XL 1DJSA 2ADFL 2FB4L 1CFVL 1S9XA 2QVIA 3MOBH 1ZVNA 3O2WL 1W15A 3ZHDA 3BVUA 1YPZB 3AREB 3HCVB 4NO2A 1QNZH 4YSPA 3QUXD 1R3HA 3RGHA 4V2BA 3CE1A 1OGPA 4PR5A 4TSCL 3P1VA 1O0VA 1YJDC 2F74A 4MQ7A 1ML0A 4R0LA 2OTWB 5IBTL 3RAJL 1ZLWH 4PWFA 1DUZB 1L0XA 5BPPA 1IU1A 1Q94B 3V0WH 5KW9L 2CWRA 2OMXB 2AQ1A 1OTTD 1IBHA 4MJ2A 2BXYA 4KQ4H 2K4WA 2FAUA 2L7QA 3F58H 2X89D 3F65A 3LRKA 4H8WL 1NOAA 2CO7B 3HS0A 4HOMA 1UADC 3MU3A 4QGYA 4YXLL 3I02A 1RUAH 1CBVL 1D6VL 1WICA 2MKWA 2Z4QA 2FYYA 2ITEA 3AADB 3IDGB 4I1PA 2DMHA 1EAOA 2COVD 15C8L 3M07A 2ATPA 2CBOA 1A8JH 3APNA 1NAKH 2J1ZA 2DEXX 5DHEA 3NJXA 1I1FA 2VZSA 2VR5A 5KSBB 2Q1EA 1RH8A 1A6TA 1SXSA 4P5TD 5DUPH 4Q0XL 3ZZLA 4M48L 2YZ1A 3TP4A 1DUYA 5EIQA 5TPWH 1ACCA 2N7BA 2WSKA 2V7HA 2IADB 3KLDA 5BZDA 2ADYA 2EKSB 4WWPA 3FAXA 3BKML 4IBWA 5MI0B 2VN3A 1G9MH 5I9QB 4PS4L 5AOIA 2ZOWA 1ITCA 4KVCL 3ARFA 4UT6H 3TT1H 4C56E 2XKSA 4TQEH 4NCC1 5ICYB 1OW0C 4K5LA 5EEXA 2VERA 4LVOB 1H3TA 1HINH 1AO7D 2ORBL 1BZ9A 4R0LB 3VRJA 3INOA 3VXPA 3GS7A 5BW7A 4EEEA 1GA2A 2FUTA 1PG7X 4K2UL 1B4JL 5DEGB 1NMAH 1CE6B 4AI7A 3KPRD 1I8MB 1T2QL 4YHYC 1RHFA 3PWPB 2ZUVA 4DTGH 3IXTB 5IROD 2VZUA 1HYRC 4Z8FH 3QIUD 5E9NA 4BFGA 5DRXB 4JFDE 1XF1A 1A3QA 5DJDA 1DVZA 5DDHB 4B9YA 3PGDB 3EF7A 4FLOA 3CZUB 4OFYD 4R8WH 4FNPA 2J44A 1MRCH 4NQDB 1E7VA 5A3ID 2NUTB 1RZ7H 2XWJB 1U95A 2ZWYA 1A64A 4KXBA 1A6TB 3VFTB 4YDKH 3FFOA 3ULUH 1B2WL 3VFGL 5IB2A 1SNRA 5IHWA 2Y24A 2DQDH 1P1VA 5AAMC 1YUHA 5IGXL 1CLYL 4G9FD 4UTBH 5BZDB 3P3TA 5DRZB 3GSRB 1AAJA 1XZ0A 4ZUTA 5I0ZA 1HH6A 1SXBA 1YN6A 3PWVA 1IRAY 1DVFD 3T65A 1G7PA 1MJUH 4HUVB 1OKEA 1MUJA 1P5UB 3Q6GH 4M3KB 1JPSH 6TAAA 1OARL 3QG7L 5TE6H 1P1ZB 3IE9A 4PJFF 3ET9F 2CDEA 2ZX9A 1GMEA 3MRCB 4HCFA 2PP7A 4PREB 2BSTA 3V5DA 4JHAH 3VFUA 2GIMA 3GXFA 1FG9C 3MRRB 4HK3J 5BUAA 4L4VA 2CRMA 5FUOH 4DO6A 2YKLL 3M7OA 5DUBA 2FR4A 1EHLH 3TX4A 4GSUA 3V8CA 1URLA 3GSNB 1JCVA 1KXQE 1Z2KA 3TWYA 1JZ5A 1AJ7L 3FFCA 3MRMA 5E08L 4X4KA 2OBGA 2VMJA 4BFNA 1W6LA 2FX8H 1ZPLA 2XV2A 5D2NC 3ZJAA 4B7IA 2FHBA 2WWMC 3KYOB 2VN7A 3ZE2E 3CPUA 3VXNA 4N2FA 1N6QL 3RWHB 2H45A 5E4OA 3EJCA 4ENEC 2HXAA 3QEQD 5JHLA 3V52L 1MJJB 3SDCD 4PLJC 1LGVA 2NQ3A 1ZK9A 1NFIB 4KK8C 3KVQA 5KBMA 5DK0A 4APXB 4WO0A 5HJDA 4YVNA 3FOLA 3MNWA 2NTSP 5J1TC 3NRQA 1E9PA 3C6LB 4MX7B 2IDFA 1EX0A 2GSIB 2EEBA 4KTEL 2WY3B 3HZKA 5J3HC 3ZPDA 2AV1B 4WNQB 1O5DT 2UX6A 4WEEA 1K72A 1QNZL 2JB5H 4MNHA 1UB5A 2BMKB 3B83A 5TDPB 4YEEA 4F2MA 4JN2B 3V79C 1D9KC 1PJWA 4XOAA 4NEHB 4PRAB 4APQC 4KO7A 4H25B 3TBBA 5CJQL 4PY7B 4HK3N 5E6IB 1MAKA 3IF1B 4L4TB 1A02N 1B4RA 2OS7A 3S3BB 1WFUA 2V2WA 3K6IA 4AENB 4FABH 2C9PA 3BUQA 3UTQA 5E2UL 4ABVA 4KQ4L 3KLLA 2NY0B 4JANA 3RPKA 3T1WA 5E5UB 1GTNA 3F58L 3CFBB 1QW9A 3ZL4H 5CIPH 1HYSC 4CC4A 2M1KA 2PF6A 4HKBB 4NN6B 4WIQA 3KJ6L 1RUAL 1ZD6A 5I82A 4CMHC 4GXVL 1L0PA 3HAEB 1CL7I 1WZLA 4DEUA 3FNKA 1SJHA 3S6CA 4AW7A 5B39B 4LCCC 4TYUA 1NDMB 2AP2A 3K6FA 3CFEB 4FULA 1DQJB 4JQXA 1KPUA 2D0GA 1JVOA 3B9DA 2VZ3A 1WV7T 1AZRA 2ZE0A 3BW9B 4GRWE 2JTDA 4EOWL 5JXEA 4XOCA 1UEYA 4JFSA 5DUPL 3P02A 4Z7OB 5EFIA 2WBXA 1NCOA 4MMZA 3MR9A 4WJKB 1I9EA 2Z7ZA 1HH9A 4N0RA 4UINH 3VXTA 2R1YA 1HCYA 5TPWL 4HLEA 1C5CH 3EOTH 1L9NA 4LCWA 1AFVH 4YXKH 4ZSOA 4RRPA 1TZGH 2CUMA 2FIKA 3OMAB 4P57B 1G9ML 4NZUL 3VG9B 4J3WA 1KXVA 1PCSA 4Y4HC 4RRPG 2CJTA 4HJ0C 1JERA 4N1HB 4UT6L 4Y19B 3M1OA 2RJMA 3TT1L 2HLAA 1FVCB 2C3GA 3Q8AA 4WUUE 3KGSA 2Q7YA 4GKZB 1QBLH 2IGFH 1NIFA 1LEKB 1PX4A 4N5ED 3S37H 4EO5A 1Q9LB 3DK0A 2PXYC 4ANKA 2DS4A 2WOYA 1HINL 2CLRA 4C4KT 2CIIA 1X5YA 4PRDB 5DHVH 4P2OC 1NAML 1NCNA 3FF7A 1BGXH 4H1LA 5FAAA 1TMCB 4WSKA 5DHYB 2IAMB 4NAMA 2YAPA 4DTGL 1A6VH 4YDNA 3JWDL 2HVJA 4Z8FL 2O6FA 1MW3A 4FXLA 5GGRA 1X5AA 3D1MC 4NP9A 3PXJA 3ML8A 3D07A 3PWUB 4OLEA 3TZVC 3HC4L 1ADQL 1I7UB 4C83B 5GS3A 4E9SA 3D4CA 4R8WL 3GTVA 4LGPB 1MRCL 3L17A 3OMZA 3GMMA 2I24N 3V7AG 5C0RH 5C6WH 4YDKL 3ULUL 2LT9A 2DQDL 3SKJH 2C3VB 2CBPA 3LHPH 2NQDA 1IJ9A 3BSGA 1U4EA 4YWGH 4FMFA 2BWQA 3SE4A 1XH0A 2B4CC 2ALWA 3P9LA 4TVUA 4UTBL 3FT4A 4X6DA 3HG1D 1WGVA 3TCTA 4ELKB 1KCBA 5AYTA 4A7GF 2YRZA 3ESOA 4NN5B 2LU3A 4X6EB 2DTMH 3LNDA 4E68A 4N1CA 5T1LD 4JMNA 1MJUL 4KVPA 4XNMB 2BWIA 2BZDA 3QA3B 2NLJB 2XQBL 3E38A 3Q6GL 4KXZI 2K45A 1JPSL 2J12B 4GRLC 4N2BA 5TE6L 2FLRT 3N55A 3SBWA 5DGRA 3WL9B 4F1SA 1UZ8B 4DVRH 4I88A 3IJEA 3ARGD 2C7FA 3DLQR 2R1XA 4JHAL 4IRSD 3IDMB 4X5PA 3RPBA 1MW2A 1S2EA 1EHLL 4NKMB 2F8XC 3J7HA 4WI0A 3FT2A 3X1NA 3GYRA 3ZKND 4PJGA 4N0UE 1ZT1A 2OMTB 2BVYA 3ABLB 1MCLA 3BCFA 1VHPA 2BNUA 3MV9A 3OVUB 4P23D 3WDJA 1RD6A 4C4KO 1GY2A 1N5AB 5CO1A 4X99A 4WHTB 4AL8H 1YEDA 1WYJA 4KNTA 3ZE1F 5LAPA 2ZIDA 5MERA 2GI7A 1MCDA 1ORSA 4JVUA 2BNRB 1M9SA 3RY4A 4H26A 4BINA 2AEQH 1YPZE 1GYUA 4HIHA 3HN8A 1A9BA 3JV0A 2L8AA 1A7RL 2VGLM 4HU2A 2WVVA 4YC2C 1FVDB 3K5RA 3MHZA 4U05A 4UTAH 3RWJB 5K9QG 1EXUB 4J8RA 3LQMA 3D05A 1M7XA 5I1EH 4YO0B 3EYVA 5DGQA 5E1HB 3NZ8A 5C08E 3HG3A 1G7IB 4BSWB 2GJ6D 5DC9B 3O4OC 4B6ZA 2JB5L 1MCRA 2AJ3B 1FWXA 3AABA 3IM1A 5EU7E 5A16B 4A68A 2E7BA 4ZYKB 5FECA 5C0CD 5KVEH 1IBGH 2H7WA 3OJVC 4RA3A 5H94B 4R6UA 4AQ8A 4U1JA 5C2BH 2QKSA 4FQHA 3QARA 3TO4A 5GGSY 1AMXA 2P80D 2BW4A 2W91A 5AW2B 3ETSA 4PLJD 3QDJE 4XP4L 2DY2A 4YHYB 1ZPUA 3CC5B 4X99B 3QEUA 1A6ZA 3AFLA 3ZL4L 2HYMA 2FECI 2R39A 3ULVE 2DQGH 2WVSA 4RMWA 2WLIB 1TTRA 2NY4B 4Q6KA 1SZNA 3MBEB 1HT6A 4PYHA 3PIQA 3QRLA 3IMTA 4CL7A 3IDIB 2ZUXA 5AB9A 1OHQA 2J2ZB 2X44D 3FT1A 4N0CD 4NWTL 4AEHL 1N64H 1QRKA 2G3XA 3O6FD 5J3HD 2HRPH 1R17A 1SQ2N 3ILEA 1BVKA 4XCYA 3FO1A 4F9LA 1EGJA 2X4PA 3BH9B 1FNHA 3BIKA 4JFVA 3QFJA 4YDVB 4F7MB 1R0AH 3CN4A 1IJNA 1TEYA 3A6OA 4UINL 4APQD 4ZI8A 1E2VA 2HKAA 5I71C 3QI9C 1C5CL 1QBAA 4LIQH 4YXKL 1CGYA 1XB6A 2D2CC 2VR9A 2ZX7A 4DGYL 1TZGL 5KSAA 2Y0SA 1R3IH 4M29A 4ZS6C 1B0WA 3QHFH 4NPYB 3CXDL 5FOBA 5J57B 4Q9RH 1ZA6A 3UAFA 2CK0L 2VLKE 4BZ2H 4CADB 2R29A 2XOTA 1QBLL 2CKBB 3S37L 2AXFB 3FUDA 3FCTA 4XC1L 3T2PA 4AYBA 4Z7UA 5EOCJ 4BCZA 3H53A 1F1GA 3GHPA 3MFGB 1XH1A 2UZIH 5A2KH 3OGCB 2CH8A 2J20A 3OKKA 4NQDE 2K6WA 4X9FA 2P4AB 4YUEH 1BGXL 1EUTA 4LHUD 3D4GA 2VRQA 3FBKA 4K7PX 1FL6B 3RIFF 2GT9A 2QQKH 4Y5XB 3U0PA 3IFOA 3OLDA 5L6YH 4N2HA 4Y1AA 4QYAA 4UM8A 5DMGC 1TVDA 3SDXA 1CGTA 2XETA 1T5KA 1ZRUA 5IM7A 2IG2H 4LOUD 1SYVA 3UTSA 1Z0NA 2VO8A 3NJHA 5DJXA 1S9VB 2VC2H 3CHOA 3QUKA 3FCGA 3Q7JA 2F53D 3N40P 1M05A 1D2OA 4P3WA 5C0RL 5HVGB 4PB0H 4WHYH 3LKOA 1SXNA 4Z7WA 4HJ0D 5CBEA 2EUZA 1EAJA 4FQ1H 4ESKA 3SKJL 2CM6A 3LHPL 4TPRL 4YWGL 1XL4A 2EUVA 1G1YA 4XHJC 3VSTA 4FQXA 5B7FA 3KM1A 4N3TA 2WTRA 4N68A 3VFRA 5EBLA 5T1JA 1M7DB 5B1JC 2DTML 3DSFH 5GS2D 1DP0A 2GSGA 1KNOA 3T8XA 5I5MA 4RMVA 3ZRCC 4NBYB 4Z1PA 1BXUA 4OUUB 5DRWB 3BAJA 3KW7A 4G6MH 5CSBA 2R0LH 5GRYA 2NDFA 3WIHA 4NNPL 4DVRL 2F1AA 1GPOH 2ZUUA 3O3BA 4HLZH 1WLHA 1IAMA 2XVLA 3MJGX 4QXTB 4XP6H 5BS0B 1IMHC 1UVQB 1MWAH 1FFNB 5DZVA 3KPRE 2XG5A 3OM3B 2F61A 4TL4A 4ZMOA 3FQTB 4NQSB 3QZOA 5F8QC 1NBCA 1U8MB 2IANE 4M61A 2JK5A 4LSSH 5ENWA 2JTYA 3H55A 2BCKA 2FZ3A 4Y1AB 3U1QA 2WINA 2IPUG 4JK0D 1WAEA 5SWSD 4K5OA 1XH2A 1KLGA 4NX0A 4TS6A 3NTCH 1DEDA 1K4CB 5DJZA 5DJXB 1MSPA 3BAXA 1NLDH 5DVOA 1YG9A 4UQBA 5IEKA 4D94A 2ZUSA 1TU2B 2JJWA 4GG6B 5ITBH 4L9DA 3PFQA 4QKXB 2NR6A 4Z7WB 4X5WA 1GZQB 4UTAL 3QIBD 5D6DC 3LPPA 3CH8A 3ARDA 5AZEH 4Y4FA 4N3UA 3SYCA 1E28A 3BSHA 2R2HB 2R27A 3OAZK 3L3DB 1KYAA 4UMGA 3ZT7A 5I1EL 3QO1A 3VD1A 4TQPA 1M7UA 3K72A 2E7DA 1W91A 1MI5A 2MNJB 3IDNB 2Q8BL 4JG1L 4J3SA 4MA7L 4WSGA 3VFPB 1BPVA 3UIYA 5FDWB 3U0WH 3NSFA 2ZT9C 1U8IA 5EDXA 3T3MB 1BOGB 2E4TA 2IV8A 4W68A 2DLTA 5DQ9B 4KY2A 5SV3A 2X0WA 4F7KA 4ZMYA 1II4E 3C60A 2Z7WA 5DI8B 1FZJA 2F54B 3HEIB 1ZLWK 1X5ZA 4GSDL 3SPVA 2V2TB 2VH5H 1WHOA 2WIIA 3BEVA 2YHGA 1XAUA 4BELD 5GGVY 4OQTL 2ZUTA 1S7QA 2QGBA 3SCMC 4A6YB 2V2XA 4XP1L 5T1MA 3TVMD 4H8UA 4LP4A 2FH6A 5LBVA 1J7VR 4RGOH 5CS7A 2UZXB 1A6AA 1CFTB 4MNQA 1LDPH 2GAZA 5EUOB 3GIVB 2AK4B 2Y5TB 1M3JA 2ZX6A 2H32A 1JDAA 4KRNA 1JN6A 1MJ8H 3QEQE 1RJZA 2X4SA 2IH3A 2VTFA 2DLFL 2JQAA 3H2QA 3S5LB 5TQ0L 4I5BB 3LQAC 1BVNT 1N64L 5BXFA 5L8LB 1XMWA 3D87B 3T4YA 5HYQA 1MREH 2CO2A 5JPNC 1XMEB 4D8PB 2X70B 1LEIA 1H8LA 2GBVA 1QWHA 1MCJA 4NM4H 1ZOXA 4GPVA 4LIQL 1SJEA 4JG0H 1N18A 4MD5B 4Z0BH 1V7NL 4EN3B 5C0NC