4P2RB

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
171
Chain Sequence
SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVYTCQVEHPSLTDPVTVEWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 171
sequence length 187
chains with identical sequence G, L, Q
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rB01
4M6OL 4YQXH 3HMWL 2UWEB 4HDIB 5T1DL 3LS4L 1OAZH 4GAGL 4P2OD 1V7NL 4JM4H 2D31B 5SWZD 4KRMB 5EO1B 4ZD3H 1MCLA 4UDTA 5BS0D 1NBVL 2X4UB 5HYSB 1WIPA 2CLZB 4U2ZA 2KZ1B 3WIHA 1C5BL 5MHSD 2G60H 3VA2C 2NY3B 4JFQA 5I1KH 3OZ9L 4JR9H 5DJ2A 4DUWA 3U0PA 1BGXH 1BOGA 2B4CL 5E9DB 2CH8A 4G9FD 1FVDB 1ZA3A 5DQDL 2AK4D 4I2XE 5HDQL 2DQTH 4NN7C 3MZTA 4KK6C 3T65B 1RULL 4PGCA 3L9RB 1RK0B 3C60A 1QO3A 1A7PL 4ZUUA 1YYLL 3BAEL 4L3EE 1KV3A 5F7LB 1H3GA 2AJVL 3VWKB 4HUUA 3V6ZA 4LSVL 1BIHA 4XHJD 4Y5VB 3RZCD 4UU9A 3SCMA 5DJXB 2QSTA 1MFAH 4NM4L 4DZ8B 3DNKA 4JY5H 5JR1L 4KVCL 4M6ML 4RWYH 3RTQA 1ZHLB 4TSBH 4XBEL 5TPWH 4E41B 4RRPG 4EUPG 2NY6B 1WTGT 1CD1B 2FWOB 3MMEA 1DQML 3BKCL 4Y8DC 1BVKA 2DIJA 4F58H 5EU5A 3W9EA 1KB5A 3KPRA 3B83A 1T0MA 3CFKA 1BBJA 1T7YA 3V2AR 1FQ9C 4BH7A 3MROA 3P77B 4P4RA 1PFCA 3GMPB 4MMXC 1KXVC 2HT2D 3GMMA 3KR3H 5C07B 3FB5A 2W60B 2WV3A 4YNYB 1MFDH 3SO5A 1S3KL 3RZCC 2R8SL 3MRFA 4P3WA 1IT9L 4AK1A 1BF8A 2P43B 4TYUA 1YMMD 4WCYL 4KUZL 1NAMH 4NT6A 5C3TA 3VGBA 4N8CH 4YLQT 5L2KA 1KPUA 4O58H 4PRNB 4GXVL 1J05B 4X7SH 5JPMA 2FBJH 3H9SA 3FCTB 2APVA 4ZO6A 3ZYJA 1T5XA 3MJ7B 4U6VH 4GW1B 1LVEA 5LJYH 3WS3B 2O93L 3H42H 4NZUH 5E7BA 1MY7A 4O5LH 4APQB 2VUYA 2NX5E 4M1DH 4NZTH 1PG7X 1FRGH 3I6GB 1OOAA 5JXEC 4FQPA 1KELH 3PDOB 4JM2A 5EO0B 3GEWB 1WITA 2QHRL 5EU6D 1VGKA 3BP6B 1JN6A 5TE6L 1HXYB 2HKFL 1FYHB 4XB8A 3AREB 3W2DL 3FMGH 3VXQA 2J4WH 5CSBA 4KUCD 4Z7WE 4MNQE 3L95B 1FO0A 1F8TL 2IAMB 4ZFOA 1BQHG 3ZE1F 3CVIL 3ARFB 4P2CG 1LNUA 4G43A 1E4KA 4XBGB 5EOCL 3V8CA 4NOBA 2B20A 3VRJA 4M93B 5B39G 5IVXE 1SYVB 4M1GH 5HGBA 2F15A 1A7NH 1P5VA 2FL5A 1HH9B 2V7NB 4TUJA 5BOPA 4P3CL 1E4JA 1KTLA 4OF3A 3VXSE 4C54A 5F44A 3GNMH 4PR5A 4KQ4L 1FYTE 1OM3L 2EO9A 5E2VL 4RCAA 5GSVA 5D96B 4XBPB 4BZ1H 3D0VA 1FP5A 3LSOB 1KB5L 1SJHB 3OKYA 4X6CB 1QFUH 1YEDB 2J5LB 4LVNC 3GSUB 32C2B 3I9GH 2MQ0A 4PGEB 4PRAB 3T0ED 1MHHB 2P7TB 3L3OA 1N6QL 3CPLB 1QA9A 3UTQA 1OGAB 4OM1H 4P59L 1E6JH 1E4WL 4I1NB 5D1QD 4O00A 5CCKL 1UM5L 4FFYH 5HHOD 3RKDC 1IZJA 2HG5B 4HLZG 1LK3L 4HBQA 2YK1L 2VOTA 1BD2D 1RIVL 4QTHB 4NKIH 1UM4L 1YECH 1KLUA 3ECBA 5K9JH 4UDTB 1PKOA 1HNFA 5EUOE 2VL4A 3BRGC 5C0NC 3EYUL 4AEHH 1NKRA 1MFEL 2R56L 4KKBD 1IAOB 4Y16A 2CKNA 1IGJA 3EZJB 2EKSA 3U0PB 2ZG1A 1A5FH 3PIQA 5JORB 3FQUA 2FB4L 3HNVH 5AAWA 4P4KC 3NN8A 3WXVL 3VGHA 5CEXA 2G75B 4PGCB 4W68A 2VDLL 1QO3B 4YHYB 1FGVL 3MRGA 4WW2A 5I1HH 4JVWA 2ZUXA 1GIGL 4HUUB 3MPCA 3V6ZB 2OSLA 4LAQH 4OF5A 4LVHC 2AP2A 4UU9B 3SCMB 3MCLH 3BRFA 1PQZB 2A0LC 2EE9A 2JCCA 1FO0L 3RTQB 3FAWA 3PP4L 2VXUH 2YD5A 3VD9A 4HS8L 5GGRY 3FQWA 5IEKA 2E7HA 1RJCA 3MMEB 1SBSL 3UTTA 4B53A 1BVKB 4KKBC 1NGYA 5BO1H 5IEHA 1S9KC 5DWUH 1H3VA 5EU5B 3W9EB 1KB5B 1A9BB 3KPRB 4F7PB 1T0MB 3DHJA 3CFKB 1BBJB 5C71A 5E6IA 2DLTA 3MROB 4P4RB 4WY7H 5IB5A 2H45A 5LCVH 3FB5B 4XPFL 1WVZA 1PX3A 1OT2A 3TT3H 4BELD 1N0LA 5CFHA 2CDFA 2IMMA 4XNYH 3MRFB 2F54E 3KYKL 4M7ZC 4GAFB 4Y2DD 3QXAA 4MXVE 5D6DA 1JTPA 1KJMA 2WWKO 4J3OC 4NT6B 5L2KB 1D5IL 2VR5A 1KPUB 2N4IA 5JPMB 2NY3D 1MFCH 2IALA 3QIWD 3QXTA 4GH7B 3TZVC 1L7TH 3RDTC 4MA3A 3BQUA 1NMBL 1QG3A 2PF6A 3G6DH 3OB0H 5CZXD 4LEXH 1BZ9A 5IWLA 4D3CL 4JG0L 1NLDH 3FJTA 4C57C 2BCKA 5ICZB 4JFZL 5HDLA 4LOUD 4PJXA 1FNSL 1G7MA 3MJ6A 4ZQKB 2R39A 3QXDA 5AWNH 3VWKD 5E94A 3ZKND 1M7XA 1Q72H 1VGKB 2C3WA 2VR4A 5FYLE 1D9KD 1JN6B 4GAJL 5DA0B 4QXWA 3BW9A 4BYHA 3ULVL 2GT9A 3OPZH 3U30C 2NY6D 2IPKA 4Z0XA 2PW2A 5DMYA 5EWIH 1RMFL 4ZFOB 3EFDH 3SQOH 1JZ2A 2DQUL 4UV4H 3FRPA 5DD1H 1LNUB 3HMXH 3IDIB 2X1XR 4G43B 4DAGL 2D2OA 5CZXC 2BHZA 5HGBB 2ENYA 2X44D 5MENA 5GS2D 5J11B 4G3YH 2J8UF 4XX1E 4OZHE 1NEZB 4PR5B 4HKBB 2E6QA 5DR5H 1CICB 4Q0XH 4GKOA 3V5HA 2VDRH 3OAZK 2APXA 2X9WA 4AL8L 3VXRB 3NCYP 1I3RA 1OHQA 5C7XH 1JI2A 5SWSD 5HI3C 4LQFL 3DWTA 4OIBA 3L3OB 4LKCA 2QSCL 1QA9B 3LQAL 1Q9LB 4YGVB 2A74B 3DV4A 3O2WH 5EU4A 2DBLL 2XYCA 3BEWA 4UOW0 3GSVA 3FFCB 2DJ4A 5IBUG 3FO2B 2NCMA 1OWWA 2PKDA 2JE8A 1FFPA 3T2PA 3WUZA 4S1QL 1FG2A 1LE5B 1IC5L 5EZLA 1KLUB 3ECBB 3SJVA 3OB0K 1OAYH 1I7RA 3U9PL 4J3WA 2FH8A 1NGQL 4I2XA 1HXMA 2X1QA 3IDXH 4H0GA 1QLFA 4MA8L 1P7HL 1GGBH 3EYFA 4L3EA 1U8JA 1IGJB 2DMBA 3RVVD 4TRPL 2CLVA 2EDKA 3PIQB 5BQ7A 3FQUB 5BV7L 1KIRA 4IJ3C 3W0WD 4KK8C 2DQJL 3KJ4C 3NN8B 3A6CL 5CEXB 8FABA 2VDOH 4D0DA 3CU7A 1CF8H 4YK4C 4WW2B 4OGZA 1CBVH 2OSLB 1LO0L 3U9UB 1U42A 1JGEA 4WWKA 5DD6A 2JCCB 4HULB 3HAEA 5F7FA 3ARRA 3L3IA 1CL7L 1NCAL 4PFEA 5I30H 3TC9A 2I5YL 5B3JF 5L0QC 4KTYA 1HKLL 3FQWB 4ELMF 2A77H 5CLWA 3UTTB 1NGYB 5HHVL 5IEHB 1JRHI 3IDYC 3RVVC 4Y4HC 5A3IC 5FB8B 2VZUA 4FQCH 1KT2B 1YJDC 2JB5H 2YA2A 4I3RH 5IB5B 4HHAA 1T2QL 1ES0A 5HI4D 5TFSL 4KDTC 1R5VA 2X89A 3D6GA 3NH7L 4PJEA 1PVHA 4LP5A 1WCBB 4JCLA 2CDFB 2NXZB 5CP3H 1JGVL 2YPLE 2DS4A 1ZMYA 3WIFA 1YEHL 1KJMB 4KC3B 4PS4L 2VQ1A 1CI5A 1GAFL 3BD4A 3VXMB 3C5JA 3DVGA 3WYRA 1M1SA 1JWMA 4YHOL 3TN0B 5IF0A 4M62L 1D5XB 4ZAKA 2R4SL 1W0WA 3TEUA 1BQLL 1BJ8A 1K4DA 4MA3B 3BQUB 3VW3H 5DGRA 5D7JD 4YHZL 2E7MA 5HGHA 4X6DF 1EX0A 4L29A 4UINH 5HYFA 4PJGE 4ALAH 5CGYC 3RNKB 3C8DA 3V5DB 2BCKB 2FEEL 3C60D 5DYOB 2AGJL 4PLOB 2Y6SC 5BV7B 1G7MB 4JB9H 2DL2A 2V17H 4NKMA 4Z7WA 5E94B 4MNQA 1R3HA 3GJFK 3TFKD 1TZGH 1KXTB 5K93A 4U6HA 3BPLB 1TIUA 1Q9OB 4UILL 4Z7UE 3E3QC 1DL7L 3RTQD 1WICA 3BW9B 5T3ZH 1NCNA 4P46A 4Z0XB 3QULA 3G5YB 3N0PB 4OKDA 4PUBH 4RGMC 2WBJC 2DMCA 3SDDB 3UTZA 1IEHA 1YEJH 1QSEB 5CS7A 2X9XA 3OKOA 3V6FB 2FGWH 5D7JC 4F3FA 3C6SA 3HC3H 4Z76A 3VFGL 2D03L 3BIAX 1G6VK 1U8NA 1RY7B 4LNRA 5C6TL 4LLQA 4PB9L 4CKVX 5MENB 1KB9J 5DD5L 2D4DA 4S1SL 3PWPE 5GISH 5D7IF 1VB9A 3TFKC 3SBWC 3U7YH 4EN3A 2QJDA 3RU8L 3LKNA 4LGSB 4JDZA 5L2KD 4EKXA 1A8JH 3AS0A 3WHE1 1QLEH 5F21B 1HN1A 1MJ7L 3QO1A 4YO0A 4G6MH 3NMEA 4K7PX 3SOBL 3H9SD 1AR2A 4XI5C 4CJ0A 4OUOA 2GUOA 2K7QA 4PLJC 3LEVH 3OQ3B 4K7PY 4P3DA 2IJ0C 1JGUH 4XTRD 5EORL 3DV4B 4GBXA 5EU4B 1Y6MR 2NQCA 3BEWB 5EUOA 3GSVB 1BX2A 1VFOA 4P5MA 1NC2A 3V4UL 1FFPB 4JM2D 1QFWM 3BMWA 2ERJB 2NY4C 1NMAH 5EZLB 2EH7L 5DJ0A 3SJVB 1JHTB 3FL7A 3TVMB 4NZJA 3QUXD 2WIIA 1I9RL 4NM8H 4RGNC 5EA0L 1X5JA 3HE6A 2AAVA 1EVUA 1QLFB 4JHWH 5F7KC 3EYFB 1U8JB 1T5WA 1JFQH 3O6KH 1DBBH 1AXTH 4PD4J 4TSCH 4WFGE 4LU5H 5BQ7B 4PJDE 4PTUB 4H88H 5CEYA 4D0CA 1A6PA 4RWHA 1VENA 4XTRC 3RWJA 4MD5A 4X6BB 2BXZA 4D0DB 1ZT1A 4WEBH 5C6PB 1MY5A 5M95B 4GXUM 3BPOC 5AYQA 5FV1L 2J88L 4TUOA 3V0WL 4U7MA 5I76A 4LCIL 5I1IL 5DD6B 3Q5TA 3HUJF 4FABH 4Q9QL 4LSDA 3L3IB 5ALCL 3VXUB 1G7IA 1LGVA 1A4KA 4K94L 3QJFA 3N50A 2ICWA 4K3DL 4WIQA 3IFNL 2OTPA 4RAVA 1UM6H 5EIQA 4AG4L 4HHAB 1ES0B 4PV8B 4WEMB 4PJEB 4XPHL 1JK8A 3VH8G 4B41A 1ZT4A 3BIBX 5J0BA 5FYJL 5K9QG 3EHBC 1J1XL 3MRMA 5F8RC 4KKAD 2VLKE 2OK0H 2VQ1B 1U8KB 3C5JB 3DVGB 5IF0B 3T09A 4ZAKB 4KZDH 4Y16D 3BZ4B 1W0WB 5J06A 3ULVD 3HTLX 2E5EA 4CDGC 5HGHB 2AEPH 4L29B 1IKNA 1T21A 4PJ8C 2CMRL 3GB7B 5CUSL 2EDOA 1XGPA 2E8YA 4M5YL 5I1CL 4NKMB 2NY7H 3ZE1E 1JTOA 4MNQB 4OLVL 5JHDD 1R3HB 3B9AA 4MB5A 4JQXA 5C0RH 1CLOL 5I1LA 2BSSA 1U8HA 1CK0L 4UZGA 3DMMB 1BFTA 4LSPL 3IDUA 2D7QA 5DC0A 3HRZB 4H1LH 5FF6B 4P46B 1F02I 3QULB 4LVOC 5FCSH 1BZ7A 5IROA 1EUTA 3BKJH 3QH3A 1FLRH 2WAHA 4Y4KC 3UTZB 4YBQC 3SGDH 4FNLH 4OZHA 2OP4L 2RCSH 5HBBA 3OKOB 4YPGA 3D9AL 5DJDA 5GZOC 1KENH 3C6SB 4Z76B 3VD3A 5E6ID 1U8QA 5EUKB 3U2SA 1U8NB 4LNRB 4GRWF 5T1LD 5KSVA 4L1DA 3B8SA 5EH1A 1KACB 1WV7T 2RIKA 4HC1A 4PY8I 1MHEA 3X3GH 4FQXC 2BC4B 2Q7YA 2B7DT 3MJ8B 5E5UB 2R9HC 1MEXL 2YD1A 3VRIA 4X8XA 1K8DB 3NPSB 3UO1H 2XXMB 5I8OH 1IGML 4EN3B 3WIIL 2B1AL 2UZIL 4NQEB 5BXFA 1R3JB 4K71B 5KVDH 4FFZL 4YO0B 2AEQL 2DM7A 4NWUH 1HZHL 3BQUD 4P23D 2GUOB 4MAYB 4HWNA 3NAAH 2VZTA 1JTTA 2ZSWA 4RFOH 5E1HB 4P3DB 2VWEE 1CZ8H 1A1NA 3W11D 2H8PA 5FUOL 1BX2B 1VEPA 2VH5L 3B43A 1RUKH 5IHUH 5SX5K 1NC2B 4OTXL 3NTCL 4LDLB 4I3SH 3L7FA 5C0IA 1WZKA 1JNJA 3MOBH 3E6FB 3C09C 3SKNA 5KVEH 4WHTA 3BZEA 1SY6H 2V5SA 4ERSL 2WIIB 3CVHA 2XOTA 1H5BA 2E7BA 2V6HA 2NLJA 1JI1A 2KBGA 1ERNA 4PRBA 1ZOXA 2IQAA 3HE6B 3KYMA 2LU3A 4KXZH 5F7UA 5FYLL 2NY0D 2BJMH 1HQ4A 4P23C 1MHPH 5CEYB 1BLNB 3MRJA 2ZCHL 1WWBX 1JGLL 1P84K 3ZKXB 3RWJB 3TPKA 4MJIB 1ZT1B 4JKPL 4K3JH 2DQEL 4OZFG 4XP5H 3HNTL 3VDCA 4TUOB 5I76B 4JRWA 3O9WA 4OD1L 3C5ZC 2OL3H 3QZWG 3O2DA 4M3KB 3QQNA 4DK3A 2EXYC 2QSVA 2ORBH 3QJFB 2FR4A 4RFNC 1EFXB 1HHKB 4TVSa 2V5RA 5LKNA 2NY0C 3SE8H 4L8BB 4LFHG 3K4AA 4HC1L 5F6IC 3WLWC 2XZAL 3WNKA 2YPLA 2YXMA 3KHQA 4OZGB 2VLLB 1TTFA 4RAVB 1MNUL 1KNOA 4RISL 5DUBA 2M2DA 1CR9H 1INDL 4UIKL 4QGYA 2XWJA 4QOKA 2XY2A 1OGTA 1U6AH 4HUMB 1JK8B 1ZT4B 1UWXK 4M7LL 1MI5B 4LCCA 3UJIL 4YFEA 2BSED 3SJVD 4IIQC 4D94A 5IW6A 2LU4A 4RNRA 1T7ZA 4V1DE 3B5GA 2C1OA 4NN5C 3UMTA 5F70A 4JFPA 4L3ED 4TOYH 1F3RB 1KBGL 2OTWA 5F7DB 1ZEAL 3DXAE 3P4NB 5D93C 4U6YB 5ITBL 3BUTA 1CIDA 2FJFA 4DVRL 1MPAL 1DCLA 3RI5F 3INUL 1L0QA 1H3PH 1M71A 1CWVA 3M45A 5TH2B 2AJUL 4N1CA 1VFMA 3L3JA 2XQYG 1NJ9A 3CVHL 1A6UH 1QBLL 3S6CA 4R4BA 4LASH 4QKXB 1X4XA 3JUZA 4Z0BL 4WWKD 2XACC 1U8HB 5D70H 3B2UC 4JN2A 43C9A 2ARJQ 2J8UE 4EI6A 5L88H 1BZ7B 1OPGH 1YZZA 3STZA 3NACH 1RK1A 1FC1A 3QH3B 1XR8A 1HEZA 2P49B 5JO5A 2R2CA 4D2NA 1ZVSA 5DJDB 4N8PA 4N0FA 1U8QB 1AY1H 1XCQA 1INEL 1EEYA 1WBYA 2XNAA 4N9OB 1OD7A 3LKOA 1NUGA 3VWJA 2NTFA 5BZDA 2BSTB 5I75B 2DICA 1RU9L 2X89D 3O2DL 5I71B 1FPTH 5CBEA 2Q7YB 1UXWA 5JQ6H 1YNKH 3VRIB 3TF7C 3O3BA 1FG9C 1TZIA 1MCCA 5BXFB 5FYKE 2DLGA 3U79A 1CDUA 4LIQH 5F72S 4JFFB 3NFPA 1BFOA 1J8HE 4X5XB 4ZAKD 3VFRB 1RZFH 1S9XA 2YZ8A 1TJHL 3AM8A 3NOIA 3BMVA 5HHXH 1UWEL 4M48L 1MIML 4MJ4A 1HK6A 2VRAA 1RFDL 2ZSWB 1CLYL 1FCGA 4KQ3H 1UWGL 1BVLA 2H8PB 1XR9A 2R2HA 3MZGB 3PWUB 4MNQD 2AV1A 2VDKL 4XXCA 3TNNA 3L7FB 3SKUD 1CD0A 4Z18A 1MRDH 2AJSL 3SKNB 4WHTB 3BZEB 3JV5A 2ZSVA 2R1WB 2P5WA 5HYQA 1WF5A 3CVHB 3RGVC 1H5BB 4PRHE 4HUXB 5D1XB 2A6DB 2NLJB 1IGIL 5L7XH 1P2CA 3SDCA 4HIEA 3VMPA 4PGDB 3BJLA 1XF2A 4QHLA 4CVXA 1HQ4B 2B2XH 5EOTA 2X70B 2A9ML 1FYTD 1HHHA 3A6BL 1HOCA 4ELME 2EZ0D 2CIIB 3FN0H 3OR7A 3TH2T 3BE1L 4S1RL 3IRZA 4OZ4B 2VR9A 3V6OE 2P24A 1Z9OA 2APWA 3QQ9C 5EZIL 1KJ3H 4ONGL 2K1MA 5LGHL 5FYJD 4EIZC 2FR4B 3TBTA 1LO2L 1YPZB 5D7SH 3H9HA 2HKHH 2JLLA 4AT6A 4U1SA 4X4MA 3ARPA 1ZLWH 5CEZE 5SV4A 2B1HH 4DKEL 1KNOB 4Y19A 4GBXD 3RWHA 3MBXL 1HSAA 5DUBB 2VLKA 2FX8H 2X10A 4PJIF 2XG4A 4OF0A 5DEGA 1ORQA 4IMLA 5GGQL 5EC2A 4QOKB 1TPXB 1NC2D 3TYGH 3STLA 5LWYL 1OGTB 3P0YL 4QRPE 1R3IL 2JB6A 4CU7A 1BEYL 3ARDD 4Y88A 4XVTL 1MJ8L 4R9HA 4NZRH 1U8PA 5IW6B 2C26A 3MA7A 2D7OA 5IJVA 2C1OB 3LDBB 1F3DH 2P47B 3KPTA 3HE6D 4L4VE 3QG7H 1GZPA 1IAKB 4JFPB 2AK1L 3NFSL 2OTWB 3KPSE 3K1DA 5CGMA 1RHFA 5ID1B 4BQBA 4TUKH 2G9HA 3FTGA 4DOHE 2CLRA 5C0FB 3OTTA 2PETA 2Q8AH 2R15A 3GM0A 4Q9BA 4CMHC 2OJEA 5SWQA 4NUJA 1M71B 4J1UA 4KFZC 4G42A 3BGFB 5C08E 3QA3A 3L3JB 3K8KA 1NJ9B 4GQ9L 4R4BB 4QXGL 4J3XA 1AFVL 2AI0H 3OF6D 5MERA 4M9PA 3S5LG 5JIPA 4HAFA 1A4JA 1NLBH 2H2SD 4JN2B 4R7DA 43C9B 3SDXF 1UEMA 4G8EB 3RY6C 1VCAA 4EI6B 2HWZL 1ZVHA 3F12A 3MNZA 4N0YH 4RA3A 2DTSA 5GRUL 1I1AD 5D7IE 3WHXA 2FD6H 1HEZB 4XNMA 5DJZA 1CD8A 3QHFL 5JO5B 1JNHA 1ZVSB 1UB5A 3EYSL 2BHUA 3THMH 5C0DA 1UJ3C 4N0FB 2F54D 3QXWA 3ZYOA 5AUMB 3WFCH 3TT1H 1X5ZA 2VLME 5B22A 1EEYB 1DE4B 4UT7L 1JPSL 5C1MB 2XNAB 3LKOB 2ITDA 4ONOA 3VWJB 3MLTA 5BZDB 2X4PA 4JREB 4NKOA 5GGVL 2P45B 1L7IH 1L9NA 5CBEB 4ZTOH 2FATH 4C83A 1EJ6A 5K33A 3WFEH 1ZLVK 4MZ2A 3O3BB 3FQTA 2EDTA 4L1HA 3MLSH 1TZIB 4D8PB 1JZ6A 1KJ2H 4RMVA 3BT2H 3NFPB 1BFOB 4HJ0D 1I1AC 4EI5B 1WEJL 2WP3T 5I1GL 2X1PA 4Z7OF 1P4BL 4HEPG 4NHCL 5FHBL 1T66C 2BNRA 1EO8H 4WO4D 5LGJA 3C2SA 3JVGC 1BFVL 2A83A 25C8L 5FYLD 1UH3A 2PR4H 2CRMA 1DQDL 5J12B 1XR9B 5DJ8B 2A6IA 3MUZ1 2AV1B 5ESVA 1XT5A 4NJAL 3ZKQD 1TVBB 3WD5H 2CK0H 2ZSVB 3O3DA 4C56E 2LTQC 2P5WB 2XG5A 5DDHA 1A7OH 4KY1H 2PNDA 2DLFL 4NNPH 4KGLA 4AMKL 1NC4A 3SDCB 5EO9A 1IKFH 3HUJE 3UYRL 4CVXB 4XP4L 3U6RA 5J13B 1AHWB 5EOTB 1MCJA 2OJZL 4WO4C 4YHMH 1HHHB 3ZLQC 2R2EA 1FZKA 1HOCB 2APBA 1AJ7L 2W59A 3UJJH 3FB6B 3OR7B 1T22A 4HJJL 4PY8J 1NCBH 4JRYB 2KKQA 3SKOB 3MGOA 4JO3H 4RZCB 4YXHL 1LK2B 4KI5F 4JZJC 5JIKA 2VC2L 1JYVA 1XGYH 5IJKA 1WT5C 3HCVB 3PGCA 1KEGH 4JGUA 2QQNH 1F58H 3TBTB 2LAGB 5IQ7H 1TVHA 3UC0H 1J1OL 3H9HB 4P48A 3SE4A 1SMOA 3TIEB 4XNQA 2BK8A 1A6AA 4YWGH 5DEFA 3WUWG 4AT6B 4U1SB 5DQJA 3Q5YA 5KSAC 5K9QI 5L8LB 1ZTXH 1OP3H 2F5AL 4Y19B 1IBGL 4UNUA 3WE6A 4AH2A 1S7VA 2VLKB 5CJQL 4Q6IC 5DEGB 5JQHC 4V1DA 1ORQB 2I07A 4N5ED 4GG8A 4ODVH 5EC2B 3STLB 4NQTA 3FOLA 4A6YB 5E7FA 1KYOJ 4YHNA 2GTZA 5EIIA 3DXAA 1YC8A 4HXBH 5DEZA 1HINH 2VDPH 2WUBL 4PJ7A 4U6XA 4K9EC 1U8PB 3QFDA 43CAA 1LO3L 1UG9A 3MA7B 3OJDA 4G6AD 1YEIL 5IJVB 3M8OH 1MCRA 1GZPB 1IVLA 5EBMA 3BSZH 3LZFH 3JTTA 1NCDH 3CLEL 5I0ZA 1EHXA 2DIBA 2MMXA 5F7HA 2CLRB 1O7VA 3L3DA 4QXTA 4AIXA 1TJIH 2ESVE 1JMXA 2OJEB 5FO7A 1PEZA 4OLZL 5SWQB 4QRRE 2J8UA 4NUJB 2ICEB 1UKSA 4GMSL 4J1UB 5J4MA 4A2LA 4OFDA 4XXDA 1JNNL 3BWAA 3QA3B 4N5EC 4U1GB 2XICA 2WZPD 4LLUB 3UDWA 3O9WD 6CGTA 5IOPA 1K2DA 2X5PA 2K9UA 1A4JB 5MEPA 3QEGH 4R7DB 4WGVB 4YXKL 1FIGH 2V5MA 4BUHA 4KMTL 4CW1B 3MNZB 1JWSA 4C59B 1S7WA 4U1IB 3WHXB 4NGHH 3BOVA 3U82B 4XNMB 5DJZB 3VI4E 9CGTA 1UB5B 1IGTB 2YPLD 4UUJA 4WUKL 1MIEL 1N5YH 4F2MA 1YYMH 2ITDB 3MLTB 2X4PB 4AEIH 4NKOB 1YUHA 1F90H 1MUJB 1QPXA 3FQTB 4M02A 5GS2H 1JRHL 3TM6A 4FZ8L 3O4LE 4Q9RL 4M6OH 3DSNA 1KC5L 4ODSL 3HMWH 2JJUA 5T1DH 3GSXB 1WBXA 5FUCE 4M4PA 3BH8A 2HJFA 1V7NH 2BNRB 3QNXA 3BH9B 2VB5A 1X5FA 2DDQL 2E9JA 5DD0L 2A83B 1DFBL 4FXKA 5C09E 2C1PB 3ZZ1A 1NBVH 2GJZB 2A6IB 4FQQA 1DLFL 1OLZA 1O5DT 3TJHD 4OLXL 1C5BH 5ESVB 5E2JA 3OZ9H 3MRQA 3O8XA 2IBGA 3IXTA 1FVCB 3O3DB 1NBZA 4BQ9A 3UPRA 5DQDH 5DDHB 4BSJA 1S9YA 4ELMA 3U4AA 3VXOA 3IFOA 3E0GA 5ESQB 1A7PH 1NC4B 3CXDL 1YYLH 1XGUA 3BAEH 4Y1AE 2AJVH 3BGMA 2F19L 2VITA 2B5IC 3U6RB 2NZ9D 3PWPD 4LSVH 4RX4D 2CDEB 2IGFL 2R2EB 1FZKB 2MSPA 2OZ4H 2HLAA 5JR1H 4M6MH 4EUPA 3IVKA 2N7BA 1T22B 4JFEA 4EVNA 5HI5D 3HS0A 3TJHC 1DQMH 5CILL 4M6AA 2A73A 1AE6L 4M7LT 2I26N 4IRJC 2QQKL 2Q1EA 3LPWA 2FGZA 4K2UH 1UXSA 1TVHB 2YSSA 5HPMA 4KROB 4XNQB 1A6AB 4X6DA 3OKLA 5DQJB 4QRPA 2ATKA 1S3KH 2NZ9C 3MV8A 4WGWB 2R8SH 2EDHA 1CG9B 1IT9H 4J7RA 1TLKA 4WCYH 5C0JA 3WE6B 4AH2B 3QUKA 1QRNA 3AS1A 3ARQA 3IAQA 2XTJE 4GG8B 1WBZB 1GC1C 5HI5C 3L1OH 4GXVH 3FOLB 4H8WC 4ZO7A 3ET9F 2L0DA 4YHNB 1K5NB 2GTZB 3V79C 4WFGD 4ZS6D 4PJ7B 5GS0C 4ODHL 3QFDB 2WWMC 1N7ML 5DRNA 4ZUTA 2FEDD 2IH3A 1QSZA 4PYGA 1YY9D 3WNNA 5C9JA 2XA3A 5EBMB 3WN5C 1RIHL 3JTTB 4MWFA 3U0WL 4HS6A 5F9AC 4W6YB 5TDPA 1SJVA 1X5AA 1MCKA 3WIHH 2QHRH 3L3DB 5TE6H 3Q6FA 2HKFH 5FO7B 3FT4A 4M00A 4XWGH 3W2DH 4APQC 4XXDB 4M9OA 1ZLUK 4WUUA 3FT2A 1F8TH 3ULSB 3KPPA 2CR3A 1RUMH 5F7YC 5GJSL 2VLRA 1ZXQA 3CVIH 5MEPB 5EOCH 5F9WB 4JFDE 5AYUL 4NOFA 4YE4L 1XH3A 1JWSB 4OV6F 2GK0A 1PKQA 1C7TA 1X5YA 1YY9C 2C3GA 5ID0A 5F6HI 1J5OH 3O6FC 2QADB 2A1WL 4I13B 4KQ4H 4D0BB 1OM3H 5E2VH 5JW3L 3QPXL 1CVSC 2AXFA 2X4TA 1G0YR 2VLKD 1KB5H 1DR9A 3EYVB 3UAJC 2GHWB 1AIFA 3F7RA 1ZA6A 5JW4N 4WVRA 1A0QL 4JLRA 1RUPL 4N9GA 3SGEI 2AABL 1N6QH 1YN7A 3AY4C 3MLVL 4P59H 3MNWA 1ZE3C 1J11A 5BCAA 5ACMA 4S0TD 5CZVL 1MCEA 5CCKH 3S9DB 1UM5H 3T1WA 4OLUH 1TQCC 5CJXC 1ED3A 1LK3H 3RL1A 3HPLA 2J5LC 4KGJA 4OGYH 2YK1H 1WBXB 1RIVH 4OLEA 3BH8B 2HJFB 3MLYL 3QNXB 3WEXA 5B4MD 1WZ1H 4F37K 4LLWB 1ROWA 3QUZD 3RX7A 1UM4H 4Y5XA 1RQ5A 4CAGA 4FXKB 4GRLC 4C56A 3MC0A 2CUIA 4U1KA 3CC5A 4RAUA 4Z77A 2A38A 4N5UA 3C2AL 3DO3A 1A7QL 1SHMA 2W9LA 4UTBL 5FOBA 1NANI 5H94B 2DL9A 3HUJA 5J6HA 1V3KA 3MRQB 3O8XB 4JQIL 3QDGA 5D2NE 4GS7B 3DPBA 3P73B 1NBZB 4OIIL 2FB4H 3BDYH 1QPPA 1DUZA 3P9MA 3VXOB 3IFOB 2Z31D 1GZQA 4U0QB 4Y5YA 1IM3A 2ZCLL 3Q0HA 5D4QA 1XGUB 2LU7A 1GIGH 3BGMB 4F15C 3UEZA 4HBCL 4L9LA 3NCBB 1F5WA 3V5KA 3RWGA 1A3RL 3QUZC 2VERN 1FO0H 4KK5C 2HLAB 4MXWL 3C5SA 4EUPB 3FN9A 3U46B 1I3UA 5JW4R 5FECA 1FZJB 4HS8H 4JFEB 4EVNB 4FMFA 3FZUD 5D72L 1SBSH 4YHKL 2A73B 1MLCA 2VDNL 5HVHB 2LV4A 4UBDD 4P99A 4JN1L 3SCMC 4XC1L 3GIVB 2AJZA 1UXSB 2Z31C 1AO7E 2JJTC 3PWLA 4XPFH 5ACZA 2YWZA 3LRHA 2DYPA 4X6DB 3OKLB 1FFOA 3MV8B 4PLKD 4XAKD 3VGAB 5I1DA 1X9QA 4BUGA 5A2KH 1NCTA 4ZXBC 3QUKB 1QRNB 4DZBA 1D5IH 1F97A 4I18C 4E9LA 4JJ5A 5J1SC 3FZUC 4DW2L 3JWDC 1LEKA 4O02L 3REVA 3OAYH 4KPHL 4RMSA 4DVBA 4DOHB 2MTPA 3NCEB 5C2UB 4D3CH 4JG0H 5GGRA 1MOEA 5DRNB 4ZUTB 2IH3B 1HCFX 1N8ZA 5C9JB 4JFZH 1NC4D 1EZVX 2Z4QA 5IBLD 5I15H 4NRZB 4MWFB 2AJ3A 4O2FA 3NBNA 3BYYA 4HS6B 5TDPB 5L9DH 5D7KE 4QNPE 3DX8B 1KCUH 2Z35A 4S11A 4GAJH 1U3HD 4E0RB 5TDNA 4GKZB 4MA7H 1WK0A 3O6ML 3GRWA 1BQHB 3X17A 4CUCA 4WUUB 3FT2B 1RMFH 5EZOL 3RVTD 2VLRB 1AXIB 2DQUH 4HAGA 4DAGH 5KS9F 1T80A 1QFWH 5B39B 1U58A 3OWEA 3CLFH 2XTLA 5EDXA 4AQOA 3MV7A 1XH3B 3HE7A 1PGRB 2D0GA 2GK0B 4QHUB 4X99A 1PKQB 5JHLL 2CIKA 1BWMA 1MSPA 3HG1B 4HMCA 4XNXL 4J8RA 3LRGA 4NO0B 4YPJA 1QACA 4JANB 4NFBA 1G9NL 1FZOA 2AXFB 2X4TB 1CT8A 5GS1A 5KSBB 4ZG1A 4V1DD 4Z7OE 4AL8H 1AIFB 5CSZB 1UKTA 2WNGA 1ZA6B 3QDMA 4JY6A 3CSPA 2MKLC 4N9GB 4LQFH 5J11C 5FM5O 4KVNL 3DXAD 3UJTL 2QSCH 2BOBA 3EOBB 1YN7B 5IHZA 1JE6A 3ARTA 3LQAH 3MNWB 3RPKA 2BNUA 4XWOD 3LKRA 1DVFD 4LCWB 4MQXC 2HT3C 5C09A 1CICC 3EYOA 2DBLH 3G5XA 5H2BA 1ED3B 4N90D 3RL1B 2FO4A 3HPLB 4OD3H 3H7LA 4CU8A 4DEPC 5ENWA 4MMZC 4AZ8A 1OARH 4JCMA 2F58L 2NW2A 1QLRB 2F8OA 4C56B 2Y06L 3NCMA 2H1PH 4RAUB 4Z77B 5KVGL 3E2HB 2MCPL 1N5AA 4LP4A 3MV9E 5IT2L 1QTYT 5FOBB 4MA8H 2BNQE 2AKRA 3GO1L 4H26B 5J6HB 3TO4C 3QDGB 4TRPH 4DGYL 4LSQL 2XWTA 5AD0A 5BV7H 2UVFA 2NY2C 1R5WA 1DUZB 2DQJH 3P9MB 3JTSA 4XWOC 1DVFC 2VO5A 4Y5YB 2C4FT 4WTZG 1IM3B 4PJFB 1MCQA 2HTLC 3SGJC 1MHCA 4KI5E 4RMRA 3HAEG 1EUUA 4UQ3A 5E6YA 3GRWL 3RWGB 1T04B 1TCMA 3C5SB 4JZOA 2I5YH 4UB0L 4YC2B 3DURA 1HKLH 4JPVL 4XCCH 1MLCB 3QDJE 4HXAL 2HFFB 4PRDB 2P8PA 4KRLB 1KN4L 3OKMB 4YDJA 2AJZB 1HWHB 4OLWL 1T2QH 2X1OA 3PWLB 5TFSH 3BJ91 5ACZB 2HVJA 1C08A 1I9JL 2DYPB 2IWGA 5LVEA 3DIFA 3CXHJ 4X0KA 1JGVH 4F9LC 4FQIL 4JDTL 3AVEA 3RY4A 3LKPA 2R1XB 2Y07H 1YEHH 1QKZL 4PRHD 4O9HL 1GAFH 4M5ZL 4XNUL 3KPNA 5FO9A 4YHOH 4JJ5B 2R4SH 3F7PC 4HUWA 2NY5C 1BQLH 1LEKB 1NQBA 3KYOA 3REVB 4YHZH 4GKSA 1J0HA 3EDEA 4DVBB 2OTUA 1FSKB 3AFLA 1V5JA 3WNMA 2R23A 3W39A 3BUYB 5D6DC 5LG1A 2AGJH 3IT8D 4R7NB 2Z4QB 1EA9C 2AJ3B 3MRBB 3TN0C 4OCRL 3MO1A 2VL5A 4WI3A 4HQQL 1EJOH 4YDKL 4GRWB 5IB4A 4UILH 5DRWB 2Z35B 1DL7H 5GRVK 4PJAA 4JFDA 5TDNB 3AS3A 5K9KA 3QB7C 1XF4B 3D0LA 4PV9A 5CP7A 3MLWL 4OQTA 4FXGA 4F7EB 2F53B 2CGRL 5IVNA 3N1QC 4ZOBA 1LDSA 4KWUA 4F57L 4LPYA 3VFGH 3QP3A 4G9DB 2PUQT 3BPLC 3MV7B 5C6TH 5AZ2L 3VMOA 3HE7B 4IHOB 5IGXL 2CIKB 3VXNA 1DQTA 4M03A 4PB9H 5FFLA 4CMMA 4JO4L 5DD5H 5INDA 3U4BL 4J8RB 4QRPD 4IDJH 2PCPA 1RZJC 3SDDC 2JIXA 3V6OC 5ISZE 4LK4A 4PLNC 4IMKA 1FZOB 1KG0B 2ZOLB 1QRND 4UV7L 3RU8H 3WHE0 1DSFL 3MOAL 2VAAA 1HYRC 4L4VD 5DUPH 1MJ7H 4W81A 3QDMB 3SOBH 3WFDL 2Y5TB 3MJ9A 3KPSD 2ZKHH 2APTA 4XZUA 1R3KA 4ELKA 2BOBB 5IHZB 3CCHA 5DO2D 3J7HA 1YMHA 2BNUB 3LKRB 1LE9A 5EORH 3EYOB 3G5XB 5IBUB 4PJBF 2O5YH 5H2BB 4W4OA 2MCG1 4LLVA 4MQTB 3V4UH 1HILA 5ENWB 5TQ0L 1WGOA 5EOQL 2D7NA 1IFHL 1OF2B 2NW2B 4PJCF 3PP3H 3ALWA 4XNZB 1GHFL 4K07A 4I4WA 1K3IA 1M05B 2VQTA 4FQ1L 5FO8A 5EA0H 4MSWA 1P7QA 2YD2A 4N0UA 3BPCA 4QCIA 4WI4A 1IJ9A 2XWTB 5AD0B 3SGKC 2A9NH 2NY1B 5F9JA 5GRXG 4G8GB 5GGSA 2P5EE 2VLMD 3A67H 3JTSB 3TVMC 3RX5A 2IBZY 4RA0C 5JZ7D 1S7SA 1QFPA 2EXWD 3ZE0F 1GOFA 5F6HJ 1I8LC 1DANU 4UQ3B 4LCIH 3EYQD 2ADFL 4OQTL 4PJIA 4YDLB 5ALCH 4JZOB 3S34L 1XIWD 1FZMA 1J9CT 5I8KL 1AO7A 5K59F 4LPVA 4HD9A 4XPBL 2ZPKL 5F1OB 4HV8B 4K3DH 2UUDK 4XMKL 4G6JL 3RVWD 1RVFH 5C0EA 3WNPA 3IFNH 2O61A 4MCYA 2P8PB 3NZ8B 3VD4A 1IQDA 2ZP0T 4YDJB 4JPKH 2FX9L 3ZTNH 1RZKL 1VPOH 2EE6A 1C08B 2HVJB 3RJQB 1W72A 3DIFB 3VH8A 4XPHH 2GSIB 1QSFA 3O0RL 2O5ZL 5FYJH 4BSVA 3IGAA 5FM5M 2EIDA 3CSGA 5DMGD 1J1XH 3KDMB 4C56D 4MX7B 3MJ9L 1OT1A 4F9PC 4G8FA 3KPNB 1XIWC 3QHTC 5FO9B 4DGVL 4FG6C 3EJJX 4HUWB 3KYOB 5E08L 3BXNA 5JXAH 4GKSB 3SDXA 2OTUB 1JL8A 4YHPA 2R23B 4MA1B 2CMRH 3W39B 3PNWA 4Z7VA 1OWRM 4NRXB 2YWYA 5DZOA 1EHLL 5EPMA 1KCKA 3KS0J 4M5YH 1CFVH 4KRPD 4TPRL 5I1CH 4UOJA 4Z95H 2SEBA 4OLVH 5AG9A 4TVPL 4WV1A 4U7SA 3MODL 4IS6A 3EKCA 1FN4A 5F88A 1QYGH 1MREH 1CLOH 3BO8B 1N2RA 1CK0H 2VXQH 2YMXL 1N59A 4PJAB 4LSPH 3E1F1 3QIBB 4UT9L 5K9KB 4XX1G 5ICXA 3D0LB 3OKKA 4GUPA 3S4SG 5CP7B 2P42B 2X9YA 2AERT 4LRIC 2OP4H 3D9AH 3KLHC 3MUHL 1BMGA 2XI9A 1KPRA 2HN7A 5C2BL 3DMMC 3VXNB 1P9MA 5D7LE 1ACYL 3VXTA 4P46C 5INDB 2DYPD 2HT4C 2PCPB 4AENA 3CDYA 2JIXB 4I0KA 1IGYA 3D69B 1OAQH 1MF2L 1S78D 2Z0BA 3C9NA 4K3GA 3WIIH 5I73C 5HYIA 1H9VA 2UZIH 2VAAB 4YEEA 3LN5A 4IOIA 1T7VA 3UTPE 1OCWL 2DQIL 4J6RL 4LF3B 5HJ3B 3ZO0A 1F13A 2AEQH 3NCYS 3FO9A 3SE9L 4OI7A 3GMRA 2D3VA 4XZUB 3TA3B 1R3KB 1XF5B 4ELKB 1B3JA 4R26L 1RI8A 1T0NA 1W72L 3CCHB 4LSRH 1YMHB 3QAZC 4IDLA 3NPSC 2IEPA 3ALXA 5IM7B 4BFIA 4QRRD 5FUOH 4YX2H 2VH5H 1DLHA 3UCRA 4LLVB 4K71C 2DF3A 4OTXH 3C6LC 1HILB 2Y36L 4ODWB 5EBGA 3KJ6H 4MAYC 1B0WA 3LS5L 4QYOA 4ERSH 4I4WB 1A6ZA 3K3QA 4GG6E 4G7VL 1P7QB 5IB2A 4N0UB 4NC2B 1Q38A 3BPCB 4QCIB 4OCXL 5F7WC 2EDXA 2ICES 3DGGA 5F9JB 5GGSB 3IKKA 3RWFA 5DC9B 2ZCHH 1JGLH 3MV7D 3O4OB 3KHOA 4JKPH 5FAAA 12E8L 5I18L 3WLBA 3ARZA 3FONA 4ODTH 1S7SB 1I7ZA 1CS6A 1VFAB 3I3DA 1FAIH 1A3LL 4JGMA 4E5XA 3QZWA 4Q6YA 4FQLL 1SJEA 2AVGA 3NCJL 4WJ5A 4PJIB 3LEXA 5I0DA 1FZMB 3O4LD 5EU3B 2D4FA 3QDMD 5IVOA 1T83C 5E03A 4JO2L 2O61B 5C0EB 4UAOC 1TQBB 2XZAH 3MLRH 2EDFA 4NNXA 1NGPH 2BVOA 5F1NA 1KEML 3JWNC 2EDDA 2OR7A 4KDWA 1MNUH 5C09D 3SN6N 5JW5A 4RISH 1IQDB 3ARYA 1X7QA 3DOSA 5LAXA 3MRLA 1IC4L 4P5TB 2HJKA 1NCWL 2DWDA 4UIKH 3IU3B 4R2GB 3VH8B 3S97C 1T1ZB 1QSFB 4UDUB 4BSVB 3UJIH 3N85L 2E9BA 1EEZA 4G8FB 5IW3A 2XQBL 3G6AB 5KOMC 2JTDA 4K3EL 4MB4A 4P49A 4Y1AD 2C3VA 4MZ3A 2GW5A 1KBGH 5BS0A 3BXNB 1QBML 2AJYH 1ZEAH 1ONQA 3SDXB 3GIZH 5ITBH 4GMTH 4NQUA 4UQ2A 5J3HD 1AKJB 4YHPB 1OLLA 2V7HB 3VFTB 4JZNA 4DVRH 5CINL 2CQVA 1H15B 4Z7VB 3HRPA 5HY9A 1CL7I 1MCNA 3D25A 3INUH 1JNLL 1SYSB 2AV7A 5EPMB 5EFIA 4I0PD 4XPGL 2FECL 5D9SB 1FHGA 2AJUH 4G9FA 4AY0A 5FIEA 2SEBB 2AK4A 3CVHH 5KS9E 4WV1B 5I8EB 2H3NA 3CK0L 3VFMA 4IS6B 5F88B 2PYEE 3EO0B 3PQYB 4JHZA 3G9AB 1N2RB 3PWNA 2OL3B 2WBWB 4EDXA 1N59B 1JZ4A 1J7VR 3RZCA 5DD3L 1F4YL 3OKKB 2NW3B 4GUPB 4YXLL 1LDPL 2XN9B 1T6WA 1NL0L 2H9GA 2F9BT 3NGBB 2ATPA 4YFLI 5J3HC 5IVXF 5K9OA 1RUAL 1INEH 1KPRB 1QR4A 4L8SC 7FABL 2CR6A 1CE1L 3DJ9A 4DTGL 2COQA 3BX7C 4XGZA 3HFML 1IAII 2RHEA 2GY5A 2DQFA 4I0PC 1RU9H 4QWWD 3O2DH 2J12B 2LE9A 4M7KL 4G6KL 4AENB 3ARBC 1IGYB 2ED8A 4H5SB 3EOTL 3GSWB 3KAAA 1DEDA 1KCSL 3B9KB 4JHBA 4YGAB 3GBML 5IK3A 5JXEA 2F5BL 2ARJA 5HHNA 3X12A 4WNQA 2XA8H 1QNZL 3EOYG 4IOIB 4XH2B 3QNZA 2R1YA 1CIUA 2FEEI 2ADGB 3NZHL 5MP6L 2NYYC 1WZLA 4PTTA 1TJHH 3NA9L 3FO9B 1EV2E 4LMQE 3QDHA 3GMRB 4Z7NF 1V7ML 1MIMH 1MVUA 1N0XL 1UA6H 3B6SA 1TJGH 4M48H 2GCYA 2DD8H 1EFQA 2KL6A 1T0NB 1CLYH 2QBWA 2UVEA 1UWGH 1SEBA 3BVNB 4QF1A 3FB7A 3QCTL 3WDIA 1NSNL 4OKVA 2XTJC 1RD6A 15C8L 1V3JA 2YBRB 5DFVD 2VDKH 3LB6D 2X4OA 2AJSH 2VLJE 4P2RE 3P11L 1QFOA 4QYOB 1DUYB 2GI7A 3BPNB 4JFDD 3AU1A 2P5EA 3EAKA 3WS6C 2X4RA 1FGNL 2VZSA 1IGIH 1GGCL 1CTNA 3KPOA 5I2IA 3DGGB 4OCLC 4L8DB 2A9MH 3VG9B 5E4EB 2F8VA 5CZKA 4LPXA 4FP8H 4MAUL 4XT1C 4RMUA 5T1KB 4OZFB 2YR3A 3HC4L 5D1XC 3WLBB 3HHRB 4UTAH 4TSAL 1I7ZB 2GSGA 5DJYA 1U95B 2PO6C 3BE1H 4MVBC 3RP1A 4E5XB 3QZWB 5CJBA 3GHBL 1SJEB 3U36A 4WJ5B 3O2VL 5EZIH 4ONGH 2X7LA 3LEXB 2MNUA 1FC2D 5LGHH 4U1JA 5I8CA 1AH1A 4MXQC 4XC3L 3T4YA 3AXLA 1CTOA 2NXYC 3W5MA 3RBSA 2V9RA 1C5CL 2FSEA 2EDWA 3DBXA 4DKEH 5F1NB 2BVOB 5B21A 3H8NA 3PGDB 4MYWB 4CDHA 2Z9TA 4XCNB 5LAXB 3MRLB 3MBXH 1KCLA 3G5VB 1XFPA 1Y18B 2HJKB 3EFFA 2DWDB 3RHWK 5GGQH 4P4KA 5LWYH 3P0YH 1MFNA 3ZHLA 2EH8L 3JV6A 3QWRA 4RGNE 4ZD3L 5HHOA 1BEYH 4XVTH 4YBLB 3FQNA 2VDML 2F8XC 3HPJA 4DN4L 4GKNB 1Z0MA 4TVPD 5BVJA 2EIZA 3RVUD 1EEZB 4RFEA 4JR9L 2VXTL 3QUMB 4QY8A 4NQCE 3VRLF 5SWZB 3NFSH 5FK9A 2C3VB 4MNGA 4JEGB 5BS0B 5LBSH 1ONQB 2V9TA 4UQ2B 3ZKMD 4POUB 3VDBA 4JZNB 3RUGB 2FLBT 3F5WA 4P57B 4BH8A 3DRQA 2AV7B 5T3ZE 2EIBA 5EFIB 4XAWL 1FFNA 1L4IA 4G9FB 3LDBC 2AK4B 3VD7A 5TQ2L 1MFAL 3SY0A 4GQ9H 2HTKC 1OTUD 4QXGH 2H3NB 1WWWX 4NO5B 3S5LA 3VFMB 1AFVH 5B8CB 4TSBL 5TPWL 5D2NC 3PWNB 4EDXB 1ULVA 1DBKL 5CSGA 2HWZH 2IADA 3RZCB 3ME0A 2LABA 1AO7D 3K4ZA 4FOMA 5GRUH 4Q2ZA 1DZBA 1T7XA 1IEAA 5IIEA 3GJEA 1HQRA 5ECJE 3BGFC 1J1PL 3QHFH 1AGDA 1SM3L 2H9GB 3ES6B 1EERB 4C4KT 2ATPB 4L4JA 5JDJA 5FXCH 4JRXA 5K9OB 1IGCL 3ZKMC 4GAYB 3TZVA 1NPUA 3VA6A 4D9RE 3RDTA 4UT7H 1JPSH 3VFPA 4PD4K 1ZKAA 4XGZB 4HGWA 1GGTA 3U4EA 2DQFB 4R2GD 1F4WL 2FBOJ 4GW4A 2VZVA 1E28B 2Q8BL 2IANE 3JUYA 1QSFD 1NAML 4N8CL 5IK3B 1MCWW 2MPAH 4PJBE 5HHNB 4FN0A 4WNQB 3CUPA 3RVXC 4NQVA 4X7SL 3MACL 1WEJH 4PTTB 3BI9X 4Y2DA 1YMMB 2Y9RT 3FRUA 3JXAA 1A6WH 4JREC 5IQ9A 3H42L 3BP5A 4PJCE 3B6SB 4NHCH 1T6VN 5FHBH 2GCYB 4O5LL 5DJCA 5D7KD 1BFVH 4GW5B 25C8H 4A6YH 2Z91A 5C6WH 5E4IA 3FB7B 3QO0A 5I74C 2IFFH 4OKVB 1PZUB 4E42A 5T3XH 1OL0A 1KIUA 2X4OB 4EI5C 4NJAH 5CD3A 3FFDA 3MRIA 1U3YA 1T1YA 4Q74A 3AU1B 5C0BE 4K8RD 3VI3F 3ZE0E 2DLFH 5IKCA 4P2QE 4I3GA 4AMKH 5FOJA 1KN2L 5EU6B 3AMKA 3QRFM 3UYRH 3PGFL 2PW1A 5I2IB 4XP4H 1A7RH 5FDWA 4M1GL 4UNVA 2OJZH 3FO0L 4HPYL 3IDMA 3RNQB 3EOAA 5K59E 2GAZA 5D5MF 2ICWI 4PG2C 2E6JA 1CFQA 2GSGB 2W65A 5DJYB 4HJJH 3WJJC 1GVIA 3MQIA 4HSQA 3SDCC 1AGBA 3KLAB 1RZGA 1KOAA 4BZ1L 3U36B 4YR6A 5J13C 1AHWC 4ACPA 2VC2H 1MWAA 3I9GL 1D7FA 2OR9L 5I8CB 2FHFA 4K8RC 3T4YB 3AXLB 3UX9B 2H26A 1J1OH 3WUWA 1Z3GL 3PF2A 4OM1L 1E6JL 5GRZA 3DBXB 2F5AH 1IBGH 5BRZE 4X7DC 1UENA 3T0EB 4MQSB 3RWCA 1G9MH 5CJQH 4LEOA 5HHMB 5CMAA 3TESA 3EFFB 3C8HA 3ARXA 4NFCA 4P4KB 3MV9D 4MQ7B 4X4YA 4EDWH 2BNQD 3JV6B 4AJ0A 3DV6A 4OF6A 3L5JA 5HHOB 2UZYB 3FQNB 2WUBH 4OFYD 1BD2B 2CKBB 1T3FA 4OCSL 3B9EA 5BVJB 4JPIB 2EIZB 4LVHB 1YEIH 4RFEB 1DBML 4B5EA 4QY8B 1JYWA 2E7LA 1KLGA 3O3AA 5FK9B 3CLEH 3HNVL 4RMTA 4MNGB 4KI5D 5KS9A 1G9EA 2YPVL 3D3VA 5J7CC 1QP1A 4KV5E 1M7DB 3HMXA 3VU2A 3MLPA 4OLZH 4X6EB 3DRQB 4OCMC 4Y4HA 4LAQL 1FFNB 1H3WM 4ZSOE 1JNNH 5FYKU 1YQ2A 1DQQA 1HHJA 2HA1A 3MCLL 4NRYB 3W0WA 3SY0B 3QDJD 3DSFL 3S5LB 2CK2A 1NDMA 4LCYB 1P69B 2GJ6E 4MD0A 4XRCB 2D7PA 2Z92B 4YXKH 2W9DL 3D39E 3V6BR 1RIUL 3MBED 1ZVYA 1DP0A 4X83A 1AGDB 4LHUA 4U1GC 4FRWA 3LIZL 4LLAA 4JRXB 1MCSA 4WUKH 1FL6A 5LCVL 1MIEH 3TZVB 3VFPB 3TT3L 3S35L 1AGEB 1R3LA 1MWAL 3RKPA 1YNTA 4GW4B 4P2YA 4KK6D 2WSKA 4ORZC 5C0CA 1RJYB 5FKPA 1JRHH 3CUPB 4NQVB 4TTDC 4L4TA 3ZMRA 4FZ8H 4Q9RH 1KC5H 4ODSH 3MBEC 4NSKA 3G6DL 3TV3L 1IARB 4LEXL 4Y2DB 5GHWL 3GJFA 3BP5B 1CLZH 1FFQA 3U30B 1C5DB 1T7WA 2BX5A 3IAPA 5IHBA 3EDDA 2YRZA 4LHJB 1BFSA 4P5KB 1G9MC 4R4FH 2DI7A 5DD0H 2WBJA 1CDIA 1DFBH 4X5LA 5KW9L 2Z91B 3QIWB 3Q1SL 5H37G 4KMLB 1X5XA 5D7JA 1HIMH 3OKNB 3QO0B 3O45B 4BSWA 1UQSB 2DQGH 1CFSA 1BPVA 4X98A 1B4JL 3FFDB 3MRIB 1INQB 3KXFE 4JVPA 1FVEA 1T1YB 2NTSP 5F3BB 5EWIL 2FLRT 4I5BA 3SBWA 3JWOL 3CXDH 3FT3A 4UV4L 3HMXL 3W9DB 4KZEL 4BQ6A 1D9KB 1UCTA 2F19H 4PJDF 5FDWB 3B3IB 4HZAA 5ISZD 1G7HA 4OSUL 1YJDL 3IDMB 4H20L 3EOAB 1MRCH 2GAZB 4OT1L 2JJSC 5JLZA 4XVSH 3GM8A 1PDKA 1AQDB 4X5WA 1PX4A 1CFQB 2W65B 2W1NA 3GMQA 5CILH 3CDCA 1AE6H 2GJJA 1Q0XH 1AGBB 1RZGB 5JOPE 1OTSC 1U93A 4YR6B 3DGCR 5JXED 1AXSA 1S7RA 5CLTA 1MWAB 2QQKH 5JTWA 4HS3A 3R8QA 1WUNT 1QHOA 3F7VA 3DX6A 4XCEA 4LLYA 2HVKA 4ESKA 3QJHA 3WUWB 4P9MH 1AD9B 1RV6X 2Z93A 4ZFFA 4OB5L 3O2WL 3Q48A 4NO2A 2JK5B 5SWSB 5KVFL 2W9EH 4LEOB 4WFED 1CE6A 4FQJL 5CBAA 2X09A 4IJ3B 5IV2A 3KJ4B 4X4YB 4NQCA 4MS8C 3B2VH 3OXRA 1OAYL 2YHGA 1HI6A 3QRGL 2IC2A 3LD8C 4KROC 4IRZL 4FTVE 4PJ9D 4EQ3A 1HH6A 4IM8A 4NQDE 4F37F 1QRKA 1T3FB 2P5ED 4G7YH 2P46B 2EYRB 2VXSL 1KLGB 3O3AB 3I3BA 5L2JA 4PRPA 2EEDA 3QUXA 2HRPL 3D3VB 3ZT6A 1KCRH 2MHAA 1CF8L 4U1LA 3QEQE 3IDYB 5ACLA 4Y4HB 4HIJA 4PJ5E 1URLA 1AI1L 3W0WB 1DQQB 1HHJB 3LQZB 1LP9E 3RKDD 5GJSH 2W0LA 4CN4A 1FH5L 4MD0B 4PJ9C 2RQ8A 5AYUH 4HF5H 1YDPA 1W8OA 3RJDA 4R3SA 4M61A 5F9OH 1W0VB 1Q1JH 1K6QL 5DHVB 4EUPH 4G5ZL 4JG1L 1H0DA 5C0ND 3LQMA 2G5BB 3SDYH 3QIUC 4QT5B 3UDWC 4R97C 5JW3H 2Y5EA 4RQQA 3QPXH 3E8UL 4Y0GA 5HYJE 1O0VA 5HHMD 5F9WC 2G5RA 4Z7NE 4PJ8A 1R3LB 4P4KD 1NFKA 4LIQE 2BRRL 3ZDZE 1YNTB 1A0QH 3QWRD 1MLBA 5GQBA 4O51A 2AABH 1YEKL 5C0CB 2QADC 3MLVH 5FKPB 3RRQA 1B88A 4XVJL 2VN4A 3T2QA 1B0GA 3VXPA 5CZVH 4L4TB 5C0AE 5HVFB 3FQRA 1KXQE 3VW3L 1S7QA 2A0LD 2WLYA 4X80L 1NGWA 1CU4H 1A21A 1EGJA 4UINL 2KQNA 4ALAL 4RBPH 3DHMA 4RGMB 3G04A 4JFQB 1AQKH 4JB9L 5IESH 1PEWA 5DJ2B 1BOGB 5D7JB 3C2AH 1JHKL 1BAFL 4CGTA 1ZA3B 3HI5L 3ZHKA 2EDRA 5FV2A 5IB1A 4X98B 4NCDA 4JQIH 3D18A 3C60B 3QFJE 3UZEA 1TITA 3DETC 4ZUUB 1FVEB 4FQXA 3UTSE 4KJWD 3T2NL 2EDNA 1TETL 5JHDA 5TF1L 1S8DA 4I5BB 5D7LD 2ZCLH 1ORSA 5ELIA 5A1AA 5BJTA 4OFVA 4HBCH 4HUKB 3ROOA 3T04D 4JRXD 1JZ3A 5IHLB 1A3RH 3O8XC 5IVZA 5EB9A 3TZVD 4GS7C 4MXWH 3RDTD 5IUSA 3NIGF 3PHOA 4BFGA 5IFAL 5JLZB 1CGWA 3UTPD 1RURH 5GISL 5IMKA 4X5WB 4Y89A 1KULA 5HHPA 3DECA 4J12A 3GMQB 4YHKH 5D72H 3U7YL 3WFHA 3DVFA 4BH7B 2FX7H 3CMOL 4GQPH 5FUZH 1S9VA 3MYJA 1J10A 5T1LA 5JA8B 2WM0A 1U93B 3PJSA 3GMMB 4JN1H 4ZPTA 1AXSB 1S7RB 4KMQA 5FGCB 4XC1H 4IRSD 4HS3B 4KJWC 4OCWH 4G6ML 1MCDA 5JNYA 4WHYG 5CIPA 3F7VB 5TE7H 5ADPH 3DX6B 4LLYB 1JF1A 3QJHB 3S98A 4LBEA 3IDJA 1GXEA 3LEVL 2Z93B 4ZFFB 1JGUL 4IBLT 4NO2B 5HVHC 3CFBA 4PRIE 1H3XA 3H9SB 3VRLE 2Z8WC 3IB4A 4HCRH 3OHXA 1T5XB 3OXSA 4P23A 1CE6B 5CBAB 3TBYA 3TBSA 4BK5A 3V7AE 1NMAL 4HLZH 1HI6B 4DW2H 1SQ2N 2BHYA 2VABA 3ZYIA 1EGJL 1HH6B 1RZIA 4HMEA 4V2BA 3VGAC 4KK9C 1DEEA 2MKWA 4IRSC 3JV0A 4JM2B 3O6KL 2H6PA 4H88L 4PRPB 3QBTB 2Q6WA 3QUXB 5ILTL 3I6KA 2CPCA 5ABDE 3VXQB 4WEBL 4NNYA 4U1LB 1FO0B 5HI3D 4I77L 5HTSA 5I1EH 1CGYA 1TTGA 1YEFL 2ICWJ 3K8MA 5F7NC 3VRJB 1I7TA 5EZOH 5KZCB 1P6FA 3CSYA 2PTTA 2FL5B 1OD9A 4HKZA 1OSPL 2ED9A 4TUJB 4W70A 3G5ZA 3V9FA 1DDHA 1KTLB 1B6DA 5ANMA 1ND0A 1R24A 3MYZA 3SO3C 4M61B 4XMLH 3MFGB 1QEWA 4IIQA 5GSVB 1EXUA 4ZFGL 3D0VB 4BA8A 1H0DB 2XZQL 3GBNL 3V95A 2JCCF 1G9NH 4RQQB 3IRPX 4LSTL 3ZTJG 4XP1L 1UZ6E 5D2LE 3P0VH 3T1FA 4PJ8B 2YUVA 3M1BA 3UTQB 3WJLC 2ZWLT 4KK8D 4FMKA 3VFUA 1MLBB 4LGRB 1NGXA 3UJTH 2OK0L 4JVUA 1CXLA 4XMPL 3PABA 3VXPB 1B0GB 4KZDL 3F58H 5JDSA 3FQRB 1S7QB 1GYAA 1NGWB 1I1YA 1ACZA 5F7EH 3N06B 2FDBP 3Q3GA 2E8ZA 5L8KB 3D3VD 4LVOB 3VI3E 2BZDA 2PYED 3G04B 3LVEA 1AP2A 1F11A 3ZHDA 3P40A 4Y16B 4JPWL 2EKSB 1KFAH 2MCPH 4Y4HD 4DKFL 3B4NA 5A3ID 1S9WA 1TNMA 5IT2H 1B2WH 1A1OA 2M1KA 4PP1C 3VJ6A 5IB1B 3GO1H 3IDGA 1JPTL 3V4PL 3D18B 1L6ZA 4DGYH 3MRGB 5D5ME 4FQXB 3AB0B 4R8WL 1VFBA 4NUGH 5HD8C 5JHDB 3HKFA 2AW2A 3MRKA 3BKJL 1KYOK 1FLRL 4WTZA 4GRWH 1ORSB 1DN2A 3GSRA 1KENL 1CDGA 4LHUD 3PXJA 2NNAA 1NCUA 5BJTB 1MCPH 3ROOB 1MCIA 5IEKB 3GRWH 4KJQC 5IVZB 3I75A 2VE6A 3TBVA 1EDQA 4OLYL 4QXUL 4UB0H 1Q94A 3TGXA 2JJVA 2BOCA 4JPVH 5HHPB 2UY6A 5EU7C 1I8KA 4Y5YC 5DK0A 5E6IB 5CGYD 3WFHB 1TENA 4HXAH 4HMDA 3MYJB 5T1LB 2Y6SD 3MSPA 5DQ9A 5C0CD 4ZPTB 1HDMA 4POZC 5KVDL 1IAMA 1XGQA 4L4TD 5JNYB 4P9HL 5CIPB 5C0GA 4OLWH 3C09B 3OJMB 4YC2C 1JF1B 4HUVA 5SX4I 1I9JH 2ZCKH 3IDJB 3QXAB 4OF7A 3RGVA 4RFOL 5C70A 1CZ8L 1IAIL 4FQIH 4JDTH 2NX5A 3CFBB 2WBJD 4P2RD 4Y4FC 4Z5RA 2KPNA 4NYLA 2IALB 4N68A 2UWEE 3L6FA 3OHXB 1QKZH 3OXSB 4O9HH 4P23B 1RJZA 4M5ZH 4XNUH 3TBSB 2YUWA 5D6CA 4MCZA 1BZ9B 2HMIC 4KKLC 4U1NA 5KVEL 3MLUH 5DJAA 2YD9A 4PJXB 1RZIB 3QXDB 5E5MA 4HIHA 3IS1X 1DEEB 2BJML 2YN3A 3IS0X 2YC1A 3QEQA 3LEYL 3F6LA 2DWEA 3MGTA 3MRDA 5FA3A 4CADA 1MAKA 2A6KA 2AXHA 5E9DE 4PJ5A 1RZ8A 2EO1A 1QR1A 4OCRH 5IVXA 5T33H 2GT9B 3I6KB 2IPKB 4RFNB 2PW2B 4HQQH 4YDKH 4NNYB 3C8KA 3V52L 4XI5D 2ITCA 2NY0B 3A6OA 1OTTC 4XP5L 1FSKC 1ZHNA 4OGAC 4G80A 4U1HA 3VXSA 5F6IB 2VYRE 4PLJD 1YEGH 3MV11 2BMKA 1FYTA 1I7TB 1PJ9A 3MLWH 1LHZA 3CSYB 2PTTB 4YZFF 1EIBA 5GZNC 1EO7A 4E41E 4F57H 1DDHB 1PW3A 5ANMB 1ND0B 1RJLA 1A14L 1R24B 4GO6B 5AZ2H 1I8IA 2NY4D 1AR1C 3QI9D 4KJPC 4JO4H 5DK2A 1EXUB 2BVEA 3JBG7 4L8CA 3V5HB 2WP3O 4WHDA 3QUYD 4RGND 4NN5B 2VN7A 3O41A 4Q9CA 5BVPL 1CR9L 1I3RB 5F97E 5C07E 1UB6A 4MLSA 5DT1L 1DSFH 3MOAH 3NA4A 4LKCB 5D93B 3M1BB 1D6VH 4LRNL 4NQCD 2V9QA 4DQOL 3IKCA 3SKMA 1JF6A 3UP1A 5LXGL 3PABB 4U3HA 4C55A 2QTEA 35C8L 5DHYA 2XKUA 5JDSB 1G1YA 1FG2B 2VUOA 5T3ZD 2W91A 3DO7A 1WZMA 3ARDA 1I1YB 3QI9C 1I7RB 4PRPD 5HVWA 4I2XB 4GSDH 3ELAT 3RY6A 1C8PA 1HXMB 3QUYC 2PXYD 1ZGLA 5EOQH 3QFJA 1AP2B 1F11B 2OXGA 3LKQA 4L3EB 4F33A 3MNVA 1CGSL 3TWCH 2VISA 1A6UL 4F7CA 4ODXA 2CLVB 1TNNA 4QRQA 1X44A 1KIRB 1S9WB 5KZCD 2A6JA 1JBJA 4CN6A 3VJ6B 8FABB 3IDGB 1FV1A 1VFBB 3MRKB 4D9RD 3DRTA 4WW1A 4XNZC 5E8EA 3CMGA 2BVPA 1JGEB 1Z9LA 3EHBD 3OF6A 4WWKB 5E2UL 3HAEB 1JCKA 3UYOD 1U8IA 3SDAD 2RFXA 2IAND 3KVQA 1U3JA 2HLFC 2PXYC 1I1AA 3I75B 2VE6B 1PG7W 2ADFH 2XFXA 4OQTH 3TBVB 3AMLA 2NY1C 3QNYA 3S34H 1Q94B 5E8PA 4PJ8D 3JVGA 4BFBD 1I8KB 1ZHKA 3PDGA 5TGBA 4NQXA 5I8KH 5ITFA 2F54A 2I60H 3ZE2E 4XPBH 1RHHA 4XP9L 4G6JH 3RAJL 5DQ9B 4MGXA 2XKNA 4X6CE 4LIQL 1R5VB 2ICCA 3SKJH 4S1DC 4PRIA 1CDCA 4DK6A 1WWAX 3IFPA 5D1ZD 5C0GB 3OSKA 2FX9H 3U83A 1RZKH 3K1KC 2J7LA 4HUVB 1V8HA 3L5XL 4UNTA 3WIFB 1NH6A 1OGAE 1X6LA 3RGVB 1D5ZA 3SDAC 1MCFA 4XCYA 3P4MA 4EBQL 2NX5B 1JWMB 2C3HA 3T4AA 2IPTH 5D71L 4Z5RB 4NYLB 4Y4KD 1UADC 4XPAH 4YBQD 2BSRA 3MJ9H 5C0BD 1K4DB 2B0SL 3EDFA 3L6FB 4LARH 1RJZB 5GZOD 5D6CB 1HE7A 4WO4A 2ZUTA 4M3JA 4U1NB 4HFUL 3H3PH 5DK3A 4JKLA 2BDNL 5E08H 3Q5OA 5FHAH 2H32A 5DSCA 2IBBA 4LKXA 4FQXD 5L7XL 4Z7WB 1XCTA 2DM4A 4HIHB 3CX2A 2R9HD 3RIFK 3QPQC 5FA3B 2DWEB 3MGTB 5D1ZC 5AAMA 4CADB 4U6HB 1BREA 2A6KB 2B2XL 1CFBA 4TPRH 4JZJA 1WT5A 1QR1B 1OAKH 4TVPH 1NBYA 5IVXB 1VGEL 3LPGA 3ULUH 3MODH 4H0HB 3JV4A 2YMXH 3EGSA 1OP5H 1ZHNB 2Q86A 4UT9H 4G80B 4U1HB 3VXSB 5EC1A 4F3FB 3D48R 3S4SA 1OVZA 2BMKB 1FYTB 3P4OA 1J0KA 1VERA 3REWA 1G7QA 2AEWA 3CX5K 3H7BA 5JOFA 5GIRA 4KAQL 4LLQB 1I4FA 3EJYC 1D3CA 3DX7A 5IG7A 5F1IA 1RJLB 1EK3A 5BRZD 2HKHL 3QIBC 3KPRE 4R6UA 3VI4F 5DK2B 4H0IA 4DUXA 3AS2A 3LKNB 4BZ2H 4JDZB 3O41B 2BRQA 3BYTA 3MGAA 1BM3H 2IFGA 3QO1B 5J6GA 1UB6B 2HFEA 4OI8A 4S10A 3TYGL 4EXKA 3HB3C 4DCQA 5A40E 3OR6A 1MCOL 3TJEL 2CUHA 1OCWH 2DQIH 3NABH 4J6RH 2H2PD 1UVQA 3VFVA 3SE9H 2Y1VA 4GBXB 3ZDYF 1UYWL 5EUOB 3SKMB 4OZGF 5DZNA 3OJ2C 2KQMA 4R26H 5L2KE 4P5MB 4LPUA 3QG7L 5DHYB 2DI9A 4NN6B 2O5XH 1C1EH 2WINA 3ARGD 1AC6A 3U1SL 2R2BA 3C5ZD 3DO7B 3ARDB 5DJ0B 2QR0A 5KJRL 4U31A 4R90H 2EXYD 3U7AA 4QO1A 3WMSA 4NQSA 3C87A 1ZGLB 1WFOA 3TH3T 3QFJB 3TA3C 2GJ6D 3LS5H 1CDHA 1CXHA 1T5WB 3MNVB 4F33B 2VISB 1Q9KA 4F7CB 3WLWD 4ODXB 2G2RA 4QRQB 2Z8RA 4JQVC 4D0CB 4G7VH 2H2PC 3QR2A 4I0CC 2EICA 3DI3B 4OCXH 3FOMA 4MD5B 1FV1B 3NIGE 4NWTL 4WU7A 5E70A 5JPNA 5IW1A 3CDGA 3OAUL 3N1GC 3DRTB 4NP4L 4WW1B 5E8EB 3SE3A 4OM0L 4N8VG 3ARGC 3STBA 2OMNA 4R0LA 2BVPB 12E8H 2DLEA 3ULUC 1V3MA 1G7IB 1WLHA 2RFXB 3BD5A 1A3LH 1A4KB 4MJ5A 5L6YL 1NKOA 4Z8FL 3ZDXF 4FQLH 1I1AB 1OQOA 2XFXB 3NCJH 3MRHA 3QNYB 2ICWB 1L7IL 2V2TA 2AXJA 3D85A 3NCFB 4Q58C 3L7EA 1QUNA 1ZHKB 3O4OC 4NQXB 5ITFB 2F54B 4N1HB 3H6JA 1Z2KA 4K7FA 1FIEA 3BT2L 2BERA 4K9EL 3VXRE 5FM8A 1XF1A 3IFPB 5A2FA 1IC4H 1OAXL 3LPFA 1NAKL 1BBDH 1NCWH 1ZT7A 2DRUA 2LTQB 3B2UD 3MRMB 2BY2A 4PJGA 3LN4A 5KSUA 4JFYA 3T4AB 3KXFD 5HYSA 3FFCE 3N85H 3S88H 2BSRB 1RUQL 1IL1A 2GY7B 4LL9A 2XQBH 1T21B 4WO4B 3VCLA 4P5TC 1XF3A 4K3EH 4M6NL 4AYFA 4Z7UA 1F45A 2DLHA 4O2EA 1QBMH 2H32B 1XGPB 5DSCB 4LKXB 3T65A 3TCLA 1IC7L 2FHBA 5JA9A 4HG4J 5CINH 2WIMA 1JNLH 3I50L 2BSSB 4XPGH 2JELL 5I1LB 4JZJB 4IRJA 5DJXA 1V3LA 3KG5A 4DZ8A 3CK0H 1H8NA 1ZLSL 5JOPD 1WJ3A 4E41A 2Z8VC 3JV4B 3EGSB 1CD1A 2FWOA 4OZHB 5E00A 3PWPA 4YPGB 4U05A 3S4SB 4RX4A 5DD3H 3P4OB 4YIQA 2VSDA 3REWB 4YXLH 3U2SB 2JCCE 1C12A 3H7BB 5JOFB 1LWRA 1YQVH 2YEZA 5KSVB 1I4FB 1VDGA 2NR6C 4OZFH 1YN6A 1MHEB 5CD5C 5IQ7L 4HK3N 1S5IL 5E56A 5F1IB 5C07A 3UTTE 1CE1H 4DTGH 4OFKA 3HFMH 4ZNCD 3GK8L 5DMKA 1QBAA 3I6LE 3RGVD 4M7KH 4G6KH 3LMJH 3I2CL 2NX5D 3EOTH 2X4NA 3WN5A 5J6GB 1KCSH 2HFEB 5FGSA 2F5BH 3N1PC 1VSCA 4PRNA 4DCQB 1QNZH 1CVRA 4ZS7L 1YPZF 4HUNB 1VEOA 4TULH 5MP6H 4GW1A 2CJUH 3NA9H 3VFVB 3RHWF 2J3SA 1A1NB 1VHPA 1V7MH 3CZFA 3A0OA 3VXME 4APQA 3ZL4H 4HIXL 1FJ1A 2WINB 5E5RB 3B9KC 5C0IB 3QEQD 4WDIA 3M07A 5A2LH 3QQ9D 4I48A 3QCTH 4PJ5D 1KTDA 1NSNH 3BKMH 4PJDA 1II4E 15C8H 4XPTH 1BF2A 1A2YA 1TJIL 4NQSB 4ZODA 3QUMH 3W5NA 4PRBB 3QG6A 2IQAB 3KYMB 4QTIH 3P11H 3O6FA 3OGOE 3CXHK 3ARSA 5IBTH 3VXSD 2OZ4A 3RY5A 1FGNH 2G2RB 1S5HA 1JZ5A 5DI8A 3MRJB 1GGCH 5HVGB 4XBGA 2AJXH 3FOMB 3QEGL 1FIGL 4WU7B 5JPNB 3K2UH 5IW1B 3PWJA 1PY9A 3O3EA 4R0LB 3O9WB 1QSEE 3AY4A 3MTRA 3K74B 5GRJH 4PB0H 4WI5A 3QCUL 4XBPA 1P4LA 5CJXA 1SJHA 5MENE 1WIOA 4AEIL 3MRHB 3O2VH 3MLXL 3RWDA 5E4EC 2L7UA 1U2CA 5GRWA 1MCWM 2YUXA 3L7EB 1MHHA 4XC3H 4NBYB 2YPLB 1GC1L 2JJWA 2P7TA 4H8WL 2QQLL 5MI0B 2V2WA 4J4PC 4GRLA 1C5CH 2CXKA 4HWBH 1OGAA 4IEFB 4KKCC 3HNSL 3IYLW 4JKWA 1IZKA 3P30H 5GS0L 2XWJB 2HG5A 4MDJA 4CVZA 1MH5A 3TPUA 4PGBA 5IMLA 3M17A 4LCCB 4QTHA 1F2XK 1G6RA 2CDGA 5FGBC 1ZT7B 2DBJA 5DVKA 5J1TC 3MREA 4PJGB 1QQDA 4RNRB 3LN4B 2EH8H 3TLRA 5KSUB 5IFHL 4JFYB 4KDVA 3S36H 5CJ8A 3QFJD 1EAJA 2VDMH 3UTSD 3RX8A 1L0XA 3CFIC 2B5IB 4DN4H 5J89A 1QHPA 3SGEH 5A2JH 3TCXA 1IL1B 1IAOA 2EKJA 1HSBA 5M94B 2VXTH 3VCLB 3QUZA 4QRTA 5JW4M 1XF3B 2FJFB 4Z7UB 3SJVE 5JORA 1W8NA 1GGIL 4AIZA 2GKIA 4O2EB 4AEEA 1T1WA 4WI2A 2DTML 2G75A 4LGPB 3TCLB 3SQBA 1FFRA 4LLMA 3HI6L 4WRLA 4YBLC 1PSKL 3QXVA 1W0YT 3ZT7A 2DM2A 1XMWA 3GI9L 2RB8A 3B9DA 4YZFE 4XAWH 4P2OC 4IRJB 4HPOL 5TQ2H 1PQZA 2OZ4L 2E3VA 4QNPF 2Z31A 2JJTA 3L5IA 1BWWA 5CJ5A 1NANH 3STZB 5BW7A 1RK1B 1DBKH 1XR8B 2XQYK 3WKMH 3QHZL 5DMJB 1T66D 5E00B 1E6OH 3PWPB 4NDMA 1P4IL 1U3ZA 1W2KT 1A9BA 4YIQB 4F7PA 3B9VA 1XCQB 1C12B 4JFOA 3KS0H 1WBYB 4ZXBA 1J1PH 2E27H 1SM3H 2YEZB 5E99L 3VXUE 4X7EC 5FA4A 2NTFB 1YN6B 4I18A 2WANA 4K2UL 1IGCH 4ZPVA 4PRID 5B8CC 3ARVA 1UXWB 3ETBF 4MJ2A 4JE4B 4J23A 2X4SA 4OFIA 5DMKB 4QRSA 4XHJC 1ZLWK 1F4WH 2MFNA 2Q8BH 2B39A 1DBJL 2X4NB 3WN5B 1S9XB 2D7TH 3L1OL 4PJEE 1Q0YH 3CFJA 4F8QA 3H9YA 1MCBA 1VESA 3MACH 4BFEA 4MNHA 1BVLB 3ESUF 2R2HB 3CZFB 1G6RL 4URTB 5ICZA 1FJ1B 5DLML 3TNNB 2CRYA 2HT2C 3MXWL 4WDIB 4ZQKA 4LQ1A 2ZUUA 2HH0H 1IGFL 4I48B 3TIDA 3E6HA 1KTDB 4PJDB 3R8BB 3WIHL 1GJIA 2ZZUT 5HYQB 2CKBH 1A2YB 3L3HA 5D8JL 3QG6B 1P2CB 4CVUA 3T0AA 3P9WB 2A2QT 3F7QA 3O6FB 4HIEB 3CFCL 4XWGL 1XF2B 4QHLB 5KSAD 1S5HB 3EDKA 5DI8B 1RUML 1KN2H 4UMGA 3IDIA 4EIGB 1LO4L 3PGFH 5DA4A 2OQJA 2BY1A 1T89C 1U3HA 3LH2L 3FO0H 3PWJB 4HPYH 1UEYA 1JYXA 4OZIF 1J5OL 2EE3A 3O3EB 1T4KA 2P24B 5TJWK 3BESR 1NEZA 5E1AA 1M6OA 4HKBA 3BN3B 1N64L 4WENB 5DFWH 1CICA 5J9PA 1P4LB 1TQCB 4JO1L 1MELA 1QVOA 3DARA 3VXRA 3RWDB 2OR9H 2HJLA 3UBXG 1UCBL 2V2WB 4GRLB 2DKSA 3W82A 1OB1A 1Z3GH 4QLRA 3JWDL 3RWHB 1HSAB 1Q9LA 2EIEA 4YGVA 2A74A 4NQEE 4IMLB 5FYJE 5B38G 2OI9B 4OLUL 4CVZB 4MDJB 1MH5B 3FFCA 2ID5A 3TPUB 4PGBB 5IMLB 3FO2A 3M17B 4OGYL 3TO4A 2JB6B 5T5FL 1G6RB 1SEQL 2CDGB 3MUGA 2HFTA 4QEGA 1LE5A 1WZ1L 1KSRA 3MREB 1QQDB 5KTEH 1DVFA 2YKLL 2N56A 4HGKC 4OCNC 1NFIA 3SGJA 4F15B 3PL6D 5ETUA 4J3UA 4OCSH 2J8OA 3OKDA 1HSBB 1DBMH 2G9HB 3FTGB 5HDOA 3T0EC 3QUZB 4QRTB 4FXLA 1T03H 2K7PA 3BDYL 4X6FA 4AIZB 1T1WB 2YPVH 4TQEL 3ARWA 4OQ1A 5D1QC 2AS5M 4G42B 3UROR 4LLMB 4X9FA 3I85A 4PG9A 1WFUA 1QSVA 5MERB 4PBXA 3U9UA 4GLRI 3LY6A 2VNCA 4XP6H 1P7KA 3BZFA 5JUEH 3DSFH 5FEBA 4ZFOL 1CGTA 1ZANL 2Z31B 3F12B 5KANG 3C08L 5A43C 4MJIE 1A1MA 5EZJA 1YEEL 3GKZA 3PL6C 1JNHB 2W9DH 3D85D 4NDMB 1RIUH 4F9LA 4LHUG 5C0DB 3UZVB 1DANT 1U9KA 4LSUL 5FCUH 4J3VA 4JFOB 5FB8A 4ZXBB 3OAZH 2KZWA 1MAML 5CAYB 1KT2A 2I9TA 1CDJA 5FA4B 3LIZH 4I18B 5DMIL 4ZPVB 1J8HA 5IMMA 4C83B 2PTUA 3S35H 4TNWK 2X4SB 1WCBA 3ZDYE 3D1MC 4QRSB 5DURB 5GGTA 4OZGE 1MWAH 4RDQF 2JF1A 1EEQA 3MCG1 1OP3K 3MOQA 3VD5A 1CGXA 5GS3A 1E4XI 3VXMA 1U92A 3TN0A 1S7UA 3LS4H 1CDYA 4GAGH 1D5XA 1JPFA 2GTWA 4BKLA 3CFJB 3IF1A 5LGJB 1MI5E 1N4XL 3TV3H 5E9DD 3T0DA 1I8MA 2FECI 4MNHB 5GHWH 2DJSA 4PRHA 3RNKA 2BVYA 5DHXB 3V5DA 5DYOA 4KTDL 2EEBA 1X3DA 4HWUA 5I15L 5KW9H 4M43L 3Q1SH 3TIDB 2B4CH 3E6HB 5L9DL 4TN9A 4IRJD 1KCUL 5HDQH 1Q9OA 4Y2DC 3L3HB 4HIIA 1B4JH 1RULH 4PJ7F 4E41D 4MA7L 5EO9B 3G5YA 3SDDA 2NY3C 4HEME 3QIWC 3V6OA 3JWOH 1QSEA 2LAAA 4NM4H 3ZDXE 3V6FA 4KZEH 1QFWL 4KVCH 2OQJB 4J3SA 1U3HB 3CLFL 4XBEH 4U1MA 2ZUVA 1VEMA 4ISVA 2XZCL 3PHQA 4OSUH 1YJDH 5C07D 4H20H 3BKCH 5C92A 3QSKB 2J2ZA 3BGAA 1T4KB 4LOUC 3VWKC 4R96A 3MGOB 4OT1H 3RPIA 3S37L 5GS0D 3ZKNC 5E1AB 2YD4A 4Y5VC 1M6OB 2WWMD 4FS0A 3PGCB 4LNVA 5J9PB 1D9KC 5IP4A 2XKSA 1QVOB 5I66A 5DHVH 2NY6C 4DEPB 3QEUA 5DEFB 2HJLB 1CLCA 5FYKL 2QSQA 1Y6NR 4M7JL 2NY5L 1OB1B 4KUZH 1S7VB 1IC1A 4QHNA 2EDBA 3FQXA 4OB5H 4S0SD 4APQD 1KCVL 4V1DB 2I07B 2RGSA 5GGTL 4JFFE 1LD9A 4L4VA 3L5HA 4DGIL 3K81A 1B4RA 4OD3L 3TO4B 5KVFH 3LKSA 5ERWA 3KPSA 5EIIB 4FQJH 3DXAB 3SGKA 3MUGB 2NY2B 1OARL 4U6XB 4WI9A 43CAB 2PTVA 1BJ1J 1JHTA 3OJDB 1DVFB 1OSZA 4O2CA 3TVMA 3QRGH 2ZUQB 4IRZH 2H1PL 2ZG3A 4HW6A 3ARED 3O6FD 1NFIB 5C08A 3GJFH 4YBHA 5ETUB 4K55A 1I8LA 5TF0A 2GIYA 2IAMD 3OKDB 5I9QB 3U7WL 5BOZG 1FNGA 2VXSH 4XCFL 4QXTB 4OUUA 2MWCA 3ARFD 5GRVL 2P4AB 3WFBL 4PTUA 4X6FB 4U3XA 3UAJD 1FBIL 2J8UB 2DOCA 2HRPH 4X6BA 3BWAB 2Y72A 2YD6A 5D7IA 2B4CC 2RBLA 2QV2A 4PG9B 3OV6A