2GEQA

Crystal structure of a p53 core dimer bound to dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
193
structure length
188
Chain Sequence
b'QKTYQGNYGFHLGFLQSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*TP*GP*AP*GP*CP*AP*TP*GP*CP*TP*CP*AP*C)-3'
publication title Structure of the p53 Core Domain Dimer Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 41
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2geqA00
4QO1B 2BIPA 5AOLA 2ATAA 3KMDA 2BIMA 2X0WA 5AOKA 2BIOA 5ECGA 3WTUA 4AGLA 3IGLA 3WTXA 3D08A 3WTYA 4G82A 5G4MA 2X0VA 3QYMA 1EAQA 3VD1A 2J1WA 4IBUA 2BIQA 3WTTA 1LJMA 1H9DA 1E50A 1IO4C 2IOOA 2J1ZA 1HJBC 3WTWA 2OCJA 4IBQA 4LOFA 2J20A 4L0YA 4G83A 4MZRA 2J1XA 4KVPA 3US1A 3Q05A 4GUOA 4IBSA 1T4WA 4L0ZA 3D0AA 5ABAA 3VD0A 2AHIA 1EAOA 1YCSA 1GZHC 2J6WA 4A63A 5AB9A 1GZHA 4AGMA 4HJEA 3QYNA 4AGPA 3D06A 4GUQA 4XR8C 2P52A 3D07A 5AOMA 3WTVA 4IBZA 2J1YA 2PCXA 5KBDA 3EXLA 4IJTA 2J21A 3ZMEA 3TS8A 4L18A 4LOEA 5LAPA 4AGNA 4IBTA 2BINA 4AGQA 2FEJA 3Q06A 3D05A 5BUAA 1TSRA 4MZIA 3IGKA 4IBWA 4IBYA 1TUPA 2AC0A 2YBGA 2WGXA 3VD2A 3US0A 1HU8A 5AOJA 2X0UA 1CO1A 1EANA 4LO9A 2IOIA 5G4NA 3Q01A 2XWRA 5A7BA 2H1LM 3D09A 1UOLA 2RMNA 2MEJB 2IOMA 4IBVA 3KZ8A 1CMOA 5LGYA 4AGOA 2ADYA 2GEQA 1KZYA 5G4OA 3EXJA 1HJCA 3WTSA 3WU1A 5AOIA 2VUKA 2XWCA
chains in the Genus database with same CATH superfamily
4B95C 3NCFB 3IGFA 1U3JA 4FQQA 2IV8A 4G80A 4LVOB 3M1BB 3QA3A 1DUYB 1EJFA 4POUB 5E00A 1YMME 1I31A 4F15B 3C6SB 1HFUA 2ZSWA 1EXHA 1E6OH 1WFUA 3VE0A 4OAWB 5B8CC 1KELL 2DW5A 4LK4A 1Z9LA 3N42F 3ETSA 3E8UH 2A9NH 4QHNB 1XF4B 1PTZA 4XZUB 4OLWL 5F89A 2R1XA 3D4YA 2GY7B 3PQYD 4LF3B 1D5BA 1YPZE 1YG9A 4QNPE 4TNWK 1VKXB 4AVJA 1X7SA 4WWPA 1YEJH 1B4TA 2NY7H 5DZAA 2YPVL 1QUNA 4IGBA 5DT1L 5DJ0A 2ZKXA 4RRPA 5F1NA 5I1EL 1HOCA 1AAJA 4YHNA 2XY1A 4HUWA 4U1IB 2W0KA 1KCSL 4P2QB 4GUOA 5EBMB 3V7AE 2C3VA 1R5IA 3RZCD 4K71B 3GLEA 3TIDA 2GI0A 5E2WL 1M56B 5F7MC 3JWDC 2YXWA 3U4BL 3ZE0B 5B3NA 2AJYH 1C16B 4RFNB 5SWZA 1P5UC 1ACZA 1NWPA 1XR8B 5EEUA 3UO1L 4KWUA 1KGCD 5D6CB 2AEIT 3ARFB 3PL6B 1SM3L 1D5MB 3B9KD 4MD0A 25C8L 1D6VH 3GC3A 4R4BA 3KE0A 1MIMH 4U3XA 3ZQ9A 1S46A 4GO8A 1UQSB 5AOMA 3WJMB 4UTBA 1BIIA 3I6LE 4XTRC 5ALCH 1MLCA 5KYUB 4M00A 4RCAA 2AJUL 3ZT5A 43C9A 2LU7A 2PXYA 4OGXL 1NCUA 4Z7UF 3HZMA 5BQ7B 3BGMB 1D5IH 2RHEA 1GJIA 2ZONA 3QO1A 1YN7A 5K9OA 1B0GB 2CKNA 2OL3B 2V2TB 4NQDA 1JV2A 4QXTA 3FHAA 5GRVK 1EVTC 1TUPA 4HS3A 3ROLA 1NCTA 2H26B 4Q6IB 4M4RB 4HK3J 2AQRA 3HAEB 2QGEA 3SIKA 4FEIA 5B21A 3WFEL 3MZTA 5I18H 2GKIA 4NQXA 4NAMA 3N3EA 3UACA 3DECA 5EH1A 1I1YA 1N8ZA 5E2UL 3SYQA 4TUOB 1HIML 3K6OA 4DGYL 4Z7QB 1WEJL 1UD5A 3G5VB 2P8LA 3V5DA 5GS0D 1T66C 1W0WA 3VGHA 4F24A 5B39B 1YMMA 3G04B 1GYCA 2X12A 3MI6A 4ODSH 5AQ0A 1N7ML 3BKJL 4N3UA 12E8L 3IJ8A 2BZDA 2UY6A 3D7PA 1JPSH 3L3GB 35C8L 3EAKA 4FXGA 1UENA 3VX1A 3ZT6A 3VA6A 2C4FT 1ET7A 4LARL 5I1JL 1N3NB 1U91B 1ZMYA 1KYUA 4DWHA 1YPZA 3WTYA 4WK2B 4KI5F 4R26H 5T1LD 2YPKB 5AD0A 5AZEH 2QHRL 2OZ4A 3ZE1E 5C0EB 4B41A 1MJJA 4UNUA 2HRLA 3RNQB 4X4XB 3L81A 5FYKL 1HQRA 4M4PA 5IUSA 3TYGH 4F9PA 3VXPA 4PJXF 1OTSC 5JOPD 5KSVA 1FUNA 1YJDL 4WAFA 5EU5B 2APTA 1XXFC 2JK5A 5FYJD 4ZZKA 5EFIB 3S9DB 1UVQA 1U3YA 1NPUA 1WJ3A 4PJBF 3VD3A 4QPEA 1U8NB 3LN5A 3ARED 1BVLB 3O6FD 5LXGH 3KGTA 4L37B 2O6EA 3NIGE 3RJDA 4C4UA 5B4MD 4U1SA 5ICZA 5C08D 4HKZB 1RZPA 1FORL 2FJHA 2A74C 3IU3B 4HWEL 1VADA 4ODBD 4JPKL 4NC1E 1SXAA 4HBCH 3ILQC 4M93C 1A4CA 1I1AB 2CDEB 3RX8A 3QUXB 1M6OA 4IM8A 1N6VA 4Z9KB 4BH8A 2GYSA 4OCLC 4PBXA 5IBTH 3DPDA 4JFUA 3U9UA 2XPGB 3IDYC 3F8UB 3L17A 1HILB 3G5WA 1JF5A 4FP8H 2AGJH 4EVNA 5BZDB 5KN5A 1JXJA 3BZFA 3B2UD 2NY6D 3HJ0A 5DR5L 1C12B 1SOSA 1S6NA 4NLHA 4G7VH 1A0QH 1GMIA 2EDRA 3RNKB 1JYVA 2HTLC 2VLMD 2EUZA 1Z2KA 4Q4IA 4ZK8A 2WLNA 2QVKA 4O2FA 4P3DA 1PCXA 5CWSB 8FABA 3REVA 3IDXH 3KNBB 3T08A 3WHXB 3P30L 2F74A 4NEHB 5IWLA 3FT1A 2C9UA 1DVFC 3CN2A 3UTTA 3IGKA 2PN5A 3REWB 5EEVA 1CF1A 2AJVH 3ZRSA 1R47A 2AI0H 4GRLD 1KBBA 3FHEA 2O6FA 4GKNB 5E5LA 1F11B 2WP3T 3H2PA 4N0YL 5CMAA 1NTDA 2AMUA 2XFXB 1L6ZA 3AG2B 4N2CA 5LNEA 3M45A 4N86A 1G1CA 3L3HA 3VXUB 5D1QC 2P80D 1HI6B 1IGYB 1UACH 1ET5A 3CPUA 5IFJB 4WI5A 5CN1A 1ERNA 4MVBC 5C9JA 3EO9L 3JWNE 2NNXA 2WXNA 3X17A 1JHLH 5DJ8A 4UI2A 1SOQA 5SWQA 1OF0A 1FLRL 4BFEA 3LZNA 1IIKA 5JORB 2FLMA 2YSTA 4OCWL 2NXZD 3S36L 2P48B 3G5XB 4PJ8C 2FE0A 5E9AA 5DMKA 2E7LA 4QRTB 3VFSB 3QVAA 4JHBA 3GXTA 1SXBA 1X9RA 1UASA 1NM9A 4JFDA 4PR5A 1BAFH 3CLEH 1EQWA 1QUPA 4MQTB 1UYWH 3FDWA 3W0WE 3ZX1A 4AITA 1SF5A 5K1NA 5HGHB 1PAZA 2X7LA 4P23C 4LGSB 3DXAE 2NY1D 3LOWA 5L6YH 4X2UA 3EHBD 2GPZA 4L1SA 4ZTEA 4JM2C 1NL0L 4Y16D 5FYKE 1E0OB 1E27A 1EO8L 4XMZA 5A2LH 3QG6B 3MV9B 3T3MB 1JD7A 3VYNA 1K8IA 3WUZA 2PW2A 4HSQA 4F3FB 2R29H 1IAKB 1EHAA 1LWRA 1YN6A 2V8MA 3GI9L 4R5XA 3SDCD 3WUWA 5DK3A 1DQVA 1NGYB 1QBAA 5FUOH 9CGTA 2I26N 3BQUA 3N5AA 1GJWA 2BJML 4XVUC 2VTFA 1CICA 3HAEH 4PSPA 2XTLA 1NC2B 1B0RA 1P4UA 3ARWA 4YWGH 1ZTXL 5A6MA 1G9MC 1MCRA 1KN4L 1PZCA 1AGCA 4MCMA 1D7FA 3OKNA 3OKYA 4NI6A 3I50H 5ES4B 3BH8B 3BWAB 3JQOB 3QEUA 1MFMA 2DQTH 1K6QL 2GJ6E 5INDB 3SE9H 3VRLF 5F88A 3VFGH 4WI0A 4A2GA 4HEME 1KV7A 2PTUA 2ROYA 2AEPL 1JK8A 2DEYX 3F3HA 1UCTA 3JYCA 2HVKB 4DH2A 3L3DB 3MOQA 1Z5HA 4KDVA 4QT5A 2XKNB 1I1FB 1T20A 1ZGLP 2ADJA 2G9KA 4PGDA 4W6XB 1HHGB 4TSCH 3EKCA 5I66B 2GUYA 4OCRL 3WGVB 3HE6C 1EANA 1RIHH 2FIKA 3WAJA 3BVTA 1WK0A 4NQED 2VJ8A 5D7SH 5MERB 1IEAA 5HI4D 3MNDA 4LLMA 5C0RH 1KWKA 3UBXA 5J9PB 5ISZE 4BD4A 2W07A 4UB0H 4RESB 4P05A 1MAML 3QDMB 1RUQH 2J4WH 3OZLA 2HPOA 1NAMB 4L8BB 4YFLI 3RLSA 2DJSA 3QGVA 1FP5A 3UYPB 5SWSD 5B38A 2LLLA 4OZ4A 4MA7H 1ZA6A 3MLRH 2UXVA 3G6JB 1JZEA 4NO0A 4MA8H 1VHPA 3MRBB 4GKOA 3H3PL 4Y89A 2YZ8A 5D7KE 2P44B 3ARPA 1CPUA 5KANG 3D3VE 3QUYB 3W0WA 2AJSL 1SLVA 4KRPB 4L5FE 3DIDA 3MJ9H 4JQVC 3ISYA 2EVHA 2BH0A 3ATBA 4J3OG 5BVPH 1Q0YL 1VRSA 1MELA 3AM8C 2BMKA 4JFFB 4TVSa 3DXAA 4TNVF 4JN2B 4TF4A 2HT3C 4ODVH 1NBVH 4HXBL 3PFQA 3N1MC 4NM4H 4ZAKA 3EYQD 1WPCA 1UCBL 2FWUA 3FYEB 1UG9A 2XXCB 5L2KB 5C9KA 3OJVC 3D2UB 2AJXL 2VSCA 1WZAA 5KUMA 2WD0A 1T83C 3DI2B 1XZWA 2WQSA 5FGCB 1M1SA 5GGSY 1CK0L 1ZA3A 2OCJA 4JRYB 4XMPH 3DYMA 5IOPB 4G11A 1KPRA 4IMLA 4F8TA 4N8VG 1L5GB 4G83A 5DZNA 1WLHA 4LL4A 4XXWC 4AYDC 3NCCB 3IT8D 4BZ2L 1UZ8B 2ZOTA 4JJ5B 1T4WA 1MCCA 3F00A 5T1KD 2PYED 3F5WB 4H40A 1AOHA 1QA9B 1RUKL 3LEXB 5D7LB 2N1KA 1FZOB 3HN3A 3OGCB 3C60A 4ZMQA 4LSSL 4CJ1A 2GJ6A 3CIQA 3C08L 4HEMA 4X50A 1NIEA 5D9SB 1IEBB 1L0PA 1VCBC 3QAZC 3GSQB 5LGJA 2DEXX 2Z34A 4GQPH 5IQOA 2VE6B 1U8KB 3PGDB 4PI2A 3CHPA 1BQSA 3VVVA 1JGUL 4JKKA 3E9TA 2VITB 1EO5A 4KK5D 5EC1B 1FNEA 1JSYA 1EXUA 1ZTXE 2FBOJ 4IIQC 3SCMA 5E08H 3JTTB 4KKAD 3BAIA 4M5YH 4P0DA 2L0DA 1YEFH 2DM4A 2Y0SA 1KSRA 4DT2A 1MFVA 4OJFH 3T0ED 1OVZA 1REIA 5ILTL 1JOIA 4UM9D 5C0DA 1OP5H 3K72B 3IJYB 1VPOH 2ENJA 3LEVL 2MPAL 4JBSA 5E6IA 1BX2A 4PRIE 4TQPA 5I1AA 3DHUA 1EMTH 1G6RB 4TSAL 2BP8A 2SEBB 4PRPB 5GSRA 3UTSD 1U8PA 3BDXA 3AZUA 3OM3B 4MD5B 5DMIH 3RY6A 1WV7T 3D0LA 4QOKB 1PKQA 1RJZB 1WS7A 4DTGH 2HFFA 5DZLA 4YUEL 3WNIA 2JCCB 3L2MA 3Q0HA 3BVUA 3RVVD 1QFWH 5I5JA 4FQ1H 1OO2A 3KYKH 4DOHE 2D7NA 4IOSD 3SDDD 2XWJA 3CG8A 4F58L 3DBXA 3RGVB 3R1GL 5CU9A 2A7BA 5CIPH 1VEMA 2BSTB 3DVGA 2V6HA 4P06A 4CW1A 5D4QA 4KROD 4PJIB 4RDQF 4WGWB 3UXFA 4K8RL 3UEZA 5C09B 1RUPL 3G5YB 3PWLB 3DHJA 7CGTA 4AV4A 2Q7AA 3A4DA 3BGAA 3HG1B 2EE0A 3HI1A 3VD1A 3CZUB 1JMZA 2BX5A 2JB5L 1E9OA 4O2CA 1T1XB 4Q7DA 5ELIA 5JA9A 1TFPA 1E4XH 2VLJB 3EJYC 5FDWB 2X2JA 1DUZB 2OA9A 4F7EA 4XPBH 3KBFA 3SE4A 3CSYB 3ZHNA 2IPTH 4FFZH 4KXDA 1PIFA 2QLVB 4YHLL 3ISRA 5I71B 1T2QL 2R0KH 5DC0A 1JGDB 1IBFA 3MGOB 4GMSL 5DD5H 5DFAA 1NFDE 4JFOB 1MHHA 3TBVB 4ZYKA 5CBEA 1LO4L 3IDJA 4U6YA 1F00I 5IQ7H 1FC1A 1FGVH 1QPXA 3QIWA 1TVBA 3PIQA 4L9LC 3AT9A 2BHFA 1ZSDA 3CFJB 4OZHF 1WWBX 2H0FA 5B3JE 1WO2A 4PW9A 5GJTH 4PS4H 1VFOA 4GBXB 1BLNA 4FL4C 1YY9D 5AVWB 3HN5A 1UD3A 4P57B 2GSGA 2TAAA 2VSMB 1GXEA 4Z18A 4FYRA 5HHQB 3QUZD 4IGBC 1MJ7H 4Q9RL 1BFTA 1GGIH 2EEXA 2I5YL 2WINA 3ARBB 3GUFA 4OZIB 2MCPL 5GGTA 5FO8A 5I9QC 4MS8D 1ZV2A 4HJUA 1EBAA 4XOAA 1J0JA 5FOJA 2IPUG 1QFWI 4WFGD 2IQ9L 3T4YA 3T4AB 3B83A 2YS4A 3LDBB 3OSKA 4A2MA 1N18A 4NWUH 3RU8H 2QBWA 1B3IA 2D2CC 2ENSA 3FSVA 4U6XA 2VDRH 2I9TA 1M53A 2EDLA 4YNYA 3FO1A 3CX5K 3IMUA 4OCSL 4PRIA 2UY7B 4FYQA 2VN7A 1MY7A 1AFVH 5DYFA 2R1YB 1K72A 4JW3A 3US0A 4MCYA 2CCVA 5F1KC 4NRXA 5AL8A 4CBZA 3GZOA 2A9BA 4W81A 5F7EL 1E4XI 1NCNA 2VC2L 2WLIA 3D09A 5FM8A 4NYLA 1UWGL 3DBSA 2Z7YA 5EOTB 4TQEL 1G6VK 3IDNB 3OLGA 4M8UA 1QBLL 5JA8B 3SDXF 1N5AB 1U3HB 2HJFB 3MXVH 4ONHB 3WNNA 3UTQA 2R2BB 2WXFA 3WFZA 4MDJA 5D5MA 4BFFA 1WAAE 1CFNB 1SJMA 4JDVA 4NZUL 1K85A 1WD9A 2RFXB 1I53A 1DCEA 1N10A 4MAYB 2I24N 1KTCA 3RIKA 4OZFB 1ORQB 2W80C 5KYNA 1BFOB 1NMAH 3LPFA 3TH4T 5HI3D 3DI3B 3FTGA 4QF1B 3X14B 2Z31C 3EH1A 5GRJL 1TZAA 3BEWA 5HGAA 2CDFB 2O5ZH 4BFNA 5MEPA 1D6EA 4DERA 2X0VA 3QFGA 4N8VB 5DUBB 3SE8L 3GS4A 1CURA 4XBPB 1MFNA 5ANMB 4AOFA 4S2SA 4PW4A 1T6WA 1KB5A 1TETL 4M1DH 1AS7A 3ML9A 1OAQH 1WZKA 5G5DB 1X6LA 4XX1E 1DDHB 1T5XB 2E5EA 3FBKA 4EDWL 4UIMA 4ZO8A 4AQ1C 1KJ2L 3FYIB 3FOMA 2W9EL 4PJAE 1U30A 1TZIA 1SFDA 2J8UA 1S7XA 2Y24A 2JELH 3CFKA 3FUMA 2XOTA 2WKOF 4MKTA 2YGOA 3U4KA 3WY2A 5J0BA 4HKBA 4IOIB 1JI2A 2FQGA 2ZG3A 2G5UA 1BQHB 3MYJA 3QNXA 4L05A 3C6EA 3L4XA 3RWHB 3VFOB 4X5QA 4WV1B 4AI7A 2PO6B 1OW0A 1K3IA 4K55A 4ODTL 1AKJB 1BD2D 3TJHC 3MZGB 4A63A 3O9WB 1OAKH 3GMLB 1YQVH 5EU6A 3K74B 3QFDB 3VG0L 4PD4J 5F9WB 4RGNC 1S8DA 3DDGA 4RFEA 4HG4K 1F4WL 1N9PA 4R4NC 3OGOE 3D39E 4PUBL 4NQVA 2DIBA 4IRJB 5GZNA 1T0NB 4ZMWA 4Z23A 2YJQA 4UANA 4UDTB 3SGDH 2HVJA 3HIZA 3B2VH 4KZDH 3SZKC 2BHZA 4U2YA 3VG9C 4S1RH 3BPOB 4HIHB 3LIZL 2HP4A 3HN8A 5C7XL 2FL5B 2DJ4A 2O30A 1OAYL 4OD3H 3BDBA 2J3SA 1IGJB 5IFHL 2ZCLL 3LKRB 3CVHA 4PU2A 5D7IF 3ULSA 4XTRD 3G7TA 4ALAC 4IRSA 2EZ0D 3PQYB 5F1OB 4K3HA 3FU9A 3AS1A 5GRVL 4A55A 5KUKA 5I74C 3L16A 1KDIA 4PV8B 3B2DC 1A5FL 1WD8A 2P5EE 2XN9B 5HYQA 2GQHA 2NW3A 5K9JL 5DDHB 4KJWC 1U95A 1OLZA 1BLIA 3ZKNC 1KIPB 1T6VN 2WWMC 3F7LA 4JCLA 3WO4C 4RWYL 1MRCH 1QYGH 4YZWA 3SKOA 1E6JH 2BY3A 3GUTA 5PAZA 1NBZB 4NHCL 1MWAL 3PJSA 1GW0A 1X5GA 2HUHA 4DN4H 3QEHB 1F58L 4M5TA 1CE1H 1W72L 3V0EA 3FTYA 1AO7D 5IKCB 2EICA 2Z4QB 1KWGA 2BNUA 4KKZA 3B9KB 1T66D 3CFEB 3QW9A 3GRGA 1OSEA 3QJTB 3QQ4A 2VDQL 3IFOB 1T0OA 4Z7WA 1ZV9A 1V27A 2XG4A 4MQXD 1X7QB 2AJZA 2JKNA 2VISB 3K8MA 3NG5A 1T04B 4AQ8A 5E95B 4IS6B 3FB8A 2G4GA 1QVOA 4PG9B 1MWOA 4AVHA 1BZ9B 3OHXA 3DX7A 1LQBC 3SQBA 1J8HE 3WMSA 1FNLA 3SO5A 2D7PA 3K6DA 4KDTC 3WL9A 3IK2A 3MV7B 2L8AA 1A7OH 1RJLA 2R0ZH 1XIWD 1D2OA 3BFOA 3LKSB 5ADPH 2DWTA 3V6ZA 2Z35A 1I7TA 4BWWA 3CQQA 2KZBA 1KYAA 1AS6A 5BUPA 1Y6MR 1YMHB 4XPHL 3RHWK 2BP5M 4D9LL 4LCIH 4ZD3H 2KI6A 2AQNA 2FQEA 3VGAC 5CSZA 4TPRH 1RZIA 5EUOE 3N41B 3OKKA 3S2CA 5C1MB 1FFOB 1KEMH 3LV3B 4JQIH 3RUGE 3SPJA 4L0PB 3U6RB 3G5ZA 1EEZB 1UXLA 3T0VA 3IAGC 3K2KA 1F8TL 1Z3GL 3VGBA 5GGVY 1DJYA 1JK9A 4HHGA 3EJRA 4J3OH 4K2UL 3ILQD 1MZYA 2UV3A 3GINA 5HGBB 4UINL 3FQTA 3Q44A 5F9JB 1EHLH 5AYUL 5EUKA 1OQOA 2X89D 1A6PA 1OP5K 1RXLA 4JLRA 5EA0H 5IP4A 4OKVA 4FAAB 3LRSB 1ONQB 2R9HC 2AC0A 1I7ZA 1JHKH 4LSTH 4X8XA 5GS1B 1FFPB 1F90L 3VXSA 1EEYB 4BYHA 4GG6B 2WXJA 4BSJA 5HYSG 2ZCKH 3NZSA 3UTPE 3IGAB 4ZXBA 3WNPA 5IJBC 1G9ML 2YGVA 2A9MH 5DJZB 4P5TD 2VL5A 4X5LA 5JR1L 3WEAA 3BP4B 1I8IB 2YEVB 4PWJA 3T71A 3AREB 4TSBL 4GLRI 3T5WA 3EYUL 1CYWA 3MA9L 2CG9X 1IJNA 3VI3B 3V0HA 3LXUX 5C08B 1KV3A 4NZRH 1KG0B 1WTLA 3C5ZB 3FQNA 4DFHA 2HA1A 1LEKA 3KPRE 2ERJB 1AY1H 4ZTPH 1CBVL 2XN2A 3PY9A 4TLSA 2J57A 2MNUA 3L1OL 2NY2B 2DLGA 3NCEB 4LCCC 4G43B 4L1TA 4PJ5B 5CSBA 5IB1A 5KS9A 2DMBA 2AQSA 3NESA 1C7TA 4KTDL 2W0LA 1U93A 3HHSA 4JM0A 1A6TA 1KLUA 3KPLA 2VSKB 5HJDA 3U0PA 2CGRH 5J57B 3ZTNH 2YMXH 4MVBD 2QADD 3EOBA 3I3DA 1J8HA 5TQ2L 4MJHA 3SKJL 5AL0A 2YBRA 2BZ7A 5DJXA 4C47A 1SUHA 4CNIB 2NDFA 2W81C 4LOVA 1LLAA 1TVDA 3NUKA 3O4LD 4YHIB 4EJ1C 5F8RC 5TK2A 2KQMA 3LRKA 4XRCB 4U1KB 5BMFH 4FC3E 5BOPA 4XCCH 5L4IA 2IADB 4HPOL 3CJJA 1F97A 5D1QE 4FG6C 4PJCA 3H9HA 4A2FA 4YHZH 1B4LA 5FUZH 3SE3C 1JUFB 3B3IA 4OFDA 4AUJA 1DBKL 1NLBL 4IMKC 4FLQA 1CGVA 5EUOA 2FO4B 4ZMTA 3J2PA 1IBGL 4ZDHA 3RUGA 1YYCA 5J4MA 1GOFA 4MZ2A 4P23D 4PI0A 1II4E 4FXKB 3LMJH 2V9RA 2VIRA 4EN2A 1AXSB 4QAWA 5T1DH 2GTZA 1PD1A 1QBBA 4MJ6A 1TVHA 2WUBL 1KXVA 4L4VD 2BS71 2J12B 1XR9B 1XBDA 3CDFA 4P4RA 5EO9A 1IM3D 1Z9SB 4WWKA 4JZOA 3ERXA 3QDGD 1J12A 4RZCB 2K9FB 2MWCA 3E80A 4MB5A 2DYRB 5AVVB 3EBAA 1TMCB 4G3YH 5KSBF 2XA8L 3MROB 2V3FA 4HJ0C 1BF8A 5KG9A 5K33A 2NXZB 5TE6L 3HMXL 4PYGA 3P2BA 2Y6SC 4U7MA 1A9BB 4PV9A 3CH1A 3V4PA 4OFQA 1T7XA 5HGGS 2BWIA 3WXVL 4CMHC 1UA7A 2CSPA 3MKGA 2NYZA 4N1HB 1OD9A 3WIAA 5LBVA 2FR4A 3C6LB 4HCRL 4B3EA 1EFXB 4HK0B 3ZSSA 5HXMA 1TDQA 1RLWA 2OK0L 3BHBB 3C8KB 1PDKA 1INDL 1IAOA 4FQXB 5K93A 3LKNA 3ULVL 1RUMH 2NY1B 2HXAA 3N85H 2DY2A 5KVEE 3RGHA 3AVEA 3C09B 3G6DH 1Z9OA 2E4FA 3MFFB 1DQMH 3JV4A 2YD4A 4PG2A 1AGDA 1HJCA 4TL5A 5I15L 1FJ1A 4PQXA 3NEXA 1AXTH 3MREB 3EDEA 3BO8A 2Q9OA 4XOBA 4XHJC 2OMTB 4R0LB 1GS8A 4B9YA 4LLVB 4ZFOL 4EIZC 3HS8A 4D9RE 1JZ3A 1NDTA 2Y07H 3DO7B 2P28B 1W72A 4D0DA 1HH9B 1EJ6A 5A2IH 4QYAA 5C71A 2FZ3B 5B7MA 5BV7C 1E6OL 3I6SA 2HLFD 2JSFA 1ZIBA 2FDBP 3E8UL 3P77A 4KUCD 1FNAA 2A9NL 4NQCA 5B3SB 4QCIB 1DL7H 3W9DB 1I3VA 2F7PA 4MSWB 4WWID 3UJIL 3HZKB 3RDTA 3T04D 1Z5YD 3MNWA 3SGKC 2D7MA 5CILH 1G4RA 1S9VA 3QRFM 3O8XD 1I8LA 3DVFA 1EAJA 1F3JB 1FBIL 2NY7L 4N2BA 1XF2B 2FJSA 2X1PA 2P42B 1FGNH 3KD4A 5AW6B 1TJHH 1TO4A 1U2YA 4JFWA 1JZJA 3NQKA 1DVYA 2QHLA 1NIDA 3CFCH 2EXTA 1U9KA 3DDFA 4CSTA 1ORSA 4FLHA 1GZQB 3ECBA 2A99A 4NM8H 4D7BA 1CFVH 1CGTA 3L4TA 4NQEB 1P69B 5I17B 1ZV5A 2AMGA 2BIHA 4P2OA 4FQLH 1N2RA 2WHVA 1A6VL 4APQC 4NQTA 4HA1A 5CBAA 4MNQE 1OZTG 5BVJB 1EEUA 2JFCA 1D6VL 1HCYA 5SWSB 1MIML 3MR9A 2ADIA 1OT2A 2APSA 1AD9B 4XP1L 3MRDA 2ZT9C 4PJ9A 5D1XD 2X6VA 2N7SA 3DETC 3WE1A 2Y1YA 2DKUA 2LU5A 1XGQB 3SOBH 2FEJA 2WQAA 1CLOL 1D5IL 4B53A 5FV1L 3FFCD 1U8CB 4IBWA 4TMPA 5C0BB 3ZTCC 4CMMB 4WKZA 5EBWB 3DX9A 4MNHB 3EJQA 1ZT7A 2JB6B 3TIEB 2B5IB 3G9AB 4XGZA 5C0AD 5F21B 5G4NA 3NZ8B 3U7AA 4ELMA 4HIPA 2WOYA 1N64H 1T4KB 3C9NB 43CAB 2CLVA 2GG1A 5EG6C 4UMGA 1BPLB 2BIIA 3MRFA 4FFTA 4X83A 5DI8B 4WW2F 1BJ1H 2XN1A 2VWEE 3L6FB 5KYWA 4XNYH 5E1IA 1I1RA 5FW8A 3EGXB 5ABDE 1QFUH 4W9IC 4ODSL 5T1KB 1SVZA 4EN3D 2PYEB 3ULVE 5E5UB 5KEZA 1EXGA 4Y19E 5JW5B 1NBYA 4JM4H 2BIPA 4LMQI 3RWCB 2AITA 1JPSL 2ZWSA 4ANWA 3DX6B 3RFRA 3QQDB 1SVBA 4MJIE 4ESKA 3IN0A 2KLRA 1S78C 1N6UA 2R23A 4H25A 4YAQB 4YXLL 5CEZD 5DD1H 2I9LA 5AZEL 1V3MA 2QGCA 4Y2DB 2PTTA 5AB0A 3I3BA 1XCTA 3WJLA 2N0KA 3MFGB 1ZWIB 3TYGL 2XWBB 4G8GE 4WO4D 3QR1A 5IROC 1I3UA 5EO1A 3ARSA 4GJTB 3L3OA 4HAFA 2X4NA 4EI6B 2A6DB 3M17A 1TSHA 1JGVH 2H8PA 5E1AB 4MRCA 5LXGL 3T0EB 1IJ9A 1KIQA 5ESQB 4PY7A 4ES8A 1T5WA 1DZBA 2ED6A 3EJYD 4M1GH 4X4ZA 3NJLA 4ONFH 3N55A 4MD4B 3OSVA 3PAUA 2EDHA 1NUDA 4IOFC 1TJIH 1WZ1L 3GPEA 1NOFA 4XPFH 3D0VB 3RE0A 1G7HB 3NFNA 1S5IL 3H9SB 1BVNP 2VL4A 3CVIL 5IBTL 5C07E 1XD0A 2RBLA 3GTTA 4URKA 1BBDL 3ZGHA 3UGEA 3I6GA 4MQ7B 1FZKA 4FXTA 3MRGB 1DEEB 1A3QA 2FX8H 4FFWC 4FP8L 3B2XA 3FMGH 1DJZA 3SDDB 3QHZH 4CC4A 4FQ2L 1A0QL 4G7VL 4Q9BA 1NFIB 5I8EB 4WSJA 1U41A 4IGBD 3IDXL 4U1MB 3WCYA 4XB7A 1J88A 4DGVH 1QNIA 3FN0L 4ELKA 3ULUC 4HJGB 2LLGA 3VDAA 2Y3AA 3CPLA 4X8JA 2OR9H 4XPTH 4TN9A 1T3FA 5FECA 2AI0L 4XAKD 2X0UA 3WIIH 3NRPA 5DVKA 4JGMA 4R90H 4KTEL 3ABLB 2ZICA 5I1LB 1ICTA 5SWZD 2X88A 3VFNB 3RWGB 4APXA 4PJGE 3BE1H 3L7EA 4OVUA 4Y19A 1MHPH 1RL1A 2V2WA 4FZEH 2W60A 4LLAA 3AWEA 1DVSA 2UWEA 2WPGA 3CSGA 4HDIB 1MI5B 4AYMC 4MJIA 1UACL 1ZEAH 3WNMA 1ZJBA 3TBYA 5HGDA 1A8ZA 1CR9H 3ME0A 4OV6F 3W56A 2PXYD 1JHLL 4P5MA 1ZVSB 4ZFOA 3II3A 3TJEL 3DJRA 4KKLD 3HG3A 1QACA 3NFPB 4CADB 4QHKI 4XE5B 5FF6B 3EZ8A 3GLDA 4G8GA 1G7QA 4GKZB 1JZ6A 2CBOA 3WLWC 3PGFL 2ZUSA 1IARB 2CRMA 5IF0A 3D69A 3PE9A 2AXFA 1S7TB 2CPCA 4JRWA 2V5MA 1TLMA 3A6BH 3MUGA 4JO4H 4WUUD 1ZPLA 2OV0A 1F41A 1UYWL 4J6IA 2Q3ZA 1UM6L 4PRNA 3D50A 4Y5VA 4WJKB 3FUFA 3ZYIA 2UZYB 1D9KA 4X9HA 2G3NA 4NKDB 4U33A 5L6YL 3QI9B 3K4DA 1JYWA 1RK7A 3P4MA 5E70A 4OGYH 2D03H 1YMMD 2EDKA 5F9OH 4QYOB 2VKWA 3RVXC 1R6VA 3A5VA 4N2HA 4LNVA 4HUUB 5C07A 2EDMA 4DAGL 4U1HA 5IHZA 4X6CE 5MEOB 2ZP9A 3K46A 3EDDA 4FTVE 5FUOL 1UD4A 1YNTA 1HEZB 2EDFA 3THMH 2CO6A 4HWZB 3I9IA 3AXLB 4XVJH 2YSSB 4EBQH 1ZHNB 4KTYA 4MMYB 4YWGL 4Z0XB 5H4YA 2FLRT 2NYYD 1J5DA 3GXUB 1HXYA 1MCDA 4PJEF 4AQAB 1KPUB 4TKWA 3CFNA 3V4VH 1ID2A 4OGQC 3TPKA 5C0FB 2NR6C 3VFGL 2BOBB 2VDNL 4PTTB 2ICCA 4ZODA 2ESVA 3ARGA 3TWCH 1ZHLB 4RGND 2PWGA 4FNQA 3GBDA 2YN3A 3VFVA 2YBGA 1MCIA 4JREC 2W5PA 4PJGA 4O58H 4MMZB 2PABA 4XMKH 4TSCL 3ZDZE 4M61B 4ZO7A 1AGBA 2BWQA 2HG0A 1ZK9A 3O3EA 5D1ZI 1DO6A 3VJ6A 1QRKA 1LM8V 5D7SL 4ZFZB 4RDQG 5C0RL 5I16B 5ID0B 1K4CB 1ACYH 1MCOL 3MA7A 1FO0A 1A7BA 2OTWA 4NRZA 2EYTB 4UB0L 2FIRT 4TYUA 2J4WL 3WEMA 4BUQA 3FU7A 3QHTC 5BZWB 4FKHA 3IMTA 5ESAA 6TAAA 2IPUK 3TX4A 4MA7L 4YHOL 3V5KA 3MLRL 5I6MA 4HIEA 3Q5TA 4N0CC 4P2RD 4PRHB 4WEBH 3QZWG 4LSVH 5HVHB 5DFTA 3DURA 3U25A 2LHAA 1P84K 5DUJA 2ARJB 3MLSH 4Y5XB 5KSAA 2F53D 3A4FA 3TVMC 2VQTA 2CKBL 4C4KO 3UTTD 1RD6A 1G0DA 5GZOC 3HUJF 1TTUA 4C4BA 1BWMA 3DUHA 2H0EA 4JUSA 1E3ZA 4WHCA 1N26A 4ODVL 2NDGA 1NBVL 1NC4A 3GM0A 4NM4L 2AJ3B 2MKLC 2Q1EA 2VQ1B 3QPXH 4I9WD 3KPOA 4Y4KA 1MW2A 3MCG1 3LHPL 5IVZA 2OXGA 4WHTB 1GYVA 1Z6JT 2CIKB 1EDQA 5FKPB 4ZFFB 4JFPA 4GO6B 4X6CA 3F7KA 3FO9B 4MMXC 3RWEA 2KT6A 4XMPL 5HJ3B 5LNDA 2YAHA 3WFDL 1OGSA 2F54A 1XMWA 3X13A 4FTVA 5DS2A 3D8MA 4WO0A 4HETA 3ZE2F 3EGSA 4XT1C 1FFNB 5IHBA 2RCSH 3R0MA 4NNYA 1VZGA 4RMBA 4QTHB 3QUMA 5DJCA 5EOCL 5JLZA 5DSCA 4HQQL 2AEQH 2AF2A 2NQCA 2WLLA 2JIXA 4JFHD 5IREA 1DVXA 2FHFA 4OSUH 1QRNB 1KYOJ 15C8H 3CDZB 1XGPA 4UOQA 3TO4C 4QRQB 4PLKC 1DZ0A 1XEDA 1S3RA 4NO3B 2RH0A 4XCFH 4RA3A 1G7LA 3BH4A 3AY4C 3N44B 1ZLSH 3VFWB 4PRAB 4ODHH 1FVEA 1R3HA 4JFDD 4X99A 2P24B 2VN3A 3MRPB 3P9LA 1KPVA 5J06A 3FN3A 1OE2A 5C7ZA 1WC7B 1E4WL 1M4KA 4QRPA 4JPQA 1J5OH 3VI4B 3ARVA 4IU3A 2WW8A 5E08L 2C3WA 3U2SA 4YH6A 4U6HA 1MHEB 5F7AA 4M5YL 1D5ZB 3MUHL 2OX5A 3LZQA 1YEFL 4NHUA 2J71A 3E2HC 3EJZC 2NUPB 1YEHH 2C9SA 3QRLA 4GT7A 3HS0A 4MJ2A 4U1GC 1VPOL 4OAWA 4AZ8B 4QXUH 2C9QA 2DYPB 3BQUD 4N2MA 4QHNA 1XF4A 3TJPA 4XZUA 3PXJA 3NN8B 1CICD 2IAMA 1DBAH 2XIBA 4LGRB 1HE7A 2V3DA 4LF3A 3WKQA 5HHPB 2NY4C 1L9MA 4Y5YB 4DTGL 1VFAB 1X4XA 1XF3B 2JI2A 3I9PA 4XP4L 1XIWB 4PB0H 4NZTH 3ZKXC 4A2EA 3O41A 4I9XA 2BVTA 3L5WB 4LCYA 4Z7VF 5IVXF 4U1IA 5IW1B 2YD7A 4MJ5B 5EU4A 3KWUA 3NSFA 5EBMA 2YGNA 4EXPX 2YRPA 1OCZB 3IRCA 5ENWA 1A6WL 1FIGH 2QKIA 1SOXA 5I28A 2HT2D 1CBJA 1TFHA 1CDCA 1RZGA 2FD6H 1C16A 1CFSA 3GMRB 3TNMA 3RPIA 1AZRA 4AMKH 2ZJSL 4KKPA 4LLDB 4Y2OB 4D7PA 5CHNB 1TT6A 3CHSA 2Y1VA 4GIPD 4OLVH 4XPBL 2H6PB 1K8DB 2Y36H 5DHDA 1UQSA 4B7LA 4FZ8H 2IPTL 4HZ1A 4FFZL 4FNTA 3IXAB 3VD5A 4RFOH 5T3ZL 3AG4B 5IMOA 3GJFH 2PPDA 5DD5L 3PREA 5I75C 3JTSB 3K80A 1RHFA 2G60H 4X5WB 1FGVL 2R29A 1VZHA 2OL3A 1BQKA 1MREH 2LW3A 3FAWA 4NO0D 2V2TA 4KRNA 4PJFF 5AWNL 3K5SA 5GJTL 5FPIA 4KFZC 5I5IA 4S1DC 1BZQK 4JRXE 2X05A 1A14H 2XETA 4P5TB 4YVUA 1K4DB 3CV5A 3LRHA 3W0WD 1UD8A 3E6FA 2GJJA 2WIIB 3HAEA 3L95B 3ZZSA 1ZXKA 4FG6D 3NP3A 2CBQA 2YAQA 4MYPA 3M7FB 1TZOA 3QRGH 3GRWH 1JFQL 2VDMH 4ZAKD 1PL3A 2P8PA 3BEVB 3TA3B 3S34L 4NWUL 3M46A 3RU8L 3HRZC 1OALA 3M8OH 5E4EC 1WIUA 3PFUA 4LAQH 4F20A 2TSBA 5IQLA 3WS3B 5DMGD 1JP5A 1UWEH 1MVUB 1F6LL 3H0TA 3L3GA 5JHLH 1JGIA 1RH8A 1AFVL 1FV1A 2WQVA 4A38A 1S7VA 2AKRA 3TM6A 1H6UA 2QADB 1N3NA 5JQHC 4OLXL 2WNWA 4FS0A 1AJ7H 4GEJA 3Q01A 4K7PX 2YPKA 5C0EA 4HJ0D 4BK5C 1RK1B 1LWHA 3C60D 5L9DH 3QZWB 2D31A 2GC4C 3TBTB 1H3TA 2Y6SD 3MCYA 3PNWB 4Y4HA 3GWJA 4MJJA 5EZOH 4WTZA 5BS0B 2V7NB 3UDWC 1K5NB 5EU5A 4ONGH 3BIKA 1BVOA 1F4YH 1WHPA 2AAVA 1I3RB 1NANH 3EJPA 4LAJH 1U8NA 2Y7QB 1BVLA 4QO1B 1RU9H 2ZE0A 2J2ZA 3TH3T 1FPTH 4L37A 1KBGH 3KYOA 1NCCL 4QXWA 4R96B 3SCMD 1JNJA 2R69H 5IIEA 1KB9J 1NMAL 1U8MA 3DRTA 4FI7A 4JZJC 4ANVA 3KVDD 2B14A 4GAYB 5FWQA 2CK0L 3MJ9A 3K7UA 3QUXA 3T3ME 3GS0A 1BV8A 3I6KB 2OMXA 4JHWH 1IM3B 5D6DA 2A4ZA 4XHJD 3QDGB 4P59L 5C0CD 4UZSA 1B90A 1HILA 1HS6A 3PWNA 1UKSA 1QBML 3DYOA 3E6HA 3VWJB 1BSIA 4TLTA 1C12A 4KMLB 2JELL 5D7KD 4N3TA 3VB8A 3T8XB 4R7XA 4JRXA 1U36A 4H0LC 1RERA 2FRGP 3T0BA 5EDXA 4UAHA 2W94A 2VZOA 1GKOA 2AHIA 1SXSA 2W92A 3L4WA 4FG0A 4FJ6A 1RQ5A 4OUOA 5FOBA 5T3ZE 1B4RA 2ITFA 1RUAH 5EPMA 3REWA 2FJGB 5I1IH 3ABMB 3BYTA 2GW5A 2C9RA 4MWFA 4PWEA 4N90E 4ABUA 4GAAA 3SPGA 3HS9A 4LCWB 3KLSA 4K7FB 1OAKL 2Y9RT 1P5VB 4AIXA 4OD1H 1ES0A 4Z7NB 2JNZA 3QXUA 3N9GH 3ATEA 4GRWB 4W93A 3EYSL 4MNGE 3ZMEA 3OB8A 4ICXA 1HI6A 1XCQA 4PJHB 4G1MA 1IGYA 4HJJH 2FEDC 3ARDB 3FTWA 2HX7A 3B2VL 4KZDL 1FWXA 2VH5H 4JEGB 1WT5A 5CD3B 3FU0A 4APQD 1AXIB 2IC2A 5E0FA 3IJSA 4K5NA 3BP6A 3OPZH 5D2LF 4Z0BL 4WSGA 2N4IA 3G5XA 3SD5A 2BFGA 1H3GA 2ZKHH 1MUJB 1XTLA 2NY0C 3RIAK 5MENB 4WFED 4A7TA 2JV6A 4HH8A 4WNQB 1A6UH 3MX0B 5GGVL 3G08B 2ZWYA 3O8XB 1O7DE 4ZOEA 4IJ3B 1QKZL 2AK4D 4FNLH 4ZUTB 1W0VA 4G6JH 5HDBF 4GNKB 7PCYA 1F1DA 1Y1UA 2F7QA 1ZE3H 3FF8A 1KLGA 1MRCL 2HJLA 3GMNB 4LDOB 4PJ7F 4RMUA 1RFDL 3CZFB 3QG6A 2J5LB 1E6JL 3KL5A 1YEWA 1HSAB 2GEEA 3MV8B 4GAJH 1HHHB 4CGTA 4F3FA 4DN4L 1RZJH 1IAKA 3LNGA 5F7HA 5IV2B 1CE1L 3I02A 3K3QA 2QKSA 4CU7A 4JB9H 4PRID 1DQJA 3KR3L 3RX7A 3V6OA 5ETUB 3GQFA 3H9YA 1NA8A 2BXYA 2UX6A 4KQ4H 5IB4B 5IJKA 5DEZA 4Q56A 2QVTA 2WUCH 3DMMC 4OI7A 1JZHA 1MRDH 2BFVH 3LPGA 4I0PA 4DHLA 1I8KB 3OKDA 5D1XB 4BSVB 2MPVA 3RRQA 1TTAA 2ADFH 5J6GA 4G9DB 4S1QH 1KTDA 1AOZA 1EPFA 4U3SB 3NCMA 3BWAA 4QHUB 3LPOA 5CGYD 4R7NB 1CL7I 3NIDF 4CN1A 2B59B 5F6HJ 1E65A 1CD1B 2P1YA 1NKGA 3FOLB 3K8LA 1TQTA 3VFTB 1XGTB 3L3DA 3QFJB 2MOGA 2ICEC 3S3BB 3AACA 3MBEA 4H8WC 4KU1A 4X7TB 1TLKA 1J05A 2DQ6A 1I8MA 1HHGA 5K39A 3QIUB 4LCIL 1AGFA 4ZD3L 2BS8A 4E0RB 1D9KC 1AZUA 4J1UB 2B7DT 3CC5B 5M94B 1KTLA 4IDLA 4XP9H 4TPRL 5DRZA 3QZOA 3V0VB 4OGZA 3EH2A 4MCNA 1KEML 4JQIL 1WBZB 3EH4B 2P5WB 4HCIA 4EN3B 2WXLA 5AAMA 3TTYA 4RH4A 2G3XA 4KO5A 4CRPA 2PWHA 1TPXC 4LSRH 1BMWA 3I75A 5HBBA 3UYPA 1AG0A 2EDEA 1LXMA 1QD0A 4JZNA 2FBJH 1Q0EA 3C2SA 5HYJE 1EHLL 3DV4A 3FKUS 5EA0L 3HEIB 4AEEA 5IT2H 2ZOWA 4YHMH 1ETZB 4FFWD 5BXFB 1A6AA 4O02L 4B5ZA 4LSTL 1JHKL 1FSKB 1JRHI 2WAQA 5JYLA 1KCBA 4R2GB 1PYWB 3CN0A 3QT2A 4G9FD 4WO4B 2H1LM 4JFFA 4YFDB 5IY5B 4UDUB 2ZWLT 4UT7H 4ZBJA 4XNDA 4NC0B 3V55A 3Q6GL 4W9EC 1NGXB 1OCCB 1NOAA 5I6LA 5EU6D 3U48A 4R97C 2PR9A 2JTYA 1U8LB 3D2UA 5M7QA 2EP6A 2AV7A 1QSFB 1Y07A 1KIUA 1AHWB 2BW4A 3FQWA 1A64A 2B1HH 3DK0A 3AFLA 4IBLT 5IOPA 1JXGA 4FNSA 2DMGA 5KYXA 2UVFA 5GZND 5JXAH 1QSEB 4ZTPL 4FQQB 1XV8A 4G80B 5AW8B 4BSWB 4I1RA 4ZMXA 2BC4A 3FT3B 3D08A 5E00B 1IKFL 4G82A 2DQUH 5D96B 5CZXC 1QA9A 2ZSWB 4KDWA 1X5LA 4LVNB 3P0YH 3QWQB 3HC4L 4JPVL 5D7LA 3O6LH 1FZOA 5J12C 3Q1SH 2AP2A 5CR1A 3F6LA 2BDNL 1SY6H 2CGRL 1WBYB 2J55A 4HU8A 3ZTNL 2YMXL 3CMGA 3CDCA 1EV2E 5B7FA 3EYFB 4IRSD 4BRVA 3TEYA 3KLHC 1IEBA 1TJGH 4JS7A 1D5BB 4GP8B 2XPYA 2HRPL 3GJFK 5TGBA 3A6CH 2CNZA 3BT2H 2VE6A 1M3IA 1S7UB 1WFMA 4JRFA 5KJ7E 4UBDD 1QUNB 5DJ0B 2GIXA 1PPIA 5F1NB 4E5XG 1HOCB 2EXYC 1TQBB 4ZMLA 2VITA 4XCCL 1RLBA 4MXQC 2QFRA 2Z93B 1BZ8A 1D5RA 5FUZL 3FCGA 4EI0A 2C3VB 5E8OA 4Y4KC 2NY5C 5DRXB 5KBNC 4GRWF 5IB3A 3QIBC 1DSFH 2DQDH 4YXHL 4DQOH 2R0WH 2R2CA 4YDLC 5EU7C 3LMJL 1HSBB 2Z6FA 2YD9A 3STLA 1E3FA 1OIOA 4EAEA 4MD0B 4Q58C 5CJXA 1FI8C 2ZXWB 4R4BB 5FB8A 4GSUA 3H54A 3RVXD 5HYJA 4GAGH 3CFBB 3GHEL 3UYRH 1BIIB 3IWUA 1MLCB 1ND0A 5AUMA 2JCCA 3AAZB 1WA1X 3H55A 2K3HA 2PXYB 3WY3A 2QPFA 1RIUL 4MHHG 2NCMA 4Z7OE 4OF7A 4IBTA 3HZMB 3RGVA 1NAKH 4XOCA 4LSUH 3QO1B 4Y4FC 1NCWH 4NFDA 5K9OB 3S4SG 2NMSA 4NQDB 1EJOH 1JV2B 4HU2A 2YPLE 4OGAD 1OSYA 3DOHA 4QRBA 4QXTB 3ZTJG 4AXWA 5I30H 1IUZA 3M88A 5CP3H 4A6YH 4GRMA 5CLZA 2OJZH 2XWDA 3HG1A 4OQTH 4QXGH 2FGWL 2IPKA 4YPGA 4A37A 2VKXA 5KSUA 4NQXB 3NIFE 3RIFF 1I1YB 1N8ZB 3QJUB 2VR7A 3BSZL 3G6DL 3V5DB 4WEMB 1DQML 4W6YB 1J0IA 4LVOC 1YMMB 4DK5A 1UXMA 4F8LA 4OJEH 3WFBH 1IGIH 2C5DC 2IH8A 1LP9F 3MGOA 3ET9F 3CU1A 2UY6B 4W4OA 4JFOA 3BRDA 4YOKA 3P4LA 4WU7B 3TBVA 4B3VA 6FABH 1DLHA 4MXWH 3GZQA 2H0PA 2ZYHA 1IC1A 2Y07L 5KZCB 3GDBA 4PWGA 3WBDA 1YPZB 1D7BA 2ZQKA 3B7TA 4TQHA 4A2HA 2IBZX 1FNHA 2IDUA 4G6AD 3VXSD 1HQRB 4OZIA 3VXPB 4ZXBD 2IANE 1L3NA 5FFLA 5DD3L 4ZO6A 2C9PA 2Y23A 3CDYA 2JK5B 3K81A 3IPBA 4K7PY 2VXSL 4X6FA 2ZUQC 1SEQH 5E99L 4KI1A 3L3KA 5TDNA 3EADA 6CGTA 5BO1L 4LXFA 3TVMD 3LN5B 5TD4A 4AG4H 4KK9C 3K91A 4QD2E 3QAQA 3GK8L 4RFNC 4YZFE 5CUSH 1TJHL 1PJWA 4J28A 3CFCL 1E8YA 2FJHB 1JGEA 3HB3B 1VADB 3TZVC 2CBTA 3ARFC 3PL6C 2UY7A 5EORH 2MH4A 5JIIA 2XU9A 4NM8L 4B9CA 3DGGA 1CFVL 3GHBH 4GFXA 5FYLD 1F13A 2FUTA 4BH8B 3U79A 3GMPA 3U9UB 5LDSA 5FLUA 4PCSA 4NX0A 1TF4A 1N0XL 5LVEA 2J1KA 5KN5B 3BZFB 4HIIB 4JQIA 1CIDA 4U31A 5CZRA 3TS8A 4CVZA 5D4JA 3NJNA 2R2BA 4NOFA 4BCYA 4K07A 4K73A 2E86A 1IEHA 4O2FB 3TO4D 4Q6IC 1HK6A 3IVKB 4NUPA 8FABB 2DDQL 2PF6A 4W70A 3REVB 4AEHH 2F74B 3SJVE 4OJAA 5GRUH 2XN9E 4DVRH 1U4FA 3AS2A 3O4OB 3BJLA 3QJOA 2WK2A 4QF1A 1IL1B 3IFLH 1IAIH 2CDFA 4KVNH 1T89A 4ENZA 3O3DB 2EE9A 1AR1B 4BFKA 4N8VA 3MACH 5DUBA 5DU7A 3KVPA 5CMAB 3VXTB 4DZ8B 1MFBH 2A6IA 5AW3B 3M1CA 4J12A 3ZUNC 3GXIA 2ZX9A 1N64L 4XMLH 3L3HB 2DIJA 2WLHA 2YXFA 4FHJA 3UBHA 1EHXA 5HVFB 3U2JA 5JMOC 4KKRA 1X5JA 1XGYH 3EJZD 4XNMA 1BM7A 2FJFB 4N5UA 4WWKD 5C9JB 1J0HA 3NA9H 4AL8C 3CHRA 1ASOA 5IJCC 1YHPA 2Q7YB 3ZE1B 5SWQB 3IBOA 2X0WA 4JM4L 3UJJL 3RB7A 4DEPB 4R7DB 3OB0H 5EF2A 3N6YA 1ZPUA 1FA4A 2GJZA 3NDYE 2IANA 3ELAT 3UTPD 4I2XE 3MAWA 2NY4D 2PO6A 4C56E 3VCLA 4WLCA 2FSDA 1KOAA 5EBGA 4C4KT 1PZ3A 2APBA 1AKJA 4UT9H 1DQDH 3HR6A 2O5XH 3GMLA 1KFAH 4NQQA 4PEEA 4OIBA 2P49B 2F1BA 2WLMA 2EEDA 5G55A 4LOUD 3WDHA 2EC9T 3NIGB 3NPSB 5AAWC 3V0DA 4DVBA 4QHLA 4PGJA 1NDGA 3ZR5A 1VDGA 1R34A 5A2KH 4IRJA 4UDTA 1E27B 3OZ9L 1Z7JA 3UMTA 3AY2A 1JGVL 3PHSA 1I1AC 1K8IB 2PW2B 3WUWB 5G2NA 1YN6B 2JJTC 2IWEA 3L3JA 1L0XA 3APDA 4J5VA 2FL5A 4LHQB 1ECZA 3F12B 4A67A 3NZHH 2JJUA 1IAII 2OMYB 3JUZA 1JZGA 2H32B 5GIRA 3KWTA 1AP2B 3Q8EA 4Y1AE 3A24A 2X6MA 5AKRA 2Z92B 1AACA 1U92B 4HC1L 5LHDA 4HJEA 3MLVL 4JO2H 2QGDA 3X3GH 3EDFA 1JHTB 3EJSA 2QVIA 3KYMB 2NRDA 4NQCD 1NCJA 2FX8L 4JFVA 2VAJA 4PV8A 3FMGL 3BCDA 3RYMA 1QWUA 3SJVA 1JZ2A 4I18A 3WI9A 2XN9A 5F88B 2Q76B 4YFEA 4WI0B 2QMJA 5EB9A 2Q0ZX 3RDTD 4KFMA 4GXVL 5FGRA 5HHNA 1WCBA 1CZ8H 5DHYA 4S1DD 2ZUWA 3O3AA 3ALPA 2FYVA 3BVWA 3IMBA 3WKMH 5F8QC 4QT5B 4UU9A 1T20B 1UEYA 4LQ1A 4AX3A 3QEHA 5JIPA 4HMDA 1J9TA 1WWAX 1ZT1B 4DGVL 5I1CL 3GTVA 3EF7A 5FO2A 2E8YA 2X4OA 3TF4A 2OR9L 3G6AA 4XPTL 4JNXA 2FIKB 3WIIL 4G8IA 5E1HB 1M1XB 3DYPA 1IC4H 2E0PA 2BVUA 3O2WH 1IEAB 3CVBA 4P2OD 2Y7MA 1X7QA 3LXAA 4I4WA 2H4EA 2AXWA 3BE1L 4BFIA 1MHPL 1T04A 5DVMA 3ZOAA 4FZEL 3MQIA 4IS6A 2H3NB 5AW2B 3Q2WA 3B7YA 1A1NB 5C86A 5D72H 4B9IA 2XTJE 1BZ9A 4ZFGH 1ADQA 3D85A 1Z9NA 5JO5A 2ZPKH 2P47B 4OZ4B 5HHVL 4C56A 1ZEAL 3DX4A 4WWNA 2ORBH 2FECI 3O3UN 1CR9L 4JDTH 3ML8A 1MFUA 2WCPA 3RKPA 2WXRA 1U0QA 4R6UA 4AGLA 5MHSD 5I24A 4Z76A 1P2CA 3LKSA 3FB5B 2V5RA 4XN2A 5F1IA 3EDKA 3VWKC 3MLPA 1NDMA 1YMHA 1VGKB 4FI6A 5T5NG 1RZKC 4ZMPA 2R0LH 3DXAB 3UG4A 2Z9TA 2K6WA 2E9BA 4GY4A 3MRQA 2XYCA 4ZAKB 2F5AL 1CLYL 4NZ8A 3RVWC 4OB5L 3A6BL 4YS4A 5LQBH 1FFOA 3JTBA 3LV3A 3TC9A 1H8OA 2OW7A 3MUY1 4GMTH 4PW3A 4X9FA 1HWGB 3U6RA 3DUSA 3Q6FB 2NY3D 5T1MB 4ZPTA 1ZA3B 2Q87A 4PRDA 1KPRB 1LYQA 4X80H 3ZYJA 4JGUA 4D9RD 1NCAH 1CD8A 1J9SA 2YR3A 3GD1C 1PQZB 3F7YA 1XBRA 1C5DA 5F9OL 1V05A 5LCVH 3I84A 2C3GA 1G5AA 3LRSA 4U6VH 1FQ9C 4P2YA 4PCKA 5GJSH 3TCLA 3W5MA 4P5RA 5JIDA 3BQVA 1OT1A 1FFPA 5GS1A 5L88H 2GJ6B 4W1TA 1QR1A 4UNVA 5DK0B 3THML 2WYZA 4XVJL 4EBQL 2W65B 2Z0BA 4MA1C 3UTZB 4LVHB 5B1JA 3N1PC 4FQPA 2ZUXA 3BFWA 3S98A 1X5HA 4AYSA 3BP4A 3IF1B 2DICA 4S11A 3TBBA 3V4UL 3PP4L 1LE5B 1IFGA 2TRYA 2VM4A 3V4VL 3WS6A 3VI3A 2OMZA 1FNEB 1ID5I 4JR9H 5LAPA 3BWZA 3KXFE 3SCMB 5DO8A 5FYJU 1EX0A 4LHUD 3C5ZA 3HC0A 4DPRA 5I1DB 5GS0H 1HXMA 3JWOH 4H8WL 1MCWW 5A2AA 3VTTA 1JG9A 3II1A 3V95A 2WGXA 4AJVA 4L29A 4PJ5A 5EU3A 5C0DB 1P4BH 4HK3N 4PHXA 5ISZB 2JCWA 3T65A 4O58L 1GYWA 5FAAA 3TONA 1CWVA 2CHNA 5E6IB 1ULVA 2R56L 5D70H 4XNQA 2DWDA 1U21A 5I1AB 4OLWH 2K4WA 1QI3A 4WFFE 4N0RA 2BP8B 2FEEL 3QNZB 4Z78B 3MUZ1 1U8PB 3AXHA 4DK3A 1CMOA 1G7PA 1NMCB 2R39A 3D0LB 2HFFB 2XJLA 1R5VA 2BY2A 1ACYL 4M48L 1OGPA 4L1BA 3D3VB 2F18A 4M3JA 5LBGA 3TF7C 1W9XA 2X9WA 4LPWA 2DL2A 2O5YL 1SYSB 3QUYC 2XWJB 2ZWNA 4WQOA 4U1KA 4KRPC 4JVWA 3ZKMD 2IADA 3UP6A 4MBOA 3CLFH 4BFGA 2WY3B 4OT1L 1N70A 1BVKA 3KJ6H 4LBEA 3DO3A 1H6TA 1ETA1 4WEBL 1XGZA 3U0WH 4MTMA 5E2WH 1OPOA 3LKOB 3SYAA 4PN6A 1WRFA 3RTQB 1I9IH 2WZ6A 3NCYS 2GVYA 3FAXA 1PFOA 5EOCJ 2D7QA 1QQDA 2L7UA 5BQDA 3FFDA 4O2CB 3EH3B 4E9SA 2NT1A 2DQGL 5KWYC 2CJTA 1SHSA 2CO3A 4OR1A 3VXRB 4F7EB 3ZTJH 2I7SA 2HFGL 1XR9A 2E46A 3V52H 1SEBA 1UUSA 3D12B 4XX1G 2CZNA 5FUCC 2FTAA 2AJUH 2QSCH 4OGXH 2NXYC 3ZBMA 4XAWL 3AMKA 4L3CA 1IC7H 3UP1A 1MHHB 5JPMA 4NUGL 5JXEC 3IDJB 4PLJC 1N19A 1EUTA 2WBJA 2VMDA 3QIWB 2RCSL 3BAXA 2GIMA 1TVBB 3P40A 4GUCA 3L8QA 4PD4K 4E41D 3H7BA 4KJPC 1ZSDB 5CS7A 3ATAA 1FNGA 3T3PF 4HAGA 3RL1A 3MPCA 2P7TA 2J6WA 1BLNB 3D5OF 1E2ZA 4HS6B 1V7NL 3N06B 4OSUL 2GSGB 2QDVA 15C8L 1OGAE 3GSUA 2VLKD 3C6LA 3L1GA 1EFXA 4HK0A 1P4LA 4HUMB 2CM6A 4G8GD 4HUKB 3WFEH 5KTEH 2LAAA 2WINB 4WRLA 1C1EH 3IETA 1GCFA 3KXFA 4UWQB 3GYRA 5E2UH 4BWTA 1ZLSL 1WFTA 1CGSH 1Q9OB 2IBZY 1PZDA 4DGYH 4JFTA 3BH9A 3AB0B 3UAEA 3T4YB 3MFFA 3CZNA 2XZAL 3C87A 1AS8A 4U6XB 1Z3RA 2I9TB 3VXME 3MREA 1CGXA 1D9KD 1ACXA 3NJMA 5B1CA 5IBUG 1J5OL 3FT2A 4JKWA 2OMTA 1EGJH 2EO1A 3ZU8A 2XBDA 4PRIB 4N22A 1FLTX 5KVDH 1BIHA 4Q2ZA 3E3QC 3IDGA 5AW5B 5I1JH 5IB2B 1YEHL 3INOA 3PJNA 3F7RA 4NRXB 2C1OB 5T5FH 2D9CA 4DOHB 3PCYA 4JFXA 4QGYA 4XHQA 2WLIB 2OYKA 4JQXA 1MCHA 2QQNL 4LEBA 3W9DA 3WFHA 2HLAA 4MSWA 4DP6X 2AERT 5D8JH 1DBAL 5IVNA 1K5WA 3BT0A 4IDJL 4UMSA 5DJ6B 3UTQB 3OKMA 4OI8A 1BAWA 3BD4A 3ZMRA 4JDVB 3OB0K 4G5AA 3S96B 4PB0L 3RFZA 2Y72A 3BAYA 3V0WH 1AZZC 2EINB 3QORC 1QEWA 2LV4A 1T03L 3FTGB 3O2DL 4HWEH 2ESVD 2EDOA 3ARGD 3BEWB 2Y2WA 1FIGL 2X3BA 2X09A 3ARUA 4FERA 4Z7UE 1DBBL 2FD6L 4IK6A 4L4TE 4DW2L 3GTNA 4HWBH 4S2SB 1AG6A 3EFFB 2P9RA 3QDJE 1YECH 1GGCH 5D1ZA 4AMKL 5I71C 1QFPA 4PJDF 3TT3H 1NFDB 4G7RB 4NNPH 4FX5A 4DEUA 2CLZB 5BVJA 2PUQT 4UIMB 2KZ1B 3MRLA 5AENA 2J72A 4MCZA 4W9HC 3LPPA 1CT8A 4OLVL 1UXWA 1TZIB 2CPUA 2Y36L 1RURH 1S7XB 3S8FB 3UG5A 4FZ8L 5HYSA 2RQ8A 3CFKB 2PPCA 4RFOL 5GGRB 2ETWA 2VRQA 4KJQD 5I6KA 5ITBL 4GBXC 3BZDA 1ZY9A 4NQSB 4XI5D 1XGQA 1A7RL 1OGAA 2IQAB 4HKBB 4WENB 3QNXB 3MYJB 4OIIH 3KBPA 3JXAA 3TURA 4FNPA 2GABA 1MREL 3ARBC 3KYNA 5EBWA 3COOA 4FFVC 4Q9QL 2WXOA 3TIEA 1A14L 2WM0A 2Z91A 1DJGA 3H56A 2CXGA 2FBRA 3T4AC 1JZ8A 2VN4A 3BUTA 1XAKA 2ODIA 1S8DB 3D07A 2FHBA 4RFEB 3VXMA 5C2UB 3K6SB 1RK0A 3MCLH 4R5TA 5DD6A 4HPHA 4KI5E 3EXLA 3QRGL 2NOYA 1NC4D 5HHOE 3GRWL 4NQVB 4Y4KD 2BVOB 3V4VA 4IQHA 2E3VA 1FRGH 2F15A 1K3ZA 3EGXA 1VACA 3EO9H 3F64A 3M8OL 4PJXE 4D0CA 4LAQL 4H13C 4F9LA 1U8OB 2F54D 2LTQC 4P46B 4FTVD 4PJBE 5DA4A 1YNLL 3QQDA 4EIBA 3P73A 4J3UA 4RMWA 5HY9B 4YAQA 1BA9A 1JZIA 3U7YH 1JPGA 3X1NA 1AJ7L 1CFMA 1U3HC 2JIXD 4F2FA 3BXNA 4YBLC 1B3JA 2IOMA 3FB7B 1C5CL 5L9DL 2IALA 2WANA 4QJ4B 1IE5A 5EZOL 3KVQA 2P45B 4MAYC 5EU7E 1ZWIA 2WNXA 4PCYA 5I23A 2NW3B 1LQSR 2DV6A 2XI9A 1U95B 5IOKA 4V1DD 1DHKA 2D7TH 2MIZA 3SKOB 4KTGA 1JMXA 3B7SA 4Z7UA 1MDAA 4L4TA 2X1OA 1IZKA 4QRPD 1FPTL 1KBGL 1PAMA 4POYA 3QDJA 3I9AA 2BO0A 1RJYB 1EAQA 4MD4A 3QYMA 3FUEA 3U4EA 1YUKB 2WV3A 2BNUB 3BC9A 4PJAB 2QR0A 2BJMH 4MRBA 3D0VA 2XHNA 5AB2A 1G7HA 3QQ4B 1DE4A 2IV9A 1G9HA 4TV3A 2XG4B 1ZTXH 3ARZA 2C26A 1KN4H 5H37G 2ZOLB 3EG9A 1DEEA 4Y1SA 1JCVA 3SEPA 5CN3A 4AM0A 1QVOB 4GQZA 2QMKA 1K6QH 1UXSB 2IAMD 3OHXB 4ONOA 4TRPH 3NJIA 3SQBB 3FUNA 2J1XA 1GIGH 5KBKA 4WV1C 2PO6C 4RNRA 5LN4A 4E9VA 4GIOA 4ZW7A 2Y2TA 2DAVA 5HHXH 5I8EA 3O9WC 3WJJC 2WVVA 4JFEE 3HI5H 1XH0A 4XMXA 3V6ZB 1I7TB 5H94A 1EZSA 4Z3EA 3UCRA 2XVLA 2XQ0A 3QUKA 4XNBA 1RUAL 2HT4C 3D39B 1MCQA 3NRQA 5HHOA 1QWNA 3VD9A 5IBUB 3APCA 2EILB 1RZIB 1IFHH 3OKKB 3K2UL 4KK9D 4RAVA 3CZSA 4WI9A 1TYJA 4OFVA 1GSMA 1H5BA 3QYCA 3G5ZB 3DRQB 4PJXA 2V5YA 5MP6L 2OYLA 2PCXA 1UHVA 3EO1A 3VMNA 2DKMA 3N9GL 3PL6D 4AENA 1MAMH 5GS2H 4M8QA 1JK9B 4NXKA 5DZOA 5E6RB 1CFTA 1TZGH 4HDIA 3FQTB 1MI5A 3GBML 3RG1C 2VRKA 4HJJL 5T3XD 3QPKA 3PHAA 3H3PH 2VH5L 4JLRB 4ERSL 1J8SA 3CSPA 1C9SA 4OKVB 1HC1A 1ZVSA 4NKOA 3FT0A 2PP8A 4DPBX 1P5UB 3OPZL 4K23H 4L8SA 1OANA 5KJRH 5IQMA 2P5EB 4BINA 5FF6A 1WA0X 5A2BA 1Q0YH 4P9HH 5D5MF 5SX4H 1HL9A 3GSNL 3DJZA 3QZBA 2AW2A 4HOMA 1S7TA 2M8XA 2VC2B 3LNHA 1A6UL 1UCBH 3BMWA 4HSCX 3RZCC 3RWFA 3MRIB 1ITBB 4FNLL 4OZGF 2WWKO 1CK0H 2UZYA 2G3ZA 4OY9A 3FQNB 1CD9B 1LEKB 3OXSA 3L7FB 3CH8A 3B9KC 4BZ2H 1CUOA 3ZMNA 3BAEH 4GAJL 2OCFD 4QYOA 1E28A 5I0ZA 5IB1B 2GK0A 1HAUA 4HUUA 3VRLE 1RUKH 1E40A 1K2DB 1O5PA 4IW4C 5DLLA 5MEOA 1A6TB 1KLUB 4JB9L 4ZS6C 2J8UF 5HDOA 3KPLB 3WLBA 3VQ1C 4KOBA 4X8GA 1ILSA 4KQ4L 1HEZA 3AROA 3EOBB 1J8HB 3C08H 3CUPA 4HWZA 4PLOB 2YSSA 2YBRB 2BFVL 3PGCA 5AVQB 3WNKA 4Z0XA 3DJSA 3TASA 1KJ2B 5DVOA 1OQXA 4JFEA 4S1QL 1QRNE 4AQAA 1KPUA 1JGUH 1T21B 4HZLB 5C0GB 4XMUA 4YDMA 5C0FA 2VLRE 3GJFA 1L3WA 3FUKA 3FL7A 3UJTL 3B3IB 2BOBA 4M6NH 4N9OB 1CLCA 4HD9A 5EUOB 2SODB 2EIEA 1YCSA 4EI5A 3RUGB 5ILTH 1JWUA 1OE3A 3JWOC 4MFHA 5AB9A 4U1LA 3FJTA 4XPAH 3UX9B 4MMZA 3BFQG 2MPAH 1HKFA 3QH3B 5SX4I 2NNRA 2VIRB 4DUVA 1HOEA 1RV6X 2GTZB 3D06A 3FH8A 1OTUD 1IKNC 5GRWA 3SODB 4MJ6B 4TSAH 1I1AD 1TVHB 2HTKD 4NS0A 3QUXD 2IDSA 4LSQL 3LJ3A 1BEXA 5I1KH 4LRIA 4UNIA 4ZFZA 1ZLWH 4P4RB 4KK6C 2J21A 1PY4A 4XZ4A 1K4CA 3BAKA 4YUEH 4OCMC 5ID0A 4XNUH 4Z95L 5EIIG 1J8KA 4XC3H 5F3HB 4MQSB 1PG7W 2V9QA 3TN0A 1NGPL 5KG9B 5FHAH 4LSRL 1IVLA 4ZOBA 2JJSC 2Z64C 2FBJL 2JKTM 1HWHB 3CH1B 3GB7B 4PV9B 2X4UB 3V4PB 3MNMA 1C08B 3V8CA 4UT6A 4K8RH 2EABA 2R4SH 4FA6A 5JHLA 4YHML 4WIQA 2ZX5A 2CR3A 3AXIA 2ARJA 1VLXA 4TVPL 1M71A 2FR4B 3AREC 3ESUF 3IDYB 3O6FC 3HBQA 1G9NC 3QG7H 2MOQA 1PDKB 1J86A 5B4MC 3K71A 2A3TA 3LKNB 3FTXA 5DC9B 4KMTH 3KPRB 3MO1A 2AJ3A 3QEGL 3KPMA 2ERJC 3JV4B 4QKXB 3S37X 1N67A 1AGDB 2CIKA 3WIFA 1FJ1B 2ITEA 4S1SH 4WW2C 5FKPA 4ZFFA 1T2QH 4HJSA 3BO8B 3ASWA 4X0KB 1CF8H 3FO9A 3SBWC 2BVPA 3Q43A 4Z7WF 2DWEB 8PAZA 1FFNA 3HKFA 2R69A 4NKIL 1W72B 4QTHA 5CZVL 3T8MA 2DQUL 2ZKWA 3ALXA 3UZVA 4TUJB 3P0YL 4C58B 3HVDA 3O6LL 1QRNA 4KZ0A 4N2EA 3Q1SL 1JNLH 2VDQB 4JAMA 5LXVA 2PWFA 4Q9RH 2FX7L 2I5YH 4QRQA 1UC6A 3SBRA 4NO3A 5IJVA 1INQA 5D1QB 2MCPH 2VLRA 5D7HA 4YJZL 4WWOA 1I85A 1MCBA 3CSTA 1S9VB 3EJTA 3A6CL 1KGIA 2IQ9H 1L4IA 3EGDA 4X9IA 4A66A 4A7UA 4KOCA 2DZEA 4IK7A 1WC7A 2APWA 3SKUD 4DP8X 1BYNA 1CFBA 1Z0MA 3O3BB 1QW8A 3RWIB 3V0AC 4FXKC 3OAUH 3RVWD 3TEXA 1ORSB 3JWDH 4E9RA 4KZCA 3ECBB 1IBYA 5EF1A 1PF3A 1H6EA 1UM5L 2A4CA 1K9TA 1DSFL 2FT7A 2GB2A 3KAAA 1N2RB 4DQOL 4K7PL 5H8DA 5CBAB 2DYPA 2GSMB 4L4JA 3NN8A 3LZLA 3B7UX 2NXZC 3NJFA 4AMXA 1DO5A 3MR9B 1HE8A 5KBDA 4I0PD 1QBLH 4GAGL 2ADIB 3UYRL 4JM2B 3H1ZA 1UWXH 3KHOA 5HHPA 4PJ9B 4Y5YA 1ZVNA 2DH3A 1VFAA 1GKEA 1XF3A 2ZIDA 4NZUH 1PU0A 1X9QA 3RWJA 2DBLL 1NAKL 3OXRA 4LSUL 4MJ5A 4N6RB 3GIVB 3LN4A 3GSVB 1WAEA 1CVSC 1EJOL 3SDAA 4WHDA 1ZT4A 4FQXC 5CINH 2NY1C 5KBLA 3EHBC 4A6YL 3C09C 4Y16C 4LP5A 5GQBA 1NUNB 1PLCA 3OLDA 4A68A 3MBED 3DROA 2OJZL 4M03A 2WXPA 3W2DL 1AQDA 4QXGL 4LFHG 3KCWA 1JIBA 1A3ZA 3PWVB 4RAHA 2ZYIA 2I32A 4KX9A 4OZHE 4Y2OA 2CLVB 2E4TA 3SDCC 3MRFB 4Y9GA 5CHNA 4IEFA 4G8EA 4R0LC 1FDLL 4TVPE 4WVRA 1EFQA 1P84J 2EKJA 4OF3A 4UOJA 5KS9F 3K6IA 5F2FA 5KYWB 1K8DA 2JKWA 3FO2A 4Y2LA 1E5UI 5JIMA 2ZAIA 1A47A 4N2GA 3NSJA 2G0KA 3QDMD 3N43F 1D7CA 1NBYB 3JTSA 1AC6A 5ECGA 3VXQA 1QPKA 6FABL 2X4TA 4MXWL 4MA3A 3L3IB 3LH8A 1FIEA 4CBPA 4DKFH 1ODUA 5FDYA 3T0AA 1AQMA 2H2PD 3RDJA 1TCRB 2Z7UA 4ZUSA 4BH7A 2YA1A 3QXAA 1G7MB 2I9LB 3QQ9D 3QUYD 4QRRE 4JANA 1K4DA 3H2QA 4PJCF 3VG0H 2PTTB 4A7SA 4QJ5B 2WIIA 3L95A 4K94H 5JPNC 3DVNA 1F4WH 4JFFD 3IKKA 1A3RH 2QZ5A 4NOBA 4PUBH 3L3OB 2X4NB 1TEYA 1ZS2A 3M17B 1O6SA 5L2KD 1I7UB 4OFYA 3D2UD 3ULAB 4AG4L 2D73A 1KIQB 3CXDH 1R46A 4X8CA 3LIZH 1KBVA 1SZNA 4GSXA 1BVNT 4PY7B 5A3ID 1L9PA 1T5WB 4WFHE 5ICUA 1OAZH 3SDXE 1MVUA 4L8DB 4MNQB 4KITB 5E5MA 3Q8FA 5F3BB 2NSMA 3NFNB 1T6BX 1BXAA 1OHZA 4ZQTA 5I6OA 1PFCA 4I0CC 5J1TC 5D2NE 5D7LD 2M1KA 4PAZA 5DVLA 2FCBA 2L4OA 1RK1A 3I6GB 4GP4B 4KKCD 4PLJD 5JXED 3WTVA 3QZWA 1X5FA 1B2YA 2ZSVA 4XNZB 2EYSA 3WIHH 4KUZL 1ZLEA 4N9GB 1FL5A 4P4KA 1FN4A 3NAAH 4LP8A 4RWYH 1I3RA 1BJ1J 1TTRA 1X5KA 1HINH 4FA8A 2ZXBA 4M7ZC 3EYQC 4QO1A 4RISH 5FUCE 1BF5A 1MWAH 4IBYA 4NKQB 4AEHL 1OOAA 5A1AA 4R96A 3T1WA 3VRIA 4C57C 3IU4H 2KYIA 1NICA 4OZHA 3ZDYF 4ELKB 4HF5L 3CPLB 4X8JB 5FECB 4YDKH 1T3FB 3IFLL 5JQ6L 4K3JL 1DQKA 3MACL 2BNQE 1MFBL 1Y1DA 3NTCH 1ZK5A 1XF1A 4APXB 1A3LL 1OCRB 3L7EB 1Q94B 4Y19B 1JV5A 2V2WB 4XMLL 2W60B 4XMVA 3HI6H 3FSAA 2K4AA 3SYOA 3VWJA 3ZJAA 2KLTA 4PRPD 4PLNC 1XGYL 4MJIB 4YBHA 2HSIA 3TBYB 3D18A 1VB9A 4LVEA 3NA9L 3ME0B 4X4MA 5HGDB 2I25N 3T8XA 3ZLQC 5I8KL 1GTFA 4P5MB 4ZFOB 4QRRA 4BA8A 5GPRA 2VN5A 5G4MA 3RGVD 3Q8CA 1T7ZA 4Y2DC 4XO4A 3T1FA 4HD5A 4ECNA 1O75A 4XPHH 3V8OA 4G8GB 2QZQA 3KWVA 1MQKH 2FJGA 3LZOA 5IF0B 3D69B 2AXFB 4I13B 5LDUA 2K6YA 4LCWA 5DZJA 1SY6A 2O5XL 4KY1L 3MUGB 4K7FA 4N8CL 3O0LA 2CRZA 3QQ3B 1J0ZA 2OMBA 3HG1D 3QC6X 5ALBH 3N50A 1QAWA 2Y06H 3T0EC 3U83A 4A39A 2XVGA 4PRNB 5D7IE 1EJ8A 5C2BL 1F3DJ 1F8TH 1Z3GH 2DH2A 3UC2A 5D55A 2VLJD 1KJ3H 3FFOA 3SDXA 4K2UH 4OJCA 4YSUA 4UINH 3P4MB 1V54B 1KYOK 32C2B 2VAAA 4B6ZA 4MKMA 3LD8C 3QPQC 2KLSA 1ZLDA 1DLFL 5C07B 4U1HB 1ED3A 5D2NA 4ZW3A 2DTMH 5IMMB 1N6QH 1KY7A 3UZQA 2XXGA 3NZHL 3AITA 2BRRL 4N0UE 2CALA 3SDDC 2AQ3A 1CTNA 1IIIA 1ZLWK 5CCGE 2PWDA 5E94A 2F8XC 2B9AA 1G9MH 1CDUA 4O5LL 2CCWA 1IQWH 4ETQB 4HHAA 4KROC 4GBXD 4P9HC 4WNQA 3OZKA 3X3GL 4ADGA 5JHDE 5JR1H 4XP6H 2CR0A 1HXYB 2CLRA 5DGRA 5E9DE 3ZL2A 1AANA 3S37H 3UL4A 3MA9H 3B9AA 3QBTB 1X4ZA 4XCEA 1Q9WA 1MCEA 3CXFA 3L4VA 1XB6A 4OBSA 1Q1JL 1CZ8L 3D87B 4X6DB 5CGBA 5IUCA 2WKOA 2KDYA 4H0HB 4ELMF 3ARGB 2HMIC 3HFMH 1KDJA 3WKML 4WGKA 1Y0LA 4ZW5A 2BNQA 3MV8A 3UO8B 5C3IA 5I19L 2ZP0T 3TYFA 4V2CB 3ROOB 4W9KC 5CP3A 4A6YA 1X44A 3OAWA 1MAKA 2OSLB 4ZJ9A 2Y25A 3O3EB 5IB4A 4OQTA 2EKSA 3VJ6B 3SKJH 5CEXA 3D25A 3O2WL 3MBWA 1E8WA 4UTCA 4BSVA 1KCVL 2OTWB 3WTSA 4PVNA 3NABH 3ETTA 3J07A 1SMOA 5I6XB 5C0JA 4U4BA 1KCWA 1YY9C 4Y9BA 3FU7B 3PG2A 4GSDL 4ZFGL 2OYMA 1SLUA 2GUOA 4R7NA 3HZ3A 2ZPKL 2EIDA 3DKHA 3UAJC 3V5KB 4GUPA 1MEXH 5CZKA 4UTAH 2ORBL 4DESA 1CD1A 1JXFA 4JDTL 3JZ7A 3VFTA 3C12A 4MS8C 2K8MA 1XGTA 5ESVA 3QFJA 5BRQA 5BRZE 1IBGH 3L4ZA 4MAYD 1BFVH 5KSAB 1MXGA 3PHQA 4X7TA 3HZYA 2A9CA 2ARWA 3HZVB 4NN5C 4YSOA 3OD3A 3BP5A 4J1UA 1S5HA 3MYZA 5BW7C 3QI9C 3UPRA 3B6SB 2WUBH 3IMVA 5IVZB 3VYOA 4NWTH 2VN6A 5LQBL 2IBBA 3FT4B 4MYWB 1WBZA 2EUVA 2P5WA 1MW1A 2KL6A 4HFUH 2ZX6A 4FG4A 4X6CB 4EZJA 4M02A 2PCPA 2CNYA 3VSQA 2Q2LA 3X13B 4FTVB 4RMVA 4H1LG 5TE6H 3HMXH 1KXQE 3DSFL 3EGSB 1NCAL 2XYBA 2DQFA 3SGJC 3WXVH 1J9QA 2V5SA 2JWYA 5JLZB 5DSCB 2WLLB 2JIXB 3O0RL 5BXFA 2Y5TA 3LRMA 3ARYA 5GJSL 1MPAH 4LPUA 5E9DA 3QCVH 4KH2A 1JJUA 1XGPB 2N1TE 4YO0A 2IAND 1P7KA 3KLDA 5FS5A 2PO6D 2OK0H 4NPKA 3SN6N 3RPKA 1G7LB 1CXFA 4AQ1B 1AKJD 3U4AA 5HI3C 1FAKT 5AVYB 3O9WD 1JNNH 1XSKA 1FVEB 1KN2H 1NGXA 1R3HB 4X99B 2R4RH 3LNDA 3P9LB 3D34A 3WE6B 1U8LA 1L7TH 3CSBA 1QSFA 2H47C 1XGUA 1AHWA 2IDQA 4G5ZH 4PS8A 1AHKA 2K45A 3ZDZB 3QJHB 1X3DA 3U2SB 4IRJD 3P3TA 4U6HB 3V0FA 2OX5B 4KJYB 1CC3A 4P2CG 5GS0L 2X4PA 3JWOL 4BSWA 4WI8A 2OXHA 4NHUB 3PWPE 4NIKB 4XVSH 3FT3A 2OTUA 3AU1A 3LQAH 2UWEF 5DHMC 1P4BL 3ZHDA 1Q0XL 2E27H 4HH9A 3HS0B 2VR8A 4RSYA 1N59B 1N5YL 5D70L 4YIQB 3X3FL 4C59B 4YGVA 1LD9A 2AV1A 4FDWA 4HULB 1WBYA 1UB5B 4QR7A 3M7OA 4LB8A 3UZEA 2IAMB 4YL4A 3EYFA 3UJIH 1OAXH 4PP1C 1KB9K 5E24E 3UIYA 2VDKH 1QLEH 4W9CC 1FBIH 5HVHC 3VG9B 4E9QA 1S7UA 5BRZA 3SJVD 5D7JA 4Y5XC 3K1DA 3O41B 4LCYB 2XN9D 2VGLM 3MODL 1XAUA 2Z93A 3CLFL 5EU4B 5F1SA 4LE8A 5FYJL 1QLFA 3KJ6L 1IBBA 1AKPA 3A6OA 1Z0NA 5ENWB 1XH1A 1FVDA 2QKIB 3U0WL 2Q20A 5KSBE 5DRXA 2X70A 5DFVC 4BELD 3TWYA 1RZGB 1LNUA 4AVKA 4WSKA 1MLBB 1G9NL 1CFSB 3FH5A 3TNMB 1I9IL 3RPIB 3WN5C 4PS3A 1AI1H 3QXWA 3FSZA 1UEMA 4UT9A 1A6VH 1HSBA 2D3LA 4TLKA 5JTWA 2Z7ZA 3APNA 3AU0A 3UADA 3N0AA 2YAFA 3HOGA 4UQEA 1KXQA 1M05A 3BP7A 4LPVA 4Q89A 1PBYA 4XXCA 4LOFA 2J56A 4GAFB 3WO4B 5BNXD 3CFBA 3ASOB 3V52L 4XP1H 3GRBA 4BQ6A 3AAZA 2EZ0C 5IMOB 2QSCL 4ZS6D 1YNTF 3W11D 1RJCA 3HPJA 1IC7L 4YEEA 2KKQA 1KC5H 3F85A 3GI8L 5CFHA 1CLOH 3D85D 4XPGL 4C56D 1FH5H 1CXKA 5K9KA 1KGCE 1KULA 1VFUA 3D4CA 4KNUA 5DHVH 3MV7D 4M6OH 1MCNA 2FVNA 1XEUA 4NSKA 4BKTC 1NINA 2EE3A 4XWOC 1XDTT 3E6FB 3ASNB 5SX5H 3UC0H 5KTEL 1G5GA 3OBAA 1C1EL 3GLAA 3U36A 3VDCA 3N2JA 1AE6L 2ZKYA 1CGSL 2GITA 2X4SA 2G30A 4J3BA 3JVGC 4PJGF 1H3VA 2P8PB 2WYTA 3PWPA 5E51A 4D9QD 2X41A 5CJQH 2NX5E 1MJUL 2BOLA 4XO3A 4MQXC 5JIHA 2YGQA 1EGJL 4GXUM 4WU7A 3H0TB 2WO3B 5KVDL 5K1VA 3E1ZA 4K3DH 2I7OA 2OAAA 3CFMA 1FV1B 4KK6D 1S7VB 2AKRB 2FYYB 4YXLH 4LQFH 3QULA 2M83A 3LSOA 1SN2A 1W2KT 5T5FL 4FG2A 5TDPA 1RZFL 2A4EA 1U8IA 2D31B 3H3BC 3KGSA 1XIWC 1JF6A 3FU6A 4Y4HB 2QV4A 1NGZB 4GXUN 2MCMA 3GMMA 1H3WM 5D8JL 4K94C 3BIKB 2E47A 1NCOA 2WWKT 4FJZA 4EOWH 3L4YA 2IWGA 4RGMB 3B37A 4X7CC 2J2ZB 2E9WA 3K6NA 3KYOB 3V0WL 5IIEB 1H6FA 1U8MB 1JERA 1UT1A 2XIIA 3DRTB 4RMRA 3C5ZD 2BERA 5LGHL 2OBGA 1L0YA 1IGCH 1G84A 1WZ1H 2CKBB 4E9WA 5JOPE 4CSPA 2YA0A 2NY2D 1NEPA 1S5IH 2WVUA 1E2VA 4PJ5D 3Q2NA 2XQYG 2OMXB 3CVIH 1LTXA