2GEQA

Crystal structure of a p53 core dimer bound to dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
193
structure length
188
Chain Sequence
QKTYQGNYGFHLGFLQSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*TP*GP*AP*GP*CP*AP*TP*GP*CP*TP*CP*AP*C)-3'
publication title Structure of the p53 Core Domain Dimer Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 41
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2geqA00
5AOKA 2VUKA 5KBDA 3D0AA 4L0YA 1UOLA 2IOOA 1T4WA 3D09A 3VD1A 2BINA 3EXLA 4IBSA 3WTWA 3EXJA 2X0WA 2OCJA 5AOIA 4HJEA 2MEJB 2IOIA 2RMNA 5LAPA 3Q01A 1LJMA 3Q06A 2J20A 3WTXA 2X0VA 4AGMA 3US1A 5AB9A 4LO9A 2J1WA 1HU8A 4MZIA 4MZRA 5LGYA 3US0A 4IBWA 3WTTA 1KZYA 5ECGA 3VD0A 4AGQA 2BIQA 4L18A 2BIPA 4AGLA 2XWRA 4AGNA 1TUPA 2J1ZA 4IJTA 3QYNA 4GUQA 1GZHC 3VD2A 4LOFA 2BIMA 1HJBC 3WTUA 4KVPA 3WTVA 4QO1B 4A63A 3TS8A 5AOJA 3QYMA 1HJCA 1EANA 4G83A 4IBVA 1CMOA 1EAQA 4L0ZA 3KZ8A 2FEJA 4AGPA 2ATAA 5G4NA 3ZMEA 1H9DA 2X0UA 5AOLA 2XWCA 4IBTA 2BIOA 2GEQA 2IOMA 4G82A 5ABAA 2ADYA 3IGLA 3D06A 1YCSA 2J21A 3WTYA 4IBZA 4IBYA 3WTSA 5AOMA 2PCXA 3WU1A 2J1YA 1IO4C 4LOEA 4IBUA 3D05A 2YBGA 2J1XA 2AC0A 4AGOA 4IBQA 2J6WA 3IGKA 3D08A 5BUAA 5G4MA 4GUOA 1GZHA 1E50A 2H1LM 2P52A 3Q05A 3KMDA 5G4OA 1CO1A 3D07A 2AHIA 1EAOA 5A7BA 2WGXA 1TSRA 4XR8C
chains in the Genus database with same CATH superfamily
4B5EA 3APCA 1ZKAA 3ZHFA 3CFBA 1U2HA 4WSKA 1OAYL 3UEZA 1CICC 5AQ0A 3H1ZA 5KBDA 5MENA 3DGDA 4NOFA 1AGCA 1VAHA 1WT5C 3U30C 3ZGHA 4CADB 2B5IB 4R96A 3GS7A 1VEOA 3GI9H 3HBQA 5ACZA 1I3UA 2DWEA 1OF0A 3FN0L 3Q01A 5D1XD 5J13B 5HTSA 3AU0A 5LBGA 5DQDH 4ZUWA 1O6SA 2GT9A 3TFKD 2XCMC 4KJQC 1QTYT 4KRMB 3S5YA 4U0QB 1FA4A 2ARJB 4NKOB 3Q8BA 1MJ7L 1FH2A 2IPUG 3NJMA 4U7MA 3MNVA 4ZFOB 2NW3A 3OBAA 4FFYH 4A6YB 5I0XA 2A6DB 4F24A 3KDPB 2J3SA 2NQDA 4I0KA 1BM7A 2KPNA 3ASNB 1CD8A 2MTPA 4TVPH 4G8GB 2YRLA 1NLBL 1NKGA 4PJHF 1YC8A 4MXVF 3ZDZE 2RCSH 4D9LH 4PJDF 3IJYB 2CIIA 3QFGA 5HHOD 2QGDA 1EJ6A 1O7DE 2WVTA 3HNVH 4M48L 2G3XA 3J2PA 4DN3L 5KW9L 4XCCL 3TX4A 2WWMD 2ZUUA 2NNXA 5A7EA 4UT9H 3V0VB 1S5HA 1CD9B 1P0SE 4W9KC 4OIIL 3E6HA 5KANG 4Y2DD 2Y72A 5HVFB 1FZOB 1RIUH 2F54A 4XPHL 1GJIA 2R0KH 5ID1B 5LQBL 1U8OB 2CWRA 1I1YB 4IYKA 3VA6A 2Q7YA 5B21A 4WI3A 1P7BA 2NLJB 1IJNA 1U4FA 3CQPA 1D5MB 1KCSH 1MI5B 4Y2NA 3VXMA 3WIFB 3KPPA 4FTVA 4OLUH 1X5XA 4ZX5A 1WITA 2NY3B 1OZUA 3FCTB 4B5ZA 4HJSA 3BISA 1UA6L 4LF3B 3SE8L 3O0RL 2FQDA 4JZNB 4RETB 2A74B 4GS7B 2YD6A 3MLUH 2EO7A 3O3DA 4UOQA 1HWWA 4UT9A 3WTYA 3GIZH 2G9HB 1IL1A 4OGYH 4TV3A 1NFDE 1QKZL 4DQAA 2YQ2A 3DGCR 4HH9B 3VSUA 5KSBB 2YBRA 3QO0B 3N0AA 3LY6A 3EADA 2X4QB 5T1DH 1J48A 2WXHA 1BP3B 3HPJA 3T6XA 1A6AA 3ML8A 1V7MH 5GGSB 3LKRB 1GL4B 3BAJA 4B7LA 1GW6A 4RGOH 4WI2A 5BS0E 4XVUC 2XWEA 1QLFA 3LH2L 4NHCL 2OSWA 3VFWA 3DJSA 2P48B 4KH2A 2AGJH 2H3NB 4QHUB 3CXDL 2B1AH 4BFJA 4XMLL 1QYGH 1GC1C 1R0AL 4NQEA 3MNZB 5FYKU 3SQBA 3KS0H 3TPUA 43C9A 4EBQH 3VFGH 4LVOC 2VMEA 2CBTA 4IIQB 1OAZH 1MPAH 2Y1ZA 4P4KD 4QRPA 1CF8L 3N40P 5C0AA 5CD3A 1FAIH 3Q06A 3BSGA 4HSQA 3GRBA 3FQ4A 3CSGA 3BWSA 5E08H 5EMYA 1I85C 1NMBH 1XSOA 5JMOC 1JGIA 2YQ3A 2C9VA 2XTJB 5AB9A 4RQQB 9CGTA 1PZAA 2NQ3A 3ET9F 3IJ8A 2ZG3A 1U91B 2F58H 3FOMA 5F7NC 4R0LC 2WXRA 3QDMB 1N26A 4JREB 5E5MB 5AD0A 1MIEH 3E3QE 4JGNA 1HZLA 3HB3C 3RWIA 3O3BA 2K4WA 3Q1SH 3QEQE 3QXVA 5EEWA 4PRNA 1II4E 5EORH 4JFEB 4NOBA 3D9AH 2ITEA 4EN3D 1JTOA 2PR4L 3WTUA 3WXWL 4ACTA 2C9QA 4U6YA 4MWFA 3NFSH 1VSCA 4FL4C 3QRBA 4GKZB 3V6ZA 3VRIB 4NP4L 2OW7A 1W72L 4HX1B 4KAQL 1FO0B 1ETZA 1F4AA 4KK9C 5CJXC 3QIBD 2P8MB 4WW2A 2AV1B 2GI7A 3CJJA 3STZA 1HJCA 5F7DA 2J55A 5I16B 3FBKA 2D9CA 2AK4B 2QDWA 3GMPB 4JCLA 4PI0A 3WE1A 5J4MA 2C3HA 1J5CA 3MBEA 4L4VB 3LXCA 1AFVL 3A3YB 3NSCA 3NFPA 1HOCB 4UT7H 3QZWB 4KXZI 5KBMA 3PPEA 5FCUL 5KANI 4DKFL 1ASOA 2H0PA 4IOSA 3DYOA 1SHWA 4G71B 1P4UA 2WZPD 4WEUD 3FK3A 1MJUL 3GSOA 3S5ZA 1G7PA 1MEXL 4LSRL 2DYPA 2XN9D 4HUMB 2Y1AA 3OJDB 4PGDA 3VTMA 2K70A 2UZIL 1A7OH 3TNMB 3MRKA 1IAIL 3RGVC 3ZZ1A 2OR9H 5CBAB 2KQMA 2BVOB 3QH3B 2NY1C 1K72A 3X11A 5E4AA 1HILA 2PPEA 4OH2A 1XF4B 1KF9B 2GTZA 4YXKH 2W60A 3HMXH 2LAGB 3MRIA 5KUKA 2CR3A 3HBPA 1XGUB 2G5BB 2IDCA 3AXLB 5E8NB 4PP1C 4Y1TA 5I2IB 4AQ1B 1S7WA 4FULA 4M8QA 4OV6F 3SKUD 3HA0A 4S1RH 1UUNA 3SOBL 5B38G 3L9RA 4PBXA 2HH0H 4PGCB 5AZEH 2ZX7A 3B1TA 1JPEA 4AITA 2COVD 5I8CA 3VD1A 2HKFH 4XMVA 4HUXB 4MQXC 3S5LB 2XZAL 3NQKA 3VRLF 3VMOA 3DDGA 5JW3L 2XFGB 2ENJA 5CZKA 4HIIA 4YLBA 1M56B 1RZKH 1UGKA 1IFRA 3ZO0A 1DQDH 2C1OB 2VIRB 3GD1C 1Q72L 3LNGA 2OSXA 5FGBA 4AYMC 2OYLA 2W0FB 3HMXA 1CFQB 3VA2C 3DIVA 4HISA 1FIEA 1P5VB 4GRWH 5DD0L 3UAJA 1CGYA 2BW5A 1Y7VA 1L7TH 3P11L 1K6QH 3ECBA 4J8RA 4K3GA 4D3CL 4PWHA 3QA3B 2R7EA 3QQDA 4NLAA 3G5XA 4JVPA 3ZDWA 3A6BL 4LLVA 1Q94A 1QNZH 3VTAA 3QYNA 1DCEA 4EIBA 1AY1H 2CO1A 3LKOB 3OLGA 3PWJB 1KLGB 3PFUA 5FYKD 4N8VG 2X6BA 3QDJD 1ZOXA 3V4LA 5T1MA 4FQXB 3O45B 2CHNA 5FAAA 2VR7A 3EJTA 3ZKMD 4W9CC 4X98B 3W5MA 4G6KH 4GKSB 4N0UA 4YHML 2E27H 3GHBL 3LPPA 1EERB 3O6FD 4XNYH 3RVTD 5FOJA 1LWHA 4UOW1 1FF5A 5G4NA 5LBVA 4AOFA 3TF4A 1IAOA 2F8XC 2JB5H 4PG2A 4YHPA 2VJXA 3PWPE 1EMTH 2G60L 3KVDD 3VSTA 1JD7A 5F7EH 5EC1A 3T09A 3WV0A 1JV2A 4M1CC 3EOTH 2LE9A 3CX5K 4JGUA 1E65A 4ODXA 1N2RA 4HKZB 2XZQL 5J6SA 2IANA 4X5XB 5GRVL 1XBRA 4EO5A 5L88L 3VWJA 1W0WA 1IM9A 4DEWA 1FNEB 3HG3A 4PRHD 4Q6IA 2K0RA 3D4CA 1BV8A 1N5YH 3DO4A 1H15A 3HB3B 5CF3A 1KWKA 3NEXA 4MAZA 2J1YA 4Q2ZA 3L4CA 2KT6A 4QCIB 2J1XA 2EE9A 5EEVA 2VITA 4QD2E 4F7MB 1RSYA 5D7IE 5CZVL 3LNFA 3GXTA 2PTTB 1NC4D 1SYSB 3ES6A 5BNXD 1M3IA 1KT2B 4GNKB 1CFNA 2ENSA 5G4OA 4PJBB 1S9WB 4U6XB 2AK1L 4FL4B 5ANMA 3P2BA 4GIAA 5HHQA 3KD4A 5B7FA 2K9UA 5J6GA 5D7LE 4HLZH 1PIFA 4Y19B 3L13A 4WFGE 4W6XB 4YXHL 1UM5H 2PMZA 5FC9A 3G9AB 3BC9A 3I3DA 4ZO7A 5T5NG 3CN4A 4TQPA 3V0IA 1E4XL 2BNRB 5EBLA 2VDPB 3F83A 3FTWA 4W4OA 5AB2A 5KVGL 4XNMB 3MQIA 3DJ9A 3L5XL 2R56H 2FBJL 2L7EA 3DVNA 3G5YA 3HC4H 3B2PA 3LRSB 2ZZUT 1AR1C 1JXJA 3MZTA 1CU4H 3NN8A 1Z9LA 4L8SC 1SM3H 5DJ8B 2C4XA 5KAQF 1AXIB 2J2ZB 4HXAH 3OAWA 3RBSA 3RTQA 1FNHA 2QELA 3RGVB 2HZHA 4HW6A 1LGVA 1DN0A 1N3NA 4TS6A 1QFHA 1A21A 4XOEA 3VJ6A 1FBIH 3ATEA 4NC0B 3CVBA 3RGBA 2NY1B 3ZIYA 5LN8A 4WI7A 3TXAA 3V8OA 3NK4A 3DSFL 3FOLA 1KGJA 4YHYC 3HI1B 2I7OA 2EDMA 5BO1L 3O41B 4ORGB 4D94A 4S1DD 5E8PB 2WLNA 1JNJA 3RY6C 5CCKL 5GRJL 2ZSVB 4HIPA 4RLDA 5C6PB 1VEPA 4MCYB 1FZKB 5SWSD 5I0VA 2O5ZL 2EIMB 3CZSA 1FVCA 1KCVH 1SOQA 4N86A 4ZRGA 3WJLC 5KG9A 3FZUC 4K94L 5IESL 4NRZB 3CDCA 2YMOA 1IILE 5AVSB 2IQAA 1QSEE 3FQYA 1EDYA 1HFUA 1XIWD 3HNTL 5SX5H 4XOBA 1H6FA 4GI8A 4LBEB 5ESQB 1UWXK 3B9EA 4WEMB 1I4FB 5T3ZE 3FU8A 4KDWA 2ADGA 5A43C 1HZKA 1MF2H 4PJCE 1EA9C 3KCPA 1BVKA 5DR5L 5C7ZA 1U3YA 1N5AB 4HLEA 5I9QC 2A6JB 1AANA 4QLWA 2ORBL 1LP9A 4P2RB 2CHZA 3IXTA 3AMKA 4NCC2 2OW6A 1FG9C 3MXWL 3Q2LA 1JWMB 5CEZH 1WYJA 8CGTA 4H8UA 3D39B 2VDKH 2F74B 3QZMA 1FGVH 1ECZA 2EYRA 5IQ9A 5B8CA 4J8QA 1HEZA 1KGXA 4PJ5D 5BRZB 1MCCA 1H5BC 2VDQL 1BOGB 1INQB 1JJUA 5GS0L 2YPKA 1GOHA 1I8KA 4YSUA 4WWKD 2FH8A 1WJ3A 1TVBB 4WI6A 1UWEL 3WEBA 4FLSA 1UOLA 1NGQH 4LSTH 1C5BL 1ZPUA 2F1BA 2AJXH 5GGRY 2Q8AH 3AREC 5EOTB 3VGDA 3QUYC 3QXDA 5DYOA 4OM1L 4DGIH 1YQVH 4OFDA 4HWEL 3OB0K 4XRCA 1YMMA 4KC3B 1N6QH 1QR1B 3PJSB 4RWYH 2ZKHH 4M4RA 5D2NE 4JRXA 2SODB 2JKSA 2PW1A 1IBHA 3TV3H 1A66A 3HBGA 1J0YA 3GMQA 3ASWA 3VI3F 3LZFL 1Z9PA 3CDZA 4PJ7F 2FX7H 3C12A 1OVZA 2MQGA 2FECL 3HN3A 4P5KA 3FQ2A 2OQJB 1WA1X 2GY7B 3VD4A 4ELME 3OKLA 5A3ID 1WQVT 2BP0A 4YHZL 1A4AA 3C9NB 4PV1C 1JGVH 2Z31D 4FMVA 5CZRA 5E94A 5TH2A 2EVFA 1KJ3H 2LVEA 2YWZA 3FB5A 3SGJA 1QOKA 3DX7A 2BVEA 1SF5A 1RULL 1KBGL 4QHPA 3OMNB 4KH9A 3L3KA 1FGNH 2NSQA 3BFOA 4EUPH 3S34L 3TURA 2Z7WA 2GITB 4DO4A 1T2XA 3S2CA 2P5EA 4NHUB 2HUHA 1LEIB 2YA1A 4I5BB 4PD4K 2O72A 3H9SA 4KXZH 4R4BA 3MACH 3N43F 1BIIA 2YEQA 3EO9H 3GI9L 4HGMA 4A2GA 1AR1B 4HUVB 2WSDA 2WLIA 4L8SB 3EOAB 2UUDK 4GUCA 2IPTH 3KGRA 3WTSA 3FU9A 5DQDL 3EYUL 4A2HA 4BCYA 1A4BA 1P2CA 4FQ2H 3TIEA 2X9WA 4PRPB 2VYRE 1HQRA 2ZUQC 4X7FC 5DHXB 4F33B 4ZFQA 3MR9A 5F71A 1XCQA 5CJ5A 4YHYB 4KK6C 5DS1A 4EUPA 1KBKA 2CU9A 5TK2A 1EAOA 5C08D 3S2AA 1MRFH 1AMYA 3A4AA 3AAZA 4KI5C 4KOCA 4A2DA 5IJVA 1YEHH 2XBTA 3DMMD 1KULA 5INCB 1YNKH 4D9LL 3V4VL 3MRLA 5IZ7A 1ACZA 4HS6B 1TZAA 1PL3A 1PF3A 1FG2B 1TZ8A 4JPWH 1DUYA 5CIPB 2VDLH 1CN4A 1MFBL 1XR8A 3U7WH 4AH2B 4FNPA 4TVSa 1KXVA 3S36X 3ARFA 3QZWG 2I25N 2WCSA 4JFPB 4ZAKA 2BERA 2Y1YA 4OCWH 5I1KL 4UWQB 4RAVB 3IETB 3M6DA 1ZLUH 4G7VL 5EU3A 5F97E 2FX9H 4JJ5B 4YBHA 3FUMA 1I7UA 1ET5A 2ZAIA 4KFZC 2XYBA 5AUMA 1KCSL 1TKWB 4LLUB 4DP8X 3BRDA 4OLUL 1V10A 1U8KB 5A1AA 5EZJB 3VGHA 5F9AC 4B9FA 1AXSB 1MFDL 1O0VA 1NIDA 3WJJA 5CJQH 1SQMA 2AEPL 2YGOA 1UZ6F 2FNBA 2LABA 3EIFA 2NXYB 4WUKH 4AW4A 1V3JA 3IPFA 3U2IA 1VFAB 2QADC 3SKJH 2GTQA 2JKTM 3CQFA 4LSUL 4PV8A 3GIZL 4JG5A 2EVIA 1PLAA 4C4KO 1MRCH 1KXQA 3E1ZA 1XH3A 1H6EA 1H5BB 5F7YC 2RQEA 1CF1A 5HBBA 3CFEA 2HT3D 3BYYA 3LVEA 4HEMA 5CR1A 5IM7A 1V7ML 3KWVA 2WCPA 2ZWLT 1I9JH 3NJIA 3S5LG 1NBZA 2Q2LA 4RGOL 1OLZA 3T4AA 5J06A 4NZRH 4XPFL 4QOKE 2Q0ZX 1BIHA 4AE0A 5CEXA 2RD0A 4UNVA 2Y7QB 4O02H 5DD6B 5IB4A 3AREB 3FO0H 2AGJL 3QUYB 4J27A 1VZHA 2B1AL 2DI8A 3L9YA 3L95B 1QYGL 4MJ6B 3TPKA 4EBQL 3VFGL 3MGOB 5DGRA 4LPUA 3T1FA 3ECQA 1OGAE 2P5WE 5BUPA 5DA0B 4KKBC 1MPAL 1C5DB 1ZS8B 3GTNA 3KAAA 1JPFA 3EKCA 5EH1A 5LAXB 3T6QC 1GGCH 1KXTA 1KNOB 3KYNA 4K7PH 5E08L 1NMBL 4K3HA 4X6DB 3VI3A 3CBJB 3RNQB 2YD9A 4PJ7A 4ZMLA 4FX5A 1L5GA 4JY4A 3S3CB 5GZOD 1KPVB 2OL3B 4OI7A 2QT6A 3GYRA 4O02A 3VXRA 1GS6X 4R26H 3SDAB 1KLFB 3NGBC 2CNZA 2ZOKB 2XVLA 3LN4B 5B1JA 4ZTOH 3CFKA 3RPBA 4FLHA 1J1XH 3DI2B 1RJLA 3KBEA 3Q1SL 4X5WB 4PJGF 3TWYA 4ZW5A 1QA9B 1QUNB 3EBIA 3O11A 5EORL 4BK5A 2NCMA 2BVQB 3L3GA 3ZGIA 1O6TA 1SHSA 1QR4A 3MV9A 4OD2B 4B9IA 3OKDB 2BIHA 5D1QA 5J56B 2Q2EB 1DVTA 3X3FH 1JFQH 4D0BA 4A2LA 2HJLB 2GJ6E 1HYSC 3NFSL 3LQZA 4GW1B 3MRHA 5JXEA 1UENA 2VLKB 1L3WA 1C1EH 3C5ZC 1SQ2N 3P9LA 4K5MA 5TE4H 5AB0A 2H2PC 2WCGA 3S48A 4A7UA 2ATPB 1ESOA 3MUGA 4L1LA 3DYMA 4BK4A 2Q7AA 5ISZB 4ODUA 1AHWC 3TBTA 2DRUA 4OFYD 3BQUD 4KZ0A 3QDGE 4Y4FA 4YPGA 5ICXB 3GO1H 2D4FA 2KDGA 2WQAA 3VD0A 1BVOA 4X2UA 1R17A 4GI6A 2EIZB 4YHKH 1SZNA 5TQ0H 1TQBC 4KK8D 2DQEL 4U1IB 3A24A 4LSVL 5EUKA 3SYPA 2DOCA 3ARWA 1LMKA 5DQJB 1BBDL 1OAKL 5F7MC 3RE0A 4HETA 6PAZA 4WUUA 4ZS6D 1ZT7A 2IAAC 1AVAA 2G2PA 4P3WA 1GHFH 2VJ8A 5HI4D 2D31B 5IMOB 5HVWA 4E41D 2FD6H 4XZ4A 5JNYA 1S9XB 1IQDB 3QUKB 1C9SA 4KQ3H 2Z7UA 2ED7A 2F61A 3CDGB 3CZUB 4H88L 3QORB 2IGFH 4POYA 3V7MA 2BZCA 3WNJA 2YAEA 1BMZA 4OCRL 3WN6A 3WELA 4MQSB 2PO6D 3NQIA 2DLFH 3B7RL 2G30A 4S1RL 1LNUA 1KOAA 2CRZA 5E7BA 1MCSA 2R1YB 3JTTB 3HZYA 1XGYL 2HH0L 3BZ4A 3PWUB 3JUZA 1LO0H 2WXFA 2Z3FA 2HKFL 3JWNC 1QATA 4JL1A 4V2BA 1TDQA 4HOWA 4FOMA 4LLMB 1RZJH 3P77B 5C0ND 1A2YB 1XB8A 4XT1C 3BJ91 1JVOA 2NZIA 3RBGA 5I28A 1OY3B 2Q10A 1CLOL 1YEGH 1F13A 3RYMA 2GBUA 3K2UH 2DKSA 3SJVE 1U8QB 4PLJD 3F85A 3OXRB 1IGJB 1BZ9A 4QEGA 4QY8A 1TTBA 4XI5D 5C09D 2C3XA 5CFAA 1U3ZA 4CGTA 2PP9A 3IGKA 2CKBH 5L7XH 4ZI8A 2QADB 1L7TL 3MGTA 1K6QL 4BYHA 4ZUTA 3REVB 3AABA 2FWSA 2O6FA 1ZDQA 3BIKA 1YEKH 1CL7I 3N0PB 4N20A 2XWJB 3HFMH 2VO8A 4NBZB 4OZHE 1S3KL 3R4DA 3VXSE 2GBTA 2I07A 4D8PB 4N8VA 5F0LB 5IQLA 5BVPH 1E43A 3RTLA 5K9KA 1QNZL 3KM2A 3FRPB 4KJPD 4UM8A 4NFBA 2IMNA 3CPLA 4G1EB 5GIRB 8FABB 1AY1L 3CZNA 2WQVA 3F7PC 4YWGL 5H2BB 5IF0A 3I6LD 3LEXB 4OF8A 1U36A 2X0WA 3MROA 4F57H 5D5MF 2HCZX 2ESVE 1FZMA 4OCYH 5GJTL 4NGHH 5SWSA 5I6MA 3ARGC 1F4XH 3QJFB 3RAJH 3EYVA 2UZYA 4JFSA 3HZKA 2B8OT 2V7HB 4ZDHB 3X12B 2YJLA 4HZLA 2H6UA 1SJHA 2CKBA 4GBXB 1NH6A 2YPLB 2E27L 5B4MD 4FQCL 4RDQG 1NM4A 2VLRB 2VQTA 4XNYL 5T1LB 3K6OA 2FQGA 4PWEA 5LN4A 4Z3IA 4ONGL 1XIWA 3MNMA 4CSSA 1M4KA 2JB5L 4Z7WA 3RZCA 5I1EH 2RQ8A 1FLRL 3N41F 5F7EL 4KRLB 1BXUA 2X4NA 1ZSHA 3EOTL 4OJFL 2MPVA 6CGTA 1SJEB 5BZXA 5C0DA 2GIYA 4HJTA 4JJHA 1WFTA 2HB0A 2W91A 1N5YL 4JRYB 4LQ1A 1UGNA 3PHOB 2KLRA 1UWXH 5EO9B 4LARL 2ZWSA 3ILDA 4P5TA 5IVXF 3I50H 3IYLW 1JCVA 4PGBB 1NSNH 1A8ZA 1N6VA 1M2OA 2NTFA 3V4PB 2NCEA 4MKTA 2IH1B 2WVVA 2ID5A 3VMNA 1N64L 2R51A 1DVFD 1PY9A 3P02A 4Z7VB 1LEKA 2CK0L 3DVIA 5DJAB 1JHLH 4N0FB 3FAWA 4HZAA 4S2SB 3RVWD 3BAXA 5CJBA 1WFUA 2E4TA 2NNCA 3VFNB 5K93A 3C5ZB 1HS6A 3I9AA 1AKJB 2NT1A 4XOCA 2WOYA 2ATKB 1HEHC 5D71H 1S7XA 3UTQA 1UB6B 4B60A 2Y25A 2BXYA 4F93B 1G6VK 3BUPA 1F97A 1LDSA 3AT9A 1AHWB 2KC0A 5DZAA 1JPSH 4U1SA 2OBGA 4M3KB 4G8EB 4LLDA 3K6DA 3QJXA 5JOFA 1VRSA 4MDJA 1C08B 1DQKA 2R56L 3QJQB 3SBWA 3SY0A 2K3TA 3HEIB 1TQBB 3HC4L 1QSFA 4Z0BH 2JCCA 3D48R 5KSUA 4BA0A 1CU4L 1UFGA 2M2DA 3OB0H 1SM3L 3P0VL 3HE7D 4MB5A 1RK0B 4K4KA 1J5DA 2AABH 1A47A 2EXWD 3W81A 4A6YH 2TSAA 3UO1H 3WLWC 5AWNL 3V5HB 5LGKA 5CBEA 4WTWA 3S35H 3QIUC 2KZBA 2YMXL 1U21A 2BWDA 5FLUA 1DJWA 1AXTH 4M7ZC 4E9VA 3LS5H 5CD5C 3RWFA 2H0FA 1FL3A 4HK3J 1JERA 3AACA 1U95B 2CGZA 4O9HH 4I0CC 1NANI 3LPFA 3O6MH 4BGLA 5BOZG 4Z1PA 3CFUA 4FZEH 3HG2A 1KCVL 5D7KE 3TCXA 3T3MF 4HFUH 4MZIA 5SWQA 2O61B 4X6CF 4ZFOA 5C0CD 1X7SA 4DHLA 1F8TH 4A6YA 3ZKSD 2A6DA 2FIKB 3WS3A 3C8DA 3MRPB 1HSAB 3MN8A 4L4TA 4GSXA 3ZY7A 5MEQA 1BM3L 3IRCA 3NJNA 4QAMB 1U8CB 2QPUA 1U0QA 1P6FA 2R29H 3TIDB 2GC4C 4HF5L 4Z7QE 5HJ3A 2UXFA 2BHFA 1BQUA 2N59A 3IJYA 1N12A 3E8VA 1MF2L 1QUPA 4N6RB 2TAAA 4IHOA 4PPTA 3B2DC 4YC2B 1FYTB 2OYPA 3WDJA 1JG9A 3V0VA 3FCSB 2ZXWB 1PGRB 3C5XA 3FS9A 3APMA 4ENEC 2CBOA 1FZOA 1SY6H 3C5SB 4L9LC 3FFCD 2UUDH 4M1GH 5GGVY 5ID1A 5CEZL 3K7UA 3SDCB 2HAZA 2NDFA 1I1YA 2VDKL 4ODHL 1FGVL 3I75B 1BOYA 2FEJA 3LZPA 4I4WB 1A6ZA 4S1SL 5E2VH 3BUQA 3WIFA 1MI5A 3D33A 5D5MA 5KJRH 2EH7H 3O4LA 5DJYB 4KO7A 5IBTH 3ARGB 3FCTA 2R29A 5IEHB 4LF3A 1F11B 3SY6A 4ALAC 1VERA 2BIOA 1NGQL 4W81A 3ZDXF 2GSIA 4J3TA 2A74A 4LSTL 5FYLE 1B6DA 3BXNB 3OGCB 5KN5B 1ILUA 3WHE1 2AJXL 3BD3A 2VXTL 2KBGA 5L4JA 1HINH 3HS8A 1WIOA 2AMGA 2G9HA 1FNGB 2PTUA 4KTDL 3BESR 1YQVL 1WWBX 2NSMA 4NKMB 1SY6A 3QO0A 5EU4B 4M3JA 3UBXI 5BOPA 2MKLC 1QRNB 2X4QA 5JA9A 1G0DA 5HYJD 4QAWA 4UAOC 4KHTL 4RWYL 1OD9A 1BD2D 2C26A 5GGSA 5HHNA 3LKRA 1TCMA 1EBPA 3GWJA 3R1GL 2AMUA 4Y9GA 3UTTA 3TV3L 1KGIA 1ZVYA 4X9HA 2C9UA 5EN2B 4WJG3 3GMOB 1CFVH 1F0LA 3FQUB 1N67A 4Y4HC 3VFMA 2WJ7A 2FX7L 4FXGC 2AQNA 5AW0B 1PVHA 5K9QG 1URZA 4QHUA 4GG6E 3PDOA 4DAGL 1DBBL 3MNZA 4WK0B 2JLLA 4P5SA 4R4ND 1JGUL 2BINA 5LVEA 4IIQA 4HYTB 3PAYA 4KVCL 4BINA 3LZQA 4K8RC 1JGVL 4Y5XB 5IJDC 3FO1B 3LRLA 1TYJA 3RWCB 4XP4H 1JWSB 1TR7A 2F53B 1FO0H 3EYOA 5M7QA 3WD5H 4I0PD 2ROYA 4HKBB 2VL5A 1S7UB 5JMRA 4AKQA 2FHBA 4GO8A 4RQQA 4GRLC 2VDNL 4MAYC 4PS3A 4Y4KD 1KYOK 5ELIA 5FO2A 1U91A 4HU8A 3ZMRA 1FGNL 3SDXE 4D7BA 1VFOA 2J8HA 3QDMA 3X3GH 3BUYB 3QQXA 3OG4B 4QRSA 2Y6SD 3QXWA 4K3JH 4PRDA 3RIFK 4G6AC 3MACL 5EZIH 5AVWB 3EO9L 2BNQE 4P99A 4AK2A 1E30A 4F8PA 1FFNA 2ZX8A 3KPSD 2IPTL 4XHQA 1GKEA 3JWNE 2C9RA 3WTVA 4GKZA 5GRXG 3SIKA 3VRIA 1UQSA 4HX1A 1OP3K 2E7MA 1FO0A 4ZFZA 5KYYB 1F58H 2P8MA 3QIUB 3IFLL 2AV1A 2GIXA 4HJIA 1AGBB 1UUSA 5I16A 4JZJA 3EJCA 4TUJA 1AZRA 2H0JA 4M7ZB 2AK4A 1XF2B 5FA3A 4UQBA 1AZUA 2F08A 5KVFL 1JUFB 4GG8B 4LU5H 2VGLM 2QTVA 4XCNA 4AYGA 1MRFL 4UIKL 5FHAH 1XGRA 2E7BA 3B5GA 5TQ2H 3RWEB 4XB8A 4AIEA 1USZA 1HOCA 4J4PC 3QZWA 2CMRL 1MCKA 1J8HE 4N2HA 3SPCA 3L1EA 3PV7A 4H26B 5FUCC 1RZGB 3MRDB 4QHLB 2XV6B 2VDLL 1I3GL 3ILPB 3EGXB 2H2SD 4OLYH 4Y1AD 2I69A 3BDYH 4LCWE 5CINL 1OW0C 1L9OA 2CXGA 4X6CA 3NAAH 4ZFGH 2ZKWA 4M3HA 2O5XH 4G1MB 4OCWL 3HJ0A 5SV4A 1V27A 3NESA 3UPCA 3RJDA 2FX9L 3GSNB 5HHXH 4PJIF 2V37A 2ZICA 1YLBB 3K72A 3D25B 3WDHA 4DP2X 1J0ZA 2FK9A 1QWHA 3P0YH 2AJ3A 1RP8A 2XWBA 4I18C 4HJ0D 4OB5H 1AGDB 3P54A 5BMFH 1GIGH 2G5BA 1HH6B 3AXLA 4K2UL 5E8NA 4XO3A 1NLDL 1JFHA 1RUQL 5I2IA 4AQ1A 1CL7H 3TJHD 4AQ8C 5CJQL 4LHUB 2MFNA 4QHNB 1MJJB 4L9LB 1XD1A 4X4ZA 4NNPH 1DFXA 5FOBB 2IFFL 1SNRA 3KXFE 4LVEA 1Q9WA 1GZQA 1Z9SB 5JIIA 1F90L 3F7KA 1MRCL 4HUXA 3S5LA 2WAQA 4WO0A 5FWQA 4XMXA 3G08A 2JJWA 3ZKXC 1K4DB 3JYBA 1CDCA 3QUZD 3SO5A 3KW8A 5KBNC 1NGWA 4YZFF 1TTAA 4DK5A 1DR9A 4KRPC 3V0GA 2C1OA 4LOVA 2KDYA 1HYRC 2VSCA 4NZRL 3H85A 1CFQA 5J9PB 5IIEB 4O02L 4ZJ9A 4HUWB 2JI1A 4JFQB 5KVDL 3EDFA 1KV3A 3FO0L 3WFCL 3VG9C 2DMGA 3PREA 2PWFA 4CMHC 3ASOB 4DKDC 2NYZA 2K6WA 3F01A 3QA3A 3MRMA 2VJ0A 4IGBC 5DRWB 4P2QE 1TYRA 3EYSL 4UAOB 4F2ME 2Z9TA 3BAEH 4MSWA 3O2VH 5D1ZB 3STLB 3V6FA 3UL4A 4D9RE 3REWB 4P5MA 1A9EA 4PG9B 1EHKB 3OGOE 3PWJA 4K7PL 1KLGA 3V0AC 3W39A 2I85A 1DVXA 3FRPG 4FXGB 2BHUA 4FQXA 3QUXC 3O45A 5GHWH 3FXIC 2XA8H 3UJJH 4OAWB 4M93C 4UQ2B 2AZAA 4GKSA 1F3JA 2X4SA 3C75A 4R26L 3NJFA 1TTUA 1QQDA 1S9YB 4JHBA 1NM9A 2EE2A 2O6EA 1YYLL 5ESAB 4NC1C 1S9VB 1ETJA 2PYED 5D55A 4KZDL 4QF1B 3V5KB 2ICWI 1IV8A 5CWSB 5JHMA 2G0KA 4N28A 1RIHH 1JFQL 1UOVA 3ROOB 3BP5A 3ZMNA 1UA3A 4X5XA 3KPNB 4MAYB 3ABZA 4WKZA 1M42A 3C6LD 2WM0A 2XPZA 3V7AE 1JPTL 3I9IA 4NQXB 4YEFA 1C1EL 5TE4L 2FCBA 4HIQA 1RCYA 4Z23A 1F1GA 2NX5D 2VDPH 2ZTBA 2YBGA 3JQOB 3CSFA 4UI2A 3S3SA 1QFOA 1XGTA 2F7RA 3RB7A 1O7VA 2RIKA 3FMGH 3VQ2C 2PTTA 1HNGA 1KT2A 1IKOP 3GO1L 2HJKB 1I8MA 3ILQD 4TRPH 5ETUB 4YHLH 3LQAC 4XX1G 2GAZA 4PJBA 4OBRA 1BPVA 3IS0X 4YHKL 4R5XA 3RA7H 1UB5A 3FONA 1VKXB 3II1A 3KW7A 1JYXA 3NIFF 4N3TA 3RP1A 4NQDE 5DURB 4L0YA 1YYCA 3IS1X 4R7DB 1GOFA 3CK0H 4X7TB 3U7WL 3ULVL 4MA7H 1OGTB 4JM2D 1UH3A 3LTVA 4B9JA 4FHKA 5IB2A 1EAPB 2FD6L 3L54A 2V5RA 3JWDL 6TAAA 3QNXA 2BNRA 4LRNH 3DGGA 3DHUA 4KQ3L 1I1AC 4PJFE 3RVVD 1NANH 3HG1D 1I7TB 2Z8WC 4MNGB 2F7IA 1HSBB 3ATBA 1DVFA 4K7PY 4NM4H 4LO9A 1YPZF 3LRSA 4W68A 2GTWB 1AGEA 4I88A 2NZ1A 5DJ8A 1CG9B 5GSRB 2DLFL 1RZIA 2ZOTA 3H42H 4FYQA 1E7VA 4MXVE 2KHAA 1CURA 4FKHA 5DMGC 3GLZA 3ARSA 3AROA 4PJDE 2WKOA 2AZUA 5EF0A 4C47A 3ZU8A 3U6RB 3P2TA 3W0WD 2J8OA 1RJYB 4QXGL 1Z7JA 4ICXA 1RZJL 4AY0A 4EJ1C 4H13C 3IMSA 4XCYB 4UDTA 4I18B 3HI1A 3CG8A 3O41A 1I9RH 2F1AA 3ZHLA 4CMMB 4NYLB 2IQ9L 2VNCA 5EDSA 3KPRD 5I1GL 2APFA 2QHLA 3PG2A 3IDGA 3MLWH 2Z7YA 1WK0A 4IK7A 4WGKA 1FZKA 1IIIA 1J9RA 3D8MA 2CKBL 3FUEA 2V5YA 5L7XL 3ZE1B 3BI9X 1UJ3A 4RX4A 2QMJA 2WTRA 3WAJA 1M05B 1YEKL 3FTVA 3V0WL 3HFML 3FQNB 4ZQKB 4ANWA 3ZKXB 1NGPH 5CSGA 2WZ0A 4HEPG 5IQMA 2EDBA 3BLBA 4PAZA 1PSKH 3CHSA 5BVPL 4AEHL 2E5EA 2YN3A 1EO7A 1CDHA 1N8ZA 1WAPA 4KRPB 3KJ6H 4JFUA 1H9VA 1ZE3C 1N68A 4QRQB 1BBJA 1A3RH 2NZ9C 5ESQA 4P0DA 3NP3A 4KRNA 1I4FA 4KKPA 3T6ZA 4NGHL 1RD6A 3VG9B 4QPEA 2BRRL 3V95A 1N5AA 5AOMA 1R3JA 4M62L 4CMHB 5L8JB 1U8PA 1T1YA 2FNWA 2PWGA 2MQ0A 4MJ4A 4P2RA 4U1HB 3RIFF 2PLTA 4MB3A 3ZYJA 4GLRI 3RKPA 1ZSDB 3PWPB 4JMXA 5T1KA 3EOYG 4NQCB 4OZGE 5I1EL 1I53A 4G59C 3L4ZA 2MPAH 1L0PA 3I9GL 1BOGA 4YNYB 2LLGA 3IPBA 3EG9A 5DHVB 5IKCA 2VR3A 1OHZA 2C4FU 3BDXA 5IBUB 1TFHA 1RZ7H 4OJEH 2H1XA 3G04B 2J5WA 1UKQA 5LB1A 4RDBA 2M8XA 4GQRA 4N1CA 4N6QA 5CJOH 3UYPB 5EOTA 5ICYB 2AP2A 3I50L 5BV7C 1NSNL 2E9IA 3MRGB 1KY7A 4NCC1 1I8IB 4KV5E 3UBXA 4KKCC 3UGUA 2C34A 3PJSA 4L3ED 5DVMA 5ESVA 3Q1EA 1LK3H 2WXJA 5JOEA 1JHLL 1I1FB 4QJ4B 1WP6A 2FUQA 1OTSD 3WENA 4U1MB 4O58L 2P8PB 2UV3A 4FG4A 4EI0A 1L0QA 1VADA 2CLVA 2DBLL 1BFVH 1RI8A 1UD3A 2W9DH 3IBOA 4DJMA 3LN9A 4FYRA 3P69A 5L2JA 2MCG1 4DP9X 3EHBC 2F68X 5GRZA 2NY5C 1H8NA 2OQJA 3VXUE 4DCQB 2YZ8A 3FTGA 5AVXB 3FB8B 1RPUA 3T0WA 4LSDA 1SMDA 1UT9A 3B7TA 4XPGH 4X6BB 2VXQH 1E9PB 3C9NA 3NA9L 2A6IB 1R24A 2WUCH 2YRBA 5HYJA 5FUCE 1U2CA 2IBBA 4WJKB 4Z7NF 5FO7B 4O51A 3RFRA 4Z0BL 1E40A 1NDTA 2X2HA 3OM3B 1VACB 5E8EB 3ZR6A 1I7ZB 5I17B 1X5GA 3WHXB 4ZFOL 4XP9H 3WKMH 1ITBB 4PYGA 4A6YL 2WO2B 1VFUA 3O6KH 5GJSH 3TYGH 2X05A 2D03H 2KQNA 1H9DA 3W9DA 1ZXQA 2GITA 2QZ5A 3S35L 4CNIA 1I1AB 5IMLA 3LXAA 1X6LA 4L37B 2MHAA 4G9FE 1LEIA 4WWID 3LRKA 4I5BA 3CZLA 1AXTL 4XE0A 3DETC 1FN4B 3LS5L 4OFIA 2VDMH 2VQ4A 3S3BB 5B3JF 5JZ7C 1U6AH 3WKPA 4Z7UF 1GS7A 2VXQA 4L8SA 2FQFA 5JW4N 4Z0XB 4TL5A 3AB0C 2PCFB 2VDOB 1P4IH 2F8IA 4I0PA 1RZPA 1OTUC 2DTSA 2IXQA 4FZEL 4PRPA 3ALWA 2XI9A 2AC0A 1SUHA 2AXWA 4OLXH 3RX5A 1QFPA 1E90A 3IJSB 4HFUL 3JTSB 4N2FA 3OKNB 4BWUA 1S8DA 2GQHA 1F8TL 3DIFB 4OQTH 1HH9B 2E6QA 2W92A 4GRMB 2IWEA 3QFJB 4ZPTA 1TENA 2D4DA 3PUCA 4XCFH 4NKQB 3BWUF 3VM5A 2ZWZA 2R29L 2K45A 1KELL 1KLUB 2H32H 3BKYH 3C60D 1DQVA 3QJHB 2AS5M 2ZCLL 2J8UF 3FSZA 1GYCA 1G4MA 2WHVA 1T4WA 1T04A 1MNNA 3VRLE 3EYQC 4HS6A 2FJSA 1GJWA 4ZTPH 4AL8C 3SB3A 2G5RA 3GNMH 5E8OB 5HDBB 3S96B 4NT6B 3CD4A 4DWHA 4R7XA 1CR9H 4OU3A 1E9OB 3T2QA 4N90E 4KKLC 5LG1A 5C8JA 1SY6L 3HZ3A 4JFPA 3BMVA 4R4FH 2XICA 4JM2F 4M1GL 5D1XE 2OR7A 4S1QH 3FHAA 4LMQI 3T0EE 4PCKA 4RAVA 1DLHB 1WFOA 3UTSD 4Z76B 2IAMA 4P46A 2YAPA 3DBXB 4JJ5A 1OP3H 3P3UA 3VGFA 3FT9A 4XVJH 4OQTA 3K0YA 5E2VL 3GJFB 4PJXB 1LHZA 4LLUA 5KJRL 4C56A 2YFNA 5IBTL 1U8KA 5EZJA 1E3XA 3L3HA 4ZOAA 2H32A 4AGLA 1AXSA 1S7QA 1CZ8H 2XWRA 3D50A 3IJHA 1PZBA 4WY7H 1QEWB 3ERXA 5B7MA 4MNQD 1FL5A 3Q6FB 2IEPA 1AOHA 4HDIB 3CFDB 3RKDD 4DIXA 4FHBD 4R3SB 4NSKA 4J39A 1VZIA 4P23A 5HHOE 1SF3A 3B1UA 2XRAH 1IAKA 2BOCB 2NRDA 2Y06L 2YZ1A 4KKRA 4LHUG 4CN1A 5IUSA 3ULUF 1UG9A 5HD8D 4JFWA 3U1QA 4JFOB 3UIZA 5DFVC 4U0RB 1JE6A 3MKGA 4M7KL 4X4XB 4AIXA 3TYFB 4L29B 3IJ9A 1OM9A 3IFPB 5DMKB 3GMMB 1IC4H 5K9OA 1HHJB 1CFVL 2Y7QA 5AVVB 2OK0H 4WWNA 3HRZC 1PEZA 2HN7B 5AOLA 1UWGL 4PN6A 3D2UA 4AX3A 5BV7B 5H8DA 1XTLA 3IDYC 5GZNC 2ED8A 2V7NB 2H8PA 1KC5H 1CGWA 2D3JA 3GEWB 2IPKB 3MGOA 2Y2WA 3MOQA 1NAMH 3LKQB 1A9BB 5CSBA 2V2TB 4Y16B 5DJ6A 4PMFA 4F1SA 5KYWB 5LAXA 3CWGA 3UADA 1PY0A 1TCRB 4XP4L 5FO8B 4IBYA 4MRCA 2IBZX 4M7LL 4D0DA 1FO0L 4X6DA 1LQBC 3IKCB 3DUUB 4IMKA 3HS9A 4CAGA 1JI2A 3ZT6A 5IOPA 4HSCX 3MV7E 3RNKA 5T5FH 3EHBB 3V9FA 1NINA 3D18B 4F8NA 4W9HC 2BFGA 2M1KA 4YDMA 5F1IB 2EDEA 3WGUB 1IEBB 2FT8A 3D7PA 1EEYA 3SDAA 1KLFA 1SJMA 4DGVH 3LN4A 3II3A 4IDJL 3QZOA 2AEQL 3JVGA 2CALA 3R06B 3UG3A 5EZIL 4OT1H 5IJKA 2BVQA 2ICWA 4N2CA 1WBXB 5F7BA 3D0AA 2OV0A 4OD2A 4FYSA 1KBPA 2CRMA 3OKDA 4AWJC 3QI9D 4YDLC 2D7PA 4J3VA 4NJAL 3U4KA 2RA1A 4TTDC 2FR4B 2PP7A 4FC3E 5D6DC 3AM8A 1W6WA 4EZKA 2F0CA 2QKSA 2VLKA 1F58L 1J8SA 5MEOB 4OV5A 1N8OE 5T5FA 4Z77A 4KMQA 3RFZC 2TRHA 2ATPA 4NRXB 5A40E 4BUHA 1UD2A 2LTQC 4E2OA 5DZNA 5ISZA 3MV8B 1KYUA 4LU5L 5CR8A 2VN6A 4FNQA 4W9IC 4MVBD 5FHAL 3AB0B 5TQ2L 1YUHB 1TNNA 2N3JA 1LWRA 3K80A 2EIZA 1X7TA 4LAQH 4NO3B 4OI8A 3DPDA 4NPJA 1JF1B 2W07B 3C6LA 3VXPA 4IQHA 1XSIA 2A9ML 1RK7A 4HG4J 5BCAA 5BZZA 1AQDB 4OLYL 5IMKA 1HL8A 5CEYB 4OZIB 4LVNB 3NAAL 3MRRB 1TZIB 5GSVB 4ZFGL 3RUGF 3BAIA 5IMOA 3MXVH 1KN4H 3L4UA 5G55A 4F8OA 1WC7B 3QUKA 2CE6A 5EPMB 1T3FB 2Y7SA 5HHXL 3OJ2C 3CDGA 2A0LD 1SDDA 1QBMH 2RB8A 3QORA 5E03A 1UT1A 4FERA 1ID2A 1KYFA 4OM0L 5BS0D 1GIGL 2B15A 5C0RH 2HMID 1UWYA 3GM8A 1AD0A 2MCPH 1CL7L 3QWRD 1F5WA 1KJVA 4NO0A 4J3OD 3KLQA 5C0BB 1PQZA 1V3MA 3S3PA 5J6HB 4NNPL 2R1YA 3ULUH 4QRFA 5L2KE 3PWUA 4BFEA 4WI0A 4FKKA 1IBBA 1G7JB 3I2CH 5I8KH 2VISB 4G82A 4ZX3A 1T1XB 1A1MA 4DTGH 1SHXA 3HE6C 4LLMA 2EDQA 3P77A 1A2YA 3N6YA 3QO1A 3IN0A 4XN8A 3VTTA 4GEJA 4YBQD 1ZLDA 2E3VA 5HYFA 2XN9E 1N4XL 5FIEA 4LKCA 2YK1H 1J05B 3CFCH 4N25A 1Z9MA 3QWQB 3OXRA 2GK2A 1AE6H 2EDKA 1WGVA 1GC1L 4UDUB 3VXNB 2L7JA 5IROA 1JMXA 1MHCB 2BVPA 4WAFA 5CN3A 3VQ1C 4GLRH 2PN5A 4MJIB 2F6AA 1VJSA 5HI3D 3VQLA 1HIMH 2ZQKA 3HPLB 1BWMA 2XWJA 1IUZA 3COOA 3SQRA 5M94B 3DUSA 4HMCA 5CMAB 2OR8A 3FT0A 3W0WA 3ZQWA 4D8PA 2JI2A 4U1LB 2BMKB 3FRPA 3BAEL 2DN7A 1BF8A 1JSYA 1K4CB 1T21B 5GIRA 1LL1A 3L2NA 8FABA 2UYLA 5H2BA 2NY6B 3LEXA 1WE5A 2YUXA 3KPRA 3TJEL 2Q6WB 1NDGB 4GKOA 2AJZB 3HRZB 3APDA 3VD5A 5AZUA 1DHKA 2HVBA 1IGYA 3QJSB 5GHWL 4FEIA 3SKNA 4I85A 3UJJL 1KACB 4ZDHA 5A2IH 4GBXA 3MBXL 2VLRA 4G8GD 5H94B 1FL6B 2CD0A 3NIDF 4YX2L 1JL8A 2EE3A 1OAUH 2WXNA 3O0LA 1JK9B 3VWKD 1JN6B 2ICCA 1S7SB 2H0EA 2E7LA 4AYEC 2V17H 3MOAL 4XWOD 1EEZB 3DYPA 3VYPA 4FNSA 4IJTA 3OQ3B 1SJEA 2GJ6B 3DO7B 4KZEH 1E8ZA 5AENA 3G6AB 2WINB 2ZX5A 4X4YB 4PJAF 5JW4Q 3IRPX 4EMZA 1CFBA 3PHOA 2DBJA 3ARDC 2R8SL 1T83C 4XVSH 2C3VB 2HTLD 2J1KA 2VDPL 5C0GB 5J1SC 4W6YB 5FYKE 4PGBA 4LKXB 4MXQC 5HI5C 5IBUG 3QDJE 4NDMB 3VAEA 4MAUH 3VXQB 4LPVA 3I74A 3O8XC 2NY3D 1GGIH 3KZ8A 1ZLEA 2FL5B 2BSBA 4TRPL 4S11A 5DJAA 2GW5A 4N0FA 4S2SA 1T2QL 1GTFA 1DVYA 5FFLA 4IEFB 4UOJA 4PUBH 4QT5A 1T7XA 4XHJD 1X3DA 5F2FA 2DI7A 3GKZA 3K4DA 4JN2A 2FWOB 4ZXBB 3QDAA 1IM3A 1CGXA 3CK0L 2R2EB 3SDDD 3RFZB 3W11D 4OCSH 4WNQB 3WLBA 2LTQB 3VD7A 3EFFB 3OSVA 3QXAA 4YHIB 4BIKA 3DXAB 3DURB 1HKLH 4G8EA 4MJJA 4G6JH 3K71A 1ICTA 3OLIA 4JRLA 4PRHE 4BHUI 1OSZB 2NQCA 2ZNXA 3LD8C 3D3VE 3F5WB 1W72B 4NPYB 3PQYE 4EIZC 3E80A 3MKKA 4A38A 2OULB 1RK0A 5D4JA 4LPXA 3BD4A 3LVTA 4Y1SA 2R2BA 1J8KA 4GT0A 2IFGA 3T2LA 1GYAA 3TEZA 4J3XA 1ZEAH 4QWWD 2FWUA 2VUYA 2JK5A 3OKOB 3HG5A 4FD0A 2JKXA 3TGXA 3K1KC 5LBSH 2K9FB 1OPOA 1TIUA 3HC3H 4PIRF 4TNFA 1FQ9C 1BFOB 1ZV2A 2YD0A 2DD8H 3B2UC 1QVOB 1JHTB 2G4EA 4P9ML 1I9RL 2JKRM 2D7TL 3FRUB 2R9HC 3ZDZF 2J71A 2BOLA 2GHZA 4LCCA 3BPOC 3ZO9A 3GXFA 4L1DA 1MIMH 1QACA 2R0LL 3V6BR 1RXLA 4G8AC 3NIGB 1HNFA 2OJZH 4HEPA 3S4SB 3SGKA 3MV01 1D9KC 2Y7NA 4Y9CA 4ODVL 4TF4A 3GTVA 1F4YH 4OZHB 4KJYB 3S7GA 4HBCL 5I1IH 3D1MC 1NGPL 3IDIB 4JFED 4DQOH 2FIKA 1PSKL 1BJ8A 2FJGB 3MRNA 3MRPA 4C59B 4FF9A 1UZ6E 4NJ9H 4AGNA 2ZP8A 4XBMA 5TDNA 5D72H 2OTWB 3LZOA 3TIDA 3BKJH 1A3RL 4XNBA 2B9BA 4QTHB 2OXHB 2W5PA 1Q90A 2ESVB 4OKVB 2CO2A 2DMCA 3V0EA 2MJWA 5L0QB 5AL0A 3JV5A 1G9MH 3C6EA 1FYTA 1CICD 3ULAB 3DRQB 3FULA 4YUEL 4FQ1H 4DERA 4DFHA 1WUNT 4OGAC 3C5SA 4PJEE 3LKNA 2WW8A 5IP4A 1VZGA 2YUVA 5T3XL 3DK0A 4L4VD 2ZUWA 2K8QA 5D2LE 3SDCA 3WFZA 4F2FA 5DUBB 1OP9A 1TTRA 1UOKA 4TNWK 3I75A 3QJTB 3WO4C 2JIXB 3DOSB 5IB3B 4KJQD 1MHPH 4G8IA 2MPAL 4BD4A 4JCMA 4JQXA 1OCZB 3GSRB 5FM5M 3ARGA 4WWPA 2L04A 4H8HA 5IEHA 4TPRH 2D73A 1GH7A 2Y7OA 1Q9LB 4W93A 5AW9B 2YIHA 4DO5A 1IKFL 2PETA 3F04A 3Q0HA 4P48A 3VCLA 2OX5B 3BXNA 3OGCA 4GH7B 5KN5A 4J3OF 4JFVA 4RZCA 4YIQA 1Z9NA 1IC5H 3PU7A 3CMGA 3IMWA 1FNGA 3UTSA 1THAA 5ENWB 1QWNA 1LTXA 3LXBA 5E99H 3K5SA 2VQ1A 2YOAA 4JDZA 1QRNA 3IXAA 4PP2A 2UX7A 3RLSA 1LK3L 1CDGA 1NICA 3Q05A 4JB9H 2ZOWA 3SYAA 4EKJA 2ZXCA 2PXYD 4PJGE 2WLMA 2GJRA 4RVBA 1TEFA 3ARDB 3QZBA 4L8DA 1BFVL 2W9DL 4MNQA 3MMEB 4FNRA 4U4BA 5LJYH 4UQ3B 2GSGB 3ZZQA 4PIBA 3H54A 2WK2A 3QR0A 4P9HH 2CHXA 3LZRA 5E6IB 3O8XB 4LBAA 2HLAB 4X99A 2FDBP 4XPGL 1N70A 2VXQL 2WUCL 5DO2C 1DBJH 4Y5XA 1JAEA 3FO1A 5EWIH 2AKRA 1AQMA 1T66C 4QRRB 2F53A 3QUGA 1PJ9A 2DQUH 3QJUB 4HKBA 3ZE0B 1S4IA 3GJFK 2HT2C 4JFHE 4FABL 4OSUH 4IKKA 1F2QA 4XP9L 3WKML 3SKOB 4GP5B 4NO2B 4RGNC 3O6KL 5GJSL 1QX1A 3TYGL 2YQBA 2D03L 5F9JB 3BUYA 2HFFB 4EQ2A 1BLNB 2F2HA 5H4YA 1T22A 1ZA6A 4WWOA 5E2WH 1ZV9A 3RI5F 4IOIB 5ERWA 4XVUD 1DO5A 4APQA 2EVJA 4MYPA 3A0OA 2X6MA 1E27B 2VDML 4OI9A 2RJMA 4K5NA 2J44A 3HG4A 4B50A 5TPWH 2QQKH 1TXKA 2WP3O 1WTGT 5DS2A 2D0FA 3OF6D 1P4IL 4Y0GA 4NZDA 2PABA 3C08L 4ONHB 3NDZE 5LDSA 5DC9B 1BZOA 3ATDA 1JTPA 3QR2A 4GT7A 1ZA3B 1AGBA 4GP4B 3EBAA 3TESA 2O26U 1SBBA 3ZDYB 1Q8MA 4HFWB 4OQTL 4F2EA 5FGCB 4JR9H 1JUFA 4GG8A 4XCFL 1HXYB 3PWVA 3FO2B 4Z7QB 5LWYH 4MA3B 1BZEA 2Y7LA 1FZJA 3BKYL 3L5WB 4UTBH 3RWEA 1J18A 3IT8D 2C8NA 4NN5C 1S7RB 1Q9KA 1ONQB 5IVOA 3CZFB 3HB3D 2JKIS 2CSPA 5C0EB 3WI9A 3MRDA 1MY5A 4A68A 3GNML 4WI4A 5JPNA 5GGRB 3QHFH 2AAAA 3MJ7A 5JIMA 3L08A 1OALA 1KCUH 2ZUYA 5FDYA 2D3VA 2P80D 3NCXA 4R4FL 2OA9A 2VMDA 4U2ZA 1HZHH 5IGXH 1KEMH 1DLFL 4AJ0A 3INUL 3RWDB 2CJSA 2AQTA 1X5KA 4BBWA 4YZWA 5DLMH 4ZSOE 4GKNB 4OZ4B 4X6EB 3WKNA 3WUWA 4N2NA 3MLXL 4KK9D 3U46A 3HMWH 1P5UC 3QS3A 3K4AA 1OT4A 1UJTA 4JM4L 4LCYA 2CRYA 2GJZA 1ZJBA 3IDMB 4J3OH 1LMIA 2CIKB 3WL9B 3FL7A 1BXXA 4UTBA 4HU2A 1CDIA 3DARA 2BSSB 2FHCA 3LNDA 2J6EA 3MFGB 1MJJA 2P24B 4L9LA 5C08E 5AW1B 3FQWA 1F00I 4G7RB 1Z9SA 3OXSA 1NFDA 2VN4A 3WO4B 2G75B 4Z3FA 3OKKA 3M1BB 4KHXH 2XTLA 1L9MA 1ZANL 3N3EA 3AT0A 4AT6B 1OLLA 5BS0A 4ADIA 1IC4L 2QPDB 4AVIA 2CA3A 2YC1B 3RGVD 5GXBB 1WICA 2D7NA 4EE2A 4GI9A 3TBSA 1C8QA 2OK0L 5EOCJ 1OV8A 3WHE0 4DP1X 4HUWA 2NY1D 5IW3A 3SE9H 4F7CB 1BG1A 4NQQA 1I8AA 2VOTA 3OR7B 1PYWB 4YSQA 2JKWA 1KC5L 3HUJF 3LIZH 3IAGC 3CSYB 2VDQB 3D0VB 3KLLA 2IJ0C 4D0CB 5DEZA 1LEGB 2NY4D 3BRGC 2WNWA 4RWHA 5D1ZA 4XPAH 1U8IA 5DEGB 3STLA 4ODBD 3REWA 3BVNB 4PG9A 5IVXE 1DEEB 4G72B 1G1YA 5EU5A 4ZS7L 4M1DH 4BEIA 4NRYA 3ORJA 5IQNA 3IB4A 4MQXD 4QHMB 5EU7E 5FX3A 1XZWA 1G0XA 2W65B 1U4EA 3CXHK 4OJCA 4HWBH 4UQ2A 4QRUB 1NCOA 3B6SB 3TO4B 1ADQL 3VNYA 1M7UA 5A2BA 5B3SB 1J5OH 2ZYSA 1CDUA 5I26A 1J9TA 1YUKB 1XAKA 1ZHKB 4DGVL 1JK8A 2XQBH 1RJZA 1S9YA 4PB0H 1TJGH 2DF3A 1M6UA 3NABH 3QEQA 4KXCA 5ESAA 5M95B 1S9VA 5SWZE 4FQHB 5D7IF 4WO4B 3H2QA 3LIZA 1DANU 5I8OL 1DQJB 3V5KA 5KBPA 3VXTB 4MZ3A 4JG1H 1IGTB 1X44A 2YUZA 4WW2C 4YS4A 2FATH 4MAYA 3ETBF 1C7SA 4QHKI 4BQ9A 2YPVH 4YFDB 4RGNB 1QTPA 5IJBC 1AGCB 4HOXA 5KVGE 4NQXA 4R96B 3U48A 3WY1A 4XNXH 2P9RA 5A16A 5ACZB 2QQLH 3D39D 2E9JA 4F9PA 2DWEB 3MBEC 2P26A 3EJSA 4AZUA 4HWBA 4D7PA 5BRZD 2WYTA 1O6SB 4D9QD 1D3CA 3L7EA 4KNQA 3VWKA 4U6HB 3HN8A 1EQWA 3BVUA 3MSPA 3LMJL 4WU5A 4UQAA 5ETUA 3PL6A 3O81A 5HYQA 3US9A 1J8HB 3DJTA 2BRQA 4QYOA 3VI4E 1VKXA 2ZYIA 2IWGA 4AV4A 3K5RA 1QFWI 5KOMC 5F6HI 3VB9A 4BFIA 1OARH 3ZTCC 4AI7A 4X7TA 4P8QA 2YPVA 5INDA 4M1CD 3KGUA 4PJ9D 3V0HA 4YQXL 2CIIB 1HL4A 4M6AA 1A6TB 1YEWA 2DJMA 2J20A 3WXVH 1KN4L 2X44D 5E8DH 7TAAA 4JUSA 2OMWA 1OSYA 1V5JA 4BHUA 1I7TA 4PCTA 3WEAA 3B9KA 2HG0A 3DJZA 3E6HB 3T3ME 1E5YA 1AHMA 1Q9OA 4BXSV 1OWWA 2IDUA 2F54B 2Y69B 5FR3A 3UO8B 4H0LC 4QOKD 4ZX6A 2BY1A 4HKJB 1UATA 3LNEA 2E59A 5C0RL 2H26A 3CQQA 1AZCA 4N26A 5DUMH 1OW0A 2Z34A 5C3LD 4UQ9A 4WI8A 3DV4A 1KN2H 1S3RA 2A7BA 3KXFB 3UAAA 2XJKA 3U9PH 3VXMB 2FLRT 4APXB 3OR6B 2NY0B 3ULUL 3T4YA 5I8KL 3QG6A 3U6RA 4BZYA 4EI5D 5KBLA 1KMGA 2Z1PA 2BWIA 1CDBA 2FLMA 4JO4L 1HJBC 4A2FA 1NFAA 5FGBC 1EJ8A 1P5UB 2VCOA 4XCYA 5IQ7H 4GIPD 4I18A 3UAJC 2HP4A 4CMMA 4NI6A 4NYLA 3PHSA 2DYRB 2YK1L 3CFCL 1BXVA 1T2JA 2XBZA 4GFTB 1IL1B 4WFED 3ZOAA 1AE6L 4E41E 4NN6C 5E23A 1CIDA 4PJCF 4JLRB 4DT2A 5LXGL 2G2RB 5EIQA 3DTXB 4G6FB 2WXIA 5EUOB 1ZHBB 1HIML 4OGQC 4OVUA 1BVZA 3LEYL 4ZQKA 3EDJA 4GKLA 4E9TA 1DJXA 3KCWA 3S4SG 1AR1D 3ZDXE 1QLFB 4F2MB 4GXVL 1RZKC 1A8JH 5FWRA 4IJ3C 4CU6A 3ZE2F 3FN3A 3KHOA 5D7SH 3F58H 4QRQA 3TPUB 3ZQ9A 1EFXD 2Q86B 1EZSA 3VE0A 1XMWA 3MRFA 3IAPA 2OKMA 4FMKA 2WSPA 4U1HA 3BGMA 3QS2A 3V4PL 5J57B 1ZSDA 4EN2A 4HJGB 5C09E 3PWPA 2CCWA 4ADJA 4AZ8A 1E5ZA 3FTSA 4XTRC 4BELD 3FOMB 2B59A 2V17L 4Q6IC 3LS4L 1OGPA 5AD0B 1Y6MR 4HIJB 3E8UH 2J73A 4V1DB 5MENE 1SN0A 3FZUD 3GB7B 5DHVA 1DQML 5E1GA 4DK6A 4Z9KB 2EADA 3B56A 5IFHH 2YXMA 2ZKMX 3O3BB 5EF3A 4KZEL 3LHPL 3N91A 3FB7A 3VACA 4AMKL 1AO7E 5I15L 1A6VL 2ITCA 2FRGP 1PD0A 4HV8A 4HHAB 3N2JA 3DNKA 3I6LE 5L9DH 5ICYA 1CXEA 3BVDB 2X6AA 2X70A 3N9GH 4U6YB 5D7IA 4MAUL 3V6ZB 3O3AB 1HTYA 2ICEA 4MD5A 1DJHA 1PLBA 4RRPG 3X1NA 4NFCA 4WW2B 2QKIA 4FDWA 4MZRA 4EVNA 3L5HA 4XP1H 1UXSB 3H4HA 4NB7A 4TSAH 4PUBL 4D2NA 5BJTB 5D7LA 4XO9A 1DQIA 2VRKA 1DUZA 4RFOH 4WHYH 3MBEB 5EZOH 3LV3B 3DDFA 2VDRB 7PAZA 4W4OC 4O4YH 3OAUH 2YEZB 4OCSL 5GGQH 5FEBA 4N0RA 1YAZA 2VZTA 4WSGA 3FB8A 3DX1A 2ICES 3H9ZA 1HKLL 1ROWA 4G6JL 4KVPA 1G7PB 3HR6A 3U6XA 4FLOA 4X80H 2DYPB 3IE4A 4K71C 4PGDB 3SJVD 4JKPH 1HDMB 2XT1B 3UPRA 4OCLC 3MRKB 1L9RA 3V9EA 5I0DA 3NACH 4MNHB 1FLTX 3G3LA 3X11B 5I17A 4PJHB 3ARBA 1HILB 5G5DA 3KLKA 2GTZB 3NCBB 3ARRA 4TOYL 2W60B 4YPJA 1GS8A 4PLNC 5FM4A 5F3BA 4XGZA 3K6SA 3MRQB 4WK2B 4NERA 1I1AA 4F92B 4M03A 3KR3H 2VXVL 1S7WB 2FEEL 4M8QB 1LXMA 5T3ZH 3V6OE 3FU0A 5ACLA 2DD8L 3L9RB 3BVTA 1M7XA 3PDGA 5I8CB 3W2DH 4W9FC 4Z0XA 2X1QA 2PCFA 3P40A 2OJZL 4S0SD 1WEJH 4PJIE 3SO3C 3IBEA 4Q9BA 4HIIB 2EXTA 1NCIA 2NXZC 5LO7A 4JJOA 3RU8L 4TUKH 1K8IB 2HFEA 2P52A 3OKNA 5DD3H 1QSEA 5JHAA 5DK2A 4F8TA 4DQOL 3GJFH 1T0MA 5E24E 3MLVH 3LJ3A 5FCSH 4LT7A 4NJ9L 1YJDH 4QXTB 3ECBB 5KSVA 4CU7A 3BKJL 1KLUA 4NN6B 5CFHA 4C58B 3WY2A 4PJCA 2R7EB 3D09A 3QQDB 1CI3M 1M71A 2W95A 4QRPE 4XN9A 1X5ZA 5KS9E 1Q94B 1G9ML 1YEEL 4ORZC 2QSVA 4F8QA 5E8OA 5LAPA 5JQ6H 4NT6A 3QSKB 4YZFE 3LB6C 4L9DA 4FQ1L 1E9OA 1YNLL 5B8CC 3CVCA 2CLRA 2VN7A 4DPBX 3JV4A 1T6BX 3WSQL 4C57C 3UACA 4NNYB 5FUZH 1DLHA 4Z76A 5A2KH 1OCOB 1FDLH 2BWQA 5T1MB 4QDGA 4PRIE 3FUFA 4MMYB 4P2OB 4JUTA 3GJFA 1VGEH 4PJXA 2A83A 5D4QA 1USQA 4AUYA 5JDSA 4OLZH 2QGCA 4Y2DC 5C0CE 3T0BA 3AADB 1EXGA 4GW4A 4TPRL 2EDDA 2XXGA 3U4EA 2CPUA 4BA8A 4YHPB 1RLBA 3N55A 4KK6D 1NCWH 4FQLH 1XHHA 1OAJA 5EC1B 5J3HC 1MFCH 4WFFE 2P44B 2FO1A 3BN3B 2K7QA 2EIEA 3Q6FA 4ODXB 2VLJE 4TL4A 2IANB 3D85B 1W0WB 1IM9B 1GMEA 1U2YA 5E99L 3V2AR 5DMIH 4PS4H 4AC2A 3V5DA 4EI6B 1DQTA 3BW9A 4JFOA 3CBRA 1EUUA 2MOVA 5D2NA 3T65A 2QL1A 2LAAA 2N7BA 4Q2ZB 4JB9L 4L5FL 3FFCE 2MKWA 3IFPA 4TULH 5AVRB 1H3TA 1XL4A 2VITB 4G9DA 3BLPX 1HHJA 5CHNA 1X5FA 4XXWA 1NWOA 4EOWH 3ES6B 1SBSH 2QFRA 3TONA 4AQAA 4R2GC 4BFGA 3IU3B 1SOXA 2V7NA 1MFAH 4P9HL 5ANMB 4ELMA 1FHGA 1UHVA 2IPKA 2A4ZA 2YD3A 2V2TA 4YHNA 4MASA 3MJWA 4Y16A 3SGJC 1SEBA 5J6GB 3TZVD 2C4FT 1DBJL 4Q74A 4X7SH 4YK4C 4DAGH 3IDNB 4CVXB 2BY3A 5EWIL 3UG4A 3MAWA 5E51A 2XA3A 2L3BA 4M56A 5EBLB 1MFEH 3DUUA 4NNXB 5I75C 2HRPH 2CGYA 4PRBB 5CGBA 1KFAH 2YS4A 3FT2B 4AMWA 3NPSC 4H1LB 4IDLA 1FORH 5F1IA 3DVNB 3ETBJ 3G5YB 1IEBA 1BD2E 3Q8FA 1FE8H 3QXUA 4J2QA 4FP8H 4YSTA 3FT4A 3W57A 3NN8B 1OOWA 1IRAY 2SEBA 3NIFE 4HT1H 4X8XA 4FGMA 2ADFL 4K71B 3WN5B 5D7JA 1F56A 1N3NB 1DN0B 1TZHB 4KZCA 1QFWH 3VJ6B 3KYKH 5ECJE 5TPWL 3A4EA 4IBSA 1JDAA 3NCYP 4I2XE 2FR4A 3JUYA 2H1PL 3FCBA 3N1FC 1LJMA 4IKLA 3U9WA 1KTDA 2YPLD 3TLRA 3KL0A 2F7QA 1MNUL 1X5LA 3HG0A 1S9KC 5T1LD 4KKBD 4DUXA 1NCJA 3NCFB 3QULB 5MEOA 1MXDA 1YNTF 1YPZE 3PE9A 2DLIA 4FXTA 3ZT5A 2QPEB 4IOFC 4NRXA 1C8PA 4EN3C 2LU7A 4JR9L 4YDVB 1EJOH 2XXCB 2NUTA 4EXKA 5I6PA 5LWYL 3VW3H 1JRHI 2IIJA 4RBPK 4I87A 5KG9B 3O2WH 4IU3A 2FJFA 4UTBL 4I3GA 5AYUH 1MZZA 4HIXL 2J6EL 2IQAB 3SO3B 1R3KA 4BFFA 3U36A 1CGSH 2V5TA 1KJMA 1JF1A 1Q0XH 2CR0A 2W07A 2GVYA 2XWDA 2NXZB 4ZUUA 1ZD6A 4OF6A 43CAB 4XAWH 4ENZA 3PJNA 1AQDA 1CFTA 1K85A 4OY9A 4BH7B 4OZIA 3GUTB 2DIEA 1KCUL 3DHPA 3MRRA 2V9QA 5GSVA 1BVNP 1T0PB 1HZHL 5IGXL 4MXWL 3KCPB 1BVKB 1A3ZA 5DJXA 4N0UE 1HYSD 3SBPA 4ALAL 1RHHB 3MREA 4URTB 5DLML 4F7TA 1LP9B 4C55A 3WJJC 3IXTB 5JORA 2Q86A 3HMWL 1OAQH 3CFJB 3VD9A 3A5VA 3L81A 5I66A 2KLTA 2H2PD 1E0OB 4PEEA 4YSAA 4LE8A 5IHHA 2LGNA 5KBKA 5IQ9B 2JQAA 1HEZB 1DSYA 4KNTA 1MFNA 1BJ1J 5AAPA 1U8MA 5C0FB 3S8GB 3FBQA 5I8EA 3NH7H 4A55A 1GMIA 3PIQB 5HHOB 1KUMA 1QD0A 3JZ7A 2EDNA 5FM5O 2GHWB 3ISYA 3T4AC 4C4BA 1MUJA 3I3EA 3OZ9H 4F5CA 2EDYA 5IV2A 4OFPA 4Y1AE 4R84A 4Y2DB 1O75A 3MYJB 2LW3A 1J05A 2DMBA 1U92A 4NZUL 1OGSA 5DYOB 2WXGA 1CXKA 4UDUA 3K6FA 3VXNA 1XVSA 2XXFA 2WXLA 1VLXA 4GUOA 5E5UB 2DAVA 1UACL 3SE9L 3LXUX 1CLCA 4N2EA 4YAQB 3C6SA 1UD4A 3GLAA 3A67H 5I1CL 1NDMA 3HPLA 3T77B 1MOEA 2DMKA 2PW1B 5H37G 3LIZL 1OGAA 2P5WA 1BQHB 3EJUA 2Q8BH 5EF2A 3CDZB 4W70A 4XPAL 1T21A 4MA1C 3KH4A 2BNQD 3PXHA 4FEMA 2R2CA 1H8OA 4LNVA 4AJWA 3EXLA 4LEXH 4P5KB 1TTFA 4JKLA 2YAFA 1PX4A 4KVNL 3WTXA 2E74C 2AJZA 2JJSA 4R2GB 1OCWH 5B1JC 4E36A 2BP0B 2DQHH 4NO5B 1QW8A 4PBDA 4KFMA 2D7MA 3DPBA 5TH2B 2BNUB 3B3BA 3FTXA 4YO0B 1HI6A 3FDWA 2X1PA 1G7IA 4NKDB 4BK5C 1J5OL 4M6OH 3FB5B 1PG7X 2XQBL 4J5VA 5D1QC 1TJGL 3NABL 1NJ9B 5E1AA 5AVTB 1OKEA 2PCPA 3AS0A 3HAEB 1U93A 2VRQA 1ACYH 1JK9A 1BZ8A 1NBQA 3L3KB 1S7SA 4HS3A 4I48A 4WSJA 1P7KB 5JXEC 4PI2A 1EEZA 4G11A 3MOBL 5ICZB 1EFXA 5I75B 5J0BA 4MKMA 2GJ6A 2FATL 2G9KA 4PB9H 5TDPB 2YPVL 3H9SB 3THMH 3FHQA 1QLEH 3NPSB 3G6AA 1JPGB 3VFRA 1BREA 1WFJA 4LCWD 1BIIB 3OMZA 4H0GA 4XNXL 1J0KA 1P4BH 2FYVA 1VCBC 2ZG1A 2C3VA 4UTCA 1CQYA 4Y4FC 2ZXDA 1CLVA 1A5FH 4NDMA 3TC9A 3ZLQC 4XC3H 1P2CB 2R4RL 2V9TA 4L0ZA 5C0JA 1RP9A 3QDGA 4K07A 3D4ZA 2BW4A 1EK3A 2FSDA 2A77H 1HQRB 5E00A 3MR9B 3QEUA 1XCQB 1SLUA 4I77H 3UTZA 4EUPB 5KJ4A 1OARL 4GXUM 1R3IL 4ZXBA 3AAZB 4Z7UE 1AP2B 4ZMPA 1XH0A 1EZUA 4EN3B 2NOYA 4LLWB 4WNQA 4FZ8H 3MRLB 3EFFA 4YHIA 1XMEB 2EH8H 3QEHB 1XB3A 5JYLA 4GQ9H 5E0QA 1DUYB 1A6UL 4BQCA 3B7SA 3X1EA 3QIBB 1OSZA 2CJUL 3F5WA 4UQIM 1SXNA 2QPFA 5KSAD 3DSNB 2ZX6A 3S9DB 1IE5A 2NX5E 4NPYA 5C6WH 1U3NA 1QHPA 2FUTA 4PLOB 3KL3A 5DTFA 2OMXA 1I7UB 1CIUA 4HXBH 1J7VR 1Z5LB 5AVZB 3TBVB 1NCDH 1J88A 2WNXA 1KN2L 3FQTA 3U9PL 2J8UE 1EO5A 2XPGA 3BIBX 2P5PA 4AW7A 1OD7A 2YAMA 2APSA 1TQCC 4Z3JA 4N8CH 5I23A 1RUML 1JZIA 3BN9C 1T6VN 5LG6A 2IBZY 2W81C 1BFOA 3SDYH 5IQ7L 2VO5A 3H3KA 4Z6AT 3UGXA 1OM3H 2X0VA 2X53A 2Z4QB 1F6AA 2VDLB 4AIZB 4LCIH 2I32A 3UTPE 1YMME 5CEZE 4JFDD 1XH3B 3Q44A 3F6IA 2P42B 4JRXE 4XZUA 3EJJX 4RNRB 1I8UA 3CFEB 2ZAGA 3HG1E 5KWYC 3OKYA 1EAJA 5IM7B 2QGBA 4RA3A 5BPPA 4OZHA 3BH8A 1KGCD 3VXSA 1NBZB 5JHDE 3B5HA 3MPCA 1RZJC 3IDIA 5JOPE 1G1KA 2JQZA 1TJMA 3MBWB 2OTWA 1RIVH 3F58L 3NBNA 4AG4H 1MW1A 1VFBA 3UP6A 1FNLA 3N85H 2ESVA 4EDWH 2FVNA 3WLWD 2QEJA 2QPSA 5K9JH 3QIUD 3BVWA 3W3BA 3PCYA 4NKIL 3QWOB 1FCGA 1I75A 1XIWC 5EG6C 4AK1A 1N19A 1JPFB 1Z0NA 3RZCC 5JR1H 5CD5D 1KXTB 3PV6B 3KYNB 5AG9A 4UZGA 1S46A 4W9ZA 3VI3B 5GGTH 2FTAA 4LXFA 3L4TA 5D4IA 1EUTA 1A1NA 4MA1B 5DUBA 4PJ7B 4PY7A 1B6UA 5IHUH 4JY4B 1L5GB 4PGEA 5IB3A 3M8OH 1J0JA 1GYVA 2CUHA 4O02B 2EDJA 4IU2B 1NCCH 3EO1A 1IKNA 1AZBA 4AIOA 1O9WA 1P69B 1E4KC 4M7LT 1JNHB 3CFKB 1M1XA 4CBPA 5IFHL 1RVFL 4P5TC 5LGJA 4G2AA 5FB8A 5I5RA 5AOZA 4V2CB 5TD4A 3V4UH 3L3GB 4P04A 3QCUL 2IO5A 4BQ6A 5D1QB 2VB5A 2XN2A 4ZMYA 4KUZL 4RMVA 3U7YL 2WYIA 5L9DL 4D0BB 1QSZA 3N9GL 2JLPA 3F6JA 3WU1A 2J88L 3LQZB 5AKVA 3MRHB 4WWKC 3QHZL 3M88A 5GGTA 2OMVB 1EXUA 4IBQA 5EBWB 1QAWA 3P9LB 4JHAL 3OG6B 2F18A 2COQA 3GLEA 4JZOB 3O6FB 4ENED 2DM7A 1T89A 3GHEL 3MUGB 4JPKH 5HYSA 4TSAL 3G5ZA 5E95B 3N43B 3KJ4B 4ABVA 1VDGA 1A22B 3IMVA 3TBTB 5I6LA 4EDXA 1KCLA 2Z35B 5EZOL 4HC1H 3RHWK 4O4YL 3OAUL 5IJCC 2QDVA 2A9BA 5GGQL 2VXSH 5KVMC 2I5YL 3SBWC 5E6IA 3OTTA 3O8XA 5IFJA 1WVZA 5EUKB 2E76C 2RMNA 2RGSA 4X80L 4WUUB 5DI8B 1GXEA 1DTUA 1ZT7B 2Y6TE 4RIRB 2AJYH 2VDOL 4OZFG 4RFNC 1G6RH 5JNYB 4YBLC 5I6KA 5IBLC 5IHLB 1KCKA 5KVFE 4AV0A 4CKQA 1NC4B 1BZ7A 3S6CA 4NO2A 5A3IC 4EZJA 4YSEA 4L3EE 1WLHA 5CKGA 4A66A 3G6JE 5KTEH 5F9JA 1EHLL 2Z31C 2VM4A 4QGYA 5AW6B 1JRHH 4HC1A 4HS8L 3D0LB 2FGWH 3KR3L 2WBJD 2Q3XA 5T3ZL 4TM9A 2P45B 4KPHH 2YXFA 4MD0A 5D70H 4H1LG 1FP5A 3TZVA 1ANUA 4Y4HD 1KBVA 2ROXA 3HZYB 4DOHB 1CT8A 3RUGE 2H41A 4TSCH 1NCHA 3W2DL 2VZOA 2ISDA 1QPXA 4XNUH 4O2CB 1WEJL 4ONHA 5IOKA 3IVKB 1G6RA 5F21B 3SQOH 3ZVVA 2ZPKL 3GDBA 1ZVSB 4TUKL 2DMHA 4HLZG 3CDFA 4K8RD 5DVOA 5L8KB 1JZEA 5DD3L 1BZ9B 4QY8B 4HFWA 5I30L 2Y2YA 1A4KB 4PJ8D 3RVUC 4H8WH 3MLVL 3ZRCC 1A7NL 1C16A 2QJDA 3EH4B 3MTXA 4FKEA 1HXYA 2XLLA 4MS8D 3RWHB 1YJDL 3U82B 1NEZG 2CGRL 2UWEE 4GRLD 4ZUTB 4RFEA 3BIKB 3L5WA 4ODSH 3PNWA 3CSBA 3ILEA 1IEHA 5FYLH 1S7RA 4Q0XH 2I07B 4IBLT 3IU4H 5C0EA 5EEXA 2FJHB 3EZJB 4HZ1A 4AYFA 4Z95H 4IM8A 4UM8B 3CPLB 5GGRA 4G6AD 4B7IA 2P49B 5IF0B 3L3JA 4GY4A 4JAMA 3BHBB 5EIIA 3MROB 4M5YH 3I6GA 4EIGB 2CDEA 5FUZL 1LO5B 3M46A 5SWSB 3SPIA 2GK0B 1FDLL 3JT0A 2GJJA 5DFTA 1WWCA 3Q7JA 2H7WA 3VXRE 3HZKB 5KVDE 4GKNA 5F6IB 4X6EA 1VGEL 4JN1H 4NCDA 1R33A 3U9UA 1J12A 2A74C 4JS7A 5DU7A 2OM5A 3G5VA 4GS7C 4UTAH 4OLZL 2BX5A 3Q13A 3IDMA 4FG2A 2CIKA 1XIWB 5T33H 3WL9A 5BV7L 4JO1H 3RZCB 4DNLA 4FQLL 2R0WH 3BDBA 1MFCL 5K5YA 3AY4C 2X4NB 4V33A 3F7VB 4RBPH 3RDTA 3WUZA 4N5UA 2Z8VC 1W16A 3VXUD 4NZTH 1YN7B 3OSKA 4J4PD 4U1JB 1KB9J 5DMIL 2W88A 5FYJL 2BVYA 3M1BA 1WIUA 2NNAB 3H6JA 1OTTC 1BEYH 4AT6A 1AYRA 2WLHA 1MWAH 4PS8A 4TULL 4YL9A 1BGXL 3NIDE 2YC1A 4PJGB 2GPZA 2PKDA 4ZUVB 4UTAA 2PCYA 2NTFB 2WBWB 4EOWL 2ALWA 4F7CA 1SBSL 2E8YA 4PJ5B 4DZ8A 4GG6A 4JG9A 4QJ3B 3UDWA 3UAFA 1Q0EA 3NG5A 4IIQC 3RJQB 3OR7A 4JFFE 3QNZA 4JCWA 2HT3C 4Y5YB 2WOBA 3UZVA 1MFAL 4G9FD 4WWKB 3BOVA 3D0VA 4D0CA 5GISH 1LEGA 1VIWA 3L1GA 3UTQB 1S7XB 5AVUB 5DEGA 1RMFL 1N6UA 1AJ7H 1U8LB 2XTJC 2YOCA 3FNKA 3GXDA 3JWNH 3R4RA 4PS7A 1W91A 3ALXA 4QMEA 5HHMD 5HGBB 1B3IA 1HEJC 1S2EA 3QNFA 5DHYB 1DEEA 2DEWX 1M1SA 1BQHG 2JKJA 2DDQH 3O9WA 4U1SB 4JREC 1MFEL 1R5VB 1JHKH 3FCGA 2HRPL 3JBG7 4LLDB 4QHMA 5JOFB 3CZKA 3JV0A 1KFAL 1E4WH 2Q76B 2Y3AA 3SDXA 4GPVA 2AAVA 3TO4A 4IRSA 3BAWA 3SY0B 1WIPA 5C07E 2JCCB 5KSUB 1QHOA 2XX1A 3BT0A 3IMRA 3BWAA 1ZTMA 4HT1L 3ZKNC 3A6CH 4ZD3L 4JO3H 4M5ZH 4WO4A 1S7VB 1IIKA 3HW7A 1DQJA 4RFNB 3SYCA 3TN0D 2CH8A 2PWEA 1GPOH 3TV8A 3ULVE 4YBLB 1KPRA 3KYKL 5CBEB 3KEHA 4ODWA 3SSGA 2LQRA 4Y9BA 3HAEG 1GAFL 2FT7A 2OJEB 2XWTA 4MQTB 4G5ZH 2QSTA 3MLYL 4JZJC 4K5LA 3GBMH 4IGBD 1AI1H 4K15A 3RWFB 2Z31B 1FL3B 4N90D 4DEUA 4TTGA 4IRJA 3QRGH 2Z8RA 1TQVA 3FKUS 4NQCD 3T0ED 4JY5H 5G4MA 3U0WH 1NFIA 2Y07H 1T1WB 4BE6A 1YSOA 4QXVA 1EJOL 2XIIA 4PJFF 4XVTH 4U6HA 4AL8L 3QUXD 4LL9A 3VW3L 1CWVA 3M1CA 4Q56A 3O2WL 5SWQB 1BAFH 5AYUL 3ISRA 1J8HA 5KAQG 4KY1H 1CGSL 4FFVD 3WS3B 3GSVA 3ECWA 4L4TB 4XAWL 1YMHA 5AW4B 5MEQB 3M1OA 1SOKA 4MDIA 2O6PA 3F12B 1OIOA 3TBYB 2Y36L 3KWWA 4OTXH 5FKAA 5I18H 5HJ3B 3KH3A 1A6TA 4EUPG 4AGMA 4ZK8A 4IHOB 1BYNA 3KYMB 4ZSOB 2X89A 1MAKA 2E8ZA 3UYOD 4AQ1C 3GZKA 1YECH 3H3BC 5H37H 4L2YA 2UXTA 4Y2OB 4EKXA 4HKJA 4B3EA 2OI9C 1HE7A 4YHOH 1VPOH 5FYJU 5DZOA 1PFCA 4FFYA 5C08B 1A6ZB 1QZ1A 5E2UL 1G9EA 2W9EH 1T4KB 3KXFA 2HKHL 3POCA 4APXA 5D5MB 3FHEA 3DMMB 3O4LB 3OR6A 1OQXA 2J1ZA 4J7RA 1QBLH 2GSMB 2VZ1A 4NUPA 2BIMA 3K4ZA 3H6AA 2GSIB 3GSXB 1CXFA 4KWUA 3OZ9L 4KK5C 2J57A 1P5UA 4AVHA 5K39B 2IWKA 4P3DB 4K3EL 4YVNA 4L0PB 5KSAA 4JPSA 4PQXA 4BSVB 3S37L 4P4RA 4WTQA 4LP4A 1EANA 3QZNA 1FWXA 5H37A 4JLRA 1KGUA 2PWHA 2G2RA 3N41B 3RHWF 3DTXA 2I60H 3MV7D 4P06A 3LNIA 4GAGL 4YXLH 2CO7B 5AYTA 1MVUB 3HIZA 5EUOA 2N1TE 1ZHBA 1CLYH 3A67L 5HHNB 3LZNA 4NUMA 2WQXA 4GEIA 1V55B 1ES0B 3C5JB 4GO9A 4P2QA 3TASA 3UTTB 2NY2C 1KJ2B 2ZUSA 1AR2A 4F2MA 3BGFC 4XI5C 2CCLA 1TO5A 3LN5A 4OZGF 3VFMB 3MU3A 4DETA 5AG8A 1D5IH 4FQXC 1MQKH 3PDOB 4KUCF 1VENA 4DGW