5A40E

Crystal structure of a dual topology fluoride ion channel.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYWSYQEFTVPGSKTATISGLKPGVDYTITVYAYWEHMYHYSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PUTATIVE FLUORIDE ION TRANSPORTER CRCB
publication title Crystal Structures of a Double-Barrelled Fluoride Ion Channel.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 12
structure length 90
sequence length 90
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a40E00
4Y5XB 1FL6B 5D7SH 2CIKA 1VFMA 3BEVB 1ORSA 4NCC1 1RV6X 4QHNB 3ARED 3O6LL 1MVUB 4NO2A 4PJBF 3FT3B 4KQ4H 2NY0D 5F6IB 5JUEH 3W9DA 2NYYD 4LOUD 4OZIA 3PDOB 4PS4L 1XGTA 3TVMD 3TN0C 3HS0B 4NJ9L 3VXQA 2W07A 1YEIH 5F6HJ 4CRPA 3VGFA 2EC9T 2UWEE 1AE6H 1FC1A 3JV4A 4ZAKB 3RVTC 15C8H 5CP7B 5IVZA 1OQOA 3ZHDA 3N9GL 5EOCJ 3DRQA 1FNAA 2WQRA 1DUYB 4X9BA 1OGAD 3NZ8B 5ETUA 3L7FB 4JN2A 1Y0LA 5FYLL 2D4DA 4IJ3B 4WDIA 1OAZL 4EXPX 1ZANH 3FB7A 5I71C 1RPQA 3IS0X 3QUZB 4PJAF 3DECA 2H41A 3QG7H 4WW1A 4Z7UF 1P9MC 1G9EA 1RHHB 3LHPH 4WNQB 2FHCA 2BJML 2DMKA 1G6VK 1QQDA 4OZGB 1V7ML 3ZKSD 2HTKC 5SWZD 1KEGL 5SWQA 3TZVB 5D7LA 2KPNA 4NZRH 1B4JH 4K94H 4U1KA 1BD2A 2R56H 3JV0A 4HKXB 5BV7C 2IFFL 4HQQH 2JCCE 3FFDA 3QAZC 1S7QA 5F70A 2OZ4L 3U82B 4XAWL 5HVHB 2XWJB 4K3EH 3UJIH 1ORQA 1DQQB 4LU5L 3L6FB 5HYEA 3AS1A 1RIVL 2P47B 4XP6H 5GRJH 2EYTB 4FQXA 4ZFZA 3GSUB 3CFJA 3IRZA 3R0NA 3WFEH 1F4XH 3HZMB 4G5ZL 4S1RL 1CDUA 3D1MC 3ARYA 3PNWB 3O81A 2B4CH 3NIFE 4YK4C 5AWNH 2VE6B 3VRLF 2B2XH 3EOBB 4BQBA 3IB4A 4IRJA 3DROB 2XPGB 5DJDA 2HTLC 1FFOA 2BCKA 4D9QD 5I8OL 3RL1A 2R9HC 3CUPA 2IFGA 1N3NA 4WV1A 3MRJB 1JE6A 3HMWL 3O41A 5ISZA 3LEYH 4YJZL 1GGCH 3PJSB 4HKBB 5GIRB 4E9LA 4NPYA 2VJXA 3GMLA 4Y19B 5IWLC 3HAEB 3S7GA 2V2WA 3TBWA 3JWOC 4K23H 1IAKB 1RFDL 2K7QA 4IDJH 2HLFC 3QDJE 2EDHA 5MHSE 1PG7L 3ZT6A 1BQHA 3L5WB 2RCSL 2BVOA 3PGCB 2FR4A 3TH3T 3MOBH 4PJBA 3SE8H 4PFEA 1TCMA 4H8WL 2DI7A 3MBED 4F3FA 3IGAB 4O51A 3HUJE 4UB0H 3O8XB 4D94A 3SBWC 4YPGA 3DSFH 2YBRA 3ZKQD 2J8OA 1I9RL 1CFQB 1WIOA 3C6SA 3PXJA 5TE4H 1A4JA 1KXVC 3UPRA 1EA9C 1T6WA 5IIEB 5HHOE 5IVXF 3U36B 4I2XB 2R4RH 5F89A 5GS3A 5IFAL 5L8KB 1AFVH 1ZMYA 2BSTB 2CLZB 4YHLH 5C2BL 4CVZA 4L1HA 4XPHL 3OF6A 3WFZA 4UAOB 3UJTH 1S9WA 3BH8A 4PJAA 5K9OA 3QG6A 1Q9KB 1FQ9C 1J0KA 1Q0XH 4Y1AA 2IMNA 4CVUA 3RX5A 2QQKL 4ZXBB 1E28A 2YPKA 2PXYC 5E4IA 4Z7NE 1I9JL 3RJDA 3I2CH 3RZCC 4DCQB 5GSRA 2P5WA 4E41E 3PIQA 4HIXH 1D9KB 3LN4B 4Z7VB 1EO8L 4QNPF 5IHUL 3MO1A 1FZOA 2QR0A 2MFNA 2A9MH 1CFVL 2VSDA 3TNMB 4DFIA 2YZ1A 1IZJA 4X6EB 4XXCC 5EOTB 4WRLA 3S5LG 5C0FB 3C5SB 3PWVB 3C2SA 2GJ6B 5FYLD 4JPWH 2HN7A 3WDIA 3ZKXB 4LL9A 4RNRB 4LCCB 4AG4H 2VKWA 4M8QB 4GW1A 4OLEA 8FABB 3BIKA 1VPOH 1S7XA 1BP3B 2F54E 2ZUXA 5D7IF 7FABL 1MFAL 4KK6D 4RGNB 4BSVA 2DQUL 4D3CH 4LGSB 4NT6A 4XP9L 1FN4B 4KI5C 3HMXL 2AJVL 5F1NB 2Y7QA 1YEJL 4TSCL 1LEIB 1X7QA 3QXVA 4PD4K 5C09A 4OCLC 1KNOB 4MA1C 2EKJA 4LSTH 3EKCA 1PKQE 1GZQB 4WI2A 4NDMB 5IB4A 3QIUA 3D18B 3X3FL 1RJCA 3ZKNC 4C83A 1QFHA 2Z8WC 5FXCH 1JZ4A 4CN4A 4JY6B 2DB8A 4ZG1A 3C9NB 2A73A 5IHZA 2Z93B 3C6LB 3TJEH 3PG2A 5ANME 4XPFH 5TPWH 2Z8VC 1QPXA 5JLZB 1JF5A 5FO9A 4OZFH 4OQTA 1KIQB 1OF2B 5F1IA 3RWHB 2PCPB 1AHWB 1NSNH 5CS7A 3L3DA 1IKNC 3ELAT 4X6DF 4M62H 5DFVD 3SQOL 3HC4L 5EUOF 3T4AA 5C07B 2EIBA 2EXWD 2VR5A 3V5DA 1T22A 3QWQB 1XGRB 2XYCA 4L4VE 5IVXA 1CICB 3UMTA 4LASH 4YX2H 1OTTD 3KPOB 4U2YA 3JVGA 3QI9A 5J12C 3RIFF 4KZDH 5CWSB 3KWWA 4JZOB 3S96B 1JYNA 2EDLA 5FV2A 4ODXB 4UUJB 1T1XA 1G0YR 4AM0B 5HDQL 2A6JB 4CN6A 2DQGL 4ZUSA 4KAQH 3VWJD 3EYOB 2YC1B 1T0PB 5T1LA 5EO9B 2P7TB 1QEWB 4MNGA 2HWZL 3OJMB 3ZTJG 5HPMA 3P77A 1F42A 1JF6A 4ORGA 5EU7E 1NEZB 3PHSA 3DIFB 2MQCA 5B8CC 2X05A 1D5MA 1WIUA 1UWGH 1NCDL 2GT9B 4RZCA 2IANE 5J6GA 1BJ1H 4DVRH 1WAAF 4FABH 1BHGA 2PTUA 2B0SL 3OGOE 2XA8H 3HFML 5CD3A 3IKKA 3VXUB 2ADIB 4AENA 3K3QA 5JW4N 3FT4B 1U8NA 2CDEA 3ZHLA 4KGJA 3X13B 4XPBH 4JFDA 3B9KB 5C08B 3EO9H 5B4MC 5MEPA 4QXUH 3LKOA 3VD7A 5JQHC 2WLZA 2VITB 4LCUA 4N9OB 5D7IA 5JHDA 5HGGS 3QHTC 3VD9A 1MCKA 1FAKT 4I0CC 4OCSH 3LPWA 2UVFA 3O2VL 4ZOEA 1IGJA 1F58H 3BWAB 4H8WC 1ED3B 5FV1L 2J4WL 5D7KD 1AO7A 3QJFA 5GGVH 5CBAB 1G7QA 4PJIE 3G5VB 4TVPH 4W70A 4DGYL 1KCRL 3ZL4L 2DWDB 4FQLL 2RJMA 1A2YA 3IFNL 2FIKA 4CUCA 2C7UA 4TUOB 3O2DL 1EMTH 2FWOB 5D4QA 1IC5L 5B39A 1XF5B 2VZOA 3NTCL 5BVPL 3MXWL 4FZEH 4KHXH 5HHNA 1S9XA 2AP2A 1EAPA 4OFYD 2LVEA 3F8UB 1K5NA 4GRLA 4Z9KB 2DBJA 3NAAL 2GIYA 5I1DA 3KHQA 1R3IL 4NC2B 3DXAD 5BOZG 4WHTB 3BQUB 1TQBB 1E4WL 4JANB 1X4YA 4KRLB 4WFHE 1BJ1J 5EUOA 2A6IA 2DLIA 2DQHH 1C5BL 4X9FA 1KIPB 1S9YA 3MRMB 4S1SH 1FZMA 2ENYA 5LGHH 4M03A 5JR1L 1D6VL 4G9FB 1CXEA 4Z0BH 4MMZC 1B88A 2MCPL 3TBSA 4HGMA 4ONOA 1OAUL 3KPRB 1L9NA 4X4YB 5I9QB 3GJFK 2HVJB 4L3EB 1K2DA 4X7DC 3CFKB 1SJEB 4JRXA 1LILA 4XWOD 3ZYIA 5IJKA 4JHBA 1BFVL 4MNQB 3W9EB 2R23A 3MRIB 5F9WB 2IWGA 4Y4HB 1J1XH 3WIFB 2R1XB 4OF8A 4XVUC 3VGAC 2H2PC 2VISA 3G6JB 3H9YA 3QXDA 3ARWA 1A47A 1YNLL 4Q9RH 4U1HB 2WP3O 4JY5H 4DGVL 2VERN 2FD6L 4J1UA 2CXGA 5EU5A 4GAJH 3VW3L 1IGTA 1MJUH 4WI6A 1HILA 5SWSA 2NXYC 1IGCL 4PLNC 4U1MA 4AK1A 1WAAA 1EGJH 1P4BH 1GIGL 3VXTA 5CJXC 4DN4L 1MUJB 5FDWB 5J57B 1G6RB 2HVKB 3P4OB 1AY1H 3TGXA 4MLSA 5HY9A 3TCLA 4QRRA 3RWEA 3BDYL 2EIZA 4NN7C 4G80A 2BSRB 1CD9B 4YC2B 1FGNL 3U0TA 1VKXB 1K85A 5CEXB 1HSBA 1P4LA 1BREA 1P6FA 4R8WL 2ZPKL 4Y5XC 1G7PA 3KAAA 1FPTL 1Q1JL 4S0TD 4R7DB 3EHBC 3MRDA 4LSRL 3D3VE 3SE4A 5DVNA 5JQ6L 5F6IC 3SY0B 3TIEA 3WFCH 4U1LB 4MHHG 1ZT1B 3RWDA 1BGXL 2XTJB 5GGSY 4YXHH 2BVQB 2JK5B 4YHKH 3SKMB 1CFSB 2AW2A 1P7KA 4NC0B 3VFRA 4ZAKC 1BD2D 4NHUA 4ZUTB 4KK5C 2DQDL 4OGYH 1FNEA 5GISL 4GLRI 3UAJC 1TXKA 4XNXL 5K9QI 1PFCA 2OSLA 3OGCB 2I9LB 1R3JB 3SKJL 3OKEA 2G75B 5CHNB 5IR1B 3UTPD 4L3CB 4X6FA 3QUZC 4DJMA 5GGSA 1SEBB 4IMKA 3TO2A 1ZA3A 2BY3A 4V1DE 5ALCH 3WIHL 1MF2H 2YWZA 3VXOB 5AD0B 3KDMA 1C5DB 1EFXA 4HUXB 5ID0B 3QFDA 4POUB 4JFPA 3QRFM 2H6PA 4ZFGH 4NO0D 5DF0A 4L8CB 5GJTL 3W0WD 2N7AA 2OL3B 1P5UA 3V79C 3SKOB 5HVHC 1U95A 2XA3A 2XICA 3TN0A 1OSPH 2D9CA 3RAJH 3MODH 2C3HA 3Q1SH 4KPHL 3HI5L 1HOCB 4MAYA 1BF8A 1MI5E 1VENA 3MV8E 5HGDB 4FQIL 1FH5H 5I1EH 5EU3B 2FCBA 3IDGA 1WCBB 3RTQB 1F8TL 4K3HA 1R3HB 1WGOA 2OMNA 5MERB 4HWBL 1F4AA 4M1DL 4JLRA 5I16B 4PBVC 3P11H 4ZS6D 1OTUD 4QRUB 1HHKB 4FQJH 1OAYL 3WFBL 4ZSOB 2APBA 5E1AA 4HKZA 4ZODA 3EIFA 1MCPL 2A0LD 1MCRA 5HHVH 1S7TB 1P9MA 3KYAA 3QIWB 4TNVK 3W5MA 1U8QA 4R3SA 3DHMA 2V2TA 3QB7C 4JO3L 3KS0H 3BDBA 4OZHE 3GB7B 4NWTH 2DQJL 1CGVA 2HFEA 4XWGH 4HIJB 1QYGL 1S7RB 3C09B 2G5BB 3PL6D 3RWFB 4RGMB 1TZHB 4XMKL 2E7LC 4I5BB 4ZXBD 1U91A 1VEPA 1IE5A 4G6FB 2PYFA 5F7HA 4Y1AD 1DBBH 4MQXC 3QUYC 5JIHA 3O8XC 5T3XL 1FNGB 3GJFB 5DJYB 5K33A 1RK1A 5LQBH 1UJTA 1KJ3L 3VXSA 1E4KC 1MRDL 3MNVB 4NRZB 1BBDL 3VRIA 1ZGLB 3VGDA 4YR6A 3D5OF 1GOHA 1TZGL 5JPMB 1MCEA 5GGQH 4RMSA 1U93B 2BOCA 4KI5F 3WUWG 4Z0XA 4UIKH 4YUEL 3O4LE 3IYLW 1KBGH 4YDIL 1LK2B 2OK0L 1KC5H 1L7TH 2H2SD 3UP1A 1I7TB 3WUZA 1AXSA 4HF5H 3RL2B 1CXHA 3MQIA 4XT1C 3RA7L 3TNNA 5FKAA 3WXVH 4BK4A 1QSFB 5HVFB 1C7TA 2NY4B 4UAOC 2WWMD 3BN9C 5FOJA 4MD5B 2OR9L 4BQ9A 1CD1B 2R1WA 3VFOB 4PRNA 4JB9L 3X17A 2W60B 4XCNB 5IWLA 2VXVL 1JNHB 2HA1A 3DURB 5FO7A 4LLWB 3DX6B 1VADA 2PYEE 2GAZB 1IAII 4P3DA 1B0GA 5EBWA 2X4RA 3ZT7A 1UM4L 1D9KC 1H15A 4M6NL 1CDJA 3L1OL 2C3VB 5E5UB 4QGYA 4OTXH 4ZNEA 4BH8B 2Z91A 1U8JA 4UTAL 3KLHD 3MRNB 1PYWA 2HG5B 4OLXL 2ZOKB 3SBWA 4WENB 3UCRA 5MP6H 2AEWA 3E6HA 5A16A 4LCCC 2FBJL 1WIPA 2VO5A 2J8UE 4LAJH 4BYHA 3FFCA 1BX2B 4MWFA 5F3BB 4PREA 4QWWD 4RGNC 1J10A 5DVOA 2BRRL 1RJZA 5EPMB 3QNXA 5J1TC 5E4EB 1I7ZA 4IS6A 5L7XH 3EYVA 1EVUA 5TF1L 8CGTA 1P1ZA 4NYLB 5FYJU 1G7HA 2NTFA 2I60H 4WUKL 4HLZG 4Y5YB 4FQQA 2PXYA 3O9WB 5GS0H 3O6ML 4PB0H 4C4KT 3CMOH 4TYUA 3PABB 3RZCA 3MYZA 3C6LC 3MR9A 2IPTL 4JM2B 5F9DC 3D39D 2V17H 3J7HA 5C0AD 4ZS7H 4Q2ZB 3P73B 4YXKL 1HYSD 1AHWC 1HXYB 1EAJA 5GXBB 4G8EB 5F72S 4XXCA 3WHXB 5DD0L 1XMWA 4MDJB 2Y5TA 3O0RH 3B4NA 5IEKB 3TBVA 2GTZA 4H5SB 4JJ5A 3FO0H 4MS8C 4DAGL 2FSEA 3VGHA 5F44A 1CICC 1NDGA 1ZHLA 3LB6D 3QXWA 4E5XB 1GHFH 4HX1B 3RIAF 4EN3B 4ZUUA 1RURL 1ZHBA 4O58H 3B9KD 3GZKA 3KPQB 4L8DA 4YHOH 2VL5B 2NX5A 1IC7H 3FQNB 5DGRA 4P2OB 1LO2H 4Y4KD 4PPTA 1V7NL 2OTPA 5D1XB 2GHWB 4QOKE 5FUCE 1AGFA 2DM3A 5JHDD 5MEQB 1FSKB 3NFPA 4P23B 4UU9A 3KLDA 3MJ8B 4P2QA 3H3PH 1BIHA 1YMHA 4MXVE 1DBKL 2ZKHL 3AMKA 5L0QB 4IDLA 3QDMD 4IIQB 3CZFA 4PV8B 3CCHA 2UUDH 5JOPD 1IKNA 2BZDA 1CN4A 1LO5A 3QQ3B 1EH9A 4GRMA 3WLBA 4NQDD 1WFOA 4W6XB 5KS9E 4OD1L 4RA3A 1N2RA 5DK3A 4N0YL 4HWNA 3DHJA 5EDXA 4Y89A 3DTXB 3GSQA 4WUUA 1LE9B 2YD6A 2X9YA 5F88B 1MCIA 3BQUD 4KQ3H 2EH8L 4XVJH 3VG0H 4MCZB 2A74B 1NC4A 5E08L 1MFDH 3KXFB 3IVKA 5ADPH 2NMSA 3O3AA 3IDIA 2E9WA 5FGSA 1NC2A 1DEEB 2YN3A 1Z6JT 4RQQB 4R2GD 4ORZC 1ZLVK 5FECA 2Q1EA 1LK3H 2ITDB 3V95A 1NFDB 4P5MB 1DQLH 4HGKC 1G9NC 3GMQA 5J1SC 3BUYA 4XMPL 1ADQH 4LSPH 1VFBA 4GW5A 4NRYB 3TA3D 5B8CA 3CSBA 2ESVE 3LMJH 1ZLSH 4KXZH 1D5ZA 1XH3B 3PV6A 1RJLA 1VFUA 5BXFB 4LNRA 1U3HB 3LSOA 2IAMC 4FZ8H 4MJIA 4U1SA 2RIKA 1GZPA 1OGAE 1TQBC 3LEVH 2G60H 5CGTA 1F3RB 2HFFB 5HGAB 3RWIA 5LJYH 4W4NA 5F6HI 32C2B 1CFBA 1OWWA 1MCOH 4OQTH 5EU6B 2DL2A 1VA9A 3WJLC 2EYRB 4XNYL 4Z95H 3A6CL 4CVXB 3U0PA 4CADA 2Z4QA 4JG0L 1K8DA 3OB8A 1OT2A 4UZGA 5I9QC 5J06A 2IALB 4HCRL 4XH2B 1U8OB 2RHEA 2X4UB 4NNPH 1R5VB 5IBUB 3KYMA 1EBAA 1NANI 1IL1B 4EIZC 4QLRA 4OCYH 4S2SA 2XY1A 5F9WC 5C0CA 1Q38A 4Y4HC 2BRQA 1U8PB 2VC2H 5HHMB 1JV5A 5KJRH 3I3DA 3MRPA 3KLAA 1LE5B 4RGOL 1E6OL 4IHOB 1TZIA 3DGGA 2JTDA 3IDJB 4JGJA 3V9FA 3AB0B 3BHBA 5ERWB 3TO4D 1C5CL 3VA2C 5EH1A 5ENWB 1KEMH 4EOWH 3T8XA 2Y72A 3ZYJA 3CFEA 4KK8C 2CKBA 3R0MA 1GJIA 5IMMA 3L5XH 2A9NH 5CZXC 4XPTL 3P4MA 4PLKC 3VFMA 2AJUL 2MKWA 3A6OA 1LP9E 1EPFA 4X83A 5I73B 1T1YB 2CLVA 4PJ5A 4OLVH 3QZWA 4YDLB 2V7HB 4LLUB 3QUML 5CEZD 3VFNB 4W6WB 4YC2C 2X4TA 4ERSH 1A3LH 2HFTA 4QHLA 2DLGA 2EDFA 4OB5H 1KPUA 4PP2B 4XZUB 1S9VA 4WU5B 2H32B 3NGBB 5DEGB 4BZ1H 5JXAL 3T0WA 2H1PH 1KPVB 1CLZL 2XFXB 3E2HC 4X5WA 3W2DH 4BKLA 2EC8A 2IQAA 4G43B 1FVDB 3DV4A 1A6UH 3IJYB 1S7SB 3HPJB 2CO6B 5EN2A 2VLJD 3VH8A 1R5IA 5T3ZE 4OCXL 2BNQE 4PRIB 5E56A 1KCUH 5J8OA 2VXQH 4LSVL 2C1OB 3RWCB 1CL7H 3E1F1 2XTJC 3CX2A 4N9GA 3BZ4A 2P8PA 3C2AH 4LPTA 2FLRT 4FN0A 1DANT 2FGZA 2I24N 1D5IL 1RAMA 1CS6A 5KSVA 1K4DB 5HGBA 2KUTA 1U41A 1JFQL 1XZ0B 2FO4B 5C6TL 1FAIL 5HTSA 3EO1A 1I7UB 4JN1L 1OGTA 1ZSDA 5B3JF 2VTFA 5BMFL 3PWPB 4FMFA 4OJFL 2Y5EA 4KTEL 5CJXA 1L7IH 5HI3D 4EI5B 3DMMB 1WWBX 1EEZA 2WSKA 1GC1H 4O4YL 5J11B 4MAYD 4XC1L 1YY8B 3QQ4B 3MRGB 1MREL 3P4NB 2CDGB 3CFBA 1EXUA 4JFEB 2R0WL 4G8GA 4C54A 3WS3A 2X70A 4B53A 2GUOB 5ALBH 5EU4B 1QO3B 5IF0A 3PWUB 1JZ2A 4GG8B 1CE6A 4JZJB 5CP3A 2W0LA 5IB2B 5F3HA 3T1FB 5D6DC 5ICXA 5T33H 1AGBB 4Y5XA 1FL6A 3F58L 3BEVA 4CMMB 4L9DA 5JIKA 3MFGB 1KB5H 3FT3A 3G08A 2APXA 2AEQL 3DBXB 3PDOA 2HTKD 5GHWL 4OM1L 5F9OL 4ALAL 5GS1B 4YDJB 5DMGC 4ZAKA 3K2UL 1EHAA 5IROC 5CP7A 4FNLL 4LPCA 4EJ1C 2AEPH 3ZSSA 1A6ZB 3RTQC 1DUYA 3NIDF 4M1GL 5C0BB 3M1BA 4LAQL 3NZ8A 2YD4A 3L7FA 5HYJD 1QBML 2K9UA 3HG1E 1VGKB 3C87A 5KANI 5JORA 2QSCH 4N8VB 4GKNB 4LIQE 4P59L 1GCFA 1HI6B 1XGYH 2R69H 2X7LB 2EE9A 3QUZA 4OIIL 3QIWC 4BA8A 4K3DH 3C5ZB 4UT7L 1NMCB 1RHHA 3JWDL 4WNQA 1MHCB 3WNPA 4OZGA 2XIDA 1NMAH 1DUZB 4XRCB 5FUZH 5KN5B 4D0CB 3RPIB 3JV5A 1ZS8A 3VMOA 1QSEB 2VXUL 1GOGA 4HKXA 3VFWB 3C09C 3OG6B 1J18A 2PF6A 5JHLH 1CD0A 3QUXC 4WGVB 2HTLD 4WHCA 3U4BL 1UQSA 3BP4B 5ESQB 1MPAH 4OLUH 2R0KL 3QPQC 3RFZC 5I1HH 5DD5L 4UQ3B 1DQQA 4LMQE 3L6FA 2BNUA 1JHLH 3V6OC 2VB5A 4YDVA 5J56B 5DQJB 1TITA 2LE9A 1E4XH 1UCBH 4U6HB 2HJKB 3GSUA 2HLFD 2EZ0D 2RR3A 3HZMA 3MLSL 3HZKB 2JF1A 3SDDA 3GI8H 5HDOA 1EFQA 4HS8L 1A0QL 1J0HA 3RKPA 2CJUH 4U31A 3FOMB 4WCYL 1X9QA 4K8RL 2EIEA 2I25N 1A7PL 4WFGD 3EOBA 4P49A 1IFHH 4PLJC 3DROA 3RUGB 2XPGA 5F7FA 2FB4H 3D25B 4U1NA 5C70A 1GGBH 2NY4C 5E94A 4PJ8B 2Y06L 2QADD 3MRJA 4LGRB 1A22B 4HKBA 5GIRA 3D9AH 3VG9B 4XHQA 3QNZB 4Y19A 4NP4H 3HAEA 2XZAL 5LCVL 2DOCA 4P5TB 5EZIL 3V2AR 3B2VH 4G6AC 4XVTL 1IAKA 4PRPD 4M7KL 4Q58C 4AEFA 1OP5K 2LTQB 3GO1L 5DMKB 2NNAB 4M43L 4Z7WB 3I6GA 3PGCA 4QTIL 2E7LA 3WFHB 3VA6A 5MENB 3GKWL 3IGAA 2VUOA 3H7BB 1RUPL 4M61B 3GBNH 3QUYA 4HH8A 3O8XA 3Q6FB 4OM0L 4QRSB 1FIGH 1IGIH 3SDCB 3ARXA 4UV7L 4XAKD 4DKFH 5ABDE 4ZO9A 1E4KA 5CGYD 4PGDB 2P24B 3UBXI 2KZ1B 2I26N 4S0SD 4R4FL 3U36A 5FO8B 4I2XA 1JNNH 3ZYZA 4AIZB 4F8QA 3GSRB 5E4EC 2ADJB 2BSTA 2CLZA 4M7LT 2IBZX 1YN6B 2RFXA 3E3QE 4NKMB 5DLML 2Q3AA 4CW1B 5HYSG 1Q9KA 1VHPA 4IBLT 5CILH 4Y5VC 4YZFF 3S88L 4Y5YC 4L29B 1AKJB 3O9WC 4QHKJ 4GRWB 4DCQA 4YHNB 1R0AL 1D9KA 4JM2C 3LN4A 2BHZA 5ICZA 2G5RA 3PWJB 1LVEA 4I3SL 3P0YH 4GMTL 2XZQL 4X4XB 1MNUL 5EOTA 4UIMB 5BV7H 5C0FA 3PWVA 1D6EB 2GJ6A 4PJ7B 5IBTH 3P9WB 4RNRA 3U46B 4LCCA 4M9OA 5CEYB 3QEHB 5D7JD 2OCFD 2N1KA 4M8QA 4P2QD 2A38A 8FABA 1CGTA 4GG6F 1AD0B 2QQQA 1MWAH 4RFEB 4Z6AT 4HDIB 4KRPD 1ACYH 1N64L 3DX9B 3QO0A 3L3KB 4PRHB 1YEEL 5F1NA 4BZ2H 4EN3C 2RGSA 3QT2A 3AU1B 5BRZD 4JGMA 5I1IL 5J89A 1TJHH 4P2OC 2AK1L 1LMKA 5D1XC 1FJ1B 4NKIH 2ATPA 2H9GB 3STLB 4K3JH 2MPAH 1JF1B 4QRPE 4JY6A 2VLKD 1JGLH 3LRGA 4P23C 2Z93A 4PV9B 3DV6B 3QCTH 1M7XA 1I7RA 3C6LA 1EHXA 2E8YA 4HH9B 3E6FB 5JLZA 3MA9L 1KIQA 1OF2A 3DWTA 5E2JA 5L0QC 1A4KA 3RWHA 2PCPA 4IIQC 4JHAL 3TV3H 3FT2B 3HC3L 5GGTA 1S5HB 2NZ9D 3D85B 4I77H 4WWKB 3WV0A 5FA4B 1IT9H 4K8RD 4OZIE 1X5LA 3S36X 3QDGB 5SX5K 3OKNB 3GNML 5HHXL 2C1PB 1XGRA 5DMYA 3GMMB 4X6CF 4TSAL 3OX8B 4KJWD 3S97C 1CICA 3KPOA 1WZ1L 3HNTH 1LDPL 1A6WH 1A14L 2D9QB 4JZOA 5CWSA 3S96A 3VWKB 4ZYKB 1MJ8H 4ODXA 1MQKL 4UUJA 4JPKL 1T89C 1NBQA 1MH5B 3IU4H 5EO9A 4GXUN 2P7TA 1QEWA 1KIRB 3VXMD 1CGYA 1WUNT 4PJDE 4B7LA 1FFRA 3G6JF 1PZ5B 2XQYK 3TBYA 2DLEA 5DRZA 3O3EB 3DIFA 4JDZB 5D7LE 3V5KB 2M26A 2CGRL 4XC3H 4ENED 1CTNA 4GKSA 2GT9A 4N8CH 1TVBB 1BD2E 2CDFB 4WI4A 4OCWH 1U3HC 3ULSB 1R3KA 1OD7A 2ADIA 3SJVB 1CGUA 1X4ZA 3WN5B 3FT4A 3RVVC 3V8OA 3EOYG 3MJ6A 3X13A 3NA9L 4LHUG 3UTPE 1GGUA 5C08A 3T04D 4FQ1L 2YPLD 2GJJA 3ARBD 5I15H 1RZKC 2G9HA 4MAUL 5ILTH 2VITA 4HUMB 3GK8L 4YNYA 4ZTOH 3UTTD 4LMQI 2Q3ZA 3GRWH 3QSKB 1BQSA 3KPTA 1V8HA 2HT3D 3VXPB 3SE3A 3BWAA 4GSDL 2EDRA 1BFOB 5D71L 1FCGA 2JE8A 3F7QA 4DQOL 3ARPA 3P4LA 3TIDB 4FTVD 1U58B 5DJXB 5CBAA 5MEOB 4M6OH 4MD0B 5CSGA 1TLKA 4I3RL 3S3PA 2DL9A 1JWUB 4AMKL 4KHTH 3PWLB 4KWUA 2MWCA 4PS4H 4TUOA 4Z7OE 4X9HA 2D4FA 4NJ9H 1XF5A 4OCMC 3I9GH 5FCUL 1YEFH 4QHMB 3RBSA 1H5BA 2JCCB 2RQ8A 4H1LH 1JPTL 3OAUL 3SDAB 2IAMA 5FM8A 4DUVA 1FHGA 4WHTA 2NLJB 5I73C 3X14B 5B38G 5SX4H 4PJBE 3WUWA 5FYLH 2LVCA 4IOSD 4G9FA 4YDLC 3OV6A 1OAZH 4UOJA 3WJLA 4YEEA 1QRNA 3VXRB 5DJAB 5DEZA 3JTTA 1HE7A 4X8XA 3OHXA 1KCSL 2AJZA 2BJMH 3K1DA 3KPMB 4X6CA 1V7MH 2HVJA 4L3EA 3NGBC 1KEGH 1BVLA 1SJEA 2VQUA 4GBXB 4MNQA 3W9EA 3BWUC 3Q2CA 1DLFH 2IFFH 1HSAB 1R6VA 3MRIA 1Q0YL 4Y4HA 3SCMD 2OZ4H 1T0MB 3WIFA 2R1XA 4R4ND 2YD3A 1PVHA 4PJAE 3G6JA 4Z7UE 3IU3A 2WBJD 4LU5H 4U1HA 4Y1AE 3GHBL 1JGUL 4WI9A 3UBXG 2DLFL 1RIVH 2MCG1 1ZK9A 1RUQL 1T5XB 3AXLB 1JBJA 2P5WE 4OZFG 4G5ZH 4NQCD 1YNTB 4S1RH 3EJZC 2W9EL 1MUJA 5FDWA 1B3JA 3ESVF 1G6RA 4EI5C 3DMMC 3P4OA 3HUJB 5DD3L 1A1MB 3CX5J 3IETA 5HD8D 5J11C 2LAGB 3RY6C 5A3ID 1VKXA 4LBEA 1Q8MA 4JQXC 4BQ8A 5I8OH 4F33A 1A7QL 5E9DD 5CEXA 2ICCA 4L8BB 4Q9QL 4PJGF 2I07B 2ZG1A 3HMWH 4JZJC 5HHOB 1PW3A 2WINB 1BBJA 4HEPG 4E42B 4Q9CA 3OZ9L 5JIPA 2ARJB 5HYFA 2XNAB 4L8SB 3C5ZD 3BN3B 4DW2L 2OTWB 2XZCL 1RFDH 1CVSC 1UZ8B 2PO6D 5MI0C 5IEHA 4K94C 3VRLE 5I75B 1PG7H 3CSPA 2ED7A 2RCSH 1ZT1A 4U1LA 1NUNB 5E6ID 2X4SB 5C09E 4M7ZB 3VCLB 2B39A 3SGEI 1NQBA 1CWVA 2BVQA 2F5BL 2JK5A 3SKMA 4H8WH 4YFEA 2GSIB 1AGDB 5GS1C 2WWKT 1UH2A 4ZUTA 4FQPA 1QFWM 3S37X 4AL8L 5IVNA 1AC6A 5L9DL 1I9RH 3C5JB 4O2EB 1P7QD 3LZFH 2W0PA 2R2EA 2D0HA 3OGCA 1A3RL 4MLIA 2ATKA 4I48B 2G75A 5CHNA 3V6BR 4JR9L 4EI6B 5IR1A 4J3TA 5C3LD 2B4CC 5IFAH 3N1FC 4L3CA 2EXYD 1N4XL 4L4TB 2EYSA 1I8MB 5D93B 1A6TB 1WEJL 1SEBA 3MV11 3RWJB 4XPHH 1IM9B 3U1SL 3LD8B 3SDDD 1ZOXA 4UBDC 2F54B 4MJ4A 1MY7A 3DETD 4MB3A 4X8JA 5M95B 5D6DA 1REIA 2QQKH 1G0XA 3VXOA 5AD0A 1IMHC 5ID0A 2BP3A 5INCB 3QPXL 5IVXE 3QISA 1LNUB 4MXWL 4PJ8D 1I9JH 5CGMA 1S78C 2OL3A 4AY0A 5D96B 2F53A 3LQAL 3SKOA 5IESL 1ZKAA 3KGRA 1EO8H 3BVNB 5IHUH 1YJDC 1PKQB 3OKLB 1X3DA 4ZUWA 2WP3T 2DM2A 2XN9B 3MRKB 5HHPB 1CFVH 5C7XL 2EDBA 5HGDA 5IROA 1JI1A 3T0ED 5IQ7L 2DYPD 5EU3A 1WCBA 2BFVL 3RTQA 3ARGB 3MV7D 1R3HA 5MERA 5ANMB 1ZHKB 3LIZL 5I16A 2KDGA 3MRRB 1QG3A 1BOGB 4U1IA 1MFEL 1KIUA 2A1WL 4HFUL 1HHKA 4G8IB 4LRIA 4QNPE 1NAKL 2DQUH 4NFBA 4XP9H 5I1KL 1DZBA 2AJVH 1FO0B 1N7ML 2VABA 3ARFB 1YEJH 1S7TA 4TSCH 3QIWA 3ULVC 1FBIL 1HNGA 2ADGB 5FM5M 1U0QA 4A6YL 5JXEC 3JBG7 4JFDE 3MMEB 4J2XA 2NY1C 3VG9C 4PJGA 2VQTA 3RY4A 3RHWF 3QBTB 4HIJA 4XPAH 4P5TC 3BZDA 1J12A 2C3GA 5D7IE 2G5BA 5JHDE 3PP3H 6FABL 1T4KB 3QUXA 2AXGB 5EZJB 5GGUB 2LTQC 4PBWD 1YQVL 1TZHA 2Q8BL 1AO7E 5DRNB 3QDME 2IG2L 4JFYB 2BXYA 5EIQA 4G6KL 5JOPE 2MKLC 1FNGA 3GJFA 5DJYA 3SDCC 3SQOH 3HC4H 5CIPB 5C6WH 5F1OB 3O2WH 4NRZA 3MNVA 5I1CL 2IF7A 1A7NH 3LY6A 3VDAA 1CGSL 1HINL 4H20L 1T7WA 2QQNL 5FYKH 2IANB 1U93A 4M6MH 4NZTL 5EIVA 4L1DA 4UV4H 1I7TA 3RL2A 2HJFA 1X5YA 2Q86B 4JHWL 2V5SA 3BE1L 4LLMB 4Z18A 4X6DE 2ZSVB 5EUOE 2H8PB 1OM3L 2DQGH 4MD5A 1CD1A 1NGWA 3FMGL 1EO7A 3IF1A 3VFOA 5IT2L 2L7JA 2W60A 3UROR 2HWZH 4TN9A 4WEBL 4XCNA 4RWHA 2VDQH 2QV2A 3WD5L 3BAEL 3BT2L 4ZFOA 1JNHA 2M8XA 2FX9L 4LLWA 4JO1H 4U7MA 5KVDL 2GAZA 4WJ5B 1JPGB 4HPYL 1CDIA 2MTPA 4JRXE 1XCQB 2C3VA 4TNVF 4LCWA 3MFFA 3CFCL 1I3RB 1PY9A 1NCDH 3QA3A 4BH8A 4PY7B 3OWEA 4PJIB 1IRAY 2ZOKA 2B0SH 2R1YB 3HFMH 1JJUA 5KW9H 3MRCB 2VIRB 4DOHE 2KL6A 2E27H 2CUMA 4KKCD 1KV3A 2QTEA 5T1KB 5J3HC 4U1JB 2X6MA 1WWAX 4GKZB 3NCYS 4QRQB 5IOPB 5DURB 4XCFL 1BX2A 5F3BA 3B6SA 3QQNA 3H2WA 1VB9A 3MYJB 1MCNA 1UH3A 2P44B 4APQA 4P2RD 3BGMB 5F7UA 1JN6B 5SWSE 1HHJB 3KR3L 2ICEB 2VZ1A 4XI5C 5F7YC 1WAAE 3MZGB 4ZQKB 2V9RA 3O2VH 4JFHE 4JRYB 1AXTL 4NYLA 4XCEB 5BS0B 4FG6C 4QRRE 1I1CA 1MRCL 1K3ZA 4Y5VA 3Q3GB 5D8JL 3QFJB 1KCRH 3ZL4H 4FQLH 1ZVSB 2J6EL 4V2BA 3O9WA 4R0LB 2P8MA 3IFNH 1VFAB 4NBYB 4JM2A 1Z3GL 3NTCH 5BVPH 1J8HA 1MHEB 1T21A 3HNSL 4XX1E 2XACC 3QUKB 4DZBB 3P73A 1H3PH 1VGEL 4DEPB 1HXYA 1NGYB 3HAEH 4G8EA 4F37K 3NAAH 3WHXA 2PN5A 5DUML 4WWKC 4MDJA 3KYOB 4BUHA 1RMFL 5IEKA 3V5HB 5CEZE 1D6VH 4M8VA 5E8PB 2V5RA 2AJ3A 4JKKA 2BXZA 2MCPH 4KVNL 1Z9SA 3LQAC 2XQBL 2HRLA 2OS7A 4HUWB 3W81A 4E5XA 3VWKC 4HX1A 1UWXH 4EN3A 3OJVC 4I18B 3K4ZA 5H37H 4AT6B 3HI6H 3KPQA 1ND0B 1JPFB 2CO7B 5H2BA 4P2OA 5D1XA 2JJWA 1BFVH 2VDPL 1I75A 3AAZB 4GJTB 1ZLWK 4P4KB 3MA7A 4KDVA 2Y1VA 1WFTA 5FOBB 3G5YA 5JO5B 3DI2B 3FQUB 3O6FC 1UB6A 4W81A 5MEQA 4QXTB 2VUYA 4LK4A 4P23A 4YFLI 1EUUA 4F7EB 3Q48A 1IGFH 1YNLH 3QWRD 2CLRB 4DGVH 2FD6H 3OKDB 1UXSB 4PV8A 4UQ2B 2DDQL 3W82A 3F5WB 1WBYA 1IGCH 2OR8A 3QQ3A 4DKDC 2A6DB 4F58L 1GIGH 5EWIL 5AYUL 3WN5C 3EAKA 1U2CA 4PJXF 4DN4H 1QACA 4U6TA 2YA2A 2X1QA 5E8NB 1JUFB 1FYTB 1IC4L 3BDYH 5DSCB 1LE9A 5F88A 1JTOA 4GAGL 1LEGB 1WTGT 4MCZA 2A74A 2DBLL 1JWSA 2IAMD 3KXFA 1A9EA 4TUJB 2WANA 3N06B 3G04B 3MUJA 1DEEA 4KKBD 4TTGA 5DXWA 2ZUSA 4FP8L 3RKDD 1T89A 1QBLL 2E7MA 2ZPKH 3D48R 3WKML 1RD6A 1FPTH 1Q1JH 3RDTB 2ITDA 1NFDA 4P5MA 1UWEL 4LSRH 3RVWD 5I8KL 5JQ6H 1FO0L 2FL5A 1A6VH 4NRYA 4JVUA 1ROWA 3HE6D 1XH3A 3BPLC 3V7AG 1HKFA 3EZJB 1EEQA 3F65A 5BXFA 2DQDH 1H8SA 1U3HA 3SDAC 1AC0A 3MJ9L 2NTSP 4XNXH 1EHNA 3D2UD 3E8UH 5EFIB 2FH6A 1CF8L 2HFFA 4JFOB 32C2A 2XXMB 3SKJH 4C55A 3QDJD 2YSSB 3LRHA 5EU6A 4Y4FD 1FLRL 2EYRA 4CVXA 1S8DA 1YY9D 2Q7YB 4LDEB 1V3KA 3RWGB 1I1AB 2IALA 4YAQB 2ZUTA 1UXWB 1HKLL 4NKQB 3WIHH 2X4UA 1R5VA 4GBXC 2D2OA 3UZQA 1YUHB 3QXTA 1HIML 1W0WB 4X9IA 1DL7L 2IC2A 4OGZA 4P5KB 1F3DJ 5GJTH 2DQCL 4XBEL 2AKRB 1U8PA 9CGTA 5B3NA 3RGVB 4LGPB 1LE5A 5FGBC 4LLVB 4IHOA 4OZHB 3ZDYF 5IG7A 2LV4A 3IDJA 3CAFA 4KFZC 1NGPL 5ERWA 5ENWA 4KPHH 3HI5H 3AS2A 3BZFB 3BXNB 4FQIH 2FH8A 3L3GB 1DBJL 1SBSL 5D2NE 1F8TH 2O5XL 4HWBH 4M1DH 1T1YA 5GS2D 4ZNEE 4HV8A 1OAYH 4BFEA 4HT1L 4LLUA 3VFNA 3SO3B 4E41D 3T1WA 4LEXH 4FQCL 3EYQC 4F57H 1MCPH 3HE7B 4HZAA 3PHOA 4PP2A 4XZUA 4Q74A 4LSSH 4MQTB 2H32A 4DKEL 3ARDD 4JO3H 5KSBB 2FECI 3FFCE 2XFXA 4G43A 1FVDA 4JAMB 3IJYA 1S7SA 3HPJA 3IAPA 5HVWA 4O2FB 1QYGH 4PRIA 1XF3A 3CPLA 1T7YA 5I75C 1J88A 1F90L 1MJJB 2C1OA 2F54D 4XMKH 1J0YA 4M7ZC 3UTSB 2ZUWA 1I4FA 4OGAC 2AXHA 5BW7C 1EZVY 2CMRL 2DJUA 4IM8A 1K4DA 4K7FB 1XZ0A 2FO4A 5T3XH 1JHKL 4HC1L 4XAKE 3F7YB 1F02I 4U0QB 2PYEB 4X98B 1G9NH 1MRDH 1BBDH 4OF5A 3BI9X 4MA8H 4LPWA 3T77B 3GFUA 3PWPA 1RIUH 2DD8L 1WVZA 2GITB 4NQXB 2ZNXA 1TZGH 1WICA 4X99B 3TPKA 3DMMA 3H0TB 4EKXA 1KTLA 4M93B 1EEYB 1KJ2B 4YDIH 2OK0H 1MCSA 3ARGD 4FQ2L 4ZPVB 5GGRB 5HI4C 3ULVF 1LD9B 1YY8A 2NY6D 3QQ4A 3MRGA 4EDWL 5D93C 5KZCD 4JQXA 3RA7H 4L5FL 3LD8C 2J8UB 5EU4A 4ZOAA 1QO3A 2D7MA 2OR9H 1J1OH 3PWUA 4GG8A 5CAYB 4PG2C 1D3CA 3T1FA 4JB9H 5A2KH 1AGBA 3SQBA 3ARFD 2VXVH 4LFHG 2VLRA 2P1YA 4CMMA 4Z7WF 3RP1A 3EFDH 2B8OT 3WIIL 5D96C 5DUBB 3R8QA 1UM4H 2MHAA 1RZGA 4M6NH 4Y16C 3DBXA 1QOKA 1P84J 2DRUA 1YN7B 1HN1A 3L1OH 4L4VD 1Q9OB 4TOYL 4HJJL 3C8KB 4WO4B 1DQTA 1MFCL 4UTAH 2IPUG 2C3XA 4S1QL 1FV1B 4OLXH 5GS1A 4YDJA 4QHKI 1CZ8L 1IKFL 3BH9A 4XBPA 2Z31B 3Q5OA 1A6ZA 2VDML 3QUXD 4LARL 5E2VL 4FFWD 4P2QE 4KKAD 1JI2A 1RJYB 1S7UB 2FBJH 4N1EA 5C0BA 5TJWK 4UDUB 5DD6A 1DE4B 3TYGL 4MA7L 2C4FT 3PGFL 4N8VA 4GKNA 1M7DB 3VFUB 1HI6A 1XGQB 2X09A 5C8JB 2X7LA 1OOAA 3KPPA 5GZOD 2AK4B 4XRCA 1DUZA 5KAQG 5F21B 5TF1H 5KN5A 4D0CA 1P69B 1IQWL 1KN4L 1GRWA 3RPIA 1MY5A 2GTWB 1K3IA 4WUUE 1G6RH 3N1MC 4IOFC 1FVCB 4BELD 1OLLA 1QSEA 1RSFA 4MJ5B 4WUKH 4OSUL 4GRWF 3TF7C 2P48B 3MLWL 2FRGP 3O6MH 1FNHA 3IKCB 1C8PA 2KH2B 2P42B 4OI9A 1UFUA 2J8HA 2IPTH 2XG5A 3BP4A 5ESQA 2YXFA 3SGDH 1GH7A 2EDXA 3WFDL 4UQ3A 4HK3N 3MREB 4LEOB 2AGJL 3AM8C 1HYRC 1KCVH 1JPST 4P46B 4PJ7F 2QJDA 3JSSA 4QOKB 4X7EC 5DQJA 3HZVB 5F7EL 2APVA 4M5ZL 2OLDA 1U8LB 3R06B 1WBZB 2HJKA 2UVEA 3CLFL 4N0FA 1TIUA 1CD8A 3JUYA 3HZKA 4KRMB 4U4BA 4LCWD 4QTHB 3VGGA 1TETL 3FOMA 5C92A 4DAGH 5IBLD 1F6LL 1UT9A 3RVUC 3ETBF 3HHRB 4MJIE 4KKLD 1KENL 3D25A 4AQ1B 2FBOJ 1G9MC 5KS9B 1RURH 4GUPB 1RIHH 5JXEA 4CU8A 3GMNB 2DS4A 3I02B 1V7NH 3VXME 4D9RD 4APQD 4LVEA 1OCWL 1FZJB 3H9SB 2DICA 4J4PC 4UT9L 2XTLA 1VSCA 2NNAA 5DMKA 4Z7WA 3TJHD 1UEMA 3QIBB 5CJ8A 5GS0C 3B2UC 2QQLL 3WFHA 1DBKH 2ZKHH 3ZHKA 1OQXA 5JOFB 1DQJB 5MENA 3AREB 2X5PA 1X6LA 4G6MH 3FB8B 4QRSA 4AEHH 5I1LB 5C0CE 5ACZB 2R0LL 2L0DA 2NY0B 3SDCA 1MFBL 3S8WA 3TVMB 3VRJB 4L4JA 1T04A 5KSAD 4PGDA 4YO0A 2P24A 4OD1H 4K9EL 5DDHA 4N0YH 2NW3B 4XP1L 1J8HD 5BZDB 3QULA 5FO8A 3B5HA 4KJQD 2EH8H 4NNXB 1MWAB 5K9KB 4AIZA 1OGAB 2ADJA 3GSNL 3GKZA 1Z9MA 1ZEAL 5B39G 1YN6A 3V0AC 1N0XL 4F8TA 4NKMA 5EOCL 2L4OA 3GSVB 4CW1A 3FQTB 4PJ5E 2VMFA 4IRZL 4FXKB 1FNSL 1G7IB 4FTVE 3JUZA 2OYPA 4L29A 5CJBA 2BNRA 1AKJA 5I0ZA 1B9ZA 1IBGL 3N85L 4R0LC 4XMPH 2AV1B 5SWZB 2CIIB 2X9XA 4YHNA 1G7MA 3VFTA 3QXAB 4K7PL 1T66D 3S35H 1DN0B 3ILQD 2X1WL 2HFGL 1S7VB 5KVFL 2DTSA 4PJFF 3PWJA 4KC3B 5FFLA 4X4XA 1NCAL 5DHVB 4DEPC 4M3KB 4J6RL 2LQRA 4UIMA 3HA0A 1AIFB 4PJ7A 1CU4H 5DS8B 2LFGA 5I19L 4NQEA 1MLBA 3U46A 5CEYA 3QEHA 3O3BB 1S3KL 1PEZA 1NCCH 2CQVA 3IJHB 5D1QB 1QRKA 3W39B 1EBPA 4RFEA 3D3VD 4KGLA 4HDIA 4BQ6A 4ZD3L 4XNYH 1UH4A 3A6CH 3VFVB 1Q72L 5I18L 4HIEB 4JG0H 3L3KA 4PRHA 3GJFH 1C08B 5L2KD 5JUEL 5DJ0B 4MCYB 4I18C 1AQKL 5FGRA 1Q9WA 4Z5RB 1PSKL 4PJEB 1FJ1A 4N0CD 4P4KC 4D0BA 1MSPA 2H9GA 1XF4A 3STLA 1MCLA 5DC9B 5M94B 3GJEB 4M1CC 1JF1A 4KMQA 2FHBA 4G8GE 4RAVA 2WUBL 3BPOB 5IJVA 4PV9A 2VXTL 3DV6A 4RGOH 1E6OH 5D5MB 3LS4L 1CQKA 4HH9A 4XHJD 1C5CH 5I8EB 1S5IL 3EOAB 4V1DD 3FT2A 1JMZA 2IH1B 4GW4B 1S5HA 4XPTH 3D85A 2AJUH 4WWKA 5FA4A 4MGXA 1TMCB 3EJYD 3C60D 1E27B 2D7OA 1UCTA 2UZXB 5FYKE 3MBEB 1T2JA 2GSGA 3QDGA 5CJQH 1JP5A 4X7SL 1T1ZB 6CGTA 3ULUC 1LDSA 2OTUB 5CBEB 3OKNA 2C1PA 3GMMA 3OX8A 3B8YA 3BD4A 4NFDA 4OAWB 1T1WB 4RISL 1HCVA 2W1NA 3VWKA 4ZYKA 2FZ3B 1SBBA 4XPGL 3UJIL 3EFFA 1CLZH 3GMRB 1MI5D 4JFFD 3MV8D 4NUJB 1MH5A 2HLAA 5ITBH 3CU7A 4H0HB 1FP5A 4HXBL 4OCXH 3BP5B 4I0PD 5DR5L 5E2WL 5E1HB 1PZ5A 2VWEE 3FZUC 2RAMA 4LSVH 3O6FA 4HK0B 4MVBC 3O3EA 4JDZA 4M3JA 1NUFA 4JFZL 2D03L 4LLYA 1YYLH 3V5KA 3TP4A 4RRPA 2VDRL 4GXVL 2PW2A 3X3GL 1BWMA 3RZWA 1TVBA 4ZUVB 5C6TH 1FAIH 2X4QB 2W9LA 2CDFA 3BRFA 3ULSA 3LKRA 1HXMB 5BMFH 1YPZF 3SJVA 1F13A 4OJFH 3WN5A 4KTEH 5T1DL 1G1YA 5A2LH 4J8RB 5K59F 4U6VL 1DSFH 5HI5C 5JZ7D 1W72B 4O4YH 4DVBB 4NC1C 1MREH 1CFNB 1KG0B 3GIVB 4MXQC 1B0RB 4XNUL 2R0WH 1XGUA 3MNZB 5KVGL 1I1AC 5FYKU 3HPLB 3VXPA 3HG1B 5B3JE 2P5EA 3QJHB 5C9JB 5DJCA 4PJHB 3RNQB 1FRGL 3V52L 4KROB 3WLWD 3F58H 3TIDA 1NEUA 1U58A 1XGPB 5DJXA 3TH2T 5MEOA 4MD0A 1E6JL 2R2HA 4Z76B 4Z7QF 1JWUA 1SJHB 4NOFA 4K9EC 3RGVC 3PWLA 1FL5B 4LPVA 5FYJD 2AEQH 3VFGL 4HXAL 3O4LD 1MAJA 3ORJA 4I8DA 4HK3J 4M7LH 4OM1H 2R4RL 4QHMA 1M05B 4Y19E 2BVTA 3CVHB 4M7JL 3U83A 4FXGB 4ALAH 2DF3A 1VFOA 2QHRL 3K2UH 1OSZB 3T0EE 4R90L 4OUUB 3HB3D 4FNLH 3EW3B 5DHYB 3SDAA 1I8KB 3WJJC 4OGXL 1MCFA 4M1GH 1OTSD 3OXRB 4LAQH 3L9RB 1NKOA 3K81A 4OT1L 5ESAA 4YQXL 1JK8B 1QBMH 1PJ9A 2WUCL 1RU9H 3WL9B 1A02N 1F3JB 3M8OL 4NQSA 3LOWA 3V7MA 4P59H 3VJ6B 1J5OL 4YGAB 3FKUS 3ALXA 3VXRA 5DJAA 3HE7C 4OIIH 4UT7H 2VAJA 3JWDH 3KPMA 3RPKA 1RUML 4CAGA 3REWB 4K71B 2ZSWB 1KACB 3NIDE 4M5YL 4GBXA 1XF1A 4I2XE 5IP4A 4WIQA 4LDOB 2VXUH 5A2IH 1QFPA 1HSAA 2B5IB 4UILL 5E8OB 4CN1A 3NCFB 2VDOL 4O02L 1JGVL 4LQ1A 2D7PA 3U4BH 1TJIL 3VWJB 3N1QC 2R0KH 5FGBA 3ZYOA 2J12B 2R39A 2AI0L 5DD5H 5FB8A 3OKMB 4N5EC 2Q7NA 4X4ZA 3VI4F 3FCTB 4PJ9D 4XTRC 1RZJL 1LO4L 3AXLA 1DP0A 2IPKB 2XKUA 3MLSH 1YNTA 3U79A 4LSTL 2ZJSL 4JO2L 4HWUA 4HS8H 1A0QH 4OFVA 4WCYH 1YPZA 4K8RH 3S98A 1I8LC 4BK5A 5GRWA 1A7PH 4M93C 5DQ9B 3AMLA 5SV3A 1T7ZA 5E8DL 2GJ6E 4GH7B 3MV9D 1V5JA 1CE1H 4PLOB 4OFIA 3RI5K 3SKUD 4L8BA 5GSVB 5TPWL 2I07A 2Y06H 2ILLA 1U8IB 3TYFA 5HHOA 2WINA 1H0DA 1S9KC 4E42A 2ADFL 4ODSL 4RGNE 3MGOB 1BQLL 5LCVH 4DTGL 2XZAH 3FO1B 5DMJB 5EZIH 2XNAA 1UADC 2NY5L 1QBAA 1RZKH 2OTWA 4XVTH 1UZ8A 2EH7L 1U92B 3GO1H 4M43H 2X4SA 3B9AA 4QTIH 4Z8FL 4NGHL 1L0XA 3W11C 4FRWA 4WO4C 3GDBA 3ECBB 2P8LA 4KK9C 5BW7A 3CSYB 3GKWH 4JPIB 5C0NC 5HYQB 1RUPH 2N56A 1AGDA 4HG4K 5BJTB 3U7YL 4YX2L 5J9PB 3DOSA 4UV7H 4NHCL 1YNKL 3GBLA 3GBML 4EUPB 1UVQB 1AGCB 4P9ML 5GRZA 3TFKC 3HRPA 5CSZB 3VFPB 1EHLL 2D0FA 4Q0XH 1OAQH 2UYLB 4FFVD 1BFTA 4R4FH 2XY2A 2NR6D 3I6KB 4EI6A 5F7DB 4Y2DD 5T3ZL 4NWUL 2F8XC 5FIEA 4L4TA 1T7VA 1I8MA 4IRSB 1A6TA 4O00A 5H8DA 4ZO7A 1IM9A 5DLMH 2WAHA 5J1AB 1HQ4B 4GAYB 5F71A 2Q20A 4LHUD 3KYNB 1UWGL 1R5WA 1KLGA 4PG2A 2Q6WB 3WNNA 3BRGC 2FEDD 1D5XB 4OCRH 3S88H 4J12A 5INCA 1DLHB 2ARJQ 4JO4L 1LNUA 4M9PA 3WDJA 2FJFB 1R0AH 2XKSA 5E2TL 1I3GH 4Y16A 1F11B 2YMXL 3BVNA 5C6PB 3OKLA 3QH3B 4I3SH 4GMTH 2XZQH 3MACL 4P46C 1LQSR 2XN9A 2XV6B 3HKFA 5HHPA 1MNUH 4LPUA 3MLZL 3CMGA 3LKSB 3UTZA 1Q9LB 4YZFE 2BC4B 1TFHA 3T0DA 2VLME 2X42A 4KVCL 1F58L 3D69B 2Y23A 1ZHKA 3GIZL 4YHML 1BOGA 4KKNA 3CC5B 4H1LG 3MCLL 4CKVX 2CIKB 4NKOB 5DO2C 4G8IA 5ADOL 1N64H 1M71B 3SDYL 1X5IA 2ESVD 1YEEH 1CFTB 4TSBL 3U7AA 3W9DB 1O7SA 4Q6IB 3SGJA 4JKWA 4OZIB 1XGTB 2IPUK 2IQ9L 1PX3A 2ADGA 3DX7A 5I1IH 4POZD 1BEYH 2AK1H 1XIWC 2E7CA 2VH5L 3BFOA 4ONGH 2FYYB 5IQ9B 4YHYB 5E95B 4GG6E 3NPSB 4RSVA 1W72L 1W0VB 1LGVA 3MJ9A 2YUWA 3DRQB 4OLWL 4PGEA 2AXGA 3VFSB 5GGUA 3EYSL 1EV2E 2NY3D 3EUUA 3QIBC 2DQHL 4KJPD 5LAXB 2IGFL 4S1SL 3K8KA 3AREC 5DRNA 1A1OA 4JFYA 4LIQL 4PJDB 3AM8A 1OAXH 4XB8A 3FTGB 5H35B 3HC3H 2NY0C 2BNRD 2EEDA 2NYYC 5CIPA 3TVMC 3U30C 3TWCH 2FJHB 1DBAL 5TGBB 2FLBT 4KUZL 4QHUB 4XP5L 3NZHL 5L8LB 3GNMH 2DWEB 2W92A 1BD2B 5HHXH 1OLZA 4DZ8A 2O5YL 3FFDB 4XCYB 2QBWA 3CVHL 4TSAH 5JMOC 4NO3A 1DVFD 3CU1A 1WZ1H 2KBGA 2Q86A 1LDPH 1A14H 2VZVA 5D1QD 4NQED 4XXDB 4U0RB 1ORQB 1ZLVH 2H8PA 3VGEA 4CGTA 3IFLL 4Q9RL 2HJLA 3BDXA 4G9FE 3EYUH 4RDQG 3LPGA 2HT2D 4HPOL 4GAJL 1QRNE 3INUL 4ZFZB 1MJUL 3UZVB 2FATL 3K46A 4X6CE 4L3EE 4B7IA 1MIEL 4WJ5A 1JPGA 4J4PA 1XCQA 4F7MA 3P40A 2WIIA 4O2CB 1I3RA 3MGTA 5DD1L 1VERA 4MNQE 4FG6D 4NO0B 4PY7A 2V7NB 1FDLL 5DJDB 3W0WB 2JIXD 1XEDA 2BCKB 1O7VA 3ZTJH 3BJLA 1M1SA 3BD5A 2R1YA 3V8CA 3EJJX 4NCC2 2VIRA 4QO1A 1YA5A 3G6JE 3NH7L 3QEQD 3ULUF 4JQIL 3O41B 2EKSA 4GKZA 4NPYB 5T3ZD 1RZIA 3NA9H 2OMBA 2BNQD 1RULL 1EERB 3GEWB 2GCYB 1YJDH 1UM6L 4H26B 2NY5C 3MYJA 1MELA 1KJMA 1ZVHA 3BO8B 4FQ1H 5KAQF 2YKLL 4RIRB 5D1ZC 3BGMA 3GK8H 4G42B 1D5BA 4RWYL 1HHJA 2EE2A 2BVOB 2ERJC 3QHFL 5E00B 4LLDA 4YXHL 1KOAA 2O93L 4JRYA 4UNTA 4GSDH 4WVRA 5D71H 4XCEA 5BS0A 3NOIA 4R96A 4DQOH 1HZHL 4YPGB 2OBGA 3Q3GA 4OGYL 3QFJA 4WEUD 3HNVL 1T7XA 4O5LL 4I1NB 1F45A 4HLJA 4R0LA 3PUCA 3C6SB 4AMKH 3BESR 3BPOC 1A4JB 1O5DT 4IMLB 1VFAA 3SOBL 3ULVH 3QZWG 5LG1A 5FCUH 1MHEA 1AR1D 1Y6MR 5F89B 5IM7B 3DSNA 4TQEL 3PL6B 4DZBA 4D8PB 1NGYA 1DR9A 3OAUH 3T08A 4WEMB 4CVZB 1ETZB 3KYOA 4BJLA 4PJAB 4YFDB 4Z7UB 5K9OB 3FN0L 4L9LA 4Y1AB 4FOMA 3V5HA 2YD7A 3VH8G 5I8CA 2V9QA 1E28B 2YPKB 1H3GA 4HJ0D 3MLXL 3DRTA 4LDLB 1YC8A 1TPXB 4I18A 1ND0A 3MO1B 1SJVA 4MHHI 1JPFA 4FHBD 2QR0B 2UZYB 5JW5A 3Q1SL 3RIFK 4X80L 3AAZA 4P4KA 2XWTB 4X6BB 5I1EL 1YDPA 2OI9B 2V5MA 2M2DA 3HG1D 1ZLUK 4QXTA 2YK1H 3T3ME 4KROD 4LLAA 4F7EA 3CLEL 1ADQA 3IXTB 1FFPA 2P5ED 3GHBH 2CLRA 2EDYA 4S11A 2FGWL 5EO1A 1RUQH 5D6CB 1A5FL 1UXSA 4UQ2A 1KLFA 3EDEA 3F5WA 2ED8A 2F53E 5C09B 1NAML 2A6DA 4GRWH 2W9EH 3IDNB 3F62A 3K74B 3RVXD 1BVKB 2KQNA 2ENSA 5E8NA 3EYFB 3UTQB 3MRHA 1JUFA 1FYTA 5DSCA 1H3UA 1LEGA 5KSBF 1A8JH 1WF5A 3OTTA 1A7QH 3QEUB 4GQ9L 4HIHA 1G84A 4N0UA 4Q9QH 2QHLA 3NCMA 4TUJA 5FO9B 3ABZA 5HYIA 3VDCA 4KK6C 2UY7A 5F1IB 3KPSA 1I9EA 2AV7B 4HMDA 3OZ9H 3L3DB 3GI9H 4DW2H 3P9LB 1YC7A 2XZCH 4R9HA 4ZFFA 1F4HA 2JB6B 1A3QA 3NA4A 3T2PA 1T22B 4DUXA 1L6ZA 5ID1A 3CXHK 4PJGE 3ZKMD 1A6AB 5IVXB 3I85A 4JQVC 5CKAA 3TT3L 1YZZA 2O5ZL 4AL8H 3KWWB 5L9DH 1P4IL 3D39B 4AZ8A 1F4YL 4ZUSB 4PTUB 5EFIA 5C0AB 2HAZA 4JFOA 1A3RH 4TVSa 1KTDA 3CK0H 5KG9A 2YSSA 4JR9H 5DFVC 1BM3L 1N4XH 2YPVL 1FZKB 2EXWC 1JRHH 3PQYD 4F7PB 2Q7YA 1QFUL 1Z0NA 4K7PX 3U1SH 2Z9TA 4QXWA 1I1AA 2JLLA 3RWGA 1ZE3C 4OIAA 4K71C 4OTXL 3LKPB 1DANU 4RZCB 5J6GB 4LP4A 1YUHA 3QPXH 1OTTC 2ZUYA 4P5KA 5MP6L 3QO1B 1QFOA 2AKRA 4AENB 3UYOD 4Q6YA 3IJSB 3LQAH 3RGVA 1R3LB 5IESH 4K7PY 4Y4KB 3GHEL 1FYHB 2QLVB 3LKOB 1MFNA 1MCHA 4WGWB 4XNMB 5JIIA 3AC0A 3BZFA 3BXNA 5JHDB 1BIIA 5IQ7H 3L3GA 4BH7A 2BFVH 3WJJA 3PDDA 2HRPL 3KPNB 2E6QA 2R15A 1X6NA 3LIZH 3F6LA 1Y6KR 4LCWE 4ZTPL 3HAEG 1MFEH 4HFUH 3QDMB 4PIRF 3ROOB 3I84A 1MAKA 5IB1B 1NAKH 4TRPL 1TTGA 5I1KH 4BFBD 1JZ7A 1A2YB 5H94B 3CMOL 4NQDB 3OQ3B 2FIKB 2W9DL 1FBIH 2WWKO 3T2OA 5FKPA 5KSBA 4EVNB 4JDVA 1EAPB 4D9RE 4BZYA 4JAMA 1K5NB 4GRLB 4IRSD 3MZTA 2YWYA 3TPUB 5H37G 6FABH 1UA6L 5HI4D 3NIGF 1V05A 3QCVL 3X12B 2DKSA 5GGRY 3E3QC 2BERA 1YQVH 1MJJA 4X6DB 4FFYL 2NY2D 4D2NA 3SDXB 4QF1A 1DN2A 1N26A 1SM3L 4R2GB 4GOSA 2Q8BH 3UTSA 4ODBD 1T5WB 1FZMB 1KB5A 1C1EL 1I8IB 1OB1B 1JZ3A 1SMAA 2IG2H 3FO9B 4K7FA 4ELMF 4WI5A 4Y0GA 2BVEA 2H3NB 3TA3B 2PYEA 4X98A 5I1CH 4YHOL 3T77A 3DUSB 4YHPA 1CGSH 1IC7L 5DUPL 4NQXA 4H20H 4Y16D 1J8HE 5IV2B 2QQNH 1GVIA 4BFIB 4QRPD 2YUXA 1I8LA 1EEYA 1KJ2A 4NZTH 1UZ6F 3DGCR 1FVEB 4PYHA 2HMID 4ZPVA 2X10A 5SV4A 1LD9A 2VISB 4JHWH 2DQEL 1F6AB 3KJ4B 2J8UA 1OM3H 3WBDA 4N8PA 1RHFA 5DJ6B 2EE3A 3FMGH 4U3XA 1V3MA 5C0EB 3GUTB 5IKCB 4KTDL 5IT2H 4J1UB 4OD2B 4WEBH 1INEL 3WD5H 5BO1L 1KN2L 3BAEH 3BT2H 1XCTB 5SWSB 1NFKA 5T1MA 2FX9H 4P9HL 3NCCB 5KVDH 2ZUVA 5DUBA 3N0PB 4HPYH 4XWOC 3ZSTA 4R4BB 1YN7A 5HY9B 1Q9OA 3CFCH 4OUOA 3IDXH 2LABA 3OKOB 25C8L 5FGCE 2GYSA 4IOFD 3BP7A 4XVJL 4PYGA 5EBMB 3KNBB 4JM4L 4HIIA 1HSBB 5AZEL 5I1JL 3CJJA 1RJYA 5IHBA 5ACMA 4UDUA 2VDLL 3TO4B 4FFZL 4F9PC 3VXNA 4WHYH 1M6OB 1M7DA 1T6VN 2HT4D 4DK6A 4NKDB 1XGQA 1BFSA 5I0DA 1JZ6A 2ICWJ 5D7LD 5L2KE 5C8JA 1U42A 4LSPL 4Q6IC 3KR3H 4RX4A 3F7VB 3RBGA 4EEEA 3LMJL 4P48A 2AK4A 3V4VL 3TESA 4UINL 4PP1D 3FB5A 5IMOB 4YHYC 4NHUB 4X7CC 1MRCH 3NCEB 5D8JH 3NPSC 1YEHL 3PWNB 2J6EH 2OP4L 1BZ7B 5EORH 1XR9B 2F19L 3KXFE 3LEVL 4IJ3C 4NBZB 1CDCA 2Q76B 1SEQL 1OHQA 1Z3GH 1QA9A 3OKEB 4FQXD 1MCOL 5AZ2L 2VLJB 5DK2B 3MREA 4LEOA 3MLTA 4P46A 1VGEH 4QOKA 4X6FB 2UV3A 3TZVC 3NABL 1U8LA 5DUMH 3R06A 1WBZA 1MJ7L 4ELMA 1U9KA 1X5KA 5SX5H 1RMFH 4IRJD 4QTHA 3QFDB 5I1AB 2H6PB 12E8H 1A7BA 3G5ZB 2WBWB 5GS2H 3MRQA 4KVNH 4Z78A 1NEZG 1X5ZA 4TUKH 4U33A 4PR5A 2FX7L 2XQBH 5ISZD 2FX8L 3T0VA 1HH6B 4PJEF 4YPJA 5J4MA 5KS9A 2BMKB 4U0RC 4GUPA 3JV6B 4JFFE 3GMNA 2NQCA 1XIWA 3I02A 4I0KA 2VDPH 3QCUL 4MAYB 5EU6E 2J5LB 1N8ZB 2VDNL 2Y36L 2Y6SD 3IDGB 1FZJA 1JGDB 3H9SA 5D5MF 1IAOB 4YXLL 1MAML 2QSTA 2R29L 3O3UN 4P3WA 3CX5K 2VYRE 3DYPA 5DFTA 2ZUQB 5IB5B 1ZTXL 4LP5A 3BKML 5KVMC 5JOFA 2G2RB 3AREA 4HKZB 5E2UL 2J3SA 1HHGB 3IXAB 4F15B 3FB8A 5I1LA 3LEXA 5ACZA 2DDQH 5HHME 4OB5L 2F15A 3S36L 1U8QB 1RUKL 3OR7A 3VRJA 4PB9L 4BZ1L 3LPFA 4F58H 3KHOA 5EWIH 5AYUH 5CINL 3B5TA 1H8OA 1U36A 1C16B 2NW3A 4EDXA 4GLRH 5BZDA 2DN7A 3HI1B 1IC4H 4ESKA 3BKJH 3OF6D 4TNWF 1G7JA 4GAGH 4NNXA 1MWAA 5K9KA 1IGYB 1PBYA 5HYJB 4TULL 1YEGL 1RY7B 2UZIL 3PF2A 1JIBA 5IGXL 4ZS6C 1OTUC 3S34L 3GSVA 3FQTA 4FP8H 5IB3B 4ODWA 3WNOA 1QBLH 3WKMH 4FXKA 1G7IA 4PJXE 2P5WD 2A0LC 1UWEH 4QCIB 5I8KH 5C0JB 5CMAB 4X7TB 2AV1A 5FYJE 1FO0H 5SWZA 3VRIB 2CIIA 1QLEL 4YR6B 3SGKC 3QXAA 5JDSB 4YK4B 1S7VA 2BOCB 4KJYB 4HAGA 4Z0XB 4LFHD 1GC1L 3PL6C 5DHVA 2GI7A 1AXSB 1KB9J 5EOQH 2WQ8A 1KPRB 3DX8B 2EIDA 1AIFA 3MJ9H 4ZXBC 2FIRT 1F2QA 2DQTH 1CF8H 2R1WB 1QFWI 3O3BA 3KS0J 4G7YL 3IJHA 2ZUUA 4WHDA 4ETYA 5HDLA 1P2CB 1FLRH 4YH6A 5D1ZA 3VFVA 5C09D 3QNYB 4HIEA 5D2NB 4NOBA 1IILE 5EBWB 1C08A 3QUMB 4U1GB 1W8OA 5DJ0A 1TPXC 2B1HL 3QIUD 5CIPH 3RX8A 4PJHF 1HKLH 3ILPB 3LV3A 4Z5RA 2Z91B 3D6GA 4PJEA 3ZKXC 1SYVA 1L0YA 4AYFA 2H2SC 3BPNB 2Z35A 1PYWB 3RIAK 1HIMH 3UTOA 1HDMB 1DL7H 2OI9C 2FECL 1BJMA 3BPCB 1T0NB 3GJEA 4XBEH 2J88H 2WWMC 3MRLB 2J7LA 2QADB 5F7KC 1U8HB 1CIUA 1G9MH 1RK0B 3DNKA 2Z8SA 4MWFB 3PE9A 3P0VL 5D5MA 1ZT7B 1PDKA 3KPSD 4MZ3A 4MZ2A 3L3HA 2K7PA 5I8EA 2VLRE 4PRPB 3EOAA 3QNXB 1DQDL 4DUWA 2XOTA 5GRVK 1K8IB 2IH1A 1DBJH 1SBSH 3KJ6L 2O5XH 1JYWA 2I5YL 4W68A 1P1ZB 2P4AB 4WTZA 4GXUM 4ZMAT 3KLHC 1T1ZA 3H42H 4N1HB 2OTUA 3S6CA 5CBEA 4D9LL 3QI9D 4HT1H 1QHPA 3LN9A 3ZDYE 5F9JA 5GRUH 4FQCH 4FQQB 3FJTA 2LU4A 3MV9E 4PG9B 2DI8A 5TDNA 1MHHA 1T1WA 4OAWA 4RDQF 4ZOBA 1JPSH 5T1LD 4HBCL 5C0BE 3V4PL 4NM4H 2XZZA 2FZ3A 3ES6B 4QWWC 3LS5H 2NXZD 3WXWH 5HBBA 3GMRA 2JJTC 1L6XA 3GRWA 4Q97A 4NUJA 1UENA 3UO1L 2WM0A 3FRPA 1UCBL 2Y5TB 3BP5A 3FHQA 3UDWC 4GFTB 4G3YH 2I9TA 1N5YL 4HK0A 5FCSH 3TBVB 2GK2A 2GTZB 1NCWL 4JJ5B 5CD5D 1NUGA 5D72L 2CMRH 3OPZL 4S1DD 1IAIH 1QSEE 1R24B 5CEZL 1NBVL 1UB5A 1IFHL 1JHKH 2X4QA 5DJ2B 4LQFL 2GW5A 1J1PL 1HXMA 4JFDD 4L8DB 4PRBB 2X4OB 2DD8H 4H1LA 5HDBF 3Q5YA 1N6VA 4QRTB 1HYSC 1TDQA 4S10A 3T65B 3D0LA 2MSPA 2BY0A 4PJCB 4FQ2H 3N1GC 4DVBA 1F4WL 4DGIH 1AO7D 5D7JB 3LH2L 5F7NC 1KJVB 4L5FH 4P2QB 2Q8AL 3BZEB 1XR8B 3WE6B 2GJZA 2QEJA 5DVLA 4KRPB 4NRXA 5C9JA 1RUAL 4B50A 4PJHA 3RNQA 5FK9B 4KMTH 3GBNL 4HS6B 1FIGL 1XGPA 3JTSB 3BIAX 1LO5B 4Z76A 1DQML 3X11B 5BRZB 3B9KC 1SJHA 4EBQH 3EO0A 4OLZL 3ULVE 4ONHB 5TDPB 4QXGL 4Y4KC 4GRLD 2OZ4A 4TOYH 4HJJH 3GSQB 1ES0A 4WUUB 1V3JA 1MFCH 3S37L 1M05A 3CVHA 1YMMA 4S1QH 4FXGA 2VLKB 4HG4J 4JQVA 1CZ8H 1K6QH 1IKFH 2VZ3A 2FHFA 5DHYA 3TM6A 2HYMA 5E2VH 1I8KA 3IDIB 1XT5A 1WISA 2DM7A 4Z7WE 1YECL 3OXRA 1IGML 3L9RA 3QDAA 5LBSL 3TYGH 4MQSB 1JK8A 3WL9A 3ZDXE 1F3JA 3PGFH 2DI9A 2V2XA 5FECB 1A7RL 2LAAA 3U0WH 3T4YB 5JNYB 1DFBL 2NPLX 4JRXD 3A6BL 1BWWA 1VFBB 3JXAA 4HWZB 4QT5A 3SE9H 1J0JA 4G6JL 2WBKA 2VZUA 3PV6B 3MRFB 4YE4L 1IQWH 4OCNC 3REWA 2ZSWA 2Y4SA 3BQUC 3Q6GL 3ULUH 2HKFH 4OSUH 5DVKA 1OARH 1OP3H 3MLWH 1N6QL 4U1SB 5AYQA 4PGBB 3DJ9A 1GZPB 5E8OA 1ODAA 3MSPA 3RWIB 4R2GC 5GZND 3WFDH 1IAMA 1TVHB 2MNUA 3VXMB 5SWSD 2YS4A 4HUUB 2AGJH 4XGZA 2Z4QB 3FCTA 2BNRE 3ALPA 4FS0A 5F7EH 4M5ZH 4JFHD 4BZ2L 2D7TL 3TA3C 3CLFH 4GRWE 4C56A 1FGVH 5DJZA 2IPKA 4QRRD 2M1KA 3G6DL 3L5IA 3KYMB 3MXVL 1AJ7L 4MX7B 1UYWH 1FG9C 4S2SB 3QQ9D 5INDB 1MRFL 2JJUA 4NM8H 5DQ9A 4HUVA 1NCUA 2AJXL 4GKOA 4CNIB 2C3WA 4PJ7E 1KENH 4YDKL 3QCTL 4NQEE 5E99L 1JNLH 5GSVA 1HHIB 3UYRL 5DC0A 1U8IA 2AVGA 2H45A 3SKNB 2W65B 3BHBB 3U7WL 2YPLB 3ARBB 3VE0B 5CJOL 1KULA 2CKBB 3TV3L 3FO1A 5DEFB 5CFHA 4I77L 3UTTB 4PRHE 3JWOL 4EQ2A 2BOBB 1U92A 4NJAL 2EDQA 5IK3B 3UJJH 4RX4D 5A1AA 2CLVB 5DC4B 4RMUA 4OZGF 3FHAA 2QQLH 3RGHA 3IAGC 3HC0A 3KLSA 3ECBA 4FTVB 4JPIA 5HYQA 3D0VA 4QHLB 5BJTA 5J9PA 3HNTL 1KPUB 1MFBH 4HAFA 3QEQE 3OJDB 1I85C 1UVQA 1AGCA 2BY2A 3VFPA 1EO5A 4OI8A 3H9HA 4K9EH 3HCVB 3TO4C 4NZUL 4ZO6A 2UYLA 4XP1H 5B22A 3MCG1 4OFYA 1T2QL 3L3IB 2W0FB 1CXFA 4ZDHA 4X0KB 5DRWB 5F7DA 4NUGL 1CTOA 1KUMA 2R2CA 3DXAA 3VGAB 5CUSH 2L7UA 3DVIA 4N9GB 1ZEAH 1EFXD 1N0XH 4Y8AA 3HMXA 1HQ4A 4RAUB 5I17A 1GPOL 3QDGE 4ODUA 3KYNA 3S5LB 2Q6WA 1FNSH 3ZDZF 4AEIL 3BGAA 2P43B 1ZHNB 4OCWL 1NBZA 1DLHA 5I66B 5GJSL 3TN0D 1IBGH 1NDMB 1ZSDB 3N85H 3K2MC 3FO2B 1NANH 4E0RB 4XNQB 4HJGB 2HFGH 1F11A 4U3HA 5KVFH 3RVTD 3C8DA 3QH3A 1CDBA 3S9DB 5EUKB 3O3DB 1NCAH 4U2ZA 1PAMA 5ILTL 3SCMB 4J6RH 3BYTA 2N7BA 3LKSA 4MD4A 4G9DB 3WS3B 1Q9LA 2Y25A 4J3XA 4TVPE 4I13B 2WBJB 2P46B 3K0WA 5IF0B 4QHNA 1S3KH 1K4CB 1NCNA 2CRYA 5JW4Q 1MVUA 1IEAB 3DO7B 3CC5A 3CDGB 4NKOA 4OFKA 4ZD3H 4F9PA 4M6OL 1JZ8A 4PJFE 5I18H 1M71A 1Q72H 1WZMA 3HS0A 1CFTA 2BVYA 3G08B 4KHTL 4NQCB 4Q6IA 4LPYA 1G7LB 1AQKH 3SJVE 2PR4H 5HI3C 4AJ0A 3P30L 1BQUA 3LRSB 3I9GL 5CZVH 1YEFL 1PSKH 1ZLWH 2FYYA 5IQ9A 3T2NL 5L6YL 3NFSL 3O45B 4MAYC 4CMHB 2J5LC 5D70L 4ISVB 1KJ2H 2DQFB 5E9DB 1W0VA 3MOQA 5FHBL 4CVWA 5FEBA 1SMOA 3VFSA 3M1BB 2WUBH 2VXTH 2ZUQC 4H0IA 3C08H 4HEME 2P5EE 5JORB 5LAXA 3LS4H 4LVOB 5F96H 2VSCA 1HWHB 3VXSD 4F15C 4PJDA 1S5IH 2PO6B 3FTGA 5H35A 1CLOH 3TZVA 5AAWA 5E6IB 3VD4A 3WSQH 1J0IA 2FJHA 5TGBA 1TNMA 2Y07H 1ZS8B 4X7SH 3CDCA 4QHUA 4Z7VF 4LSQL 4RGMC 4KU1A 5FM5O 5DVMA 1LEKB 2DWEA 2R0ZL 1DLFL 2R9HD 1CI5A 4XCYA 2XWJA 1P7QB 4RISH 1UQSB 4ODTL 1NLDL 2AS5M 4JG1L 5LWYH 4XPGH 4XXDA 1OPGL 2EYTA 4UT6L 2BNUB 3MLVH 2V5YA 4YDVB 2MQ0A 4W6YB 4HXBH 3VXRE 4JKLA 5D1ZD 2YN5A 1WCQA 3PNWA 5DR5H 4J3VA 5E2WH 2JB5H 4BM7A 3SDDB 2VE6A 5C0GB 4JFZH 2D03H 3DYOA 2VDRH 4GXVH 4O2CA 3X3GH 5I6XB 4N68A 5F9AC 4JZNB 4NO0A 1WITA 3UEZA 2EDNA 3O2DA 4RCAA 2V7NA 3W0WA 4UDTB 4YWGL 4KZEL 2Z92B 4U1NB 3PJSA 3FFCD 4O9HL 5E94B 4ONFL 4MNHB 5IBUG 1J05B 1OW0C 4JEGB 5D2LB 5T1DH 5DTFB 4U6VH 3BMWA 3FB6B 4P2YA 1JHTB 2GCYA 2OQJB 3J8F7 4H26A 3L5WA 3BO8A 4RIRA 3T0EB 3WS6C 2KKQA 1P84K 2DYPB 3PQYE 2EZ0C 5D2NC 4G42A 3MV7B 5TQ2L 4OLYL 3L3OB 4OZ4B 4U1GC 4XNUH 3I6GB 5KVGH 1J8KA 4YFLF 5E00A 2ZOLB 3H3KA 2YEZB 4GT7A 3WDHA 2DLHA 1SY6L 1YPZE 3V52H 1FRGH 1INQB 2PXYD 3QUYB 1GAFH 3BPNC 5FUOL 2AJYH 3RZCD 1CFQA 1OD9A 5K59E 4X4MA 1Y18B 1QKZL 1ZT4B 1E6JH 3H6JA 4HW6A 5IIEA 2CK2A 1II4E 2QADC 5CZKA 5I74B 3LZFL 4FQHB 4IMLA 3VFGH 3SGKA 4HXAH 5DMIL 3DUUB 1AGEB 3CXHJ 1CR9L 5IM7A 4M7JH 5GRVL 3PL6A 4KY1H 4JE4B 2QHRH 4D8PA 2CKBL 4R90H 2R4SL 2RFXB 1ETZA 4OGXH 4XMLH 4ZXBA 1JTTA 4Z7UA 4OT1H 4YQXH 2WUCH 4Z7QE 1Z9OA 1UACH 3M8OH 4KI5D 4G7VH 3ARSA 35C8H 4DN3L 1J5OH 2IBZY 5BOPA 2X1XR 4Z7VA 5CGYC 2NX5D 2JJVA 3A67L 1PGRB 1WK0A 1PLGL 5ICZB 3TNMA 1RUMH 3ZKND 4X6EA 3F7PC 3C5SA 2BY1A 4M5YH 5IUSA 3U6RB 3MPCA 2DJSA 2BVPB 4I3GA 4KRNA 4URTB 5CJ5A 4HWEL 4JJHA 2XWTA 4X6BA 5T5NG 4UILH 4L4TE 1T03H 4Y7MA 2VDOH 4O02H 1JGVH 4WWID 1TJIH 2OJZH 3LCYA 2AQ2A 1JRHI 3BOVA 4JCMA 1FN4A 2AI0H 3IXTA 4GMSL 3TLRA 3QO0B 1LEIA 1NLBH 4OF3A 3O6KL 5D6CA 2E7BA 1RZJH 1B0WA 5EBLB 1LO4H 1KNOA 3VMNA 3GSXB 4YIQB 1GZQA 1BVZA 4NDMA 3D18A 4WUUD 3B9DA 2ZJSH 4JO2H 3IDNA 4YLQT 3C9NA 1LHZA 1NC4D 2ATPB 1FSKC 1BVKA 3UTQA 4PUBL 3EYFA 4XPAL 2XN9E 1YMMD 5DHVH 5E8DH 1SQ2N 1NC2D 3VI4E 5D7JC 3QEUA 3MRBB 1I7RB 2B7DT 1X5AA 1A9BB 1AHWA 4MA3B 3ROLB 4KRPC 3A0OA 2CR6A 3JWDC 2JJTA 1A4KB 4P2RB 5IMKB 2NY7L 2HP4A 1U8KB 2ADFH 2AV7A 2ORBL 4ODSH 1BQLH 5C07A 4DTGH 3KYKL 3WIHA 2NY5H 3F6IA 1I3UA 3P9LA 3SDXF 2EH7H 3QDHA 3O2WL 3I50L 3UDWA 2JB6A 1A7NL 4Y88A 5C3TA 5JPNB 4Z8FH 4NGHH 4N8VG 5FYKL 1NGXB 4MJID 4M6ML 1A6AA 4UNVA 4UV4L 4AM0A 3U7YH 2A6JA 1CK0L 4NHCH 4XVSL 1YNKH 1EJOL 3EYOA 2YC1A 3GBMH 4NFCA 4P9MH 3NACL 2B1AH 5B4MD 3D39A 5TQ0L 1EHLH 1I1FB 4PTUA 4W4OC 3V7AE 1KYOJ 5C0AA 4LCIL 5F7MC 4HWBA 1NEZA 3NMEA 3WNLA 2VDQL 2NZ9C 2V9TA 5HSFA 1CLYL 5T3ZH 3TBYB 4NWUH 1FZKA 4K8RC 3LKNB 4JO1L 1NMBL 5DRZB 5KVEL 3O11B 2Z0BA 4F7PA 2CK0L 3OBAA 4C56D 1CBVH 1ZA6B 3BSZL 4TTDC 5TFSL 5C0CD 4RBPK 4GKSB 3LKPA 5T5FH 4NO5B 3VXUA 2FDBP 4KJWC 4A6YB 2ICWI 5DWUL 2AJSL 2VDKL 1URLA 4QGTA 4AH2B 1R3KB 4JO4H 1UJ3B 5KW9L 3B3IB 1Z0MA 3QO1A 2VNCA 3B9KA 2UWEB 2E27L 3IJSA 5E2TH 1WWCA 3K1KC 5E7BA 1R3LA 3FOLB 3VI3F 3QHZL 4Y4KA 2YMXH 5DRXB 2VN4A 4HUKB 2G9HB 3MACH 4GG6B 1CT8B 4XNMA 3MLZH 4YNYB 2CKNA 1ED3A 4PJ5D 3G9AB 5C0DB 1T20B 3EOTL 4KVCH 3UYPA 3ESUF 3KPNA 3PV7A 4ENEC 3G5VA 3GIZH 3O6LH 4YHMH 3V4UL 2DWDA 3MCLH 5D9SB 3QDMA 2X44D 2AABL 5EBGA 5ADOH 3ROOA 5IB1A 3BP6B 3MLRL 3QWOB 3SDYH 5ISZE 7CGTA 2FWOA 5H94A 4TSBH 1Z2KA 3AB0C 4NQDA 4WY7L 1RQ5A 2IQ9H 2JKXA 2VH5H 4JKPL 3ARBC 3N9GH 1H5BB 4EVNA 4IOIB 5BCAA 1IEBB 1H3PL 3BQUA 4XVUD 1MHPL 2H2PD 4JANA 2OJEB 3EBAA 3NPZB 3TH4T 3TPUA 1W72H 4OLWH 2IAMB 1KIPA 3MRMA 2HT3C 3X12A 4LPXA 3EYSH 4X6DA 3IFPB 3WUWB 5F7LB 4JRYE 3SDXA 3H7LA 2F74B 4P57B 2MMXA 3IS1X 1T5WA 2IGFH 5BS0E 1QSZA 3T3PF 3KPRA 2X4NB 1I8IA 1OB1A 4X4YA 1P7HL 2C4FU 3NCJL 1QRNB 2NXYD 3FO9A 4LIQH 2EEAA 2IH3B 4GAFB 1X5GA 3QFJE 3CFKA 3JTTB 3OHXB 4OFDA 2O61B 1RVFL 2H3NA 2AJZB 3TA3A 4X6CB 4HBQA 1ITBB 1BLNB 4I4WB 5L8JB 3R1GL 3HE6B 1BVLB 2DKUA 3HI6L 3V6ZB