4P2RB

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
171
Chain Sequence
SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVYTCQVEHPSLTDPVTVEWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 171
sequence length 187
chains with identical sequence G, L, Q
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rB01
1YEEL 4G9DA 3O81A 2BSTB 5D6DA 5EIIB 3P9MA 2J88L 1IE5A 1NFDA 3BRGC 4X6DF 3L3OA 2VDRL 3VXRD 4H0HB 1CBVH 4QOKA 3O6LH 3BD3A 1VHPA 3LPFA 2F53B 4JFFD 1QRNB 3V8CA 2E6QA 1OQXA 3ME0A 4JY6A 5L6YL 4LAQL 1ZT4B 4WJ5A 3TT1H 4RMVA 4HWUA 4IRSB 1KC5H 1HDMB 3L3GA 2BHZA 2FWOA 3PHQA 2YRPA 3M17B 3ZDYF 2ADFH 3QWOA 3DXAD 2WZPD 3TEUA 1NCDH 1FC2D 3WFCH 1A2YA 2YD2A 1DUYB 1G9NL 2HT4D 3LZFH 2H41A 2IANE 4XZUB 5IQ9B 5I16A 3C08H 3KPLA 1UVQB 3WD5H 4KPHL 43CAB 1IQWH 4FZEH 4G8GB 4U7MA 2EDNA 2GTWA 4OV5B 4RWYH 1QSED 1F4WH 1X5YA 2ZSWB 1FNEA 5KSVA 1OF2A 3UTOA 5CJQH 5C0BA 1LO4H 2E5EA 4NNXA 1ZLUH 3PQYE 2ZUTA 2PYEA 2G5BA 2X89D 1CF8L 3LOWA 5HI4C 4ELME 4Z78B 1IKNC 4R9HA 2CRIA 4JR9H 1ZXQA 3FOMB 5E70A 3BH8B 1J8KA 1PG7W 1DZBA 5LCVH 3SQOL 4FMFA 4JPVH 5EU5B 2OJEB 1CXIA 4J3SA 3MUJA 5D1XC 3BFOA 1BFSA 4IEFB 1IQDB 3NIDF 5IMMA 3SDAD 2W0FB 4JQXA 1KNOA 3MV7D 3KHQA 1XR9A 2D0HA 1V3LA 2DB8A 5BV7H 3HI5L 4ZUSA 2XWTA 3Q2CA 1KENH 4J3WA 2P5WE 2YUVA 2XNAA 2XQYK 2BHYA 3G6DL 4NQDA 5DQDH 5JIPA 3MLWH 1OTTD 1LEGA 5FO7B 4DAGL 1INQB 2DL9A 2KQNA 1FGVH 2CKBH 4I48A 5DC9B 4OLUH 5DGQA 1ACYH 1QR4A 4HUVA 3KDMB 1EFXB 4IOSD 5TE4L 4E41B 2ZUVA 4EN3D 4N90D 1I1YB 5I8CA 3KLAA 3EOBA 4ELMB 3S36H 1Z9LA 5F1NA 1M6OA 1ES0B 2XOTA 3CLEH 5FYLE 5INCB 4J12A 4OD2B 2C3VA 2ZOKA 4XPAL 3U9UA 3TN0C 3O6KH 3QUXA 5EUOF 4O9HL 1JGUH 5FDYA 3NCYS 4HH9A 4F15B 4I0CC 5CP3A 2YOCA 5J13B 1U91A 4BH8A 2ICWJ 5AD0B 3KJ4B 2QSCL 2CIIB 3LKSA 2R56L 1DLFL 4AL8L 4WGVB 5B3JF 2EZ0C 3MRPB 3VFOA 3D39D 1GGCL 5I19L 3ZT7A 3T65A 2JCCB 2BY0A 1IFHH 4YBQD 5D2NA 2RR3A 3QUML 4U1LB 1CVSC 1KIUA 4YAQA 5IB3A 5MEND 1UXSB 5LBSL 1FNHA 5F88B 4LCWA 2RFXA 1DEDA 2XPGA 4LOUD 1IEBA 3SDCD 3BDXA 1HKLH 5E99H 2CSPA 1M7IA 5AG8A 3BT2H 1AH1A 3PWJA 1FORH 1IAOB 3WN5C 3IS0X 4YXKH 1RUAH 1E28B 3FO9A 4JZNA 3WUWA 3SKMA 5J9PB 4ODXA 2VE6B 3QRFM 3I2CL 5EFIB 5I66B 1Q0XH 2AERT 3HC3L 4JM2B 5LG1A 1KBGH 5A40E 3DSFH 2IBZY 3KPNA 1UB6A 2HKHL 2XXMB 3BAEH 2YPLE 1YQVL 4M5YH 4WNQB 4AT6A 3QH3B 1MJJB 5D5MF 1KJVB 2FHBA 3L3HB 5F9JB 1PX3A 3WE6A 3HE7C 3QHZH 1QQDB 1P2CB 4YHNB 4YDJA 3OAYK 5TQ2L 2Q76B 3DRTA 1ZAGA 2D4DA 5IJKA 4KC3B 5FEBA 4L29A 3VWJD 5HHME 2DQTH 1B4JL 2CO6B 5E94B 1I3UA 1BD2D 1JGLH 1JHLH 2NYYC 4IIQA 4AIZA 4O2EB 4ISVA 2JKXA 4R7DA 3SE4A 5EZLA 1N8ZA 4Y2DB 1C7TA 2C3HA 1P7HL 2NY4C 2PO6B 4X99B 3HHRB 2P8MB 3K74B 3UJIH 4R4ND 3MV9D 4N5EC 3BZEA 3LRGA 4M8QB 5SWZB 4DFHA 4KKAD 4S1SL 1TITA 5DJ8A 5DJ6A 1DVFA 2KPNA 1JGDA 3E6FA 4GW1A 2NY6D 4LU5H 3IDIB 2R2BA 4KROB 1LD9A 4KK6C 2XKNA 3DLQR 4OF5A 4GLRH 4ODTH 5JPNB 5IVXA 3IAGC 1CD9B 2AV7A 2Z92B 4P2RD 4ZTOL 4HCRL 1A64A 3BPOC 3Q5TA 2MKLC 3SHSA 3F7YB 4HF5L 3ZL4L 5F96H 32C2A 4GRLA 1S9WA 3HE6B 2D03H 1SBBA 4YGVA 1HI6A 4LPCA 4L3CA 2J7LA 1KB5B 3D25A 3GMMA 3H42L 3SJVE 5C2BL 3NIGE 1H0DB 4AJ0A 5HHMB 4PGBA 3ABZA 2DLGA 1NC4D 4QRQB 1LILA 4Y4HA 3MX0A 5JQHC 4HDIA 3HZYB 1P7QB 4FQJL 2ZCKL 5EZJA 1I8IB 4YC2B 3HG1D 3HC0B 1NUNB 3W11D 4CL7A 3B2VL 1UZ6E 3BHBB 5HPMB 1R3HB 3DGGB 1HZHH 1R3KA 4JY4B 1JWUB 3GSRB 4GSDL 4JFXB 1I4FA 3PV6B 3S3PA 1YECH 2EH8L 3VGHA 1CL7H 3CMOL 1TETH 3HMXL 4GFTB 3R0NA 1I9RH 1U3HD 5CLTA 4WWKC 4G9FA 4H25A 3O2DL 3BP4A 4ZXBD 4LLMB 3ESUF 3GZKA 5GRVL 5K9KB 2A1WL 4FFYH 1JYXA 4YNYB 3P4MA 2IGFH 4KKBD 1C08B 5IFJA 4X5LA 4Q6YA 1MH5A 3GRWH 2LU3A 3L9RA 1SEQL 2EDLA 1MLBA 3VWKA 3QG6A 3TH4T 2Q7NA 1SVZA 4ODSL 4J8RB 1EPFA 3EKCA 4Z7WF 4QXUL 2ZCHH 2ITCB 4MXWL 4Y5YB 4TNWK 2VL4A 3FB5B 3CFCH 5FHBH 3SJVB 3MUGB 3B9KC 1NBVH 1OAXL 1KELH 2HLFD 1AQKH 3FTGB 1NGPH 4IS6B 4ZO9A 2COQA 1CG9A 5D1QC 3WSQH 5FOBB 2FB4L 1CXLA 1XGPB 4OZFA 1PG7L 1UZ8A 2VDQH 4P0DA 4L9LB 4NRZB 2H2PC 2ARJQ 3G6JE 1UXWB 4LLYA 2D7MA 4K2UL 1MCLA 4U33A 4Z95L 4S11A 1AFVL 1IGTB 2B4CH 3RUGE 1QEWA 5GGSA 5EU3B 1CDGA 4IMKC 4O2CB 5E6IC 5DS8B 4Y19E 3CC5B 1C1EL 2ICEA 4X9BA 5DRWA 4Y16A 5CEXB 1LEIA 3ARFA 2FJGA 2BC4A 2Z31C 2CGRH 2JIXB 2WNGA 3IKCA 3VFPA 4IRZL 3O11A 5C0CA 4U6VH 1LE5B 4OKVA 4LIQL 2JELH 2WWMC 1QA9A 4HBCH 4KJQC 4FP8H 1T03H 1WGOA 2A6IB 4OM0H 1A6ZA 4B7LA 5FYKL 1CTNA 4PJGE 2O5XL 4UAOB 4QNPE 4HEPG 5JOPD 2A73A 5L0QC 5K9OB 4PD4J 1N0LA 5T3ZE 4D8PA 4K7PH 5C09A 3FN0L 3FB6A 5D70L 1NFDF 4LDLB 1WIPA 1RHFA 2ED7A 3VXME 4PJHE 4XPHH 5GQBA 5L2KA 4C56D 4AM0B 4CKVX 4L5FL 2VABB 1A7RH 3WFZA 1NBQA 3QDJA 2WINB 1T7YA 4OQ1A 3BGFC 4TOYL 2XG4A 4HXBL 1KJ2L 5HHVL 3L5WA 4DN4H 2YEZA 4UILH 1ONQA 3T0AA 4PYGA 1EO8L 3RZWA 1JPSL 1PLGL 2BNRB 3PWVA 5T1DH 4E9LA 5I1DA 3PWUB 2CQVA 1B90A 3C6SA 2EXYD 3MRMA 1C8PA 3MMEB 4D9RE 1MRDH 1JN6B 1DLHA 1P1ZB 3BW9B 5FUCE 3U30C 3HI1B 5AWNL 1SY6L 4MJ6A 4PJ5E 2HFEB 4BZYA 4PJGB 1OAKL 4I3SL 5JR1L 3HB3C 2VDLL 4OFIA 4H20H 4QGTA 2JB6B 1F90H 4NOFA 4U3HA 5AYUH 2AJVH 2VLJE 1FN4B 1FJ1B 2EO9A 4FQXA 4BZ1L 3C60B 3MOAH 4GBXC 3SE8L 2FIKB 4NQXB 3VFNA 3DMMB 4ONFL 5F3HB 4PJIE 3N85L 1HHGA 4AY0A 5EC1A 5LWYL 5EOQH 1EMTH 2UY6A 4DVBA 5B38G 3H0TB 2ADIB 4PRPB 2ATPB 2ICES 1HIML 4MHHI 5KSBA 1DBBL 1I1AC 4WU5B 4HWBH 2FHCA 5FYJD 4HQQH 4Y4KA 5C08A 3MV8A 4NT6A 2NW3A 1FZOB 4QCIB 5DWUL 1U6AL 3HAEB 4X5WA 5DK2A 4NM8L 3L7FA 1F02I 5DUMH 5K9QI 1PDKA 3U83A 1REIA 4JKWA 1L7TH 4KRPB 1HHKA 1KCUH 2QKIA 5JIKA 3TM6A 2P44B 4H26A 2HVKA 2C4XA 4JQXC 1VEPA 5B8CC 3WHXB 1E27A 4PREB 3T2QA 3G9VA 2VDRH 3ZDZE 4PJ5B 4M6OL 2EZ0D 2QADC 2O5ZL 5SWSE 3T77A 1KJMA 3GNML 5SX5K 1N5AA 4P46A 2I9TA 4HFWB 4NKQB 3P4OB 1CGXA 3GI9H 1NBYA 5L6YH 4LAQH 5D2LF 1IC5L 3RVVC 3RQ3A 5DI8B 3S34H 5I75C 4YHML 3STLB 3U4EA 4PJIB 4P23C 4K9EL 1I1FA 3UXFA 4J6RL 3NCYP 1TTFA 4ZFFA 3MA9L 1G9NH 2GK0A 2WK2A 3EOYG 5EZOL 3HPLB 4L3AA 5ESAA 3VXPB 1UB5A 2DYPD 3T09A 3E8UH 1V3KA 5ENWA 1XGYL 4Y4FB 1F6AB 1EHXA 1KOAA 3OJDA 1G7HB 1D5ZA 5I1IL 1TZHB 3LPWA 4P2OB 2K1MA 2DTMH 3QUXC 4AH2A 2A9ML 3JWOC 1E4KC 5IM7A 3U7WL 4HIIA 1DR9A 5DD0L 3DECA 2Z4QB 3SDDB 4RQQB 1KULA 2W65A 3MRQA 3KYMA 2EDDA 1U0QA 3QHTC 3QT2A 2W9EL 1CF8H 4XCNA 5SWSB 1H8SA 3LKOB 3VFUA 1U3ZA 4JZJA 2X2YA 2Z93B 1YNTA 4Y5VB 5DUPH 1PEZA 3I6GB 2Q6WB 5IFHL 4GQ9L 2RAMA 5AYQA 4N8VB 1QHOA 2RQ8A 3SQOH 3FQTA 1NUGA 3TO4B 4HS8H 1N5YL 2EDBA 5D7LA 5FA4B 3LRSA 1W72L 4LPXA 3KNBB 2BY3A 4POZC 5CIPH 4HGWA 4OKDA 1QFHA 2OZ4L 2X09A 3QXAA 4PGDB 4EI5B 2YBRB 4LKXA 1B88A 2HTKD 1M4KA 4RRPA 1IM9B 5CFHA 1YNLL 3W82A 2NY4D 4WO4A 1W8OA 5ISZD 1VESA 4LSVH 5C0AE 1BQHG 4N5ED 3QDHA 4ZPTA 3BZDA 5DTFA 1KEGL 5CZVL 1HH6A 2FR4B 3DETC 5J6HB 5KSAC 4QHNB 1R6VA 5TDPB 1GAFL 5D96C 4DAGH 3G08A 4XI5D 2MTPA 2HA1A 1JMXA 2WP3O 5JW3H 2P48B 4PJ7B 3WIHH 2VDMH 2P5EE 2NXYD 1S9YB 3TA3B 4Z7QF 4RGND 3ZE2F 1S7VA 5TE4H 3IU3A 3CFJB 4ZTPL 4PTUB 1DBMH 5DEGB 1DUZA 3G04B 1UH2A 4CW1B 2X4RB 1XEDA 4K94C 4APQD 2GI7A 5IB2B 4KMLB 2H26A 3BH9A 2IALA 2FCBA 5BVJB 3LCYA 4MXVF 4NO3A 4GLRI 3ZHDA 4OZIA 4M6NH 5EBWB 3TIDB 4F9PC 4HAGA 4OLEA 3UEZA 4XPAH 1CXFA 2HJLA 4DFIA 4KK8D 3BJ91 4O9HH 2E8YA 5H37H 3WFHA 5F1OB 3GMPB 4EBQL 2YRZA 3P77A 5I30L 4LLWA 4HIHA 3BI9X 1YEDB 1DLFH 3NMEA 4AL8H 3REVB 4I1NB 2P24B 1GGCH 5I19H 3RX8A 3SGDH 2HKFL 3D85B 4N0UE 3ZTJG 3QUMH 5DUBA 1RJLA 4ZSOA 5CWSA 1K8DA 3SKNB 4NM4H 4CMHC 2A6KA 1IAKB 3FT3A 2GFBA 4XPGH 3VFVB 4XNUL 5DRZB 1SJEB 1KSRA 1N59A 2OJZL 4MB5A 4HULB 2G75B 4PJAF 1J8HB 3MODL 2VKWA 1OD7A 4ZO7A 5HVHB 2P5EB 5D7KD 1U8HB 1DQMH 5INDA 1VFBB 2BDNL 5MEOB 4WCYL 3RZCB 1MHPH 2VZ1A 1NGXA 1S7TB 43C9B 4UDTA 1A5FL 4M4PA 4M7ZC 5E2JA 5AUMA 3MRCA 4YDIL 1CL7I 1FZMB 2EDFA 5GSVB 1M7DB 3I2CH 4DN3L 3G5VA 3B9KD 3ZMRA 2V9RA 1X5HA 4FTVD 5I74C 2HKHH 1FV1B 1EDQA 3NZ8A 1YQVH 1S7WA 3HUJE 3WDHA 3I02A 4B50A 4M9OA 1ZLWK 3ULVL 3MRBA 1S7QB 3FMGL 3CZFB 1KN2H 3OHXB 5HYSG 4G6ML 1XIWA 4NNYA 1UWXH 2FECI 2HT3C 5HYJE 1UC6A 1JTTA 2ESVB 1UJTA 1QFUL 5TQ2H 1F6FB 3E0GA 2E7BA 4OZHF 2IANA 1A4JB 4MB4A 3QPXH 2NZ9D 3UC0L 1P7KA 4NWUL 1ED3B 3CXDL 2N4IA 5E6ID 2MCPL 5DYOA 5FKAA 2NY1B 2Z31D 5EOCL 4F7CB 3QIBA 4NYLB 2FSEA 3IDYB 3CVHH 4B7IA 3PQYA 3JTTA 2WWMD 4ZUVB 5LQBL 4KJQD 4WUUE 3IDNB 2PETA 4F3FA 2WV3A 4S1SH 4X6BA 3MGOA 1ZS8A 3X14B 1VACB 3Q3GA 4OUOA 3C6LB 5HGHA 1RAMA 1AGCB 1FSKC 1Q1JH 3PP3K 4WTXA 3T4AB 3DX7A 5HGGS 2X4SA 3C87A 2R2EA 3D2UA 1IJ9A 4MNHA 5ANMA 3TH3T 4QLRA 1NCCL 3LEVL 3NAAL 2BVQB 4K8RL 4ZTOH 3O8XA 4HCRH 3UTQB 3MREB 5BV7B 1RI8A 5EULV 2C3XA 4HF5H 1INEL 3ZL4H 1R24A 4JN1L 2X4PB 2QHLA 5A2IH 1I7UA 1K4CB 4EEEA 2G9HA 4OAWA 3PABB 2P5WA 4QHLB 4MD4B 3W9DB 3UPAA 5IV2A 5ICYA 1V7ML 4LQFL 4QOKD 4M1CC 5C2BH 1F6LL 1NC2B 1TMCB 4J1UA 4LNRB 2CKBB 1CFTA 3UYPA 3WLBA 3T0DA 4DEPB 1F3JB 3BDBA 2PTVA 4NQEE 2AJ3A 3TJHD 2G2RB 1CGYA 3QWRA 2JF1A 3NCMA 1AXTL 1XGQB 4DGIH 4EQ3A 3IT8D 4LEOA 4FQJH 1LK3L 1QSFB 3NPZB 4EXKA 3SPVB 3B2VH 3MLTA 3QISA 3JTSB 3ARFC 3KS0H 3MRIB 1BFTA 3IFOB 1QVOB 1KGCE 4WUUB 3OF6A 2VN4A 4L8DB 4GSDH 1MQKL 4L4VE 5JLZA 1S7XA 4FQIH 4H8WC 3MZTA 2EH8H 4FQ1L 5C2UB 1RFDH 3VXSE 3HMXH 5F8QC 1IGIL 1K5NA 1LK2A 5I1LA 1Z0MA 3O2DH 4P2CG 3B9EA 2A1WH 3WO4C 2OI9C 2GT9A 4MA3A 3MLSH 5TFSH 3S5LB 2DIBA 3T3PF 4GJTB 5BJTA 1L0YA 5JW4R 4G3YL 5C0BD 2R4RL 2XICA 5TGBA 1E4WL 4MXWH 2PYED 1I1AD 1V3JA 1FNSL 4K3JL 4UNTA 1OP3H 4WUKL 2UWEE 1MCWM 3HN3A 5DD5L 3U79A 5MHSE 4NQEB 4NN6B 1J0IA 3RTQA 1LP9B 3EYVA 3QWQB 2J4WH 2AI0L 2FB4H 3BZFA 4FXLA 3T04D 3RGVA 5F97E 4HC1A 5ELIA 3U82B 1MWAA 3QCTH 1H5BB 4XBPB 5TE6L 5CJ5A 3AREA 2NLJB 2QADD 3IJYA 4LVOB 4NO2B 4K2UH 2BNQA 2DTSA 5JA8B 4Z95H 1R0AH 1RZIA 3FO2B 1DBKL 1AFVH 4UIKH 4JANA 3CVIH 2R1XB 3LMJL 3MRHB 3EZJB 3RVVD 2YUXA 2AKRA 1FAIH 4Y5XA 1WWAX 4NQDD 2HAZA 1C1EH 1N6QL 4LLQA 2NY7L 3PL6A 3UJJH 2YPLA 4RAHA 4QXGL 5FM4A 4IRZH 1T20B 3FT2A 3HLAA 1JHKL 4XBGA 4YO0A 5GRUL 4LIQH 2APXA 3KYAA 1VADA 1BP3B 2QL1A 3CFDB 5FYKH 5DA4A 1NBZA 2QV2A 4W4NA 3ARBB 3PF2A 2UWEB 3V5DB 1CGSL 2IJ0C 4OZGF 4B5EA 4Y4KC 2PCPB 3LB6D 3QCUL 1RZGA 3FN0H 5D70H 2V2XB 2Q7YA 3MYZA 4R4FL 1HILA 3DIFB 2X41A 4RGOL 3QUXD 5EUKB 3JZ7A 3I75B 3MA7B 1AHWA 3ZE0F 3NTCL 1KCVL 2DKSA 3I3EA 2O5YH 2ZG3A 4NKMB 3JUYA 4L5FH 4P3CH 2FH8A 1JPGA 2QQKH 4TOYH 4OT1L 3OXSA 3AM8A 1YMHB 1KJ2H 5DRNA 5HHVH 3ULUE 4JFEE 1FNFA 2RB8A 1NSNH 1OTUD 2DQGL 2F54E 4ACPA 1WICA 1EO8H 2DICA 4C83A 1JPSH 1PLGH 3RWJB 5I76B 1A4KB 3I6LD 4OLVH 4GXUN 3QNYB 5JHDA 4V1DD 1TJGL 3RIFK 4LCWD 4XT1C 5C9JA 3HNTH 4DWHA 1JI2A 4GG6B 3EIFA 4XAKD 4WI4A 4HUXB 5AWNH 1SY6H 4Z77B 5KOVC 5HHNB 4KK5C 1OAKH 3TVMB 2Y9RT 3MCG1 3OJMB 4MDJB 3VD4A 4I3SH 2VLKB 4XXDA 5EC2B 2VDLH 4RX4A 4ZNCD 4NFDA 1AY1L 3F58L 4QHMB 3P4LA 5MEPB 4BZ1H 3DROA 1ZGLA 5BRZE 3CSYA 3SE8H 2X1WL 4M7LT 4ONFH 4OLYL 3N85H 4LPUA 4BQBA 1J87A 5LWYH 1DE4A 1NJ9B 1PW3A 4MCZB 3I3DA 4U1GB 3MLVH 3W9EA 2DLTA 1VB9A 1RUQL 1HIMH 1AR2A 4G42A 1NGQL 5C0FA 1MCRA 2VISA 4HS3B 5IT2L 3L3DB 4C58B 3OGOE 2YWZA 4NM8H 4HLZG 1FNGA 2AXHA 3T8XB 4JFFE 4HAFA 3T08A 1CICC 3HS0A 1BOGB 5EG6C 2XZQL 5JNYB 3ZSTA 3O3DB 2VL5B 4MAYA 4LPTA 1HXMA 3QEUB 5C07D 4MJIB 4TQEL 4PR5A 1A1NA 2WP3T 3H7LA 4X0KA 5E8OB 1H3TA 2QQLL 3RNQA 4ZQKA 4M6OH 4Z7OE 1KCKA 2O5ZH 1HINL 3FFCA 2HT2C 1W0VB 4E0RA 4JO2H 2HFFB 5T1KA 5BO1H 1NEZB 3ZKQD 3KPQA 4F37F 3QIWA 1EGJL 5F9WB 1LO5A 1DVFD 1BQUA 4MJ4A 1AGBB 2IPKA 4HK3N 5BRZB 4KKCD 4F57H 5I8OH 1ZT7A 1ZHBB 1AIFA 2YHGA 2CLZA 3UPCA 3O4OB 3QNXA 4KK9C 3RY4A 4U2ZA 5K59F 4ZPVA 1IARB 5ACZB 1ND0A 3SGDI 3MA9H 4Z7UA 5KVEL 4M7LL 4GRLD 4RAUB 5IBTL 3G6JA 4CVXA 3EJJX 5EZOH 1T5XB 2XRAL 3F65A 1I3GH 2XA8H 1YEIH 4XVTL 3FONA 1YJDL 3VXRB 1XGYH 1R3IL 4LLDA 1IRAY 4JFFB 2LV4A 3FRPA 5I1IH 1LO3L 1S5HA 1PZUB 1B0RA 2A9MH 4Y19A 2BVTA 4M5ZH 1MCNA 4IRSC 1SVCP 5CCKL 1B6UA 3MLYL 1RZFH 1P6FA 4U6YB 5I1HL 1A0QL 1NGWB 3GSOA 4KAQL 4G8EA 2W9EH 5I1KL 1IT9L 3MV7E 2HT3D 1WBXA 2BVPB 2ADGA 1T3FA 1UEYA 4WHCA 2QSQA 4S2SB 5IFHH 2N56A 3DXAB 1MELA 1LGVA 1CLYL 3ZTNL 2BHUA 4D0DB 1N5YH 1E0OB 5HJ3A 1DQQB 3HPJA 4TSAL 4K7FA 3VXMA 4UINL 2GCYA 4G9FD 2XFXB 1ZHNB 2OZ4H 3MYJB 4H5SB 3VD5A 3MPCA 3LKQA 1YNLH 2PYFA 3D87B 2VDNL 1BZ9B 2Z91B 4GG8A 3GMRB 5EB9A 1QSEB 3WFBL 3VWKD 3MRKB 4YJZL 5DEFA 5GISH 1KEGH 5CZVH 3ARGC 4N90E 3JV0A 4RA0C 1BJ1J 3NVQA 2XV6B 1IC4L 4NDMA 2ZUSA 1HEZA 1GAFH 5EU6A 5HYQA 1A7BA 2BVYA 4QRTB 1UH4A 3KG5A 2VTFA 5I2IA 2PXYA 4AEEA 5H94B 1MHCB 1G6VK 4XNZC 2EO1A 2EDEA 5K93A 1S3KL 2CDGB 4ZTPH 2AGJL 5FF6A 1GPOL 4P4KA 3SDAB 2P46B 4U6XA 3HKFA 3MV7B 4GRMA 2BVEA 3BUYA 4JVUA 1KF9B 4LSUL 1BVLB 1NFIB 1T1ZB 1A3LL 4M1CD 4NPYA 1CYGA 2GTZB 3EAKA 1RUML 2BNUB 3D39E 4DKAA 2V7HB 2UZYB 5ICZA 5B4MD 3PGDB 4Q97A 2X4OB 4YR6A 4EBQH 1Y6NR 1FCCA 4RFOL 4AIXA 2IADB 2IQAB 4ESKA 4KUCD 4NIKB 4ELMF 3FCTA 4CBPA 4Q74A 1YN7B 1YC8A 2V9TA 3GSNB 4OM1L 3WUWG 4Y16D 4MWFA 2C1OA 3ARFD 3GMQA 3R06A 5C0CD 5C0EA 1FE8L 3FQNA 2HKFH 4RAVB 2O26U 5A2KH 1DCLA 4EN3B 3P3YA 4QEGA 3QIUA 3CUPA 4WV1C 3GUTB 4XNUH 4HLZH 3UDWC 1VFAA 2J8UB 2OJZH 1A7OL 1OAZL 2BZDA 3F7VA 4F8TA 1EVUA 4UOW1 4WI2A 4ZUUB 3VFMB 4RNRA 2W0LA 5C09D 3TYGL 1X5KA 1BX2B 3TC9A 4LCUB 4WCYH 3VFTB 4XP4L 2CUHA 5J13C 4MCYB 1A5FH 1A6VL 5I1AB 5L2KD 4OCSH 4JFDA 4YDIH 5JXAH 3R0MA 1R3JA 5I73C 1T2QH 2HJFA 4LPWA 1NMBL 3N1QC 3QDJD 1I8MA 1HKFA 3EDEA 2KL6A 2B20A 4NJAH 3D39B 3HZMA 3OKEA 2EC8A 4TSCL 2PNDA 1G7LA 3LIZL 3Q6FB 3TBWB 5MENB 3RI5F 3S35X 4JDVB 3SN6N 5ITFA 2HG5A 1S78D 8FABA 1OSZA 3BDYL 1BD2E 4G6MH 4UU9A 1I9IL 3VE0B 1G1YA 4XMKL 3MR9A 3SDCB 5T1MB 3RP1A 4UT7H 1GOHA 4FNLL 4PPTA 3SEPA 1WBZB 4P5TA 4IMLA 3VRLE 3WEXA 4NQCE 2CLVA 5D7IE 3MV9E 5HI3D 1TVDA 1KIPB 3UC0H 4NWUH 1PY9A 2XWBB 5D93C 4KKNA 2MCPH 3EYFA 3ZLQC 5T1LA 1U8KA 4TN9A 4FQXD 1EO5A 4S1DC 3ZKXB 5EOCH 2XTJE 1BBJB 3VFWA 4KZDL 5KANG 2J5LB 2P1YA 5LQBH 3ARDA 2WUCH 1I85C 1QOKA 3NCJH 4P9ML 4HHAB 2L7UA 3ARPA 1F4HA 5H35B 2DQFB 1TENA 3NFNA 1KJ3H 5DHXB 3DO7B 2WMPA 2ED9A 3K2MC 4Y4KD 5C08D 3MV8D 4QY8A 2X4UA 4E5XB 5CIPB 3H3KA 4FQQB 1VFUA 4K8RH 4BSVA 4R3SB 4GKOA 3QZWG 2J8OA 4K7PY 1XZ0B 3VWJB 2B0SL 3RTQC 1INEH 4GKZB 3TNNB 1T7WA 3QEQA 4JN1H 3W0WA 1Z6JT 1BD2B 1G6RL 5C0NC 4CN6A 3U4AA 5E8NB 2HFTA 3G5ZB 2NTFB 3SGKC 1GZQA 5IF0A 3HG1E 2PO6C 3AREC 4LQFH 2JB5L 3H9SA 3V5KB 4PBVC 4WFFD 1BJMA 1OB1A 3ZKMC 5CP3H 1AC0A 3PWPA 1GCFA 4GUPB 4P46D 1MHHB 3OR7A 4PD4K 4F7MA 1U8JA 4WW2A 2BFVL 2AK4A 1AXTH 1WZKA 2ORBH 1XH3A 2NY6B 1LK3H 4X8XA 2ZWLT 2R0KH 3K81A 2V5SA 4MA1C 4PRID 1F00I 1WUNT 1Z5LA 5F70A 1GHFL 1FL5B 2ZUQC 1YA5A 4P2RB 3MJ9A 3ET9F 1TTGA 2LVCA 1G7JB 3V0AC 3GBLA 4D0BB 1M05B 2OK0L 4FQ1H 3AAZA 4CUCA 1IGIH 1UM6L 2JJSA 1Y6MR 3W2DH 3C5JA 1J88A 3FAWA 2F8OA 2ARJB 3OKDA 4OZFG 4FN0A 4PJFA 2IH1B 5E0QA 5B38B 5MI0B 4FABL 1MCKA 4OCRL 5HGBA 1X7QA 1NC4B 2JK5B 4G3YH 4V2CB 1CK0L 1AR1D 1O0VA 1NGYB 3K7UA 3MRJA 4YPGA 3CLFL 1DQTA 3QUMB 4G8FA 1G7QB 1FNSH 4K3JH 5DJ0A 4WUKH 4N0UA 3BD5A 3DVGB 2UY7A 1ORSA 4LKCB 4OBRA 3SBWC 1BEYH 3IJHA 5IOPB 3PHOA 4NWTL 1CS6A 2HFGL 3FN9A 3F12A 3K8MA 2X6MA 1UM5L 4OGZA 2X05A 3UMTA 1DEEA 1EEYA 4P3DA 4M6ML 5JO5B 1HCFX 5D7LD 2AI0H 1G7IB 3K0WA 1YMME 3FL7A 1U3HB 4ZXBB 4OCNC 2Y6SC 4R4BB 4UQ2B 5TE6H 1EERB 1Q94A 4JPKL 2V7NA 3W39B 3V79C 3RU8L 1ZTXL 3O6MH 2GIYA 4WO4D 1DBKH 1D5IL 1Q9KA 3BPNB 1Q9OB 3LMJH 4P57B 1UZ6F 2GAZB 4IRJA 3VXUA 3S3SA 1N6QH 2YPKB 2NY7H 4Z7NE 5MERB 2OTUA 5JOPE 1MCPL 3HUJA 1VFOA 2LTQC 3BX7C 5EA0L 4QXGH 1I8LA 4KK9D 3K2UL 5GRUH 1MUJA 3O6FA 5F7DA 3X17A 5I17A 1CD0A 3S8WA 1H3UA 1XCTB 3K8LA 1ZT1B 4HBQA 5FOJA 3T0WA 3Q5OA 2NY0C 3MRDB 1HXYA 3X12B 4FQ2H 3QB7C 1CGSH 2GJZB 4L9LC 4C56E 2NMSA 3EUUA 5E4IA 4LLUA 5H8DA 3V5HB 2D7TH 4R4FH 3KYOA 1QFPA 1AD0B 1NMCB 1WBYB 1RJZA 1KPRB 4RGOH 3L3KA 1FL3B 4HUWB 3CVHB 1MFNA 1MJUL 3GO1L 4PLKD 3NTCH 1KCVH 4TTDD 4HPYL 4X6DB 4LCIL 4OT1H 1BHGA 2X7LB 2VITB 5HI5D 1NFKA 1R5IA 5F9OL 2EDYA 2DQGH 2LFGA 1I1CA 4I9WE 1MNUL 3MJ7B 3SKOB 3L7EB 4TUKH 2YN3A 1T0NA 3HC4L 1RZJC 3G6JF 3NCBB 1ZV5A 35C8H 4PJ8A 5F71A 1P4LA 5ACLA 1BQHB 5K9JH 1X9QA 1AGDB 4MMZC 4YHIA 1DANT 3RUGF 2P8LB 2X70B 2Y07L 2BCKA 2OTPA 1MRCH 3ARGD 4C56B 3TIEB 4R6UA 1ZGLP 5TPWL 1N2RB 1YPZA 2PR4L 2Y5TB 3BGMB 1Y18B 3PIQB 4R96B 3LDBB 1D6VL 3VXNA 1FBIL 5GGUA 2DJSA 1F11A 4PJGF 4OLYH 4ZMAT 5F89B 4GW4B 4NC0B 5H2BA 3PP4L 3GKWL 4JRYA 3GK8L 3O45A 3I84A 4JJ5A 5FM5O 5IKCB 2R1YB 3MGTA 5EO0A 3TT3L 1RUQH 3FQXB 2FYYB 1I9JL 1NGQH 5IT2H 4PJHF 4L4VA 3MFGB 2R8SH 4LSDA 2VDOL 1XIWD 2E9WA 5JXEA 1JUFB 4PY8I 3VXSA 2E6PA 1ADQL 1U8MA 4LSSL 2IAND 1J11A 4OZFH 5HXMA 2P4AB 1JPFB 2A9NL 3IDXL 3QXDA 1MWAL 1CCZA 4XB8A 1ZLVH 2CJUH 2DOCA 3KLHD 4LSPL 3RA7H 3RL2B 5AZ2L 4LIQE 4CAGA 4ZUTA 1NLDL 2BXYA 3IXTB 2Z8SA 5FYKE 2QQLH 3DMMC 4U31A 5GJTL 2GSGB 3DX6B 3QIBD 4AIOA 5HD8C 3MRNB 1GYAA 3PQYD 5IFAL 1L4IA 3DX8A 4MNGB 1DBJL 1ORQA 4PRHA 2VXQH 5DJ2A 4WHTB 4HWNA 1AE6L 5ETUA 4ELKA 2ADJB 3ZSSA 1CFNA 4HK0B 4OGAC 1YC7A 4X7TA 3D2UD 5IVOA 2APVA 4UT6L 3GSUA 1KFAL 4L3EE 2Q8AH 1CT8A 4P2YA 3P9LA 3O8XD 4KRPC 1S7UA 4AK1A 4G80B 1WEJL 3D18A 3DUSA 2AJUH 1ODAA 5KVEH 3EYOB 5DO2C 3DV6A 5IBTH 1RU9L 4MQ7B 5FUCC 5D1ZA 5CAYB 2XRAH 1P4IL 4S10A 2PF6A 3FO0H 4ETQA 3MSPA 4XVTH 2P5WD 1YJDH 2R0ZL 3U0TA 2VQ1A 5EUOB 1TDQA 2J6EA 4W6YB 1A9EA 5IJVA 4YZFE 2H6PB 5I6XC 4F7EA 4RRPG 3IYLW 2G60L 2FX8L 2X1OA 1YYLL 3AXLB 3QWRD 1DL7H 5CP7B 5CCKH 4G6JH 5DSCB 4CNIB 1TQCB 4KAQH 5I1KH 4XP6H 5TE7L 3FQWB 5EO9A 3EJYD 3BPCB 3IS1X 4L8BB 4PJXE 1RUKL 1C12A 4HWZB 4LCYB 3OF6D 3B9VA 4R8WL 3JVGA 1IAMA 1CLYH 3WN5B 5ICXB 3QIUC 2BSTA 2NNAA 2P7TA 4Q6IB 5EIIA 5CEZL 2W07A 3EYQC 4TSAH 4R2GD 5B21A 1GGBL 5DMKB 4Z18A 4UINH 2DYPB 3DV4A 3AS1A 4AENB 3V6ZB 1QPPA 4CMMB 4S1DD 2X4QA 3UJTH 1A6WH 2VDNH 3TV3L 3TP4A 2BOBB 3GMLB 4YHOH 3WFBH 2ARWA 4O51A 4R26L 4RGNE 3SDDC 1KJ2B 4DCQB 3IXAA 3ROLA 4O5LL 2GKIA 4HS6A 4KJYB 1QACA 1XF3B 2NXZC 3OV6A 1BIIA 4KXZH 1IC4H 1WFOA 3O3BA 4JFEA 3VCLB 5E9DA 5AAWA 5DJZB 5FYJU 3GHEL 4NKDB 4LP4A 1CLZL 1QYGL 4YK4B 5DFWH 1QBML 2AGJH 3MRGB 5C0RL 3RTQD 2AJSH 3O4LE 1GPOH 1FIGH 1QNZL 4S0SD 4LEXL 4XHQA 3RGVD 5C0ND 3HR5B 3FJTA 4ZUWB 3O3AA 1L0QA 3A6CL 4G8GA 3ARED 3GSVB 3G5XB 2NY4B 5F7EH 3I85A 5ISZB 1UQSA 1RUMH 3F62A 3D69A 4P5TC 4FHBD 5JDJA 4IJ3C 4RFOH 3VI4E 2BSRB 1CQYA 1GZPA 3C9NA 4BH7B 4H1LA 3EW3B 4JJHA 3V0VB 2APWA 3BN3B 3WIFB 3PL6D 4G7YL 2YPLD 3TA3C 3GBNL 5I71C 3WS6C 2NXYB 5GS1B 4RGNB 4D3CL 1AKJA 1DQJA 2YS4A 1LHZA 1FL6B 1ZSDA 3EDDA 3MRLB 2XZZA 3WYRA 3BJLA 2BVOA 4U1MB 4APQB 3HFMH 3T2PA 4EOWL 4JLRA 1IMHC 3RIAF 3DSNA 3CFKB 3FQRB 1MVFA 4JVWA 3JV6B 4RMRA 3TYGH 3I6KA 1QBAA 3AU1B 1DN0B 3JUZA 2NY2D 4XP4H 4OF0A 1C5DB 2CXGA 2YD4A 1C16A 3GHBL 5DJAB 4I3GA 1A6VH 4P2QE 4NQVA 1GXEA 2XKSA 1J1PL 4OFKA 4OTXL 4Z7VE 4P9HL 4OCXL 1NMBH 1NMAL 2V5YA 4MQXC 4WHDA 3KDMA 1KLUB 4HSQA 1XGTB 4E41A 1QLFB 3OKOB 5CMAB 5HVWA 2WAHA 1QFWM 1KYOJ 5CBAB 1U8NA 4TSCH 2W59A 3QJFB 4QXWA 3ZYZA 1YY8B 4BQ6A 2OM5A 4C54A 5A2JH 3STZB 3VJ6B 3TBTA 1ES0A 5JHDD 1SJHA 3BDYH 4HKZB 3RKDC 1X5ZA 2Y6SD 1A6TB 5CEZD 1I9IH 4FS0A 4XMKH 3MO1B 4OD2A 2AK1H 8CGTA 4BJLA 1EEUA 1OARL 4NN5C 4FNLH 3NOIA 2GQHA 5BZWA 1KUMA 4N8CL 3SGJC 1D9KA 1JF1A 5IK3B 1RJYA 2BSSA 1X5XA 3GSXA 4MLSA 4ETYA 4RX4D 4P5MB 2JJTA 5TH2A 3S3JA 3KLSA 2P43B 3T0VA 4XVUC 1MJ7H 5IW1B 3B9KB 1NLBH 2X4TB 5F7MC 1SYVA 4P49A 3JWOL 5KVFL 4FTVB 1DBAH 1GH7A 4KZDH 1D5BA 1K3ZA 3LQMA 4Z0XA 2N1KA 5BW7A 3K3QA 2HLAA 3EO0B 4P9MH 2ZJSL 2BRRH 4ZG1A 3L3IB 1MAJA 3BP6A 3VU2A 2NY0D 4UMGA 4EI6A 5E4EB 1QP1A 4NUJA 1N3NA 4Q9BA 1M71B 4LHUA 3NH7L 5ALCH 1L7IL 3KGRA 4QOKE 4RDQF 3LKRB 4G5ZL 3U36A 5J9PA 1ZLSL 4JCMA 5D9SB 1M1SA 5E6IB 1G6RH 3CH1A 1UT9A 3FB8A 4HWBA 4HXAL 3T0EA 2Z31B 3ZDXE 3WS3B 2JB5H 3HUJF 3L1OH 3A6BH 1MJJA 3C8HA 3OX8B 5T1KD 4OFYA 7FABH 3BN9C 4OI7A 2HH0H 2BFVH 4TSBL 1QQDA 1UCBL 4AYFA 1J12A 3QIWD 4HJJL 2WIIB 4KVCL 5L0QB 5E5RB 4MQTB 1S7RB 5IHLB 1NQBA 1ETZB 5BS0A 1T21B 5BV7C 1CD1B 1I8LC 1Q0YL 3U46B 2D7QA 3MACL 4K94L 5DJCB 4PRDB 1S7SA 1I7TA 5HHXH 3LRHA 5E94A 2OK0H 1OGTB 5J11C 5DC0A 2C9AA 4PRBB 4PP1C 1UM6H 1OSPL 4I13B 5C0BE 2CLRA 4ODWB 1TJHL 4YXLH 4Y2DA 3P9MB 4K3EH 3BGFB 1NFDB 2AABL 3BKCL 1FZJA 3ULVE 3L5XL 1DANU 4QOKB 3VGGA 4DEPC 2QJDA 5SWZA 1GRWA 5CD5C 4FABH 1FC1A 4OCRH 4Y19D 1OAUH 4JY6B 3RJQB 1CK0H 4WJ5B 3CLFH 4DKEH 1N6UA 3EHBD 4OGYL 3DGCR 1J0JA 3L3GB 5FCUH 3PJSA 2FWOB 2YC1B 3PHQB 4Y7MA 3U30B 3RWFA 5FO8B 3QWOB 1UM5H 2ZUXA 4YQXL 2GSIB 4M6MH 1A2YB 1P9MA 2GJ6E 1A02N 4I2XE 4RA3A 4GAGH 3PWNA 4M6AA 2OMBA 3PWLA 3VXMD 1MCEA 4NQDE 4JPKH 4MJ5A 4PJ8C 3KPLB 4UBDD 1ZTXH 1X3DA 4ZDHA 3RVWD 4R7NA 5GJSL 5JW4N 4W68A 5SV4A 1FNEB 5KSVB 1I8IA 1OF2B 5L8LB 5C0BB 3HC0A 1MAML 4KWUA 3IDJA 2YD3A 4NNXB 3S88L 3F6IA 2PYEB 1I1AB 5L8JB 2G5BB 5EU6D 1R3HA 1MREL 2PXYD 1MCPH 1JWSA 3QQ3A 4NN6C 4OGAD 2WUBL 5IHUH 1UWGL 3K2UH 2W91A 4M7KL 3EJZD 2D3VA 1CDHA 2I07A 5C6TL 4CJ1A 1FVDB 5A2LH 5B39A 5DO2D 5IBLC 4P4KD 1H5BC 5K9KA 1A7NL 1BECA 3B3IA 1KNOB 3Q48A 1XR9B 2W9DH 4LVOC 4JPWH 1CLOH 3X11A 4NQCA 4ZUSB 4XWGL 2QADB 3TJEL 1MVUA 3EFFA 4Q9RL 3S35L 2RIKA 4OF3A 4J8RA 4GO6B 3VRIA 2XNAB 4OLZH 2ITCA 2VLJD 5JW4M 2M1KA 2FBJL 1VA9A 4NQTA 4RBPK 1MJUH 5D2NE 4QHKJ 2YA0A 2UWEF 5ITBL 4NQDB 3MUGA 3LKNA 2EIEA 1LEGB 5I75B 4LCIH 2XN9E 1EHNA 4LCWE 4XC3L 2VIRB 4I48B 5F9OH 2YD7A 4ZFZA 4HUVB 1MNUH 3QIUD 5IW6A 5I8CB 1IC7L 3B8SA 3ESVF 3EYQD 3HC4H 3EOBB 4DOHE 3MJ9L 1G9ML 4JN2A 3THML 3PGCA 5J7CC 4YDVB 5CUSH 1JL8A 5F1NB 1M6OB 3NABL 5DRXB 1TVBA 1MIEH 4KDWA 1XAUA 2Q3ZA 3HI6L 2ZOKB 3EO9L 2AS5M 2Y07H 3QUXB 3CNKA 4EUPG 1FFOA 5EU3A 1NAML 2VZTA 2IQ9L 4MMXC 1U91B 3CC5A 4QXTA 4XCCL 4BH8B 4JG0L 5CEXA 1FPTL 3N0PB 2PTTA 4G43B 3LKSB 4MZ2A 5KVMC 1T22B 1JZ2A 2NY5C 3ZKND 1D6VH 4PG2A 1FBIH 1HSAA 3IJSB 4E42A 3VFOB 3KPRA 3T65B 3MCKA 4HMCA 5D2NB 3ARYA 4WI3A 3PP4H 3GKWH 3GK8H 3LAFA 5IB3B 1IEAA 2NY3D 4EZMA 2XZAH 4V1DB 4PV9A 3MLZL 2RFXB 2HVJB 4KXZI 3WDJA 2VDOH 1ZLWH 1IEBB 4MXVE 5GS3A 2XA3A 2KDGA 3LPGA 3I9GL 5IMOA 1ERNA 4JE4B 5C8JB 1YEGL 3PWJB 4JFZH 4AM0A 4HC1H 2A9NH 3IDXH 4P5TD 1MWAH 1PVHA 4ZOAA 5KSUA 5KSAB 4DOHB 3U7YL 3FO9B 4LSPH 2PW1A 4JZNB 3WUWB 3O0RL 5AZ2H 3SKMB 1F45A 4ODXB 4YDKL 3QO1A 4FMKA 5D96B 3QUZA 5EPMA 5IR1B 2VRAA 5HHOE 5T1LD 3ULUF 3VMOA 1KXVC 5GJTH 5IVXE 1G84A 4OGXL 4A2LA 1FRGH 1T1YB 3KPNB 4EJ1C 1UB6B 3BXNA 5IFAH 5ILTL 3ARDD 3MJGX 1PBYA 1DBJH 5E8PA 4RIRA 4AT6B 4JCLA 3T4YA 5HYIA 4Z8FL 1A6UL 1Q9LA 3WE6B 3ULUC 3HI1A 4UT6H 4YDJB 1KFAH 4CADA 3DRTB 4LVNC 4X4YA 1YMMA 3AS2A 1WEJH 3IETA 4L29B 1KB9J 3U0WL 4NQUA 1FN4A 1FJ1A 3QEQD 3W0WD 4Z9KB 1LWRA 5C07B 1P4IH 4IIQB 4AIZB 4ISVB 2FIKA 4KJPC 4MQXD 4R7DB 4QYOB 5EZLB 1N8ZB 4KQ4L 3CMGA 3H9SD 2APBA 2QQNL 3PWPD 4PRPA 1YUHA 3HZKA 3NN8A 2G60H 2DM2A 4CMHB 3PE9A 1SEBA 5CHNA 5DJ6B 5JMOC 5C0JB 1DVFB 3EDKA 4YHKH 1JGDB 3E6FB 4GW1B 3EOTL 4QCIA 3HAEA 2R2BB 5CSBA 1LD9B 2XKNB 5TE7H 1JJUA 4G9FE 4HT1H 2AV7B 1RUKH 1WK0A 2ED8A 4X7EC 4N0RA 4UTAL 4R8WH 4HK3J 32C2B 4OB5H 1IILE 5CEZH 2B4CC 1S9WB 4M7ZB 5D7JA 3BZ4B 4PRNA 4EDWL 2R2CA 4Z7OF 4K07A 3MFFB 4YGVB 1HI6B 3BGAA 1U41A 2FO4A 4L3CB 5E00B 1U8QA 4LMQI 3D25B 3GMMB 4OIBA 1NL0L 2Y23A 5I74B 3TV3H 2VO5A 3RL1A 4PGBB 4LSRL 3OXRA 3QO0B 1TLKA 1MF2L 3C5ZA 3CFBB 4O5LH 1GVIA 2QBWA 3BIAX 1OQOA 2VAAA 5IQ7L 5FGBC 3ROOA 4AZ8A 3L95A 4PS4L 4A6YB 1U92B 2R29L 3QZWB 1X44A 3GHEH 3O3EB 1CLZH 2MMXA 2CDFA 1QBMH 3H9YA 4M1DL 1I4FB 5C0RH 4JDTL 5HHQA 3QP3A 3VXPA 1WWCA 1JHTA 1QNZH 3CPLA 5BMFL 3SY0A 4H25B 4Y4FA 1F6AA 3BP4B 3ETBF 4ZFOL 1CGTA 4DUXA 1IGJA 3A6CH 4YBHA 3ES6B 1TZHA 2IG2H 5IFJB 2R15A 3CJJA 1MH5B 4OZHB 3L9RB 1EO7A 4JFHE 2DBLH 2FEDC 3P73A 4JGJA 4NO0A 2Z4QA 1MLBB 4QF1A 4RQQA 3VWKB 3QG6B 5JORB 1UACL 1WC7A 4FXGB 1FFRA 4PJEE 5ESQB 2W60A 1KCRL 1FSKB 3QG7H 4IRJD 4OFDA 3VXUD 3QNZA 1I8KA 4Z76A 3GBNH 4ODUB 3DURA 4EVNA 4HPOH 2AJZA 3FAXA 3O6FD 5FA4A 5BW7C 1RZJH 5IHZA 1RQ5A 5GS0D 2CH8A 4OZFB 4EOWH 3SE3A 3TZVA 5L2KE 4EI5A 1UZ8B 2YBRA 3RWEA 4UUJA 3WBDA 2C7UA 1ZLUK 3TCLA 4UV4L 1VEMA 3QDJE 4PRAA 4LLYB 4GW5A 4JQVA 4U0RB 5J6HA 5SWQA 4YHLL 1RULL 3BMVA 3JSSA 1BJ8A 4QHNA 3RBSA 2VLMD 4YHZL 4OTXH 1QEWB 5GGSB 2DDQL 5DQJA 4F33A 4X4XA 4CGTA 2ZG1A 2ICEB 1NMAH 4ODVL 4PJ7A 5DRWB 4Y16B 1S9YA 1BAFH 2DRUA 4L4JA 3ARFB 2FJGB 5C9KA 1LEIB 2A6JA 1AD9A 3IKCB 4MNQA 5LGHH 1SYSB 3CFJA 3O11B 1JNHA 3E3QE 5C0CB 3D1MC 4OKVB 1KLFA 1QA9B 1H8OA 1AGFA 2DL2A 5IB2A 1D6EB 1PYWA 2IBBA 4NRYA 4BYHA 4JB9L 4XPFL 1WITA 4L3EA 2A73B 2AJYL 5EBWA 4M61A 1VEOA 3MROA 5DFTA 3S4SA 2OI9B 5C09B 4PJ8D 1RIVL 3WO3B 4DTGL 1OARH 3QDGA 5D4QA 4N8CH 2F58L 5F1IA 2CK2A 2DWEA 4X80L 4UNUA 1I3VA 5MEQA 2AEIT 1JFQL 2YR3A 1ZEAL 5CGMA 5EN2A 2VZVA 5IBUG 3QDJB 3T3ME 1T89A 5KSBE 4WVRA 3GJFA 4LNVA 3IDUA 3MV8E 3RPKA 4P99A 3L5WB 1SY6A 2YEZB 4MS8C 1ONQB 2ZJSH 2DKMA 5F9AC 1F13A 4JRYD 1CFSA 3P11L 3PWVB 1J8HA 4PJXA 1EXUB 5IBLD 1CR9H 1XGRA 1G9NC 5I1DB 3ULSA 4LOUC 1U8PA 2YMXL 3SDCC 1LVEA 2DQIH 3NH7H 4LHJB 4L4VD 1DLHB 3X3GL 1WF5A 5FAAA 5MEOA 5JXED 43C9A 3VXSD 1T04B 4KQ3H 4MJ6B 5DQ9A 3VGBA 4G5ZH 4WFFE 1U8IA 4X9FA 4XP1L 3P30L 4LFHD 4CVZA 1EJ6A 4JPIB 4HXAH 4FQXB 1KPVA 2GITB 1IGFL 3P9WB 4L4TE 1H3PL 2ZPKL 4CVWA 5D72L 3VFNB 2GUOA 4PYHA 1HHGB 3A0OA 4DVBB 4NRXA 2EYRA 3IGAB 2DD8L 5E8DL 1JP5A 5IVZA 3U2SA 3QJHA 4HJJH 2DWDB 1J1OL 5MHSD 4NFBA 4Y4KB 5C08B 4NT6B 2NW3B 2W92A 1U2HA 1P4BH 1WSST 3CZJA 1A4JA 4X5WB 4BFBD 3VRLF 3O4LA 4XPBL 1Q0YH 3L7FB 3VWJC 5D7IF 2VYRE 4M43H 3MACH 4DW2L 1RHHA 1F4XL 1UFUA 2IAMA 1MEXL 4QO1A 1OTSC 1MCDA 3WFEL 2R2HA 2QKIB 4PG9A 5T3XD 4H26B 3M1BA 5J89A 3AGVA 3N06B 5KZCD 2HVKB 4FOMA 2AABH 1LEKA 3S36X 3OR6A 1PSKH 5DMYA 4O2FA 4R4NC 3T77B 1KJMB 1FLRL 1N5AB 4KKAC 4CU6A 4P46B 4LMQE 4KI5D 2I9TB 1T83A 5F7NC 1NBYB 4RDQG 4PY8J 3T4AA 1NCAH 4PY7A 3L3JA 2XTJC 3V4VL 2UYLB 4W4OC 5D7LE 5I1CL 5IIEA 1R5WA 4NO5A 3B6SA 4PRIB 3ECBA 3UTQA 1AXSA 3MREA 3U4EB 1AP2A 4BZ2H 1MCQA 2W0PA 1I1FB 1UJ3A 3BISA 5IWLA 4YQXH 2FJFA 3OJ2C 3MTRA 5IROC 2GK0B 2VXTL 4MD4A 1JGVL 5ESAB 4MHHG 1UB5B 2EDRA 4ONOA 2F9BT 5MI0C 3GSQA 5ENWB 3OJDB 5CKGA 3FB7A 2CMRH 5F7YC 4JM4L 1D5ZB 5GJSH 4Z7VA 4HEME 1XGQA 1RZ7L 4AH2B 2AJXL 4XMPL 2GY5A 3ARVA 4HIIB 5KVDL 1MAMH 3W11C 3MC0A 1MCJA 1W72A 1TIUA 2W65B 1EHAA 3MRQB 3KYMB 2AQ2A 1RZKL 4B0MM 4QGYA 3ULUD 4JFED 4K23L 5E9DD 5F7FA 1ZOXA 4XCNB 1MCHA 4PG2C 3VFUB 4JZJB 3BYYA 4OZIE 1INDL 1WZMA 5C6TH 1CTOA 5F7HA 1FDLL 3FQTB 1U3HC 3BE1L 2K9UA 4Y1AE 4ZXBC 3LRSB 1A7NH 3V0WL 4HGWB 2IMNA 2ZOLA 2RCSH 4KJPD 3QXAB 2H32H 3TJEH 3S5LG 4Q9RH 3LY6A 4WO4B 2IH3B 5ADOL 3BKMH 5F7WC 1NCTA 1MFEL 5DTFB 4ZSOE 1RVFH 5GRXG 4O4YL 5ITBH 3VFGH 4XCFL 4KDTA 3G08B 2HP4A 5KVGL 4QRSA 4XC3H 1BBDL 2LE9A 5L9DL 4MVBC 3EOAA 4HIXH 4F2MA 3FFDB 1ZVYA 1AKJD 1S7VB 3IU3B 1FH5H 2MKWA 5CLWA 4NHCL 1IC7H 1H3GA 1AGEB 2GHWB 4XBPA 1KPUA 3MJ9H 1G9MH 3THMH 2H26B 3BH9B 2IALB 2A74A 2F5BL 2J1KA 5FXCH 1MCOL 1QBLH 1FGNL 4NO3B 1NMCC 4X6CA 1OOAA 2AXJA 4OZIB 2FX7L 2FGWL 3HI6H 3VXOA 4D0CA 2HJLB 3WFHB 1BM3H 1CVRA 1QBBA 5LGJA 4FFWD 1F4YH 2ICCA 1NCWH 4JG0H 4LLVA 3P77B 4Z7NF 1FPTH 5EOCJ 1RPQA 2WQRA 5D71L 4LLWB 3QRGL 3E6HA 3CK0L 4HJGA 4HIHB 1G0YR 3S96A 3BESR 4H88L 1KTRL 1X6LA 1S9KC 3GDBA 5GXBB 2NQCA 1HCVA 2FDBP 5DUBB 5BXFA 1RJLB 3ARBA 4FRWA 1K8DB 5CWSB 4ZSOB 2ZCLL 5HHPA 2C26A 2A6KB 3TWCL 3FT3B 3A67L 1BLNA 5BQ7A 1N59B 4NZUL 3KYNB 2DQEH 2WBJC 5L88H 3IFNL 1LQSR 4P5KB 4ZFGL 2EDJA 1G0DA 4LCCA 2QR0A 3TPKA 3UTTE 5EUKA 3WNMA 2EIZA 5INDB 3I9GH 2GJJA 3VW3H 3I75A 5F7LB 2FEDD 3IAQA 1NGXB 4OI8A 1D9KD 5T33L 4NKMA 4UDTB 3ARGB 1KB5L 3ELAT 2AV1A 5F3BA 2NR6D 3O0RH 3MRCB 4WHYH 5FUZL 4YDKH 3LDBC 2HN7A 3VH8A 4WU7A 5TQ0L 4X7SH 2VXSL 3G5VB 1EJOL 1IAIM 4OGXH 3ORJA 4XNZB 5ANME 1IGYA 4HWEL 2OR8A 5ILTH 2Y06H 4JO1L 5FUOL 2FO1A 4U1NA 3I02B 1EBAA 4NQSA 5FV2A 2EXYC 3MRBB 5JOFA 2AP2A 1A6UH 2M26A 2EICA 4RMUA 3S6CA 4GG6A 4YXHL 4ZD3L 1NDGA 1XIWB 4LHUD 4XXCC 4F58L 2R23A 1IGML 3TVMA 2GJ6A 2EH7L 4WENB 4I2XA 2VLKA 5EC2A 5C0GA 1MFAL 2NCMA 5GS0H 2VLRA 5BZDA 2AEWA 2IANB 2F74B 5IB4A 1B0GA 3INUL 4HUUA 3U0WH 4PJDA 5MEPA 2I25N 5EO1A 1MJ8L 3OB0H 5DYOB 3LS5L 3FOLA 5FKAB 3T0ED 4KJWC 3FO1A 1DQDL 1NJ9A 4KQ4H 3QIBB 3QCVL 5I8EB 5HVGB 1BQSA 2Y7QA 3PQYB 3JTTB 1VPOH 5F1KC 4A2MA 3MJ8A 1MI5E 4OFYD 4WV1B 4F3FB 2X10A 1YYML 4X6BB 1ZS8B 3AY4C 3Q3GB 5HGHB 3MXWL 2EC9T 4AEIL 3DX7B 3B2UC 2X4SB 4PJBA 4MA7L 3D2UB 5ANMB 5BS0D 5GRWA 3O8XB 1QFOA 2X9WA 4TUOA 5I0ZA 3O3DA 2ZSVA 1EUUA 1R24B 3QEUA 5HDQL 1X5JA 4NNPH 3FRUA 5I73B 1UA6L 5E8OA 1BWWA 3UTSE 1I7UB 3WNLA 4EDWH 4BK4A 2ZKHL 5LAXB 2G9HB 1KYOK 4OAWB 4Y2DD 2P5WB 5TF0A 1EEQA 3UYRL 4CN1A 3ALXA 4K7PX 5ICYB 3K8KA 4JKLA 1KACB 2FIRT 3GI8L 4J1UB 5SWZD 3Q5YA 4K3GA 5ADPH 4MS8D 2AJ3B 1MF2H 2XN9A 1AGBA 1NEZG 2X5PA 1TQCC 5BVPL 4LEOB 5IQ7H 2DLIA 3LS4H 4UB0L 1YEHL 2ZP0T 4H1LG 3MBEA 5ACZA 5JIIA 5EWIL 2OR9L 3CX5K 4M1DH 5JLZB 1NUFA 1S7XB 4Q6IC 2BNQE 4JDTH 1I7ZA 2WWKO 5FM8A 5JQ6L 4OBSA 4AMKL 1LK2B 5BMFH 4Y89A 5D93B 3VXRA 1CWVA 4GAJH 4WI5A 3RY5A 1BZ7B 5J3HD 3WL9A 1ZMYA 4YZFF 2IPTL 2GT9B 3MCLH 4MA3B 4Q7DA 1HYSC 4C55A 3RWHB 5GSRB 5BJTB 3PG2A 3TPUA 2I27N 4EDXA 1KCRH 5D8JH 4PJXF 3WCYA 3VXTA 1T89C 4X6EB 4YK4C 4XRCA 4BSWA 5FM5M 4D0DA 1FYTA 1KEML 3AS3A 1X5LA 3RTQB 4XGZA 1OTSD 3GSWB 1L6ZA 3EYVB 3L5HA 3BZFB 1ZHNA 4BQCA 2DIJA 3RGVB 3MYJA 1MWAB 2HTKC 3OBAA 4XCEA 4UV4H 5LXGL 3AREB 1KLGA 1QSEA 4YWGL 4M03A 4NQCD 1B0WA 3IJYB 3MV11 3O2VL 1RZIB 4YHLH 1RULH 1J5OL 4TUJA 4JANB 5HHOA 5T3XH 2D0GA 4YHZH 5EU4A 2X9YA 2NY5H 4XI5C 2DDQH 2AKRB 2CUMA 2XTJD 3NACL 4WTWA 4Y5XB 4BKLA 3ILQD 2F8XC 1MHCA 1F3DJ 4MA1B 4ODVH 4LLQB 4LSTL 5JHDE 2NXYC 5EDXA 2J6EH 2YPLB 5GS1C 2ZUQB 4RGNC 4BA8A 4WWID 5CEZE 4C59B 1BF8A 3GIZH 1Z3GL 3FT2B 3HLAB 4XBGB 1P6AB 3D9AL 4RMTA 1VADB 1Z2KA 4I18A 1XR8A 4APQC 4TTGA 1MIML 2Q87A 3QQNA 1JTPA 4TNVF 5A16B 1SQ2N 3PDGA 4ODHL 1NBZB 4U1JA 4JB9H 4TPRH 3BOVA 3AROA 4I3RH 3SQBA 3HNSL 4PJCA 2BNUA 2AEPH 1IBGL 1X5FA 1RIVH 2AEQL 2Q7YB 2V7HA 4KK8C 4DTGH 4X9IA 4XHJD 1RJCA 4LHUG 2X4OA 2NY2B 3VI4F 5A3IC 5JDSA 2YUZA 1K8IA 1AHWB 4XCYA 6FABL 5IG7A 1E6JL 3GSNA 1JFQH 1NAKL 1ZEAH 1M7XA 3VMPA 1JPGB 2X4NA 1AO7A 2AQ3A 2ATKA 4YEEA 4PP2A 3KPRD 1T1WB 1XF5B 4K9EC 5KN5A 5CSGA 4ZOEA 1W0WA 3UPRA 2MJWA 3ULUH 5FCSH 2XQBL 1WT5A 5JHDB 5GGQH 2YMXH 1HYRC 5E24E 1EIBA 3IFPB 15C8L 4LCUA 1MFCL 3N1FC 3SDXE 4OD1L 2XY2A 4LRIA 4MCYA 1GL4B 2GYSA 5I1AA 3FFCE 4Z7VF 5IWLC 4KUZL 3QI9A 4JHWL 4MX7A 3U0PA 1S9VB 1HH9A 2VSCA 3QUZD 4D9LL 3BRDA 5DHVB 1QLRA 3DROB 1AC6A 2LTQB 1LDPL 3ARTA 1ZGLB 4MVBD 1H3PH 2ZPKH 3CSYB 5CINL 3KJ6L 2KKQA 3X3FL 5MENA 1DE4B 4XVSL 4JDVA 3W9EB 2A83B 2D7PA 1BGXH 4RMWA 1OPGL 3U4BH 5E4EC 5E8DH 4H1LH 5KAQF 2NY0B 5MP6L 2DQJL 3VE0A 4Z7UE 3RWIA 5T1MA 1G9EA 5C0FB 2VISB 2MPAH 4EUPB 2V6HA 1A14L 4XPBH 4POUB 1FNGB 1YMMD 4JDZB 2NZ9C 4XPTL 2DLHA 3HS0B 3BQUA 3JBG7 3WFEH 1DN2A 3CD4A 1OWWA 1EGJA 3QULA 1HXMB 1BBJA 4YLQT 1GOFA 5E7BA 4PR5B 1A1NB 5T5NF 3QAZB 4X0KB 4ZAKA 3MBXL 4FXKA 3RNQB 4ZQKB 5KTEL 5FHAL 4PJEA 3VDAA 1UWXK 2DLFL 4K55A 4E0RB 4XB7A 5C92A 5H35A 3FHQA 3ILPA 4KVNL 5T1KB 1U8OA 1NDMA 2W1NA 3K1DA 3TO2A 1QR1A 3P0VH 1CLCA 3KPQB 5IGXL 3S97C 1LO5B 3D0LA 1FFNA 5I1CH 5I9QC 2VWEE 4JG1H 5E5MA 2IPKB 3OKNB 2WBJD 5L2JA 5FO9A 1KG0A 1ZT7B 3BKJL 3QA3A 1AIFB 1KIRA 4UTBH 5LGKA 1A47A 3LEXB 3QNXB 1I7RA 3TNNA 4QTIH 4ZPVB 5E03A 4N1CA 1HNFA 4EKXA 1A9BB 2C5DC 3I3BA 1Y0LB 1VERA 1ND0B 2V2TA 2PW2B 3L5JA 5E8NA 5D6DC 2NTFA 2F8VA 1O7SA 5D7JD 2VXTH 3G6JB 4MA8L 3ZDXF 1JGVH 4CVXB 1UADC 3K4ZA 3WKML 1N4XH 5B39G 2DM7A 2FBOJ 4XNYL 3V5KA 2C4FT 3FONB 1R3LA 5EU6E 4N9GA 4GUPA 2C1PB 4M93B 4WI7A 4LLDB 2BY1A 2ZUWA 3RUGB 2XZCL 4JM4H 3TJHC 4M1GL 1S5HB 1B0RB 2AJXH 4Y19B 4KHTL 4X98B 4XMPH 1DTUA 3C5ZD 1QKZL 5KVDH 1DSFL 2XG5A 2O61A 2CPCA 2R1WB 2OX5A 2E8ZA 3GSOB 3RDTA 4G8EB 4K23H 1J18A 1KN4L 1OP5H 4QRRE 1WBXB 1LO0L 4I9WD 5SX4H 4Q9QL 2ADGB 1T3FB 3GJEA 3QFDA 1INDH 1FDLH 3QXWA 5HJ3B 4Q58C 3HPJB 1T0PB 3V0WH 2H2SC 4FFZL 5H37G 2BOCA 4PJ9A 4PJHB 3VXMB 3ULVF 1CBVL 2GCYB 4Y4FD 1CDBA 1QSZA 4LCCC 4KJWD 4YHPA 3LKQB 2DI9A 2PYFB 1CE6A 4GG8B 1P5UA 3B83A 1K4DA 5ADOH 3TT1L 3GB7A 4NO0D 1TCMA 5CJBA 1MFEH 5DEFB 4GXVL 2I60H 3ULVC 4GAFB 4O4YH 1TCRA 3DVGA 3RPIA 4NDMB 3BD4A 1HEZB 4LKCA 5EU6B 5HYQB 4K71C 5KVGH 4NUGH 3B2UD 5I2IB 1BBDH 5L9DH 1KB9K 1MCCA 1NCDL 5GRVK 2DMBA 2VR9A 3JWNC 2H9GA 1D5MA 2LVEA 3LZFL 5FF6B 1YEEH 4XP9L 2EC9U 4HGKC 1KTLB 3GGWB 5DD6A 4UQ2A 1SBSL 3D3VA 2J88H 4PJDF 3TZVD 1ZA6A 4EI5D 1KTKE 2WM0A 4JFDE 4GRMB 1C5BL 3X13B 5GGVY 3JWDL 1FGNH 3O41A 5KS9A 2FGWH 3CFEA 4NPYB 1CFBA 3VGAB 5I6XB 2I9LB 5CBEA 2VLJB 5CILL 1CFVL 4YR6B 4Z6AT 5FYKD 1K6QL 4POYA 3DOSA 4L4TA 4F9LA 5LKNA 1XF2B 3FCTB 4XMLL 2XY1A 5D71H 1OWRM 5DVMA 1NGZA 1PQZA 2NX5A 4JR9L 3CK0H 5F7KC 5E7FA 4ZS6D 2Q8BL 4PJBF 3GMQB 4H88H 4MNQD 1B2WL 4LF3A 4TVPL 3R06B 4JPVL 3CSGA 3FQNB 3AMLA 4K8RC 2BMKA 4GRWH 5F21B 1WAAA 3EO1B 3QIUB 4NOBA 4JFYA 3UBXA 1VFAB 4NZUH 4L3ED 5BV7L 3LB6C 4DVRL 3IFNH 3F7VB 2XWJA 4KPHH 4ZFGH 2YD9A 5C70A 4C4KO 5JPMA 1QSVA 4RNRB 4BELD 1KPRA 1FL3A 1HYSD 4WFEE 1KXTB 3QDGD 4OLXL 2K3TA 2OL3A 2AXFB 1OL0A 3NFSL 5T33H 3FQUB 4X6DA 2NXZB 4WFHE 2YXFA 5FUZH 2CKBL 2HJFB 1I8MB 1RUPL 3NFPB 1F5WA 3IDGA 3CGTA 1OTUC 1NCUA 5D2NC 3HZMB 3QFJA 3OKEB 3HNVL 3KWWB 4HWEH 4JO1H 5JZ7D 4U1KB 4YUEL 1G7LB 2YWYA 2WWKT 5HPOA 2H1PL 5ITFB 1U3JA 3HI5H 3QEQE 3W0WE 2HG5B 8FABB 3QQ9C 1OSZB 1MOEA 3G5YA 4YXHH 3LQAL 1AGDA 4ZD3H 4UU9B 4F58H 3MR9B 2X70A 1UWEL 5JUEL 1Z9SA 2EH7H 3MBEC 1MFAH 3G6DH 3KXFA 3UTZA 3H9SE 4HD9A 2EXWD 4NCDA 4P5TB 3WEXB 3PWPE 2CLVB 4IJ3B 1QD0A 1N2RA 2VLLA 1Y18A 2OXHA 1HHHA 1IKNA 2AK4E 5FFLA 1I75A 3EYFB 3LS5H 5T1LB 1E4XL 4U05A 1U8KB 3AB0C 5DJYA 4GAYA 3MRFA 4Y88A 5I71B 1DQDH 2FJHA 3QCVH 3PUCA 5KG9A 5IKCA 3ARDB 5D1XA 1BVKB 5IMKA 3AS0A 4G8IA 4H0IA 4DGYL 2HTLC 1YYMH 5ACMA 1MHEA 3MXWH 3NFNB 1WWWX 2KUTA 1JUFA 1G6RA 3B5HA 4HMDA 1OLZA 4JREB 4MA7H 1HKLL 2WANA 4O02L 5DMIL 4QY8B 3BT2L 2X4UB 2DF3A 4JAMA 5IJKC 1FORL 4Y1AA 3O4LD 4WIQA 4PJFE 4BSVB 1RUAL 2EYTA 5A3ID 2IAMD 5IBUB 2QSCH 3SOBL 3QEQB 3W0WB 3RFZC 4IIQC 3GMOA 3IXTA 4N0FA 3WV0A 4DZBA 2R56H 3MRRA 1UA6H 1Q0XL 1DDHA 2ZKHH 2NY1D 5IVXF 3SE4C 3DX6A 2HYMA 4PLJC 3ARXA 3EFDL 1GZQB 3MNWA 1KBGL 5IF0B 5C0AB 4W6WB 3UYRH 4LP5A 1HQRA 1I9EA 4ZYKA 3H9SB 4MNGA 3GI8H 1WIUA 1AQDA 1OB1B 2A77L 3PWPB 1TQBB 4YBLB 2VUOA 5TDNB 3OR7B 5LBSH 1EHLL 1DVFC 4TVPD 4F7MB 1U8JB 4WW2B 1CDIA 3QHZL 5CGTA 4KKCC 3WLWD 4YHYC 1Z5LB 3TN0A 2UVFA 5CD3A 1QG3A 4UB0H 1CGVA 4PJCF 1WFTA 3BRFA 4NN5B 4QHUA 5EWIH 2OR9H 2DQTL 4IHOB 4I18C 3IF1B 4GRLC 1CIDA 1JGLL 1JHLL 3AAZB 3TBVA 5JQ6H 4AMKH 3VFRA 1OHQA 5F1SA 3VG0L 4I5BA 4IOFC 3C5JB 1JNLL 2ERJB 3HC3H 5TDOA 5J4MA 2NZIA 2DQUL 2YZ1A 3OKDB 3VXUE 5EUOA 1PJ9A 4PJFB 2QEJA 3UJIL 4P2QD 3KPOB 1KCSL 1JIBA 5HYSA 4Y4HC 5HGBB 1X7QB 1GGTA 4LU5L 4CNIA 4YPGB 3E2HB 3MRJB 3PGFL 4G8FB 1TVHA 3QUYA 4M4RA 1JZ3A 5DJ0B 5HDBE 4N0UB 4QKXB 4JZOA 4JFOA 1WCBA 2EE2A 3IJHB 2LU4A 3PHOB 3RX7A 3J8F7 1A1OB 4F7TA 3F12B 3RBGA 1KEMH 1B4JH 3P0YL 2D03L 4CN4A 1EEYB 2DYPA 3OL2A 3SO3B 2VLME 3UTTA 1JGEA 3V6ZA 2M8XA 3FKUS 5JW5A 7CGTA 1Q94B 4B53A 2V7NB 4YWGH 3VWKC 4DCQA 3O2VH 3S4SG 1FVEA 4KJYA 1Q9KB 2XYCA 3MLPA 3HE7A 3NACH 4IRJB 4OIIL 3V7AE 2M2DA 3P4NA 3RNKB 1U42A 4LSTH 1HZHL 2OTUB 2CIKA 3HUJB 3C2SA 4KTYA 3BKYL 1GGIL 1OGAE 1YECL 1U58A 1MUJB 1EAPB 1Z3GH 3O6FB 1CL7L 5C7XL 5D5MA 1TETL 4NJ9L 2DQHL 1MIMH 2X1XR 5J11B 4XWOD 4CDHA 3HAEH 4KUCF 2CK0L 3BWAB 4ODHH 2DQDL 3QDAA 3VXQA 5HYJB 1FP5A 3MQIA 3HNSH 5J1SC 3H42H 5FB8A 1IBGH 1YPZE 2AEQH 4LLUB 4U0RC 4G6AD 1A3RL 3LN4A 1Z0NA 5B4MC 3WNNA 4PJEF 3L6FA 1RJZB 5E6ZA 3L3KB 2ZCKH 2RBLA 4WTZG 5ERWA 2FECL 4BH7A 3IDMB 4WI6A 5C71A 2B1AL 4MSWA 6FABH 4JRYE 5FHBL 1NAKH 2C4FU 4Y16C 1SM3L 2Q1EA 2VZOA 1HHJA 4HMEA 3TBSA 4FQHA 1G7PB 5F9DC 1MI5A 2FZ3B 1AQKL 4WW1B 3BP7B 3S37X 3EGSA 1R5IB 3CMOH 5A2FA 2HRPL 4WDIA 4OCLC 3ARBD 4QRPE 2XQBH 3GFUA 2H2SD 5FA3A 15C8H 5I1JL 1SEQH 2CXKA 4PJ8B 3IB4A 5C6PB 1I3RA 4OD1H 1YJDC 3VD3A 2APTA 1J1XL 4YHIB 3UTSA 4ODSH 1RIUL 5SX4I 4KUZH 4QXUH 2BCKB 1H15B 4JHWH 2GY7B 5K33A 3ULVD 1KLUA 4PRHE 1QLFA 3OKOA 2AXGA 4D9LH 1YPZB 1ZGLM 2EECA 1OAXH 4U6VL 1RZ8A 2JELL 1FFPA 3VXNB 1T03L 5DZOA 5GGUB 5CINH 3TCXA 3X3FH 1F11B 4UQ3A 1T4KB 4NZJA 1ADQA 2E9JA 4XVSH 5FKPA 5H2BB 3AC0A 3V4UL 1PG7H 4L8SA 4JRYB 4WWKA 3VJ6A 3O45B 5BCAA 1FQ9C 4JJ5B 1S78C 5ID1A 3MGTB 5MP6H 3AFLA 5EO0B 2EIDA 2DQJH 3C2AL 3QXTA 3GMNA 3MO1A 4K7PL 3E3QC 4HUMB 3RDTC 4L4VB 5T3XE 5CGYC 2X40A 3VXSB 3IVKA 4OZ4B 2GJ6D 5CEYB 1U8MB 4JHAL 3OAUL 2MHAA 2YD1A 5HI3C 4Z5RA 2VLRD 4XPTH 1T0MA 4KI5E 5CJXA 3QXDB 1A7RL 3T3MF 1N7ML 3VRJA 3TYFB 5KSBF 2Z0BA 3RVXD 4FQXC 1UENA 1WTGT 4RFNB 4PJ9C 1HHIA 4ZUTB 1PKOA 1JRHL 3MBXH 3M45A 5KTEH 4ONHA 5E08L 3NIFE 4PGJA 4EXPX 4Z7WA 2DLFH 4K8RD 5D1QA 2O5XH 3UX9B 1GC1L 3DX8B 1A8JH 1ORQB 1U95A 3VFSB 5T5FL 1MRDL 2OQJB 5ETUB 4ELKB 2FRGP 2HJKA 2EIBA 1CFNB 5DXWA 3RX5A 3FT4A 2EYSA 5HGDA 2F53E 1A6PA 1B6DA 1HOCB 2KQMA 1CT8B 1RMFL 4H20L 2DKUA 3D18B 2LAGB 3DUSB 1FO0A 4IMKA 5E6IA 2D9QB 3DV6B 3WXWL 4MA8H 4M48L 5KAQG 2D7NA 4HXBH 3WS3A 3WKMH 5KZCB 2XIDA 5FGCE 4XNYH 4ETQB 5EOTA 5E9DE 4ZODA 3U0TB 4IOIA 4P46C 2VQ1B 5EOQL 3OX8A 4UOJA 5AZEL 2XZCH 3KR3L 1B4RA 1A9EB 5IJVB 2EKSA 4F7EB 3KPSA 3GSNL 4KHTH 3TLRA 1QKZH 2XN9D 1DSFH 1GOGA 3BSZL 3GJFH 4F9LC 1BMGA 1P5VA 2MFNA 3QQ9D 3O2WL 4JRXA 3W81A 12E8L 1KN4H 5EO9B 4C4KT 5ABDE 4RFEB 1LO0H 1C12B 4G8GE 4Q9QH 5T5NG 5L7XL 4FG6D 3MBED 5JR1H 4CJ0A 3V6FB 4PRBA 5TF1L 1CGUA 4L1DA 5EZIL 1N64L 2NNAB 2P7TB 1I1RA 5F6IC 1XF4A 4NCC2 4FFZH 3CSPA 4RZCA 3DV4B 1T5WB 4LBEA 2X4QB 3HRZA 3RWGA 4R97C 2IBGA 3V6OA 3HCVA 3GI9L 3AMKA 3TESA 5EBLB 1BFOA 1DQLL 1AR1C 4O51B 4DKFL 2YA2A 4MB3A 3IXAB 3ROLB 3S34L 4N1EA 1DBBH 4HS6B 2HTLD 4GXVH 4U1HB 1BIIB 5FGCB 3O3BB 5DWUH 1QFWL 1U6AH 2YC1A 4JFEB 1EV2E 5E9DB 5ID0A 4JZJC 4UIMB 4R0LA 2F54B 1QO3A 5IEKA 3EYSL 3SKJL 5FO8A 4LVNB 2GSIA 1FYTD 1FZKA 3RWCA 4XP9H 3TH2T 4MXQD 1SBSH 3SDXA 3E8UL 2X1QA 4GBXA 3QDMA 5DJDB 1FG2B 3KYKL 3MUZ1 4PLJD 1C5BH 3LN5A 4LPVA 3O3AB 3REWA 2D31A 3GNMH 2Z35B 3JWDH 4WO4C 2DTML 1WQVT 4E41E 1UQSB 3D69B 1IC5H 4ZNEA 4QWWC 1I1AA 5CILH 1PD6A 1CFVH 5HHOD 2DAVA 1K6QH 1GZPB 3C9NB 4XMLH 4YHMH 4H1LB 4BFIB 5DUPL 2Q8BH 2X44D 3DUUB 4K9EH 4OZIF 1B2WH 4J6RH 4TVPH 3VH8G 4HS8L 1AKJB 1DQJB 1FVDA 1O5DT 4PGEA 1ZSDB 5IB5A 4KZEL 4JY5L 2BVOB 5B8CA 4URTB 4IOFD 4PB0L 4LARL 4DVRH 1JZ4A 4JLRB 4Q2ZA 3D6GA 5CZKA 1YN6A 2NW2A 2CKNA 2IPUG 4LSVL 3I6KB 2JCCE 1LMKA 5E1AB 3U7WH 5DD0H 2E7HA 4OLXH 1J0ZA 4LK4A 4PLKC 4Y4HD 4TTDC 2SEBA 1C16B 3DYOA 1A7PL 1LDSA 3NFSH 3VA6A 3F5WA 5E8EA 4NQVB 5HSFA 3QQ4A 4ONGL 4X4MA 3RRQA 5JW3L 2VIRA 5HI5C 1H8NA 1YDPA 4P23A 3WIHL 2VDML 1RUPH 5D7SL 4GQ9H 1PKQA 1AO7D 4F7PA 5D2LA 1DBML 1MCFA 3EBAA 1CQKA 3P0GB 1S5IL 3HNVH 1U8NB 3HZVB 4JQIL 1W72H 4YUEH 3V52L 1URLA 2H1PH 2A6DA 4YDVA 4HKBA 3BYTA 1ITCA 3TBTB 2MWCA 1SJHB 5DRXA 3BIKA 3LQAH 4M6NL 5DFVC 4LASL 2R9HC 4BK5A 1LE9A 2PTUA 4DZ8B 4ERSL 1UWEH 3T0EE 5JUEH 5CZXC 2NPLX 1E4KA 3U7AA 1KCLA 1T1XA 1KIQB 4U6HA 1F8TL 5BZWB 1D9KB 1JF1B 1RJYB 2GK2A 5C3TA 2BSSB 3GSXB 3QI9D 5KOMC 4G43A 3TGXA 2W9LA 1T22A 5TH2B 3OGCA 1WV7T 3IJSA 1E4XH 4LGRB 4FQCL 2MQ0A 3DTXA 1SYVB 1MCIA 1O7VA 4W81A 1D5BB 4NM4L 4Z0XB 5BS0E 4XPGL 1LNUA 2HLAB 2VSDA 4V1DA 4DGYH 3DX9B 5F8RC 3BP6B 3G6AA 2HVJA 4QRRA 4PV8A 4EI6B 3DYPA 4WY7L 1XIWC 3QUYC 1N3NB 1Q9WA 4NUJB 1DQML 4LHUB 5HDLA 4O02H 5DMIH 1TPXC 5C8JA 1MHPL 1HSBA 2FGZA 3LV3B 3RKPA 3EDJA 5KSAA 3KLHC 5SWZE 3U36B 2EEBA 2L7JA 1IL1A 3SOBH 5I30H 4U1SB 3BQUD 5IR1A 5DVKA 4F80A 3CH1B 4GRWE 4JVPA 3FB8B 4JFHD 3EFDH 1T1YA 1K3IA 3QIBC 3T0EB 2Y4SA 4ZAKD 3KPMA 5EORL 4RCAA 4OIAA 4WEBL 1YY9D 2A77H 3ZHKA 4YIQA 5AEAA 3RVTD 5IEHA 1EEZA 3R1GL 5M94B 4HV8A 1EHLH 1S9XB 3UAJD 1L6XA 4YE4L 1KN2L 4U2YA 1VKXA 3MODH 4JFQA 4X8JA 2ICWA 1ZLVK 3RJDA 4F9PA 3SDYL 3DHJA 2BDNH 3O8XC 4L8CB 5BS0B 3DRQA 5HGAA 3QPXL 1S7SB 1I7TB 5DJXA 1S8DA 3D0VA 4BUHA 5JTWA 1YQ2A 5C07A 1HK6A 4ODBD 3VG0H 4D9QE 1J7VR 2CLRB 5IMLA 2JJUA 1JNLH 4QYOA 4DN3H 4KMQA 2DQUH 3CVHL 4XX1E 4DK6A 1FZJB 4HKJA 2OL3L 5ESVA 4NHUA 1KCSH 2XQYG 3ULVH 5FECB 5C0JA 1U2CA 3FMGH 5J56B 1Q1JL 2OSLA 4BFGA 5DMGD 2B7DT 4WEMB 3MXVL 3PGFH 2DLEA 4GRWB 5GGRA 3EJYC 4L1HA 3H6JA 4Y2OA 1QFUH 3RDTD 3PJSB 5CGYD 1J0KA 3JV4B 2FD6L 1ZVSA 3RWFB 3U6RA 3MGAA 3P0YH 4PJAA 4HKXA 4OF8A 3BZ4A 4R2GC 1MLCA 3CXDH 4ORGA 1MRFL 3ARZA 3MFFA 4P4RA 2QSVA 3PWNB 5E00A 5E2VL 3PWLB 4PJ9D 1KT2B 5C0IA 4MJ5B 4RISL 3U9PL 4LPYA 3QO0A 3B43A 4ZDHB 4R7NB 3CFBA 2V17L 2VAJA 3OKKB 4DGIL 5F93C 4S1RL 2VZSA 4KV5E 3IDJB 4I4WA 3BP5A 4A6YA 1U92A 3QZWA 3H7BB 4OIIH 2WQ8A 1NCCH 3LEVH 3NAAH 3BEWA 3O3EA 3QBTB 5DHYB 1PZ5A 2H8PA 3QQ3B 1JWSB 2H32A 3CDGA 4WFGD 3BKYH 4FQIL 1GGIH 1JV5B 5C7XH 1RFDL 4NJ9H 2DQHH 1CFQA 2I07B 4HZAA 4KKLD 3RGVC 4L8SC 3BEVA 2CK0H 5B39B 2DQDH 3OKLA 3D3VD 5JA9A 1TZIB 3ES6A 1A7QL 1JK8A 3MLSL 3B3IB 1V7MH 5TFSL 5GPRA 2LU7A 4HW6A 4OZHA 5EIVA 3X11B 4NQCB 5D7IB 1BVZA 5JORA 5FK9A 3MV9B 5E5UB 1A3RH 1MVUB 3EFFB 5DURD 4FXGA 4HZLA 4MAUL 5ESQA 3VRIB 3KPRE 3DBXB 5GRYA 4Y5XC 5CJXC 1WTLA 3QR2A 2B1AH 2XTJB 3D5OF 3WDIA 4L4TD 4LQ1A 4DQOL 3LKNB 3PL6C 1SJVA 4ODUA 1SM3H 2FH6A 1EBPA 5DK3A 2NX5D 4U1IA 5JIHA 2WBKA 4I0PA 1MQKH 3H2WA 3BO8A 4FZ8L 4ZFZB 5FYJL 3D48R 2HRPH 2J4WL 3IRZA 4NCC1 1NAMA 1ZKAA 5IW6B 3QCTL 1JWMA 1V05A 2RJMA 3NA9L 5B3NA 2XI9A 1F97A 2F15A 4JN2B 1JPST 3PGCB 5I1JH 4AEHL 1PAMA 3PNWA 1IM3B 1R0AL 2NY2C 4UIKL 1TVBB 5D6CA 1J1XH 3CVIL 4RGMB 1RIUH 2R4RH 1AHWC 1FFOB 1FAIL 1E4WH 2BNRE 3HG1B 3LKPB 4MDIA 4QXTB 5JHLL 3UJJL 2PTTB 4OJFL 1D3CA 1TNNA 3AM8C 5DD5H 1SYSA 4M9PA 2OLDA 1UYWL 1DJSA 1HSAB 4HIJA 4E42B 3KPRB 1D6EA 2OCFD 3N1GC 3MCKB 3QFJD 5FGSA 1AI1L 4JFPA 4OUUA 3V4UH 1XGUA 3H3PL 1ZHLA 4XNQA 1IEAB 3C2AH 2I26N 1AXIB 2R0WL