5A40E

Crystal structure of a dual topology fluoride ion channel.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYWSYQEFTVPGSKTATISGLKPGVDYTITVYAYWEHMYHYSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE FLUORIDE ION TRANSPORTER CRCB
publication title Crystal Structures of a Double-Barrelled Fluoride Ion Channel.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Transport protein
total genus 12
structure length 90
sequence length 90
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a40E00
3DPBA 3V6BR 1B0GA 4BUHA 4LVHC 4G6FB 3V9FA 4OCXL 3LRGA 1A14H 1OL0A 1MUJA 3HZMA 1DBAL 3GMQB 5C0BD 3UYPA 3VWKC 5FDWA 5GGTA 1GXEA 1YZZA 4PJEE 5HDLA 2BVTA 1XGPA 2XKUA 1U8NA 1CD8A 4WU5B 1AO7A 5DMGC 4FZEL 3GHEH 5FO7B 1YPZB 4X5WB 5FHBH 5HHOE 1MQKL 1EZVX 3IFLH 1R5VB 4HQQH 1AXIB 3C2AH 1BQSA 5K9OA 4C56D 3ECBB 3PGCA 5I75B 1T5WA 3VWKA 4KAQH 5DI8A 3TN0C 3DMMD 1ZGLB 2J8UB 1C5DA 1X5IA 3G5YB 2E7MA 4OGAD 4P4KB 4X8JA 1U8JA 3SJVE 1EJOH 4P46D 2XA8L 2VLRE 5INDB 1I8KA 2HH0H 5I1EH 5SX5H 3F7PC 1U58B 3HZKA 2BFVL 1JHLL 4ODVH 15C8L 1U9KA 1WEJH 3TN0A 3SKUD 3G5XA 5F89B 3NAAH 4U1LB 3O9WC 3X11A 3QDJA 5IESH 3AS0A 3L3GB 1MCWW 4UTAH 1S7WB 1UWXK 3O81A 3C09B 5IBLD 3F62A 2A9NH 4UIMA 5B8CC 1U8IB 3KS0H 2OX5A 5DR5L 1OQXA 4MNQB 1BFVL 2XTJD 5F7WC 1IKFL 2BSED 4XVUC 1TDQA 3TBYB 3O9WA 3HNVH 1MFDL 1T1YA 5E24E 2L7UA 3UC0L 1LP9F 1B6DA 4ALAL 2XG5A 3G04A 1WIUA 5B8CA 3IDGB 2FZ3B 1IC5L 1XGUA 5HHOA 3P0GB 4ZOCA 5IVXF 2VO5A 3WXWL 1SJHB 3BIAX 1O0VA 4FQ1H 4KMTL 1PX4A 3X3GL 1S7XB 4NZRH 3B9AA 4JFOA 1G9NC 1TPXC 2CGRL 1I85C 3O0RL 2VKXA 5C0CD 2HFEB 1ZHNA 4RMUA 1JWSA 2DTSA 5KSBF 4IRZH 4QXTB 4NPYB 3OWEA 5KS9F 1EEYA 1OSPL 3WFCL 2UYLB 1HNFA 3O2VH 4RZCA 1QVOB 4FXGA 3MBED 3QUKA 5D96C 4HG4J 2DMBA 4L4VD 3P3YA 4QNPF 2WAHA 1I85A 3DTXB 4BQ9A 5F1NA 1G7LA 3BDXA 2ZNWA 5EU7E 2ZUVA 2XPGB 1QFWH 1TZGL 1S5IH 3HZYA 2GK0B 4KHXL 2VDMH 4DN4L 3VXSE 1I1FB 1KGCE 1JMZA 1J05B 4FXKB 2GCYA 1JN6A 4MB4A 5D1QD 5A2JH 1IAOA 1Q9KB 4R90L 4O2FB 3JV6A 2MCG1 4GG8B 2B0SL 4MQSB 4UQ2B 4J4PC 5KVDL 5ALBL 2F9BT 2CIKB 5EZLA 1KB5A 1ZANH 1A7QH 2VDPL 2Z91A 1ZVSA 2BOCA 5IJKC 2ATKA 4XNQA 5GPRA 1PLGL 4LFHD 3BI9X 4NQUA 1A6ZB 4JANB 4H25A 5C2UB 3BXNA 5ITFA 1MRDH 3QIBB 5I6XB 3KHQA 1F11A 5TH2B 3D9AL 3E8UL 1OPGL 5T1DL 4J4PA 4ONHA 1GRWA 4U2YA 5EU7C 3L5HA 3VRLF 1I1AB 4JO2L 3GMMA 5EZJA 2FX9H 1DLFL 4WJ5A 1T22A 5C0AA 2AV7B 4TSCL 1EO7A 3NABH 2X4RA 4XNZC 4HC1L 4OUOA 5HI3D 2Q76B 3LQAC 1IM3B 2R8SH 3D85B 4IHOA 4OM1L 5JXAL 5GRUL 3T3ME 2ESVD 2E9WA 4L3AA 5I30L 5C08E 4N0UE 3QHZH 2XWBB 4Z7NE 3L3JA 3QXAB 3IAGC 5F9JB 3RTQB 3BPNC 4NHCL 4LCWB 4KJYA 4NRXA 3RU8H 2HKHH 1HSBA 1S78C 2P7TB 1AIFB 2EDOA 4JPKL 4R9HA 1N59B 3FQNA 4ZFFA 5JW4R 4QY8B 3PWPD 4OGYH 4YEEA 1VGKA 2NY5L 1FH5L 4GMSH 1S9YB 1CLOH 2WINA 4X7EC 1G0DA 1QFOA 1JPFB 4Q97A 5J12B 4U1KB 4MVBC 4M43H 4UT7H 3V7MA 4Z77B 5J6GB 2X7LB 4G8GD 3MJGX 1HINL 2YZ1A 1OF2A 1DQLH 5I8OH 2AVGA 1UZ8B 1MHCB 3WDHA 4MJ6B 1T03L 5KJRL 1FYTD 2VDOL 2RFXB 1FNLA 1D6EA 3BZFA 3B3IA 3ARUA 4K7PY 4OUUA 1DQMH 5C6PB 4YDKH 2GJ6A 4NUJA 3U2SA 3PDOB 5D71H 4DN3L 1DEEA 3W2DL 1NAKL 5C08A 4N0UA 4RQQA 3L5XH 3UDWC 4F7PA 1FL5B 3QQ3A 4X4YB 3T1FA 3GBLA 1DANT 3W9DA 4RGMC 5CJOL 4RGNE 4NQXB 3LB6D 4R96B 5IMMA 1OAQH 1WWAX 2ADIA 2EH8L 2V5YA 2X4TB 2YRZA 4BFIB 5IHLB 3GJEB 1DBBH 1LO4L 4OKVB 2G60L 1JCKA 4OFIA 4NUGL 2BXYA 2QEJA 4PJ7F 4KROD 3IDJB 1IGCL 5JHDA 3QPXL 5EU4B 3BGAA 3DURB 2JLLA 4JHAL 2AABH 2DQGL 3QQNA 1JE6A 4HS3A 4PG2C 3QHTC 3UDWA 4IBLT 2CMRH 2H26A 2NXYC 4LRNH 1MCHA 3K3QA 3L5JA 4JDTH 4Q9CA 5C86A 2I60L 1N4XL 4XXCA 5BMFL 1NC4B 3U46B 1LEKA 5BOPA 2ZSVA 4J3UA 1BD2E 1T7VA 3BYTA 1OAZL 1TCRA 4KGLA 3VGBA 3B9DA 1DE4A 4HT1L 1QLEL 1ZT7A 1B4RA 1Q0YH 4PG2A 3ULVF 4CDGC 3UROR 4PD4J 4GAYA 1KG0B 3ARFD 1ZA3B 2XN9E 4MGXA 3BJ91 3V4PH 3GSUA 2D0GA 5IV2B 2EYTA 2VLLB 1MJUH 5I1JH 1IGTA 3HZVB 3I85A 4A6YB 5DQ9B 3K4DA 3UTSB 1INDH 1OAXH 4HWZB 4MJID 1JWMA 2KZWA 5CSZB 5SWSA 3SO3C 2G9HB 3STBA 4YZFF 5DJ2A 4S1DD 3EZ8A 4PJFE 2W60B 2GY5A 3N1QC 2DI8A 5E8EB 1KB5H 3OX8B 5F7YC 3W9EB 3ZKXC 2PO6B 3B2UC 5FCUL 5JOFA 4AENB 3I3DA 1MF2L 3QCTL 4HV8B 1U8LA 1T89A 4LSSL 3GMRB 3Q6GL 4L8BA 4WO4D 3S35H 1A47A 5LCVH 1MLCA 4RDQG 5EO1B 3RVVC 4PJGE 5KVMC 4HLJA 4O58L 2HFFA 4ODSH 3GMLA 4WUUE 1RJLA 3VFTA 3N0PB 2J2ZA 2RQ8A 1DN2A 5MERB 1KIRA 5F9WB 4XAWH 5A3IC 3GJFB 4R8WL 1ZSDA 2D7NA 5SV3A 3VWJD 3SDCD 2HT3D 5HVWA 3BP7B 4HWNA 2CKBL 2EH7L 5K9JL 3H3PH 5D7LA 2XN9A 3C9NA 2X1WL 5DEZA 1EMTL 3LEXA 4OV5A 5TE6H 1BZ9B 1T7XA 4M6OL 4YJZL 1MHEB 2JJTC 4FP8L 2GT9B 2X4UA 4Y4HD 3LQAH 2IFGA 2EDXA 4HDIB 3QUZB 4I5BB 2Y5EA 4NBXB 4LKCA 5B21A 4O51B 2DD8L 1B0RB 4FQXC 1MIEH 4P2CG 1U8KB 5LGKA 3QRGL 4NQVB 4O2CA 2P1YA 1V8HA 3IDXL 3VGAB 2IWGA 3THMH 4KMLB 2MPAL 2DLEA 2JJTA 3EFFA 4X7SL 4PUBH 2P5ED 1GZQB 2XI9A 1RZ7L 35C8L 3GSRB 4KZEH 3KAAA 3DHJA 5AZEH 4C56E 5T5FH 3HUJE 3MRHB 4U4BA 4FQXA 4M1DH 1JHKL 5J89A 5JHLH 2YPLA 1RZIA 2IPKB 4PJGA 2X05A 1F6FB 4F2MB 2BVQB 4JZNB 1D5BB 4M7JH 3NCEB 4CVWA 4UV4H 4WUUA 2AP2A 2XZAL 1A9BA 3UBXB 4F15B 4YHKH 1BZ7A 5F7EL 4P57A 3QG6A 4GXVL 3NIDF 3BT2H 4L3EE 4A6YL 1LP9E 3D69B 2HMIC 2GW5A 3MNWA 2R29L 2CLRA 3SDDB 2YD7A 4PJBF 2NY3D 4Y4FD 3BO8A 1WSST 2V7HA 5DUPH 3OSKA 1OGTB 2PR4L 1EHLL 4XP6H 3OR6A 4GBXA 5EZIL 5I1LB 1ODAA 2DBLH 3CFJB 4PJDB 1CDGA 2AEQL 5GGVY 4H88H 3GUTA 3OGCB 4ZS6C 5I76B 3MRGB 1I3VA 5LQBL 3RNKA 1TXKA 2XTJE 2EEDA 4PFEA 5GS0D 5I1DA 2PCPA 3TFKD 2OR7A 4QXGL 3CFIC 3JTSA 5B22A 1ORSA 1VEOA 4LCYB 5HYJD 3VD5A 2WV3A 2DIBA 1NLDL 4QNPE 3HC3L 3BN9C 1UEYA 4NOBA 3U36A 5I17B 3SDXB 5E1AB 3MRNA 2OZ4L 2VLJB 2BNQA 4C56A 3KJ4C 1T5XB 2BSSB 4CJ0A 3VD3A 4I77H 4HX1A 4NHUB 2EE2A 2IPUK 2ORBL 3DOSA 5C0CE 6CGTA 4PGBB 5FOJA 4ODUA 3A67L 3CFBB 4QTHB 5LWYH 4ZQKB 1HHKB 5IBLC 3A6OA 1MAKA 1Q9WA 1PG7H 1QNZH 4L3EA 1A14L 1K8IB 1LP9A 2YMXH 4GKSA 3ULSA 3HN3A 4M03A 2H45A 4L4VE 3R8QA 2XTJC 5L2JB 3O3DB 4JDVA 3WKMH 1JF5A 4PREA 4NQTA 4HUXB 3VFSA 1KTDA 2X4PB 5C0DB 3IT8D 2FJGA 2HT2D 3GHEL 1JWUB 1MI5D 2WW8A 1U92A 4X9IA 3K4AA 3IFLL 4BSJA 4B7LA 4HQQL 5DSCA 3C2AL 3DYMA 3KPSD 4X98A 3LKSB 3FO1A 5F88B 1TTGA 1M7DB 4KAQL 1JNHB 1YMMD 4P2YA 5KS9A 1LNUB 3L7EB 2L4OA 3DECA 3ZDYE 2BCKB 4PJXF 2NXZD 1EJOL 2EZ0D 2NW3A 4QHNB 1AXSA 3GO1L 3AAZA 4QRQA 4NRYB 4EI5B 4FQPA 3UAJD 4HPYH 3VRIA 1OB1A 1M6OA 1UCTA 4QRPB 3TZVD 4LEOA 1AJ7H 1N64L 1NL0H 4WEUD 1UQSB 4CL7A 1RUQH 3DVNA 1WEJL 2VDKH 1XR9A 2NY0B 1D5MA 1FO0H 5IESL 4OCYH 1SJEA 2W9EH 1XF2B 5DRWA 1U36A 3NGBB 4BQCA 2JK5B 4FZ8H 1KBGH 2C26A 3B43A 3O3AB 1QBAA 1PZ5B 2UZIL 2A9NL 5EOCH 5J9PB 1N6QH 2ZSWA 5IJVA 2EE6A 3B83A 1B0GB 4Y4KD 1BBJA 1L4IA 1MUJB 3HZMB 4U3CA 5FDWB 4F7CB 3HNVL 4MB5A 5F70A 5T1MA 1XGPB 2ESVE 3QFJD 1U8NB 2ZJSH 3GNMH 1AO7B 1ORQA 5D7JB 4WW2F 2N7AA 5CJ5A 4YH6A 1SQ2N 4OQTH 1EBAA 4FQ1L 5MP6H 3T4AB 5K9OB 4BSVA 3BP4A 5GGRA 4ZUSA 1A3QA 4WDIA 1T5WB 3VWKB 7FABH 5DI8B 1NANI 1KCUH 1FGNH 1TETL 3GM0A 2UZYB 2E9JA 3TNMA 4X8JB 1U8JB 4IRZL 4HK3N 4HMCA 3NFSL 1ADQA 3PWUA 3LHPH 4LGPB 2ZWLT 1I8KB 3O2VL 4K7PX 4GW1A 5E0QA 4JQVC 4LSTH 3HC4L 3TN0B 3G5XB 3UYOD 4DGIH 1G9MH 2NY2C 3LZFH 4M3KB 1S5HB 3X11B 3QDJB 4G8GE 1QFWL 1KCKA 1NFIA 1S5IL 1IMHC 3S37H 5DMYA 1TJIH 5ENWA 4FA8A 3K7UA 2VDML 2HWZH 3GHBH 3MYZA 2QR0A 4UNUA 5FGSA 5TJWK 3AXLA 2VIRA 4HD9A 1NC2A 4NM4H 4PRHA 4G9FD 1Z9OA 1FYTE 4JQVA 3CCHA 2Y07H 1LK2A 4LK4A 3DYOA 1FPTH 2CPCA 1T1YB 3H7BA 1ZANL 2VDQH 3D3VB 3OAZH 1A7QL 1IEAA 3D0VA 3LOWA 1BVKA 4M62H 1HILA 4U3HA 3G04B 2X09A 1XGUB 4G6AC 5HHOB 1B4JH 1EXUA 2DQTH 2XRAH 5EWIH 4PR5A 1C1EH 4UOW0 1XGRB 4JFOB 3ULVE 1MRDL 1GGYA 4U1MA 5IB4B 3T2NH 1IRAY 3UBXG 1MCWM 4UB0H 4OZHE 1ZHNB 3WFBL 5FDYA 2VZOA 3X3FH 2FX9L 4U0QB 4N5ED 1EEYB 5C9JA 3T65A 3AU1A 3NABL 5GZOC 4RZCB 5EDXA 4FXGB 3QUKB 4WHTA 3QEQD 3QQ4A 2R8SL 1TPXB 4LU5H 1JHTA 2BOBA 1A7RH 1JFQL 5F1NB 1G7LB 1UACH 4FQHA 4WCYH 5ETUA 1SEQH 2XYCA 3QPQD 3QHZL 5GGTL 3UPCA 3HZYB 4J3WA 1UB5A 4GKZA 1C12A 4U1HA 2HKHL 4DVRH 3TIDA 1BIIB 5CD5D 5CKGA 4OZIF 2GCYB 1JN6B 3EDDA 4LSQH 3F12B 3IRPX 5D96B 4BELD 1ZTXH 3K8KA 3I84A 4IRJD 5KG9A 3ULVC 5DYOA 4PJ8B 3N1PC 3QISA 1FZJA 3MPCA 3JV6B 1CXEA 2C1OA 4OGYL 4J3XA 2WQRA 4KROC 4MJIE 5EZLB 1KB5B 2APWA 4OFKA 3O8XD 4EN3D 3K8MA 1ZVSB 5DVMA 5D5MB 1CLOL 4BFGA 2ATKB 4XNQB 5EORH 2ZOLB 3QXUA 4R2GD 5E2VH 3S88H 3BXNB 5ITFB 2ADGA 4M43L 4UT7L 3L6FA 1F11B 4JFYA 3QI9C 2CO7B 4KTYA 3GMMB 1DQLL 5EZJB 1ZS8A 3HMWH 5I8OL 3L9RA 4WJ5B 1T22B 4DUWA 4IOFD 3MRRA 4W6XB 1UFUA 4TN9A 5JUEL 5C0AB 2YN3A 4HBQA 1XCTB 4L8DA 5I0DA 4HK0A 1KXVC 5CZXD 1JJUA 2FIKA 1DQML 2DQEL 4XBPA 4IHOB 4YBHA 4HK3J 1A5FL 3QI9A 5D71L 2Z31B 5K93A 4ZUTA 3GM8A 4HJ0D 5E4EC 1TTUA 3L5XL 3ROLB 4R4FH 4HZAA 5MEOA 2NY4C 2A6DA 2ICCA 4KJYB 4NRXB 1OAQL 2D7PA 2FHFA 1CS6A 1DBBL 1JK8B 1REIA 1RVFL 3VCLB 4XI5C 4TTGA 3FQNB 2ED7A 1RMFH 4NFDA 2HTKD 1Z9LA 3TO2A 2BY1A 2AABL 4TNWK 1EAJA 4KUCD 4MJIA 5E03A 1QRND 1GOFA 4RX4D 3EO1A 4ZXBC 3BPNB 1RURL 1ZE3C 2E8ZA 4OCNC 1I1RA 2EDTA 4IDJH 2WINB 32C2A 4JDTL 1BM3H 2Z8RA 5K33A 3VGGA 1YY9D 1Y18A 2XV6B 1ADQH 4KQ4H 4Q2ZB 1II4E 1AQDA 2GJZA 3M07A 1FZOA 4NJ9H 3TJHD 3OKKA 1UWXH 1G9NL 1Q0YL 4MA1C 5IKCA 1E4WH 1OF2B 2H8PA 4ZXBA 4WHDA 4MS8D 2IBGA 1YEFH 4U7KA 3V4PL 4WI7A 4R3SA 3BZFB 1MJUL 1OWWA 3B3IB 5I1JL 4OUUB 2X10A 3MRIA 3EW3B 1INDL 1OAXL 2GJ6B 1IZJA 4NUJB 1DEEB 5C08B 4RQQB 4F7PB 3RKPA 3QQ3B 3U0PA 3T1FB 1OWRM 2R69H 1J7VR 1KB5L 3W9DB 4XZUA 5IMMB 3TWCL 1SEBA 4ZNCD 1BQLH 2ADIB 4QWWD 4NSKA 4LGSB 2AJZA 5DMKB 5C0FA 4HFUH 1H3WM 3RVUC 1P7QA 5JHDB 3EBAA 4YFDB 5INCA 4HS3B 5HYFA 3S35L 3DV4A 3FT4B 5LCVL 4M8VA 2EDNA 4KXZH 3SCMC 2H26B 5FA4A 4RGMB 3QIUD 5DRNA 5L0QC 4GRLC 1E4XI 3SO5A 4OFYA 2HYMA 3EYQD 5C0RH 4H0GA 1QFHA 4ODSL 2X4OB 1LEKB 5HYJE 2ZSVB 3P0VH 4J3SA 2ARJQ 2GUOA 4XAWL 1TCRB 1K8DA 1DE4B 3JV4A 3JWOH 3U4EA 5C92A 4PJBA 4WUKH 2J88H 5JMOC 1QRKA 1ZT7B 1EFXD 3DLQR 1JF1A 1QHOA 2DMCA 4QXUH 3SCMA 2RHEA 5HHMD 2NXYB 4JFPA 3KHOA 4GAYB 5IB5A 1CGYA 2ED9A 4LAJH 1NDGA 4PB0H 5TE6L 3NFPA 3GSUB 4ZPTB 2NW2A 5IMLA 3PGFL 1IGTB 4YHOH 3LQAL 1JWMB 1FORH 2XXCB 5ISZA 5SWSB 4PJXE 1D9KC 5FOBA 1OTSD 4HH9A 5HD8D 1DQDH 4EQ2A 3MQIA 1MIEL 1MH5A 1OVZA 3HE7C 2YEZA 1N8ZA 4JVUA 4DEPB 1DEDA 3MGAA 5JOFB 3RZCC 5F7HA 2WUCH 3WNLA 2ZG1A 4JHZA 4NGHH 4TNWF 4TRPL 2BRRL 1OSZA 1U8LB 1MI5E 5F44A 4XVJL 2HVJA 1T0PB 3ULVH 3RPIA 4Y2OA 3SO3B 1D9KA 3KPSE 3BH9A 5AZEL 2UWEE 3HB3D 1QPPA 2XY1A 1PSKL 3L3OA 5T5FL 4LLAA 1CD1A 2FR4A 2VRAA 1MLCB 2FEEI 4M1DL 3BUYB 4GG6F 1YMME 3HE7A 3O45B 4LF3A 5JHLL 3ZKXB 4U6XA 4M1CD 1IL1A 3RZCA 4UV4L 2R0WH 2HFFB 5HYJA 3GMLB 1CZ8H 1RJLB 3VFTB 1KIRB 5D2NE 3ZYZA 5DD0H 4GRWE 3IXAA 4YHKL 1ZSDB 3T0EE 3WS6C 1FO0B 5E08H 4NDMA 3VDBA 4AG4L 3BT2L 4ORGA 1N0LA 1CGTA 2P46B 2Z8VC 4CN1A 5JLZA 1BREA 4DFIA 5D7LB 2VN7A 4G9DA 2XN9B 3C9NB 3LEXB 4H26A 1IGIH 4OV5B 5DUPL 3FHQA 1G9EA 1GZPA 4YX2H 1O7SA 2X4UB 4LLVA 3WS6A 2EIEA 4EI6A 5JOPD 5I15H 3RY5A 1W8OA 1QR4A 4PJXA 1CBVL 1NH6A 4G6KH 3OF6A 2GSIA 5I8CA 1C16A 4D0DA 3LSOA 1BIHA 4XMKH 3JV0A 2J12B 1C5BL 3QFJE 2DL9A 4EUPH 4NZJA 3MJ6A 2XQBH 4NWUH 4JVWA 2AQ1A 3QDAA 1F8TH 2MHAA 1EDQA 4LEXL 5K59E 3WDJA 3SKOA 5I16A 3EFFB 1VFOA 1VPOH 1MI5A 2GEEA 1IC4H 3T0EC 1DBKH 3VI3E 3TZVC 5CMAA 2JJVA 2DMKA 2FD6L 3KYMA 4YDJA 2XT1B 4I77L 3HNTL 4FQXB 3SE8H 3EAKA 1FSKC 4B50A 2YPLB 1RZIB 4PJGB 4CN4A 2O93L 4FG6D 5LWYL 2PF6A 2A38A 4WUUB 1A9BB 3UCRA 3T0EA 1YEIH 1BZ7B 4OI8A 2PTTA 4P57B 1PG7L 3TZVA 1QNZL 1ZHLA 2YMXL 2G2RA 4JHWH 1CR9L 4NO5A 4M7LT 4LIQE 2R2CA 3IDUA 3WKML 2CLRB 4R0LA 4JO1H 3BO8B 4DW2H 2V7HB 4JRWA 3N1FC 1E6OH 4WNQA 2FDBP 1NSNL 4F8QA 4G9FE 1EX0A 1HXYB 2HFGH 3BESR 3PWVA 3RNKB 3MRPA 5I1DB 2VNCA 3N06B 4EEEA 3QFJA 1ORSB 1NBZA 2IPTH 4EQ3A 3ZSTA 4HPYL 4OLYH 4Y89A 2ZOKA 1LILA 2COQA 2E7LC 1JTOA 1HHGA 1QO3A 1EHXA 1AJ7L 1NL0L 3MRNB 5TFSL 1RUQL 1GGIH 2BNQB 4C56B 4X6FB 1S7VA 4YXLL 2B5IC 4HWEH 2W9EL 1JZ6A 2HTLD 3QUMA 4M1GL 1WFOA 5HYQA 3MFFA 4FZ8L 4ODUB 1JRHH 1A7NH 2V5MA 1F4HA 1W0YT 4P3CH 2RB8A 1YECL 1Z6JT 5EOCL 3RVXD 2GYSA 1PQZA 3VG0H 2XICA 2NX5D 2X4NA 5FGCE 1U93A 4H20L 2A1WH 4LSRL 2BSRA 4QYOA 5JDSB 3CDFA 3QEQE 4L3EB 5I1IL 1LP9B 3ULSB 4GKSB 4BFEA 3KJ4B 1SY6A 2KL6A 4H8WC 1G0XA 3G5ZA 4PREB 3I3EA 1CD0A 5GRWA 1MQ8A 3QDMD 3SGJC 4TQEH 1KTDB 3VFSB 5IVXB 3NTCH 4D0CA 1E28A 1T7ZA 3C6LD 4KKBD 1T04A 4FRWA 5ICXA 4NQCA 3AM8C 2LAAA 5CILH 5DSCB 5MP6L 4X8XA 2M2DA 3L7FB 2EDLA 2FO4A 5DGRA 3FN3A 4G9FA 3FJTA 1HHIA 3ZL4L 7FABL 5KSBB 2W92A 2XTJB 5KS9B 1Z0NA 5F72S 1OTTD 3SDAD 3NPSC 5IFAH 4NKDA 5DHVA 3SGJA 2NW3B 2I9TA 1AXSB 3AAZB 2VQ1A 4OIAA 1H3TA 1U91A 4TOYH 3LHPL 3LS5H 2Z9TA 3AM8A 3VRIB 1OB1B 1M6OB 1MRCH 4I2XE 3K8LA 5A40E 1L7IH 4LSTL 4L5FH 2MMXA 1XR9B 3BN3B 5IT2H 2OJEA 4DGIL 4P9MH 4YAQA 3NMEA 1SJEB 3S37L 4OZIA 3SGKC 3FFDA 1TJIL 1BGXH 3GHBL 4K9EC 3VXTA 5C3LD 3MUJA 5F3HA 1PAMA 1HYSC 5HDOA 3HR5A 4NM4L 4OZFA 2Y07L 1BBJB 2LABA 5DT1L 2H32H 4X6EA 1RIHH 3MCLH 5T1MB 2FLBT 3REVA 2VDQL 3SGKA 5AUMA 3IS1X 1ZGLM 2XZCH 1ORQB 4CBPA 4KZDH 3M1BA 4M62L 5CGYD 3T77B 4OB5H 3VJ6B 1GGCH 1MJ8H 1VFAA 2HJKB 1B4JL 2DQTL 4BH7A 2K1MA 5CEZH 1C1EL 3BP4B 2E7BA 4ZUSB 2WSKA 2R1YA 4WDIB 5GGRB 4OD3H 3D2UA 3V0AC 4IRJA 3T2NL 5DRXA 1I7TB 2IF7A 1JI1A 3FT3A 3TNMB 4P3DA 3X3FL 1QRNE 2C5DC 4EZMA 4YGVA 5I8EB 5ADOL 1U6AH 4I2XA 4IDLA 1R0AH 4GW1B 4XPAH 4I0KA 1E6JH 2V17H 5A16A 5CZXC 1QLRA 4HCRH 4PRPA 3VDAA 1A7RL 3UTQA 2WBKA 1B3JA 2VL5A 1IM9A 1SEQL 3TBTA 4P5KA 2JIXD 4HXAH 4JM2D 3F7VA 5ENWB 4B0MM 4M4PA 4DVRL 4IEFB 3W82A 3HCVA 2QR0B 3L1OH 4W81A 3AXLB 4LSQL 1L0YA 1NC2B 4PRHB 3CCHB 1SVZA 3ILQD 3OKNA 1KF9B 3FB6A 4RIRA 5J0BA 8FABA 3RL1A 2NY2B 3RX5A 3BWUC 3H7BB 3RWJB 1XMWA 3CX5K 3IF1A 3VXMD 3D0VB 1BVKB 4HSQA 4EDWL 5IW6A 2F5BH 1HILB 2QADC 5IEHA 4NN5C 1EXUB 4JM2F 5JZ7C 5HBBA 1YY9C 5E2VL 3S88L 3MLSH 4LLDA 4P59H 3CVIH 3WCYA 4XT1C 1ZLSL 3MNVA 3VXUD 3HMWL 1J0IA 3SPVA 1LMKA 1IJ9A 1H8SA 3GZKA 3AC0A 3T65B 4KKLD 3ARED 2CQVA 3D18A 3QXTA 4ONGH 1JHTB 2BOBB 5EO0A 5F97E 4FQHB 3KPRA 3G5VA 2BJML 5ETUB 2FB4H 5EU6D 5EUOB 4R4FL 5B39A 4TSBH 1HSAB 1CTOA 3QDGD 4U1HB 2D4FA 3TIDB 3BFOA 1CD9B 2F74B 4PJ7B 2A6JA 1OP5K 1CU4H 1JPSH 3V4UH 5GGUA 2Q86B 5KG9B 5DTFA 4J8RA 8CGTA 2EDYA 5DYOB 3ZKND 1RMFL 3AMLA 3DV6A 4M7KL 4NNXA 1XFPA 5DFWH 4WWID 4H8WH 1FC2D 5DHVH 2C3VA 4TNVK 1LE9A 4NP4H 4UINL 4IDJL 1BM3L 1LO3H 4IOSD 1R24A 3QIUC 1H3XA 5HHXH 5IB2B 3TO4C 3F7QA 2JE8A 3BSZH 1ADQL 4KQ4L 2W0PA 4CADA 4NO3A 5HVHC 4AEFA 5MHSE 4NJ9L 2ADGB 1G7HA 1A1NA 4JFYB 4KROB 5FYJH 1E4WL 1ZS8B 3WDIA 3L9RB 2IAND 3MRRB 4HUKB 3MACH 4IIQC 3V6FA 3QIUA 4JY5H 1YEFL 5E56A 3TO4A 5HHQA 4HK0B 3HE6D 3NIGE 5D2LE 2PXYD 3C5ZC 5DQJA 2FIKB 2OTUA 4XBPB 3EO9H 4NO0D 5GZND 4I0PD 3WLWD 4NCC2 4OZFH 1PJ9A 3QI9B 4G6MH 3TYGL 4ZUTB 2JTDA 2VISA 3BE1H 1EFXA 3WHE0 5MEOB 5E5MB 2A6DB 2R69L 3PDGA 1RFDL 1YEGH 1HKFA 4JO4H 5E6ID 4Q74A 1D6VH 3D39D 1BQLL 3VRJA 5D7SH 4K9EH 3IRZA 1F4XH 3ARYA 3MO1A 4YBQC 1KFAH 1WTLA 2XFXA 1XCQA 3C5ZA 3MLVL 4HFUL 5C70A 4MXVF 3ZYJA 3OAUH 4NZUH 1RJZA 4XNUH 3DNKA 3TO2B 5I1CH 1FVDA 1U3HC 4D94A 1QSFB 4MJIB 5E4EB 1YEKH 3EJZC 5IB1A 5IF0A 4K3DH 2NY4B 1FN4B 1FFPB 2EICA 4KRMB 4EUPB 3G6JE 5TQ2H 3RIFF 3KLAA 4P23C 5F21B 1R5IB 4X5XB 2OQJA 1Y18B 2QQNH 3P0VL 4L9LC 4M1CC 2R0KL 2GJZB 1UCBH 5IQ9A 1FZOB 3OKKB 2P43B 3KLDA 1F4WH 1U3HA 4Z7VF 3PWLA 1I3GH 5IKCB 1E4XH 3RY4A 3BIBX 4R97C 4QXUL 1NGPH 2H8PB 4ZXBB 5BVPL 4G42A 5IBTH 4M5ZH 4KI1A 4P23A 2XOTA 1WVZA 4WFFD 2CR3A 4PB0L 3RI5F 3RIAF 4L9LA 1JGVH 1V3MA 3MRIB 2VAAA 2VXTL 3B4NA 4ZD3H 1KTLA 4YHOL 1OM3L 4LQFH 1OLZA 4MA1B 5GS3A 4ZOEA 2IGFH 1K5NB 3U0PB 2PYFA 1CGVA 1DQDL 4AIOA 4Y16D 4GFTB 1PG7W 4XZUB 2R1XA 1SEBB 1X7QA 3MV01 4ZSOE 4NSKB 2DQJH 4I13B 2WUCL 1PDKA 2AJZB 5C0FB 4NGHL 3IU4H 4XWGH 4I3SL 2XG4A 2E9IA 4E41D 1S7TA 3B5HA 1P7QB 3ULVL 1HOCA 2ZZUT 1WWCA 5INCB 4TNVF 4G5ZH 3DV4B 3ALXA 4PLJD 4NZTH 3QUXC 1I9JL 1HHHA 1YNLH 4GS7C 5SWZD 4HBCL 2A6IA 1JNLH 1YNKL 5DRNB 1DR9A 1YJDH 5HPMB 1NKOA 1AFVL 1CZ8L 1AE6H 1A3RH 1W8NA 2GUOB 5DD6A 1Y6KR 4JFQA 3JV4B 1JNNL 4FN0A 1A7PL 3P0YH 3U4EB 1BVZA 4PJBB 3UTPD 5ERWA 5E08L 3NA9L 1G6VK 3TIEA 1INEH 3QUXA 3SCMB 5J7CC 3DUSA 1S7SA 4JFPB 5IB5B 5M95B 4Z7WF 5L0QB 4GRLB 1YQVH 4NM8H 3M17B 1IGIL 1NDGB 1NLBH 3G08A 1AY1H 3NFPB 3HRZA 3QEHA 4YX2L 2NW2B 3HLAA 2EDWA 5HI5C 5IMLB 1DCLA 2VDLH 2FECL 2VAJA 5F7FA 2APFA 2NX5E 4LRIA 5H37H 5I15L 4LHJB 5ISZB 4EBQH 5FOBB 2O5ZL 3MLYL 3V79C 5IHZA 2H2SD 2V2WA 1MH5B 2JB6B 4XMKL 2YEZB 1N8ZB 1GGUA 2A0LD 3QDME 5T3XH 4ZSOA 2XQBL 4NWUL 5C0NC 3GKZA 1F8TL 4JN1L 3QUYC 3WJLC 2KDGA 4UUJB 1VPOL 1OSZB 1ED3A 1DVFD 3TH4T 1IC4L 2ATPB 2HVJB 3RPIB 4HGKC 3T1WA 4WGWB 1D9KB 3BH9B 3U9PH 5C07D 3CUPB 3L3OB 3W0WD 3EYSH 2F8VA 4XTRC 4XBEL 1CD1B 2FR4B 4NQDD 3SE8L 3HE7B 3V2AR 4LF3B 4YR6B 1TIUA 4G43A 4KPHH 4YHIA 5GRVK 4AEEA 1P4LA 4U6XB 2DLFH 1IL1B 3RZCB 3RVWD 1I1YB 2IC2A 3QUYA 3WJLA 4PYHA 3ARRA 4DK6A 3IXAB 4OTXH 3WIFA 1UZ6E 1TZHA 2Y06H 2H2PC 2GKIA 4NDMB 4ORGB 4K3GA 3IETA 4JHWL 4N0YL 3K1DA 4RISH 4WHYH 4CDHA 2F8XC 5JQHC 1TQCB 1HH6B 3CU7A 5ID1B 5ADPH 4JO1L 4H26B 3D0LB 3KXFD 5JA8B 2DAVA 3JTTB 5IW1A 1GZPB 4U7SA 5HPOA 4Z7UF 1R3JA 1I8IA 4LLVB 4EI6B 2EDRA 1Y6MR 5EBLA 2X42A 4PJXB 4YC2C 2P5WE 4PRAA 3FZUD 2HFGL 3B9KD 3V8CA 1A6UH 2GSIB 2YA0A 5I8CB 5DZLA 1C16B 4MZ2A 4D0DB 3EFDH 5IWLC 2BHZA 3LSOB 2VR5A 1OTTC 4KI5F 2HVKA 3RRQA 2CDFA 2IPTL 4W70A 1YYMH 5I1GL 2MHAB 3SKOB 1MAJA 5I16B 2VH5L 4LQ1A 4YK4C 1AKJB 3QXDB 1GGIL 3QNXA 1FG2A 4FFWC 5HGDA 3KYMB 4YDJB 1FDLH 1GVIA 2OL3A 3QP3A 4HWEL 3W39B 4H0IA 2CLZB 5T1LD 5GS1C 5HXMA 3OXRA 5FM5M 2VR4A 1JRHL 3OKDB 4Z5RA 3ZE2F 3ZT7A 4F7EA 4JFFD 3PQYA 3T2QA 4P3CL 3VG0L 1KJMB 2A1WL 4F9LC 3ZMRA 3T0EB 3SGDH 4XVSH 3TZVB 1ZHLB 3BD5A 1ZVHA 4ZODA 4QO1A 2G2RB 1RHHB 2I24N 4NO5B 2EIBA 4MXWH 4WW2B 4K3EH 4CRPA 1FSKB 4ETQA 2YKLL 4TQEL 3CVHA 3NTCL 1S7UA 3U83A 4NKOA 2B4CC 4QHLA 2GI7A 5BZDB 4Z6AT 1IARB 1WTGT 4GW5A 1MSPA 4EUPG 4HS6A 4IRSD 5CILL 5LJYH 3VFPA 1NAMH 4KK6D 4LDLB 5L7XH 4AT6A 3R8BB 4XAKE 5IHUH 2P5WA 1MREH 5TDPA 2WP3T 3MRPB 1PY4A 5IFAL 4KY1H 5KBNC 1YUHA 3FOMA 1EHNA 4ENEC 3QFJB 3MMEA 3VXME 3FT2A 5GGVH 2WMPA 3LS5L 1H15B 1MRCL 2ZOKB 3RGVD 4M5YL 1L7IL 2DDQL 4BFBD 2BNUA 1HHGB 2PNDA 3OL2A 1CLCA 4GW4A 1FYHB 4WTXA 2Z0BA 1OT1A 5IT2L 1MHHA 1FVEA 5H35A 3V5KA 1AR2A 3S34L 3VGDA 3C5SB 2EIZA 1YEDA 1LO0H 1CWVA 5HYQB 2UY7A 4U6VL 3DX7A 4JE4B 4JM2C 1BGXL 4N0CD 3U6RA 2PYEA 1WZ1H 4X0KA 4HKXA 1A6VH 1NFDE 1PQZB 1T66D 3T08A 4DGVH 2YUWA 2X4NB 3DO3A 4JCMA 3QO1A 1KJ3H 2P49B 4QYOB 5AYQA 4X6CF 4RWYH 5GGSA 1LE5A 3BPLC 2B5IB 2CR6A 4HUMB 2DYPD 3MCLL 3G5ZB 4MLIA 3QCUH 4KZDL 2DRUA 1E28B 5EU6E 4D0CB 3RWHA 3MZTA 4JM2A 4CW1B 1CXIA 1A6TA 4P4RA 1JGLH 5ICXB 3QDGE 4NQCB 1XGYL 1EV2E 1CGSH 5CEZL 2FO4B 4OD3L 4S2SA 4GUPB 1HHIB 1JVKA 3QQ9D 4X6DF 5CJQH 1QYGL 1J8HA 3U9UA 5TDNB 1R3LA 4NKDB 5DHVB 5J6HA 5GRJL 3TLRA 2H1PH 2I9TB 4PJIF 25C8H 1EGJH 4KHTH 12E8H 1AD9A 2VQ1B 1AD0A 4HUNB 3ARZA 1U91B 5BRZD 5JA9A 3J7HA 2OR8A 1BVLA 1U6AL 3MJ8A 1R0AL 4XPAL 3ZTNL 1E6JL 3QEUA 4PJCF 5HGHA 3ZE0F 3RNQA 3EYOA 2VB5A 2OJEB 3H8NA 1J9CT 2V9QA 3QR2A 2W1NA 3F65A 4YAQB 3NPSB 3OV6A 5AYUH 1T83C 1ZT1A 1HQ4A 2NY1C 3QHFH 2DQHH 4HXAL 4OZIB 3FFDB 2EKSA 2OXHA 3H9SA 5DJ6A 2JCCE 4KJWC 5I0ZA 1EEZA 1MFEL 2IANE 3VDCA 4DUXA 3L1OL 5F3HB 4ZO7A 4HULB 4OD2A 1J1XH 4KKAD 3HR5B 5CCKH 4NC1C 4Z7QF 2DQDH 4NT6A 4OZFB 1SJVA 4MMXC 2AQ3A 1ZA6A 3MV8D 5GIRB 4I4WA 5LBSL 2OTPA 5CUSH 2W59A 2VZ1A 1EHAA 4X6EB 1T83A 2YPVH 5CIPH 3A6BH 4PBWD 3REVB 1C8PA 1UM6H 4K71C 2ICWI 5DLMH 5EU6A 5L8JB 3MLWH 3M1BB 2RIKA 2F5BL 1WISA 1F5WA 3HAEA 3QDGA 3OKOB 1ZLVH 3D39E 4XCFH 3E0GA 4BH7B 4WVRA 3WO4C 1Y0LB 2PW1A 3BD4A 2R1YB 3D2UB 3MLSL 5E6ZA 1EAPB 4P59L 1U42A 3TM6A 2Y36H 3GSQA 3CVIL 3FT3B 4CKVX 4P3DB 5JDJA 3DROA 2VKWA 3QUML 1OAUH 2V9RA 4YGVB 3V6OE 3LEYH 3VXRB 3KPMA 4I2XB 4RBPK 4ONGL 2AJSH 3LN9A 1EPFA 5A16B 5F3BA 3RZWA 1QLRB 1UH3A 2PXYC 4PRPB 3UTQB 2NYYC 3WNPA 1GHFH 2R2HA 2VL5B 4I0PC 1IM9B 3TBTB 2Z4QA 5HHNA 1SY6L 1I8LC 2FLRT 3F7VB 1FV1A 4TSBL 3BYYA 4JFHD 5CJXC 1UADC 5F7LB 2JCCA 1MCOH 2IANA 2HAZA 5E6IC 3RWIA 2JB5H 4WFFE 3VFOB 3MV9B 3V4UL 3LIZH 1ND0A 3HE6A 1R3IH 3OKNB 1RZKC 2PXYA 4OCWH 4NKQB 5D1ZD 3FB6B 4LHQB 2AJVH 3BKMH 4L8CB 3X12B 3ALWA 4RIRB 8FABB 1OTUD 3RL1B 4I0PA 1KXQE 1I8LA 3TV3H 5E8DH 4H8WL 2NPLX 3O4LD 1G0YR 4P5TC 2IMNA 4NP4L 5GGQH 4ZUVA 1SVCP 5IW6B 2A77H 1LO3L 4OIIL 5E6IA 5HHXL 1RY7B 5IEHB 2B4CH 2VXVH 3D39A 3FFCB 4JY4A 4FQQA 5C0EA 4LLDB 5F8QC 5FYJL 4Z7WE 1TJGH 4K8RC 4GKOA 3IAPA 1UWGH 2CLVA 1RD6A 3QO0A 4U1IA 3SPVB 4PLKC 4P5TA 5EIIA 3MACL 3GGWA 2J6EH 5SWZE 4JY5L 2QADB 4NN5B 3KPLA 3D18B 4ODTH 3ROOB 1CGXA 3QZWA 2W0LA 3EO9L 4N68A 5C0JA 5MEPA 5EO0B 3QJHA 4G6ML 3KPRB 3MRKA 3AFLA 4N8VA 3V0WH 5GSRB 1IAIM 3V7AE 3ZE1F 5B39B 5EOTB 2BHYA 1YEGL 4JO4L 4RA3A 3C5JA 4ONOA 3HMXA 1D6VL 3O3BA 3FKUS 3MR9B 3TBWB 4Y16C 2A6JB 5D7SL 4K9EL 4JRYD 4J6RH 1GYAA 1WAAF 1KFAL 3OR7A 1QG3A 2GY7B 1UM4H 5GGUB 4PRBA 5DTFB 5DO2D 3OAUL 1TVHA 2D31A 3RJQB 4QF1A 4XNUL 3RVTD 3WFDL 5JIIA 2DTMH 3DV6B 5I1CL 4NNXB 5KAQF 2X4QB 4ZAKD 1YEKL 5TDOA 4K3DL 4XGZA 5DD1H 3BQUC 2C3VB 1LE9B 4MJ5A 1FBIL 4Y16A 2DWEA 5GXBB 3ARWA 4W6YB 3KNBB 2AK4A 2ENYA 1MCLA 4E42A 4OJFH 5C09A 4FQ2H 1EUTA 3ARBC 4XNMA 1UCBL 2FRGP 4OCXH 4D9QD 3BHBA 1IAMA 5DHYA 3VXNA 1G7HB 2C3GA 1F4WL 4HG4K 1X3DA 4Z7WA 4NFBA 1I3GL 1IAKB 5HSFA 1HEZA 3L3HA 4EKXA 3IFOA 4R4BA 5C07E 4XC3L 3DETC 1NGPL 3W0WE 3BQUA 4KUZH 3L3IA 4J3OC 5IBTL 1FZMA 4NQDE 4LVNC 5SWZA 4Z7UE 4LBEA 3S36X 3V6FB 1MQKH 4Z0XA 3JUZA 4HEME 4HHAA 5E2UH 3TO4B 5BVJA 5HHQB 4N8CH 3ARBA 1JGVL 5HVHB 4KK8C 5BOZG 5DQJB 2OTUB 1F58L 2F53B 1IKNC 3QYCA 3I6LD 4NC2B 3UBXI 3OG4B 5FYKD 2VISB 2ZUUA 3BEVB 2IGFL 5HYIA 2H2SC 1VENA 1Z9SA 4IIQB 1LVEA 3C60C 3G9VA 3QIWD 4K7PL 4LCUA 1J1OH 5D70H 1N0XL 3VRJB 5FUOH 5A43C 2DQJL 1VGEH 2A83A 3KXFE 3EHBC 3HAEH 2XFXB 1XCQB 1LEGA 2BFVH 3C5ZB 3IDYC 15C8H 2IALB 1RJZB 1I3RB 1RUML 4GG6B 1IKNA 1FVDB 3TVMC 4JKKA 1A64A 4G5ZL 1T1WB 2VLME 5IB1B 2Z35A 4NZTL 5IF0B 3FMGH 1M05B 1YNLL 2OM5A 4KK9D 1JNLL 3BVNA 2P48B 3C60A 1CFSB 3KLAB 2OQJB 4U05A 4YEFA 2HRLA 5HGGS 5DR5H 4BUGA 1AE6L 4MDIA 1A3RL 3VMPA 5MENA 3WUZA 1RV6X 1U3HB 3TVMA 3PWLB 4KI5C 1FC1A 2NR6D 1LO5B 4OZFG 1INEL 3UC0H 1F4AA 1U8HA 4G42B 1YQVL 4NM8L 4P23B 4Z7UA 3OB0K 4LLYB 1AY1L 2D3VA 4NKMA 4L9LB 1D7FA 1F2QA 2FIRT 1IC1A 1TZIA 2VDLL 2OP4H 2HJFA 2VAAB 3RDTC 1PYWA 2BC4A 3BPOC 2NLJA 2EXYC 4EBQL 3R0NA 1KENH 1C08B 4YDIL 4R97B 4BZ2L 2PYFB 3T0BA 4U1NA 3MODL 5E5RB 1MCDA 4JZOA 4UT6H 4QHKI 1QFWI 1X7QB 5LGHH 5T3XL 4DTGH 3FHAA 2P45B 4NZDA 4XCCH 2OLDA 4N9GA 4CVZA 3KXFA 2D03L 2N56A 1ZHKB 4L4TB 1IGML 3RDTA 1S7TB 2JELL 1WFUA 4HW6A 1HOCB 3ULUF 1RZKH 3U9PL 4KJPD 2R0ZH 3EYSL 1ZLWK 3MC0A 1HHHB 3B9KA 3H9HA 4GQPH 4HF5H 5FFLA 2GITA 2A6IB 1E27A 5ICYA 4NQED 1V05A 4V2BA 3TT3H 3WIIH 2DLFL 5F71A 2DM2A 4OAWB 4PBXA 3CLEH 3O11A 5DD6B 1A0QH 3ARDD 5T3ZD 1QFUH 5KSAD 4JFQB 2FHBA 2Y06L 4LOUD 4MXQD 2ZCKH 5ERWB 1QSEB 2CRYA 3TIEB 5F7DA 4RISL 3KDMA 3QUXB 1OP5H 3DUSB 1S7SB 1T0NA 4K8RH 4PJEF 4I18C 5EOQH 3ILPA 2BVEA 1OGAD 4J1UB 4Z8FH 3HRZB 1J11A 3QEHB 4KDVA 3HLAB 3TA3D 4X6DE 1KSRA 3VA6A 4FFYH 5FGBC 4RRPA 3JV5A 2RR3A 3CIQA 5T1DH 4NBYB 1T6WA 1A6UL 5IHZB 1H3GA 2V2WB 1DLFH 1X5XA 4D9RD 3EFDL 4I18A 1Q9OA 4J3TA 4P2RD 1UGNA 3HC0A 4PB9H 4ZSOB 1YYML 1NFKA 4PJCE 4PBVC 3RUGE 4DKAA 3ZE0E 3DI3B 3IDMA 5FGBA 4RA0C 4P48A 5C7XH 5GRUH 5I19H 5JXAH 1I7ZB 3KJ6L 3RGVC 1UXWA 4Y5VC 4P2OD 5I30H 1XT5A 2OI9C 1FDLL 2GJJA 3GSWA 4G43B 4YHIB 5CBEA 4D8PB 1X4XA 4U3XA 5B39G 1ETZB 3T0DA 3QUYB 5IB3A 2ADJA 4N0CC 4PJ5D 4TUJA 2VABA 4MQ7B 3T0VA 5BRZE 4WW1A 3WIFB 1T66C 1TZHB 3OTTA 4XVSL 3RGVA 3PHOA 4Y5VA 3EYFA 4WFHD 5H37G 4MXWL 5EU3A 3WXVH 3KYOA 3GI8H 1YNTA 2X70A 1NBVH 1FH5H 4J2XA 2P8MB 4BJLA 4F7MA 3PL6D 3OKMA 5E9DA 4AQ1B 1T1XA 3RHWK 5IW1B 2VOTA 5DA0B 4YBLC 1RJYA 4X6DA 4RSVA 1R3JB 1I8IB 1DANU 5EBLB 5L7XL 1WLHA 4J12A 1JUFA 2VLKD 4QHUA 5CIPB 4Y19D 1VACB 3MV8E 3RFZC 4PG9A 4PJIA 3S3JA 3HI1A 5CFHA 4ODXB 4KY1L 2BMKB 2C3WA 4RMVA 2OMNA 3QBTB 2HVKB 2Z93A 3QFDA 1P7HL 2CDFB 1KJ2A 4XBGA 2CK2A 4PJCA 2OBGA 5GGVL 2VDOH 2W07A 4UTBL 4AM0A 2LAGB 5CSGA 3TGXA 1J0JA 1K3IA 5JO5A 4YC2B 1A6WH 2EKJA 1FG2B 1CGWA 2P4AB 5HJ3A 1N26A 5HGDB 3RKDD 3PF2A 2OL3B 5CJOH 3RWDA 1LO0L 4X5LA 1F3JA 3OXRB 4I0CC 1KB9K 5GQBA 3VD4A 4LPXA 4YPGB 4F7EB 4Z5RB 4BZ1H 3PQYB 2E8YA 1WZ1L 1A6VL 2IH3A 4DGVL 2I5YL 5BRZA 1HYRC 4YK4B 3MSPA 3W11D 2C4XA 4RWYL 2VZTA 2EDBA 3DBXA 4D9LH 5BO1H 4MZ3A 4LP4A 3DRQA 4P9HC 1FAIH 1IBGH 4WFGD 5TE7L 3RAJH 3QCUL 5GS1B 1FNAA 2I60H 1S7UB 1J1PL 2D4DA 1SMAA 4NKOB 5DJDA 1LDPH 4QHLB 1EBPA 4TVSa 3L3KB 1FNEA 4GW5B 4FQIL 4HS6B 5DD5H 2BNRB 1IVLA 1OAZH 3VFPB 4R4NC 1CGSL 3P11L 4AT6B 1QLEH 2P5WB 5TDPB 3MV8A 4S11A 3U30C 4JRXD 4PJ9D 2LU4A 1X44A 1YUHB 3S8WA 3X17A 5DK2A 1EERB 3FOMB 1XGQA 3I50H 2H1PL 25C8L 3MMEB 12E8L 2DS4A 3FT2B 4UOJA 1JZ4A 3EKCA 2UVFA 3ARGD 1ITBB 5E6YA 5EFIA 3O6FD 2CKNA 3QULA 3KPOB 4GW4B 3S7GA 1FVEB 3MGTB 3IDNA 1KN2L 5H35B 5AYUL 3V5KB 4AQOA 1BFTA 3T3MF 3QHFL 1YEDB 2DQHL 4LPUA 4YHNA 4PLOB 4F57H 3BRFA 1JGEA 3ABZA 4Z7NF 3QAZC 2PYEB 1WICA 4G8EA 3CFDA 4X0KB 4HKXB 5ACMA 2VDRH 1J1XL 5CCKL 1ZLUK 2H3NA 2DQDL 3QO1B 4Y2DD 2FO1A 4KJQD 3KPQA 4LPWA 1PKQE 5GGSB 1I7RA 2CJUH 1LE5B 5CUSL 1AGEB 4DKEH 2YPVL 4X4MA 2P8LA 4ONFL 1FFOA 3A6BL 2J8HA 3T0WA 1UM6L 3RHWF 4KQ3L 4TVPD 3WFZA 4JM2B 3MLWL 2DJSA 4WTZA 3UX9B 1A6TB 4P4RB 4FFVD 4U6YB 1JNJA 4ZO9A 3PIQA 1JMXA 4XCFL 1A22B 3O6LH 5I1AA 1H0DA 5DVKA 2FEDC 4XNYH 4JRYE 5DUMH 4S2SB 3I2CH 3D5OF 2CDEA 1AR1D 1J8HB 2Y36L 3BPLB 3U9UB 2CKBH 5K9JH 1R3LB 3HG1B 2OL3L 1AD9B 1AD0B 4YHYC 3LEYL 2NY7L 1BVLB 3HS0A 3MNZA 4FHBD 1BMGA 5DMIH 4PRIE 5HGHB 4M61A 1WCQA 3RNQB 4D9QE 3EYOB 4PY7A 5C3TA 2DD8H 1GHFL 1VFBB 1ZT1B 1HQ4B 3WEXA 5JW5A 3DRTA 4GMTH 2EKSB 3H9SB 5DJ6B 1MCOL 3IDXH 4G6FD 3CVHL 3STLA 1MFCH 1AGCA 3TYFB 4NT6B 3LIZL 4OT1H 1ZA6B 1R3IL 4LVOC 4OCWL 1PKQA 3V5HA 4P3WA 4KFZC 3E3QC 2MNUA 1QACA 3DO7A 3EIFA 1J0HA 2NY1B 3TV3L 1BEYH 5E8DL 4RFOH 2VUOA 5BCAA 5EU6B 5FYKE 3GSXA 2DI7A 4ZS7H 1CFNA 5LVEA 2A77L 3HAEB 3DXAE 1AHWC 3QDGB 2B4CL 1X5HA 1KJ2H 5B4MC 3VFUA 1U8QA 2PW1B 4FFZH 5TPWH 5D1XB 3LKOA 4P4KD 2R9HD 3GSVA 3CK0H 3GSQB 5GS2D 4S1QH 4NRZA 1TJGL 1UWGL 5J3HD 4UDUA 4ZAKA 4K71B 3LY6A 3DROB 3MCKB 3UZVB 4CMMA 2OCFD 1WC7A 4OCSL 1AHWA 4KRPC 2QKIA 4PRNA 1IEBA 3KPMB 1FFNB 5GJSH 4ODTL 3CZFB 2AEQH 4LLQA 3WO4B 4OF6A 5F3BB 4PRIA 4NWTL 4E9LA 5LQBH 1CICB 5EN2A 1KPUA 2R2HB 1BLNA 1C7SA 2YD2A 3UEZA 4QXGH 3CPLB 1U95A 3BEWA 3E1F1 4ZUWA 1DZBA 1KT2A 3I9GH 4DK3A 4PJFF 2VWEE 4MNQD 3RWIB 5D6CA 3HC3H 1QTYT 5BZWA 4WI4A 4J6RL 3VXPA 3ULUE 4WU7A 1UM4L 1S9WA 1ND0B 2OZ4H 1P4IL 2F15A 3ZT6A 4QGTA 1Q94A 5KZCB 2DTML 5ESAA 3VW3H 4XPHH 5GRXG 2EYRB 2ORBH 4RFNC 5DD1L 2VZSA 2OS7A 4P9HH 4ZUVB 4JFEB 4QRTA 3DXAA 4KK9C 4HIHA 2XWJA 2P24A 4OJFL 4JY4B 4FQQB 4FQ2L 4Z7VB 5C0EB 4UI2A 5DFVD 3I6GA 2HT4C 3NFNA 4XH2A 3UPAA 4JJ5B 2CLVB 2YK1H 3QO0B 1ZVYA 4U1IB 2NR6C 2AEPH 4KUZL 4P5TB 5EIIB 2AK1H 1QQDA 4MDJB 4X7FC 4KKCC 3GGWB 3RWCA 5ANME 4AK1A 5D9SA 3UTTB 3KPLB 4QOKB 5E2UL 1JL8A 4N8CL 5GHWL 4JZJC 3ULUC 5TGBA 2BDNH 4CU8A 3QZWB 2FBJH 5C0JB 4L8SA 3QJHB 4C83A 5T3ZE 3MRKB 4N8VB 5IFHH 5FYKU 1CXLA 1A6PA 3IAQA 3GO1H 3C5JB 1KPVB 1BF8A 1I8MA 1DTUA 3O3BB 1JP5A 1EH9A 1J1OL 5D70L 5FUOL 1VGEL 4GLRH 1DLHA 4JZJA 1UXSB 1N64H 2FGWH 4PRBB 1BJ8A 1TVHB 5ACZB 4XMPL 2MOVA 4B5EA 3GBNH 4NBZB 4OGXH 5GRZA 5TDOB 3FMGL 3P9MA 1S9KC 2YZ8A 3HUJF 1C5CH 3FRUA 1NUGA 2DWEB 2UZIH 2MJWA 2DOCA 2AK4B 3QIBD 5FK9A 4P2RE 1CFQB 4N0RA 5C09B 4E42B 2J1KA 4FXLA 4XNMB 5CINL 3BHBB 2Y5TB 4UILL 5DHYB 5DF0A 2QQLH 2P42B 3GSOA 3X13A 1BBDH 4PJEA 4Z7WB 1HEZB 3L3HB 4MXQC 1BFOA 4IM8A 3DUUA 4R4BB 2RGSA 3BQUB 2YWZA 3BP5A 1DUYA 1FZMB 4HMDA 4QRUA 5EC2A 2KQNA 4HHAB 3D85D 4JAMA 3SGEH 3ARBB 1F3DH 4WTWA 3ES6A 5J13C 2OP4L 4PJ5E 3DVFA 3HHRB 1TETH 4PP1D 3RTQD 5DZNA 4OLWH 4LCWD 5A2FA 1KENL 2AXJA 1KEGL 3AB0C 3SJVA 1I3UA 4WFHE 2W0FA 2EDEA 4ELME 4UT6L 4LVNB 3NFSH 2VLRA 5LGHL 4DTGL 4LCUB 3HR6A 4XCCL 2A83B 3OAYK 5CBAA 2K3TA 1LEGB 4K55A 2BHUA 4JGMA 3HC4H 2PUQT 1DBJH 1EVUA 1FG9C 1RZKL 3LN4A 4UBDC 3MYJA 2BSTA 2R0ZL 2VLKE 1BFSA 1BJ1J 4P2OC 4Y19E 1CK0L 4RBPH 2R4RH 4HF5L 3I3BA 3MUHL 3S4SA 3BVNB 4TPRH 3CAFA 3G6AA 3C60B 3FB7A 3TT3L 4AY0A 1OCWH 3VI4F 5HGAA 3WIIL 4E5XA 3LS4H 2D7TH 3NZ8A 3E6HA 1C7TA 4MDIB 3CLEL 2YA2A 3GBMH 1A0QL 3IDYB 5MENB 1QFUL 4GJTB 1G7JA 2JJUA 2ZCKL 1DFBH 3STZB 1MJ7H 2F54B 1P9MC 3TVMB 2YRPA 3CH1B 3N85H 3O4OC 1QD0A 2QQKL 4P2OA 4Z7OE 3FO2A 5JXEC 3DI2B 1A1MB 4K8RL 5KSVA 2VXSL 3KYKH 1AI1H 1DQJA 5EOQL 1X5JA 5DJ0A 5SX4H 4Z7UB 4FQLL 4B7IA 1IQDA 4Z8FL 3HMXL 4NKMB 2R4SH 2ZNXA 4M8QA 4FFYL 1TZIB 2HJFB 3HAEG 1BP3B 1PYWB 4XHQA 3OG6B 1P9MA 2XXMB 3C8DA 3Q3GA 1NGWA 3ZO0A 3WFBH 4P0DA 1CDHA 5JXEA 1CE6A 4U1NB 4ELMA 4FTVB 3FONA 4S0TD 4JZOB 3ZDYF 1NGZA 4HWUA 1KIPA 4PB9L 1MFAH 2KH2B 4CVZB 1YN6A 3PL6A 3CFKA 3QWOA 2LV4A 2LU3A 3FQWB 4X7CC 3FRPA 3G6DH 3RDTB 3MRDB 3EDJA 1JFQH 3BPOB 5I19L 5C7XL 4LPVA 1LK3L 1F4YH 1L6XA 4UMGA 3NCCB 4WI5A 2VLKA 5GGTH 3P4MA 4Y19A 4F37F 2GQHA 3H9HB 1NC4D 1KJVB 2GITB 4JRXE 3CDYA 4HIJA 1OT2A 3VXSA 3ZKMD 5ICYB 3PJSB 1M7IA 1KIQA 2NY6C 3ME0A 2E6JA 1QSZA 3O11B 5KOMC 2LFGA 4RMRA 5E00A 5F7DB 1EA9C 4L1HA 2IQAB 3WXVL 3GI8L 5E4IA 1NBVL 4POZC 4YDVA 1T0NB 2QSVA 4R26L 3KYNA 3FB5A 4UU9B 3QT2A 4XCNA 2APVA 4DUVA 1XEDA 1JPST 1HWGB 1P4BL 4HIEA 5CEYA 2X9WA 4YLQT 1VHPA 2FH8A 5FECB 3ULUH 3N9GL 4QCIA 2I9LA 5FYLH 2PO6D 5ICZB 4I18B 5D7KD 5JUEH 4BH8A 1Q9OB 2DJ4A 4TVPE 2Z8WC 5HDQL 2IFFH 1CQYA 3U7YH 5BS0B 4YNYA 2DQEH 3IDMB 2ICWB 3ARGC 5DD3H 5F1IA 1A5FH 2HLFD 1A6WL 2CKBB 1UXWB 3O3EA 1W72A 4YXHH 3QZWG 5A2KH 1U8MA 5EBMA 2XZQH 2BVUA 3SN6N 1CF8H 3FQXA 3UJJH 1LD9B 2CXGA 3GSWB 1ZHBA 4M02A 4N8VG 5BW7C 4JPIA 2AI0H 4XXCC 4HMEA 2AEWA 2OXGA 2WBJC 4BZ1L 1RVFH 3ISWA 3WNNA 5IB3B 4X6CB 4TUJB 2VABB 3LDBC 3ARGA 4WW1B 4MAYC 2OK0H 3C6SA 2EC8A 1U8OB 4MNGB 3RGVB 3PHOB 3EYFB 4O9HH 5J1AB 2XKNA 3DX8A 4D9LL 5FO9A 3PV6A 3HPLA 2OI9B 5BO1L 5EU3B 2FX7H 3KWWA 3KYOB 1YNTB 2X70B 4HUUA 1RURH 5KVGH 5DXWA 2Y6SC 3WL9A 1FAIL 1IBGL 3RAJL 4HFWA 5BW7A 4F7MB 2WBJA 3S5LA 1LDPL 3IJSA 3OKMB 5E9DB 4D3CH 1T1XB 5FUCE 5CD3A 2VDNH 5EUKA 4LCCC 3MRJA 1RJYB 5DD5L 4WEBH 1QA9A 2N1KA 4X6DB 2Y72A 3QUZD 4MAYA 1JUFB 1G9NH 4MQXC 4QHUB 4LHUD 4WWKC 4PJIB 2YSSA 3HI1B 4Y1AB 3QNZA 5GSVA 2VYRE 1AR1C 3I75A 1YEHH 3EYUH 4OZHF 4RGNC 3I50L 3S36H 2Z93B 3P4OA 3B2VL 1IQWH 1KJ2B 4XBGB 4PJCB 2X2YA 4LCCA 4YBLB 4AM0B 1K85A 4OZGF 2WK2A 4OF7A 1IC7H 1T89C 1IAIH 5JO5B 1A6AA 3CSPA 4WWKA 3OB0H 2XKSA 5HJ3B 4DCQA 4MCZA 5JPMA 3RWDB 1WZLA 1DUZA 4F57L 4MA7H 1F3JB 1TVDA 3TWCH 1I7UB 3V7AG 3KLHD 2H9GA 4KXZI 1Q0XH 2A6KB 4KRNA 4BK4A 4KMQA 1JZ7A 3DJ9A 1AGFA 2IH3B 2VDRL 4DZBA 3AUVA 3SDDD 2CIIA 3LQZA 2VTFA 2CJUL 3DUHA 4DKEL 5DURB 3DRQB 5T1KA 3VH8A 3WD5H 4AEIH 4N5UA 3P77A 5DJDB 4GRMB 2B2XH 2OTWB 4CVUA 1BD2A 1X6NA 1ZLWH 3O6LL 4MNQE 4XNYL 5DUML 3MRLA 5GRVL 5KTEH 3I2CL 5BJTA 2AW2A 4OFVA 3MV8B 4XHJD 1FNHA 5ESVA 4JM4H 1K3ZA 3LH2H 2R9HC 1H5BC 3B9EA 5DK2B 2ARWA 2IADA 1XGQB 2BY0A 1JGDA 5EPMA 2WLYA 4X5WA 2XQYK 1R5VA 1JYXA 1S9VA 2VLJD 4XP1L 3PGFH 4XP9H 4KK5D 3QULB 4PGEA 3RX7A 5F7NC 4C54A 1T21A 2IAMC 5DMIL 2Q87A 2D7QA 3CX5J 4OLZL 5CP3A 4QT5A 3U30B 2DLTA 2LVCA 3R0MA 5C0BE 3IDNB 1H5BA 4PJFA 3ESVF 5DMJB 4GMTL 4YHNB 3OB8A 4RWHA 1JGEB 4GXUN 1MEXH 4G8EB 1OQOA 3CFDB 3MJ9A 1RULH 43C9A 1MFCL 4TRPH 4K23H 2BRRH 4BQ8A 3CDGA 3REWA 4XVJH 4OT1L 4BYHA 2IAMA 1G7PB 3BDYL 4U1LA 3KPQB 1I7RB 5DHXB 3C8KA 4BSWB 1PSKH 5IMOB 3BRDA 5FIEA 5I66A 5I9QC 2P8LB 1FFOB 1AGDA 1BEYL 3T09A 1S7WA 4RFOL 1XF5A 1NEZA 3H0TA 4ZS7L 3QAZB 5HHPB 5KVEL 3RWGA 4GBXC 2YUVA 1P7KB 3S98A 1KJ2L 2ZP0T 5HI4D 3IJYA 4JVPA 4MNQA 3WS3B 1KUMA 1H0DB 5C8JA 5BQ7A 2WQ8A 3KPPB 4FFZL 5TPWL 4AG4H 5H8DA 2R0LH 3CK0L 4APQD 2FECI 4S1QL 3U79A 1N5YL 1W72H 3FO9A 4WV1C 4EI5D 4FQCH 1MVUB 5A2IH 3MRFB 5CSBA 1UYWH 3C08H 3IDGA 2FZ3A 3DIFA 1SBSH 3HS0B 3MNZB 2NY0D 5GJSL 3F58L 1VADA 4OCRL 1CBVH 3AY4C 2E5EA 1GOHA 2HFEA 5C0BA 5JORA 3DMMC 4RRPG 3WEXB 4WV1A 4NPYA 5JW5B 4M48H 4OGAC 1C5BH 4Q0XL 2UYLA 1QFPA 3GKWH 3H2WA 3I9GL 4YHYB 3GMNB 1QVOA 4LEXH 4P46C 1RK1A 3STLB 3R1GH 1AGCB 1GH7A 2DQUH 3BW9A 5DVNA 1PKQB 3AY4A 1AO7D 2FD6H 3HUJA 4XPHL 5D7JD 3VW3L 3S35X 3DMMA 2GK0A 3HNTH 4MD0B 3DO7B 3SE3C 3VI4E 4LCWE 4JFZL 2HLAA 1CCZA 4P9HL 3GSXB 1HCVA 1CFNB 1J05A 1ZT4A 4LARL 2V7NA 1F6LL 1J18A 1MCPH 1WF5A 1XF4A 2R15A 4P46A 2BVPA 3NCBB 3VWKD 1Q9KA 2Y25A 3WFHA 3VFUB 1U8QB 1NMBH 4HKJA 4LVOB 3LKOB 1F97A 4P99A 2E27H 3GSVB 1CR9H 3INUH 3T2OA 1ERNA 5DMGD 4X99A 3GDBA 5EBWA 4NRZB 4XVTH 3SE3A 4ODWA 2YK1L 4UDUB 5DK0A 5IEKB 1NCAL 4XX1E 4WENB 2AEPL 3ALPA 3IU3A 4CMMB 2AK1L 1AHWB 1NSNH 4PRNB 2QKIB 1IEBB 3TN0D 3VD9A 3LN5A 1SYSA 4LLQB 2BDNL 2FYYA 3UJTH 2QQQA 4LASH 4ZTPH 3QDJD 4PRIB 2FBJL 4UZGA 5EN2B 2UV3A 1KPUB 3VFNB 5J11C 3SOBL 1J5OH 1BLNB 5IFHL 2JKXA 1RHFA 4I48A 1U95B 3V4VH 3BEWB 4ZUWB 5DC4B 1KT2B 3GSNA 4XP5L 4KRPB 1NEUA 4M9PA 5D6CB 5L9DL 5BZWB 4POYA 2QL1A 3BKCH 3VXPB 3IKCB 5IR1B 2A74A 1IM3A 1JRHI 1S9WB 3PDDA 2FGWL 3MBEC 5TFSH 3D3VD 1Q94B 3CGTA 5ESAB 2DBJA 4YXLH 4NNPH 4V1DB 2FGZA 3D25A 5GGRY 3QXAA 3MLUH 2YPKB 1MCRA 3GBNL 4OGXL 5C0CA 2GSGA 4LCWA 2UWEF 4M1GH 5HHOD 1C5CL 1T6VN 1HCFX 4QRTB 1J12A 3DXAB 5SV4A 1YECH 4HIHB 3X14A 2XWJB 4HWBA 1AIFA 4W4OA 4XVUD 2P24B 3BX7C 3E2HB 4H20H 4LSRH 1UT9A 4U49A 3MBEA 5I1IH 5D1QC 2QQLL 3BRGC 3I6GB 4L4VA 4GRWF 3NFNB 1BBDL 1GOGA 1K4DA 3CFEA 4XH2B 4XPTH 5DGQA 1L9MA 2AJYL 4RFNB 1KELH 2XWTA 43CAA 1S9YA 4CN6A 5JQ6L 1ZLUH 4HPOH 1QQDB 4JGJA 3BOVA 3LKRA 3RWCB 1JPFA 5IG7A 5D9SB 4U1KA 3FB8A 1WFTA 1EZVY 4LVHB 2PKDA 1CFVH 5HHVL 3FAXA 5TGBB 5DA4A 4Z77A 3PGCB 4OV6F 3T4YA 5D1QA 3ZL4H 1W0VA 2EECA 2VQTA 4GAJL 4C83B 1C5DB 4OLWL 1CDBA 3PWPE 3Q2CA 4XPBH 1JTPA 2QLVB 4OM0H 4WHCA 1MVFA 1UZ8A 1MHCA 4MJ6A 5H94A 1I8MB 4ELKA 2X9XA 4OFDA 3QG7H 2B1AH 1CI5A 4PJ8D 1DLHB 2FATH 4JZJB 1HZHH 3HZKB 5CS7A 5K59F 4N1HB 1MCSA 5HI3C 1DBJL 2ZPKH 5AWNH 1N5AA 4BKLA 3VI3F 3P9MB 4G7YH 2R4RL 5C71A 4BFIA 2X4TA 4TPRL 3FRUB 4OKVA 1OCWL 4UIMB 3LS4L 2D7TL 5D7KE 5CWSA 5FK9B 1VFMA 4HH8A 3GBML 1OAYH 5DT1H 4DAGH 5F6HI 3X13B 1DFBL 3O9WB 2WP3O 1MJ7L 4PJEB 3BGFC 3N85L 3EO0A 4C4KT 2ESVA 4FNLL 5C0AD 3DUUB 3VGHA 1QOKA 1TVBA 2AXFA 3O2DA 3KYKL 1AI1L 3BP5B 4QRUB 3U46A 5EC2B 5B8CB 3BKYH 4HAGA 3SDYH 4JAMB 1K4CA 2R4SL 4LNVA 2Z31D 4WTZG 3ES6B 3OPZL 4KV5E 2X1OA 3PWPA 3H3BC 4LMQE 1JWSB 4O4YL 3SJVB 1KGCD 1ZA3A 3MBXL 1NGYA 5FUZL 4WI9A 2W0FB 3D1MC 4ZYKA 2MQ0A 4LPTA 2PO6C 2VLRB 1T20A 3BAEH 4OZGE 5FB8A 3TH3T 5FYKL 4M00A 5ADOH 1MFAL 5T5NF 2QSCH 3DGCR 5CBAB 1VDGA 3ZDZE 5J13B 4KH2A 4HWZA 3G6DL 4U1SA 4JGUA 2YC1A 3CC5A 3LN4B 1F4YL 4ODBD 4G8IA 4G8GA 1KEMH 2BSTB 3AB0B 1S78D 2EO1A 5C0IA 4KDWA 1Z5LA 2OSLA 2PO6A 3S4SB 5J56B 3FB7B 1CFTA 5HGAB 4E5XB 3NZ8B 2CUHA 3LB6C 3E6HB 2WUBH 3EOBA 5IFJA 1GC1L 1NKRA 1FYTA 1IAOB 2Q7YA 4WI6A 1CQKA 3PP3H 1G7JB 4YHLH 5JPNA 5KAQG 2IBBA 4DFHA 3FO2B 2Z91B 5KSVB 1DQJB 2BOCB 2BRQA 4MVBD 5DJ0B 4EDWH 2W65A 1HKLL 3GSNH 1XIWD 2GJ6D 3GJFA 5ITBH 4H25B 4PV9A 1KTKE 2EYSA 3ULUL 2X41A 3BUTA 1KCSL 4ONHB 5FYLL 4OZHA 1ZLSH 3Q3GB 3P40A 3QNYA 3O4OB 1WK0A 1CE6B 3FONB 2SEBA 1NGZB 3ARFC 4OZGA 1XF3A 2X4RB 1KIPB 1YYLH 2KPNA 2F5AH 1YN6B 5EULV 5JHDD 1U3YA 2IFFL 3U7YL 2VN4A 3CFKB 2MWCA 4HWBH 5DC9B 5DD3L 4NN6C 4I5BA 4GH7B 4O51A 5JW3H 2BJMH 4YFLF 1CG9A 4K3JH 4YXHL 4XCYA 2BX5A 1W0WA 3MRMA 3L3JB 3P4MB 1ZWIA 4LHUA 2XZQL 1CF8L 4S1DC 1UWEL 3UJJL 1N3NA 3VXSB 1HSBB 3ARFA 4JKPH 1M7IB 4XNZB 2AI0L 4HGMA 2J8OA 1CLZH 4LSDA 2V5TA 1R6VA 3F7YA 4ZFFB 2AJUH 2OK0L 2VLJE 3ZYIA 4M7KH 2NXYD 4O9HL 1VGKB 1HK6A 5E00B 3P9WB 4KKNA 4WO4C 2FX7L 5KVGL 2B8OT 4YDVB 3KYNB 3FB5B 4UINH 2ILLA 1D5BA 2FH6A 2NY6B 1OP9A 4D3CL 3WNOA 4NO2A 5I1HH 2VDNL 4HIEB 5SWSD 1G6RA 4WEBL 1ACZA 1D5IH 3JZ7A 4G7VH 3NCYP 1JGUH 4QCIB 1BPVA 3P4NA 4N1CA 2P5EE 3MV11 2C3XA 2I9LB 3AMKA 3F6IA 2YOCA 2HA1A 3VWJC 2MQCA 1G7QA 4WO4A 4PLNC 2EDHA 3SDCC 1Z0MA 2HT3C 3RBSA 3F6LA 1YEHL 3EYUL 2OR9H 3S36L 3K4ZA 4BH8B 4KUCF 1IQWL 3PXJA 4AYFA 4UT9H 1D6EB 3CFJA 4LPYA 3RA7H 1IC7L 5I76A 4PY8I 4KK5C 1IAIL 3U2SB 4Y4HC 3TYGH 3O3EB 1W72B 1BX2A 4N0UB 3VWJA 1U8MB 4TUOA 3B2UD 3SDCA 5EBMB 4I8DA 1RFDH 3FQRA 3O3UN 3N1GC 3FQXB 1YMHA 4HGWA 4MA7L 5FV2A 3ZYOA 4G6JH 1Q0XL 3RGHA 4GKNA 3MLVH 5B38A 4H1LA 3PABA 1IGJA 2VLJA 3C6SB 4L4JA 4Y4HA 1T5XA 5D7LD 4XB8A 1EO8H 2XN9D 2XKNB 4PJAF 3DX8B 3O6KH 4NYLA 1U3JA 5F1OB 4E0RA 3PV6B 3HPLB 3OAYH 3KWWB 4HUUB 2R2EA 1DP0A 4I3RH 3WL9B 2VMFA 1Z3GL 1CYGA 3WD5L 3PHSA 4AEIL 4OF0A 4EXPX 2WBJB 3IJSB 4MLSA 3WE6A 2B2XL 3VGEA 5CD3B 2CXKA 2DQIH 5EUKB 2ITDA 2R0KH 4UDTA 1QA9B 3RP1A 3LDBB 3KS0J 4MAYB 5ESQA 1JF6A 3SE4C 3ARQA 1KCVL 2P5EA 2PETA 3DX6A 5JW4N 5KTEL 1AP2A 2WWMD 4MSWA 2YSSB 4L29A 2MTPA 3LH2L 3QNZB 4JM4L 2C9AA 5GSVB 3VMNA 5BVPH 4APQC 1RZJC 2NY3C 3P4OB 4Y4FC 3P4LA 2EYTB 4LCCB 4Y8DC 1A7BA 4XP9L 3OGOE 4JCLA 3AROA 3P9LA 2EC9T 2VXTH 3SE4A 2R56H 3OJVC 1OM3H 1D5ZA 1NQBA 2AQ2A 1A6AB 4WWKB 1LNUA 3L7EA 3GI9H 5DJ2B 3SBWC 2I25N 2YPLD 1QR1A 1JZ3A 1WJ3A 4APQA 4MCZB 5JPMB 4QHNA 4WUUD 4RGNB 1DUZB 5GS0C 3TFKC 3BDBA 4DGYH 2X1QA 1WGOA 4Y4FA 5IK3A 1MEXL 1UEMA 3DSFL 1RULL 4K23L 4I3SH 2AERT 5JOEA 4OCLC 2ZCLH 5LKNA 2CIIB 5E2WH 3HI6L 3LQZB 3SBWA 4L8BB 2LU7A 1I9JH 1XF2A 4IMKC 5D7JC 4HBCH 5JNYA 2RAMA 2VSDA 5F6IC 1YNKH 5T1KB 4FQJL 3VH8B 3MJ7A 3SKNA 1HIMH 5KW9L 1MCFA 1PZ5A 5EBGA 1AFVH 2KBGA 3S4SG 1BD2B 4M6NH 2UVEA 4MD4A 4LVEA 2HMID 1JNNH 4NCC1 1A7PH 3MRLB 4F7CA 3NA9H 5BJTB 2R0LL 3EOTH 3D3VE 5ESVB 1W72L 4IMKA 5D7JA 5IVNA 2B7DT 4FQCL 2IADB 2ZUXA 1JGDB 1UYWL 3C08L 5EPMB 2HT2C 1SBSL 4ZS6D 3T4AA 1S9VB 3MZGB 4EVNA 2BNQD 5I18L 4PGEB 4JKLA 4Z18A 3NIGF 1T21B 5D2LF 3CLFL 1U3ZA 4QT5B 2P8PA 4LKCB 2O61A 1RIVL 2O5ZH 3MLYH 1H5BB 1MCQA 4PJFB 3WNMA 5AD0A 5DJCA 4AZ8A 2PN5A 5F93C 1NJ9A 3ARSA 4M48L 3GIZH 1WV7T 4HZLA 3BN9D 4O2CB 1RUPH 4Q9QH 3GKWL 5E99H 3UMTA 2NXZC 2YXFA 2EZ0C 4JN1H 3R1GL 43C9B 4L3ED 3B8YA 5D2NC 3WKNA 3CDGB 3UAJC 3REWB 4RAUA 2DQUL 4NIKB 4ZFZA 1G6RH 2IAMB 3TC9A 1LHZA 3KPSA 2UWEA 2KZ1B 1S5HA 3C8KB 5KANG 1ZLVK 5I66B 4XBEH 1OAKL 3FRPG 2EXWD 1AGDB 1YMMA 2W38A 4YE4H 1FJ1A 4R0LC 2ICEA 1XF5B 1NEZB 3H0TB 2FL5A 4LDEB 1EUUA 1FLTX 3G6JF 1MCPL 3RWGB 5FKPA 4TVPL 5D2NA 1RZFH 4OF3A 5F8RC 3IJYB 2E6PA 5C8JB 3KR3H 5BQ7B 1NMBL 1NCDL 3QG6B 4Y4KC 3MLRH 2E27L 4N0YH 3INUL 3D3VA 3MNWB 5AEAA 5I9QB 3U48A 1GCFA 3FO9B 4XVTL 4B41A 5IIEA 5D5ME 1RAMA 2MCPH 3DIFB 1JZ8A 3NH7H 5D93C 4KVNH 3OR6B 2C4FT 4GBXB 1XGRA 1I1CA 1VADB 3MRBA 3UJTL 4Y4KA 5IM7A 3GUTB 4LASL 5IB4A 2VITA 4H1LH 4ZTPL 1S3KH 1J87A 1J5OL 5C0BB 2M26A 5JORB 2PCPB 3PUCA 4WV1B 3TPUA 3WHE1 4H0HB 3V4VL 5D4QA 5C0AE 3JTSB 2YD8A 3WUWA 3P30H 5I1GH 1RK1B 5DK3A 1YQ2A 3FO0H 3BKCL 3U36B 2VH5H 4JFDD 2YHGA 2XTLA 4PJ8C 1KYOJ 1L0QA 3BW9B 5ILTH 1NMCC 2QTEA 4DZ8A 3MUY1 3HUJB 2DM4A 4NNPL 3DMMB 4HX1B 3MLUL 3SGDI 1JYVA 1A02N 3MREA 4G3YH 2HLAB 1BIIA 1TTFA 2K7PA 1ZT4B 2V7NB 3F12A 4P46B 4PTTA 1XF4B 1F6AA 2BVPB 3CMGA 1MFBH 2DI9A 3WFHB 4NJAL 4PJ8A 3UYRH 1Q9WB 4HKJB 5DEFA 1P5VA 4X99B 4JDVB 5EBWB 4ESKA 5JIHA 4XPTL 3CSGA 1XGTA 4ODWB 5DK0B 2YKLH 3UO1H 1KELL 5D5MA 2FJGB 4CU6A 3IU3B 4OIBA 1OLLA 1RZJH 2I26N 4HPOL 2AAVA 1U92B 2EEAA 2ZOLA 3LN5B 1CFVL 1SYSB 3MJ9L 2FYYB 4X98B 3S5LG 5KVFH 3FO1B 4QGYA 1VA9A 2Z31C 3Q5OA 1MCCA 3T04D 5LG1A 3L3DA 4XPBL 3NZHL 4OM0L 4I48B 4MAUL 4EIZC 5IJKA 4QRQB 3GSNB 1XCTA 1NC2D 4PRHD 5GS0H 2MKLC 1S7QA 4N5EC 3QG7L 2B1AL 4PGZA 2FATL 3M45A 2A74B 4M5YH 1HZHL 2DDQH 2NY2D 4LEOB 5DUBA 2GJ6E 3DVNB 1UKTA 2Z31A 2ZPKL 4ZFGH 1QBMH 5J11B 1D5MB 1NBQA 1BQHA 4M7LL 5AWNL 3ROLA 3TH2T 3D25B 4RAVA 3S34H 4TUKL 5C0CB 2GSGB 5DRWB 4G7YL 3QPQC 4U6VH 2BVOA 1L6ZA 4NCDA 1JK8A 3VCLA 3X14B 2ZSWB 3L95A 5IJVB 5CD5C 4HUVA 5DVLA 3MBEB 3QEQA 5JHDE 1OAYL 4IRJC 4DAGL 4L4VB 3BISA 3CFEB 1K4DB 1UZ6F 3LD8C 4QRRD 4QLRA 4N8PA 1KXTB 2XWTB 43CAB 4G6AD 1FFQA 1KIUA 3O8XC 4EN3C 1HHJA 3ZKSD 3LKRB 4Q2ZA 5IG7B 2ZG3A 3BKYL 3FB8B 3SDYL 1XGYH 1KLUA 2B39A 3VH8G 1NMAH 2A2QT 2CRZA 1XIWC 4BSVB 3QSKB 1XR8A 3T4YB 1KLGA 5D1QB 1W0VB 3QA3A 1QYGH 1XZ0A 4R2GC 2D9CA 1X5YA 4RCAA 1Z2KA 2D0FA 3PNWA 5GRJH 3CSYA 4N1EA 5GZOD 3HFML 1ES0A 3O8XA 4EN3A 4JG1H 5H94B 4ELKB 2LTQC 3BAEL 1CE1H 3PWUB 4IOFC 2BZDA 5E8OA 2QSCL 1ACYH 1HH9A 3ZTNH 1MWAA 1XIWA 1EFQA 2VJXA 1NUDA 4GRWH 5SWSE 1GSMA 4F33A 3U7WH 4BKLB 1N5AB 3U7AA 1DL7L 1KEML 4DVBA 1NFIB 1OP3K 4HJ0C 1CL7L 3H42H 1V3LA 5EUOF 1JZ2A 4X7TA 2VSCA 5L8LB 1MFEH 1E4JA 3ULVD 5DMKA 2WIIA 4JJHA 2WUBL 2VIRB 5CWSB 3OJMB 4H5SA 4PJAE 4LP5A 4J7RA 1LK2B 5LBSH 4FS0A 3MX0A 4YHLL 3FT4A 3EO0B 2ESVB 2HTKC 1IEAB 4ODHH 1TVBB 2AXFB 2O26U 4HLZH 3HKFA 4W4NA 1EO5A 2X4OA 3GSNL 1K9TA 2Y4SA 4JQIH 1P84J 1PW3A 1K4CB 4AL8H 4PR5B 3RIFK 3GMOA 1NEZG 3WN5C 3QI9D 3HRPA 5ITBL 4U1MB 3TJHC 4Z0BH 3BGFB 3PWPB 2HKFL 3OJDA 5D7LE 1NGYB 1QRNA 1WBZA 1YEJL 4ZYKB 4RX4A 5E95B 4PJHF 3HPJA 2NZ9D 3EOAA 3QUMH 4DEPC 5C9JB 5LXGH 1AH1A 1T20B 3AU1B 5FB8B 4W6WB 4ZPTA 3SKJL 1YYLL 3V95A 4MS8C 2F5AL 4WHTB 3WN5A 3PGDA 4HWBL 3QQ4B 1QSFD 4Y5XC 3RI5K 4U1SB 3RIAK 4TULH 3GIVA 1BOYA 2YC1B 2NY4D 3CC5B 3HA0A 5JW3L 3MLPA 4K3JL 1CIUA 4G8IB 4G8GB 3G9AB 1SY6H 4LIQH 1UB5B 5C0IB 1PVHA 2IG2H 3TJEL 4QRSA 4GKZB 1C12B 1Z5LB 2OSLB 4XI5D 5HHME 1YC7A 4JKPL 1CFTB 4XNXH 2PTVA 3EOBB 1CLZL 5IFJB 4QWWC 4K2UL 1FYTB 4PJAA 2GFBA 4Y5XA 5D72L 2Q7YB 2AJUL 1NFDF 1FZJB 4JKMA 2C1OB 3FQTA 3U4AA 1RJCA 4ZXBD 5JPNB 3MRQA 3VE0A 4DOHE 3BUYA 3O45A 1H9VA 4HS8H 2YPLE 2ZUQC 1P6FA 4OIIH 4BK5A 1A7OH 2W65B 4JO3L 5AAWA 1U8PA 5I1HL 2BXZA 3EYQC 5ABDE 1FO0A 1FRGH 1D5IL 2EYSB 3L6FB 4PV9B 4G7VL 1JGUL 5E2TL 4OZHB 9CGTA 3IFNH 3QNYB 1KB9J 1A1OA 4XC1H 2NTFA 2V5SA 4MA3A 2LQRA 4S1RH 2WWMC 4V2CB 5HVGB 2SEBB 2OR9L 4XCEA 4OZGB 1XF3B 2E7HA 4L8DB 1Q9LA 4QXWA 5F7MC 2DN7A 1P7QD 4UT9L 1F42A 1FL6A 1R3HA 3HI5L 2XA3A 1Q72H 4K3HA 2DF3A 3V0VA <