5A40E

Crystal structure of a dual topology fluoride ion channel.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYWSYQEFTVPGSKTATISGLKPGVDYTITVYAYWEHMYHYSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Double-Barrelled Fluoride Ion Channel.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Transport protein
molecule keywords PUTATIVE FLUORIDE ION TRANSPORTER CRCB
total genus 12
structure length 90
sequence length 90
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a40E00
1BWMA 1RZKH 4JFFA 4ETQB 3T0EA 1RZIB 1YNKL 4YZFF 2X09A 1ES0A 1PLGH 2FATL 1RZKL 4JAMB 3WJJA 4JO4L 4XI5D 5MENA 3QXAB 4HQQL 2EXWD 1JPGA 1AGBA 1CGSL 3OXSB 4LASH 1JZ7A 1U93A 1YN6B 4XNUL 4F9PC 4LCWB 3K4ZA 3PUCA 2VQUA 4CADB 5D7SH 3UC0H 1OARH 5HGBA 3TO4A 1EO5A 2CJUL 5DJ2A 1A1NA 2DWEA 1G7LA 4XP5H 3QUKB 4N9GB 4MLSA 5E08H 1RUKL 4JFQA 4JN1L 1N3NA 3TIDA 4X0KA 5DR5L 4XNYL 2XQBL 3VXNB 1ZMYA 4QXTA 3QWQB 4Z7UA 5IR1A 2J8OA 4ODWA 5IB2B 1TQBC 5DJXA 4GRWH 2J8UA 1MHEA 3VWJA 2NY6C 3VGHA 2DTMH 4MB3A 1NQBA 3HZYA 4NRYA 1XGUB 3GBNH 1N6UA 2VLKE 3IFNH 2DQDL 2ZP0T 1T0NA 3GSQB 2MCPL 1YN7B 2F19L 5C0AD 3TCLB 5TFSL 4S1QH 1DANT 1VDGA 3EBAA 2ZCKL 1KJMB 1U91A 4LLQA 4J3UA 2H26A 2YRPA 2R4RL 2X70A 5J13C 3NCCB 3CUPB 5BRZE 5KAQG 1RZFL 5C8JA 2VITA 2DQEH 1T22A 2X4UA 1QBBA 4U6XA 5IVXA 4S1SL 2B4CH 2DIAA 3B2UC 3QQ9D 4XPGH 4L8BA 3TVMD 2CSPA 1U58B 5A3IC 4WUUA 3VXUE 2NY1D 3T1FB 3KYMA 3BHBA 3SDAA 5DJCB 5DJDB 2DF3A 1CDJA 3RHWF 4LHUA 5H35A 4PJXF 2EH7H 3UTPD 5C09D 1EXUB 2W65B 4ZUWA 2IQAA 4WWKC 5FM5M 5ISZA 1CR9L 1UKTA 2OXGA 1BQLL 1FO0B 2GKIA 2V2WA 3KXFD 4GKZA 5EPMA 4LPTA 4LGSB 4O2CA 2R1WB 3MO1B 4S11A 1BD2E 2FD6H 3HZKB 1VFOA 4NSKB 2AGJL 2FD6L 2W0LA 4PB0H 1CDBA 2ZOLA 4NO2B 1UADC 3PHQA 1S78D 2VLRE 3U30B 1G9EA 5I75C 1T1ZB 5DVKA 3V5DB 5TE4L 2BOCB 2QR0B 3ZKNC 2OCFD 4QWWD 5KSVB 4WEUD 4RBPH 1LP9A 2VO5A 3T2NH 4HUVA 1XH3A 3MV8B 1EEZB 3QAZB 1I9JL 1XF5B 4OUOA 1KF9B 1ZXQA 1K6QL 2FLBT 2YRLA 4Q6IC 2H2SD 1RZKC 3W9DA 3V8OA 3O6KL 4ZS6C 1KIUA 4MQ7B 5I18H 4NQCD 4OT1L 3CDGA 2GTZB 1CLZH 3NACL 4U33A 1DUYB 1LO4H 4H88L 3N50A 2PW2A 5BRZB 2DS4A 3E1F1 1WK0A 2A83B 2B5IC 4CNIA 5A2FA 4JFFE 1FYTE 4CVUA 1F4AA 1C16B 1DE4A 5F1SA 1INEH 2VR4A 3SQOH 5I1JL 2B20A 4TUKL 1MCOH 3MV7E 5F88A 5EBMB 3QWOA 4NCC2 4LLUB 4JKLA 5ACLA 5C71A 2HTLC 4NO0D 1H3PH 3F7PC 3PV7A 3DX6B 4DCQB 2IFFH 2Z92B 4X0KB 4XTRD 3T1FA 1SVCP 1PFCA 5I17B 3MOBL 3OGCB 2VLMD 3S98A 5EUOF 2QSVA 4FNLH 4UNUA 1NL0L 1V7NL 2IMMA 1MWAA 2F54B 1HYRC 1QFWM 1HIML 4G7YL 5CD3B 1Q94A 4QHKI 5DS8B 2E6JA 2ITCB 4KK9C 2DQHL 2VLRA 3VI3F 4DKDC 2APWA 3ETBF 3U9UB 4IRJD 4EUPG 2C3VB 2I07A 3UTTA 4I0PC 1CLOH 2HN7A 1KIRB 3KLDA 4LKCB 4YE4H 1SBBA 2B5IB 3T0BA 3O3DB 3VXMD 1QSFB 3O6FA 5K9QI 3SE9L 3HTLX 2C1OA 4D8PA 3AB0B 2XG5A 3KJ4C 4PJIA 2CGRH 3GGWA 5EC2B 4PJ5B 3V7MA 2CXKA 4G9FB 1BAFH 1RUQH 1DBBH 3T77B 3ARGB 3O0RH 3ESUF 1HNFA 4FOMA 1RUQL 3TA3D 1GZPB 3BKYL 3OKEA 4RRPA 2BVQA 4WVRA 4S0TD 2YBRB 1WBXB 4I77H 3CX2A 3QPQC 1BOGB 3KPPB 4R8WL 1UA6H 4KKCD 1R0AH 4OGAC 2DI7A 3MRNB 3FQNA 2VZTA 2XWBA 3GMLB 4QXUH 1A3QA 1OL0A 3FOLA 4MAUH 1BGXL 5B3NA 2EZ0D 4D3CL 4PRBB 5EUOB 2EDEA 4ZXBA 4R96A 4NWTH 3BMWA 5DVMA 5HGBB 5KSVA 1RPQA 4ZFFB 3FFCE 3E8UL 4L9LC 3NCFB 2VABB 3SKUD 3FO9B 5EOCL 5DK3A 4PJEF 4AG4H 1T1XB 1KIPA 4EZMA 1YNLH 3HC4L 2FATH 2O5XH 5FYJH 4BSVA 5EU7E 3WO3B 4TNVK 5I0ZA 1XIWD 4MQ7A 4NJ9H 4R97C 1I7TA 3LEVH 4TUOA 3G6JB 5I30L 1GIGL 5ANMB 5HYJB 2EE9A 4GAJL 1NUFA 2D7QA 3IDMA 3QUMB 3MRLA 4EI6A 1OTSD 1QSFE 2VNCA 3B9DA 4LFHG 4E41A 3O2DL 4FABL 4J8RA 1SJXA 5CINH 5AZEH 3PWUA 1ONQB 5EU7C 1GL4B 3UX9B 4BK4A 5DRXB 3ZYZA 3BPNC 1I1AD 3GMRA 2ZG1A 3IYLW 4P2QD 3CK0H 2ZOLB 1FH5H 4NO2A 5LKNA 3TBVA 3W39B 3WDHA 5BVJA 3U7YH 5EZLB 1OT2A 3LDBB 4L4TD 3PXJA 5EC1A 4FG6C 1CXKA 4U1GC 3DX6A 5I19H 3ZDZE 1DQTA 1OM3L 3L9RB 1HXMA 3E6FA 4ALAH 4M5YH 4JPWL 1YEDB 4NYLB 1JPTH 3GFUA 1BPVA 3UTTE 5EO1A 4V1DA 2ZCHL 1MF2L 3S4SG 1E4XL 4L8DB 4WW1B 4GRLB 2ZCHH 1OAKL 5BOZG 3MRRB 5FEBA 5IGXH 4G9DA 3RIAK 3P4OA 1J0JA 2UWEA 2GTZA 3DX9A 2WW8A 4FTVA 2PTTB 2CUMA 5IM7A 3ME0A 1QBMH 2P7TA 1Z9LA 3FO2A 1SYSA 3Q3GB 1UXWB 2VLLA 3FQXA 4HWEL 1B0RB 2ORBL 4ONOA 1RI8A 5J89A 3UJJL 2JB5L 4JB9L 3MV8D 1I1AC 2P5EB 3HRZA 4AEHH 4GG8B 3N06B 4H26B 4IRZL 4KGLA 1UB6A 1GPOH 1AGCA 5K9JL 43CAB 1N6QL 5ITFB 4MXQD 2H32A 4DKAA 4YHYB 3MREA 3WJLA 1T1ZA 3V5DA 4RA0C 3REWB 4YXKH 2XFXA 1AQKL 5D5MA 4PRIA 3D2UA 5JXEA 3MRIA 4FQLH 5T5NG 4PJEB 1KELL 1I7UA 4FQLL 3EOBA 3FQRA 1JWMB 4EXKA 2W9EL 3EOAA 3JV6A 3ARBA 4MYWB 3IFOA 4I0KA 3TBTB 3VRJA 1ZSDB 1OT1A 2R29H 4G8EA 1PSKH 4LU5H 1Q9KB 1CVSC 1I7ZB 2BP3A 1LD9A 3EJYD 4EI5A 4Z7NE 4RNRB 4IOFD 3CPLA 1FGVL 5CEYA 3GKZA 1LGVA 1CT8A 1DR9A 3VXMB 2D7PA 5FYKD 3VFWB 1M1SA 1YC8A 3TBVB 4I18B 1JNJA 1OAUH 3JTTB 1X5GA 5HHMD 3UTTB 4HIJA 4YNYA 2QEJA 4J3WA 1AO7B 3BUYA 3PF2A 1A2YA 4TNWK 4JG0H 3Q48A 2ESVE 5TDOB 4NKOB 2RGSA 4ZXBD 2C1OB 2F15A 4HS8L 2CKNA 4LPWA 3MRCB 3ZHDA 5I2IA 5CBAA 5CIPA 4J23A 5IUSA 1DDHB 4Y4FB 2IBGA 1BGXH 2VXUL 5MEOB 1AIFA 1S7WA 4R9HA 2ZUSA 1KEMH 3F12A 2ILLA 4OCRH 3VXSA 3DUSA 3BZ4A 3MCLH 3N1PC 4U6VH 1UACL 4OZGE 2FR4B 1LMKA 5BZDB 4Z5RA 1KB9K 1AI1H 4KKNA 4P48A 1R3JA 5FB8B 1Q94B 1HOCB 3W5NA 1NGQH 1C7SA 3D87B 4M7JH 3FMGL 5HPOA 3LS5H 2MNUA 1MI5D 2OTUA 3BRGC 4U6YB 3E2HB 5TQ2H 3SGKC 3NABL 5INCA 3GSVA 1FCCA 5M7QA 2AKRA 4RGNE 1K85A 5JW4M 2NTFB 3MREB 2NXZD 1QLEL 1RMFH 1FE8L 2YXFA 2DL9A 3VE0A 4FXLA 3DVNA 4XP1H 5A1AA 1R3LA 2NY7H 1QFWL 3VFVA 2NY3B 3MV9B 2IPUG 3FO1A 2XZCH 4NC1C 4BSVB 4F7TA 3T3MF 3KAAA 4M48L 5FF6B 1W0YT 3IFOB 4L4VB 3DVIA 4QHUA 1P7KA 3QUML 5DEFB 3S37H 4MQXD 5GGSB 1F13A 3NCMA 1WZ1H 3PJSB 4LCYA 3EYFA 5D70H 1O5DT 2BNRE 1EEYB 2KUTA 3BESR 2VH5L 1HYSC 1NC2B 5HGDA 1E4JA 2DTML 3LN4A 4U1NB 3C9NA 2C7UA 1H3VA 4P9MH 3AY4A 1A7RH 4XP6H 5DC0A 1HHIB 4DFHA 1QBLL 3O6LL 3EDEA 3ROOB 5ICXA 5TFSH 3GKWH 2ZCKH 2XZQL 1UJTA 2H9GB 1A6UH 3QUZD 4ELMB 2LE9A 3L5XH 3S34L 2NY3C 1W0WB 2DI9A 4L4JA 2B4CL 3OZ9H 4QYOB 4K3EL 5D1XD 3WHE0 1QRNB 4CVZB 1M7DB 3RGVA 1H3TA 3GSUA 4G6JH 4MJIB 5ALCH 2DJ4A 3ALXA 5EU6D 2XKNB 4M1GH 2XWJA 3K2UH 4G6JL 2DMKA 3KXFB 3KYKL 3PL6A 4I0PA 1RJYB 4I4WA 3PQYA 5SWQB 4P2OC 5IT2L 5KTEL 3ARDA 2BVOA 5EIVA 1JF5A 2BNUB 1I8IA 4DAGL 1G0YR 4HJGA 2CIIB 5B4MD 4FQCH 3IKCA 3QPXL 3L3OB 5JA9A 3ARRA 4P23A 3CXDL 4IMKC 1VEPA 3FL7A 3ZE1F 4LSVH 4IM8A 4ODTH 4M3JA 2VLKD 2VDOH 3JTSB 5J11B 3QJFA 3VGFA 5EFIB 1MLBB 2DLFL 3MGAA 3GI9H 2VDOL 4XHJD 1G0DA 3BN9D 4Y4FC 2P42B 4HKXB 1KPUA 4HUUA 2ITDA 4NZJA 4OCXL 1JNLH 3KPSD 2BSTA 3ZKMD 2FZ3A 4S1DC 3C6LA 5I73C 1K5NB 2GIYA 4PJ5E 1EEQA 2X4OA 4EVNB 4U2ZA 4TSBH 5CWSB 4XAWH 2IANB 4HIEB 4TQEH 1QLRA 3CDCA 1CS6A 1J1PH 3OAYK 3RBGA 1U8LA 1GZQB 4JN2B 5IK3B 1KG0A 5CZVL 5IJKA 4A2LA 5HGDB 1YMMD 1HZHH 5FA3A 3F7YA 4FQ2H 3TYFA 4H88H 2OR9L 4LHQB 3D1MC 4J1UB 2BVEA 4P4KD 4NWUL 2HTLD 3QXTA 3MLPA 1S7UA 1YYMH 1UWEL 4JZNA 5HYQB 4GG6A 2J2ZA 3MV7A 4P5MA 3MRHA 1JPTL 4KGJA 4NQDD 4RGNC 3KXFE 1JGVL 4PRAB 4KPHL 2NXYC 1F6AA 4IMLA 4MA8L 5F1OB 3VFMA 5I76A 4YDJA 4PTTB 1WBZA 1I4FA 3TJHC 2GJ6A 4YDVA 4H26A 4NCC1 5I15H 1N8ZB 1WLHA 3T8XB 5CSGA 2PXYA 2QHLA 1TZIA 2F5AH 1XF1A 4POZC 4M5ZH 5FYKL 3L3JA 1REIA 1J12A 4DUVA 2BNUA 3ZDZF 3MYJB 5TQ0H 2BC4A 3RUGF 1QPXA 2QADC 3PWVA 5KSUA 4WCYH 4RAVB 1L7IL 4RMQA 4ZAKD 4MNHA 5MENB 3RNKB 5DJZA 4AEIL 3KPLB 4Z7WF 3KPMA 5IW1B 1YEKL 3IB4A 1OW0A 3QJFB 5F6HI 3L7FB 2VDRH 3T0EB 4ODVH 1G7QB 4WRLA 4NQCA 1BREA 3NTCH 4EN3C 3HS0A 5I8KH 2OL3H 1JBJA 4I18A 4X6CA 1BVKA 3CAFA 3OJMB 5LGKA 4PBWD 4U1LB 1MAJA 4AZ8A 4OGZA 5J56B 1F4XH 2UUDK 4ZDHB 3HCVB 1RJLB 3SE9H 3VE0B 5J3HC 4YPGA 3BPLB 3FHAA 2ZCLH 4Z7VA 4P3DA 3G5XB 3TPUB 3QDMD 1TNNA 4R4FL 4S10A 3H0TB 1Z5LA 5D1QC 5IFHL 1CQYA 3IXTB 4GAFB 4JRXD 2WP3O 5KS9A 3LKPB 3D0LA 3QAZC 3OKNB 4GO6B 3T0WA 4X5WB 5D96C 4NZDA 3LY6A 2ZUTA 3WDJA 4UT6L 3N0PB 4K8RD 2GFBA 4HGWB 3RQ3A 4YZFE 4PRHE 3PIQB 4I48B 4U1IA 4MMXC 3HUJE 1NANH 1T89C 4FQJL 2M26A 3KPSA 5AUMA 3U83A 4CADA 4NKIH 1NBQA 5EU5A 4RWHA 4N8VG 1MIML 3RZCB 4WU7B 4M7KL 3BH9B 4OF0A 4X6DE 3DMMB 2YUVA 1NDGA 3H9YA 3BWUC 4U1SB 3U30C 3MCG1 4U2YA 3IXAB 4JO1H 1K5NA 4UIKL 4NWTL 2AQ2A 2XYCA 3B9KA 3QDGB 3O41B 1PKOA 1INDL 4JPKL 2DQFB 5D7LB 3GSNH 4HIEA 4AQOA 3QG6B 2FWOB 4HULB 4A6YH 1TETH 2L7JA 3FO1B 4PJXA 4M7JL 5IJVA 3LKSB 3NIGF 1ZLSL 5EZIH 1AXTH 3MTRA 4N8VA 1Y0LA 5EDXA 4QRPD 1P84J 5C6PB 4KRMB 5D1QD 4P2QA 5H94A 4QHUB 4NN7C 3UC0L 4MCYA 1VADA 4XAKE 3V5HA 1TCRA 5B21A 1W72H 3CXHK 3HR5B 3OJ2C 1NGPH 3EYQC 3UTSE 4RWYL 1XAUA 3VWJD 1S9WA 4UAOB 2HG5B 2W9LA 2XICA 2A6JB 2N1KA 4X8JA 4YBQD 5IESL 3LOWA 2BZDA 1AO7E 2COQA 3MO1A 4TSAL 4ZO9A 3QULA 3QUZA 3G6JF 2BJMH 2DQGL 4LCIL 3S35H 5KG9A 3QT2A 2EYTA 5HHQB 2BVTA 5JMRA 1T1YA 3V6OC 1A1NB 3H9SD 4PJAE 3KPTA 4KDTA 2X4UB 3TBYB 4HWZB 3T0XA 1B9ZA 1CXLA 4OCNC 3QJHA 4Y5VA 1BQSA 2EC9T 5CJQH 3H9HA 1MQ8A 1V3LA 4IRSC 1P1ZA 4HG4J 1YEJL 2FBJL 4MJIA 5DJCA 1QLFA 1H8SA 4P49A 4NJAH 1KXTB 1AKJD 5TE7H 5SV4A 3SDDC 1A14L 1N5AA 5EIIB 2NY2C 1S7RB 3D39B 3LRSA 4RSVA 3QXDB 3ABZA 4LAJH 1VERA 3L7FA 3MLYH 3UYPA 3WFEL 1H9VA 3EYQD 5BO1H 2PW2B 4KROC 3KPSB 3P11H 5CBEA 1PG7L 1HCFX 4FNLL 4YGVB 4WEBL 3MNZA 1G7JA 3DROB 1NAMH 3BO8A 3AGVA 3ARUA 4L3EE 3IJSB 4YC2B 4ZNEE 3A0OA 3MPCA 4LAQL 2NZ9C 4GKSA 1FN4B 5LG1A 4JDZB 3RJQB 3CC5B 2ICWJ 4PJFB 3RVUC 1X5ZA 1MIEH 3UBXG 2VZSA 3L3GB 2C4FT 25C8L 1F3RB 1CFSB 2AJXH 2H6PB 4J3OC 4WJ5A 4R4ND 3A6CL 2IQ9H 1KACB 5CP7A 1A1MB 4OCYH 5D2NA 4F57H 4X6FB 4L3EA 5IFAL 1WFTA 4JFQB 3WSQL 4HMCA 2Y36H 5HVWA 4ZAKB 3DOSA 4A6YB 3KR3L 4PRPD 4MNGA 5DJDA 3UTTD 4JDVA 4ELKB 2Z91A 1RQ5A 2PO6A 4JGJA 5CEXA 3P40A 5IK3A 4LNRA 5EU3A 4YHZL 2XTJD 4OJFL 2WQRA 1GGBH 2MOVA 5IVXF 3AUVA 1XEDA 3DXAA 4RGMB 1M7IB 1K6QH 3NBNA 3CGTA 2YD5A 2CIKB 4Q0XL 2VQTA 4D8PB 4FQIH 5CSZA 2WWKT 3HAEG 1PY4A 3QCUH 3V6FA 1TMCB 2VDMH 3DUHA 3QCUL 1R5IA 4NT6B 4N0CC 1LO5B 4YQXH 1HCVA 4N8PA 3QI9A 2W38A 4RFOH 1HHHB 1AP2A 2YR3A 1N4XH 5AG8A 3WHXA 5E7BA 5D93B 3P9MB 3VW3H 1P4BL 5DQJB 1CDCA 1S3KH 4FFVD 4JO1L 5EIQA 5F7KC 1IGCH 1NMAH 1WAAA 3DJ9A 1N64L 2VDLL 5DJYA 4JY5L 3G6DH 2A74B 4WWKB 2UV3A 1WGOA 4JY5H 2YBRA 1AE6H 3OKYA 4WTWA 1KULA 3IFNL 4RRPG 1Q9WA 5SWSE 5IVZA 4HUWB 4PRBA 3EO0A 5E4EB 1F45A 4ZUSB 4LQFL 3TZVC 2NY5L 4I3SH 1A7OH 1UJ3B 4WGWB 1EJOH 2MQCA 3I9GL 3QISA 4OFDA 3FT2B 5AZEL 1FYTB 4HJJH 2R69H 2VDQH 3RHWK 5CEZD 2X1PA 2ESVD 4LRIA 4C56E 1JGEB 1IAIL 1MFDH 1EFXA 1T89A 3S37X 4CW1A 1NBZA 5DD1H 3ZL4H 4KHXL 3KLSA 4JFHE 4KZDH 1Y0LB 2NX5B 4KI5F 2BDNH 5FYLL 3ARPA 4C55A 2DICA 4OFVA 3WE6B 2X41A 3S8WA 4PBXA 3GBMH 1RZGA 1IAMA 1KCRL 5C08D 5LJYH 1IM3A 3N9GL 3U0PB 1MCHA 3GBML 4JRXA 3RZCC 3CSGA 1CR9H 5ERWB 1TITA 2BVYA 3OX8A 3V52L 1KCUL 4Z9KB 1QACA 1N2RB 1SY6L 1J0YA 4N0UA 4HGWA 1FVDA 4NC0B 4JREB 1M4KA 4I48A 1CL7H 5EUOA 4R4FH 3SGDI 3MR9B 2D03H 3NFPB 5KSAC 5KG9B 5C3TA 1Z9OA 4X6EB 4MSWA 1WEJL 3ZKND 1A6UL 1FPTL 5AWNL 2NW3B 1P4IH 3DTXA 4G8GD 2AXHA 2I9TA 4GKNA 32C2B 4HWZA 3DIFB 4I18C 1HWHB 5KZCD 2GAZA 3O4OC 4O5LH 2YN3A 3Q0HA 4WDIB 4E41D 5KTEH 3EZ8A 4UUJA 1VB9A 5A2LH 4NC1E 4NO5A 4GBXD 1NCBH 3BJ91 4ETQA 1CICD 4PBVC 1U3JA 2AJVL 4K2UL 1FZMB 4DN3H 2VB5A 1JWUB 1TZGL 2YWYA 4E0RA 4G6KH 2AEWA 2VISA 1IC7H 4FQXA 3B83A 5GGTA 3LD8B 1J0HA 4GXUM 4D0BA 1G6RA 5IMOB 4PJIF 2IAMA 1OAQH 5GRVK 4EBQH 2JIXD 1ZTXH 4OD1L 3W5MA 4QRQA 5B8CC 3QUXB 1I8MB 1ZT1A 1EHLH 5GGSY 1LO2L 3A67L 3ES6B 4YX2H 3EYSH 1IM9A 4LMQI 4G5ZH 4TTDC 2GUOB 4NNPL 4KKLC 5EWIL 3ARFD 1DUZA 5F71A 4N8CH 1GRWA 4QNPE 2DQUH 4Y2OA 3TIEA 1RK1A 4WFHD 2EYSB 5JXAL 4NO0B 3FO9A 1ULVA 5I8OH 5KN5B 4B7LA 2NY4D 1OSPL 4OV5B 1CQKA 1IEAA 3GMPB 2VZVA 5DJXB 3P9WB 4L8DA 5CD5D 5CD5C 3WN5A 5DRWB 3RU8L 3NACH 5HI5D 2BOBB 5F7MC 1GHFH 5HHNA 2ADIA 4XVTL 1Q9KA 4FZ8L 3OR7A 2KQMA 3SOBH 4PJBF 1YQVL 4ELKA 1GAFL 3QH3A 3OKEB 5D6CB 5FO8A 3V5KA 2FO4B 4UTAL 3DETC 2V7HB 3UTPE 1MHCB 3C8HA 4ALAL 5KBNC 2V6HA 4KAQL 4GFTB 4HUWA 4LSPH 5HD8C 1MCWM 5ANME 3EFFB 3MOQA 4PD4J 3VRIB 5HYSA 2Z9TA 1X4YA 2AQ1A 3DRQA 4LF3B 3QQ3A 4X6DB 3FT3B 4YXLH 3MNZB 3MUGB 5DJ8B 5IMMA 4BH7B 3LKOB 3CVIH 3ARFC 2K7PA 3DNKA 5L0QB 3QDJA 5D7LE 3FQUB 3REWA 1FSKB 4Y4FA 5HHXL 4QTHB 5DTFB 3P0VH 1FLTX 4HWUA 4PRHA 4BZ1L 4LLMB 5TGBB 4H8WH 2RR3A 5JW5B 3MRCA 3AMLA 3DUSB 4JVWA 1CFVL 4X6DF 1JUFA 4GMTL 2HRLA 4WHTB 4WY7L 4KQ3L 4N5ED 1MREL 2ICCA 4P23C 4NKQB 4M6AA 4WU5A 3PDDA 2BCKB 3ZE2F 1RUKH 2IAMB 4NQCE 5F1IB 2VDQL 1NLBH 2DWDA 3BZ4B 4O51B 2HFGH 4HD9A 5KW9H 5LGJB 3Q6FA 5CJ5A 4HPOL 4LNRB 3Q3GA 2MPAL 1CT8B 1P84K 1NDMB 1ZT1B 5FUOH 3ARDC 3NFNB 4UV4H 4JY6A 1F3DJ 5DHYA 4YXKL 2FL5A 4UU9A 4XCYA 3HRPA 3FB5B 1AO7A 1C08B 2X2YA 3MROA 5C0DB 4LKXA 1NCCH 1T3FB 5ID0A 4RAHA 4QRRA 4XPBH 4NQDE 3TVMB 2AXGA 3IDNB 1OQXA 5C7XL 3VXOA 4PJCB 4M62L 4JY4A 1KT2A 5F97E 1HH9A 4P9ML 1WVZA 2OMNA 1NC4B 5HJ3A 3WBDA 1I9IH 3JXAA 4N0FA 1F58H 5C6WH 3X3FL 3WS3A 1K9TA 3EFDH 2YKLH 15C8L 5HHNB 4KV5E 3F8UB 4PJ8C 4JVUA 3HPLB 2R23A 1F02I 3VFOA 4CBPA 2AXJA 5ENWA 5FIEA 5FO9A 4XMPH 3MJ9H 1NFDF 4GW1A 4HIHB 4CNIB 3WV0A 2R0ZH 2EEBA 1TVBA 4ZFZB 3CLFL 3SBWA 5FAAA 4Z7WE 1MVUA 4DUXA 2UZYB 4XX1E 5EH1A 1K2DA 1T0NB 4U1JB 4F7EB 1PBYA 3C9NB 3KJ4B 4KWUA 3STLB 3BWAB 1XGUA 3TJEL 3RBSA 1NEUA 1BZ7B 4LDEB 3B9VA 5CJOH 2BY0A 3RWJA 5JHLL 2YPLA 4Y1AD 1JYWA 4K07A 1YN7A 3P0GB 1KBGH 3MV9A 5FGRA 1TZHA 2DIBA 3VXME 3UYRL 1UM5H 1F6FB 2VN4A 4IDJH 3QFJE 3KS0H 3QUYC 1XR8B 2DM3A 5TDPA 1FFOB 3WNLA 1AXIB 4UNVA 3LN5A 5EA0H 4OLXL 2HKFL 3W11D 3IS1X 1ZHKA 2ADIB 5A40E 1Y6MR 3LEVL 2XWJB 1DBJL 2C5DC 3JV0A 4B0MM 1FG2B 2FGWL 1A6WL 5H35B 4V1DE 2ESVA 4NBXB 1D9KA 1OGAA 3VFNB 3PGCB 4PJCE 3QUXD 4HEME 5ISZB 1B4JH 1QBML 5HDOA 3I2CL 3FB5A 2AK4A 3SE3A 4LSQH 3I2CH 3LMJH 4DTGH 3O3DA 1HWGB 4MA3B 4UT9L 3KS0J 4RISH 1OM3H 3B6SA 2D31A 3EAKA 4AEFA 3K8MA 3LZFH 4LEXH 1BIIA 4RDQG 4JFXA 1EGJA 3LZFL 3FB6B 1I3GL 3RAJH 4ZOAA 3WIHL 3MMEB 4MXVF 2GSIA 5IB3B 1I3GH 4NZTL 5DMGC 2H2SC 2GSGA 3GNML 1FDLL 2EO1A 1NFKA 2BY3A 3QHTC 1AIFB 4O2FB 1YZZA 3AFLA 1U2HA 3QEQD 1FFPA 4ZUVB 3TNNA 2R29L 4HKBB 1GGCL 2FYYA 4K8RL 3DUUA 4POYA 5EORH 3LPGA 5E94B 3REVB 4K8RH 1JF1B 5T5FH 2OI9B 4K55A 4MJ2A 5K59E 3GSNA 3FT3A 4P2QE 3MRMB 1AO7D 2CXGA 2Y6SD 5SX4I 3QWOB 4LPVA 1IEHA 3MLWL 5ADOL 2QQNL 5CMAB 1CG9A 1KEGL 2J6EL 4PTTA 5GQBA 3W82A 4OZIF 3O3AA 3NZHH 3GRWL 35C8H 1V8HA 4L4TE 2JJUA 3H9SE 5AAWA 1A4KB 4DKFH 4Y2DA 2ZG2A 5SX5K 2DQCL 3K80A 3SJVA 4TSCL 2NX5E 1TIUA 2NW2B 5EZOL 1FNFA 3VU2A 3IGAB 3WN5C 1GCFA 5I1CL 3L5WB 3S5LB 2ZKHL 1SEBA 5ESVA 4WHYH 1MLCB 1JRHL 4XPHH 4F9LC 1IVLA 4KMLB 4KJQD 4PJ9D 3HPJA 5JPNB 3NFSH 1QSEB 4TYUA 4JM2D 5IFHH 5DHYB 3MLSH 4Y5XA 4P46D 1ZLVK 3WXWH 2EZ0C 4D9RD 3ULVH 4U0RB 3U7WH 1F2XK 4GRWF 3WO4B 4XMPL 5MP6H 3HZKA 1BIIB 5LAXB 4C83B 2Y06L 3L1OL 4D9LL 1QSFA 2PXYB 1NUGA 1JPSL 3R06A 3T04D 2BSSA 3VD5A 4XZUB 1FCGA 3U2SA 3RUGA 2E7LC 2QR0A 5GZND 4DCQA 4XI5C 4KMTL 3VGDA 4CVZA 3QCVH 2Z92A 1FJ1B 3HE7A 3TNMB 4X4ME 5KS9B 2F53B 1T7WA 3PHOB 4PTUB 5GISL 1OP9A 4JLRB 3RL2A 1A7PL 4YXLL 2XPGB 4OI7A 1U8QB 3VRLF 3QCTL 2G75B 1FL6A 2DWDB 4P0DA 3VXRA 4JO4H 1JCKA 4OZGF 3MV7B 3VMOA 1BJ1H 2KBGA 2XTJE 3MRHB 5FKPB 1N0LA 1BLNB 1KXQE 1XCQA 1PDKA 2N7AA 3IAQA 4R6UA 3MROB 3SDCB 1I1CA 4TNVF 1LEKB 2VUOA 2DQFA 5IHBA 3RZCA 2DOCA 3QHFH 4NQUA 1S7QB 4DZBB 5KJRL 1MHPL 1IAII 3RWFA 4OQTA 2IPUK 5JIPA 2F54E 2I60L 4GMSL 1XR9B 4ODHL 5B8CB 5DZLA 2GJZA 2VABA 1C12B 2X4NA 3FTGB 1S78C 5CKAA 4HBCH 1YEFL 1FBIL 4X5XA 1FNGB 1F90L 4UI2A 5L0QC 4Z7NF 5I1LB 1LEGB 4W81A 3RTQB 4FFYH 4BYHA 3S36X 3TA3A 3S36L 5TH2A 4PJ8A 5BV7B 4OB5L 3FAXA 3QXUA 5AUMB 3O2WL 3HC3H 1M05B 5D8JH 1DBBL 2KQNA 2EKSA 4KKAC 2DLHA 4ZMAT 5DI8A 2IJ0C 1MI5E 3MCKA 4YXHH 2HJFB 4AM0B 3W39A 1ZGLM 1Q8MA 1YEIL 1JZ8A 5CMAA 3B6SB 4HKJA 1RZ7L 5DMKA 1BD2A 3EO9H 2EE2A 4PJGF 5TE4H 3U4BH 5T1DH 2DQEL 3IJHB 4R7NB 3BZEB 4C58B 5DRZB 3NAAH 4OLWH 3PWPA 2BNQE 4LBEB 5BVJB 3ZO0A 3LH2H 3UO1L 2P8MA 4L29B 2RQ8A 1G9NL 3MQIA 5I8CA 4POUB 2DYPB 2CLZA 1T4KA 3B2VH 1IRAY 5C0ND 3QNZB 2HMID 3NPSC 1NGZB 4WUUE 3VXUA 4OZIB 3CVHL 1LK3H 5HHMB 3JWOC 1I9RH 2EH7L 2OK0L 4G43B 2AEQL 5GGRB 3IFPA 3ULVC 4X4YB 5H8DA 3RNKA 1C5DB 4G6ML 2YS4A 2X4PA 2EE6A 4YK4B 2X9YA 4JO2H 3DURB 4G7VH 2CRYA 2VC2H 5IM7B 3EYSL 1J87A 5BQ7A 1U95A 3MLVL 2W59A 1BECA 4CMMA 3D18A 1MF2H 1WQVT 1U9KA 4ZG1A 3S88L 1ZT4A 4DGVL 2LVEA 3ARFA 3KWWA 3TFKD 5DO2D 1ADQH 1X7QA 3LD8C 4YFEA 3MRJB 2AP2A 3L6FB 4IHOB 1MRDH 5HYFA 5IBLD 4ZAKA 3L3KA 1MH5B 4NCDA 4U05A 4J4PD 2ZPKL 5ALBL 5BXFA 5HYJE 3DO3A 3E6HA 4OZ4B 4UDTA 5E5MA 5E4EC 4WJ5B 1MEXL 3L3IA 3FB7B 4NKMA 2FJHA 3TBWB 5ITFA 1D6VL 3O4LD 4OSUL 4J4PA 2Z93B 1AY1L 1U3YA 2F58H 1MI5B 1MCBA 2HFFB 3NVQA 2ZJSH 4KQ4L 3CCHA 5EBGA 4Z7WB 4AMKH 2B39A 3QIWA 3EOBB 5D7IE 5IW6A 5M95B 3QEHB 1B2WH 3BJLA 3WS6C 4JJ5B 1BFTA 4XTRC 4JHAL 1U8HB 5J6HB 4ELMA 5E00A 5F9JA 3Q1SL 4XVSH 1CYGA 4O4YL 3JWNC 3GUTA 2WNGA 4PJFA 1UM6H 12E8L 2ADFH 2AJZA 3RKDC 2JLLA 1YMHA 4KU1A 4I5BB 3U46A 2D4DA 4WFEE 4NHUB 4OGAD 3UEZA 2IG2L 2VXTL 2EDFA 4JPVL 1TENA 5B8CA 5B38G 3DO7A 1ZLVH 2OSLA 5GS1B 3ULVF 3QNZA 3U1SL 3BPNB 5L2KD 1OD7A 1ZA6A 1EJOL 4JM2B 4YHNA 4V1DB 1C8PA 2B2XH 4FQXC 1VFAA 2GCYA 4U7KA 5GJTH 1TFHA 3CH8A 5LQBL 3NCEB 1YMME 3KG5A 3X14B 3HKFA 4APQB 3DYOA 4G8EB 3WNNA 1X5AA 5E24E 4M48H 5EFIA 4NM8L 3TBSA 1EAPA 1QSVA 3ZSSA 4IJ3C 1G6RL 4ZNEA 3IRZA 4A2MA 1CLOL 4M3KB 4QLRA 1PG7X 3GO1L 3GSVB 4PY7A 5CCKL 1R5VA 2N7BA 3ARSA 4G80B 4M7LL 4XPBL 4GRLD 1TJIH 3VFRB 5DQDH 5HHQA 2Y25A 1F58L 3FKUS 1OP5H 2UZIH 2DWEB 3HNSH 5DRZA 4L4TA 4K94C 2I5YH 5JR1L 2DRUA 3NPSB 1NUDA 5C92A 1QKZL 3L95B 4EDWH 2BSED 2VIRB 5D7LD 3SKOA 1WAAF 4L3EB 1NCUA 4JFEE 3BKJL 2IC2A 3D6GA 2Q86A 1A7QH 2FX9H 3UTZA 4IOIA 4MQTB 5KZCB 1Q0XL 3GJEA 2WBKA 1T6VN 4Y4KC 2Z0BA 1JNNH 3GSXB 5GGVL 1HYSD 4WO4C 4GQ9L 3OQ3B 1Z6JT 2X4QA 4XH2A 3B9KC 4OZHA 4WO4B 3SDCD 4X9HA 3HZYB 3DURA 5TF0A 5E00B 5IOPA 1A3RL 2OQJB 1RUPL 4LRIC 2AJVH 3GIZL 3TF7C 4EOWL 5ITBL 1YNTB 4KKBD 1VENA 4UILL 1MJ8L 3SGEH 5FK9A 2F74A 4M7ZB 3W0WA 5CZXD 2N56A 3L3JB 3H9SB 4OTXH 4ZQKB 3E8UH 3O9WD 3TO4C 1Y18A 1YMMB 5T33H 3P73B 5K33A 5D5ME 4HHAB 5GHWH 2YC1A 5DGRA 4Y4KA 3S4SB 5GHWL 4GAJH 4I4WB 1KNOA 2IQAB 4UOW1 3H3KA 3GSUB 5L8KB 4O2CB 2IFGA 3OR6A 2Q6WB 4XVUD 4PP1D 1ZV5A 2J7LA 4TVSa 3W9EA 4FQ1L 1JHLL 4M6OL 2Q8AL 5CILL 4YIQA 2SEBA 2W65A 4ZUWB 2GI7A 5BZDA 3MNWA 5FGBC 3B9KD 3SDCC 1F42A 3MGTB 1QR4A 2R2EB 2WIIA 5DMIH 2KDGA 5IESH 4KRNA 3CFEA 3FN0L 1F5WA 3QDJD 3WXVL 5F72S 2ICES 4IRZH 2ICEA 3IDGB 4UINL 2OBGA 5B22A 1OW0C 1H3XA 3OV6A 2NTSP 3PNWA 1X4XA 3U0TA 3VGAC 3FO0L 5KS9E 2FB4L 3AREA 4Z8FL 3NIFE 4OGYH 1R24B 3CZJA 1ZHLA 1SY6H 3PWPB 1ORQA 1SJHB 3K8KA 3HC3L 1JPST 2MHAA 2JE8A 1UWXK 4V2CB 1BP3B 4QTIL 1FNLA 3LKRB 5SWQA 3MXVL 4O02H 4XNQB 1H5BB 5DXWA 5C0CE 5I8CB 5GRZA 3RPIB 5CD3A 1QNZL 2ARJB 3MRQB 2PXYC 4Z7WA 1DQJA 3UTSD 3C8KA 4BQ6A 1S7TB 4ELME 1T04A 4K94L 2X42A 5SWZE 5MERB 4PV9A 4UIMA 5BS0B 1AR2A 3W81A 3MZGB 2DQIL 3H9SA 1WISA 3BPLC 4F33A 2OTWB 4YHPB 2IH1B 25C8H 3V4VH 4X7SL 2R1XB 4LVOC 4Y4KB 3U4EA 5HY9B 3NZ8A 3L5IA 3T0VA 4LSTL 4U6XB 4G6AC 4XB8A 1CE6B 4OCSH 2VQ1B 4G8IA 1FC1A 4MS8D 3D9AL 1OAXH 4JO2L 4NBYB 4RMVA 2QQKH 3UTZB 4Z0BL 2EH8L 4ZD3H 1SJEB 1CFNA 5F8QC 3UBXA 1QYGL 1S5IL 1EMTH 3MJ7A 4XCFH 3KYOB 1FL5A 3U0WH 3C5JA 4D0BB 1OAUL 4BZYA 2NY0C 3Q6GH 3DV4B 5BJTA 1H3GA 3QIUA 2HH0H 4QOKE 1EUUA 3TPKA 3U9UA 3FRUA 4Q9RH 3C87A 4LASL 2E9WA 4PY8J 3KPMB 3KYNA 5JORA 5IMMB 3M1BB 4K7PX 5ADPL 5D7KD 5C0CB 3SOBL 2F58L 4MJ6A 2AXGB 3V4PH 3H7BB 5MI0B 1OB1A 4YPGB 5E2UH 3PHQB 4XCNA 2X1OA 3SDYL 5C0RH 2BMKB 3S4SA 5I9QC 1RIUL 3NIDF 4U1LA 3IF1B 4W6XB 1A6TB 1T66C 3T65A 2VXUH 2YA0A 2W9DH 4WUUB 4OZIE 4O2EB 4K7PH 5F9OL 1P9MA 2V5YA 3IDMB 1M71B 4LHUB 1MFEH 3MBEB 4PGBA 4LSDA 4D2NA 2OLDA 1ERNA 1G7JB 3DROA 1JNHB 3MBXH 3MFFA 5DC9B 1U3ZA 1BFVH 1UZ8A 3BGAA 1MFAH 1ZE3C 1BFVL 2LAAA 4HXAL 4ZFFA 2BXZA 3Q2CA 5ACZB 4XBGA 3J7HA 5DJ8A 3VGEA 1MPAL 3V0WH 4H1LB 5JIHA 2G2RA 4HCRA 1RZFH 3S34H 2DMBA 4ZS6D 1TZHB 4JDVB 5J11C 2EO9A 2GITA 4U6HB 3UBXB 4UQ2A 1RHFA 3SDXF 1KPVB 3PV6B 1G84A 1J0ZA 1AQDA 4FTVB 4MAYD 1AXSB 1PKQA 3S36H 1K4DA 4MD5A 1A6PA 1F3DH 1MCPH 2QSCH 5D1XA 1GJIA 5JZ7C 1NAKH 3CXDH 1S7TA 4CJ0A 2ZUVA 1INDH 4GLRH 4YEFA 2WINA 4XRCA 5BS0A 3MA7A 1C08A 1JMXA 4F33B 3L9RA 4CGTA 1T7VA 3F5WA 3K81A 2VDKL 4JHZA 5ELIA 5DD0H 5AYUL 2WM0A 3AS2A 3RDTB 2BRRL 1WEJH 4AIOA 3H3PL 5B39G 2HMIC 4ZPTB 4V2BA 2UVEA 4PRPB 3PGFH 4JR9H 3WHXB 4ONGH 5D71L 4BZ2H 4G6FB 3EYOA 5DD5H 4F2MA 1UFUA 1MFBL 4G9FA 4X4MA 3DX9B 3LH2L 3QZWG 5IV2A 5DQ9B 3QP3A 3ZTNH 5KVMC 5E8PA 2CLVA 3MNVA 4MDJA 4F37K 3HE7C 4PJIB 2CLRA 3TNNB 4UT7L 5BMFL 3TJHD 5B39A 2AEIT 4TN9A 1S7RA 4KK8D 2C3HA 4UILH 4U3HA 5DUBA 1BX2B 5I1EL 2ITCA 3OPZH 4IRJB 1SYSB 4JPIB 4LLWA 5CP3A 4Z0BH 3VXMA 3FOLB 4R0LB 1U2CA 4PB0L 1T80A 3H42H 2Q76A 2QADD 5DUMH 4FQHB 5IMLA 4OLYH 1CU4H 2P8PA 4MJ6B 1CGVA 5GS3A 1NFDA 4HF5L 4Z76A 4HEPG 5DUPL 4Z0XB 2W07A 2B1AL 4YFLF 2PW1A 3QIBC 4RFNB 3UZVB 4LLAA 1CG9B 3WFDL 3D0VA 4G9FD 3T65B 3PV6A 1EEUA 4Q9CA 2CDEA 3O3BB 1ZSDA 2WWMD 5ANMA 3VD7A 3L3GA 3SJVD 5JQ6L 4JQXA 4ZTPH 1D5IL 5E9DA 3SE4C 4I8DA 4PLKD 5JXEC 1G9MC 4NWUH 4X6FA 3PP3K 5IWLC 3HHRB 2BVQB 5IJKC 3WJLC 1AR1D 1JHKH 3C60B 3JWOH 3MRPA 4HS6B 3JWDH 4CRPA 3K0WA 1NPUA 5IBUG 1KTDB 4POZD 1KJVA 4ZS7H 1WWAX 1LEIB 2CUIA 3QIUB 4JAMA 1JN6B 4M1CC 2DLIA 4DOHE 2R4SL 1KJ2B 4M43H 1Q38A 2BHYA 1GXEA 2R4SH 4IIQB 3D3VB 3BSZH 2YUWA 1QZ1A 5E2WL 3STBA 2R9HC 2G2RB 3HG1E 5GGUB 4P5KB 4ZFGL 2VXTH 1KC5H 4WFFD 4OZFH 4G8FA 4MVBD 2ATPA 1J1XL 4P5TD 4I3RL 5E99L 1BVZA 4OJFH 3TBYA 4PRNB 1KGCD 5E6YA 5GS0D 5K9OA 4GBXA 2CK0L 3BN3B 5DK0B 2R2HB 4OFYA 3AM8A 3RL2B 4AYFA 4JZOA 3VJ6A 3H9HB 3CX5J 3O0RL 5HHOE 5I1IL 3CDYA 4HS3B 1IGTB 1F4WL 2LAGB 1CDHA 1FG2A 1P4LB 4GAGH 2CDGA 2ERJC 4WI7A 1HEZB 3L3HA 2VWEC 4RAUB 1JTPA 4WNQB 3LIZL 4P2OA 1TJHH 1U8QA 3SCMD 3PL6C 4P2RB 3PWUB 4EIGB 2PETA 3QRFM 3ARZA 2AK4B 1U8OB 4KI5D 4OCSL 4WV1C 4BSWA 5KSAD 4EQ3A 1XGTA 3AU1A 5J6GB 3C5ZC 4ODSH 6CGTA 4HWBH 1CE1L 2HKHH 2XXCB 1IQDB 1VEOA 4TNWF 1XF2A 2HKHL 4PGEA 1JZ4A 2WUCH 3VA6A 2J5LB 2APBA 1YNKH 5GS2H 3QO0A 1R5IB 3ZKQD 3VMNA 3L5JA 1UB6B 2GTWB 4OCMC 3G08A 2W0FB 4FTVD 1AP2B 4Z7VE 3MLSL 5IVXB 4HH8A 3MOAL 2I25N 3BKML 4OI9A 5IKCB 2BRRH 3UTQB 3ZLQC 3M07A 3R0NA 5BRZD 1MHEB 3CU7A 3NA9H 1RVFH 3QUYA 3PJSA 5I66A 1JNNL 3P4NB 2VDPH 5L8JB 3VGGA 2AV7A 3PABA 3CIQA 2AJ3A 5MEQA 1H0DB 4ZO8A 3UO1H 3E3QE 2E6QA 5JZ7D 2QJDA 4OIAA 4TVPE 1A0QH 1XZ0A 5JPMB 1KJ2A 3MFFB 1Z2KA 1S9XB 2R39A 4BH7A 3UJIH 2HJLA 4PJGA 4HK0B 3SQBA 3LPFA 2XQYK 3C5ZD 1FO0L 2W60B 5IB1A 5JO5A 5HI3D 5C3LD 3TH4T 4U1GB 1N64H 2VDLH 3MRMA 1Y6KR 3R1GL 1DQLL 3SBWC 1U8KA 3QUYD 4LIQE 3UPRA 2H32B 1O0VA 3B3IB 2H3NB 3T4YA 3QQ9C 3WFHA 3X3GH 4D94A 1A6ZB 4K3DL 3TIDB 4YX2L 3V6ZA 5DEGA 5A3ID 4PJHE 3X3GL 4OZFA 2AS5M 1URLA 2AQ3A 1HSAA 5FA4B 3T4AA 1EZVX 4U4BA 5I1AB 4O51A 5H2BA 4LSSL 3FQRB 3HE6B 3EGSA 4TRPL 1NGPL 2EDYA 5L88L 4RX4A 4M6OH 3HMWL 2XNAA 4JY6B 5ILTH 1RU9L 3G5YB 1DBAH 2JK5B 1VCAA 1RZIA 1QHPA 4XMKL 4XNZB 3RIFF 5HSFA 3BT2H 2BJML 3FN0H 2ZNWA 5ERWA 5JOPE 3HPJB 2FR4A 1MAML 3K2UL 3KYKH 3S37L 4UINH 3TH3T 3AS0A 5JDSB 1U95B 2GY5A 2BFVL 1E28B 5E6IA 3CDFA 3P4LA 4HWNA 1KENL 1J9CT 4XPTL 4LAQH 6FABH 5FO7A 4X7EC 1XH3B 3MV8A 5IG7B 5BOPA 4JFFD 1EUTA 5C0BE 1YUHA 4PLJD 1XGRB 2VTFA 4ODUA 4PRPA 1U8IB 3CH1B 1EGJL 3VCLA 4XBPB 3GMMB 3S96A 3EYOB 4GUPA 3AM8C 4EI5C 2DKMA 3GSRA 3LAFA 3UBXI 1UWGL 2YZ8A 3R4DA 3AXLA 3OGCA 1KB5B 2A9NL 1P4LA 4J2XA 3H3BC 4JZNB 4GG6B 3RPKA 2DLTA 1JWUA 1BM3L 2UWEE 5FO8B 4PLOB 4V1DD 3C60A 4XT1C 4PRAA 5F96L 3TO2B 1O7SA 2QSTA 4J1UA 4WENB 4HDIB 4NNXB 4P46C 5J9PA 5ALCL 1MRFL 4CJ1A 2VLME 1P7HL 3NMEA 5D71H 4W70A 5HYQA 3UJJH 3C6SA 1SYVB 4Y19D 1DVFC 1IT9L 3ZDYE 5C0FA 3LHPH 1PAMA 4KZEL 4FA8A 5DI8B 4UTBH 2BVUA 5CLTA 4Y4HB 3THML 2JTDA 3OWEA 2E8YA 1JFQL 4UT7H 5BMFH 1N6QH 3UJTL 5DJAA 5IFAH 2IALB 1G1YA 4Z7OE 4KK6D 3SE4A 4PJ8D 4C56A 1ZA6B 1M7XA 1N59B 5C70A 2YD4A 4MJID 4RFOL 1IEAB 4LNVA 4G7VL 4F7PA 2VAAA 5D1ZB 3VXSE 4O9HH 1JGUH 3UTQA 1RZJH 4PREB 1P7KB 3CDGB 3O45A 3OAUH 5A2JH 2C3XA 4Z95L 3X12A 5I66B 1NGZA 1I9IL 3DARA 4MA1C 2KH2B 3ULUE 4ELMF 2D7TH 4X4YA 3UMTA 4FQXB 3U7WL 2EC9U 2I07B 4JCMA 3MRPB 2HT3C 5F9JB 5D6DA 3QNYA 2EDBA 2ICWI 1DFBH 1H3WM 2HH0L 4LKXB 4KJPC 2IFFL 3MRNA 3RY6C 4QRTA 1R6VA 2R0ZL 1RVFL 3WD5H 4TULL 5J6GA 5EG6C 2BSRB 3F6LA 5EBMA 2IGFH 5SWZD 3VXOB 1AD0B 3CFDB 2HJFA 2XA3A 4X6BB 4HFWB 3UPRB 2VIRA 3CH1A 4FP8L 1WC7B 3SKJL 1YJDL 1QFWH 3GHEH 5F89A 4KTEH 5IB4A 2IMNA 1CDYA 5INDB 1PQZB 3VXPA 2EXWC 2EE3A 3T77A 4NQEA 4D9QD 3TPUA 1Q0YH 5EOCJ 3SDAC 4IIQC 5K9OB 2ZUQC 4P2RD 2EDNA 3LRHA 3PQYB 1PD6A 4KRPD 4TUKH 4OM1H 4QRUB 2NLJA 1ED3B 2UY7A 1DQLH 4K71C 3FFCD 3BI9X 1VADB 4ISVB 1FBIH 3T1WA 2ADFL 1A7NL 4XP4H 4LVNB 4L3CB 2OQJA 1QQDA 1ZLUH 4E41B 2VL5A 1NDGB 5GGTH 4LSSH 1CFVH 2XXMB 1UZ6E 2ENYA 1IGIH 3ZDXE 7FABL 3B9KB 3HMWH 4M6NH 5I8EB 3QHFL 1WTGT 1QEWA 4WHCA 4YXHL 4HKXA 2YPLB 2GJ6B 4RFEA 5D1XC 4PS4H 5I1IH 4CN6A 4F7EA 3MUGA 3QXWA 3ULSB 2JCCE 1N59A 4X98A 2NY0B 3Q5YA 3I02A 2NW2A 4NHUA 1CXIA 3EDJA 3QDGA 5MEPB 5F9WC 4H20H 4R96B 1N7ML 4D0CA 1P7QD 4JFDA 4WI2A 3CZFA 1BFOA 1OSZB 3CVHA 4IOFC 4RMWA 4EUPH 1JGLL 2Y23A 3QPXH 5EOTA 3V52H 4M7LH 1U8PA 3QFJA 2DJUA 3JV4A 4PLNC 4JFYB 4OD3L 3X14A 2EDRA 4OFKA 5HI4D 2A73B 1PZ5A 3JWDC 3OG4B 3T3PF 1YNLL 1IBGH 3OXRA 1A7RL 4PG2C 4XP6L 4YGVA 3HNVL 3TZVA 5JUEL 2K7QA 2LU3A 2AI0H 2AXFB 1UYWH 1EHLL 4M6ML 3PQYE 1HDMB 5C0DA 4NPYA 4HK0A 3O6FC 1JYNA 3B5GA 1NLDH 1D5XA 4CAGA 2DN7A 4KH2A 3WJJC 1MJ7H 2YWZA 3I50H 3FCTB 2HAZA 4YPJA 5HDBE 3DGGB 5J1SC 2IAMD 2FJGB 2E27L 4R7DA 4OF8A 1TVHB 4YLQT 4ONHA 1XT5A 3X13B 2AABL 1NSNL 3O3EA 5D7JB 4J3SA 3SKOB 1N5AB 3LQMA 3BX7C 2NLJB 1HILA 1LK3L 5C0NC 3FB6A 1J86A 1QLFB 1WTLA 2DQJL 2EDJA 4P46B 2PO6B 4NP4L 1J0IA 4FQ2L 2E9BA 2UYLA 3EGSB 5I1KH 2JJVA 1X5FA 3I3DA 3SY0B 3VI4E 1RJZB 3NN8B 3MRRA 4JFEB 3RKPA 1T21A 1OQOA 5KSBB 3PIQA 4WTZG 1K3IA 4M7LT 2YHGA 4ZOCA 3D25A 2OTPA 2OR7A 4YHMH 3GB7B 4JHAH 3DWTA 5J3HD 4XBEL 3VFPB 5DO2C 1P5VA 2B1HL 2YPVL 3BP7A 3QO1B 4RMSA 4JDTH 4XBEH 3GJFK 4HF5H 3CVIL 1KCVL 3B5HA 3QDGD 5FYKE 2F5AL 1UC6A 4Z7VB 1E4XI 5TDPB 3GMNB 1JWMA 1P2CA 2BNQD 4NRZB 3UXFA 3MLUL 1CI5A 1ZHKB 1OGTA 4OD2A 4X83A 1NC2D 5D2NC 4QGTA 3RTQA 3V4PL 1ZKAA 5A2KH 4O2FA 3WXVH 4HT1L 3TV3L 1E27B 2GK2A 1KENH 4WUUD 3HZMA 4HKBA 3OJDB 5FKAA 1IC4L 4P4RB 4Q6IA 5D7IF 4H0IA 4LOUD 4NZTH 4Y5XB 4AIZB 3O11B 3OHXA 2WLZA 3EOTL 1SY6A 3C5SB 2Z4QA 1LP9F 5EBLA 3BEWB 3ZT6A 4C59B 3DECA 1RHHA 3AROA 4HIJB 4OBSA 5FM8A 4L29A 1WC7A 4FQPA 5MI0C 2E7BA 3HAEA 3MGOA 3RL1A 1S7XA 4JFXB 1PG7H 5INDA 1T1YB 4YBHA 2C4XA 4NQVB 5DYOB 2EYRA 2NZIA 2N4IA 3QRGH 3RVVD 5CS7A 4WW1A 2ZG3A 4GAYA 4NKDA 5IQ9B 3UTOA 2WBJB 4BQBA 1Q0XH 2VZ3A 4Y5VC 4PUBL 3MUZ1 3O6KH 1NGYA 3BP4B 4B7IA 2WWKO 1QO3B 1MUJA 2VE6A 3VD3A 3PHOA 4XHJC 3OMZA 3VH8A 1DQJB 2EDTA 2Q20A 3QDHA 1NJ9B 1IGFL 3EYVB 3RVUD 1CTOA 4CMHC 2Z31A 3QUZC 4XVJL 5LGHH 1Z3GL 2VXSL 4O58L 2VZOA 1WWBX 4X7DC 4YDKL 4C57C 2VKXA 1OTSC 5FGBA 5CCKH 3FZUD 5GRYA 5GPRA 4GRMA 4RQQA 3U6RB 3DX7B 3WKMH 7CGTA 2HT4C 3ROLA 2FJGA 3QQ4B 1EMTL 4LVEA 1NBZB 1XGYH 2O5ZL 1FV1B 5HGAA 3WKML 5GGQH 4P57B 1VACA 1A9EB 4CUCA 3P9LB 4XNXL 4JQVC 5T33L 2XN9E 5CJBA 4UBDC 1BFSA 4GG6F 3LS5L 3WE6A 2YD7A 4F58H 3WCYA 2DBLH 5DEFA 4PJBB 4HLZH 4X7TA 5F3HA 1AE6L 1KGCE 3HA0A 4RBPK 3FTGA 1IM3B 4JEGB 4J3XA 4TPRL 5IW3A 2CRMA 3QBTB 5L2KE 1FAIL 4JJ5A 2ADJB 1XR9A 4XP5L 1BJ1J 1EDQA 3RWDA 3TESA 5FKAB 3UZQA 1V7MH 3IJYB 2ATKA 5CGYC 4N9OB 1I7ZA 4JFYA 1Z0NA 1FNEB 1UB5B 4OKVA 5CEXB 5FECB 1M05A 4U1KB 4Y4FD 4HC1H 1J10A 3RDTA 3QNXA 5F1NB 2HRPL 4OCRL 4AM0A 4P3CH 4M7KH 5C09E 5I1KL 2WV3A 1ZT7A 1YY9C 5KANG 1I1RA 2Y07L 5I8EA 1UKSA 1KSRA 2OJZL 3H7BA 4OLUL 2YD2A 2J88L 4HKZA 2BSSB 1IILE 1N5YH 1CFSA 4QCIB 3MBXL 4QHNA 1HH6A 1KCUH 1JWSA 1VFMA 5DDHA 4MD0B 4AK1A 4R2GC 4JFDB 2VLRD 5GRJL 1AKJA 3CNKA 2CO6B 3JBG7 5B4MC 4QHKJ 3U9PL 3P77B 3T0EC 3QHZL 2XZAH 1IAOA 2ED8A 4MD4A 4PP1C 1CGUA 1XGPB 3JUZA 4LLWB 4PJ5D 4N1CA 3BT2L 2P5EE 5L7XL 1MEXH 4P4RA 4RMTA 1JNHA 3WO4C 2CDFA 2LTQB 4XMKH 4BFIA 1K4CB 3G9VA 4JFFB 2GUOA 2EC8A 1D3CA 5E2VH 5K9KB 3V0VB 2A6KB 2AAVA 1EAJA 1MAMH 4NNYB 3VG9B 4RX4D 4HUUB 1KPUB 1TQCC 5JQHC 4NQEE 4ZOEA 5BS0D 3BISA 5L2KB 2VH5H 3KPQB 1J7VR 4L1HA 3V4VL 3S3JA 2YD6A 3OKDB 3PDGA 3FCTA 3T3ME 2NY6D 4NQVA 4WIQA 5DYOA 1ZS8B 5FUZL 5I17A 1BQLH 2XRAL 1UH3A 1UM6L 5D6CA 4GAYB 1LP9E 2EXYD 2O5XL 5FYJL 4TOYH 1I8IB 5J4MA 4PJ7F 3RVTC 3TYFB 1B0WA 4M6MH 3E6HB 2OL3A 4OZ4A 4UDTB 5E5MB 1QO3A 3ELAT 2A9NH 4FN0A 1OOAA 4EXPX 2PXYD 1FNEA 1UB5A 2FX7L 3J8F7 1U8LB 1JZ3A 3RX8A 1KCKA 5D1XB 4JG1H 2FO4A 4KC3B 5DFVD 5FA3B 3QNXB 3F58L 1N2RA 3PE9A 4FFWD 1BBDH 3LHPL 4PJ8B 4XB7A 3VDBA 2H26B 2NY5C 4JRWA 2IEPA 5FV1L 3ZHLA 1OSPH 5JOPD 3DXAE 3BRFA 4ZQKA 5LCVH 1FVEA 4ZUUB 4P5KA 1FLRH 3GRWH 2ATPB 4P9HC 2AJZB 5ACZA 3KPRA 3MLWH 5ADOH 1RHHB 2FZ3B 4NP4H 1FV1A 5DK0A 1HH6B 1IL1A 3RTQC 1UCTA 2DQCH 3ZTJG 5JLZB 4IHOA 2XQYG 1ADQA 1YQVH 5HGGS 3UDWA 3KPNB 4MNQD 4OZGB 2ZKHH 4QXGH 4BUGA 4PGJA 5E9DB 2QSQA 5DQ9A 1NCDH 4ERSH 1LNUA 4KUZH 2BX5A 3GMNA 1MCWW 5K59F 4ZAKC 3DSFH 3STZA 3W9DB 1WBXA 3CFJB 3IDUA 1IMHC 2HFFA 1QYGH 4QT5A 12E8H 2D9QB 3C6LC 3HNTL 4YDIL 1HK6A 1KJVB 1G6RB 1U8OA 2NYYD 4P23B 2B0SH 4QHLB 2F8VA 3U79A 1DFBL 1OF2A 5ABDE 2IAND 4DJMA 4E0RB 1KPRB 4P2OB 4JPVH 5MHSD 1KJ2L 4JRXE 4Q9BA 5DD6B 4DW2H 1C5CL 3MV9E 5GS1C 1G7QA 4CDHA 5KVDH 3HMXL 1NFDB 4KQ4H 3IETB 1L7IH 3ARFB 2R56L 2YOCA 4Z0XA 1ZS8A 4GJTB 3HS0B 3WIIL 5C0JA 1HIMH 1X5LA 4P3DB 1JGDA 5T3ZD 5HDBF 5ITBH 3GHEL 4DN4L 1G1CA 3TGXA 4ZDHA 4YDLC 2HFGL 3QUYB 3A6CH 2FIKB 3F7VA 5KVGH 1MCIA 2AVGA 4ODVL 4MAYC 1SBSH 4MD4B 1A7NH 3ECBB 4XP4L 5IJVB 3OTTA 4NQTA 4Y0GA 3MRLB 4GOSA 5IEHB 1K2DB 4OLUH 1KCLA 1PKQE 1YEHH 4HZLA 3QFDA 3LPWA 2X4RB 3HE6D 2ZNXA 4HXAH 4N90E 1D5BB 1QBLH 3O6LH 1X6NA 3HR6A 1W72A 4PG2A 3CFKB 3QA3A 2R0LL 5JW3L 2CMRL 1MELA 3BKYH 2VDNH 4HMDA 5HY9A 4XAKD 3AY4C 5ILTL 3U4EB 1DP0A 1HHKB 2Z8SA 1T83C 2QHRL 4U7MA 4I77L 5GGVH 3TT1H 2Q8BH 4HV8A 5EU5B 1ZANH 3O8XD 2PW1B 4WEMB 5E2VL 3EHBD 3HAEH 4NZUH 3BMVA 4BZ2L 3E2HC 2WZPD 3W0WB 5JNYB 2R0WH 3GM8A 4P2CG 3D48R 3PGCA 1IGFH 4PJGE 3STZB 5DD1L 3ZL4L 2NY2D 3VXRE 3V6ZB 3SKNA 3GZKA 3C08L 3P73A 4D3CH 3ARGA 4XXCA 1UZ6F 4PGZA 3IAGC 1ZVHA 4M62H 1CFQB 5GSRA 5JTWA 1X9QA 3UYRH 3GK8H 4OZHB 1FVCB 2RJMA 1XGYL 2V5RA 5DF0A 4K9EH 4A6YL 5D72L 3GMQB 3EOYG 1SMAA 2DLFH 1UM5L 5LGJA 1FVEB 4N0YH 2Y5EA 5FO7B 3H42L 4GT7A 3MMEA 3RNQB 2WBWB 43CAA 4UU9B 2JJSA 3BP6B 4XCYB 4OI8A 5I74B 1P4IL 1U8IA 3EJYC 4LLDB 2PYEA 3FQUA 3QO0B 5K9QG 3BDXA 1NBYA 4PJ7B 4R26L 1VFUA 3BRDA 2W0PA 1FE8H 1I9EA 4Y4HD 4HLJA 1OVZA 3WFDH 3NCJH 3SO3B 5IB3A 3IU4L 3PP3H 3L95A 5DHVH 4PJEE 3SDXB 2H32H 5IEHA 1NC4A 3ESVF 3V9FA 5DDHB 2VXVH 4PIRF 5EOQH 2YPKA 2HFEA 2HVJB 3MBEC 3VWKA 1P1ZB 1D5MA 1AR1C 4PV8A 4RGMC 4XX1G 3TFKC 4LIQH 2PTTA 4I0PD 3LRGA 3KPRE 1A5FH 1W2KT 3HB3D 3S9DB 1YEEH 3CLEH 2YEZB 2VC2L 3MODL 5F7EL 5GRXG 4ZUTB 3QZWA 5EU3B 4ODBD 3RY6A 2A6JA 4ZD3L 2X4SB 2WQ8A 3ULUF 1A3LL 2HTKC 1GOHA 4JANB 2JIXA 1SEQH 4XC1H 3DSFL 4PJGB 3REVA 4FQXD 1Q9LB 3OBAA 1TTUA 2B1AH 1X44A 4CN4A 1FIGH 2APFA 1A1OB 3FB8A 4F9LA 3QHZH 1RIHH 5CUSH 3MX0A 3F6IA 4JDTL 1U8KB 1YEGL 3O41A 1DL7L 3ARBC 5FDYA 4H1LG 1D5ZB 1W0VA 1CDGA 2YA1A 5HYJA 3B43A 4XPAH 1G6VK 2BY1A 3EJZD 1TJGH 4ODXB 4F7MA 4ZTPL 4FP8H 2ZSVB 2MCG1 3MJ7B 5J06A 4Y5YC 4XPTH 4GRWE 6FABL 5EZJA 1VA9A 1KEGH 5LBSH 1SJEA 1WWCA 2AV7B 3PABB 4FG6D 1JTOA 4DFIA 4GXVH 1C7TA 4WUKH 3GHBH 4Z77B 1Q9OB 1T5XB 2X4TB 1RULH 2C1PB 1OAQL 1EX0A 4OM0H 5EC1B 1YYLL 3GMOA 5DLML 4F7CB 4RGNB 5GZOC 5GSVA 2IH1A 2W9EH 3I6LE 4YHLL 1D7FA 2EDKA 5EUOE 5I1CH 2F53A 5SWSD 4YHLH 1MWAH 4YGAB 1A02N 1FGNH 5GJSL 2E7MA 4NQSB 2X9XA 4XBPA 2YPKB 2IPTL 3LB6D 2BNQA 3RA7H 1MPAH 3V0WL 1PW3A 1HQRA 1R3HA 1HHHA 4KY1H 5A16B 3TT1L 1DJSA 5C0BB 1X5XA 3IF1A 2VDML 3THMH 1E4KC 3QZWB 2I24N 1KTKE 5E8DH 4WTZA 4Q2ZA 3WLBB 1T1WA 2Y06H 3L1OH 3LIZH 4C4KT 4D9LH 3SDYH 3AAZB 1U0QA 3P2TA 3BD4A 4RZCB 3OKMA 3UAJC 4RFEB 1JE6A 2CIKA 5AYQA 5DQDL 2ZUXA 4I1NB 5B38A 4KUZL 4OLZH 5F9OH 5C08E 1NEZB 5E6IB 2X70B 3BUYB 3ILQC 4Y7MA 3TVMC 4XCFL 2X89D 5IB4B 1D9KC 1YECH 4DKEH 3IDIA 3IJHA 2NY1C 1I7RB 1D5ZA 1W0VB 4HPYH 4NKOA 1QRNE 5TPWH 2YKLL 4WFFE 15C8H 1GSMA 1MFAL 3RWHA 1ZLWH 4XWOD 1CE6A 3UTSB 5IF0A 5EZIL 1UGNA 2IWGA 1VGEH 5KANI 5DHVA 1ED3A 1MCDA 2YN5A 5DVNA 1G7IB 4KROB 4HS6A 3MRIB 1QFWI 4NFCA 1AQDB 4CW1B 4NO5B 4WW2F 2DL2A 1BFOB 2XY1A 4MHHG 4WY7H 4YO0A 3H8NA 4Z7UB 2CJUH 4OIIL 1L0XA 3TZVB 3SE8L 1WT5C 1A7OL 3IFLL 1Q9WB 3JV4B 4JANA 1T5XA 1L7TH 1ACYH 1E6OH 1I3RB 5D7IA 2FYYB 4KMTH 4TTDD 2VXVL 3GMOB 1VFBB 4HPOH 1L0QA 5MEND 1L4IA 1TNMA 4KI5E 4KHTL 2NXZB 2EKSB 5T1KB 5FGSA 1G7LB 4Z7VF 3ULSA 1S8DA 1NMBH 3FONA 2NW3A 1X7QB 1I85A 1ZHBA 2VZ1A 1HHKA 4KI1A 3LQZA 3W11C 3L3DA 1CDIA 4W68A 1QLRB 4RIRB 5C8JB 1XF5A 4R7DB 5L88H 4DUWA 3MNVB 4MDJB 2YPVH 4EN3B 3KPSE 4FQQA 1UM4L 5CUSL 4QTIH 2F8XC 4U6TA 3B4NA 2CMRH 3DETD 3WHE1 1T1WB 3KJ6L 5IMOA 4UV7H 5SWZA 2G75A 3D18B 3AU1B 3CFBB 1DVFD 3BD5A 5E5UB 4YFLI 1D5IH 4AQ1B 2CKBL 1DN2A 1W8OA 2Y1VA 1NFDE 5I71B 4XP9H 4YUEL 4GSDL 5K9JH 1HI6B 4U1HB 1NC4D 3HI6L 1GC1C 5SX5H 2I9TB 3TC9A 3DIFA 3QO1A 3IT8D 4PGCA 3K46A 4OD3H 1UT9A 2DMCA 1ZA3B 4N1HB 1U58A 4OD1H 4XMLH 4LK4A 2DD8L 2WWMC 1CXEA 5FUZH 4KDVA 2FLRT 1OAXL 5C07E 2GITB 3PL6B 2PYFB 1OD9A 2ZOKB 5CKGA 4PP2B 4OCXH 5JW4Q 1WFUA 3LN4B 4JM2C 2R0KL 1MFCH 4N1EA 4DGYH 1K4DB 3P30L 1MHHB 3K3QA 3VGBA 4OF5A 1NC2A 3HFMH 4DGYL 4KZEH 2AABH 1J1PL 1MOEA 3PHSA 3RA7L 1CGTA 3CSPA 4Q6IB 1SM3L 4TSBL 1QFHA 3ZTNL 3KLHD 4O00A 2DQIH 4YHOL 1I4FB 3RVXC 1I9RL 3DX8B 2AJSL 4MLIA 4MQXC 1ZEAH 5J57B 5FHBH 4JFOB 3HZVB 5D2LA 1VPOL 1NFIA 4AENA 3DBXB 4CKVX 2BXYA 1YY8A 2Q7YA 5E0QA 3G5ZA 5HHOA 3IXTA 4K3JL 1KJ3H 4OLZL 3I84A 5I16A 1OLLA 5BV7C 2YD3A 1DN0A 3OL2A 3HC0A 4Z95H 4X5WA 3FFCB 1EJ6A 1INEL 2RIKA 5E2WH 3SQOL 3ARDB 4O4YH 2QKIB 5FO9B 4NZRL 1N0XH 4D0DA 2BNRB 5SV3A 1UQSA 5GS2D 4DW2L 1VFBA 2FRGP 1A6AA 3BH8B 3WFEH 1OLZA 5GIRA 3ZE0F 5IMKB 3RVWD 1DSFH 4QRRB 1NDMA 1MCJA 4WI5A 1YNTA 4Y19E 2C3VA 5C2BH 5C08A 5EO0B 5IIEA 3QIBB 5KSBE 3LV3B 3L6FA 1CXHA 4PJ7E 3LKNB 4G7YH 1NMCC 1T7ZA 1JI2A 5KN5A 5IB5A 1IAIH 1MFDL 4ZSOB 3WUWA 5DEZA 4ODHH 2R2HA 3O3EB 5D7JA 1YPZB 2X89A 5J8OA 1NMBL 5FM5O 3TZVD 5DFTA 5D93C 1RULL 1I7TB 4M61B 2LU7A 3I75B 3VXSD 1TPXB 4WGVB 5I8KL 1NCCL 3GO1H 3PWVB 3QFJD 2VLRB 5ETUA 3VFSB 4YIQB 5C0IB 5IHZA 1S5HA 4RAUA 3BVNA 4G6FD 3VH8G 5E6ID 2HWZH 3DVGB 3GBLA 1JZ5A 1UCBH 5J12C 4N5UA 4QRPE 3EFFA 4G3YL 2Z8VC 1ZT7B 5I76B 1C16A 4BH8A 3QEHA 3X3FH 1IZKA 2NQCA 2D4FA 4R3SA 2VZUA 1EO8H 2FNBA 2VLJA 4H25B 3NIGE 2HVKB 4KXZH 3VFPA 2EDHA 1P69B 5HD8D 5AZ2H 4KROD 1N7MH 2HJLB 2VJXA 4BK5A 3B3IA 1KNOB 5GRWA 5T1MA 1FNHA 3G5ZB 1ZANL 4XPGL 5HHOB 4MZ3A 2CKBB 1PYWA 2A77H 2XKUA 1MFBH 1ND0B 2A77L 1GZPA 5HYEA 1B0GA 3WMSA 1Z3GH 2H3NA 4D9QE 4PR5B 4Y19B 5IQ7H 4P2RE 5FDWA 3V5HB 3NGBC 2OK0H 2WUCL 4G8GA 1GGYA 1W8NA 4OKVB 2P7TB 1IGCL 4E42A 2AJ3B 5MEQB 4N5EC 3B8SA 4XNXH 4K3DH 3R8QA 1ZVYA 3FQXB 2CDFB 5AD0B 1UYWL 4JHWL 3S88H 1EBPA 5DUML 1DEEA 3QEQE 2YK1L 3HI1B 3NA9L 4GW5B 3AREB 2V5SA 3UYOD 1G7MA 3BH9A 3G9AB 2A6DB 1MQKL 1A6WH 1YC7A 3GI8H 3IDJA 4JR9L 1DBAL 1QUNA 4H8WC 2P5WD 4EUPA 1QVOB 2ZPKH 3G6AA 1BJMA 3GI8L 1CWVA 1A3RH 4RGOL 4LGPB 1ACYL 1E6OL 2DM2A 4L3ED 1YEDA 4QRPB 4OT1H 3OG6B 3BXNB 3N1GC 1X4ZA 4PRDA 2HLAB 4Y1AB 1F3JA 3VCLB 3SDDB 2GYSA 1DLHA 1HXYA 4LQ1A 2OL3B 2HA1A 4NFBA 4APQA 3TO2A 1MJUH 4YHML 3GMRB 1A6AB 3BH8A 4BH8B 4FXGB 1T20B 4MA3A 5IEKA 4ZPVB 1JGVH 4F8TA 5HBBA 3BO8B 3CMOH 3KYNB 4P23D 2F19H 3PWLA 3TM6A 4TRPH 3CMOL 4P2OD 1CL7L 1H3PL 1M6OB 4NN5C 5DUPH 4YHIB 3H2WA 3ARQA 1VESA 2OZ4A 2CRIA 3MXVH 4O02L 5L2JB 2IG2H 1IL1B 5F96H 1YEGH 1UVQA 3BUTA 4JKPL 3VDCA 2M8XA 2CK0H 2XTLA 1YPZA 3P9LA 2RBLA 4K3EH 3ZT7A 5EORL 3O9WA 1K8IA 5C2BL 1QA9B 3D69B 1AKJB 3C5JB 4OFYD 3TV3H 1SEBB 1TJGL 2D7MA 1UXSA 1AHWC 4LEXL 3I6GA 4KTEL 2ZOKA 4YWGL 3OAYH 5JHDD 3ZKXC 5TE6H 5DK2A 3ARBB 4DN4H 2PN5A 2XZZA 3BQUC 2AEPH 3MRBA 3S5LA 3QXDA 2JK5A 3OKLA 4NNXA 3NTCL 3NZHL 2JKXA 1TTGA 5L9DL 4F15C 4EBQL 4HH9A 1RFDL 4KDWA 4ODSL 2VXSH 4X8XA 4TOYL 2HT4D 1OP5K 3A6OA 3A67H 2EIBA 2FECI 4G42B 3KR3H 3FQTB 4BUHA 5BV7L 2P43B 1AD9B 3LN9A 2E9JA 1FRGL 1QBAA 3LSOB 4I9WE 5DSCA 4ESKA 1R3LB 3D85D 3BZDA 4N9GA 5J1AA 1MRFH 3F58H 4NQEB 1XGRA 5DC4B 3EO1A 2WP3T 4LRNH 3U2SB 3NH7L 3LKRA 3D39A 3RPIA 3ULVL 2GJZB 3W0WD 4X5LA 3KHQA 2OM5A 4XWGL 1DQDL 4UNTA 4UQ3A 1HQ4B 4GS7C 3V6OA 4PFEA 4OZFG 2F54D 1G6RH 4QXUL 5C86A 5F6IB 4Z5RB 3O6ML 2X4RA 4HS8H 4JFHD 4TSCH 3D9AH 1RURH 1K4CA 1I3UA 4OLVH 4P9HH 4PPTA 5IQ7L 3SDCA 1NCDL 5ICXB 1M7IA 3VGAB 1UACH 3TCLA 1EERB 3HN3A 3A6BL 1ETZA 5EU4A 4XPFL 1NEZG 5E8NB 1PGRB 4H0HB 3MCKB 2FDBP 5IBTL 5EO0A 4K9EL 1E6JH 2A6IB 1JIBA 2O5ZH 4NGHH 3Q6GL 1MFNA 1XF3A 1N5YL 3CD4A 4QRPA 1V3MA 2K9UA 3HI5H 3RVTD 3QDMA 4YC2C 1AXTL 1CVRA 4MNGB 2J8UF 4PJAF 3UPAA 4HLZG 4XC3H 5FF6A 5C9JA 1DLHB 1MQKH 1UKQA 4XP1L 5CGYD 2NXYD 2X4NB 5HI4C 3TA3B 3MLTA 1KFAH 3CZFB 3IRPX 4L8SA 4XGZA 1H8NA 4X9IA 4LSQL 2LFGA 4HJJL 5KJRH 4KJYA 1T0PB 2DQJH 3QIWD 4KHXH 1JL8A 3GSOA 3ZSTA 1U93B 3MR9A 3ZHKA 4HBCL 1U8JA 3FRUB 1WAAE 4KK5D 2BSTB 5E8PB 3RFZC 3I6KB 2M2DA 2MCPH 1LDPL 2VLJD 3LVEA 4HUNB 1AGEB 5CFHA 2NY6B 1BEYL 2YA2A 5A43C 3QB7C 2YRZA 4S1RL 2IH3A 3VXQB 43C9A 2DYPA 2XTJC 1TQBB 4K23L 3O2DA 1TCMA 1R5WB 5KSBF 4LCYB 2P4AB 5DGQA 3PGDA 2JF1A 4JE4B 5GGRA 4PGBB 2FX9L 4J3TA 3WNOA 3ZE0E 1FO0A 1HXYB 4JQIH 1R3IH 1GC1L 4X4XA 3L3OA 2L4OA 3MRDA 3H3PH 3DV6B 4QRRE 2P8LB 3QUXA 4F80A 3QQ3B 4HFUH 4X6DA 1OTTC 4JZJC 3B9AA 4Z6AT 1FG9C 3B2VL 4L8CB 1DEDA 1F8TL 3VD9A 1D6EB 4XP9L 3EO0B 4YUEH 4HKJB 5MENE 1G9NH 5C0CA 2F5BL 1IC4H 4Z76B 4G8FB 1EV2E 4UDUA 1CK0H 3RWGA 2XRAH 1ACZA 2B7DT 3FO0H 5C2UB 3GK8L 3KXFA 1WIUA 3C2AL 3MJ9A 5L9DH 1YPZE 2MFNA 1RJYA 4B5EA 2C9AA 1DBML 4WHDA 1JHTA 4G6MH 3DVFA 1TTFA 4HS3A 4LHUD 5ID1A 1JNLL 1AC0A 3OAUL 4TUJA 5D6DC 4WI3A 4JCLA 4X5XB 1FRGH 2UYLB 5F6IC 3EDDA 2GJ6D 2JELL 2A83A 3HFML 1MCSA 3ULUL 2J8UB 4URTB 2A9ML 4HUXB 5EZJB 3AS3A 5EO9B 4M03A 5F44A 1KTDA 2Q1EA 4HWBA 1T6WA 5CINL 2Q8AH 4K94H 5HTSA 4KY1L 1T03H 3OX8B 1I8MA 5EBLB 1OGAE 1FLRL 4Z7UF 3AB0C 1U8HA 1BQHA 2AEQH 4NQED 3VXUD 1XGQA 1AGDA 2P24B 3VFMB 2X1QA 3MUJA 5JOEA 3GUTB 1CD1B 3CFCH 4JKKA 4IS6B 1X5YA 3LSOA 5DSCB 3HUJB 1FAKT 3G08B 3BPOB 4UOJA 2V9RA 4OCWL 5ENWB 2Z93A 2E8ZA 1A9BB 3H0TA 5EUKB 1BD2D 1Z5LB 1B6DA 3HNTH 4YDIH 3CCHB 3KPPA 1D5MB 3MJ8B 4FFZL 4JRYE 4KKLD 4ZFGH 3C2SA 3C09B 1XGTB 2DBLL 3HI5L 5F7DA 3K1KC 4PGDA 1NMCB 1N0XL 1Z0MA 5FUCE 1CXFA 3MOBH 4K7FA 4QKXB 4HMEA 1NKRA 2X4TA 2FL5B 5I6XC 5B38B 2HT2D 2IGFL 2J6EA 2VLKA 1WIOA 1BZ7A 3RWJB 3PWJA 5IMLB 4CMMB 3QRGL 5BW7A 5CZKA 3BEWA 2EYSA 3DXAD 3KWWB 2BVPA 5EU4B 1T1XA 3FQWA 2QQLH 4X6CB 1L9MA 3T08A 1DANU 4QY8B 1IAIM 3JWOL 1TXKA 4YEEA 2X4OB 5F7HA 2AJYH 4W4OA 4LEOB 2XT1B 3MYJA 4F2MB 5KW9L 3B8YA 3WFBL 4ZFOL 3RX7A 3DX7A 1HQRB 1BVLB 2Y07H 5A16A 3GJFB 4PJDA 4Y1AE 3HE6A 4H1LH 3CFIC 4P57A 1JUFB 3BSZL 5C7XH 1OGAB 1D9KB 1OWRM 1GGIH 2EECA 2QQKL 2XNAB 2YD1A 2AERT 1IEBB 1MHCA 1KIQB 1CE1H 3G04A 5ISZE 1EAPB 1FORL 2PF6A 2VE6B 2O5YL 4OB5H 1DCLA 3SN6N 3VH8B 4P5MB 3ZE1E 3ILPB 4MJ5A 1AH1A 3PWNA 1S9WB 5KVFL 3FONB 1RJCA 5F21B 2IANE 2WIIB 1F6AB 1FP5A 3BKMH 3K4DA 4HJ0D 4KRLB 4GRWB 5FHAH 1XGQB 2F74B 1CD1A 1T3FA 4M9OA 1U36A 2P8PB 1QSED 4Q0XH 4XCCH 3EYUH 1RZ8A 3I50L 4ENEC 5F88B 3EHBC 3KDMB 1JRHI 4P5TB 1LO0L 4Z7QF 4PJHF 2IBZY 4R2GD 2Q7NA 2EIZA 3QDJE 5D7LA 1U3HB 3GSWA 1EK3A 3GSXA 5JHLH 1JGLH 3LKSA 1NCAH 4PJFE 1WT5A 5T1LB 4YAQA 1V5JA 4GRLA 3KPLA 1KXVC 2GFBB 1BZ9B 4FXKB 1NMAL 4X6CE 2HTKD 4Y16B 4MA1B 5GGQL 3VRLE 3BKCH 4C4KO 5F7EH 4NGHL 2XA8L 2NZ9D 3VFUB 3BZFA 3QQNA 1NCTA 4U1JA 4N90D 4WU7A 4DGIH 5C0CD 4OUUA 5EB9A 1I1AB 4CU8A 4DVRL 1ZVSA 1CU4L 2P48B 4GQ9H 3GSOB 1R5VB 4G80A 1V7ML 1F00I 2P5WA 4L4TB 4XAWL 4Y4HC 1ZLUK 5IROC 2E27H 5ALBH 4R26H 3GIVB 1RU9H 5EO1B 2WIMA 3RWHB 4HIXL 3TN0A 2J8HA 3C5ZA 1OTUC 1XCTB 3WS3B 2E7LA 3MBED 3CX5K 1CLYH 5FCUL 3TEUA 1KIQA 1QFUL 5ESQB 4RA3A 3RWEA 1ZHLB 2Q6WA 2OR9H 4RNRA 3DGCR 5ACMA 1A5FL 2DB8A 2CRZA 3JWDL 1H5BA 2P46B 3VI3E 2AK4D 5ESAA 3LKQA 1MCPL 1WZLA 3WIHH 3RVVC 1T2JA 2P5EA 3HRZB 5LAXA 4IRSB 5TDOA 4MJ4A 2OR8A 1CF8L 3DMMA 4HK3J 1SHMA 5FYJD 1FFNA 1J11A 1CGYA 3FQWB 3IXAA 4GBXC 4JVPA 1P5UA 1NEZA 1IC1A 5CBAB 4JFDE 4L5FL 4LEOA 2MTPA 4PREA 4H8WL 4G8IB 1IKFH 4WTXA 3IDXH 5E95B 1KYOJ 4OZGA 4PJXB 3V2AR 3AS1A 4M4RA 2APTA 5KVDL 4Y2DC 5T5NF 3NZ8B 2PYFA 5H2BB 2IPTH 1HKFA 2O61A 3T4YB 3O2VL 4PY8I 4FQQB 4LARL 2QKIA 2Y5TA 4LGRB 2FH6A 2R1YA 5B3JF 1NANI 3VRJB 3O2VH 3VG0L 4MXWL 2X7LB 3BFOA 5IHUL 1DN0B 1KB5H 5DJ0A 3BW9A 4YO0B 2SEBB 3MRFA 3UAJD 1BBJA 2R2BA 5JA8B 2IQ9L 5FB8A 1HN1A 2AKRB 4LSVL 2EDDA 4HG4K 3QULB 3IJSA 4JQXC 2JCCA 4U7SA 4L9LB 5E94A 1OY3B 4LSUL 4P2YA 5GZOD 1ZGLA 4GQPH 2FX7H 4P5TC 4JM4H 5HYSG 1FGNL 4MXVE 5JORB 1J1XH 2R0KH 2JJTC 4WI4A 5GS0L 4OLEA 3DMMC 1QOKA 2F8OA 3OKDA 2FIRT 1ITBB 3ARXA 1A6TA 5JW3H 2VSDA 5JXAH 3WXWL 4MZ2A 5IB5B 4CL7A 3NCBB 4S1DD 2MHAB 3UCRA 1PZUB 2G60H 3DLQR 4L1DA 2FO1A 2VOTA 3MV8E 5J1TC 3S96B 5ESAB 4JG0L 4NRYB 2AK1L 3DXAB 1MHHA 5C07B 3VWKD 3MBEA 4PJCF 3VWKC 4I2XE 2FJFB 4XNMA 3QEGH 4JM2F 2V2TA 3CSBA 4LPCA 4PJXE 3ZMRA 3RGHA 1FFNB 1RURL 5F9DC 3T0ED 1KJMA 1U91B 4NOFA 4HJ0C 5HHPA 4Y4HA 4NQDA 3Q1SH 4XVSL 3ILQD 5GGRY 1KEML 1A2YB 1SVZA 5IVNA 4HPYL 3BE1H 3MUY1 4K7PL 4XCNB 5C0JB 2NCMA 4W6YB 4XCEB 4I0PB 1JGDB 1J5OL 1OSZA 3CVHB 4N0YL 3TN0B 5HHXH 1VHPA 4D0CB 1GIGH 4LDOB 2GAZB 4JFPB 1FAIH 1QRNA 1I1FB 2QLVB 5T1LD 3RGVB 5JHDA 2CQVA 2X7LA 4PJEA 2O93L 1F97A 1P6FA 4OIIH 1I7UB 4Y5YB 2BK8A 1NL0H 1V7NH 3WKNA 1MAKA 5HHME 3LCYA 1F4HA 3S97C 1S5HB 4FQ1H 4NDMB 5JPNA 3TBTA 1KPVA 3U36A 4U1NA 2H41A 1DQMH 1AGBB 2EKJA 5L7XH 1QR1B 1RZGB 2OYPA 1HHIA 2XQBH