5D1XC

Isdb neat2 bound by d4-30
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
127
structure length
127
Chain Sequence
ESGGGLVQPGGSLTLSCAASGLIFSDSTMHWVRQASGRGLEWVARIRSKANNYATSSDKSATAYLASVKGRFTISRDDSKDTTFLEMSSLKIEDTAVYYCIASSTTGWYVREDFDYWGHGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords D4-30 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1xC00
3R8QA 1PDKA 5GGQH 4U1HB 3UZQA 1XIWB 4GW4A 4M7ZB 4L3EB 5D6DA 4X8XA 3V0WL 5SWSE 5BV7H 5TDOB 1QO3B 2CUIA 1QSFE 2QQLH 3BAEL 5F1IA 3WJJC 4GS7B 3FHQA 3BHBB 4G5ZL 2H3NA 1XGTB 4IMLB 1T7YA 2F5BL 4EUPG 2H6PB 4CJ0A 2VNCA 5I71C 2AJYL 4JKMA 1BZ9B 3TBTB 5A2JH 3SGKA 1UZ8A 1T83A 3RA7H 6CGTA 3REVB 2VDQH 4K71B 5KVEL 4XP6L 4HWBH 3O3EB 1TZGH 4LLWA 1DQTA 4ONOA 5F8QC 3PHQA 5J11C 3ES6B 3O6FD 3CCHA 5IFJA 1GGCH 3WD5L 1S9WA 2F74A 3UBXA 4ORZC 2MOVA 1AFVH 1GL4B 2CO7B 4YFDB 1MUJA 1CGSH 4QRRE 5E03A 1VENA 2E6QA 3FB6B 5I9QB 5KANG 3W5NA 3VI4E 2LFGA 4NUJB 4PGCA 3CFDB 3DECA 2ZCHH 5B38A 1DBAL 3RX5A 1BFOA 2ITDA 5BV7B 4RZCB 3MLZL 4HKXA 4AMKL 4F58H 5D72L 4JPWH 4WEBH 1XF5A 3FO1B 3V4PH 1X5IA 3BGAA 3VXUE 3V4VL 2UZXB 3GUTA 2OX5A 2YPKA 3VXRD 2VL5B 4Y5VB 1ZVYA 4D9RD 3CDGB 5FYJH 2NXYB 1PG7L 5HYSG 1OP3H 3O6LH 3S4SB 1YMHB 3MRLA 3K80A 5HHOD 4WI5A 4YEEA 2UUDH 5ISZD 3KPQB 4KXZH 4JO2H 5E8PA 3FZUD 4IOFC 4PV8B 5JIIA 3DGCR 1G7PA 4NNYB 5DVNA 1KCRH 3VFUB 4C83B 5C6TH 4UU9B 1W0WB 4ZUTA 4G43A 3RBGA 1F4WL 2VE6A 5EUKB 3I2CH 4A6YL 5INCA 1F11B 3BEWB 2B4CH 5KSAD 1NMBH 4PD4J 4PGJA 1OSZB 4K8RH 1XF3A 5F7DA 5MERB 2YN3A 3KLDA 5DLMH 4FQHA 1J8HA 2D7PA 4QNPE 1OWWA 5ESVB 2ICWA 4R26H 5GGTL 1B0RB 4AH2A 1TVBB 4KROB 1JGLL 1NCBL 3MR9A 1NKRA 1YEIH 3HZVB 1P6AB 5E8DL 5JHLL 2VN7A 4FQIL 4XXCA 4CW1B 4PJFB 4AL8H 1T1WB 1AI1H 4XGZA 5DWUL 3MRQB 3TYFA 3IDYB 2V9TA 4PRHB 4X9GA 4HWNA 2PXYB 1X5AA 4XC1H 5E4EB 1BD2A 1Z9SA 1KELH 4MJIB 4NNPL 4NQUA 5EDXA 5EA0H 1B2WL 1Z3GH 5CILH 4DZ8B 3BIAX 5IEKA 3V6OA 3BW9B 2AJUH 2DBLH 1FH5L 1FG2A 3OZ9H 4Y4FD 1FIGH 1UM5L 4KJPC 5ALCH 1U3HA 4M7LL 4NFCA 4S1DD 5A3IC 5C07D 3QIBD 3HR6A 3D2UD 4J3XA 1T22B 3F58L 4LCIL 3VH8B 4LRIA 3PHSA 1P7QD 3G5VB 5DQ9B 1L6ZA 1ED3B 2EYSB 1HZHH 4OD3L 4NO2A 3EHBD 3C6LB 1LDPL 3RWJB 4OZHF 2BSRB 4Z0XB 5BXFA 4H0IA 3QJHA 3VXTB 4NO3A 2C1OA 4LNRA 4R97B 4YHNA 3FN0H 4QXGH 3T4AB 5C7XH 1G7JA 3MNWA 2R2HB 2JB5H 1JRHH 4H25A 25C8L 5IB4B 2H2PD 2NY2B 2APWA 3MLXL 4ZOEA 2PYEB 1J1OH 2OL3H 4J3VA 3PJSA 5ICZB 3BZFA 1EUTA 1IAIM 3JTTA 4NQDD 1Y6MR 2BXYA 1EXUA 4QHMB 1CVSC 3P73A 1MI5D 2BNQB 3KYKL 1CDBA 4KMQA 2W07A 5EN2B 4OFYA 4HIEA 1EV2E 1CU4H 2QADC 1AO7B 2FR4A 3I6LD 3LMJL 4GG6A 1YY9C 1FPTL 4MXVF 4F33A 2R8SH 5HJ3A 1R3LA 3VXSA 4ZG1A 5E9DD 3PUCA 2O5YL 2HVKB 4ELKA 3HUJF 1TPXB 2HN7A 4LCYB 3VFTB 1SQ2N 2IWGA 1BECA 2YD2A 4JFOA 4OV5A 5IB5A 1RJLA 4LCWB 1VESA 4XTRD 1TVHA 2ZUYA 2P24A 4K94C 4KKBD 2DQGH 3H42L 3DO3A 3GMMA 2ATPB 4HPYH 1QHPA 5F89A 1KB5H 1PX3A 3FB8B 2ATKA 1Z6JT 2OL3B 4MQXD 4Q0XL 1QD0A 4HMCA 5AYUH 1I9RH 4PTUB 4MMXC 4ODVH 4LLUA 3QO1A 4AZ8A 1FL6B 4NIKB 4XP5L 1QKZL 1JJUA 2C1PA 2NY1C 1UH2A 3TCLA 4ZFZB 1OAXH 4MZ3A 1MFCH 4RGOH 2XZQL 3OGOE 5E6ID 5E00A 1KG0B 1CFBA 1JGEA 3QPXL 4ERSL 4PJHF 3L7FA 1FVDB 4YHPA 1DBJL 4AT6A 4JPVH 2E5EA 1G7LB 4LLQA 3P0VH 1B6UA 3QDJA 1G0DA 4XCEB 4YZFF 4UQ2A 1MRCH 2PO6A 4KK6D 5GGQL 2EIEA 2RGSA 3GB7A 1NC4A 4NKIL 1QSEA 4G8IB 4ZO8A 1FN4B 4Y5XC 5BV7L 1KB5B 2QQLL 4NQEB 1P5UA 4NFBA 1EEZA 4GBXB 5KSVB 3MXVH 1JV5B 5DMKB 3EOTH 3G5ZB 3KPSB 2YD9A 2FYYA 3SE8H 5F9DC 3WIIH 3ALPA 4EQ3A 3M8OH 4JRXD 2NW3B 1PW3A 4HWBL 3WLWC 1TZGL 2BCKA 3HAEH 1P9MA 1YNTB 4OZHE 4U0RB 2XQBL 2F54D 3V0VA 5HGDA 4OLUH 3QNZA 4Y2DD 1GGCL 5I1LB 5DUMH 3OKDA 1AFVL 1OHQA 3QB7C 4EOWH 1VGKB 3CU7A 4WEUD 3S96A 3UJTH 5FUOL 4YK4B 1CGSL 3NVQA 5DEFA 1WISA 4NN6B 3T65A 4YGVB 5MENB 1TDQA 3FONA 4UBDC 1G7IA 2WIMA 5FCSH 2ZCHL 1UCBH 2IEPA 1OT1A 4WWKA 1N8ZB 3ARGD 4HAGA 1FP5A 3K4AA 1OSPH 4WHDA 3QDGA 4OZFG 5KSBA 5JXED 1ZLWK 4CMMB 4WEBL 2C3XA 4IM8A 3V4PL 2KPNA 4ZUSA 3RY6A 3BKJH 3MRPB 1QFOA 2AJXH 2A6IA 2V6HA 1TQCB 2Z8VC 4K55A 1QVOB 1MCPH 5FYJL 1AC6A 2W92A 3GNMH 2X4NB 1T2XA 3GIZH 4H8WH 3HAEB 3QIUB 4L8SA 3KPMB 4MXVE 4PJ7F 4F8TA 2M8XA 3LQAC 3QG6A 3G6DH 4RMUA 5CZKA 3W9DB 3QULB 1B4JH 4JO2L 1Q38A 4LLMA 4U7KA 2AK1H 1YMME 1IT9H 1NGYA 4OLYL 1MCFA 2IMMA 3CMOH 1CDUA 2Z91B 5C0ND 4D0DB 3I2CL 4XXDB 3FT3B 2H9GA 2NX5D 3ARUA 1KB9K 1QEWB 2B4CL 3HE6D 4P46D 2CKBH 1YECH 2X1PA 3MRCA 2CIIB 5I19H 1I7RB 4K8RL 4NQVA 3WS6A 1QRNB 1A3RH 2FH8A 2VWEE 2DL2A 5F7EH 5DLML 1MCNA 4NQCD 3AAZB 4G6KH 3IDXH 4KJWC 4KRPD 3CFCH 2WINA 4R26L 4X6FA 2W0FB 4P9HC 3BVNB 3DMMC 1Q9WA 4HDIA 1FSKB 3TN0A 1OAZH 1YEIL 5IIEA 3RWHB 2X4TA 5JQHC 3VG9C 2Y6SC 4AL8L 2DKUA 4HFUH 4QHUB 1BLNA 3WJLA 1AI1L 4KGLA 5E94B 3B9KC 4YDLB 4XBPA 4YZFE 1I7UB 3IJSB 4XWGH 3QFJA 5ERWA 2AGJH 4KK5C 1RURH 3IFLL 4NKDA 2Z31C 3UYPA 1F6AA 5EA0L 1GOGA 3RVWD 1Z3GL 2DJ4A 5D2NB 2AJUL 2DBLL 4HS6B 3SKNA 3QFDB 2EYRB 3BX7C 4I5BA 1FIGL 3QUZC 1PZ5B 5J13C 1M71A 4XWOD 2P48B 1GOFA 1CIDA 2P46B 3GBNL 1O7VA 4LVOC 1MHEA 3DURB 3P9LA 5LQBH 3VWKB 3LKNA 1XGQB 4UT7H 3UZVB 1T5XA 1HZHL 2IGFH 4MQTB 1KIRB 4N5EC 1NEZA 1MRDL 4Z7NF 5D7LE 3WHXB 3VA6A 4XPHL 2GJ6B 4RWHA 5IB3B 1K9TA 4ZO7A 5DEGB 5E6YA 3I02A 8FABA 3F7YA 4P23B 1FZOB 4UDTA 1CXHA 3FFCE 5IB1A 3GJEA 1NLDL 4LFHD 3VFRA 5KS9B 5DQDH 5DC9B 2X89D 3NFSH 2JB5L 1JRHL 1T04B 1L7TL 2X9YA 3QG7H 3QI9C 4FNLH 3MBED 5IESH 4JFYB 2JB6A 4LGSB 1XCQA 2HLFD 4MVBD 2RQ8A 1HHJB 1J1OL 5A2KH 3SKOA 1NC2A 1TIUA 4TUJB 5DJ6A 4GKNB 2EXYD 4R96B 1UXSB 2WBJB 4BQBA 2FX7H 3UTSE 1XR9B 4UT9H 3EIFA 1CU4L 2XPGB 4JFXB 2R8SL 3IVKB 4Z7OF 2GT9B 4NKMB 1WAAF 2DWEA 1AD9A 3QSKB 4IIQC 1RUAH 1IAMA 3HTLX 4N68A 3S35H 5LGHL 1XF2A 2EYTA 1KLGA 2DM7A 4RAVB 4WHYG 4PS4H 1T7WA 2XN9E 1VEOA 2DQGL 4MJ6A 1QNZH 3KJ4C 5FGRA 4FA8A 3LD8C 3OAUL 2NNAB 4YPJA 4HPYL 1KIUA 4D9QE 1W0YT 4KWUA 1KB5L 1OW0C 1A5FL 2VKXA 1BX2B 3T4YB 3TM6A 1YEDA 3NIGF 1LEIB 3BD3A 4PJXB 4MNHB 1CI5A 5AYUL 5LWYH 4ODVL 3FO9A 1LHZA 2PCPA 1U3JA 2D0FA 4JM2D 2FLRT 4D8PB 2EDQA 4FQ2L 1OAXL 4RGOL 3U46B 4EVNB 1N6UA 3C08H 2EXWC 1A7PL 3O45A 5D1QD 2F15A 3IT8D 2X10A 3W39B 3MFFB 3ROLB 1F2QA 3PWJB 1I8KA 4UDUB 3P0VL 1NGXB 4XHJD 3RIFF 5HBBA 2E9IA 4OBSA 3QNYA 5DRNB 1QG3A 3IFOA 4P4KB 3VXRA 4TVSa 4XI5C 3HB3D 4KZDL 3BPOC 5GZND 3Q0HA 4ZYKA 2P5WD 2A0LD 1U92A 5HHOA 3TVMB 1IAOA 4GSDL 5B8CB 4Y89A 5ISZA 4PJDF 1HILA 4R4NC 3ARXA 4GAYA 4TVPE 1FFOA 3UTTB 1MCCA 3EOTL 4PJBA 3PWLA 2OTPA 1J86A 2AEWA 5EOTA 3ILPB 2AV1B 3UX9B 5IFAL 1NQBA 3CX5K 3M8OL 4FTVE 3FCTB 2JK5A 4Z7NE 1KTKE 1UJ3B 1CICB 2W9EL 4ALAH 5SX4H 5DDHB 3WFEL 5HHME 5DUML 3Q3GA 1VEMA 2FCBA 1E4XH 3RIFK 2GUOB 5I18H 4EOWL 1P69B 1SMOA 4IEFB 2CRZA 3UJTL 3FOMB 2XFXA 2AJVL 5DJDA 4AY0A 3ZE2E 4MCZA 4DZBA 5CZVH 2NPLX 1BZ7A 3G6JA 1AKJD 2XQYK 5L7XH 1CLYL 2DJUA 5AUMA 2C4XA 2Z92A 4YDVB 4QXTB 3HC4H 4YR6B 2EZ0C 4XC3L 1UCBL 1X4XA 5KZCD 4HUXB 3GSXB 5L9DH 3OKEB 2HFTA 3EO9L 5LJYH 4LLDB 1W8OA 2RHEA 1F90L 1KJ2A 5BS0B 3BKJL 5JPNA 2MPAL 2FJFA 2P5EE 3RTQB 1MCPL 4NM4H 1MF2H 4KK9D 1P7HL 3GNML 1UA6H 3GIZL 4H8WL 2VXSH 4S1SH 2YMXH 4Z7OE 2CLVA 2R4SL 5JPMA 1IKNA 3V5HB 3G6DL 3CC5A 2Q76A 3QT2A 3GKWH 2FECI 4HIHA 2FZ3B 4Y4FA 3W9EA 4W4OA 3NGBC 1INQA 1SVZA 2AK1L 1EFXD 1ZANH 2EO1A 1IT9L 4YPGA 4ZFOL 3F12B 4DEPC 2HFFA 2N1KA 3CMOL 5EUOF 1R6VA 4OF0A 5E2WH 3DXAB 4F9PC 5C07A 3QIBA 4HBQA 1NEUA 5I76B 1I9JH 3LHPH 4YDJB 3D2UA 4P5TB 1R5WA 4X5XB 5M95B 1TZIA 5LVEA 2R2BA 5MEQB 4HHAB 5HHPA 5E0QA 3ET9F 1BGXL 3TLRA 1P7QA 4G42B 3NIGE 5F7EL 3MROA 3IDXL 4XPTH 3KLHC 5FYKH 1MCSA 3CFCL 4U1NA 4XNMA 3HMWH 4Z7VF 5KANI 4LVNB 2V2WA 4JPIA 5I1CH 1P2CB 2VISA 1U91A 4L4VD 4N9GA 1I8MB 4UAOC 1OAZL 3OKMB 2JELH 2E6JA 5DJYA 4X6DE 2JJWA 2QQKH 4HT1H 2BP3A 1SEBA 1FZJB 3VD5A 4X80H 5C0DA 2H3NB 3V5DA 4XWGL 3TBVB 1CE1H 4X7EC 3MOAH 3M07A 3T3ME 2PTUA 1RURL 2NY3B 4EDXA 1C12A 2DQJL 1JHLL 1VFOA 5C0AD 2ADJA 1UZ8B 5F7YC 4NQDA 3MO1A 4U6XA 1WT5C 4LLWB 4PJDE 1MI5A 3PHQB 1F4YH 1CDGA 5HDBE 3CCHB 5IFJB 1S9WB 2F74B 3UBXB 1Z9OA 5DRWA 5JW4R 5HI5D 3QEGL 5CP7A 4M6NL 3GI9H 5CEXA 1MUJB 3S36H 3LKPB 3O4LE 1IC4L 3NABL 5E9DA 2HJLA 4KRMB 2Z8SA 1EZVX 5B38B 4X98A 5F6HI 2Q8AH 5I1DB 1BFOB 4HWEH 4K3JH 2ITDB 2IGFL 4JFFD 4IRJB 4HKXB 4NQTA 2NZIA 3ZZ1A 2ED7A 3RJQB 4D9LH 1HOCA 3GUTB 5T5NF 1U9KA 2LQRA 1QA9A 3HMXL 4NHCH 5SV4A 4HLJA 4RFEA 5A3ID 1YUHA 1KBGH 4YXHH 2VSCA 3HC3H 4TVPL 1Y6KR 5DRZA 2BRQA 5DQDL 1A6PA 3VRJB 4DJMA 4FNLL 2VIRA 2KL6A 3QG7L 5GS1A 2BSTA 5JTWA 2VH5H 5E8PB 4EN3A 1G7PB 5E6IA 1TLKA 1ZVSB 5T5NG 3RI5F 4ZUTB 5IQ7L 2AXFB 4NSKA 2VE6B 5A2LH 5INCB 1XGRB 1NMCB 4LP4A 2FX7L 2ZUXA 2APBA 4WUKH 4PGDB 1XF3B 5KSUA 1WZMA 3HC0A 1IGML 1J8HB 4FQHB 5EUOE 5ITFA 5D70L 2B0SH 2PKDA 4TPRH 4MNGA 2E9JA 3RX7A 1RUAL 3S35L 4AH2B 2WLYA 5C08E 1S7RA 2PN5A 3MGAA 4GFTB 3MR9B 2UZIL 4RIRA 3VE0A 3WDJA 4PGBA 5DJCB 1OTTC 3SKMB 3JV0A 3JWOH 4PS4L 3CUPA 5T1MA 2DKSA 5ITBH 3H0TA 1JPST 1QNZL 2ED8A 4XBEH 4Z7VE 4HH8A 3FB5A 3TYFB 2F54A 3K4ZA 4HAFA 1A6ZA 4Y2DA 3ZL4H 3ARPA 3RWIB 4M62H 2QADD 4NBZB 3K1KC 5CBAA 4CVZA 3TPKA 1ZLUH 4F15B 5J56B 3WL9A 1LP9B 1TJHL 5IEKB 3GBMH 3ZLQC 1FG2B 3TBWA 2PYFB 2A83A 1BQHG 1P7KA 4F57H 1YEGH 4XNZC 1CL7H 1U3HB 4PJ9C 5IVXF 5CD5D 1IE5A 5D1XC 3JSSA 1MRFH 2A6JA 1MJ7H 1GGIH 2QSCH 2V5YA 2X4SA 1NCNA 5L2KD 2O61B 3ZTJH 1U93A 1IGFL 5CSBA 1YY8A 4NO2B 1F97A 3S88H 3BWUC 4Z7UF 1D6EA 1KT2B 5BXFB 5DVMA 3QJHB 4M5YH 1G84A 3D69A 1T7VA 3L3DA 1FCGA 4NO3B 2C1OB 1GZPA 5FDYA 2VDOL 1E4KC 4NWUL 3G9VA 2WP3O 2NX5A 4ALAL 3HE6A 4P46A 1P84K 1BD2E 3O0RL 3MNWB 4L9DA 4H25B 3QEUB 1CFSA 2VAAA 4NQCA 1WZLA 3U9PL 4Y16C 5FUCE 4RGNB 4OZGF 2OR8A 3OAZH 3PJSB 2J5LB 4X9BA 3DSNA 5CZVL 1XGUA 4P2QA 4UOW1 4E5XA 3VWJB 1FFQA 1EXUB 1F02I 3P73B 4LPCA 1S9KC 4U1SA 3FMGL 1MCWM 4HGWB 4MYWB 3O2DA 5L9DL 4H20H 4PJIF 3DUHA 4HIEB 1ZHLB 5HHQB 2WMPA 4Z7WA 1H3WM 4GG6B 3O11A 3WLWD 4F33B 1R3LB 3DTXA 4M4PA 4YGAB 4NNXA 2VABA 2YD1A 1QLFA 1NSNH 3LDBC 4ELKB 2HN7B 2YUVA 4QTIL 4NM4L 1MF2L 5AG9A 4JFOB 3LKRA 4OV5B 5IB5B 5I17A 1RJLB 3MRNA 5ID1B 1TVHB 2AEQL 2P24B 3OJDA 4L8DB 5F3BA 4UBDD 4YBQC 3VXMD 5DK0A 2VXUL 4JANA 3GKWL 3GMMB 4WUUE 5F89B 2NY5H 1A0QH 2D3VA 2ATKB 4U31A 3T3PF 4LSTH 5DYOA 3U83A 1URLA 5I2IA 4LLUB 1I9JL 1U8OA 3QO1B 5BW7A 1MCDA 3RHWK 4IHOA 3LS4H 3MJ8A 2C1PB 5J3HC 3TCLB 5LXGL 1AY1H 4NOBA 1A14L 2WBKA 5E00B 4JO1H 1JGEB 5EPMB 3L7FB 4YDKH 5FYKL 4DFIA 4G9FD 4YHPB 1XF1A 4AT6B 4LLQB 3HMWL 3QDJB 3NAAH 1BVZA 3D3VE 4UQ2B 4LMQE 1D6VH 4FQQA 4OLVH 5DMIH 1OL0A 2X70A 1RZFH 2VDNH 3RWDA 1FYTD 1U42A 4P2YA 3VXSE 3GB7B 1NC4B 4FFWC 4RCAA 5IVXE 3QQ4A 1DDHA 2QQKL 1UKSA 2DM4A 2X89A 1IC1A 1NCDH 1T80A 1EEZB 3SJVD 3UXFA 1RJZA 1ADQA 2F5AH 4KJWD 2RR3A 3Q48A 2P42B 4I4WA 2CJUH 1I7TA 3DMMD 3O8XB 3ULVH 4W6WB 2OJZH 4Z7UE 1M05A 2BCKB 4FFVC 3HZKA 3QO0A 1F4YL 5I74B 3V0VB 5HGDB 3QNZB 5DR5H 3ESVF 1BVKA 5I73B 3RWGA 3GI9L 3S96B 3UTPD 4NZUL 3MRMA 4U1KA 5DEFB 2WANA 3T65B 2NY4D 3E8UL 3FONB 1G7IB 3MXWL 1IGJA 1MY7A 1LO2H 4QHKI 3WV0A 4WWKB 2Q8AL 2CR6A 3U4AA 5T3XH 4ZFFA 4FXKA 1XZ0A 3I6KA 4HWEL 2V5TA 1DVFD 4UTBH 4OZGE 3PL6C 5A2FA 3QDGB 4YAQB 4MB5A 2O5XH 1RZIA 2YWZA 4CKVX 4ZUSB 3BN3B 4OCMC 3NACH 1PKQE 2A6IB 2GSIA 3NBNA 2Y07H 4QHKJ 1KLFA 1QSEE 4NHCL 4PJIE 1HYSC 1I1AD 1CDIA 4JCMA 1R3KB 4YXHL 4L8SB 1I1FA 2X44D 3QG6B 4YC2C 4JM2A 1RMFH 3CFKA 1S7UA 2DLHA 2VH5L 2NYYC 2V2TB 2DIJA 2DI8A 4Z95H 5HVFB 2MQ0A 3ORJA 5C0GB 1NGYB 5D1QA 4N5ED 2UYLA 1RIHH 4ZD3H 5EZJA 4CU7A 3FT4A 2VQ1A 2H9GB 3LSOB 1WFTA 2DKMA 3MRCB 4EIGB 5EZOH 1C5CH 4YXLL 1KPUB 4WUKL 4R0LA 5K9KA 3BZDA 4ZUVA 2R9HC 2VRAA 4I1NB 3T3PE 4AQ1B 4KI5F 2B0SL 3NFPA 2P5WA 4LSRH 4R8WH 3IAGC 4TPRL 4APQC 4X6FB 3QI9D 4JKWA 5B4MD 5AWNH 1JVKA 4PGEA 3UZEA 5F93C 4Y19E 5CJXC 5KSBE 4LSVH 3UDWA 4M9OA 2WP3T 3JWOL 5IIEB 2X4TB 3H7LA 4UOW0 2IFGA 1K6QL 1NEZG 2XWTB 4RNRA 1BLNB 1MNUH 2GJZB 4XBEL 4PJ8A 2GJJA 1IQDA 4JFPA 2VWEC 5GRVK 4TSBH 4S0SD 2ADGB 4F7CB 4BSJA 3QEHA 3QFJB 3MCKA 5ERWB 3T04D 3ZL4L 4XP4H 2MMXA 3MCLH 3C5ZC 4LDOB 1ZVHA 3PXHA 4NKDB 4PB9H 5D71L 1R5IB 3FO0H 3MRHA 1F6AB 3VGHA 1LK3L 3EDKA 3TV3H 4RX4D 3DUUA 5AZ2H 4U1GB 3GBML 1AHWC 3SKNB 1N64L 5FKPA 2KZWA 5IW1A 1FFPB 4I5BB 3RKDC 4UIMA 4F57L 1YEGL 1M71B 1WBZB 2K7QA 3IGAA 5DD6A 1ZKAA 5K9QG 3UTQA 4ODSH 1X5XA 4Y4HC 4MCYB 3WNPA 4G80A 2F53D 1MRFL 5DT1H 2QSCL 2VR9A 2FLBT 3P9LB 1U8LB 1R5VA 4G6FB 2I07A 2VUOA 3BGFC 1OD9A 4JHBA 4RFNB 3AROA 2X4RA 3WSQH 2FD6H 1J12A 4PBVC 4BZYA 4FQPA 1BJ1H 5B21A 1UM4H 4UDTB 5F6IB 3GRWA 4PYGA 3AU1B 4ZS7H 1MVUA 1A47A 4AM0A 1K5NA 1A6AB 1U8MA 3GJEB 1ZLSH 3ILQD 4NJAL 4QGYA 3VFRB 5EULV 5FGBC 1CGUA 1NJ9A 3B2VH 4OB5H 5DFVD 4XI5D 2OSLA 4DUWA 2OI9C 4PJGB 5F9WC 3SKOB 1TQBB 1NC2B 1V7NH 1OPGH 5JUEL 5DJ6B 5GRZA 2H1PL 4JRYE 4R4ND 1AQDA 1GOHA 4L4VA 3X3FH 1GH7A 4KJQC 3MV9A 1JBJA 4OUUB 4RBPH 3CD4A 2AKRA 1E0OB 3S9DB 2BNUA 4NKOA 4JVUA 2YKLL 4HMDA 1H3GA 3T0EB 2DWEB 2DBJA 1AD9B 3QUXD 2XY1A 1NUDA 2EYTB 1SMAA 4D2NA 1ULVA 5C0AA 4KI5E 4PB0H 4EI5C 4MJ6B 4LLVA 4M48L 2EZ0D 3BD4A 4ENEC 2NY5L 4JR9L 3D25A 1A0QL 1KF9B 2C3VA 1RIUH 5IT2L 3BIKA 4K3EL 4N90D 3R1GH 4NZTH 1WIPA 1HXYA 3U82B 1F4XH 4MA3A 1JPSH 3LS4L 1UM6H 5IR1B 4V1DE 5BJTA 4GRWH 5LGKA 4JO1L 3O45B 2ICES 3FKUS 5DURB 4YDKL 4MNQE 1PJ9A 2Y36L 2W59A 1NBVH 4HKZB 1ZLVH 1FL3A 1A9BA 4QOKD 2EDKA 1B88A 3QA3B 4L5FH 2DMBA 2ZCLL 1D6VL 3QNYB 4OLVL 1PBYA 2XNAA 1H0DA 1OAKH 5DMIL 3MMEB 3IFOB 3VXRB 2VDNL 2ADIA 1KPRA 2EH7H 1IFHH 2YD7A 5FAAA 1U92B 5HHOB 2QBWA 5F1SA 3LCYA 5ABDE 4KVNL 4P2CG 1AR1D 5ISZB 1IGYA 1NCDL 1X5JA 3S5LA 1HILB 3NIFE 2IANA 2CDEA 4GAYB 2KBGA 3DX9A 1FFOB 3SGEI 4PJBB 3SDDC 4I3GA 1CT8B 5JHDD 3EYOA 4DOHE 5EOTB 3C8HA 3OB8A 1WUNT 2AEPL 4AQOA 2EH8H 4JREC 3DWTA 2OJZL 4GRWB 1VADB 3VGAB 3VGFA 3W2DH 4HKBA 5DR5L 4X0KA 3Q3GB 4XBGA 3BYYA 4KKAD 1HSAA 4YE4H 5ANME 4ZQKA 2GCYA 3CPLA 4CJ1A 2H8PA 2XFXB 5DJDB 2BZDA 4DZBB 1BZ7B 3G6JB 2A9MH 2Z92B 3RWFB 1LO2L 1KCSH 2VZUA 4Y4KB 2C4FT 5ILTH 1G9NH 3B2UC 4UTBL 1CXLA 1L9MA 2QR0A 5B3JF 1KJ2B 4NRYA 4YH6A 5TE6H 1HEZB 2R23A 3AMKA 3RUGF 1Y0LA 1MLCA 4D9RE 3NACL 5IV2A 5JPNB 4UV7L 5DD0H 5M94B 5AEAA 1N0XH 5H37G 1NFIA 1XH3B 1XGYH 4F7MA 5EBMA 4XAKE 4M00A 4R3SA 3JV4A 5JPMB 3TNMA 3CC5B 2Q76B 1RMFL 2QV2A 1TITA 4HIHB 5I1GL 2GI7A 3G04A 3L3IB 1INQB 4ZO6A 4P4KC 4YPGB 2IBZX 2FATL 5DVLA 5C0BB 2APXA 4R7DA 1RIHL 3LEXA 1PAMA 4ZD3L 3FOLA 5C07B 2Q86A 3QIBB 4GXUN 3RVTD 4E41E 1R5WB 1PG7X 2X9XA 5EZOL 1C5CL 2R2BB 4F80A 1F4AA 3OL2A 1JYNA 5HHPB 4C4KT 1P7QB 3QNXA 4ZS6D 2BJMH 1FL5B 1IAIH 2VZOA 2XTJC 4LSRL 3BKYL 1CS6A 4P3DB 4U1NB 4XNMB 5CGYC 2AI0H 4HUNB 1JGDA 2V2WB 5AWNL 2VISB 1U91B 3IRZA 1MCOL 4N9GB 2XG4A 5DK2A 5HGBA 4LSVL 3QUKA 2NR6D 2EE6A 4LVEA 3I75A 3VFMB 2XA8H 4TSBL 2VC2L 4N0CD 1SEBB 5D7IB 3U9UA 5IP4A 5C0DB 2Z9TA 2VZSA 1KPVA 3H6JA 3O2WH 4Y2OA 2QSTA 3V5DB 1AH1A 4XP4L 1OQOA 4KMLB 3MCLL 1A7RL 4A2LA 4EDXB 4LSPH 1C12B 4PB9L 3FO0L 2ADJB 4Y5XA 2Z35A 5JIHA 3MO1B 5SV3A 4U6XB 3P0GB 3TJEH 4HK3J 1RHHA 1YNKL 5AZ2L 1GHFH 4L8CA 3S3JA 2BHYA 1MI5B 4R7NA 1OTTD 4QTHB 3ULSA 3RTQC 1A22B 4JDZB 1R3HA 5DRWB 1D5XA 3BZ4B 4ODUA 4J3UA 5CP7B 5CEXB 4O9HH 1C1EH 3GZKA 4F7PA 1ORQA 3C09B 4LHJB 2HJLB 3N50A 2B5IC 4CN4A 3GHEH 4W6XB 3L5JA 4X98B 2XY2A 4OZIB 3U2SA 4O4YL 2D4FA 5DSCA 2KH2B 4ZSOA 3EW3B 1XCTA 2FD6L 1HQRA 4GQ9H 2OTWA 4ZPVA 1Q1JL 1HOCB 5C2BH 4LSUH 1QA9B 4O5LL 2E6PA 3QP3A 4ZS7L 3M1BB 4RFEB 2HT2D 4ELMF 1YUHB 4EEEA 5F7LB 3WYRA 1ZLSL 3RZCC 3ZYOA 3RUGE 4H26B 3TO2B 1MJ8H 4OGZA 2X1WL 4LLYA 2VZTA 3TO4B 4OB5L 2VIRB 5T3ZE 2BSTB 3NH7L 1K3IA 3FQXA 4EN3B 1S9YA 3D5OF 4NQDE 4W4NA 5CUSL 4U0QB 1WJ3A 4G9FA 4PP2B 1HINH 2UWEA 3KPTA 4NSKB 1OPGL 4PV9A 1U8KB 2IADB 3OG4B 4U05A 4NN5C 3X3FL 4JHWH 3I6LE 1O0VA 4DKFH 4GRMA 1JPGA 4NZRH 3HC0B 4HV8A 5E9DE 4FABH 5ITFB 3MNZA 1DCLA 1T83C 2BMKA 3OJ2C 4MNGB 4YBLB 2R0KL 3O9WC 5IMLB 1S7RB 4O02H 4RIRB 4W68A 3VE0B 2VLKB 4ZOCA 3DNKA 1VA9A 3CUPB 3MV11 3U4BH 1WZ1H 3DMMA 2OJEA 1AQKH 3FB5B 1NFDA 3OJMB 3TH4T 1BBDH 2C26A 2F54B 4UT6H 1A6ZB 4Y2DB 4JZNA 3MYJA 3DETC 1RIUL 3FFDA 5E8OA 3R1GL 5CBAB 4CVZB 3KYMA 5IMMA 1OGAD 1F4XL 2DYPA 4C55A 1U8IA 4HK0A 1DUZB 1JPSL 2CO6B 4M6AA 3D85D 5GGUB 2AV7A 3NN8A 2HJKA 1CGYA 2VKWA 3TBWB 4A2MA 4PP1D 1RUMH 3LOWA 2RBLA 3MRGA 4R4FL 5AAMA 4YBQD 5I1IH 4JAMA 4DUVA 2A6JB 1VDGA 2OCFD 4TNWF 3C6SA 4WV1B 1OAKL 1FNSH 1U93B 4ZFGH 2H26A 2FHBA 1BM3H 2GFBA 1I1AA 3AY4C 1YY8B 2MKWA 1IFHL 4BZ1L 2MCG1 2NQCA 5FOBB 2VO5A 1OAYH 3SEPA 5J3HD 5D5MA 1KJ2L 1NMCC 2KQMA 4C56E 3MACH 3D69B 3L3DB 4JRXE 1GZPB 3PDOB 3U6RA 3L3GA 4XP1H 3F6IA 5ICYA 1DANT 2EH8L 3C60C 2ZJSH 3DX6B 1FORH 1J5OL 4WDIA 5J9PB 2NX5B 1EA9C 5JDSB 3PGCB 3VD3A 1KACB 3QCVH 3OXSA 3PABB 1F2XK 1CFSB 4OT1H 1OM3H 4FFWD 2VAAB 4NQCB 4KY1H 2VMFA 4ELME 3K4DA 4OIIH 4CU8A 4M8QA 1H15A 5IQ9B 1XGUB 4P2QB 2A9ML 3QI9A 4E5XB 5CD3B 1F6FB 4LAJH 1SYVA 4JLRA 4U1SB 5FGSA 5DD3L 5IHBA 5ILTL 1G9NL 4HLZH 4JFDE 3KPOA 2IG2H 3ARSA 2IAMC 4IJ3B 4Z7WB 3O11B 5TE6L 1PSKH 5ADOH 4HMEA 4N9OB 5FUCC 3WMSA 1QLFB 4NJ9H 1I75A 5DD0L 4X6CE 4M6OH 1N0XL 1N2RB 3IKKA 4MAYC 3EAKA 4MX7A 3LKRB 3ARTA 5I17B 3MRNB 5J89A 5GRXG 4IIQA 2Y5TA 5DUBA 4AEFA 5F3BB 5HYFA 2DTSA 4U7SA 5ENWA 5JIPA 3HS0B 3QUYD 3WFBH 4HXBL 5KG9A 2ZOLA 1BJMA 1ADQH 2ZNXA 3BRDA 2F53A 5IFHH 1U8OB 2LTQC 3ULUH 1OW0A 4LASH 3CXHK 4MA7H 3SE4A 4BFIA 1QBLL 2XICA 4G3YH 3TBYA 1PD6A 4U6YA 1UB6A 2W91A 1FVCA 4WI6A 3UMTA 2GY5A 4GW1A 3UAJC 3OR6A 3SN6N 4DN3H 1IGTA 3ZE0F 1A3LL 3B9EA 4Q6IB 4K7FA 3OB0K 2I9TA 2IALA 3VXQA 4BH8A 4X9FA 2ZUQB 2X70B 1WC7B 5F7KC 4GMTH 2YZ8A 4JFEE 2H45A 1NCWL 2WUCL 1DDHB 1NL0L 3H9YA 4HPOH 3AB0B 4X7FC 1UH4A 5INDA 3O2WL 5D2LA 4KUZH 4PJ5E 1RJZB 3DBXA 3JWDH 4L8BA 4AIXA 3LIZH 4LSPL 3IS0X 5GGSA 2OM5A 1NAKH 5EC2A 5C0CD 4I4WB 4WTZG 1YMMD 1I7TB 5CEZE 4TN9A 3INUH 1KC5H 3IS1X 3RIAK 3HZKB 3QO0B 3CFBB 3VW3H 1X6NA 1BVKB 1I8IB 4P59H 4J3SA 3BSZH 3GO1L 3U7YH 1CVRA 4P2OD 1C1EL 3ZSTA 2EDBA 5DF0A 1IC7H 3MNVA 3QUXA 4OFIA 1FNFA 3GHEL 3R06B 3UPAA 1CD1A 3EGSA 5TF1L 4ZFFB 4FXKB 3H7BA 1XZ0B 3I6KB 2X1QA 5AG8A 4PFEA 4JZJA 4LLAA 4XNXH 2ESVE 4KXZI 5DHVA 4DVBB 1WWAX 2FIRT 4GQ9L 1IZKA 4L4TD 4CVUA 1DQDH 3EDEA 5C2BL 4NT6B 2VXQL 5FYJU 3RKDD 1HCFX 4OD1H 3VXOA 4TSAL 4J1UA 1A4KA 1K4DB 3D87B 3GMRA 3KJ6H 4I77L 4J2XA 1YEHH 2DMCA 3WHE1 5BRZE 1N59B 2IQ9H 4F7TA 1J0YA 4UV4L 5HVGB 1SJEA 5E99H 4LHUG 4XPAH 3DVNA 1DR9A 4PBXA 1Z5LB 1D7FA 3CFKB 4PJEB 5C9JA 5IOPA 2EDEA 5E8EB 3QIWC 4I2XE 4KRLB 4M1CD 3RKPA 2PO6C 5D1QB 4Z77A 2UYLB 5EZJB 1HYRC 1HINL 3FT4B 4PJCA 3QDME 4MA8H 4MA1B 4QOKA 1GC1L 1X5YA 2OQJA 2VXTH 4XAWH 2FEDC 4JHWL 3QWQB 4K9EC 5LCVH 4DKFL 4R0LB 5K9KB 3I3BA 1AP2B 4ZUVB 3VGDA 1BZQK 4XNYH 2ZUSA 5K9QI 2DI7A 1LP9F 3O6KH 3KXFD 1KTLA 4U6TA 3KNBA 2DD8H 4PGEB 1UT9A 3WUWA 3AXLA 4O02L 1EO8H 5EU4A 5D7LD 1RK1A 4C54A 1DE4A 5JHDA 2XWJB 2VR5A 5EU6B 3ZE0E 2EEDA 3CX2A 4IMKC 3P40A 4RNRB 1ZT1A 2XI9A 4PJ8B 4JFPB 1AQKL 1EVTC 1BBDL 4UT6L 3RP1A 4KJQD 3RNQA 1JHKH 3MUHL 3SE9H 1NGPH 4Q7DA 1OTUD 2MCPH 2QEJA 4E42A 1K8DB 3MLSH 4WJ5A 1S7WA 3BP4A 3PWNA 5IF0A 1BFSA 1KJMA 2I9LA 1CG9A 3DUUB 1EHAA 3X12B 1S7TA 1KULA 3BDYH 3RY6C 3QDAA 3L3HA 4R90H 5FKPB 2M26A 3BI9X 3DPBA 5IW1B 5KZCB 5HI4C 4UIMB 1RUML 1PQZA 3RY4A 3IGAB 5DD6B 4JDTH 1CFTA 1QFWH 3MJ9H 4MLSA 5I1IL 1JF6A 5EIIA 4G80B 1WT5A 2JCCF 3BIBX 3LKQA 3KHQA 5J11B 4RAHA 2Q20A 1FNSL 4NC1E 1R5VB 5E5MA 2I07B 2P5WE 2XZCH 1JTPA 4ZFGL 1BM3L 1A6WH 1VB9A 4YHZH 3PNWA 2AXHA 3O2DL 1HN1A 2D7NA 2X4RB 4KMTL 1MLBA 4X7SH 5IK3B 43C9B 5GRYA 1TJIL 4UNVA 3MRBB 2HVJA 2A73B 3MACL 2GEEA 1WBYB 4PRDA 4QRSA 4XVJL 1MVUB 4GG6F 3FHAA 4XP1L 3VD9A 1K5NB 1J9CT 5C09E 1JGVL 1U8MB 2ZJSL 2ZUTA 3TT3H 1FORL 2HG5A 2GTWA 3QCVL 4WY7H 5GGVY 1NJ9B 4QRRA 2J6EA 3WN5C 2L4OA 3DI2B 4OT1L 1OM3L 2OSLB 3TN0C 8CGTA 4KDWA 4KY1L 2OR9L 4OIIL 3DROA 5CLWA 4IBLT 5IBUG 3PHOA 2JJUA 1AQDB 4P2RB 4MXWH 4L4VB 3QH3A 3SDDD 4WO4D 3MLUL 5CCKH 4OCSH 1QFUH 3VXUA 3MV9B 2IG2L 5EBWA 4BFGA 2P8MA 1FC2D 4GKZA 2VUYA 1LO3L 1EEYA 1N7MH 2R69H 3RVXD 3CGTA 1HIMH 4NJ9L 5EZIH 1VGEH 4S10A 4NBXB 4QGTA 3VCLA 5EH1A 1YEJH 1HCVA 1HXMB 2EKSA 1JZ8A 5EBGA 1JZ5A 4FQXD 4FZEH 5IBTH 1PFCA 4FTVD 2ZKHL 3D25B 4LKXA 1WEJH 4NCC1 3H9HA 2OP4H 5GS2D 3WFBL 1JZ3A 2C3VB 5SX5K 1U2HA 1TVDA 3N1QC 5FM8A 4RDQG 3BIKB 3C2AL 3GSNA 1ADQL 1BVLA 5IFHL 3U48A 4YHYC 4MA3B 2IF7A 3ULUL 1ZGLP 4MA7L 4YXKH 1T0PB 4G3YL 4KI5C 3EYVA 3BD5A 1BOGB 2P4AB 4TNVK 5EORH 2ILLA 3IRPX 3HFMH 4DN3L 4GH7B 4G7YH 4LOUD 2JIXD 1FL3B 4OJFH 4PRNA 2MKLC 4UI2A 3EOAA 2NXZC 2X41A 1A2YA 1NGZA 2EDRA 3MGOA 2XNAB 4EUPA 5HY9A 2HTLC 5DZLA 4JGJA 1A1NA 2R1XA 5SWZE 1KPRB 5JORA 3QPQD 5D1XA 1I1RA 3CSGA 1B0WA 4QLRA 2JCCE 5EOCH 4ODHH 1RUQH 3S5LB 2Z93A 1T89C 5C0AE 2IANB 2CDEB 2CH8A 3DX9B 3GM8A 5DFWH 4HJGA 3LIZL 5EFIB 1IMHC 1NAKL 4Y5YC 5C0FA 5DJZA 1GPOH 3CVHA 3MV7D 5KVDH 1FGNH 1KC5L 1RIVH 1WZKA 4S0TD 3VW3L 4DVRH 1CR9H 2R0ZH 4XBGB 1DN2A 4P59L 3ULVF 1MIEH 1I9EA 1HSAB 1VFBB 4P99A 3BSZL 4ZQKB 2GCYB 2H8PB 3U7YL 4K94H 4Z76A 5GRJH 5FYLE 3WNLA 3T0XA 4HS8L 4JFFE 5I0DA 3O6FC 1YJDC 1RK0B 4OSUH 4DAGH 3HZMA 5HYSA 2VLME 2OTUA 3TJHC 1EAPB 4P57A 4PREA 2LVEA 2R23B 1P1ZA 3SOBL 1WWCA 1DQDL 3SDAD 1Y0LB 1MLCB 4Z6AT 5IV2B 2GYSA 4OD1L 3DO7A 2QADB 1NFIB 3N85H 3P9MA 4MQSB 2OMBA 1LE9A 2NY0C 4F7MB 4QRPD 2IQ9L 1KCUH 1OGAA 3GGWA 4R3SB 3U0WH 2MSPA 1UWGL 2BRRH 3TNMB 3D85A 5IBLC 1NGWA 3G04B 5C6PB 1JWMB 5DJXB 1FNEA 4PD4K 3C8KA 5IHZA 5GGRY 3MZGB 3QISA 5TFSH 2GK2A 2YD3A 1V3LA 3FOLB 5IMKA 5DS8A 4MA8L 2Q86B 2BNRE 2VXTL 1QUNA 4RMQA 5IHUH 1WTGT 2ZSWB 4L9LA 3O4LD 3NA9L 3GMLA 2XIDA 3HG1E 3ARVA 4Z7QF 3QNXB 1J1XH 4AENA 1T20B 1JK8A 3MRFB 2XZAL 5MEPA 4WFGE 2A9NL 1KIPA 3D1MC 2NY1B 2DD8L 4JFZH 5KSAC 1XAUA 5DK2B 5HGBB 1BIHA 3DI3B 3QUKB 2FX8H 1I85A 1RZJL 3I75B 2FSEB 1A7QL 3QCTH 4QHNB 1KPVB 4U1JB 3SE9L 2VLJB 2QQQA 5BZDA 3MJGX 3D0VA 2MCPL 35C8H 2SEBB 4YWGH 3S35X 1HQ4A 3GRWL 4Y5XB 1EJOL 2PTTA 4YX2L 4L3CA 2FO1A 4R6UA 4LF3B 3WFCL 1RHHB 1BP3B 1QSZA 4L8CB 3G9AB 3VXPA 4R7NB 3ZYZA 1VACA 4MDJB 4BQCA 4QRQA 4X5WB 1ZE3C 3L5HA 4JE4B 3VFSB 5DFTA 1R3HB 4X9IA 4B0MM 4ODUB 3QWRD 1U8JA 3OHXA 5L2KE 1QFWL 3CFEA 2UVFA 3FTGA 1AGBA 4F7PB 3O4OC 1FVEB 3LQAH 3LN9A 4BH7B 5CS7A 3MPCA 3I3EA 4XB8A 4G8EA 4Y4FC 4PJGF 5LAXA 3ULVE 1A6WL 5C08D 1F8TH 4NGHH 1DQLH 3U30B 2WWKT 4ZSOB 5DSCB 2HMID 4Y7MA 2NMSA 4X7SL 2H2SC 4JQXC 4OAWB 2OTWB 4ZPVB 1MJUH 2VN4A 1ONQA 1V8HA 3BDXA 3DSFH 2P47B 3IAQA 32C2A 4OZHA 2G75A 3Q5OA 4HC1A 1UXWA 3CH1A 3C5JA 3TT3L 5F44A 4WGWB 1M1SA 3EHBC 4WY7L 3A6OA 4LLYB 4P9HH 2YRZA 3TZVD 4OLEA 1S9YB 1NCAH 3L6FA 4B41A 5FECA 1ZAGA 2A6KA 4GRLD 4M9PA 3AREC 4PPTA 4G9FB 2UWEB 2W0KA 3ARFC 4LU5H 1QP1A 1S78D 4CN1A 1V7ML 4NO0A 4OLWH 5CCKL 4OCSL 4GRMB 3OSKA 2H2PC 4HV8B 3C60D 3MNZB 3FO2A 4RA0C 1N7ML 4Y8DC 2R69L 3LEYH 2VDKH 5DUPH 4Z0BH 5EZIL 1VGEL 1OY3B 2ZZUT 2VLRD 3VXME 5F9OL 3HUJA 4APQA 1YEJL 1YMMA 1DBBH 3BP7A 1S5IL 4PLNC 3DMMB 2OJEB 5F1OB 3BKCL 5JOEA 3NCFB 1NFDB 1XMWA 5IBTL 5DVOA 5CJXA 5L6YH 1WEJL 3B5TA 2OP4L 4JZNB 3PQYB 4HH9A 1K4CB 3FFDB 5E8OB 1Z2KA 4P4RB 5C1MB 2CD0A 3KYMB 5IMMB 4P2OA 1JWUA 4XTRC 4KKBC 3B9KB 2DYPB 5GIRA 1U8IB 4HK0B 2NY4B 2AV7B 4I9WE 3QJFA 4MAYD 1C16B 1VFAA 1Q0XH 5GHWL 5IW6A 2CIKB 4K3DH 3KYNA 4S1QH 2Z31B 4BSWB 3KS0H 3MRGB 3AS1A 4G7YL 3HI1A 5DZNA 4JAMB 1JN6A 3BP5A 4GRWF 3GMOA 5J6HA 4L4TA 5JLZA 1FYTE 1QACA 4K7PY 5B22A 3C6SB 2XRAH 3DV6A 3QUZB 5GS1C 5J13B 3WO3B 1DBKH 1H5BC 3CLFH 1EERB 6FABH 5HHXH 2H26B 4WI4A 5E6IC 2GFBB 4Y4HA 2BHZA 5CWSB 3ZKMD 3D9AH 5SX4I 3RPKA 3SJVE 4LVOB 5D5MB 3KLSA 3QXWA 4ODHL 5EOCL 1RUQL 1E4XI 3WIHA 2EDXA 2CK2A 1M7DA 2MTPA 4KK6C 2VITB 3ELAT 3U6RB 3L3GB 5F70A 5ICYB 1CBVH 4ONHA 5KVDL 1FGNL 4G8GB 5ELIA 4WDIB 1MWAA 1P5VA 3SCMC 5L8JB 4HD9A 3O2VL 1HKFA 1G9MC 4DVRL 1CR9L 2R0ZL 2KKQA 1A6TA 1MIEL 4GKSA 4XVUC 1RFDL 3ZSSA 5CJOH 4GAGL 3T0EE 4M8QB 1H15B 5FGBA 5GRJL 3QI9B 1LE5A 1QSVA 1DJSA 1SYVB 4BA8A 4JLRB 3IFNL 2IH1B 5JZ7D 1JNHA 5D7LA 4OSUL 3KPOB 1SBBA 2RJMA 1GC1C 4JDVB 3KPRE 3RGHA 4OGAC 3BAEH 3IJHA 4G5ZH 5JMRA 3CSBA 3BEVA 5LKNA 5IJKC 3ARGC 4MX7B 3LQMA 5B3NA 1KCUL 2V7NA 1RPQA 3P2TA 5KVEH 4IIQB 2Y5TB 2HJFA 3UTZA 5JXEC 2BRRL 4HF5H 3GJFA 5CHNA 3RL1A 4OCYL 1N26A 4N0UA 4JN1H 4PG9B 3T2NL 3BUTA 15C8H 3Q5YA 3KGRA 3JV6A 5CSZB 3KJ4B 5JOFA 1L0XA 4XMLH 1YYLH 1TNNA 3LD8B 2X4UA 5D7IF 1HSBA 2XYCA 1A21A 5JW3L 3T0BA 5IHUL 1TFHA 2LE9A 3MV8B 4YNYA 1IRAY 4CU6A 3TBYB 4PTTB 5FYKU 2WIIB 1FVCB 1J1XL 1MFDL 4GW1B 1NANH 2YSSA 4G6JH 1IGTB 1AGFB 4LKCA 5D72H 1WVZA 2ERJC 5JQ6H 5C0NC 4JFZL 3HE6C 4P46C 3VXQB 3QIWD 4BH8B 3TPUB 2NCMA 1IEBA 1ZHKA 1PG7H 2FX8L 1G1CA 2DN7A 4KRPC 3WFHA 1BFVL 2VQTA 3GSOB 3GSQA 5J6GB 2FEDD 4X7DC 2J1KA 4QYOA 2P49B 5INDB 4OZIF 5D2LB 4ACPA 1BBJA 3L1OH 1G7QA 3BPOB 4L8BB 5GGSB 35C8L 4YWGL 4CBPA 1F4WH 4IJ3C 5JO5A 1AJ7H 4PY7A 3BN9D 1JZ4A 2VXVH 1UGNA 2EIZB 4RMRA 2LAAA 1E28A 1ZV5A 3OGCB 1WSST 3SDDA 4EJ1C 3EUUA 1J05B 1T0MA 5L88L 1XIWD 3Q2CA 4L3ED 4I18A 3LQAL 4OCLC 3DVGA 3MNVB 1ORSA 2J8OA 1KJ3H 1CD1B 3IXAA 4FQIH 4OCWH 1REIA 3H7BB 1ETZA 4NGHL 4NFDA 4Y19D 1CE6B 4XWOC 2DJSA 3B6SA 4JHZA 4C58B 4MXQC 3SGDI 4ZUWB 1MFEL 4RFOH 5BW7C 5HPOA 4FQXA 1U3ZA 3LH2L 4FTVA 5FO7A 1JF1A 2VL4A 5HI4D 4OGXL 3DYPA 4F9LA 4GMSL 3ZHDA 4J1UB 1A4KB 5L8LB 1Y6NR 4WI8A 4NNPH 5CEYA 4RAUA 1B2WH 4OM0H 5FO8A 2F9BT 3H3BC 3QYCA 3EYUH 4H1LH 3DVNB 4XHQA 5FA3A 1I3UA 5C9JB 4MQ7A 5JW4Q 4KQ3L 5IOPB 1NCAL 3FQWA 3ROOA 1KN2H 3A67H 1K85A 3KWWA 4Z77B 5C71A 3RVUD 4JZOA 2JIXA 4PJCB 2YUWA 1JPTH 4LU5L 3QHFL 4QOKB 1JUFA 1U6AL 1SJHA 2OQJB 2L7JA 3NCJL 1SYSA 3AB0C 3F58H 4LCCA 4V2CB 1CFQB 3NGBB 4LCIH 3IDMA 4HJ0C 1TTFA 2VDLL 2GQHA 3BDBA 3MBEC 1A3QA 4DEPB 4WU5A 1QYGH 4WVRA 4Q9QL 5C3LD 3IYLW 2YUXA 3PP3H 2HLFC 1A64A 4MVBC 3WLBA 2NXYD 1ACZA 4LK4A 4L29A 5HYJB 3O3BA 1NLBL 4O2FA 1NH6A 1KTLB 1LDPH 3LEYL 2VDKL 3KNBB 5DUPL 4Z0BL 5FFLA 2ENYA 3WUWB 3AXLB 5EU4B 4P49A 3CXDH 1RK1B 1ZHNA 3EYQD 5D9SB 5BOZG 2IBBA 4H1LB 1LO5A 1ZT1B 3IF1A 1O7SA 3OR7A 4UAOB 2IPKA 3RNQB 4N90E 1CL7I 1Q9OA 3BGMA 4KV5F 4JQVC 5TGBA 5JW4M 1TNMA 4X6EA 4IOSD 4X8JA 1HI6B 4B5EA 4E42B 3GIVA 3GEWB 3BP4B 5IF0B 3NCBB 1KJMB 1CG9B 4HUVA 4R4BB 5FGCE 4KROD 4JRYD 4K3DL 5FYJD 3L3JA 4S1QL 1PQZB 2J6EH 4HCRA 4U2YA 1CFTB 1FPTH 1PLGL 3MFGB 5EIIB 3LKQB 1JZ2A 4U4BA 4X6DA 3SDAA 1S5HA 2O5YH 1YN6A 2XRAL 4JM2C 1Q9LA 1RZKC 3CDYA 5E5MB 5SWSB 4NRXB 1QSFB 5HHXL 4WI7A 1HWHB 2PXYD 2XACC 3D9AL 1IQWL 4MJID 2AK4E 4KI5D 1LNUA 4XHJC 2CRIA 1WIUA 5JHDE 3PV6A 4K8RD 2DLFH 2HVJB 3QQ9D 4ETQA 1KGCE 1FO0A 4QRSB 4PJDA 5C86A 4GUPA 2B8OT 4Z7WF 5KVFH 4F37K 4UQ3B 2P44B 4NC1C 3P4LA 3MRKA 1CBVL 2EC9T 1R0AH 2HG5B 3HLAA 4XP5H 3WFZA 4JY5H 5HGAB 3AM8A 3O4LA 2GTWB 1UB5A 2P1YA 4QRRB 3SDXF 3FRPG 2XZQH 1Q0YL 4IS6A 1IL1A 2YPVH 3QPXH 2X2YA 3MCG1 3RZCA 3CFJA 1DFBL 3O3AA 1CZ8L 3BO8A 4Y1AE 3GSNH 1E27A 1MAJA 4MNQD 4P0DA 3QZWB 4OKVA 4LPXA 4XZUA 3QH3B 2XWBB 5I30H 3VXUB 5CP3H 4DCQA 5EBWB 4NKIH 3MLRH 2FEEI 2P8MB 4QWWD 4GKZB 2YWYA 3QUMA 3RX8A 1EEYB 4KZEL 1WFUA 3H9SE 1LVEA 3ZDXF 1RVFH 4P5KA 4EUPH 2NY2D 1N6VA 4J3OC 2JTDA 3OKYA 3IETA 1A02N 2PYED 2HFEA 2EKSB 2ZUUA 3E2HC 3IAPA 3O9WA 4HF5L 4U2ZA 5GGVL 5C0IB 1CF8L 1ZA6A 2EICA 4TRPH 5I1EH 3RDTC 1VHPA 2XQBH 5J1AA 4JN1L 4OM1L 4XCNB 4LKXB 2BNQD 5FKAB 5DJ0B 15C8L 5TDPB 1JHTA 3Q6FB 4KRNA 1RZJC 4NBYB 2V2XA 1NUGA 1OB1A 3GSNB 3O3UN 3QWRA 4KK9C 4XMLL 1YYLL 5FUOH 3TJHD 1AO7D 1BVLB 5T33L 2XZZA 3MLTA 5EUOA 3C9NA 1WCBB 1S7XA 3EYVB 2NY0D 3O81A 4FXLA 2YA2A 4MJ2A 3WEXA 5C08A 4M61A 5EBLA 4G6JL 5TQ0L 4LCWD 1NCCL 5JQ6L 2X4QB 4PRNB 2J8UF 5F1KC 2LV4A 3EOAB 1T4KA 5IBLD 5BOPA 1A2YB 3MGOB 4Z7VA 4EUPB 2BDNH 5HY9B 4XNZB 2IQAA 2K9UA 4YHKL 4PJ9B 4QKXB 3DV4A 2R1XB 1A9EA 5D1XB 5IW3A 2DQTL 2NZ9C 3RU8L 5K59F 2D2OA 4HIIA 4IOIA 2HP4A 3LS5L 4XAKD 1RZGB 2Z93B 3L1OL 1H8OA 3AY4A 4OLYH 1OVZA 4GRLA 5C0FB 2ZP0T 5DJZB 3PWUA 1JNJA 1AJ7L 4YFLF 5GRUL 2VXVL 5ID0A 4BM7A 1M6OA 1FE8L 1A6VH 2ICEA 4E41D 4DN4H 3OXRA 1A1OB 1RUPH 4BELD 3C60A 5HGHA 4LIQE 1NDGA 4Z76B 4PJEF 1MIMH 3PDGA 4NQED 1KJ3L 3SDXE 4NN7C 4Y16B 1AIFA 3CSYA 4GBXD 4OCWL 1N5AB 2R1WA 2AERT 1W72A 3HZMB 5HYSB 5HI5C 2Y4SA 1JNNH 4RFOL 1AGEA 3LN4A 5IVZA 1LO0L 2DQCH 4LNVA 3IDNB 3KPNA 2L0DA 3EO0A 43CAB 2IFFH 5FUZL 2IAMA 1LE9B 3IFLH 5DMGD 2AJSH 3GSWA 2E7CA 1ZA3A 4OM0L 5D93C 1FYHB 4OFVA 3EYUL 3D85B 1NGQL 3LDBB 2AXGA 4MAYA 1NGWB 1KN2L 1TTGA 3A67L 1FNEB 3WE6A 5IHZB 1U36A 3FQUA 2H2SD 1JPTL 5IMKB 5DS8B 5I15L 3GBNH 1JNLL 3CMGA 1DEEB 1FDLH 4H5SB 1LEKA 3ZHKA 1KFAH 4I0KA 3GMLB 1HHKA 1QYGL 4HEPG 5A1AA 1JK8B 1MFNA 3K2UL 1TTUA 4OKDA 1MRDH 1KIPB 3QIUD 4XPHH 2J2ZA 4TYUA 4WUUA 3CXDL 4GOSA 3ARED 3NFNB 5FEBA 3CSPA 3J8F7 3ARFD 2PF6A 3BJ91 1NLDH 3LZFL 2J8UE 4CVWA 3WBDA 1LD9A 1L7TH 4Q6YA 4XVTH 4CNIA 2CK0H 1OGAE 1MCWW 5BZDB 1BQHA 2DDQL 4X9HA 5EO1B 5T3ZD 1QRND 1XR8A 3EDJA 3D0VB 4AJ0A 2YPLE 3VJ6B 1HQ4B 1N5YL 1MH5B 2ID5A 5DMYA 2PTTB 3QEQE 4HC1H 1PY4A 4P3CL 5I8CA 3VXPB 1VACB 3VMOA 2Y72A 4QRQB 4UINL 4M5ZL 3IKCB 3D3VA 2J6EL 3EOBA 4CVXA 5FF6B 2BERA 1U8JB 3OHXB 1D9KC 3I85A 2AJZA 5ESAA 1AGBB 3SO5A 5IVXA 5EOQH 2BK8A 1E6OH 5LGHH 4ZTOH 5EC1B 2OMNA 5LAXB 4CL7A 1EBPA 5I1AA 5CD5C 2YBRA 3OAUH 4YDIL 1BJ1J 3X11A 4KTEH 2K7PA 1A5FH 1ONQB 3MQIA 2DLFL 4Z7UA 1D5IH 4OZHB 1H3UA 3GM0A 5KVFL 3PL6B 4PRPE 1UXWB 2ORBL 5ESQA 3C5JB 1I7ZB 3GBLA 1R0AL 1JYWA 3U4EB 4JY5L 2VDRH 2R56H 4EQ2A 3L5WA 3TGXA 4B7IA 1CFVH 4FQ2H 2NLJA 5T1DH 3THMH 2YPVL 3L6FB 1QFPA 1A7PH 5FECB 1WTLA 1HH6B 4M3KB 3QQ3A 4PJAF 4YC2B 1QR1B 2HKFL 4MLIA 3GSNL 4UTAL 4YHML 4AK1A 4ZTPH 2PW2B 4OZGA 1O5DT 2F58H 3U0TA 3P4MA 3QIWA 3F7QA 4ZDHA 2CRYA 4NO0B 5I30L 2OZ4A 5IJVA 1H3TA 5I1KH 4KZDH 4ORGA 1QQDA 4GG8A 1PKQA 2BVTA 4ZODA 3MLRL 4PJIA 3SCMD 2Z4QA 4GSDH 1W0VB 3T0DA 5FA4A 4N8VG 5HYIA 1MAMH 1CGXA 1CN4A 2MHAB 5D96C 4XVUD 4AIOA 1RVFL 3KYOA 4C56D 5JXAH 2FECL 4NQSA 5IFAH 3W0WE 4APQB 1YMMB 3BP7B 5CSGA 1KV3A 3VFWB 3GKZA 3WCYA 2W9EH 4UZGA 4TRPL 5FK9B 5I1EL 3I6GA 5F9JA 3PXJA 3QHTC 3WFEH 5I8OL 4F2MA 2WBJD 2BOCB 2YRLA 4HH9B 1GGBH 4IMKA 3WIHH 4U1HA 2AJVH 4OGAD 4P2OB 3U30C 5GIRB 1ZLWH 1CLYH 4L3EA 2YXMA 5TDOA 3CVHL 4NYLA 5GZOC 3EJYD 2IBZY 3BHBA 2FX9L 3QJFB 4XC3H 3TBSA 3QAZC 5IW6B 4ODXA 3C5ZB 1CDJA 3KYNB 3EO9H 4U3XA 4LQFL 1BZ9A 1DP0A 4Y19A 3TBTA 2ZPKH 1X5FA 3CAFA 1F90H 3ZT7A 4CDGC 1BHGA 3BP5B 4JFDD 3GMOB 5J6HB 1AHWB 3QR2A 1INEH 4OZFH 2MPAH 3DV6B 3WKMH 3IDGB 2BDNL 3ES6A 1BEYH 1IBGL 4Y4HB 2QL1A 1GYAA 2R4SH 2QTEA 3JXAA 4HWUA 1LILA 3D0LB 4LHQB 3BGFB 2E7MA 3KDMA 4FOMA 3HUJE 1G7HA 4JCLA 4U3CA 5C0CE 3TF7C 3P4OA 1M7DB 3OWEA 3LEVH 3ETBF 2Q6WA 1G6RA 4ONHB 2AQ1A 2IBGA 1MWAB 3FQTA 5IROC 5KN5A 1U0QA 4ODWA 1A6VL 5DRXA 3HE7C 2Q1EA 1BGXH 4DN4L 1A6TB 1CGTA 1RUPL 2VL5A 4YHLH 3CDGA 4U7MA 4OZFB 3DGGB 1YMHA 5T1LA 3OPZH 3QXAA 1MIML 3WN5A 1LE5B 3QHZH 3HRPA 5IEHB 3GJFK 1JNHB 5D7LB 2OI9B 4PV8A 3UTTD 5F9WB 1SJXA 4PJHE 4L4TE 2P8LB 3SDCC 4C83A 4W70A 4PJAE 4X4XA 3ZYIA 1W8NA 3FFCB 3F62A 1JNNL 4JFED 5EUKA 3IJHB 2DQCL 4X5LA 4ZFOB 2NY4C 4CUCA 1F11A 3BEVB 4L1HA 2IFFL 1Z0MA 2DQJH 1JHLH 2FL5A 2AJSL 2V7NB 4PJ5D 1DVFC 2VJXA 2E3VA 3RNKB 3UTZB 5EO9A 1FV1A 3GJFB 3ZHLA 5CHNB 3RL1B 4G6AC 5CEZD 4XPBL 1IAII 4JRYA 4KGJA 4F3FA 4M03A 3N9GH 1U8QB 3JV6B 3QEGH 3UTSB 4M6NH 4EI5B 1I1AC 4MXQD 1IC4H 5JOFB 4NP4L 3NABH 1FDLL 1TXKA 1T1WA 1KFAL 1KUMA 5D8JH 5BS0D 4MS8D 5ACZA 4YNYB 3V2AR 2F8OA 2HRLA 5F7MC 2GTZB 3KXFE 3X3GH 3LAFA 2G5BA 2YSSB 5TDNA 1RULL 3LKSB 3CZFA 3G6AB 5E24E 1CTNA 2PR4H 1NKOA 4OF6A 1S7SB 1GXEA 2XN9B 2DMKA 2G60L 5BVJA 5HDLA 3BW9A 2ESVD 1AXTH 3HMXH 4HIJB 1IEBB 1ZHKB 4XRCA 4BFBD 4UILL 5DA4A 3SE3A 1UCTA 4J8RA 4LEXH 5B39G 3WFHB 4YHIA 4I3RH 4TVPH 1TJGH 2E7LA 3GSQB 1JWSA 3DVFA 4OIAA 3DLQR 5BRZD 4HJ0D 5E2UH 4XVTL 4YQXH 4P5TD 5B4MC 2CK0L 1BBJB 2B1AL 4NOFA 1G7QB 4V1DA 2E27H 4X6BA 1NCTA 5GS2H 5IQ7H 1WK0A 1G7MA 4PJ7E 5JO5B 2EYSA 4HC1L 4N0UE 4PY7B 4MNQA 2V5RA 3VFGL 1T89A 4RWYH 3F8UB 3QDMD 4Z0XA 3SDDB 1N0LA 4Y5YA 2CXGA 1IGMH 4PBWD 5D70H 4JO4H 4JREB 2A74A 3U1SH 2D03L 3FAXA 2CDGB 4XB7A 5EOQL 1E6OL 1ORSB 2YA1A 4ZTOL 2UZYB 2UZIH 2R2HA 4M1DL 3IU3A 3IXAB 5IB4A 2UWEF 2QHRH 1RZ8A 2NY3D 4KK8C 3W11D 4HFWB 3MLVL 1D5MA 1YC8A 4WHYH 4KTEL 4FQXB 2EDOA 3O6FA 4FTVB 5FO7B 1JF1B 3SE4C 1D5IL 5DZOA 1DQMH 4EI6A 5EN2A 5FYKD 3WO4C 2HTKD 5HHMB 2B39A 4WCYH 4RAUB 5ANMA 1TJHH 5DJ2A 2VDRL 2R56L 1CFVL 1QLEH 4MQ7B 5T1DL 3THML 1F3JA 3FQWB 3ROOB 2EDDA 1FFRA 4LCYA 3J7HA 3VFTA 1OCWH 3KWWB 4QXUH 1Z9MA 4JZOB 2K3TA 2ARJA 1WGOA 4IRJD 1JUFB 4ZTPL 3ILQC 2AAVA 3Q6GH 2F58L 3EYFA 3F7VA 3MUJA 1EEUA 3P9WB 4WU7A 1XGPA 5DFVC 5I1KL 1CFNA 1OARL 3W81A 3CZJA 1IGFH 4WU5B 1I9IH 5IVOA 2P5EB 3RAJL 2OL3A 2BXZA 4YUEH 3WLBB 3X14A 5KW9H 4L29B 1KEGH 4JJ5A 4ESKA 1IAKA 4O2FB 1FL6A 1MREL 5DD5H 5TPWH 1MAML 3FN9A 2XTJB 1ZHNB 5JXAL 2WQ8A 2VDOH 3D39E 4YIQB 3EO1A 4NWUH 1T3FB 4EIZC 1P53A 3NMEA 3OR7B 5KSAA 3O0RH 2VSDA 4LHUD 5C09D 2FHFA 4XCEA 1BAFH 1B0GA 4NQXA 4N1CA 3QUXC 4Q9RH 1Q9OB 3BGMB 4E41A 2Y1VA 5FOJA 5TGBB 1CCZA 1GGBL 3DRQA 3U9PH 3WIHL 1PEZA 1FO0H 1ZT4A 3GIVB 1DN0A 4JZJC 5DEZA 1YA5A 4G8IA 5EO0A 1FN4A 5D6CB 5T1KB 4NQEA 1MWAL 4O2EA 3FMGH 1EHLL 2X40A 3L3JB 4HWZB 4JGMA 1DEDA 2YD4A 4PLJC 2ZWLT 2ZPKL 3MLWH 3KPPB 3RDTD 1INEL 3QBTB 2JJTC 4X6DB 4RRPG 1FJ1A 1YN6B 2X05A 3WKML 3KYAA 4RA3A 2ITCB 1JMZA 4QTIH 1BEYL 5I1LA 1NUNB 2XKNB 3PWPE 4WNQA 1N4XH 2X4PA 3V6FA 2AEQH 4UNTA 4ONGH 1WAAE 2Y06L 2WW8A 2VXUH 2B5IB 4MD4B 3RJDA 1LNUB 3PV6B 5DC4B 1CGWA 3QUMH 2C7UB 4BUGA 5TE7H 4ETQB 4WFFD 1FO0B 4PJDB 3MV7E 1SM3H 3LEVL 4GUPB 1N8ZA 4KUCF 4AEIH 2DB8A 1BQLH 1ZGLA 4MJ5A 5BVPL 4JQXA 4XCCH 2YXFA 1QFWM 3HLAB 4DUXA 1GCFA 1RY7B 3O4LB 1AR1C 1UB5B 3L95A 4I3SL 5LXGH 4KI1A 4OQTA 4IS6B 1A14H 1QVOA 2NZ9D 1F58L 2R2CA 4YHLL 5F7NC 3RZCB 4C59B 1G6VK 5ACLA 3CFJB 5L2JB 4WW2F 3O3AB 4DKDC 2X4NA 3BP6A 3BO8B 4NRZB 3OPZL 3QIUA 1E27B 2VR4A 3NCYS 2P7TB 1OGTB 3QHZL 4OKVB 4FMFA 3QULA 3O41A 3CH8A 3L5IA 5CGMA 2VZ1A 1X5GA 3VRLF 3AREA 4ZOAA 4KKAC 3ARFA 4F7EA 4GW4B 1JFQH 5SWZD 3QUMB 2V17L 5F1IB 4NN5B 4D0DA 4XXDA 3HHRB 1QEWA 3RUGA 4QRPE 4OTXL 4ISVA 1DUYA 4JRWA 1QRNA 4P5KB 7FABH 3AAZA 5F21B 4AEHH 3IETB 4PIRF 2EO9A 2HFEB 2HT4D 3O9WB 4X7TA 1OD7A 2W0FA 3GK8L 1ZA6B 2RCSH 3VWJD 2D4DA 1EVUA 3HRZA 1IZJA 2DLTA 1T7ZA 1JHTB 5EIVA 3N9GL 2JJSA 2V2XB 4OFYD 3LRGA 4P48A 1OB1B 4RGMC 4NZUH 4HKJA 4R2GD 3W5MA 5F7HA 2MQCA 3MLTB 1FAKT 3E8UH 5EUOB 5D8JL 5D2LF 3C9NB 4PGCB 5E94A 4I0PC 2JLLA 3MXWH 1S7XB 5FYLD 3Q1SL 3X3GL 5C08B 4M61B 5EBLB 3LPGA 2PR4L 1XF5B 3OF6D 1LEGA 2CKBA 2VLMD 4FRWA 1T4KB 4YFLI 2CXKA 3RVTC 1AXTL 3IB4A 4Z7VB 4JM4H 1GZQA 2YPKB 3ECBA 3DV4B 1PZ5A 1A9EB 1QLRA 4ZS6C 4XMPH 1T2JA 1IM3A 4LEXL 4XPGH 3MRLB 4QCIA 4I3RL 1TJGL 3H8NA 1W72H 1L4IA 4IRSC 4HIIB 1FZMA 3TNNA 5E2UL 3MODL 1H5BA 4YQXL 3B43A 4YHOH 5HHVL 3T8XA 1XGQA 4U1LA 2E27L 4BKLA 4HUWA 1K2DA 4HG4J 1NUFA 4X4YA 4G43B 2NR6C 4Z18A 4RQQA 1KIRA 5ID0B 3QDJD 4RWYL 4N0CC 1M6OB 2BNRD 4YXLH 5IB3A 2GITA 5BQ7A 5F7DB 2ICEB 1YPZF 3OXRB 4DKEL 1KTRL 3HG1D 4V2BA 3C60B 4JO4L 5HGHB 3SCMA 3U1SL 2QKIA 2ICWB 1T2QH 1NDGB 1OOAA 1MCHA 3NCYP 4WFGD 1T04A 1AIFB 5ALBH 4KQ4H 4C56A 1W72B 2QHRL 1K6QH 4JRXA 4XGZB 3EZJB 4U33A 2ZUWA 1ERNA 3GSVA 3O8XD 3LN4B 3RI5K 3MRJA 5IVZB 4JG1L 3KPNB 2R0LH 1CD8A 2C4FU 2WBJA 2YUZA 4P3WA 3MRRA 1DQML 1BD2B 3VRLE 2IAMB 2QSVA 1D9KD 4HUKB 5D71H 2BVOA 3GSWB 4WCYL 1YEKH 2HT3C 1LK3H 2XPGA 4ELMA 3GMNA 4RISL 1QLEL 1N64H 2AXGB 4MAYB 4YEFA 2ZNWA 5IJKA 4U1MA 3ARGA 1OCWL 2FJGA 3AUVA 4QXUL 2HT2C 5GSVA 4RAVA 3FQUB 5JXEA 3B83A 3QDGD 4JFDA 3Q6GL 3C5SA 1LEKB 4PRIE 3CDCA 3D18A 4NCC2 2JF1A 1HHKB 4MSWA 1I9IL 2A1WH 4YUEL 1LEIA 4RMTA 4X6CA 4BZ2L 5KW9L 3BQUD 4M8VA 1KEGL 2LTQB 3Q5TA 3ULVD 4HCRL 5DD5L 2VLRE 3MV01 5TPWL 1RU9H 3RQ3A 3QDHA 3OMZA 1L6XA 3S34L 1MY5A 2D7TL 4WUUB 4LNRB 2N7BA 3QXTA 1OT2A 4YHNB 3ROLA 4NJAH 1G7JB 4XNUH 1LD9B 1BAFL 4WGVB 3PIQA 4CNIB 1ES0A 4JY4A 4Q9RL 4ZAKC 5T3XD 1KYOJ 5JOPE 2IPTH 4KKCD 1BQHB 3P11H 2G5RA 4LP5A 2AABH 1FO0L 4HQQH 3BZFB 3UPRA 3PGDA 3JUZA 3SQBA 3JTTB 3E3QE 5JUEH 2FH6A 2H1PH 1JZ7A 2GAZA 1BMGA 1MSPA 2F8VA 5DD1L 4Q58C 3UTTA 3D3VB 4FQ1L 3EOBB 3BUYA 2KDGA 4CVXB 2FR4B 4JKLA 1Y18A 3MLPA 1TCRA 3MLWL 2YKLH 5HJ3B 3ILPA 2AV1A 4M93C 3VXSB 5I75C 4JFEA 1IC5L 4WI2A 5IVXB 3FCTA 3D6GA 5JNYA 1I1YA 2DOCA 1YPZE 3QFJD 4PP1C 1N4XL 2OZ4H 3NCCB 5EG6C 4PJ5A 5I1AB 1VEPA 2HH0H 4J3WA 4ONGL 4M48H 5GZOD 5GSRA 4JR9H 3QUML 4L9LC 3SQOL 5C8JA 4Z7UB 5TE7L 4K9EH 1G0XA 1SM3L 3UP1A 1QBAA 4AEIL 5IT2H 3GSXA 1L7IH 2D9CA 3OKEA 4K3EH 3HNSH 1BQLL 5ESQB 4ZXBC 2EDLA 1IGCH 4XCCL 5BZWA 5T5FL 3V7MA 4LLDA 2E7BA 4RMSA 5BS0A 3K1DA 1CDCA 1JI1A 2NLJB 3MJ7A 5HI3D 4TTDC 5LGJA 4I9WD 5I6XC 2Y36H 1I85C 3KVQA 2B1HH 1FNHA 4OZGB 2ZCLH 3U7AA 3U0TB 3P4MB 1H3PH 3QIWB 4ZDHB 2ESVA 2AXJA 2XV6B 2PO6B 1EDQA 2FIKA 4GG8B 1PKQB 1QSEB 1JFQL 3M45A 2DTML 4QNPF 3MLYH 1GIGL 4PJIB 2Z4QB 4KH2A 4KVNH 5BRZA 5FA4B 5I76A 3MBEA 3HE7D 5HTSA 1B6DA 2OXHA 5EWIH 2FYYB 4G42A 1OLZA 4NQSB 7FABL 3P4NA 4I2XA 2AEPH 4AEHL 3EYSL 4NWTL 4B53A 2X9WA 5L0QC 2RCSL 5I1HH 3I6GB 1BF2A 3QDMA 2YEZA 5F9JB 1IM9D 1I8MA 3UC0H 3OKDB 3SDCD 3OKMA 3NOIA 1JI2A 3GSRA 5IB2A 3T0ED 1G6RH 1FZJA 4NYLB 4OCNC 1FBIL 4JQVA 2R29L 3TBSB 3TBVA 4ODXB 4X4MA 1Q94A 3QUYC 4OLXL 3RWCA 3NIDF 4Y19B 3S4SG 5KSBB 5HDQL 1NDMA 3EDDA 4G6AD 4AIZA 4UV7H 3KPRD 4JM4L 4LPWA 1ODAA 4XP9H 3UJIH 2DL9A 1RSFA 4XMPL 1BF8A 4XPGL 2X42A 1SHMA 5EOCJ 5KTEH 4WTZA 3UEZA 3LKPA 1W72L 4LQ1A 3QXUA 3F5WA 3KDMB 4LLMB 1GAFL 4YHOL 1G7HB 5I1GH 1WLHA 3P4OB 1JTTA 2FATH 3RGVC 4PJFF 5I1DA 3B8SA 1DBMH 2HA1A 2Q6WB 1DZBA 5DURD 3LVEA 1G6RB 4IRJA 2P43B 3FQTB 4OF3A 5KN5B 5FO9A 1UJTA 1HHGA 4ODWB 4NQVB 5DRXB 5IWLC 4OF7A 1HH9A 2VTFA 4L3EE 1FLRH 1DANU 3BKYH 4KHXL 2WINB 1T2QL 5T1LB 3QXAB 5IGXL 3WN5B 1Q9WB 4HDIB 1MCOH 3VRJA 3TN0B 5HD8D 4N8CL 1OAUH 5ALBL 4GJTB 4KQ4L 1ZVSA 1OP3K 4H0HB 4NO5A 4X4XB 1CXEA 4ZUUA 5JA9A 4OI8A 3UPCA 4P2OC 2AXFA 1U58A 2VC2H 3MREA 2UUDK 4XBPB 4LHUA 5C09A 1DQQA 2R39A 1XGRA 1SJVA 1UG9A 1F6LL 2R0LL 3I9GH 4CN6A 3WS3A 1A7RH 4KTDH 1U95A 3VGEA 4W6YB 3HPJA 2EDJA 1RV6X 4FHBD 4PGDA 1FAIL 2FL5B 5KJRH 2WLZA 4OF5A 5E6ZA 4ODTH 4DW2H 1YEKL 4K2UH 1AKJA 1ZK9A 5EO9B 5HGGS 2BVEA 1YNKH 1FV1B 2IH3A 3STBA 3VH8G 4JRYB 4F3FB 3HI6L 5DJAA 1C08A 5DJCA 5CFHA 3SKMA 4KK8D 4Y4KD 3K0WA 1MVFA 1VFUA 4J4PD 2DRUA 3RDTA 1GVIA 1MHEB 3LKNB 5CIPA 1FHGA 5ACZB 2WWMD 3SKUD 5DVKA 1T5XB 2A1WL 1VKXA 3RWIA 4M1CC 1KEML 2G5BB 4O4YH 5TDNB 4YHYB 2RAMA 2VB5A 3CZFB 4C4KO 1I4FA 1NEZB 5J12C 1Q1JH 5BVJB 1LP9A 2FNBA 1RU9L 2PNDA 3I02B 4S2SA 3STLA 8FABB 3F7YB 2ZOKA 1EFXA 1J0ZA 4O5LH 2PYFA 4XRCB 3EOYG 1MELA 4OLZL 1P6FA 5C0BD 4J8RB 3NIDE 5CJQH 5IB1B 1LO4L 4YHIB 5GPRA 4X4ZA 2NXZB 2IPUG 3OKKA 1JWSB 1M4KA 4XNUL 1W2KT 3NH7H 2GK0A 1H8SA 2O61A 1EUUA 2IPTL 2JB6B 4ZMAT 4V1DB 1XCQB 5CUSH 1S3KH 3P11L 1YJDH 4JGUA 4KHTH 2RB8A 4J7RA 2AABL 4HQQL 4X6BB 1G7MB 3FJTA 4BSVA 4MNQB 5FYJE 4NUGH 1KT2A 2IPUK 1MHPH 3BT2H 4Y5YB 4PJFE 1C5BH 1RJCA 3N1FC 5FB8A 1OTUC 1QRKA 2A74B 3R8BB 5SWZA 1X5KA 3B9VA 2R0KH 3D48R 4LARL 4O00A 4YJZL 4PRHE 1XF2B 2JCCA 4DGIL 1RD6A 5DO2C 4WHTA 3QEUA 4MJIE 1KLGB 3IU3B 5C0EA 3MA9H 3ARYA 2OZ4L 3BESR 1RZ8B 1N3NA 2DQHL 2HH0L 1HHIA 3L3KA 3MZTA 1X7QA 1D5MB 4DOHB 2VZVA 4FP8H 2NY6D 3VWJA 3O6FB 5E2TL 1F3DH 4K9EL 1YEDB 4PLJD 4HGWA 1L7IL 4EI6B 1YEEL 4WEMB 3HNSL 1ZHLA 3FO9B 1IGCL 5HHQA 1T5WA 2PCPB 5TQ2H 5ANMB 5DJ2B 3UYRH 3ZDYF 4UOJA 2MQ3A 1F3JB 1U8NA 2XG5A 2NY0B 3TWCL 1T21A 1MQKH 4JFFA 4R4FH 1X9QA 1KCLA 2EEBA 1I8KB 1NMAH 5ID1A 2ARJB 1MQ8A 3OF6A 4L8DA 2B1HL 1QR4A 2A6DA 3EYFB 1H3PL 5E2VH 1FG9C 3F7VB 4WU7B 2R1YA 5HVHC 1XGPB 4BK5A 1CFNB 3LKOA 3PV7A 1VPOH 4ZYKB 4XMKL 4BZ1H 1YEFH 2X4OA 4JN2A 3BPLC 3X14B 3MLYL 1IAOB 2DLIA 3HKFA 4M02A 2HWZH 4GO6B 4JJ5B 1IAKB 3RVVD 1KJ2H 1M7XA 2AK4D 3TO4D 4M1GH 3PWLB 2PYEE 4WO4C 5EWIL 4EN3D 4XCFH 1KGCD 3EBAA 3EO1B 4FG6D 5EPMA 4OZ4A 2JK5B 3SBWA 1J5OH 1QOKA 2BNQE 3QRGH 4JFHD 5C9KA 5KSAB 5I1HL 4I18C 2BNRA 4DGVH 3RVXC 1B0GB 4NQXB 1CXIA 1AO7E 3UC0L 4E41B 2DICA 3DRQB 3HG1A 3OQ3B 5A2IH 5FXCH 4MCZB 1ZT4B 4GLRH 1DN0B 3ARZA 2BX5A 2V9QA 3STZA 4M43H 5EO0B 5AUMB 1G6RL 2CLRA 2P8PA 3KS0J 4FQXC 4Y1AD 4O2EB 2Q87A 3AVEA 5DI8A 5DD3H 1T0NA 5TH2A 4LCWE 4JQIH 4F9LC 3VRIA 2VLKD 2PW1A 4OQTH 1JYVA 3EJZC 3HAEG 3RA7L 2VDQL 3O8XA 4N5UA 2CKNA 5F97E 1FJ1B 4LCUA 2FJFB 2ICCA 3CJJA 4XP9L 3UJIL 1D9KA 4OBRA 4WNQB 3H9SD 2X4PB 1WF5A 3V6FB 5KTEL 5H37H 2FO4A 4GKOA 2CLVB 4LOUC 3O4OB 1L9NA 2CGRH 3FQRA 4I0PD 2V7HA 3V95A 4Y0GA 2CDFA 1JCKA 4Y4FB 3W9EB 3IFPA 1D5ZA 4LCCC 5CINH 1T1YA 1H3XA 4PLOB 4HXBH 2HFFB 1DBML 3QPQC 4J23A 1ZGLB 4MJ5B 5T3ZH 4F58L 4YAQA 3D2UB 4JPWL 3SPVA 5L2KA 1TZIB 1QBLH 3DVIA 3L95B 4OFKA 2O26U 3SO3C 4Z5RA 4EXKA 1X5ZA 3MROB 1FLRL 1A3LH 3BQUA 3HPLA 4NQEE 3SKJH 1WITA 3O6LL 4IRSD 3BP6B 4GXUM 3GMQA 1R3KA 5GRVL 1A7NH 4JPIB 1KCKA 5D7JD 3ZDYE 5CMAA 3KPSE 4PG2A 4NDMA 3O41B 1OAUL 2CRMA 1I3RA 4AYFA 5DXWA 4WRLA 2V2TA 1A7BA 3AREB 1C7TA 2AJ3A 1G9EA 1U8PA 5DJYB 5C0GA 1KCRL 1UEMA 1NCWH 2WUCH 1JF5A 3ARFB 4F7EB 5C6TL 5MI0C 1NL0H 3QXVA 4UNUA 4XNQA 3LSOA 3ESUF 1Z9LA 1NMBL 3RUGB 3I9GL 4KTDL 3N1GC 3VDCA 1KPUA 4ISVB 1DUYB 3GSUA 5KJRL 4ODTL 5C3TA 4DW2L 5MENE 3HN3A 1FC1A 2Y25A 4K2UL 4NQDB 3ZDZF 4X7TB 4P2QD 3SDAC 1JMXA 5EB9A 1NANI 1EAJA 3HRZB 2VDMH 2LVCA 2IC2A 1GJIA 3GO1H 5KS9F 4HKJB 4LVHC 2XWTA 3NPSB 5E9DB 2GJZA 1JYXA 2J7LA 3OX8A 3PWVA 5J57B 2ADGA 4F7CA 3MRDA 5TF1H 4WTXA 4XC1L 1MJJA 2HT3D 1KELL 1XT5A 1BIIA 1R5IA 3VXMA 3VD7A 4B50A 1LEGB 2CKBB 3QXDA 3WNKA 2D0GA 5CILL 2AP2A 2VXQH 1I8LA 3AM8C 2LABA 1OP9A 1GZQB 4TSAH 3OZ9L 1G9MH 4I77H 1HK6A 1FFPA 3ECBB 1QLRB 1S9XA 1IM3B 5CJQL 5ALCL 1WBZA 5B3JE 4QCIB 3LY6A 4UV4H 1XF4A 3KG5A 4MCYA 5DRZB 4AEEA 1FZMB 3TNNB 5GS1B 3TESA 4LSSH 1H5BB 4HJJH 1QRNE 1G0YR 2WNGA 3T8XB 1U8LA 4KDVA 5E6IB 4U1LB 4BKLB 1S3KL 4HUWB 1S7VA 1K2DB 1YJDL 4KHTL 4X4YB 3F6LA 1EBAA 1DQJA 3MSPA 4RQQB 4EKXA 1GC1H 3BE1H 4NUGL