4P2RB

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
171
Chain Sequence
b'SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVYTCQVEHPSLTDPVTVEWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 171
sequence length 187
chains with identical sequence G, L, Q
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rB01
2ICEA 4NOBA 3WN5A 1JGVL 4FQIL 2C7UA 5C7XL 4MZ3A 1CLOL 3RAJL 1ORQA 4PJ5E 1QBMH 3C60C 3ES6A 4BFGA 4JCMA 3HC3H 1CQYA 4UV7H 4LASL 3MOAH 4FQ2L 4OZIA 4JDTL 5I8OL 4YLQT 4X6CB 3DI3B 1YEDA 2ERJC 1MPAH 2XT1B 1YQ2A 4TVPL 1I9JL 1JPST 2FL5A 5I1KH 3V4PH 4R0LC 1KCKA 3G6JF 1U3YA 3FQRA 1WWCA 2OCFD 2W9LA 4XNUH 3C5ZD 3RWGB 5DSCB 1F3RB 2CDGB 4F7TB 4NZJA 1I8MA 1M71B 4Q0XL 2XWTA 5GPRA 3MGOA 2Z0BA 4P3DB 3RL2A 3B43A 3BEWB 4PGBA 3DX8A 3X3GL 3FOLB 1MRFH 3U4EB 3LKRA 5EPMA 1Q9WB 5E8NB 4ZXBC 2YK1H 4OF3A 1S3KL 5D7LD 4R8WL 4MA7H 2IANB 5FUZH 4JKPH 3TH3T 5F44A 1G6RB 1BD2A 2JJUA 4X4MA 3R8BB 4JRYE 4EQ2A 3AY4A 2AJ3B 3OXSA 5CUSH 4F37K 5EOCH 5IQ9B 1IGYA 3I02B 4JO2L 3SE8L 4RFEB 2VR9A 1HHKA 4QOKA 5KOMC 3U7YL 1QQDB 2Y36L 5CILL 3EOYG 5AYUL 1FNEB 4CBPA 1P7QD 5AAWA 3K1KC 1OSZB 2X89A 3JUZA 5J0BA 4X4XB 2CXKA 2QLVB 3WJLC 1A9EA 1KACB 3VE0B 4MD0B 4XP9L 2VXUH 4GG8B 5EBMA 3RI5F 5FGBC 4NO3B 4PTUA 5D1XB 4UT7H 4TNVK 3WS6C 3KXFD 3KPOB 3QH3A 1AGBB 5CIPB 5HGDA 1P5VA 5IBLC 5EO9B 5HYSA 2J8UE 4L1DA 2DM7A 2P1YA 3T08A 3PWJB 1UCBH 4X6DA 4Y5VB 2R1YA 3V79C 1WK0A 1W72B 1XF5A 1CK0L 3V6FA 2ATPA 2KDGA 5JOFB 5FHBH 5IF0B 4BFBD 4Z7UE 4YK4B 4QTIH 4HD9A 1XEDA 5DR5H 1DQDH 1L7IH 3MCG1 4HS3B 2W0LA 1M7IB 5IB3B 1B9ZA 4ZUSB 1URLA 3DX9B 1FVCB 2PTVA 3RL1B 3FQWB 35C8H 4ZDHA 3MA9L 1IL1B 2IPUK 3UC0L 4HJ0C 2VDKH 1G7PB 2R1XA 4YUEH 2VL5A 3NIFE 5L2JA 4LFHD 4QT5A 1NGPH 2FJHA 3OKYA 4NBYB 5DJYA 1G7JA 1DZBA 3OV6A 3BDYL 5DTFA 4BK4A 1C5DA 2BY3A 5C0IA 1GGCH 4EXPX 1KTLA 3CFJA 4POYA 3A67L 3U46B 3KPSE 1P4LB 3V6ZB 5J1SC 2X4TA 5DMIL 4CNIA 1EJOL 4UDTB 5E8PA 4LFHG 2OZ4A 1GXEA 3P30L 1UGNA 3HAEG 4HF5L 3SDCA 4LNVA 4YHNB 4F7MA 3H9YA 2IAMC 2WQ8A 1N64L 4ZYKA 3QO1B 2AJYH 5IW1A 1ZVHA 1KXTB 5CJXA 4BQ8A 2FIKA 1GOGA 4EVNB 3V4UH 3GKWL 2B2XL 4IRJD 5HHQA 1PLGH 4OZ4A 1U6AH 2KH2B 4I8DA 4M61A 5DVLA 1JJUA 2BHYA 2B1AH 4MB3A 3T2OA 1R3HB 2FJGA 2J3SA 1T4KB 4OZGE 5HHMD 2ZUUA 4UQ2A 3IFOB 1J0HA 5HYJD 1YEIH 1CICB 2H8PA 4MSWA 1KSRA 3BQUC 4H20H 4MXVE 1QR1A 1WT5A 2OZ4H 5JQHC 4Q6IA 3L3DB 3DBXA 1JF6A 4P9HH 5CZKA 5E4EB 4YE4L 1YY8A 5DEFA 3JXAA 3CH8A 2GITA 5ADOH 1LP9F 3BH8A 2V9TA 5L9DH 4NQCA 5GJSH 3UTTE 3ZDZE 2J88L 2F54B 5KVEH 3KPMB 3UROR 3FT3A 5FO8B 1KJVB 4NQVA 3EDDA 1IRAY 4UOW1 2DQDL 2OR8A 4OLWH 1TZIA 1E6JH 1EEQA 3GIVB 4KTDL 1DBBH 5DMGD 5CP3A 1FGNL 5F3HA 1Q9KB 2EIEA 1U91A 5LCVH 3VGAC 3PDOB 4Y5XA 1QPPA 2BJML 4Z6AT 5C0RL 4PGDB 1BGXH 1QRNA 1NGZB 1MCBA 4NKMA 1U8LA 2EDFA 4LKXA 4AENB 1F45A 3MV7B 4J1UB 1ZA3A 5F72S 2D7NA 1P2CA 3NAAL 5A40E 3MRDB 3SHSA 1Q9LB 1OQOA 1SJEA 3AS3A 4I3SH 3T1FB 2HAZA 4P3WA 5B8CC 5C0EA 2P42B 5F21B 4K71C 5DJ0A 4NN5C 5I17B 3T2NH 3O3BA 1QSEB 4PJ9B 3ZHLA 5LWYH 2C3GA 4O58L 4PJBB 1C08B 4LVOC 2ZCKH 4L8BB 2ESVE 4TNWF 2FIRT 1WBYA 1QFUL 2CIIB 4DUVA 3DSFH 7CGTA 1OP5K 1YEGL 4AIZB 4JFYA 4MD5A 3UCRA 5CP3H 5EORH 2NQCA 3C08L 4N8CH 3TESA 2VLRE 3SBWA 5GGTA 1SYVB 1T83A 5DRWB 1GIGH 4LEOB 4ZNEE 3TT3L 1FNHA 1YN6B 1YECL 3VRJB 5F70A 3T3ME 3QUZA 2V5MA 1EHLL 2O26U 4I5BA 4HIHA 2W38A 4CVWA 1V7ML 4HWZB 2VQ1A 4X7FC 3S34L 4CN6A 4JN2B 5I18L 4WO4A 3P0VL 1U42A 1Q0YL 1C1EL 3FB5B 1UJ3C 4D3CH 2FR4B 1UB6A 2ZP0T 5KTEH 4I2XB 4A6YA 4LGPB 4JFEA 5EZJA 5D7SL 4POZD 1YA5A 5CP7B 5IIEA 4UT6H 3P77A 4TSAH 2VYRE 1SJHB 1KEGL 2AABL 2QHRL 4JN1L 5ICYA 2EDJA 2BRRH 2GT9A 4J3OC 4WV1A 5EFIA 3TCXA 2M1KA 5GGTH 2XKSA 5E08H 3OG4B 3CNKA 5D1QA 3OAUL 1RSFA 2J2ZA 3WFBH 4WENB 1G1YA 3Q1SH 4HUMB 3RBGA 3QUXB 5GIRB 3QNYA 4HKXA 5TGBB 4Z7WA 2CLRB 1RJZB 4NSKB 5I8CB 3S35H 3EIFA 4LRIA 2EDOA 4Y19E 4PRPB 1WBXB 5CSZB 3VXUE 4LL9A 4Z8FL 2FHCA 3LPFA 5C08E 2P8MA 3QWRA 4RAUA 4PJXB 1IAMA 4L3EE 3U36B 5DMKB 1XIWB 3MGTB 4A6YH 2ITDB 4TQEL 3VMPA 3TZVA 2XWJB 3UP1A 5ID0B 3S37L 2VLJA 4G8EA 3L3HA 5IM7A 4WFHE 3LZFL 1AD9A 3QEHA 5E2VH 4PS4L 4P23C 4NM8L 5CBEA 1FSKB 1FFNA 1P4BH 3SDDD 4YR6A 4ZSOE 4UU9B 2Y9RT 5KS9E 5D2NA 1XF2B 5TF1H 1DQTA 4C55A 1DE4A 3EJZC 4J4PA 1CD8A 2DBLH 5FO9A 2R1WB 4PJGB 3VI4F 4C56D 1UA6L 3T77A 3VWKC 3QT2A 4UZGA 1DR9A 5DJ2B 2Q8BL 2AK4B 4FQ1L 2D03H 1JZ7A 4NNXB 4KZDH 3CDCA 2KKQA 4OUUA 5IVXB 1N7MH 3STBA 4FFVC 3K2UH 1PSKL 3NTCL 1T2XA 2I26N 3C5ZB 1NMAL 4PLJC 3LKPB 3MV9D 5I76B 1R0AL 5CEZE 4WGVB 5CLWA 4CKVX 3HPJB 5K9OB 1TETH 3AMKA 4CL7A 2BMKB 3AB0B 3UZVB 3IAPA 4OI8A 4X6CA 4NPYB 3TVMC 1YPZB 3SKOB 4KMTL 1GGYA 3NZHH 5D7LB 5F9WC 3QR2A 5B22A 5IK3B 1EUTA 5MI0B 3MJ6A 5EIQA 5HDQH 1VCAA 3ROOB 4FFWD 3BUYB 3B9KB 2XKNB 3G5YB 3MJ8B 1N6QH 4W6YB 5DSCA 3RWGA 5EBLB 4LCWD 1RI8A 1CG9B 1UWEL 4NJ9L 4OI7A 2CDGA 4F7TA 3IDXL 5L6YH 3W81A 1A21A 4LCYB 1M71A 4JFXB 1R3JB 4Y5YC 3MLSL 1WLHA 4WTWA 1P7QB 4GXVH 4P3DA 4UMGA 3BEWA 2XKUA 3BKCH 3R8QA 5FB8B 7FABL 3FOLA 1F4HA 3I6LD 2VDNL 2GK0B 1BWWA 2XTJB 4QCIB 1Q9WA 5E8NA 4PJHB 1JGEB 1W0WB 2IANA 4QNPF 3GSWB 1WFUA 4Y89A 5J57B 4QRPE 1RPQA 3KXFB 2VL4A 1G6RA 4OLVL 4ORGB 1WIOA 1BJ8A 3UJTH 2J6EL 2AJ3A 1NC2B 5IQ9A 3STZB 3QO0B 3QQ4B 3I02A 4RFEA 4QRQB 2YXFA 3ELAT 5TDOB 1QQDA 1FNEA 2Z8WC 3O41B 6FABH 1OSZA 4ZFFB 2JCCB 4X4XA 4Z7OE 2DAVA 2MSPA 5D70H 1WAAF 3VE0A 5L7XL 5DUPL 4HGWB 4JFHD 4MD0A 2XRAL 4LLUB 3LKNB 4GG8A 3GNML 5D1XA 1D6EB 1VB9A 4TSBL 3HPLB 3KPOA 5CIPA 1NKRA 5EU6E 4QGTA 5EO9A 5A2IH 1YMMD 3PWJA 2VH5L 1WSST 2P5WD 4Y5VA 1I4FB 1J87A 2ICWB 2J1KA 4FTVD 1G6RH 1W72A 4G8FB 5JR1H 3HE6D 5IF0A 2VDRH 1OW0A 1UVQB 4H8WC 4YXKH 3VI3E 3RUGE 3RVVC 4HS3A 3SQOH 1M7IA 5IB3A 1A64A 4ZUSA 4KUCF 3DX9A 1FVCA 3RL1A 3FQWA 3DVIA 4JY5L 4XMPL 1IL1A 2IG2H 1G7PA 4K7PH 2XN9D 3QXAB 2A77L 2AQ3A 5F93C 1NGXB 2R2CA 3RRQA 5EZIL 4IRJB 1OPGH 1IGCH 5FOBB 1L0QA 1PBYA 5CIPH 3CVIH 5E2WL 1EFQA 1BVKB 1NLBL 4QY8B 3U46A 5EUOB 3V6ZA 2BSTB 3OBAA 3CK0H 3E2HC 4UDTA 3V0WH 1W72H 2QQLH 1WF5A 3VA6A 1KOAA 5HYJB 1RUPH 4YHNA 3QIUD 3VXQB 3VRIB 4HT1H 1A5FH 4XC3H 2CLZB 2D7TL 5CCKL 3QO1A 1KFAL 2YPKB 3PV6B 3GSNB 2NLJB 2NXYC 2X4UA 4EVNA 3QCUH 1FYTD 2OXGA 4PGCB 1G9MH 4I18B 4PRAB 5FYJH 4FZEL 5I75B 1U9KA 4G7VL 4G5ZL 1T0MB 3QI9D 1R3HA 4HDIB 4U1NB 1T4KA 1T89A 4L3CB 43C9B 3IFOA 4W6XB 1CICA 1SYSB 3KJ6H 3ZYIA 5IT2L 3S98A 1B4JH 4MNQD 2UZIH 3L3DA 5JOPD 4B41A 1SHMA 4RGND 4M7ZB 4DN4L 2N7BA 2F54A 4LOUD 5CEZL 3KPMA 3TO2B 3WN5C 2APXA 2EDEA 5FO8A 1KJVA 3RGHA 3L3OB 3C5JB 4FQHB 2XI9A 5E9DE 2H2PC 4QRUB 5T3ZH 4DEPB 3WJJA 3GMLB 1GGIL 1A1NB 2R9HC 3HKFA 2FZ3B 2WSKA 3IGAB 3GIVA 1H9VA 3HTLX 4K23L 1OCWL 5SWSE 2HG5B 1WFTA 2DTMH 5DYOB 3HR6A 1FNSH 1Q9KA 1AQKH 3KPQB 4MCZA 3PDOA 2VOTA 4PGDA 4JRXD 3U9PL 4L5FH 5MENB 1NGZA 1A6VH 3WFZA 4AENA 3MV7A 4J1UA 3MBED 4ZPVA 2HFEB 4F37F 1U8QA 1PG7W 3M8OL 4DKFL 5I1HH 3ZKXB 1P6FA 1A3RL 3BSZL 5E2UL 3MRDA 2CSPA 3NH7H 1Q9LA 4HIXL 1QKZL 3QCTL 3T1FA 2Y5EA 2VUOA 4LSVL 1AP2B 1BF8A 1IJ9A 4K94H 1TIUA 3ZMRA 5I17A 3UPRB 1I8KB 1QSEA 1XF1A 2VXTH 4PJ9A 5EZLB 2AK1L 4PJBA 1C08A 4FQXC 2N4IA 4L8BA 1F3DH 3N06B 1JVKA 3VXRE 3CSPA 5DFTA 2CIIA 3R0NA 5H94B 2A0LC 3QCVL 4XWGL 1X5XA 1MLCB 3ARGB 4NWUL 2DL9A 2W9DL 4GRLD 4Y7MA 4XVSH 1RZFL 1SYVA 1YNKL 1Z9MA 5DRWA 2VDLH 2OJZH 4YHKH 3AY4C 4JVPA 4ZAKD 4LEOA 4R4FL 4YHMH 4Z7QF 2OYPA 2HFTA 3VRJA 4Y8DC 5DQDL 1MJUL 3LRGA 1K8DB 1QBLH 3HI5H 2F53E 2VJXA 1SBSH 5HVFB 2A2QT 4FMKA 4UINL 4HWZA 3O0RL 1NQBA 3MSPA 4PBWD 4JN2A 3UBXB 1F42A 3FB5A 1AGDB 2FR4A 2EICA 2J8OA 1TZHB 4M5ZH 4I2XA 1RHHB 1T1XB 5CP7A 2EEBA 2ZG1A 3MXWH 4EI5C 4QXWA 1SJHA 4KJQD 4XHJC 3VGEA 5JMRA 3ZE0F 3FRPA 2L7JA 4TOYL 3V6BR 3AUVA 4E5XB 2QADC 1KTRL 5EU7C 2I60L 3LEXB 3EW3B 5C0BD 1QSFE 3ESUF 5A1AA 1ZHNB 1OAZH 3SDDB 3QUXA 5GIRA 5TGBA 2CLRA 1RJZA 4NSKA 1CIDA 5I8CA 4PRPA 3VG9C 2O5XH 4ONFH 3UJIH 1IAII 5CSZA 4X7TB 3BKYH 5LXGH 1NAML 1BX2A 1YQVL 1MCOL 5T3XE 4PJXA 4PJXF 5DRNB 5KSUB 1YY9C 5E8OB 1U8NB 2E27L 5K9QG 1U2HA 4P59L 3U36A 1RULL 5DMKA 1XIWA 3MGTA 2ITDA 5TFSH 2NY2C 3QIWB 2PR4H 3V4VL 3LD8C 2XWJA 3W11D 1MCPL 5ID0A 2F5BL 3MFFB 2FGWL 4KKLD 1DFBH 5I74B 4KQ3H 1FV1B 3PQYB 1XF4B 2A9NL 4WUKL 1RIVL 5IBTL 2QR0B 4P9HC 1A7NH 4UU9A 1XF2A 4HWNA 3SDCC 5ANMB 2GJJA 4XB8A 5C07A 1EEUA 3C2AH 4Y0GA 5D5MF 3WIIL 1LILA 4JANB 2ZOLB 2R1WA 3ZKNC 5F6IB 2HTKD 4QLRA 1I8LC 4PJGA 3BHBB 5J3HD 3BT2H 1RMFH 1INDL 5FKAB 2PTTB 3UTPE 4XWOD 5BZDB 3I9GL 1KIQB 3EOTL 5DJ2A 1EV2E 4LHJB 4OCYL 2WANA 2AK4A 4L29A 4NNXA 5IR1B 1MNUH 3GBNH 1IZKA 4LSQL 4C4KO 5EWIL 1WZ1H 3BOVA 2F15A 1R3IL 2PXYD 3C5ZA 4KPHL 4HGMA 1QFWM 3LKPA 1AY1L 4N0YH 3VFGL 3TO4D 3QPQC 5I76A 5I73B 2Z93B 2X1PA 5K9OA 2BMKA 1FGVL 4Q6IC 1DN0B 4NPYA 3BZFA 3JUYA 2R2BB 1YPZA 1A02N 3QHFH 3SKOA 1UKTA 4UILH 1ZS8B 5AYQA 5D7LA 1CGXA 5IK3A 1OM3H 2GFBB 2XACC 4TVPD 1T03H 4BZ1H 5KVFH 3EYUH 1JUFB 1CGUA 1IAIL 1K4CB 2M8XA 1Q0XL 1Q72H 3O6FD 4L1HA 3FFCE 5C07E 3BUYA 3ROOA 1EO5A 3B9KA 3TGXA 5JNYB 5DUML 1J1OL 3G5YA 2XKNA 3MJ8A 4N9OB 5IJVB 1SVCP 2AJUH 5EBLA 1CG9A 4OSUH 4Y5XC 1HNGA 1D5IL 4LCYA 1ND0B 3CPLB 4JFXA 1R3JA 4JPWH 5IFHH 3ZYZA 1P7QA 4GG6B 1JGUH 4MDJB 4OZIE 5FB8A 3TH2T 2GK0A 4QCIA 3VH8G 4U49A 2ICWJ 4I77L 4PJHA 1JGEA 1W0WA 4Z7NF 3MRFB 1S9KC 3GSWA 4S1QL 1ZEAL 3KXFA 5I1CH 4ORGA 1EXUB 4U1KB 4CDGC 1X5IA 3M17B 4LARL 4ZOAA 1YMMB 4M7LT 2P5WB 1NC2A 3STZA 3MUJA 3TT1H 2OI9B 3QO0A 3QQ4A 1X5LA 1VPOH 3TA3D 4QRQA 2DB8A 3IFLL 3ME0A 4L4VE 5TDOA 4OTXH 1QLFB 3HE6B 2R8SH 4RZCB 1KCVL 5TH2B 2N1KA 3HC4L 3O41A 1OP5H 4ZFFA 2JCCA 3IJYB 3JBG7 3U82B 1JZ3A 1O7SA 5TDPB 1CL7I 2NY0D 4HGWA 1YEFL 1T83C 2H41A 3FO0H 3LKNA 1AO7D 3MOBH 4Y4HD 1D6EA 1N6VA 1K9TA 5HI4D 3HPLA 1U8HB 4MNGB 3GK8H 2OL3L 2XN9B 3H9ZA 2X40A 3QUZC 3TWCL 4JG0H 1I4FA 1BVLB 1KN2L 3F8UB 2ICWA 1I1YB 1E4KA 4G8FA 3H2WA 4WO4C 5AZEL 1EGJA 1A6ZA 4B50A 1UVQA 1BQHB 2EH8L 2BSRB 1RURL 3CH1B 1MFNA 5IWLA 3CZJA 3TBVB 1NFDB 5EU4B 3ZKQD 3LS4H 3QIUB 1J1XH 3BIBX 3OF6D 1BF2A 3LKSB 3GI9H 1OSPL 3MOQA 3QXAA 2LAGB 1GGUA 3MO1B 1LE5B 1NGXA 3ARRA 1FYTB 4X6DE 4IRJA 5FOBA 4H8WL 1FNAA 1MEXH 4GQ9L 1I3GH 5EU7E 1BVKA 5T3XL 5HD8C 4QY8A 2VXSH 1IGMH 1GC1C 2EDXA 1VGEH 4OUOA 5EUOA 3QI9B 2BSTA 4N8PA 5BZWB 1DQJB 1F4WL 2DICA 4AM0B 4YQXL 3W5NA 3I50H 5HYJA 5T5NF 2EEDA 4V1DD 1EGJH 4WUUB 3VXQA 4F7EB 3VRIA 2HLFC 1DQLH 2CLZA 3S88L 1UWXK 2YPKA 3PV6A 4HBCH 5AWNL 3GSNA 2NLJA 3IDUA 3KHQA 4XNZC 1HH6B 3U7WL 4PGCA 4I18A 4PRAA 3EZJB 4RGNB 3X14B 1CL7L 3ZHDA 4YX2L 1U92B 1DQQB 3QP3A 5D71H 1T0MA 3FQTB 4HDIA 3BDXA 2R29H 4U1NA 5DK3A 1X4XA 4JB9H 4L3CA 43C9A 4UIKL 2BSSB 1SYSA 3MRRB 3ZDXF 3TV3H 1J8HE 5B38G 2ED8A 3SGDH 2B4CH 1A6WL 3D25B 4UDUB 1FHGA 1QBML 3HRZB 3ILQC 4JRXB 4UV7L 1U3HD 1FFOB 3MOAL 3MBEB 2ZCLH 1JPFB 4HH8A 5E6IB 1XFPA 3TO2A 4XPBH 5I1KL 4PJ5D 2P7TB 12E8H 3C5JA 3GSNH 3C6SB 3L3OA 4FQHA 1NJ9B 4GAYB 4JY6B 4M62H 3V4PL 4QRUA 4MAYD 3GMLA 1A1NA 2OR7A 2FZ3A 3VMNA 4JM2D 4RAVB 3IGAA 4NN6C 5DK2B 1VKXB 5DA4A 1J0KA 2HG5A 1L7TL 5DYOA 1OP3H 4F2MB 4XNUL 2ARWA 2OTUB 3KPQA 3QZWB 2DRUA 2YD7A 1AE6H 5C0AE 2R4RL 2PYFA 5MENA 5D9SB 5FYLH 4JRWA 3WIFA 2HFEA 1BPVA 1TNNA 4GRLB 3Q0HA 1LP9E 1MRFL 4M43H 2IC2A 4E42B 3P2TA 1C5BH 2YK1L 4ZAKB 4M1CC 2R2EB 4L4TE 4MA7L 2ARJB 4JKPL 5BVPH 1AP2A 1ZANH 4ZOEA 5DS8B 3UPRA 1I8KA 4XXCC 4ZQKB 5EZLA 4QGYA 3DUUB 2AJXH 4X99B 5KSAB 5CUSL 5FGRA 4QWWD 4LEXH 3L3GB 5H94A 1MLCA 4DGYL 1QRNE 3SN6N 4ENEC 1OHQA 3ARGA 1IFHL 3LHPH 5GSRB 5E7BA 5I1EH 4JRYD 2BVOB 5IHBA 2XZQH 1PKOA 4NM4H 1BMGA 3KLAB 2CDEB 1NMCC 3QUYD 1I1AC 2VXUL 5AD0B 2VKWA 4OCXH 2Z35B 3BZ4B 1HKFA 1K8DA 2AQ1A 5C0BB 2Z31B 1SEQL 3GSUB 1FVEB 3OL2A 1A1MB 1ZWIB 1H8NA 3UBXA 3SQBA 5FHBL 4XT1C 1AGDA 1FL5B 3L3IB 1ZGLP 4RIRB 4QTIL 1TZHA 5DR5L 3O8XD 1RHHA 5E4IA 1T1XA 1JHKH 2DLFH 4UOW0 2AI0H 5ALCH 3HE7D 5IROA 3QXWA 4MS8D 5IMKB 4Y5VC 4OGYL 2UVFA 2BX5A 2KBGA 4E5XA 35C8L 4HXBH 1EZVY 3VW3H 4EN3C 4YUEL 1ZXQA 3BP6B 3LEXA 4NRXB 1G9EA 2E7BA 4LDLB 1ZHNA 2IFGA 4KKBC 3SDDA 3OJMB 2A6KB 3ZTJG 1G9MC 4X7TA 3AS0A 3DETC 3MLWH 4JFEE 3EFDL 3T0VA 1ZAGA 4N8VG 2V9QA 5DRNA 4ZS7H 5KSUA 5ADPL 4OF7A 5JXAH 1U8NA 4U7KA 4XPHH 4HXAH 4YFLI 2H45A 3QIWA 2AJYL 2DWEA 3MFFA 3X3FH 4LIQH 1QTYT 4URTB 1DP0A 3MV8E 1OTSC 1Y0LB 2LFGA 3PQYA 3B5HA 4BSVB 1PLGL 2QR0A 2GTWA 3H9HB 4C54A 3DURB 1G7MB 4Z7WE 2PXYB 3LAFA 4YZFF 5ANMA 5KG9B 1RZ7L 3NGBB 1QZ1A 3TO4B 2ENYA 1FE8L 5J1AB 4RMSA 3GEWB 3MZGB 2WW8A 4JANA 1MCLA 3RVWC 2ZOLA 1NCDL 3DVFA 1YEIL 1F13A 2FO4B 3SEPA 3BHBA 5FKAA 5F97E 1J18A 4LPVA 3REWB 2PTTA 3KPLB 1RHFA 4OT1H 5BZDA 4HS8H 4H20L 1KIQA 1EHXA 4F9LA 3GSXB 4HWBA 2OZ4L 5IR1A 4P9HL 5FM5O 1KJMB 5C09E 3F7PC 2VLJE 4P99A 5ADOL 3O6FB 2VLLB 1J0YA 4X80H 1OWRM 3RKDC 4KHXH 5L9DL 4LSPH 3VH8B 1YYML 1CICC 1CQKA 2Z93A 4NHCL 1A9BB 2OQJB 5IJKA 1GL4B 4R4BB 3HLAB 4O02H 1BIIB 1DN0A 3UTTD 1UQSB 4PJ7F 5CGYC 2EDQA 2R2BA 2CK0H 5LAXB 5LCVL 4K94C 2RIKA 4IDJH 4O9HH 2HKHH 1ZS8A 3WKMH 5IW6B 3ARVA 4HIIB 2GFBA 1MAJA 3RFZC 1JUFA 1K4CA 1KJ2A 3BPOC 5JNYA 4OFVA 5D93B 1JRHH 4HZLB 4HWBH 5IJVA 5B39A 3C60D 4D0BB 4IHOB 4PB0H 3DARA 1ND0A 1FRGL 3CPLA 2XZAH 1GJIA 1O5DT 4GG6A 3T2NL 4MDJA 1KC5L 4WI9A 5LWYL 1X7QB 3GBMH 4GW4B 1P9MA 2ZCKL 1NCBH 2NY0B 5J4MA 3CCHB 1JPGB 3MRFA 4L8DB 3GRWA 4CVUA 5I30L 1AO7B 4Y4HB 1JNNH 5EORL 3CFDB 3DYPA 1EXUA 4U1KA 3M17A 4AG4H 4BFIB 3VD9A 1YMMA 2P5WA 1GIGL 2ESVD 4XCEB 4R4NC 3P4OB 1VSCA 5FGCE 1KJ2H 1QLFA 3HE6A 3MV11 4RZCA 3OPZH 2IBZX 4NFBA 5TH2A 4P4RB 2Q76B 1YEKH 5DVKA 2CDFB 4ODUB 3IJYA 4OQTA 3VGHA 1IKFL 2VLRD 3QPXH 4M9OA 4ZXBD 1F4XH 2Y07L 3S36X 4PP1C 1U93B 5FA3B 4QNPE 2HFGL 4CMHC 1U8HA 4MNGA 1WQVT 1E4JA 3MLVL 3HUJB 4MAUH 2XN9A 3H7LA 3LB6C 3MX0A 3FB8B 4C83B 4UT6L 4TSAL 3GRWH 3UYPA 1BVLA 2X4SB 4NNYB 1I1YA 4JY4B 4YPJA 4OIAA 5BRZE 2BRRL 1JYNA 5GGTL 5GS0C 5E08L 1WV7T 1BQHA 2R0KH 2C26A 1TFHA 3IDIB 3WFBL 4Z9KB 2MFNA 4KJWC 3WE6B 3TBVA 1NFDA 3B2VH 5EU4A 3QIUA 5IGXH 3NFPB 3LKSA 4OQTH 1QNZL 2X4QB 5IBLD 3MO1A 1E4XH 2J4WH 3IFNH 1LE5A 3OZ9H 1D7FA 1FYTA 1RIUH 4E0RB 1HQRB 5C3LD 5IESH 2RJMA 4A6YL 4Y19D 4WW2B 3VXUD 3NFSH 3F7QA 5BZWA 4LRNH 3QI9A 1DQJA 4M6MH 1FLRH 4KMLB 5C08D 4AM0A 5E2VL 5IV2B 1P4BL 1JPSH 4F3FB 3Q3GB 1UACL 1SJXA 2K1MA 4WUUA 4L3ED 4F7EA 4JZOA 4ELMF 1NMBH 1MWAB 5E95B 3DHJA 4HJ0D 4U1MB 4DW2H 2HT2C 4DK6A 3KDMB 2X09A 4WFHD 1U3HB 4JKMA 1HH6A 4PGJA 4N5ED 3NMEA 3N1MC 1GC1L 3X14A 2XXCB 4DAGH 4PGEB 4JFPB 3EJJX 3ZHKA 1U92A 1DQQA 3CD4A 2D03L 1JCKA 5INCB 1DCLA 3FQTA 2OTPA 2P8LB 2XXMB 4JM2B 2F19H 4K8RC 4X9GA 5JW4M 4Q9RH 5IHZB 2BSSA 2DDQH 4KKAC 3MRRA 4Z76A 2EDRA 1L9NA 5SWZE 3K2UL 2ZUXA 2IAMD 3D25A 4D9QE 4UDUA 1JWSB 1S8DB 1KNOB 3HRZA 4JRXA 1TETL 1FFOA 4LPWA 1WTLA 3G5VB 3HB3D 4Q6YA 3MBEA 4OFKA 1JPFA 1DBJH 3P73B 4ODSH 5T3ZE 2NR6C 2P45B 4Q9BA 5E6IA 1I7RB 1BWMA 4U31A 2P7TA 4JY6A 3C6SA 4GAYA 1NJ9A 2CKBL 5EULV 5E0QA 3UDWC 1P5UA 5HDQL 4G6MH 4K7FB 4RAVA 2XYCA 1MELA 2YD3A 3PGFL 4ETQB 5HHPB 1VKXA 1N6QL 4F2MA 2YPLE 3IDNB 1ZTXL 5DC9B 4Z0BH 2OTUA 4JKWA 3QZWA 4ODTH 2FX7H 1X6LA 4H88H 5L6YL 2YD5A 5D9SA 2X1WL 5MI0C 4XRCB 5FM5M 2VB5A 3BKCL 4GRLA 4JRYB 3B9KC 2DIJA 5GS3A 4E42A 4ZAKA 1XGYL 2R2EA 5SX4H 3QUYB 2ARJA 1KBGH 5ID1B 1CDIA 4R96A 3OB0K 5DS8A 1INQB 5DLML 4ZQKA 3UJTL 3TJEL 3DUUA 1ZK9A 1OTTD 5JTWA 4X99A 5KSAA 3BP4B 1JNJA 2HLAB 2XTJC 1A6PA 4PY8I 3L3GA 1I8IB 3CIQA 2OP4H 1BM3H 3T3PF 2ZOKB 4WI4A 2A1WH 2XZCL 2NMSA 4NRZB 5GSRA 3K8KA 4GMSH 2J8UB 1WGOA 2BVOA 5D70L 3HE7B 3KLAA 3MUHL 2CDEA 1RZIB 4U3HA 4F15B 5AD0A 1LO4H 1UM4H 4YAQB 3RIFF 1A6UH 3BZEB 4Z7UB 4M4RA 4AY0A 2Z35A 3BZ4A 3BPNC 5C0BA 4XNYH 3D87B 5LGHH 2Z31A 4PJBE 1FVDA 3GSUA 1YEEH 1FVEA 1S7SB 2PN5A 1A1MA 1ZWIA 5IFJB 1FL5A 3L3IA 1ZKAA 2VDRL 3BMWA 4RIRA 2W65B 2XNAB 3FQXB 1ZLSH 5EU6D 4HK3J 2H1PH 4YXKL 3VFPA 4HC1A 4PGZA 3SQOL 3VD3A 4RMUA 5I1GL 1IBGH 1TJHH 5IMKA 2OTWB 4D8PB 5TQ0H 4EUPG 2BY0A 1E4KC 4Z7QE 2DTSA 2NX5E 3TNNB 2VXQL 5CD5C 2VZOA 4K7PL 3BP6A 2D9CA 4NRXA 5E94B 4W4OA 5DF0A 2VERN 1OPGL 2A6KA 2EDKA 2VC2H 1DQMH 1KLFA 4ONHB 3S5LG 1ADQA 5F9AC 5HI5C 5IVZB 3CK0L 4AQOA 1BFVH 4OD3H 3V0WL 1W72L 1B0GB 4LLVB 3MNZB 3ZE0E 1I85A 1A5FL 4XC3L 4N0CC 3W2DL 4HC1H 1RD6A 4TPRL 3DO7B 1CWVA 4Z18A 3F12B 4OZGB 1Y0LA 1UYWH 1W0YT 1Z0NA 3O4OB 4YHOH 3TM6A 4KY1H 1G9ML 3WLWC 4BSVA 4YFDB 3H9HA 4DKEL 3DURA 5FCSH 2PXYA 3NACH 5KG9A 3CXHK 2VQTA 3TO4A 4PRPE 3WXWH 3ZYJA 5J1AA 1K8IB 1YC7A 1BAFL 3SGKA 2LE9A 3U1SH 4XTRC 4AL8H 2E7LA 1N5YL 2DQFA 4PJXE 2FO4A 3UTTB 1ADQH 3B8SA 3KJ6L 4ONOA 4I18C 3REWA 3KPLA 3K46A 3O2VH 2IPTL 2D9QB 4OB5L 3VFUB 3RGVC 4S0TD 2MNUA 3GSXA 2UZIL 2BHUA 4LPYA 1KJMA 5JW4R 4P23D 3O6FA 4I0PB 2VLLA 4NKIL 4ZUTB 1K3IA 1IARB 4OLUH 3UAJC 2O5YH 4BELD 2EXYC 1OOAA 3IYLW 9CGTA 2E9JA 3C60B 4I3RL 3NCJH 2NXZB 2R0WH 3EJZD 1YYLH 5T3ZL 1A9BA 2OQJA 1UCTA 4R4BA 5M95B 3HLAA 1FNGB 3WFHB 5A2FA 1BIIA 1FFPB 3VWKD 1UQSA 1AQKL 5LAXA 4M7ZC 3QA3B 4KK8C 3TYGL 2BOCA 5IW6A 3J8F7 1TMCB 5E9DD 4HIIA 2AK4E 1A6VL 2DLEA 3M1BB 3KYKH 3H42H 5FOJA 2OMBA 2EZ0C 1FJ1A 4FQ2H 1HIMH 3SCMC 4FFVD 5I1HL 4HUUB 4HZLA 5EC1B 4KRLB 4QHLB 4PLJD 1VFMA 4JGJA 2ESVB 4KGLA 3NH7L 3N1FC 4IHOA 4TVPH 4D0BA 1I9JH 2Z8SA 4RMVA 5IMLB 3T2QA 1UB5B 4FQCH 2VO5A 4OCNC 4K94L 4NUJB 1GZPB 3MRQA 3TVMD 1X7QA 4LSUL 1WTGT 2VZVA 4GW4A 4OZFG 3SO5A 5FCUL 2F8XC 1YPZE 3ZKXC 3CCHA 1JPGA 1VENA 4L8DA 4ALAH 1AO7A 4LMQI 1FNLA 1CLYH 5D7LE 3ZDYF 1JHLH 1PZUB 3A6OA 1LWRA 3CFDA 4Q0XH 4RSVA 3OJVC 4AZ8A 4XVSL 4NQEB 1RIHH 4BFIA 3X3GH 2VDLL 4YHKL 3VXRD 3SJVE 3GDBA 2M2DA 2QKIB 4XCEA 3P4OA 4YHML 4OI9A 4LF3B 1RZJC 4R8WH 4YHIB 4P4RA 2Q76A 3BKJH 2CDFA 4ODUA 2Y1VA 2I9TB 1QBLL 3ARGC 1SBSL 3K7UA 3MCLH 2XTJE 2JB5H 4WHTB 4KVNH 4P2YA 4Z7NE 3SE8H 1U93A 3E0GA 1HILB 3OF6A 5FA3A 5JDJA 3LIZH 5CILH 3HUJA 3OAYH 3LVEA 4U2ZA 5EA0L 2P44B 2F53D 3FB8A 3QWQB 3T4AB 3MXWL 4C83A 4X9BA 5IBUG 5BOPA 2FB4H 2X4SA 1R3KB 4NNYA 4JY4A 4NKDB 4XP9H 3TIEB 3HCVB 4Y19B 1P1ZB 4PJDB 3S3PA 2GI7A 3KJ4C 2BVQB 1JHTB 1AGCB 5ITFB 5C08B 3IDIA 2X44D 3V0VB 3VA2C 4EDXB 4XPGL 4KMQA 1JYVA 3WE6A 5IROC 1QVOB 4L3EB 2ZKHH 3NFPA 3FMGL 4RGMB 1CK0H 1EPFA 5J13C 2X4QA 4DVRH 2HA1A 3BKYL 3MLXH 4KQ4L 2YKLH 4TULH 1X5AA 5LJYH 2FHBA 1CU4H 4YBQC 2EE3A 5GRUH 1HQRA 5CJ8A 1MFEL 5GS0L 4E0RA 1I7ZB 4CU8A 1QP1A 3NPSC 4IRSC 4U1LB 5KVDH 3ARQA 5TFSL 3RIAF 2PR4L 4WW2A 5E5UB 3RY5A 4I0KA 1DFBL 1FIGH 4KQ3L 4E41E 3QEGH 5T3XD 5TE7H 4O2EB 4JG1H 1FH5H 2YD2A 4F3FA 3O4LD 1FC2D 3Q3GA 3HZYB 1A7NL 1CLZL 2E7MA 3BDYH 4KAQL 2IAMB 4WCYL 1BZ9B 1MWAA 4U1MA 1M7DB 1D9KB 1LD9B 3KDMA 1MIEH 3QIWC 3CDYA 1U3HA 3IF1B 3W82A 5ACMA 5I74C 3F65A 3BT2L 1RMFL 3B8YA 4PGEA 4J8RB 4JFPA 2HRLA 4KK5D 4BM7A 1INEH 3PWPE 2DM4A 1X9QA 1N64H 3MACL 5INCA 3U9UB 1MNUL 2P8LA 1PQZB 1WZ1L 4JM2A 4WEBL 2PKDA 2VLME 5A16B 5IHZA 5ACLA 1SM3L 5F6IC 3SO3C 1UC6A 5EH1A 2W59A 3L6FB 1UEMA 3UTPD 1Q1JL 1MI5E 4LCUB 5F9OH 1JWSA 1S8DA 4N0YL 1S9WB 2X1OA 5I0ZA 5HTSA 1KNOA 3NA9H 1CD0A 4F57L 4F9LC 2NXYD 1FL6B 3G5VA 3MRLB 3LPWA 3P73A 1FNFA 3JTTB 1MWAH 1I7RA 3RKPA 4UILL 1DDHB 4K8RL 3E1F1 1OM3L 5I73C 3VFTB 5KVFL 3ZTNH 4K7FA 5IVNA 3GFUA 2KUTA 5DJAB 2IH1B 4P5KB 4ETQA 5HHPA 2FWOB 5FYLE 3ZDXE 2NW2B 3IDNA 1W8OA 5ABDE 4K3HA 4LGRB 4GMTL 4OSUL 2YRPA 1BEYH 1J12A 1T22B 4JDZB 3LQMA 3EBAA 4JPWL 2DQDH 4XRCA 3VXNB 1MJ7H 5C07D 3R06B 4R7NB 4P5MB 4JRYA 4KTDH 1I7TB 4U6VH 3R4DA 3QUYA 2H2PD 1J0IA 1DVFC 1I1RA 5ID1A 2BJMH 3QAZC 2R9HD 3T04D 5B8CB 5C0RH 5I1CL 2ICWI 3L9RB 4NN5B 1INQA 3PGDB 2K9UA 3GMPB 5KW9L 1A3LL 3G08B 4LVOB 2UVEA 4LP5A 4NCC1 3I3BA 4MHHI 3BP4A 4EDWH 2HLAA 1P9MC 3TT1L 1PY9A 1I8IA 4OTXL 1OWWA 5MENE 2ZOKA 3GB7B 1KV3A 5EU6B 3P11H 4NRZA 5IMMB 2J8UA 3O2WH 3HE7A 4O58H 5GHWL 3MOBL 3WSQH 3QXTA 1RZIA 2OI9C 4L4VD 3VD4A 4YAQA 2NY6B 3BZEA 5TE6H 3GK8L 4M9PA 1A8JH 2NCMA 3Q6GH 4D2NA 3RUGB 4FQXD 4HPOL 3B6SA 2DJUA 4JG0L 3L5IA 3MRCB 5CEXB 1S7SA 1Y18B 2EIBA 3IXTB 4LPCA 5IP4A 2Z8VC 1UJ3B 5IFJA 2W65A 2XNAA 3FQXA 4V2CB 1WIPA 1TPXC 2MKWA 4HCRA 5EZOH 1NGYB 5T1LB 1X3DA 2FLBT 2OTWA 4D8PA 1T1ZB 1QFWI 4ZMAT 1J1XL 1T04B 4YXLL 5I18H 2L7UA 3TNNA 4XVUC 3P0VH 3GI9L 5KN5B 1C1EH 3HNTH 3TN0D 1W0VA 1MHCB 1N0XH 2V17H 5E94A 2VZ1A 3ZTJH 2X89D 3QDGE 3FRUB 4PJEF 5EIVA 5A3IC 4G43B 2Q86B 4I4WB 4XNMB 1MEXL 1KEGH 4Q9QL 3IS1X 1MIMH 4JN1H 1TJGH 4ONHA 2FSEB 2MHAB 2VXSL 1IGML 1FZOB 1VGEL 4U2YA 2BNQE 5IVZA 1T6VN 4P9ML 4EI5D 4OAWB 3OAUH 4JFFB 4XHJD 1B0GA 1B3JA 3I50L 2XOTA 4LLVA 3MMEB 1CFSB 3MNZA 3QUMB 2QADD 4L8CB 1DQLL 1N0LA 4HCRH 5C6PB 3MGAA 4NT6B 3DO7A 1EX0A 5KBNC 3F12A 4OZGA 3MC0A 1LO3L 3TYFB 1FPTL 5HYSG 2MCG1 2Y6SC 1FN4B 1QHOA 4U1HB 2XQYK 1T3FB 1R5VB 5DD5L 1MVUB 2CH8A 3IRPX 3MRNB 3S3JA 1K8IA 3D3VE 2R29L 4HUXB 2VRAA 2Y06H 4JB9L 2X2YA 2ZUSA 3LZFH 25C8L 4X6BA 1YY9D 4PS4H 4NM8H 3UTTA 3O2DA 3VWKB 2P5EE 4IBLT 4RGNC 1AJ7H 1S9YB 2NY2D 4DZBB 4MD4B 3LMJL 3VFUA 3ZKMC 2LQRA 3C8KB 4KDTC 4G8IB 3MYJB 5GGRB 5E9DB 1L9MA 2A73B 4I0PA 1LGVA 3PQYE 2QEJA 4NIKB 4NKQB 4PJFF 3G6DH 1J8HD 3SDCD 1UA6H 1G0YR 3C60A 12E8L 4YZFE 2YSSA 4FFZL 5TQ2L 1QFWL 4FQ1H 4U6HB 2Q8BH 3WEXB 3ZKND 2ITCB 1FNGA 3WFHA 4UUJA 2AP2A 4RBPK 5GGUB 2DD8H 4GSDL 1FFPA 3TVMB 1LK3L 3TPUB 3W39B 2ZSWB 3QA3A 1PSKH 3RHWF 5E6IC 1AE6L 5F1SA 1NMAH 1CDGA 5F9WB 3ARDB 5FYLL 1R0AH 3M1BA 3O2DH 4X8JB 1WFOA 3TEUA 4M8VA 2WBJC 4LVEA 4HUUA 5M94B 4BUGA 3CFIC 5EC1A 4QHLA 5D7JB 1HK6A 2ESVA 1C5BL 3VXRB 3QPQD 4KMTH 5C0AD 5GXBB 1ZA6A 2JE8A 2J6EA 4G9DA 5IMLA 1T2QL 1UB5A 2BFVH 4OGAC 4XPFL 4Y5YB 5CD3B 4CW1B 5F7YC 1HHGB 1ZANL 3BXNB 3JV0A 4NUJA 2NY4C 4YBLC 1GZPA 1E6OL 1TITA 3DYMA 3UBXI 1IMHC 2AJXL 4OM1L 2NY5C 4PJ7E 3BE1L 4RWYL 4TUKH 3BH9B 4L4TD 1U36A 2HT3C 3VXSE 5DFVC 3IDXH 4JFQB 5K59E 3LHPL 4FP8H 5E2TH 5ECJE 5I1EL 4NQEA 3OB0H 1LMKA 2XZQL 4NM4L 3I75B 2VDNH 2E7HA 2OL3B 5D2LB 2QKIA 1EUUA 5KSAC 1OT1A 4LF3A 1KTKE 1CFTB 4H25B 1QRND 1KT2A 2EDNA 4YHIA 4OCXL 2XQBL 5BV7B 2C5DC 4N0UB 4J2XA 4GG6E 2I9TA 1I1FB 3OXRB 3W9DB 3CXHJ 3WJLA 2J6EH 2YA2A 4Q58C 2ATKB 1XR8B 4BSJA 4KJQC 4WHTA 1B0RB 1HILA 5CKGA 2P24B 3QISA 3MUGB 1F90H 3T4AA 2AI0L 1RZJL 3RX5A 4U3CA 1C5CH 4JFOB 1R3KA 2Z31C 4MXWL 5DUPH 4NKDA 3CU1A 3I3EA 4OV6F 3TIEA 3HCVA 4Y19A 1P1ZA 4PJDA 5IMOB 3GZKA 5EG6C 1HWHB 3BDBA 3EYQC 2BVQA 3NIGF 1JHTA 1AGCA 5C08A 5ITFA 1HDMB 4FFYH 3V0VA 2WBWB 2X1QA 1U3ZA 3O4LB 4CU6A 2C3HA 3DV4B 1QVOA 2DQHL 4L3EA 1KGCE 2R0LL 3WNMA 5AEAA 4U7MA 5H35B 3A6CL 3MLWL 2EYTB 3QUZD 1JRHI 3I6GB 1DBKH 5C86A 4ZS7L 1WBZB 4W4OC 5DMYA 1I7ZA 4IJ3C 4XPHL 3EO1B 4WW1B 4U1LA 3IDMB 3V7AG 4WO4D 3LKOB 3B3IA 5DD1H 5ESAB 1P84K 3EUUA 4JY5H 4XMPH 1JZ6A 3E2HB 3X3FL 2UZYB 4S1SL 2X1XR 4JFED 2LVCA 2VAJA 4O2EA 5KZCB 2VLKD 3HZYA 3QDMB 1OAKH 1Z9LA 4QRTB 4PBXA 1FBIH 1A6TB 2IAMA 1WUNT 1BZ9A 5J3HC 4NCDA 2QQNH 2HH0L 1M7DA 1D5BB 1D9KA 1LD9A 4XWOC 5E2WH 1RJLB 4BJLA 3IF1A 3MV8D 5DK0B 1CXLA 2GY5A 1CGTA 3UTZB 6CGTA 4MMZC 4NO5B 5HD8D 2ORBH 5CCKH 2D7TH 4D9LH 3U9UA 4JZJB 5E03A 5C0CE 1PQZA 1KFAH 4DTGL 1P7KB 3SGKC 2OBGA 1A7QL 4X80L 5A16A 2A6JB 4LSPL 2E7LC 3L6FA 5EU3B 1NLDH 3ALWA 3DX7B 4WUUE 2HLFD 3D9AL 5I15H 4LCUA 3TFKC 4KHTL 1IGFH 1S9WA 1V8HA 5C09D 1FL6A 3MRLA 4O02L 4M7LH 4XZUB 1FIEA 4OCWL 3JTTA 3O6FC 2CK0L 5MP6H 4RGNE 3V5DB 1PG7X 1DDHA 4IDJL 4P57B 5IT2H 3WKML 3EHBC 1U8JB 1KG0B 5HI3C 3VFTA 2FEEI 3LCYA 4JM4H 5DJAA 4JO3H 4P5KA 1T0NB 2FWOA 1JRHL 2DBJA 2G60H 4DN4H 1Q38A 1FLTX 4XCFH 2A6IB 3ILQD 1T22A 2WP3T 4PB0L 3MLTB 1E4XI 4JDZA 4HUWB 4ODBD 3G6JB 3VXNA 1IAIM 1XH3A 1T1YB 1QOKA 3WFCL 3R06A 4R7NA 4P5MA 2JLLA 3GBML 4MA3B 5CJBA 1I7TA 1OCWH 1NCBL 1Y6NR 5GISL 3VXMB 4UQ3B 4ZOCA 3HN3A 4L4VB 3DGGB 1I8MB 3L9RA 4JFDE 4NFDA 4M7KH 2NPLX 4YHLL 3FOMB 3PGDA 1LHZA 3GMPA 2KQNA 2AVGA 3G08A 4OM0L 4FQXB 3DX8B 3OMZA 3G5ZB 1HWGB 3WCYA 2XZZA 1A3RH 3BSZH 3WNOA 1H8OA 5EOQH 1G9NC 1KJ2L 1JZ2A 1WICA 3OPZL 5SV3A 4PV9B 3GB7A 1YEKL 4LSVH 5EU6A 2A74B 5IMMA 3SGEH 3QPXL 4KDVA 2LTQC 4L9LC 4M1CD 1F4XL 5FXCH 2W92A 4DK3A 2APVA 5AG8A 5EOTB 4Z0XB 3FJTA 4MAUL 3TN0B 4UBDC 2NY1B 2YS4A 3RUGA 2W9DH 3QIBC 1RZFH 2QSTA 3MRCA 5CEXA 1YNKH 1Y18A 3IXTA 2GUOB 1A4JB 2DMKA 1UJ3A 5EBMB 4ENED 4G6KL 3T3PE 3VG0L 2R0KL 4EI5B 2FEEL 5JLZB 5BMFH 1NGYA 5T1LA 1HOCB 1T1ZA 1I1AD 2QSQA 3QWOB 3B2VL 5IGXL 5BRZD 1T04A 4OQTL 3VXPB 4GH7B 3DGCR 4R6UA 5KN5A 2HN7B 4NJAH 2OK0H 1MHCA 2J4WL 4HUNB 4TUOB 3FRUA 1RIUL 2P4AB 1AC6A 2GHWB 4G43A 2JJTC 4XBEH 2Q86A 5FDYA 4MLIA 4XNMA 2ICES 4HX1A 2MHAA 1IGJB 3NFSL 1FZOA 1CLCA 1EZVX 5FV1L 1SMOA 1R5WB 2UWEA 2UWEF 4JFFA 3IU3B 1G7JB 4MNHB 2W60B 5BO1L 3MMEA 5SX4I 2CUIA 1CFSA 3QUMA 2BCKB 2Q20A 4L8CA 2K3TA 2NY2B 4DW2L 4NP4L 4EN3D 1WITA 4YHPB 3ZYOA 4BUHA 1R6VA 1KB5L 4QHNB 1R5IB 5ISZA 4UAOC 1YQVH 1MCOH 4JPKL 4KKBD 3TYFA 5B4MC 4MWFB 3KLHC 1J8HB 2HJKB 3C09B 1FN4A 4KUCD 4U1HA 1KCUL 5JQ6L 5C9KA 1QLEL 4P59H 1RULH 1MFAH 4OV5B 3DETD 3MRNA 5HHVH 1U8PB 4HUXA 1U95B 2F5BH 1KCSH 3ULVH 3BD3A 1U3HC 3QQ3B 3VWKA 4L9DA 5BS0E 4WUKH 1QUNA 5IBTH 5JO5B 5BXFB 4DZBA 4MD4A 1FZKB 3C8KA 4LPTA 3KYAA 4G8IA 3MYJA 5GGRA 5E9DA 2A73A 3BRGC 3L7EB 3WIIH 1OTSD 2LV4A 2DM3A 3QUMH 1DBJL 4ODSL 2C3XA 4JM2C 4UQ2B 5SWZD 2H8PB 4D9QD 2AEPL 3O3EB 5C0AB 3MRHB 4OFDA 4OCYH 3UPCA 1J8KA 4U6HA 3WEXA 3RVWD 3IS0X 2IJ0C 4G6ML 2ITCA 4KWUA 5GGUA 3LDBB 5EWIH 5T3ZD 1LP9B 2APWA 3TPUA 1BQSA 4ODTL 3W39A 2ZSWA 1R3IH 4L4TB 1AY1H 3ARDA 3X12B 2VXVL 1OAXL 2L0DA 4X8JA 3RKDD 2GY7B 3OKNB 4GOSA 2MMXA 1CICD 4H1LB 3TBYB 2YPLD 5GS2H 3TIDB 5D7JA 4HEME 1MCIA 1KBGL 1HHHB 2YEZB 1KCRL 5CD3A 4Y5YA 4CW1A 1HHGA 1AQDB 3BXNA 4JDVB 4ZO9A 4X9IA 1IAIH 1MF2L 5CGYD 4PBVC 2IFFH 2X9WA 1J1OH 3BH9A 2AJZB 3HNSL 3ABZA 1G7HB 3NBNA 3KPNB 1D5IH 3PL6C 2A1WL 4LQFH 1IM3B 4JFQA 4L8SC 1QG3A 1HN1A 3GSQB 1EDQA 1IGTB 4R97C 5J06A 2C4FT 3I75A 4IRZL 5A2LH 1BECA 1Z0MA 2OL3A 5D2LA 3QXDB 4HKZB 1K4DB 1RK1B 1UM4L 1CFTA 1A6UL 2NY5L 4H25A 1CXIA 5DQ9B 3GMOB 1XGQB 5KSBF 5F1KC 4N0UA 4Q2ZB 1I1FA 5CEYB 5LGHL 3OXRA 3W9DA 2EO9A 5D7IF 1YEEL 2FO1A 2ATKA 4LARH 1B4RA 5DD6B 4GAGL 1XR8A 1ZLUK 3ZT5A 4MS8C 1Y6KR 4RMTA 1B0RA 1SEBB 3ZDYE 4F15C 3VGBA 1K85A 1ZLSL 2P24A 2H1PL 2G5RA 3MUGA 3HC4H 1IBGL 1HXMB 3B9AA 4JFOA 4R4ND 5ITBH 4KH2A 1YEFH 2X05A 2VZ3A 4I1NB 5IMOA 5IEHB 2I07B 2YC1B 4MA8L 3PWUB 2OL3H 1EBPA 1HDMA 2HVJB 5JW4N 3TWCH 2VLKB 3O4LA 3DV4A 4PP1D 1KN2H 1DQML 1ZHKB 5BV7H 4W81A 4HK3N 4F7CB 2DLHA 2NX5D 5H35A 3LB6D 1N59B 3HUJE 4ESKA 2EYTA 3PGCB 3MV8B 3FAXA 3I6GA 1OF2B 1RURH 1WBZA 5SX5K 3EO1A 4WW1A 1LDPH 3IDMA 4HHAB 3O3AB 4QXTB 4YDLC 3LKOA 5GS0D 4HC1L 5ESAA 4LCCC 3ZZ1A 2XWBB 5F6HI 4O5LH 1UYWL 4XX1G 1IC4L 2W1NA 3QDMA 4QRTA 1AGEB 3RWCB 2IPUG 4HIJB 4H8WH 5J56B 1D5BA 2VUYA 2EXWC 3WXWL 1RJLA 1K2DB 5C09B 4XNZB 4P2QE 5DK0A 1F4WH 3DRTB 3SDXF 4R26L 3UTZA 1KIPB 1DLHB 1ADQL 3O4OC 3GGWB 4HWEH 5HDOA 3NCMA 4NO5A 1AC0A 2MPAH 4WI3A 3UYRL 3BW9B 3N0PB 3FRPG 1T2JA 4JZJA 3S88H 1P7KA 1RFDL 4YHZL 2A6JA 2CKBB 3A6BL 5EU3A 1S78C 3U7WH 2IEPA 4OLUL 5HYQB 3DX7A 2DI7A 1CL7H 4XNQB 3NCJL 2HT2D 2R0WL 1R3LA 3CU7A 1YYLL 3AXLB 4OF8A 4LAQL 3OG6B 1J0ZA 1C12B 1QFOA 1ZHBB 2JTDA 3LS5H 4XZUA 4I0PC 4UIKH 3V5DA 4P57A 5C3TA 5C1MB 1A6WH 1U8JA 1W8NA 1KG0A 2JIXB 2NXZC 4EJ1C 5IOPB 1FO0L 4K3DH 5DWUL 3KYKL 3L1OL 4K8RD 1MRDL 3H42L 4NN6B 1HIML 4KKAD 1T0NA 3BI9X 4RBPH 2ICCA 5D96B 1NCCH 5E24E 2DMBA 2A6IA 5I9QB 1CBVH 3MLTA 3B9DA 3R1GL 2OS7A 2AK4D 4FQCL 4HUWA 3G6JA 1HHIB 1QD0A 1T1YA 2YN3A 4RDQF 2GJ6D 2NR6D 4XP5L 4MA3A 4HJGB 3HI1B 1L7TH 2YRZA 3VXMA 4ZUUA 4UQ3A 1D5XB 4ALAL 5FGCB 5JMOC 1CLYL 2R4RH 1NEZB 4L4VA 1JHLL 3DGGA 4JAMB 4YEEA 1NCTA 3FO1B 3FOMA 5J6GB 1NDGA 3L7FB 4UNUA 4FN0A 3W0WD 1RIHL 4FQXA 1XAUA 1RK0B 1P84J 1GPOH 2W07A 3G5ZA 2Q3ZA 2Q3AA 3CX2A 3ARBB 4LGSB 4PV9A 3BKJL 4AJ0A 1FYHB 2P43B 2A74A 1PW3A 3B9KD 3MCLL 1IAKA 4RCAA 4XMKH 1NMCB 3SJVD 3OKEB 2JB5L 1I1AB 1X5KA 5CBAB 1JMZA 4KVNL 5BRZB 3ZSTA 5DDHB 3LIZL 5EOTA 4Z0XA 1U8IB 4DGYH 1Y6MR 3TN0A 1Q8MA 1G9NL 1IFHH 3DECA 2ZNWA 3IT8D 2XTJD 2FB4L 2GUOA 3UXFA 4U0RB 1A4JA 5DI8A 5F7UA 3AS1A 4K3EH 3VRLF 1LO5B 4J3TA 4PJIF 3FKUS 4LKCB 4JREC 4EI5A 5JLZA 5FYKU 3T8XA 1MFBH 1SEQH 1HOCA 1NC2D 3QWOA 2ZKHL 1SQ2N 3VXPA 5DC4B 5HYIA 1H3TA 5D8JL 4DVRL 1I9EA 4EN3B 4DUWA 2HN7A 3MLXL 3U4AA 2YKLL 5DXWA 4GRWF 3OKLB 1F2XK 4X98B 3AM8C 4TULL 4ETYA 3RNQB 4TUOA 4IIQB 3ARUA 3KS0J 2R0ZH 4R90L 1CU4L 3IU4L 5GRUL 1ACYH 2HT4C 5JA8B 5KVDL 2V5YA 4OGYH 3SDYL 1IGJA 4RGMC 4PG9A 4HGKC 4C58B 1FIGL 1R5WA 3QEGL 5TE7L 4ZTPH 3IU3A 4JG1L 1FH5L 4MNHA 3QEQB 3ZE2F 3ALXA 1RZ8B 2W60A 5DRXA 4N5EC 3I84A 4XAWH 3BISA 2BCKA 2MJWA 5CD5D 1JMXA 4PPTA 3IAQA 3D85D 2Q6WB 1MIEL 3SDAB 1M4KA 4Z77B 4YHPA 4QHNA 4E41D 1R5IA 4OJFH 2VE6B 1FAIL 3EFDH 4MWFA 4PJEE 2BY2A 3F58H 5SWZB 5ADPH 1J8HA 2HJKA 4R3SB 4W6WB 5EUKB 1BQUA 4OCMC 3RTQB 5HI5D 1INEL 1YUHB 4OV5A 1D9KC 1U8PA 3K3QA 1NCAH 1U95A 4MHHG 1CGWA 4APQD 1BOGB 1OGTB 2EE2A 1I8LA 2X4UB 3BPLB 3HB3C 3QQ3A 4JPVL 3PWNA 4QTHB 4UB0H 3IKKA 5JO5A 4N0CD 5BXFA 5F9OL 4PLNC 1FZKA 4KK9C 3PWPD 3NA9L 1RZ7H 2NZ9C 2X9XA 1MFDL 3FN9A 4M03A 1FE8H 3L7EA 4K7PY 3WLWD 2GKIA 2VLMD 1NCDH 2ZUVA 1MWAL 2YPLB 3HMWH 1DJSA 4CGTA 1B90A 4ODWB 1S7VB 1MI5D 3O3EA 3E6HB 5C0AA 1HYSC 1OL0A 3MRHA 3PHQB 1I3VA 4XTRD 5DZNA 3ZTNL 4EEEA 3EDEA 3V95A 1MVFA 2EH7H 5KOVC 4U4BA 4ZFZB 2FBOJ 1LP9A 5HSFA 1BIHA 3AS2A 1CCZA 1YYMH 1KPVB 3NABL 4Y2OA 3RGVD 3HS0B 4HJJH 4L4TA 1BEYL 1UKSA 3T65B 5GRXG 3KS0H 4Y16C 4IMLB 4ODHH 3X12A 4NHCH 4G6AC 2D7QA 1MJ7L 3BPOB 3OKNA 4IOIA 2PW1B 1N6UA 1KEML 1F58L 1BFOB 4H1LA 4U6VL 5FYLD 3TBYA 3UAJD 2EDTA 2EXYD 4PJFE 4ZTOH 3TIDA 1OTTC 4MCZB 1HHHA 2YEZA 2FECI 4JDVA 1AQDA 5IHLB 3S37X 3N1GC 5HPOA 4ZPVB 3BMVA 2ZZUT 4G8GE 1U8QB 4YDKH 1UFUA 1UXWB 2GEEA 4NQXB 2DI8A 1NBQA 4EDWL 4KK8D 2AJZA 3VFWA 4U1JB 3LY6A 1G7HA 5DGQA 4P2RD 3KWWB 3KPNA 1FRGH 2EZ0D 4LU5H 1IM3A 4PREB 1IC1A 3P11L 3SCMD 3GSQA 3IKCB 1KC5H 1IGTA 3O2WL 1DSFL 3ZT6A 2RB8A 3VFOB 3WSQL 3QXDA 4FZ8H 1K4DA 1RK1A 4HKZA 5I30H 3MYZA 5DQ9A 5TE6L 5MEND 3GMOA 1XGQA 2AKRB 4H1LH 4FS0A 4ODXB 1CFNB 1HKLL 4Q2ZA 3Q6GL 5CEYA 2KL6A 3HHRB 5F7DB 3WMSA 5DD6A 3Q2CA 3LEVL 2DQJH 3GHBL 5E99L 1SEBA 4CMHB 1BJMA 2NX5B 4X7SL 43CAB 2NY6C 1OLZA 3P4NB 4NQEE 5EZOL 1IKFH 4JVWA 1RZKH 1HXMA 3EYVB 1ZT7B 2Y07H 2K7PA 1Z5LB 1V7NH 2Y25A 1CDUA 4YO0B 3HNTL 2I07A 5IEHA 2HFGH 2YC1A 5JORB 1N0XL 2V17L 3ARGD 1WFNA 1J11A 3MLVH 3PWUA 3UZEA 2HVJA 3O45B 1V05A 2WWMC 2VLKA 1ZHKA 3RU8H 1MIML 4F7CA 2DIBA 3VGGA 1TJGL 1KIUA 4G9FD 4FNLH 1N59A 4JJ5B 2FECL 5GGSB 3PGCA 2IH3B 3MV8A 3QDGD 4WY7H 3L5WB 1OF2A 2C4FU 3QG7H 2M26A 4LHUD 3UZQA 3S4SB 4HHAA 1GAFL 2AGJL 3O3AA 4QXTA 3ULVC 4HCRL 3L5JA 3KVQA 4PJDE 2BNQD 1QNZH 2IALB 2XWBA 4LQ1A 1BX2B 1K3ZA 2AXGB 1MQ8A 3TC9A 5F8QC 1AGEA 3U30B 3RWCA 4I3GA 4ZFOL 4HIJA 3X13B 3DJ9A 1K2DA 3UBXG 5T1DL 4DGVL 4CN1A 2Y06L 5C09A 3DRTA 1BZQK 4YBQD 1KIPA 1DLHA 4IRSD 3GGWA 3VFMB 1S5HB 1UACH 1AJ7L 3SGJC 4FQQB 5I6XC 3BW9A 4D9RE 1V3KA 3IDGB 3D3VD 5D5MB 5I8KH 2CKBA 2QQKH 3OAZK 3G6DL 5HYQA 4YC2C 3MR9A 2P5ED 1GC1H 3PP4L 4P3CL 4XNQA 3LN4B 3AXLA 3MRGB 3QIWD 4YDJB 1C12A 4MXVF 4L29B 1AFVH 2ADIB 5C6TL 1ZHBA 1JGDB 2DD8L 4MB4A 1F11B 2GJ6B 3PQYD 4F9PA 4J12A 3NCYS 4N1CA 2FBJL 1DANT 2JIXA 1NBZA 4XH2A 3ZSSA 5IOPA 4WI8A 3WFEH 3H9SB 3O2DL 4PG2C 2FATH 4LCIH 4DVBB 3DVGB 2CD0A 4N5UA 4PP2B 3ULUF 1YEJL 3W0WB 1OVZA 3EGSB 3BZFB 2BZDA 3ARYA 3RWFB 4DFIA 2BFVL 2CKBH 3ARDC 1HHIA 4P46C 3QEUB 5I16B 1FCCA 1H3XA 1X6NA 3PGFH 4HJGA 1RV6X 3HI1A 3WUWB 4TUKL 1ZTXH 3SJVB 3RZWA 3G04B 5D7JC 1D5XA 3LQZB 2IADB 1NEZA 3EDFA 3M45A 4JAMA 4OD2B 3U0WH 3FO1A 5J6GA 3SKMB 4XXCA 5CJOH 4FP8L 5E2TL 3L7FA 3IJSB 1TLKA 3M07A 5I0DA 1RK0A 1FCGA 4F7PB 1ACZA 4JHWH 2D0FA 3LN5B 3MCKB 1XGYH 2E8ZA 3O6KL 1LO2H 1OAUH 2EKJA 2WINB 3GIZH 2EC9T 3ARBA 4UOJA 3VXSD 3ULUH 5CSGA 4WFGE 1T80A 1PYWB 2HJFB 5DLMH 4X0KB 5BW7C 3TJEH 1A47A 2XIDA 3OKEA 1I1AA 1DVFD 5CBAA 4M48L 4M3KB 3DMMC 5BRZA 4JJHA 5DDHA 1U8IA 1FFRA 4LSTH 3B9EA 3BPNB 2UZXB 5BV7C 1F90L 2XZCH 3T3MF 2HRPH 3RX8A 1C5CL 5LGKA 5MERB 1VDGA 1WAAA 2DQGH 5MEQB 5F7MC 5B39G 1ZLUH 4QRRE 4KI5F 3FZUC 4OZHF 4PJ8B 2L4OA 1CXEA 1LO5A 5GSVB 5GRVK 2YMXH 4LKCA 4GBXC 4XCNB 2WUBH 4FFYL 2BVYA 2WP3O 2DLGA 2CIKB 5J12C 3F6IA 3CX5J 4G3YL 3DIFB 1B6DA 3PHSA 4PJCF 5CINH 4HUVB 4EN3A 4GQPH 3BN3B 3D85B 2NW3B 3OKLA 1A6ZB 4X98A 1TQBB 4E41B 3RNQA 4IIQA 4NNPH 1V3JA 1DBKL 1JIBA 3BYTA 5I1GH 3OKMB 1IILE 2O61A 1KGCD 3MODL 5DD1L 4IM8A 2VXQH 4KROB 1JYWA 4RFOL 4BYHA 1MY7A 1O7VA 4TTDC 2VITB 4APQB 3QEQA 1C7TA 1RZ8A 2VTFA 2EIZB 1OAKL 3CC5B 1FBIL 1NCNA 4XVUD 2QQNL 5SX5H 1CVRA 4KK5C 3PWPB 2PCPB 2Q6WA 3SDAA 1OLLA 4Z77A 3MTRA 1LQSR 2CO7B 1VFUA 3L3KB 4FA8A 2VE6A 5IW3A 5A3ID 3AU1A 4J3UA 1IEBB 5SWZA 4R3SA 5EUKA 3ULVE 4YHYB 2FHFA 1MI5B 1U8MB 2CMRH 2NY3C 3AFLA 3RTQA 2ORBL 1RVFL 1YUHA 5KS9F 2I27N 4D9LL 3W2DH 1JZ8A 3SGEI 4D0CA 4TPRH 5EBWB 2B0SL 2UWEE 1BOGA 1OGTA 4JFFE 1GGBH 1BQHG 4LHQB 4U1IB 5DJ8B 1NLDL 4QTHA 5I15L 15C8H 5IVOA 3C6LA 4DKEH 3RGVB 1IGFL 3BGFC 3MREB 3MLZL 4WWKC 3PE9A 4GO6B 5C0CD 3AGVA 1BAFH 4JZJC 4M7LL 2YRLA 4LLWB 4AMKH 5ISZE 2ZUQC 1N5YH 2Y6SD 4WI6A 5MP6L 2YPLA 3C87A 4WUUD 4ODWA 1S7VA 4P2OC 3E6HA 5JIKA 2IPTH 2R69L 4OB5H 2BY1A 3PHQA 4HMEA 1J05B 3P9MB 4JM4L 1DUZB 4JO3L 2VR5A 3WO3B 5CKAA 4ZFZA 4NKIH 1EFXD 2H3NB 4X6FB 1R24B 2G60L 1I1CA 4LK4A 3JWOH 4XCFL 1KPVA 3ZKMD 3HS0A 2PF6A 5J6HB 3AROA 3T65A 4I3RH 4ERSL 5C0DB 4LSDA 4Y1AE 4P2RB 1N26A 4IMLA 2E3VA 2IF7A 1F97A 2PW1A 3SCMB 5E6YA 3U0PB 1BFOA 1U2CA 3PG2A 2UY6A 2HKFH 3O81A 1KLGB 1T66C 4LSSH 3TYGH 1VHPA 3BUTA 3JWNC 5F71A 4QEGA 4KTEH 3WNNA 2PYFB 4M7KL 8CGTA 2B8OT 3WIFB 3QB7C 2RAMA 4J6RH 2XY1A 1UXWA 3PJSB 4NQXA 5C0NC 5K9JH 5E6ID 3INUH 1A7RH 1YMHB 2PNDA 2F58L 4NC1C 4XVTH 4U1JA 5EOQL 2APFA 2OLDA 3LSOB 4ISVB 1OB1B 3IDYB 3KWWA 1ZT4B 4JFDD 1BP3B 1CZ8H 4PREA 4XXDB 2WBJD 3UTSE 4EI6B 1NCUA 3IKCA 4A2LA 2FNBA 1AI1H 3ET9F 4LSUH 5FCUH 3VFOA 1F3JA 5GS1C 4GKSA 5JHDE 3K4ZA 3N50A 4OGAD 4DQOH 2NY4D 2AKRA 4RGOL 2CUMA 4ODXA 1CFNA 4NBZB 2FRGP 5F7DA 2FX8L 1KELH 3KNBB 4Z7OF 1DBAL 3GJEB 3NCEB 1DN2A 4ZFGL 1MRCL 2HT3D 4KRPD 1U41A 3QZWG 5DFVD 2BNUA 2NX5A 5GGVH 4G9FB 43CAA 3P4NA 3RPKA 3TN0C 5BMFL 3QDGB 3HC0B 2NY1C 1T1WB 5KSAD 4LHUB 1Z3GL 2YD9A 3NCBB 3EYVA 3QG6B 5D2LE 1ZT7A 1Z5LA 4KV5E 5L88L 4YO0A 3H3PL 3KJ4B 4NJAL 5FUOH 5BJTB 5DHYB 1ZLVK 5JORA 2OK0L 2BNQB 4N0UE 3HR5A 3WNLA 4OKVB 4JQXA 3O45A 5EA0H 3VI3F 5D6DA 4XBEL 3QFDB 1JTTA 1MCNA 5HHNA 4M93B 4H26B 5H37H 3RZCC 2Q8AH 5J13B 1VERA 4JJ5A 5FV2A 5GGSA 4OKDA 2IH3A 3U4BH 3L5WA 1DBML 2Z31D 1SY6A 5HJ3B 1XZ0B 3NPSB 4IRSB 3ARWA 3S4SA 5GRWA 4XPGH 3T0AA 1EHNA 2AJVL 3EOAB 5FYJU 4DCQB 2NYYC 2BRQA 2VDOL 3FMGH 4KVCH 3EYQD 3MRIB 4WRLA 3D3VB 5IB1B 2IALA 4M3JA 4KQ4H 1CD1B 2WM0A 2AXGA 3O4LE 2P5EB 5GS0H 1MFEH 5MEOB 3HG1E 5F9DC 1MFAL 3CFBB 3X13A 5HHVL 2DWEB 2P46B 2E9IA 5CGTA 2ADJB 3CDGA 3TBWB 1KCSL 3PDDA 3ULVL 5HBBA 2QSVA 1T5WA 3VFMA 1S5HA 3WO4C 1VFOA 3GMRB 2GTWB 1CLZH 3C09C 4FQQA 4KAQH 4Q9CA 4MA1B 3O3UN 4WCYH 3IDGA 2JF1A 1UM5H 2O5ZH 5D5MA 1SY6H 2HTLC 5EC2B 1MCFA 3QUML 4QXGH 5DEZA 3SO3B 1CDHA 5BS0D 3SE9H 1PGRB 3QDME 1T7XA 2WMPA 1J1PH 3LN4A 32C2A 3MRGA 4NRYB 4YDJA 4GKZB 4F58H 1J9CT 3MACH 2ADIA 3VFSB 3VDBA 1JGDA 3SDXE 1F11A 2GJ6A 4WEBH 4MJIE 5JZ7C 1CTOA 1SM3H 4ONGL 4ZODA 2N56A 3THML 1Q1JH 3HZKB 4NQUA 1DTUA 2EC8A 5KJRH 3UDWA 3FT4B 5HGHB 4F57H 3H9SA 1PEZA 2B39A 1AKJB 4DVBA 5IKCB 2EDLA 3DVGA 4PP2A 1MAMH 3CFKB 1UM6L 3LDBC 3W0WA 1G0DA 2MOVA 4K2UL 4PB9H 3EGSA 3F62A 4PJ7B 3TFKD 3KG5A 1CDJA 3RWFA 3CLFL 5HVHB 4K8RH 1C8PA 3VXSB 1CE1H 5CJQL 3DWTA 5C6WH 2HYMA 3QEUA 4HEPG 5FM8A 1KJ2B 4U05A 5I16A 3ROLB 2IFFL 4F80A 3WUWA 5C0GB 4H5SB 3SJVA 3EHBD 3G04A 4PY7B 5B39B 3LQZA 1DVFB 5HI3D 1YEHL 2IADA 4GMTH 3QAZB 1WWBX 4OD2A 1JZ5A 5T5FL 4LQFL 2GSIB 3BAEH 3SKMA 1HHJB 1I75A 2C4XA 3EOBB 3IJSA 3QDJB 2CRZA 4HS6B 4F7PA 3WDJA 1KENL 3LN5A 3MCKA 3PIQB 5I8EB 2WINA 3EKCA 1RZKC 2H32B 3G6JE 1PYWA 2HJFA 4HPYL 3HA0A 4Y88A 1AR2A 4X0KA 5KW9H 5F7NC 1A3LH 3OB8A 4N90E 4NC1E 4X4YB 4N0FB 1PX4A 3U79A 3IB4A 3E8UL 1DANU 3VXME 1E4WL 2Q7YB 2BDNH 4UIMB 4PLOB 1A14L 1CF8L 4XP4H 3OWEA 2EE9A 5MERA 5ITBL 5MEQA 3S3SA 4AIOA 2AXJA 5GHWH 1CVSC 1NUNB 1JFQH 2EYRB 4PJ8A 3RVUC 1CT8B 3HRPA 4PYGA 1TPXB 5GSVA 1TVBB 4JHZA 3D0VB 5TE4H 2DLTA 3SKUD 4XCNA 3W9EB 3EYOB 2ZPKL 2VDQH 4HPOH 3PXJA 3Q6FB 5AAMA 2CIKA 5BV7L 5F7KC 4OF5A 3DIFA 2G75B 4HUVA 4YXHH 3D85A 4UBDD 2NW3A 2VR4A 5CZXC 3QIBD 4JVUA 4E41A 3BPCB 1QEWB 4XVJL 1YNTB 3RIFK 5E5MB 3AREC 3OKMA 1LDPL 4S1DD 1KB5B 2FDBP 2EC9U 4D94A 2VN4A 4YXLH 3CZFB 2ZJSH 3VRLE 4XPAL 3V7MA 4O5LL 4PJIE 2VITA 5C8JA 4APQA 3QUKA 4MDIB 2EIZA 1UZ6F 3CC5A 1NC4B 2YR3A 1QACA 4Q9QH 5JDSB 3MRKA 4Y4FC 3PWPA 2PCPA 4WI2A 1EMTH 2W9EL 1LNUB 2XG4A 4GRWE 5C0CB 2ZCHL 4P9MH 1S7WB 3L3KA 1B0WA 2IMNA 4HWEL 1IEBA 1HQ4B 2MPAL 1MI5A 1U8MA 4JZOB 4ELMB 3BFOA 1KN4L 5GZOC 1FORH 4QHKI 1BZ7B 4CRPA 4FG6C 4O4YL 4P2QD 5EBWA 1ERNA 4IS6B 1S7TB 4U1IA 4WIQA 1LO3H 5DJ8A 3LQAC 4Z7VF 1EFXB 1FPTH 3MROB 3ARPA 5F7HA 1MCCA 1M1SA 1BBJB 3V8CA 3RGVA 1LK2B 3MREA 4YFEA 3DXAE 1XCQB 2B5IB 3Q5YA 5DD5H 4A2MA 3LS5L 5D1ZD 5B4MD 2G9HB 5FAAA 2VQUA 4LLWA 3KLHD 4PRNA 4CMMB 25C8H 4WTZA 2FH8A 1RUML 4IOFC 4Z76B 1RU9H 3OAZH 3X11B 1N4XL 1BBDH 3LMJH 4C57C 1J05A 4K3DL 2JKXA 3CLEH 3P9MA 1HYRC 4NC0B 4PRHE 1TDQA 4N9GB 5EOCJ 1DUZA 2IGFL 2EE6A 2E6QA 2H3NA 4X6FA 4YNYB 1R24A 2RCSH 4F9PC 1Q94B 1NCCL 3KGRA 5J6HA 1E0OB 1WEJH 1CBVL 4DUXA 5C0DA 3VDCA 3H3KA 2X70B 4FFZH 5TQ2H 4P2RA 1QFWH 4LVNC 3BWAB 4OIIH 4JFDB 1GOHA 3MJ9A 2WBJB 3SCMA 2V7HB 3U0PA 4GSDH 1S5IH 3UX9B 3ULUC 1LK3H 4X7DC 5EBGA 3MUY1 3IAGC 5D96C 5T1KD 1KLGA 3O6LH 3RVTD 4FQLH 3O11B 5I9QC 3ZE1F 2AW2A 4GAJL 4YBLB 2NY4B 4YDIH 4Q7DA 1VACA 2FD6H 3OKOB 4LP4A 4XBGB 4XMLH 3PJSA 5HPMA 4OZIF 2H9GA 2YHGA 1GPOL 2ZUYA 3L3JB 1YMHA 2C3WA 4X5XB 4KRPB 5HDLA 4ISVA 3LSOA 1OB1A 1T2QH 1ZT4A 1D5MB 4XPFH 4R96B 5I2IB 4XXDA 4EI6A 1E6OH 4NQDE 1JK8B 4LVHC 4OM1H 4XMKL 5K33A 3BE1H 4RWYH 3D39E 1A2YB 1CFBA 3EFFB 5T1MB 4KKCC 2BHZA 3MJ9H 1T21B 2IBBA 3ARBC 1UH4A 5I19H 1B2WH 3KNBA 3GJEA 1NAKH 4FRWA 3QNXB 3U0TB 1XCTB 4NQTA 1PY4A 1TENA 1QR4A 1IGIH 1SJVA 3PL6D 4G9FA 4K3EL 3DV6A 3E3QC 2IBZY 2XQBH 3JVGA 1GHFH 3QDGA 3HC0A 1T1WA 4C59B 1MFBL 4LHUA 1FVDB 3SKNB 5ETUB 4J23A 3QG6A 1RUAH 4PFEA 1ITBB 1I7UB 4U0RC 2FX9L 5BJTA 5DHYA 4KI5C 1TTUA 2BNQA 1UKQA 3DLQR 4OKVA 3QBTB 3VFPB 3S9DB 2R0ZL 4OCRL 2HMIC 1RZJH 1ACYL 3QFDA 1HINH 4MXWH 4H26A 1IVLA 2P8PB 1MY5A 4P5TA 2BVUA 5MHSE 2F8VA 1MHHB 1XGRB 3ARFC 1YJDC 5GRZA 4EQ3A 1FZMB 5I1LB 4ZTPL 1J7VR 3Q5TA 1QYGL 1CFVH 4IIQC 5HJ3A 4IJ3B 4OQ1A 1XZ0A 4IRSA 5T33H 1ZGLB 4XI5C 4XAWL 4X6DF 4OGXH 3BWUC 3EOAA 2DQHH 1YN7B 4DCQA 4N1HB 2R0LH 3MRIA 5DRZB 3D3VA 5IB1A 1U8OB 4OJFL 5FUCC 3A6CH 5DD0L 1CD1A 5JW3L 3F58L 2VLKE 5F88B 5BS0B 2P5EA 3JV6B 5MEOA 3U48A 2QL1A 2AAVA 3BKML 3CFBA 5F7EL 3P9LB 4KK6C 3W5MA 1P53A 1NCAL 2ADJA 3SDAC 3TBWA 1CDBA 4S1SH 3SKJH 1NUGA 4UB0L 4YBHA 4HFUL 5LVEA 1HSAA 3GMRA 3C2SA 1ONQB 3A0OA 2HH0H 3RTQC 5ALBL 2V5TA 4PUBL 5ACZB 4JR9H 3JWOC 5EC2A 5B21A 5I66B 1DL7L 5IQ7H 3RIAK 4FXLA 1FO0B 2DQFB 3BPLC 3HMWL 4XC1H 5AUMB 2VMFA 2EXWD 4R2GC 4YDVB 4NRYA 3JTSB 3C6LC 4I0CC 4RNRB 1F6AB 4GKZA 3NCFB 5BVJB 1OARL 5FKPB 3VFSA 4DTGH 1A7PH 3BIKB 2EH7L 1XR9B 1A7QH 4PYHA 1G7QB 4M5YL 1G6VK 1ES0B 4HJJL 3D9AH 3F6LA 4I9WE 3MPCA 3HZKA 4KHTH 3S35X 1GGTA 3FT4A 4ODHL 5HGHA 2WBKA 1AKJA 2Z9TA 5IKCA 1S78D 1QPXA 3CFKA 3VD7A 4OCWH 4PJ7A 4ZTOL 3VI4E 2GTZB 1L6ZA 4MMXC 2C1PB 5FK9B 4CJ1A 3MJ7B 2BOCB 3VXSA 4G6JL 5GRJL 5JPMB 1KCLA 2R2HB 4LBEB 5L2KE 5TF0A 1VEPA 4I0PD 4YDKL 3ROLA 1FJ1B 1JN6B 2A9MH 4YFLF 2ADFH 4O2FB 5C0GA 3RA7L 4H5SA 1CR9H 4PY7A 3VJ6B 1DVFA 3H8NA 2NXZD 1AXTH 4PRIB 5DURD 4KJPC 2GSIA 4LU5L 1HHJA 4G8GD 1PKQE 3MRQB 3WFCH 1BLNB 3EOBA 3ULUE 3QDJA 5DO2C 1TTFA 4P4KC 3O9WC 4HS6A 1OGAE 1F6LL 5GISH 4FZ8L 3PIQA 5I8EA 5F7WC 3ETBF 2R23B 1U8KB 4GW5B 4NBXB 1B6UA 2H32A 3H3BC 2PTUA 4YHLH 3NA4A 2LTQB 4JEGB 3T0ED 5JOEA 4NO0D 4L9LB 1A22B 5FA4B 4OM0H 2LU4A 4X4YA 4GFTB 4N0FA 2DQJL 3NCYP 4DGIH 2Q7YA 4UIMA 2CGRL 1MUJB 5I1IL 1FAKT 2E8YA 4XPTH 4LLAA 3QIBB 1H5BC 3V0AC 1RUQH 2DQEH 1RZKL 2EEAA 2GCYB 1TTGA 3KR3H 1UENA 3V6OA 1V7NL 2EYRA 1CT8A 4ODVL 4OD1H 1TVBA 3D0VA 2YPVL 2ADGB 2GSGB 3W9EA 3OJDB 3EYOA 4NQED 5DHXB 1QHPA 3Q6FA 1KF9B 2XA3A 4QHMB 1NKOA 3RU8L 2H32H 2G75A 3K8LA 4FNLL 3E3QE 5ILTL 1EAJA 4G6KH 5KVGL 3VG0H 1ZLVH 3BPCA 4JE4B 1QEWA 4WY7L 1YNTA 5C0FB 3QG7L 2BSED 3LKQB 1H3VA 3WXVH 5FHAL 4JQXC 5E5MA 1WAAE 5D6DC 1KB5A 3J7HA 1RQ5A 4IMKC 1H3PH 2WLZA 4KI5E 3CZFA 4KJYB 4OIBA 3KYOB 4OZHE 3KPRA 3P0YL 1CGSL 1MJJB 1JNLH 4P2QB 5HDBF 3MLUL 3LV3B 4UV4L 4MDIA 1CXKA 1NC4A 4X9FA 2X4OB 1ZV5A 1PDKA 4MXQC 5JDSA 4PJCE 3OGCB 1LNUA 3BGAA 4J7RA 1AIFB 5C0CA 1UH3A 2BVPB 1S7WA 4UAOB 5D1ZB 3V2AR 4RMWA 2HT4D 4XHQA 1RZGB 1QO3B 1HQ4A 3JWDC 5BO1H 3RDTC 4TUJA 3U30C 4ELMA 2XFXB 4Z7WF 3ZO0A 5GZNC 4HSQA 4OLXH 5E7FA 4NP4H 1BZ7A 1ZGLM 4S10A 3QRGH 4MQXC 5FUCE 2MCPL 5I8KL 1F2QA 1KB5H 3LN9A 4IS6A 1S7TA 4JHBA 1MCJA 2QQKL 4JPKH 1EFXA 3MROA 3QEQE 4Y4KC 3KPPA 1BBJA 2ID5A 2V5SA 1KCUH 4KDTA 4D9RD 5JQ6H 1LK2A 1QLEH 2D7PA 2P49B 1XCQA 5JXEC 1AFVL 5JIIA 4HAGA 2G9HA 4CMMA 4OGZA 1HEZB 3X11A 5T1KB 3NOIA 3LQAL 1D9KD 3WFEL 2OX5A 2FATL 4K7PX 4LCIL 4N9GA 2CR6A 4YNYA 5HYEA 4JO1L 1Q94A 2X4RB 1W2KT 2H26B 4PLKC 3GSRB 4KK9D 2NZ9D 4Z5RB 2AEPH 5J11C 2X70A 3UTQB 3BWAA 4JFDA 1NUFA 2WBJA 2V7HA 4UNVA 1NFIB 3R0MA 3FTGB 3HI6L 2BK8A 1HYSD 2XV6B 3O11A 3U0WL 1TCMA 5D7KE 4M8QB 2VXVH 5CJOL 3RWEB 1OAXH 3OKOA 4WGWB 2RBLA 4XBGA 3VWJC 1OP3K 4M1DH 1JWUB 4X6CF 3L3JA 4JHWL 5FFLA 3P0GB 5FEBA 2QTEA 4X5XA 4MQSB 2AEQH 3QXUA 4Y16D 1LO2L 1OAUL 4MJ6B 3GIZL 3S36H 4G6AD 1OD7A 1L0XA 3ULUL 1D5MA 3MNWB 3PL6B 1KCRH 3WIHL 5I2IA 3UEZA 1NCWH 4L8SB 3RHWK 4BZYA 3FN0L 4HFWB 4R97B 1JK8A 1MF2H 4WFFE 3JZ7A 1WWWX