5SWSE

Crystal structure of np2-b17 tcr-h2db-np complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
239
structure length
239
Chain Sequence
TVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLFYYDKILNREADTFEKFQSSRPNNSFCSLYIGSAGLEYSAMYLCASSAGLDAEQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 47
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsE01
5EO0B 3KLHC 2GK0B 1MELA 5IB5B 1UJTA 5D2LF 4RISL 1EEYA 3KNBB 3QXTA 1OB1A 5D2LE 5SWZB 4LLVB 4F57L 4L4JA 5EOTB 2F54A 3UBXA 2WIMA 3CDGA 2Q76B 2DTML 3L7EA 3VFRB 3BPCB 2C9AA 4GKSB 3D0LA 2BX5A 1IM9B 5T1LA 5F9WB 2YPLA 2FATL 5I8KH 1ZHKB 1XGYH 2DYPB 1I9IL 1RY7B 3HMXA 3CAFA 4R7NB 2DTMH 4XNMB 4FQHA 3VFWA 5IJKA 3CDYA 1FO0B 5ID1A 4XPFL 5C0FA 3Q6FA 1XF1A 4LCUA 3M8OL 4CUCA 4WY7L 1E4XL 2NZ9D 4PBWD 4QRRB 5BS0D 4JR9L 3WO4B 1RK0A 2ZOKA 3MJ7B 3TJHC 2R0KL 1MCLA 3PL6C 4Y16A 4PJEA 3X3GL 5DEFB 3FQTA 2V6HA 4ZOBA 1AO7A 4WY7H 4N0FB 5EPMA 2O5XL 5ID1B 3OHXB 1DQLH 3F58H 2FX9L 3NZHL 2HJFB 5D1QD 1CD8A 1DQQA 4KK8C 1DQLL 1RUAH 3P0YH 4LSPL 3ILQC 1P84K 5IEHB 3WJJA 2XZCL 3VXOB 4JPKL 5LBSH 1JFQH 1I3GL 2PXYB 5JMOC 3RL2B 3T0XA 5TPWL 2PETA 3SDXB 4Q0XH 1A7OH 3FZUD 5GJSH 3LKPB 5L2JB 4JPKH 3HG1A 2VOTA 2AVGA 2PO6D 4KQ4L 4N1HB 5IP4A 3IS0X 3B2VH 4OCLC 4L3CA 2FL5B 3F8UB 2HFGL 1YEEL 5CBAB 1Q1JH 1JNLL 4OFIA 4MAYA 4PP1C 2DIAA 3ULUH 1B0RA 3LS4L 1BF2A 4UT6L 4TUJA 2IPKB 5DMYA 4XBGB 4YEEA 3MXVL 4WJ5B 3ULUL 3K8MA 2NY5H 4ELMF 1EXUA 2EICA 4Z5RA 1RJYA 2VYRE 4GH7B 2AS5M 1U8IB 12E8L 2ICCA 2QQLH 4XCYA 3SCMD 3SDAB 1MJ7H 1V7NH 2APTA 1RUKH 5KS9B 5E95B 5I19H 3FKUS 2GJ6B 3EIFA 3WEXB 3T0DA 3U6RB 1UJ3C 2I60H 2HT3D 4ODUA 1FIEA 2YD5A 4BFGA 4IRJC 4P2RD 5F3HA 5J3HD 1EVTC 3WS3A 3JWNC 4Z7WE 3UEZA 1U8NA 3KYNB 5HPMA 2OYPA 3ZDXF 4LCWD 2EDBA 4HUUA 4J6RH 3RIAF 4JN2A 4JQVA 1IAOA 3T04D 3TBSA 3ARGD 3T2OA 5CGMA 4PJ9D 1TQCC 3SJVA 3RVUC 1DQJA 3MGTA 5D1XB 1UT9A 2BSTA 1J86A 4GBXB 4PJCE 1EEZA 3HMWL 2DLFL 4HUKB 4KC3B 1SEQH 2DMBA 5LQBL 1WFNA 5F6IB 1S3KH 1MFAL 3AS0A 2WLZA 4HX1B 3RWFA 5EO9A 1UA6L 1SEBA 3PGDA 3VG0L 1U8KA 5DD1L 5C09D 1A6AA 5LWYH 5EU5B 5D7SL 1HSAB 3RA7L 1NEZB 4CVZA 4BK5A 4RQQA 5TE4L 4FS0A 3S88L 3C8DA 2O61B 1A5FH 4OQTH 3QIUB 1ONQA 2MCPH 4GAJH 2VC2H 5BW7A 1NL0L 1OAQL 2NQCA 4PJIB 5C0GA 3OTTA 1Y0LB 2NY0C 1X4ZA 3CLFL 4GAJL 2AXJA 1U58B 3GSXA 3KYKL 5ABDE 3OBAA 5GSVA 1SYSA 3DVNA 1NH6A 3QWQB 4U1HB 1DN0A 5J6GA 1Q38A 4KXZI 1NLBH 3BDYH 4DQOL 5MEOB 3QNXA 4NRXA 5ID0A 5BO1L 1KTLB 3P40A 1YYLH 4MXQD 3F62A 3FO1A 4S2SB 5B4MC 4R8WL 3VFPB 1WBYB 1ZLSH 1CXFA 4YUEH 2QQNH 3TN0D 5HHXL 2FB4H 1UJ3A 1IM3A 4GQ9L 3MRKB 1XIWA 1YMHB 5M94B 1W72B 5DK0A 2A83B 5HHQA 4G80B 4HFWB 4K71C 3L9RB 3D3VD 3MRNB 1ZT1A 2K9UA 2VH5L 3P4NB 4H5SB 3TN0C 5DVOA 1RU9L 1X7QA 3HTLX 4P2QE 1U8PA 1NGPL 2BJMH 4HGWA 2ADGB 5DHYB 1GC1H 3MLZH 4XVJH 5DJDA 5ERWA 3LDBB 4GRMA 4Y8DC 3FHQA 4ZDHA 3GSNB 4NBXB 5JLZB 2YD8A 1JYVA 5E2VL 1TTGA 4OGAC 3H9HA 2HT4C 3FOMA 2AI0L 1KIQA 3B2UC 4XGZA 2AXGB 3OGOE 4PJAE 4K3HA 1VFOA 3CJJA 5DD5L 4PJAF 3W9DA 3MRDB 4LL9A 3BQUC 2R0LL 2X70A 4O9HL 3E8UH 5LXGH 1LD9B 4G3YL 1OSPL 2JIXD 2YD3A 4OI7A 3MLWH 1GPOH 2CLZB 1CLCA 1EK3A 3NFSH 4PJAA 5TDPB 5C0JB 3MV7D 4KUZH 1M05B 3P4OA 2A77H 1NMAL 3CVHL 5CUSH 5I76A 2A73A 2XKNA 4G5ZL 3HR5A 4G7YL 1GPOL 4M6MH 1ONQB 5ESVB 5IV2A 3RKPA 5BMFL 2IANE 3MRLB 5JORA 3SN6N 4B7IA 4L4VE 3HZYB 3UJJH 4D3CH 5T3ZL 3QIWD 1NEZA 6CGTA 4XT1C 3MOBH 1A7RL 1YMMA 3AAZA 4MDJA 2X4PA 3RGVC 5B39B 4HS6B 5SX5K 3DO3A 3QQNA 2XACC 1EUUA 5GIRA 4U1NB 2BXZA 1TZHA 5HY9A 1G7JA 4RZCA 3HUJB 3KPRA 4FXKB 2DLEA 2R2HB 3DUSB 1EAPB 1RZJL 1KB9K 1T89C 4OV6F 3W5MA 2IPTL 1OTTD 3WFDL 3DV6B 4JVPA 5EZIH 2VLRD 3BW9A 4OKVB 1OAUL 3MBEA 1U2CA 4YDVB 3STZB 4RQQB 4HJJH 2R29H 1FAIL 2BERA 1BX2B 1T7VA 4HWBL 2JCCE 3TZVA 4EN3A 1MQ8A 3F6IA 1E27A 3DI3B 4PV8B 3GFUA 3TIDB 4X80L 1RUQH 1NANH 4YGVB 1FAIH 5HGHA 4W6WB 1MRFL 1WTLA 4YFEA 1MRDL 2YC1A 3QCUH 1AE6L 4I2XE 3EYFB 3ZO0A 4ISVA 1NFIA 4HFUL 3UX9B 2Q8BH 1N5YL 1UG9A 1CFNB 3N1MC 3MACH 1JZ3A 1FO0L 5GRVK 5E8DL 3QCVL 2A74A 1RJYB 4OFPA 5LGHL 3REVB 5E5RB 5DUPH 3L3DB 3K4AA 5MP6L 2FYYB 1NAKH 3I3BA 2J1KA 3PV6A 3T65A 3ULVH 1EO8H 1GGIL 2V2XB 5I8EA 4HXBH 1QOKA 1JV5B 3C6LC 3C87A 4S0SD 4Y4KB 3QFJE 5EZOL 1LDPH 4IOIA 1VDGA 3H9YA 3IT8D 2R1WA 1FVCB 4RFEA 4Y2OA 3FAWA 4PJHE 1RIVL 4M7KH 5KS9A 2GTWB 4PLJC 5DFVC 3BN3B 2OR7A 5KVMC 1J0IA 5JXAH 1FFNB 5JNYA 1RFDH 5ITFB 2JF1A 2X4RB 2VQ1B 3MZTA 4FXGA 3OZ9H 4JM4L 4LHUD 4HKZB 1S9YB 1S9WA 3PWJA 4JFFD 4P4KD 3QG7H 3MROB 2ICEA 2NXZB 3W82A 4Z7VF 4MNQE 4QRTA 4KUCF 3L95A 4HKJA 1XF3A 1O0VA 1ZE3C 5HI5C 2Q7YA 1N3NB 2QKIB 1JRHH 4X7DC 1U8HB 4OCYH 5AWNH 3UC0L 1AIFA 3FQTB 3S35X 3QQ9D 3ARBA 3EW3B 3MLYL 4OLZH 4G8GA 3QIBB 1VADA 2A74B 4LP5A 4BUGA 1CFTB 5K9KA 1UM4H 2AGJH 3IAGC 3DGGA 5IR1A 4ZFZB 2LVEA 3OKMB 1R3HA 3MLTB 4S0TD 1DLHB 2Z8VC 5D93B 4OLWH 4NKOB 3ULSA 1ETZB 1NEZG 4EJ1C 1KC5L 3CDCA 3W11D 3AM8C 1MFEH 1PKQA 3OAYK 4NZRL 3VGGA 3ZTNL 2E7LC 5EUKB 2YEZA 2AP2A 3VFTB 1DLHA 4M8QA 3TGXA 4KGLA 1SMOA 3WHE1 1G9MH 5HBBA 3CMOL 4A2MA 3MGOB 1QHPA 1F11A 1H8NA 3GI9H 2AKRB 3IKKA 4P2OA 4NQTA 1HKFA 4D0DB 3GIVB 1KT2B 2NYYC 4OZIA 3B5GA 4ZD3H 1ZA3B 2PF6A 4JFEB 4YHLH 4WUKH 3V6BR 1IEAA 2C7UA 4XNUL 5IB2A 5DUBB 4L8CB 2WINA 3CIQA 4LGPB 1R5WB 4X4ME 2UV3A 4BH7B 3EYSH 4XHJC 3IU3A 1U3ZA 5GIRB 4PLJD 4GKZB 1Q0XH 2FSEA 4U2ZA 2GAZA 5JZ7C 2YKLH 4JKMA 3WDJA 1OGAE 3HRPA 4I18B 4HZAA 4PJDE 4XPGL 1KJMB 1HHGA 2Z4QB 3UTTE 3L5WA 1KB5A 3TYFA 2PCPA 1IGIH 4TSCL 3AUVA 3IS1X 4LPCA 2AJ3A 1VPOH 3JV5A 1HILB 4F57H 4YNYB 4E41E 3KPSA 3GSQA 3S36H 5MENB 3WFDH 4JDZB 3V4VH 5B38B 5FB8B 4GXUM 5D7IF 3MQIA 3R06A 4DTGL 1FV1B 5D7IE 4NUGL 1X5AA 5JUEH 2HKHL 1HCVA 5E5MA 4HWBH 3D25A 5GS0H 4XPFH 4KTDL 5T3ZD 3VXSA 1I7RB 5C08D 1T2JA 3KHQA 4R90L 5C0CB 4DOHE 1DDHA 5B22A 2XWJB 3VFNA 1JWUB 4JR9H 2BSSB 4TVPE 4HUXA 5HDBE 5T3XE 2WUCL 3K46A 5GS1B 4UIMB 1LP9F 1YEGL 4NO0B 5ENWA 1YY9C 3L5HA 3BN9D 4FQ1L 4BQ6A 2ZSWB 4F80A 1OWRM 4P46B 4XPAL 2ICWB 3LCYA 4U4BA 1IT9L 4NN5C 5H8DA 5GGTH 3RPIA 4TVPD 1LHZA 1M6OA 5DJCA 5J89A 1AJ7H 1F4YH 1PAMA 3LN5B 2HTKD 4DN3H 4JFZH 5FCSH 1HSBA 1ZGLA 4UQ2A 3RUGF 3JWDL 3MREA 4OFYD 4AYFA 5C08B 1XGTB 2C3VB 1WFOA 1JNHA 5L7XL 2CQVA 3QDGB 3RTQA 4EXKA 3RX5A 3BXNA 3VFGL 4LSQH 5EZJB 1G9NH 4XCCH 5C6TH 5ACLA 2OL3B 1CTOA 2F5BH 2FX8L 3FMGL 1F4AA 3FN3A 3MRRA 4NZJA 4Y2DB 1TCMA 3U0WH 5J11C 2F53E 2VDKL 1BJ1J 4MZ3A 3HUJE 3P9LA 2CDEB 2P48B 5DI8B 3O41A 4R7DA 4YC2B 1K3IA 2D3VA 2WIIB 2CJUL 5C07B 3EFDH 1BHGA 1WZ1H 4JFDA 4P2QA 3FT3A 1A3RL 1T4KB 3L3OA 4J3XA 4WRLA 2AEPH 1CLZH 3VXRA 5DR5L 3TO4C 1AP2A 2XN9E 4HIIA 4EZMA 1U58A 1PVHA 3IB4A 3W9EA 3ARZA 1JZ6A 4RMTA 4R4BA 5DLMH 1QO3A 2J4WH 5C0IA 1CG9B 3BGMA 5DQJA 3KYMA 1SJHB 1JHTA 3BQUD 4MNQA 4QCIA 1NCNA 3WDHA 1IEBA 2Y07H 4NWTH 1ZLWK 2H9GB 3TT1H 1F3RB 1YECH 5D7KD 4JCMA 1FVEB 3MLYH 4JY6A 5J57B 1J1OL 1ODAA 3ULVF 1FYTD 1Y6KR 3OGCA 5M95B 3EOTL 3NIFF 1DANU 3L6FB 3FB5B 1LD9A 3TESA 5DZOA 3QUYD 5CCKL 3JV4B 1FCCA 5JZ7D 4HX1A 3NA9H 1J18A 4JO2H 1I9RH 1TZIB 4PRPE 2IMNA 2NY6B 4MQTB 4OZHB 1JPSH 1CL7I 4YPGB 1F5WA 4NM8L 4NNYA 1RUML 3IETB 1UXWB 4Y4HA 5JW4R 3AMLA 1X4YA 4KVNL 4JFFB 5FO9A 3A6BH 3TNNB 2P5ED 1OGAA 1UWGL 3X14B 3BZDA 5FYKL 1U8JB 3I75B 5KN5B 2CK2A 3RTQB 4U1MB 3WFZA 1UZ6F 1UWEH 4ODTH 4DAGL 1U8PB 4ONHA 4NQUA 1HHJB 2G9HA 3FRUB 3KPOA 4PJFE 1RK1A 2J8UB 1REIA 3GBLA 4X6BA 4JDVB 5ESAB 1ZT4A 2A83A 1NCAL 2MPAH 4L9DA 1ADQH 4F7TA 3OR7B 3GHBH 3AXLB 3RU8H 4I48A 3SQOH 4JJHA 3QRFM 3HMXL 1FNFA 3SJVE 4HAGA 3T3PF 2EIBA 4BQ9A 1OSPH 3QXDB 3BJ91 4Y89A 3P4LA 1NAML 1R5VB 1EHAA 1F58L 3P9MB 5IW1A 4QHUB 3BKMH 3OG4B 5IMLB 3W2DL 4Z77A 4Z7OE 2XWJA 3OJ2C 4HPOL 1B9ZA 4X6CB 2DQTL 3V5HA 3LB6C 4KROC 4BYHA 1SYSB 3LRHA 3MFFA 1TJGL 5E2JA 1B4JH 1KCSL 4UUJA 2ATPA 5E8OA 2QLVB 3G6JE 4Y19A 3MLPA 3WXVH 1J0JA 3KYOA 1UCBH 2DICA 3R06B 3BRFA 1T5WA 4PRHD 3MX0A 3MV9E 3E3QE 1JL8A 3MMEB 4LMQE 4DCQA 5C0CE 1N64L 3HI1B 4G6KL 2VISA 4GXUN 3G6JA 4Y19E 5DJ6A 3S35L 3VE0A 5ADOH 3RWFB 3JV6B 2E5EA 4XPGH 5CD5D 3TWCH 1CXKA 4J4PD 1X5GA 1CBVH 3MV8E 3ARGB 3MV8B 1HYRC 1R5WA 2DM7A 4HJGA 4ODXB 3ZKND 1LEIA 5AYUL 4ZG1A 1CDIA 3QDJD 4L4TE 5AZ2H 2YBRB 2H3NA 1K4DA 3ZE0F 4EDWH 5DO2D 5D71L 4J6RL 1A2YA 3SE3C 3QIWB 5EU7E 1QA9A 3D18A 3DBXA 1MY5A 4LEOA 5J1AA 5TH2B 2I25N 5KW9L 5GHWH 2IBZX 2R1XA 3ARBC 5KSVA 4BFBD 2HJLA 3HPLA 1C7SA 4G6AC 2ERJB 2YPLB 4W6XB 2UY7A 1MCOH 1LK3L 4OFKA 1A9EA 1PKOA 4QRPB 4NJAL 3WD5H 2AJXH 4PGBB 2EEDA 1Q0YH 4ZOCA 2DQUL 2F54B 1QRNE 4HW6A 1W72L 4JPIA 3DGGB 1W0VB 3LHPH 2X1WL 43C9A 2AAVA 4X9BA 4Z0XB 1IMHC 4PP1D 4OZFH 3G5XB 4CMMA 3TJEL 5DO2C 4F58L 2G5BA 3QO0A 4Y7MA 1U8HA 4KVCH 1ZHBA 1E4JA 4P9HH 1BWMA 1SM3L 3R8QA 1BD2D 2VDQH 4M93C 4PREA 5B8CA 4F58H 4NDMA 1FGNH 3VGHA 1MCWW 1IQDA 4H20H 3OKEB 3I50H 2H1PH 1FG9C 3L3JA 3FQXA 3S37L 1HHKB 2JIXB 4WWKD 5HYSG 1HQRB 1IGFH 2L4OA 4IIQB 4PRDB 1OAUH 5D6DC 1TIUA 4Y2DC 3M8OH 3F12A 2OZ4A 3HZVB 3WSQL 4KHXL 3QIWC 5T1LD 4ZYKB 2XQYG 1J1PH 3PABA 4LLWB 4S1SL 4F33B 3EO9L 3GSUB 1QFUH 4U1SB 2GTWA 5T1MA 2E6QA 1L7IL 4K3DH 1R3LB 1FFRA 2P8PB 3IDGA 3FO9B 1IQDB 1NGWA 3EOAA 3MUGB 3ZKXB 1NCBL 1F02I 3DMMD 4LK4A 3RWEA 1F3JB 4DVBB 3ULUE 3W0WA 5HVHB 1KELH 3KJ6H 1I1YA 2K7PA 3VDCA 4MXVE 2FYYA 3VG9C 4S1QH 1R24A 1JFQL 2FR4A 3B5HA 5LGHH 1QQDA 3U36B 4LKXA 4BELD 4DZBA 1BOGA 4KI5C 2X4SA 5J12C 2FO1A 3OF6D 2CK0L 3ARDD 1FNLA 3P77B 3U9UB 3DROA 1PEZA 2LV4A 4WV1A 4ISVB 1HCFX 4F3FA 4ESKA 1JPSL 4LMQI 1KIRB 4HK0B 1JP5A 3B83A 1PZUB 1F58H 1I3RB 1M7XA 2BVQB 2YMXL 4Z7VB 4N0YL 5BRZD 2OP4H 3NMEA 1N59B 1ZSDA 4FMFA 5C6WH 3D39D 3E2HC 4GLRI 3GIZH 5DGRA 4LPTA 3RKDD 2XG4A 1FZOB 1MHHA 15C8H 1O5DT 4ZAKD 5KANI 5F89B 5IVXE 1OAXL 1X4XA 4RFNC 3WXVL 3PV7A 4M5YH 2NXYD 4PJ5B 3WFHB 3AVEA 4PJCF 1QP1A 5I73B 1RSFA 2D7TL 5JR1L 2CGRL 1MCDA 1LEIB 2KQMA 5K9JH 1VEOA 1YNKH 3WL9B 3U9PH 4K23H 3V4UH 3GDBA 3H42H 3GRWH 1IGTB 2P7TB 4JZNA 5MENE 1JPFA 5ACZA 3K8LA 2OLDA 4OCYL 3X3FL 4KI5E 3RDTD 1HH9B 2W9EL 2V2WB 5B39A 3CFBA 3QHZH 3MRJB 4YDIH 3RY6A 4Y4KC 4BZ1H 4YXHL 3WKML 1TTUA 3IRPX 5I8OL 1T2QL 3PWLA 4XWGL 4ZAKB 1RJLA 5EIQA 1R3KA 2CR3A 1U8OB 1RURH 3SKOA 3H7LA 3HI5H 3SBWA 4TNVK 1T83A 4Y1AB 1ROWA 5BRZB 4FZ8L 2EE2A 1RIVH 2GCYB 2W0PA 4BQBA 2NY3D 4O5LH 4QNPF 3B6SB 3VRLF 4OCXH 1KLFA 1C16B 2AJSL 3HFML 3AS3A 4YBHA 1G7IA 3BP4A 3CFIC 1NUGA 2BDNL 4NZUH 2CXKA 4B5EA 1QSZA 4MA3A 5FO7A 5D6CA 3X13B 3QXDA 4R97B 3ZT5A 1PYWB 4JGJA 1CDGA 1WISA 4K9EC 4EI6A 1JGVL 5A40E 2VDOL 4MNGE 2FJFB 4M43H 1IGJB 2VC2L 3EYUL 1LE9A 4WI2A 1MY7A 2EDLA 4L29A 4EDXB 3UTSB 5F6IC 2VABB 1T80A 4PS4H 5IQ7H 2FBJH 1SBSL 3RVXC 4J8RB 3O3BA 1X6NA 4OV5B 2IQAA 4PJCA 3OMZA 1BVKB 4JY5L 4EOWL 1KENL 2IQ9H 3GJFB 1MOEA 4OZHF 2F5AL 1SBSH 2R23A 5CIPB 4JZJC 1G7PB 1RZIA 2EKSB 3BI9X 1A7OL 3O4LB 1AGEB 4HIJB 2JB5L 1NDGB 4W81A 1GHFL 2Z8RA 2HT3C 4DW2H 3RWCB 1PW3A 2ZG1A 3P4MA 2F5AH 3GUTB 2BVUA 3LVEA 1WBZB 2V7HA 2VLKD 5EDXA 1U92A 3FTGA 2NTFB 2AV7B 4Y5YA 2DMKA 4KHTL 3JUZA 1XGYL 4HH9A 1TZIA 5I30L 3FCTA 4KMLB 1F4XH 2X1OA 5TFSL 1BD2B 1S9VB 3QEUA 1MFDL 2V2TA 1AXSB 2HVJB 4HCRH 2WNGA 5I1AB 5FUZL 3VFVB 1I3RA 1GOFA 3PDOA 3QXAA 1HH6B 5F6HJ 1T7XA 3X3GH 2C1OB 5EN2B 1FNAA 2EDFA 3BDXA 4ODSH 4C57C 3X11A 3JVGC 2IALB 3UZEA 3GMNA 3MCLL 3IAQA 3WFBH 3EOTH 2ATPB 5FAAA 5B21A 3RDTA 3L1OL 4I0KA 3QH3A 1W8OA 2X4SB 3O6LL 1ES0A 4X6EB 3WUWB 5IMMB 3I2CL 1NLDH 3ESUF 1XEDA 3A6CH 3SQBA 4LCCA 2VTFA 2MNUA 3ARFA 3V9FA 2OSLB 2YPLD 3IDXH 4P5MB 4PGJA 5KG9B 2XZQL 4LLUB 1F6LL 3MA9L 1D5IL 3IU4H 1PZ5B 5I9QB 2BHZA 2HLAB 5AEAA 3CU7A 4JZJB 3MLWL 2XICA 5D72H 1DUYB 2ZUVA 3FTGB 2APBA 3MSPA 3NPSB 4JG1H 3B2VL 5A2KH 4NYLA 1CWVA 4OFVA 3LD8C 3R0NA 2PNDA 4P59H 3GK8H 4O58L 3EZ8A 4JEGB 3PXHA 1GIGH 1WCBB 4LQ1A 3H0TB 5KVEH 1ZS8A 1MCPH 1U42A 1VA9A 5T1KA 4PJCB 4JQXC 3SKNA 3IFLL 1BECA 1MH5A 2VQUA 4PJ5D 2V9TA 4P57A 2C4FT 2VZTA 2R1YA 4PJEE 1GGTA 3HCVA 4BFEA 5DHVH 3OKOA 3IKCA 4YDLC 5D1ZD 1LDPL 3GO1H 4BJLA 3GMLB 5D7LA 1JF6A 2FJFA 3QNYA 1JPST 1FFOB 1MI5B 4P23D 3KS0H 3LY6A 4UIMA 5CEZE 2DQTH 1AC6A 4Q0XL 3TLRA 4J3WA 2R4SL 1BJ8A 3OKLA 4YDIL 4LLUA 3SE9L 1G7LB 4PP2B 4KZEH 1ZHNB 3FQWA 2D2OA 2DB8A 5I9QC 1G7MA 4XNZC 4BFIB 1AFVL 2ZSVA 4RNRB 2V7NB 2E9JA 4R8WH 4U33A 3BWAB 5HI5D 4LBEB 4XPBH 2P5WA 3HLAB 3HPLB 1FV1A 1T1ZA 5AG9A 4IJ3C 5C0IB 1A47A 1BM3L 1WT5C 2D7TH 2EYTB 1T03H 4TSBH 2P5EB 2HVJA 3L5JA 3RGVA 2DLFH 2R2EA 1BP3B 3FFCE 3DLQR 4Y5VA 1FRGL 3BIAX 3QCVH 1BIIB 4L9LC 1FL3B 5DUPL 1JGVH 2YBRA 4JFFE 4CN4A 1T83C 2JE8A 3G6JF 5KSAA 5C1MB 4P5TB 1G1YA 1F90H 1P4BH 4H88L 1IGTA 1U8LA 1VEMA 1OCWL 3VXMD 3NAAH 2XY1A 3LS5H 2ENYA 5B4MD 1GSMA 2HWZH 5I1KL 4X4XB 1CD0A 3BEVB 4P5KB 4C56B 5HVFB 5I1EL 5IW6A 1IC5L 2B4CC 1FL3A 1I8LA 1KPUA 4XP5L 1Q9WA 4X6DE 3DMMB 3GMRB 3QUYC 1J7VR 4IM8A 3MJ7A 3H3PL 4IS6A 1KEMH 2YD7A 1YEKL 5I1EH 3C60B 3QUYA 5BCAA 2OZ4L 2RB8A 1B4RA 2VABA 4IDJH 3TV3H 2OQJA 2BVPA 4HEPG 1AXTL 3NZ8A 5ICZA 3Q1SH 1YYMH 1DJSA 1FORL 3C09C 4G8IB 4LBEA 4LSSH 3TH3T 4F15C 1G0YR 3JTSB 4DEPC 4R4FL 2ZSVB 3PP4L 1QRND 1WC7B 5GRZA 5GZOD 3DRQB 3T0VA 1QACA 4LSVH 4ZFZA 1RJCA 2A6IA 3ME0A 4OUUB 1EGJL 5C7XH 4WO4B 3GSRB 3H6JA 5GS0D 2Y7QA 2P8MA 4FABH 1HEZA 4QHUA 5JOFB 3QUXA 3VH8A 1RULL 3MOBL 1T20B 1T22A 1BOGB 3LEYH 1F45A 4YWGH 1IEHA 4PUBH 3CVIL 3NCJL 1QBMH 2O5YH 3CK0H 1NGXA 4MLIA 4NCC2 4QF1B 5DMGC 2J7LA 5E2TH 1B88A 1UFUA 4ZFOL 2YWZA 4YHKL 3O9WB 4WHDA 4EXPX 4HT1L 4U1GB 1XF3B 2DQCL 5JO5B 1A14H 1JTOA 5MI0B 2CLRA 2FH8A 1QKZL 3H2WA 3KPPB 2B1HH 3MROA 2PYEE 4PD4K 1OM3H 4M9OA 5IB4B 4XHJD 3S7GA 5T1KB 5DVNA 4OLVL 3CU1A 4H1LB 1CVRA 2CR6A 2ZCLL 1RZKH 2NYYD 4X80H 2D0HA 3QUMB 3DO7B 4KRMB 1V7NL 2VXQH 5FYJH 1L7TH 5F1SA 3PIQA 5DHVB 4EI5B 4F7MA 3BZEA 1I1FB 4OT1H 4XC3H 1N6QH 2R1WB 3IETA 3D39A 3S96B 4HCRA 5C0CD 4ZUTA 5F3BB 1U93A 4S1QL 3PP3H 5FYLL 4PREB 2C3XA 4NZTH 1DBJL 3HI6H 3AREA 1TQCB 1I1RA 3L7FA 1D5ZA 4U1GC 4CVWA 4IHOB 5T3XL 4M6NH 1KB5L 3BWUC 3PQYB 5FA3A 1GC1L 4XVJL 2A9MH 2G5BB 5FYLH 5DQDH 1CICB 4PY8I 2VLLA 3VFMB 1MCQA 3VMPA 3U4BL 1YJDL 1H9VA 5T3XH 2IJ0C 1KB5H 1ZSDB 1A0QL 1BAFH 4CW1A 1KCVH 5H94B 4WGWB 1VSCA 4R96B 5CEZH 2GTZA 1RZ7H 3GMOA 4DVRL 4KTYA 1QSFA 1CG9A 3ULUF 2LE9A 3Q5OA 3MLTA 3U9UA 4LVNC 4OI8A 1PQZB 2W59A 2LABA 4LFHD 5L2KB 3BP7A 4KGJA 5EU3B 4U05A 1A3LL 5D1ZC 3WLBB 3KPSD 3VFMA 3BHBB 3TZVB 5HVHC 3HAEH 4M4PA 1GGYA 1T04B 4P2CG 3RTQC 3WE6A 3BIKB 2Y25A 1MPAL 5EBLA 2CRYA 4LRNL 4YDVA 4EUPB 1U92B 4NQCB 3MLSL 1S7WA 4K8RD 2DI9A 2H2SC 4WFHD 1WEJH 4G43B 2W65A 2AJYL 3SE3A 5MEQB 1D5BB 4KKAD 1H3WM 2QADD 2CMRH 4NRYA 3DUUB 3U0TB 4DGYL 1TJHL 1L0QA 5EOCL 3PIQB 4NNPH 5DHVA 3VI3F 1N5AA 1S9YA 5D5ME 2DQEH 4DN3L 3L3GB 2H8PA 1E4KA 3P73B 4JG0L 2DJ4A 5HYJE 1FO0H 2DD8H 3F12B 4AG4H 4N90D 4MAUL 4MQXD 4R0LB 4I13B 2B20A 4RCAA 2BNQE 1AGDA 1ZTXH 5DJAB 1RUAL 1HQRA 2FGZA 3RI5K 1HHKA 2JIXA 3KPPA 5DS8A 1JZ5A 2PUQT 3MUY1 1MWAA 3SDDA 4P2QD 3QFJB 5BV7B 1P1ZA 5CJ8A 4M9PA 5GS1A 4OQ1A 3PV6B 1MSPA 2QQKH 2OP4L 1FYTE 5BJTA 1M7DB 1UZ8A 4LHUG 1YEKH 2BSSA 5D8JL 4QHNB 4CDHA 3IVKB 2GFBA 3HAEB 4XBPB 2V5SA 3QUXB 3DYOA 3VH8B 3I6KA 3TC9A 2DQGL 5IMLA 2R2CA 3UBXI 5BJTB 1I7TB 1DANT 4OB5L 3U46B 4JPIB 3VRJA 1ZVSB 1AGFB 2VLJD 2Q8BL 1N5YH 4OGZA 3QDMD 1M71B 5I8CA 3STLB 2CGRH 4ZUSB 1AQDA 5IF0B 1CFVH 5DRNB 3AXLA 1P4LA 4YHZH 3ARGC 4KMTL 1J8HA 4LSDA 5JPMB 5GGSA 3JV0A 3VRIA 2OQJB 4JQIL 4N1CA 4J7RA 2EH7L 1DVFC 4OZIF 4LEOB 3NFNB 5HYJA 4YEFA 1HHGB 2Z4QA 5F8QC 1F6FB 2NY2D 2NW3A 3TN0A 1D9KC 5D2LB 1I8KB 2EIZB 2FEEL 4LLDA 4XCNA 1DR9A 2IC2A 2VZOA 5CJQL 5JHLL 2F8OA 4LDLB 1FBIL 5KN5A 4DUVA 1A7QL 3AB0C 1OD9A 3KLDA 1MCFA 3WNPA 3SGKC 5FA4B 1XF5A 2E8YA 3QPQD 5JHLH 3GI8L 2X42A 1WBYA 2XZAL 3T4YB 3BIKA 2QJDA 3IJYA 3NGBC 2EDRA 2AEQH 4BUHA 3U0PA 4HBCL 1QR4A 5AG8A 4LSRH 3NCBB 1N6QL 3MBXL 4BM7A 3TWCL 3VRIB 1CFBA 4M8QB 4NCDA 4FABL 1PQZA 4CBPA 1CBVL 1P6AB 4HDIA 4JKLA 4W68A 2HKFL 3B43A 1ETZA 1BMGA 2YA0A 3UROR 1YPZB 1V3JA 1M05A 2D31A 2PO6C 3FONA 4B53A 1XF4A 1CIDA 4HS3A 3BT2H 3EFFB 3FZUC 1G6RA 1FAKT 1CFTA 1JVKA 3CMGA 1LGVA 5H37H 3PUCA 1I3VA 5BZDA 4HIIB 3BKJL 1OAQH 4DFIA 3QQ3B 3IJSB 4AL8H 4AY0A 4EUPG 5HGAA 4OLWL 7FABL 3RZCA 1O7VA 2AABH 4IHOA 5KVGL 1K4CB 4MVBD 5E6ID 4X0KA 2E7MA 5DGQA 3KLAB 3OXSB 3L95B 4HKJB 3EOAB 4L8BB 4QT5B 3GSVB 1ZANH 3X12B 2ICEB 3EDDA 1U91A 3BE1H 4F37K 3CMOH 2BVOA 1KV3A 3LKSB 1WF5A 3BGFC 3PWJB 4R0LA 1PG7W 4MHHG 3JSSA 1IC7L 4KHTH 2X4RA 3VXQA 5CS7A 2FGWH 1JPGB 1KYOJ 1HHJA 3VXNB 3ALPA 5DSCB 3MRNA 2H2SD 3HG1D 5GGVY 5CP3H 3FN0H 4GJTB 4IRSB 4K7PY 2EDXA 5HYIA 4PJXE 1W72A 3U2SB 3EYSL 5IROC 2VWEC 4NNPL 3QQ4B 2CRMA 4UTBH 4U6XA 4XP4L 2W38A 3AS1A 4CN1A 2DOCA 1CK0L 2BFVL 4XPAH 1V7MH 4YR6B 4A6YL 4EI5C 1SHMA 3MLZL 5LBSL 1FH5H 4X8JA 3QO1A 1KTLA 5C0EA 1F4WH 1UM6H 2RQ8A 1VPOL 4Y88A 4JRYE 1PZ5A 1B6DA 4KTEL 4CVUA 2ADJB 4KHXH 4P0DA 1A1MA 4Z7NF 4XPBL 4WO4A 5ADPH 2BK8A 4K9EL 2APWA 4PGBA 2VLJE 4Z78B 1P7QA 3P11L 4JO4L 4PJDB 1H0DA 1FDLH 2R0LH 4JZOB 1P2CA 2BRRH 1BQLH 3ZE1F 3GMNB 4DW2L 5F88B 1N26A 5J12B 5EORL 4NT6A 4TNVF 5I1GH 3P11H 4UOW1 5HGHB 4ZQKA 4LLYB 5MERB 1WCQA 3DMMC 3QUYB 1AY1L 2ZUQC 4OZFG 2OK0L 5I1AA 4H0GA 3EGSA 2F9BT 4WFHE 2IG2H 3HNSL 1B90A 2BOCB 3LV3A 3GMRA 2PXYA 3GZKA 3WNNA 5J8OA 3BEVA 4P5KA 5B8CC 2IFGA 1C12A 1CLZL 3RHWK 2I9TA 3VXRD 2BP3A 3F7VB 2ZG3A 4DKEH 2E8ZA 4K2UL 4LHUB 3RL1A 2LAAA 2EDEA 1XF5B 4P3WA 1AXIB 4MSWA 4P5TA 1G0DA 1OAKH 4L8SA 4C55A 1INQA 1AGEA 1YNTA 3AFLA 3VGBA 4FTVE 3VXUD 4HS6A 3T0EE 4P2OB 3N0PB 2ID5A 5EWIL 1YMME 3GEWB 3TN0B 3I9GH 2ZNXA 5EU7C 3TVMA 1BFOA 3IDXL 5K33A 4HZLA 5F7DB 4GS7B 1J1PL 1IGYA 4URTB 4HIEA 5DTFA 5GRXG 2CLRB 3CSYA 1IILE 4JO2L 1YEJH 3D69B 3UYPA 1UKSA 2XWBB 3OXRB 4Y0GA 3P4OB 2FLRT 5SWSD 2HLFD 2CJUH 4JZOA 5GJTH 3RKDC 5GS0C 3RVTC 5L2KD 2V7NA 3GBNL 1BM3H 1HINH 4X6CA 2VL5B 1UENA 5I1HL 4YHZL 1V3LA 2DWDB 5DD1H 4HK3J 2JKXA 5LG1A 5IESH 4RA0C 3T1FB 3U79A 1GGBH 1DDHB 4WHCA 4WU7B 4FQPA 4ZPTB 5C0EB 3VXSB 4L1HA 1WC7A 3CPLB 4HIXL 4KQ3H 3DETC 1LO4L 3DTXA 1QLFB 5E5MB 1E28B 2P44B 4I48B 1NCWL 3UPRB 4MAYB 5KOVC 2VXSH 2VAAB 2VDNH 3QSKB 2VZUA 2VN4A 3PWLB 3MRIA 3KYKH 4UT9H 4XMPL 5DS8B 4ZAKA 2VLRE 3KPNA 4U7SA 3QDJA 5IFJA 4I9WE 2IGFL 4OZGF 1GGCH 4PJ9A 4OZGE 3N1QC 4XP5H 3CXDH 2C3GA 2WQRA 3VD3A 2JLLA 2YD4A 5CD3B 3QHFL 1TCRB 3SCMB 3SDAD 5DWUH 4HPOH 4U6VH 4J3VA 2ED7A 1S7QB 1LEGA 3D85A 5JOEA 2W65B 3NN8A 4Y4KA 2I9LB 5AAMA 5IIEA 1X5FA 3GIVA 4QNPE 5BOZG 1VKXA 2OJZL 4FNLH 1KYOK 3KVQA 4GRWE 5ESQB 3BUYB 1OTUC 5EBLB 1BZQK 4FZEL 5EBMB 5I71B 4R0LC 5ALCL 1K6QH 1NBVL 3K2MC 3MA7A 5F71A 2PYEB 3TBVB 2EXWC 1ORQB 4R7NA 3VFTA 4KY1H 1CFNA 2QSCH 2FATH 3WDIA 1B0WA 2KZWA 1P4BL 5DQJB 4NKOA 3ULSB 2J6EL 3SDXE 4M48L 4K7FA 5FIEA 3VA2C 2X41A 1R3IH 1LMKA 5K9KB 4OLXL 1F3DJ 3ARPA 1YEIH 4LARL 2ADJA 4P2QB 1EEYB 2BSRA 4L3EB 4UAOB 3ARBB 3WSQH 4NNXB 5ALBL 2P47B 3CLEH 5E4EB 2EIDA 2VSCA 5GGQL 1YN6A 3S5LB 5JW4N 3MRHB 1QFWL 4YHNA 1KN2L 1CGUA 1JHKH 1NGZA 4J3SA 4RSVA 4YFLI 3OAUL 5TGBB 4G6FD 2JELH 3QUXD 4FQ1H 2PXYD 1NGPH 3DVIA 3FO9A 2AEWA 3UTSD 4JG0H 3CC5B 5ICXB 5KJRH 2IG2L 3HNSH 4IRSA 1I1FA 1A6ZA 1H15B 3T0ED 2DWEB 2A0LC 3LH2L 2FBJL 5HPMB 2JELL 4ZNCD 5FOBA 3RWJB 4XI5C 3WBDA 4UILH 5TDNA 4HULB 3QHTC 3VXME 3JWDH 3MYJB 2J5LB 1H3PL 4FQCH 1HXMA 2WUBH 2R9HD 5DT1L 1U36A 2H2PC 2EZ0C 2NY3B 4LLAA 2ICWJ 3E1F1 5D4QA 3QUZD 5IBUB 4EQ2A 3RPIB 1CGSL 5ESVA 5IV2B 5FV1L 4XVUD 4OCWH 2A73B 1JYNA 4PGDB 3F5WB 5D9SB 1PYWA 4HJJL 1ZHBB 4LCIH 1U8IA 4PRHE 3I9GL 5GGSY 1E6JL 5INCA 4MMXC 3VWKB 2VRAA 3NTCL 2HTLD 2Y4SA 1DEEB 1JNLH 4JPVL 3G5XA 5KBNC 3DYPA 4OZIE 4Z95L 2NR6C 4UU9A 2R0WL 3WIHH 4CDGC 4U1JB 3W9DB 1NMBL 4XPHL 3WNMA 5I1CH 1R0AH 4JQIH 5LCVH 2EYSB 1RZFH 2FL5A 4EIZC 5B3JE 2NY5L 2P8LA 1VGEH 5L88H 1HILA 2WANA 4JRYD 3H42L 2NY4B 4YE4H 1AR1C 3DV4A 2B39A 5E8DH 4ZDHB 2QHRL 1II4E 1U6AL 1T21B 3FCTB 3T77A 2VXVL 1KB5B 5FF6B 4QXGL 5JHDA 2J5LC 1KPUB 4TPRL 5C6PB 4M7ZB 5AUMA 2H3NB 2JTDA 3CD4A 4XHQA 1JGLH 4P2YA 4Q9QL 3ZTJH 1J5OL 1KULA 5TDOB 3ILPA 1AGCA 2LU4A 2IH3B 3C9NB 4L8CA 3X17A 5FHAL 3ARXA 3O3EB 4LKCA 4ZFFA 5CEZL 3BAEL 4ZXBB 4U1NA 4QHMB 5JXEC 4G42B 2QADC 1P6FA 2ZCLH 4MA8L 3FO1B 4S2SA 3O3BB 1ZVHA 5F7MC 3WLBA 4BZ2H 4X5XB 4FRWA 5F96L 2VN7A 3U4AA 2I5YL 5EA0H 4WFFD 5IHUH 5CFHA 1P4LB 3R8BB 4NZTL 2YPLE 2P8LB 1NC2A 1YEFL 4D0BA 1T5WB 3TYGL 1A7BA 2B5IC 2D9QB 3L7EB 4OZ4B 1AGFA 4K3JL 2NY1B 5D7KE 3RA7H 2CLZA 1FZJA 1TJHH 3GRWL 3S88H 1K2DB 4JVWA 3TBTB 4RGMB 5TQ0L 3IVKA 3GKWL 2O26U 1I9EA 4RA3A 1G7LA 1SEBB 4OI9A 4FQLL 4YUEL 4YBLC 2EXYD 2D03H 4JO1L 4YBQC 3LEXA 1FBIH 2W1NA 1ZAGA 3CGTA 1ZT7B 1IARB 3Q1SL 1OPGH 4UOW0 2ZUWA 3HE6D 4X7SH 3LMJH 4Q9BA 4OLXH 1CICC 1AGDB 4C56D 3GI8H 4F33A 3DO7A 1HXMB 3GMPB 3PNWA 1IAOB 3TBSB 5D1QC 2JB6B 3CLEL 1MNUL 3EDEA 2FX7L 4OCRL 1HK6A 2ILLA 1XCQB 5ICYA 3U4EA 2ARJQ 4H26B 2DQGH 4MA1C 3QR2A 3BKYL 3QPQC 4QOKD 5IBLD 3FQXB 4Q97A 4TOYH 4IEFB 3MOQA 4HPYH 5JHDE 3RWIB 2FJHA 5CJOL 5TGBA 4L1DA 4H88H 2DQCH 3GB7B 4XVTL 1D6EA 3A67H 5BOPA 5IG7B 4AEFA 1S7TB 4ZTPH 1JF5A 3S37H 3WEXA 4OSUL 5IMOB 3R1GL 4F7CB 3BHBA 3I02A 1FN4A 1OY3B 1NMCB 3W11C 4CMMB 2DM3A 5TPWH 2XQYK 1D9KD 5EC2B 5E1AB 2DIJA 2EXWD 4QXTB 4H25A 5D1QB 1I75A 5EU3A 1K5NA 3NFSL 2ZNWA 3DETD 2DRUA 2IPUK 3QEQB 3RVXD 1S7XB 3H9SD 1U0QA 3DX7B 1ERNA 3ZT6A 2LVCA 1ES0B 4X6EA 3OKNA 4QRPA 4N8PA 3EYQC 4ZO9A 2Z31C 2AQ2A 4M1DL 1MIMH 3SKJH 3QI9C 2YSSB 2X4NA 2W0FA 3NIGF 2G2RA 3UZVB 5KSVB 4MXVF 4K94L 5KSBF 3D5OF 4FFZH 1TPXB 1WAAF 4P59L 4JE4B 3WIHL 2PKDA 3D18B 3QXWA 1DQML 1VFUA 2DYPD 4QHLA 3SGDH 4DKEL 1Z6JT 1R0AL 1HQ4A 4F9PA 1N0XL 4IOSD 4LOUC 1CFVL 1G7QB 1NBZA 1UXSB 4OD1H 1XFPA 2I9LA 2XA8H 5HI3D 4V1DE 1IT9H 5FYJE 4OJFL 2A1WL 3AC0A 5SWSB 3L3IB 3S37X 1JGDB 5J06A 2OCFD 2HJFA 5FKPA 4AQOA 3MV8A 1FL6B 3FB6B 4X7FC 4Y2DA 1TCRA 2ITDB 4WUUE 1CL7H 2QBWA 1MFNA 2CSPA 3F7PC 4OCWL 1CE1H 1ORSB 4FQIH 5KZCD 2VITA 5B3NA 2D4FA 5JUEL 3SE9H 3HI1A 1FL5B 2EDOA 2ZZUT 4RBPH 3JTTA 1OLZA 1OAXH 5HHME 4KTDH 3KPNB 1KCUH 1NJ9A 3MV9A 3TT3L 3V52H 3OKEA 1QVOB 1E4WH 3WMSA 4K8RC 3O9WA 5H2BA 1LNUA 2I07A 5D72L 4Q9RL 5FYLD 3PWNA 1X5XA 4NSKA 3VFSA 1KEGL 5GRUH 2XN9B 4O2FB 3G5ZB 1PY4A 1DBBH 3MV01 3BE1L 4WFGD 3U7WL 4ODWB 3BEWA 4LQFL 4QXTA 4I8DA 4PRBA 4KWUA 3OB0K 5T5FH 1AHWB 4G6AD 3U83A 2DD8L 4OUUA 4N0UA 3B6SA 1C5CL 2VLMD 3OKLB 2QTEA 2VL5A 1IRAY 1I7RA 1MEXL 1S7TA 4G6MH 1MCRA 3HA0A 3L1OH 3T0EB 1Z5LA 4KZDH 4M4RA 2HJLB 4GRLD 3RWIA 3OKOB 3RNQB 2AJUH 2GUOA 3U4EB 2VE6B 3KJ4C 2CRIA 2GW5A 3EAKA 4OKDA 5GISL 3TVMB 1RK1B 3WHXB 5I74B 3GSOB 5D7JB 1Q9WB 3EUUA 4QO1A 5EWIH 1ZS8B 5HI3C 1S9XA 1TITA 1JGUL 5DJXB 3MO1B 4WW2C 5EOCJ 3O11A 5CMAB 4YHYB 3UBXG 4RGMC 1A02N 1OGAB 4P4KC 4MD4A 5FFLA 2YS4A 2YK1L 1FL6A 1U3HC 3GSNH 4GQ9H 1TZGH 3SHSA 1KTKE 1YZZA 5IB2B 2I27N 5EA0L 2GJZB 3F7VA 2EDHA 2ITCA 4OAWB 5D2NB 4BSVA 1FNHA 1CGYA 3C8KB 4O2CA 5A2FA 4ETQB 3QRGL 1ZHLA 2GHWB 3HS0B 2COQA 3U1SL 5EUOA 3EGSB 4OZGB 3WS6C 3EYVA 4Q2ZB 3VCLA 5IKCB 4YBQD 3C5ZD 3MV7E 3W81A 1FO0A 3PJSB 1CK0H 2BFVH 5E6ZA 3Q2CA 3QH3B 1XZ0A 2X4NB 1J10A 1JN6A 1P2CB 2BNRA 1TVBA 4JFDD 4YHIA 2OJEB 1QSEB 3MXWL 4TQEH 1KSRA 3P0YL 4LSPH 2C1OA 5EN2A 5INDA 4Z78A 3DX7A 2OTUA 1S7SA 1DLFH 5SWZA 5SWQA 5HHXH 3D2UB 4NQEB 1BWWA 4JFOA 5IB1A 1YN7A 1F4XL 2Z93B 3NPSC 3LKNA 5GZOC 5IFHL 5IVNA 1MCEA 4IRJA 2FX7H 1TVHB 3IFNL 4DVBA 1Q1JL 4FQQA 1WBZA 2V7HB 4XC3L 15C8L 3H7BA 1AI1L 4YO0B 3BH9B 5CKGA 5DQ9B 2R1YB 4M43L 3B9KD 4LPWA 3VXPA 1D5MB 3WLWD 4JN2B 3LSOB 4D3CL 4Z9KB 1INDH 4FNLL 2YHGA 1TJIH 4HAFA 3IDIB 1PG7X 3L3KA 5ITFA 3MV8D 4QHKI 2ZUSA 3QEGL 4Y5YC 3O3DA 3C2AL 1IAMA 4NOFA 1XR9B 3NIDE 1MJJB 3TF7C 5FGBC 3HNVL 4QYOA 4XMLH 3FO2A 4UMGA 4LCIL 3QXUA 4OIAA 1X5JA 2MTPA 4O9HH 5F1IA 1JMZA 4J1UB 1CD1A 4OF6A 1JV5A 1T0PB 3KLAA 3OXSA 3MV9D 1AR1D 4UINL 4Z95H 1MIEL 2FWOB 4UDTB 4YHOL 1WLHA 4BA8A 1PFCA 3SO3B 3TO4A 2Z31B 4YXLH 3MBEC 4G7YH 4G5ZH 4WHYG 5BZDB 3E6HA 1YEGH 2GCYA 4M1CC 2FWOA 3AB0B 4AENA 1L6XA 3TFKD 3EFFA 1UKTA 3GM8A 5FV2A 1FP5A 2CIIB 1BGXH 4MNQB 5GGVH 4HKXA 5GRUL 5ADOL 1CD1B 1T1XB 5KVFL 3AROA 1VENA 3WFCH 4FTVD 4XP4H 1R3KB 3TPUB 1ZKAA 2XTLA 4OD1L 1SEQL 4H8WH 5EUOF 4HXAH 1DE4B 5CSZB 1F42A 1T66C 2ENSA 3VXRB 2ZCKH 1QBML 3QEUB 1GJIA 3MYJA 2Q20A 4YXKL 4Y5XC 4D9QD 3UTTA 1MCWM 3IDIA 3B3IB 3EOBA 3B9KA 1CL7L 2DWEA 3QUKA 5DVLA 3KPQB 3VA6A 3ZKSD 4L3ED 1OAYL 5T5NG 4RRPG 5I2IB 4P2OD 2J8UF 4LPYA 3VXUB 5FUOH 1HKLL 5CJBA 2QSCL 4EOWH 2WBWB 3B9VA 4KKBC 1C8PA 1ZANL 1NDGA 1MHPL 4PRAB 3BXNB 3U48A 4I0PA 3WO3B 1AY1H 4G9FD 1KG0A 3SE4C 4P2RE 2HFEB 3AY4C 3CFCH 4HS8L 4LSUL 5C6TL 2AEPL 2Y1VA 2VXUL 1KTRL 1F11B 3O8XC 2VLKA 3RAJH 1ITBB 3MREB 1FRGH 2E27H 3MLUH 4UQ2B 4PJ7B 5JA9A 1MAJA 2IQAB 1KFAL 4I2XA 1T21A 3H9SE 4NO3B 2YK1H 7CGTA 1DQTA 4TSAL 1QLEH 3QIBC 2R0WH 1MFBL 1D5XA 3HZYA 5INDB 4I5BB 5FM4A 2DQFA 6FABL 1MPAH 2YEZB 4PRPD 4PJDF 3I6GA 1ACYH 4Q58C 5F97E 4Z76B 2DKUA 1KJVA 5I8CB 2O5ZH 2Q3ZA 1JHKL 3BO8A 4NFDA 5EZLB 1J1OH 4NO0A 4GKNB 3EKCA 1SYVB 4YZFF 4CU6A 4KVCL 4MX7A 5EBGA 2XOTA 4GG6B 3UC0H 1K6QL 3UJTL 4PJ8A 5J7CC 5D96C 3RWHB 1A7NH 1JWUA 1AR2A 3TH4T 2ZUTA 1XGQA 4LKXB 3HS0A 2UZXB 3G6DL 2PR4L 1CFQB 5HPOA 4M6AA 3VWKA 4F15B 1DBKH 3UJTH 4WTXA 1N2RA 5BZWB 3G6AB 4KDVA 5A43C 4RMUA 2ITCB 3LMJL 5E2UH 5IFAH 5KSAC 1KIQB 1N3NA 3RY5A 4FFVC 1WT5A 3UTPD 4MNHA 2D7PA 5J9PB 2P8PA 2XG5A 1JIBA 3K2UL 4FG6C 2X40A 1KXTB 3O11B 5CMAA 4QKXB 2HRPH 3QZWB 4ZXBC 2NY1D 1T5XA 1TLKA 2PXYC 5FGCE 3IDYB 5F9OL 1CU4H 2G60L 5EB9A 3BQUA 1U9KA 4G3YH 5DMIH 1KCKA 2GAZB 2C1PB 5IBUG 1C1EH 3IDMA 4WTWA 3RVUD 2ATKA 1QR1B 2FZ3B 2WWKO 3VFSB 3R4DA 3U0TA 1OTTC 2UUDK 1JWMB 5JXED 1D5BA 1BZ9A 3LN4A 2F53B 2MCPL 1UXWA 1BQHG 5I71C 1MCJA 4NQCA 1ED3B 1OP3H 2B0SH 4M03A 3UJJL 2X6MA 3OG6B 2B1HL 5BS0E 5C3LD 3BPOC 4MAUH 2X4QB 1IAKA 5D96B 3MRMB 1WAAA 2RGSA 5BVJB 2A6DA 4OD2A 5BQ7B 2PTTB 4POUB 3RUGB 1W0WA 3MNVB 3PGCA 3WCYA 1JI2A 5EBWA 4O2FA 2DAVA 3ULVC 3VDAA 4DTGH 4NN6B 3WN5C 5AAWA 1OPGL 2MQ0A 5CINL 5HHVL 2X4TB 4NQXB 5J6HB 2X05A 4M1CD 5D1ZA 2X4OA 3IGAB 1AP2B 4GRWH 1EPFA 4EN3C 5DQDL 4FFVD 4NC1C 1UM5H 3BUYA 1MFAH 2WSKA 5DMJB 3RWEB 1A4KB 1X5ZA 3B2UD 3BW9B 1YNLH 3ALXA 3CVHB 4ZFOA 4KAQH 4HMCA 1DSFH 2XZZA 4MD5A 2BHUA 4JKKA 3IFOB 1OP9A 5E2WH 4XB8A 2DQDH 3P9LB 4G7VH 3HUJA 4FXKA 2CUIA 1YEFH 1S7QA 3O3AA 2OTPA 3LZFH 4XMLL 4JO3H 1N6UA 1MVUB 2L7JA 2R9HC 1K9TA 4JLRB 1XMWA 4RFNB 1A4KA 4IOFC 1T1WB 1MCHA 4F2MA 4HC1H 1W0YT 3JV6A 4JY5H 5E1AA 2PTTA 3EO1B 3PQYE 4PJXB 1GRWA 1F4WL 3UAJC 2MHAB 5B38G 3VGEA 1UWXK 1IAKB 4Z7QE 1CN4A 4G9FB 2NW2A 2LAGB 3MLVH 4HC1L 2W07A 3KPMB 3E8UL 3FO0L 2IH1B 5LXGL 3QIBD 2W0FB 4M00A 4XNQA 4QEGA 1U8QA 1ZEAL 2VWEE 5DJCB 1MRCL 1E6OL 4PLKC 4LSUH 3WUWG 1ZV5A 3K80A 5TDPA 2ZPKL 3OJDB 1QLFA 3W39A 4D9RD 1OAZH 3MFFB 4WWKA 1KIUA 2WWKT 4NQSA 3RUGA 1T6VN 2ZOLA 5TFSH 4MCYB 4X99A 1DVFB 5FHBL 4P4KB 4F8TA 1A5FL 1CLOL 5EU6E 3J7HA 4X6FA 3MUHL 3PL6A 4HUWB 4POYA 1RU9H 3L5XL 3ARDC 4N0RA 4NO2A 3QQ4A 4LEXL 4DGVL 3DX8B 2GT9A 3DNKA 1LP9A 5E7FA 1AO7D 3BMVA 4POZD 3PHOB 5IJKC 1NLDL 5ANMB 3GSNA 5FYKU 2BMKA 3FB7A 1TQBB 2BVEA 2DL2A 4AL8L 2QSQA 5HI4C 3V7AE 2ZKHL 1CZ8H 5CCKH 2NXZD 4TYUA 1XGQB 1KOAA 3BQUB 4KH2A 4H20L 3STZA 1E4XH 4MNGA 25C8L 4NUJB 5J1TC 4HEME 4XNZB 4P9HC 4U1IA 1U91B 5D7IA 3HPJA 2VIRB 3K81A 5I1LA 1OOAA 1KJ2B 4M62H 3OAUH 5DUBA 5I17A 2FX9H 1ZA6A 4NKMA 1D5XB 1DN2A 2AXFB 1I8MB 3GBNH 1I1CA 1L7TL 1RZJC 1F6AB 1HXYB 3FN0L 5CSGA 4I2XB 3ZL4H 2HAZA 2RR3A 4NJ9H 4YIQB 3MRGA 5T5FL 5D70L 2ESVD 3E6FA 2BXYA 3EJZC 3QXVA 4ZTOH 2NY1C 1DL7L 4HHAB 4DUXA 4QRRE 5C0FB 2DLTA 3BMWA 2Y06H 3DSFH 3ZE0E 1V7ML 2EYRB 2EO9A 1RUPL 1YPZE 4EKXA 1ZVYA 4PGZA 2IH3A 3C9NA 3VWJC 3T3MF 3RY4A 4U2YA 5IVZA 3QEHB 1EBPA 3T3ME 3VMOA 3D0VB 2LTQC 1LE5A 1NC4B 2DIBA 2DDQH 2DI8A 4RNRA 1YEEH 4EEEA 2DQFB 2GIYA 2Q76A 4ONFH 2Y36L 1OTSD 4LIQH 3QUKB 4N5ED 1RZ8A 1LVEA 1UADC 1ZHNA 1HWGB 1NCDH 3M45A 4HBCH 4Q7DA 1UB5A 1GGCL 5GS3A 5K59E 3QIBA 2HH0H 4G8GB 4ONGL 1MHCB 4XXCC 1DTUA 4NKMB 1AIFB 1QSFD 1KCSH 3SKUD 3N1PC 4PYGA 3OZ9L 1PKQE 3T4AA 3IXTA 2HFFA 1IC1A 1UCTA 3THMH 5FO8A 3BSZL 2VIRA 2BZDA 2BSTB 4HWZA 5KSUB 5DJDB 3QCUL 4JDVA 4PRPA 4FN0A 1OQXA 2B4CL 1A21A 4H5SA 5JR1H 2C3HA 5M7QA 4L8DA 3KWWA 3QP3A 4Z7WA 4YC2C 2Z31A 3H0TA 1XGTA 2VR4A 1EEQA 5E7BA 3O3UN 5F3HB 1KJ3L 1U8JA 2QV2A 2DLIA 1FLTX 3X14A 2DQEL 5I19L 1QSED 4QXUL 1UM4L 1GOHA 4JPWH 4RFEB 1A64A 4JHWL 3GRWA 1FVCA 4ZUSA 4J1UA 1KIPA 2FECL 4WI4A 2VERN 4WEBH 3LS5L 3X12A 4YDJB 3HZKB 4FZ8H 2ZSWA 5E9DA 4L4VD 5BW7C 5D2NC 2CIIA 3PP3K 3T2PA 4YQXH 3CFKB 3UPCA 4I9WD 4M48H 4X0KB 3DXAD 3U82B 4U0RB 4W4OA 3JV4A 4WTZA 3HAEA 4K3EL 4DZ8A 2Z8SA 2WP3O 3B4NA 3FQRA 3TJHD 4ZOAA 1KNOB 5JDSA 3QQ3A 4BZYA 5KW9H 1IQWH 5KS9F 3ROOA 1J12A 5INCB 4OLUH 5I15L 1DVFD 3BPOB 3IDJB 1JF1A 1HDMB 3H3BC 4HMEA 5F72S 1DBAL 3I84A 3QFJA 1B0RB 4QGTA 5DJ8B 1IGMH 1U8QB 4LLMB 1A6UH 2G75B 2IALA 4JANA 4WU5A 4RX4A 2RCSH 3TYGH 5FKAA 4HV8A 3W0WD 5L0QC 1I85A 4LVNB 3T1WA 5L8KB 1LO2H 1MLBA 2V2TB 4PJ8D 5CP3A 1JRHL 4KTEH 3MRBA 3P73A 1NBQA 1YN7B 2NY7H 5TDNB 3EYUH 4F37F 1T1WA 4WIQA 2YPVL 1RZ8B 1MVUA 1T7YA 1Q9KA 5EFIA 5FYJD 2LQRA 3CFDA 1X6LA 3ZDXE 1V3MA 4Y5YB 5E8EB 4OKVA 1FNGA 2HT4D 4UQ3B 1EMTL 1MAML 1NL0H 3QDHA 3C6LB 1JTPA 2BRRL 3H7BB 4U3CA 4M61A 4QRQB 3VXMB 1CE6B 4UB0H 3TBVA 3T4AB 2EDWA 1AO7E 3MLRH 1Q72L 1KN4H 3NCCB 3T0EC 2WAHA 4G6JL 4Y16C 2HKHH 5DZLA 4OZGA 1MFDH 3WS3B 3O2VH 1HHIA 4XCEA 1ZGLP 5DRZB 1J8HD 3S3JA 3NFNA 5D1XC 3D2UA 3ARSA 1KN4L 3EO9H 1C5DB 5DK2A 1GZPA 4LASL 4HUVB 2BOBA 1S5IL 2XN9D 1J11A 2UY6A 4R3SB 5IM7B 1A6WL 5EU6D 3RHWF 3PQYD 3RZWA 1PDKA 3MJ9L 4YHIB 1NC4A 3T2NH 1CI5A 2H6PA 5I1CL 4U1LB 3MRFB 2Y5TB 1JN6B 4MJ6A 1XH3A 3T8XA 2ZUYA 3D0LB 5H94A 5ENWB 3A6CL 1Z2KA 4CW1B 4UDUA 4X8XA 1W0WB 5FYLE 1BVZA 1IKNC 3DX6A 5EU6A 1R5IB 4NPYA 3UYRL 5HDBF 1DBKL 2Z35A 4GAYA 3BVNB 4GBXD 4DAGH 4Y8AA 5BVJA 2DLHA 1CICA 2P45B 3HE7C 4RFOL 4QY8A 1P9MA 3UJIL 3O2WL 4XBGA 1QBLL 4WGVB 3V0WH 2UVEA 4Y4KD 2GSIB 5JIPA 3MRDA 5EO0A 3CZFA 3BT2L 4L4TB 1FE8L 3VJ6B 1B2WH 3C2AH 3VD5A 1SVZA 5F3BA 4V1DB 3K2UH 5T1KD 3SGEH 43CAB 3V0WL 2GJZA 4WI5A 4C83B 4Q6IA 1SJXA 4A2LA 2ZUUA 3V8OA 3ZTJG 1BVLB 2JJTA 2V9QA 3TO4D 2EDYA 2PN5A 4UBDC 1CXHA 3GBML 2BY1A 2R0ZL 4PPTA 4MJIE 5IFHH 2GITB 3PDDA 4MNGB 3MR9B 3O6KL 1E6JH 4JG1L 5I0ZA 1OP5K 2YUVA 4PRBB 4N8CL 1JCKA 4ZODA 4BH7A 2P7TA 4KQ3L 3NBNA 1FLRH 2A9ML 2N7BA 3RVWD 2UWEA 4XP6H 3SQOL 3UMTA 4I1NB 2I07B 3U9PL 2DLGA 1XIWB 1JI1A 1YMHA 2EO1A 4QOKB 1T1YA 3T65B 2UZYB 4MJ5B 4P4RB 4O51B 5DJZA 5T3ZH 1HIML 2I60L 1T7ZA 4CADA 1KJ3H 3LIZL 4DVRH 1UKQA 1A7NL 2GSGB 5MEOA 5HHOA 3ULVD 5E5UB 5E03A 4JHBA 3QULA 3OAZH 1TJGH 3AU1B 3Q6FB 4LIQL 5AYQA 1HIMH 3DRQA 5IBLC 3S4SB 4FQLH 4QRQA 1Z0MA 5GS2H 4DQOH 4WFED 5E4EC 1RZJH 5ETUA 1LO0L 1G84A 5H2BB 1JUFA 4PLNC 3ULVE 2P43B 2XTJB 3CDGB 4FP8L 4KPHH 5IM7A 4JKPH 3C08H 4P2RA 1UXSA 4NO3A 4PGEA 3VH8G 2DQJH 5E99H 3UTPE 5AD0A 4HGKC 1JE6A 4P5TD 5JHDD 4JRYA 4JB9L 4NQDA 5FGBA 1NCCH 1MJ7L 4APQD 5JW5B 1MJ8L 1TMCB 2EDKA 2HJKA 2EDJA 4F2MB 1X44A 5TE6H 4BZ2L 1ZGLM 4AEHH 3DARA 4U0QB 5F88A 1NGYA 2K3TA 4E42B 4YGAB 4Q9CA 2YR3A 4UQ3A 1JUFB 3HC4H 2R2HA 1C08B 3OKNB 3S98A 5TE6L 5DLML 2GEEA 3MXWH 4JPWL 4RGOH 3B8SA 1XGUA 3SY0A 1AHWC 1OGAD 3GNMH 4K3JH 2IAMC 1RAMA 4LU5L 4HUUB 35C8H 4H1LA 3QWOB 1IL1A 4YBLB 1JGLL 3NACH 4MB5A 1DE4A 4L3AA 5JW4M 2GSGA 1J5OH 2X4OB 3IGAA 3V0VB 4N8VB 1XIWD 8FABB 3BZFA 5H35A 5FKAB 1TFHA 2DQIH 2P1YA 1MHPH 3S8WA 1AD0A 3PWVA 4GG8A 4S1DD 5CKAA 3A6OA 4R6UA 4U7KA 3CCHA 5GSRB 4HG4J 4RBPK 4JFQB 3QCTH 4LCCC 3ZYIA 4AENB 1ZLSL 2UWEB 3O2VL 1Z9SA 1S7RA 2FH6A 5IQ9A 2UZIH 3CFEA 2CKBA 2VDOH 4MNQD 1IAIL 5DEGB 4PP2A 3TJEH 4FFWC 1Y18A 4UTAH 4KRLB 5C07E 6FABH 4KKNA 1WZMA 5HGDA 4L3EE 4NO5A 4MMZC 3MCKB 1A7RH 1PEWA 4KKLC 1MI5E 4CJ1A 4OQTL 2C4FU 2NY0D 1C1EL 2HP4A 1YEHL 2BY0A 2KZ1B 4KK9C 1AD9A 4G8FA 5J9PA 2H1PL 4Y1AD 5DFWH 2NY0B 5L8LB 5ICZB 4Q6IB 5CBAA 1MH5B 4BKLA 4PB0L 1BFSA 3FAXA 4ELMA 2DBLL 5ERWB 2L0DA 3H9SA 3STBA 2BY2A 1E27B 2EDDA 3HMXH 4HIHA 5LKNA 4YHKH 1R6VA 3AREC 2H32H 2OX5A 3UTSE 2MMXA 5JW3L 4PB0H 4PIRF 1I9JL 1K2DA 3LSOA 1WBXB 4NWUH 1I1AB 3VXPB 4GAYB 2Z35B 5GGQH 1NMBH 1FYHB 3JUYA 1P7KA 4AIOA 5EU6B 1MCSA 2D31B 5GPRA 3C5SA 4NBZB 5JW3H 5LAXA 3IXTB 1MRCH 3UTZB 1DUYA 1T66D 1TZHB 3UYOD 5F9OH 4NJ9L 5JIKA 1B4JL 4HHAA 2ZP0T 4OD3L 3MJ9H 2VZ1A 2HLAA 1KGCE 3SDAC 5C3TA 3D9AH 3ZSSA 4X5XA 2H32B 2LFGA 3U4BH 4OIIH 2CIKB 1IBGL 1YMMB 4ZS6C 1OARL 1NKOA 3KPRD 4TOYL 3UYRH 3HNTL 4RWHA 2CO7B 3RGVB 4KROD 2KL6A 1ZA6B 4NQDD 3DX9A 4Z7UB 3SDCA 4GS7C 2DN7A 4FQCL 4ZXBA 5D7LE 1XF4B 1I7UA 3LQZB 1EUTA 4JREB 4XVSH 4IJ3B 4XNUH 3QBTB 1T1ZB 1MQKH 3UDWC 4LP4A 1NC2B 5C0JA 1MHEA 1GVIA 1EX0A 5J1SC 5IGXH 3VFRA 1AXSA 4ZS7L 1G7MB 1C5BH 3WFEL 5EFIB 4OM1L 2Q8AL 2MCG1 1LK2B 1FSKC 3LPWA 3UTTB 5ADPL 3UTOA 1F6AA 1OD7A 2FHCA 9CGTA 3THML 5A2IH 4ZS7H 4JRXD 4KJWC 2FBOJ 3CX5J 4JN1H 3WXWL 1KBGH 3MNWB 4P23A 3REWA 3ROLB 5IF0A 3GMLA 1IGCL 2YRZA 4DGYH 3HE6B 4JHAL 4Z8FL 3QUZA 1AGCB 4JM2B 4LLMA 4S1DC 3V5DA 3OB0H 4WENB 2VDPH 4NO5B 3M1BB 4JRXB 4GAGH 4MJ2A 3SDDC 2ZPKH 2Q86A 3GJFA 3BUTA 5D2LA 4NJAH 1X7QB 4JHAH 5IOPA 3BJLA 1KLGB 4LAQL 1GCFA 2CKBB 5CWSB 3HRZB 1VFAB 2F58L 5D5MA 1DCLA 4MYWB 3DRTA 2X89D 1NMCC 5IEKB 3PHOA 2CXGA 2XTJD 4OGYH 1GAFH 3UTSA 1YEDB 3WNOA 3ZKNC 4ODUB 5F44A 4KZEL 3HI5L 4ZUWB 5K9OB 4M93B 1J1XL 4EI6B 3D3VA 3OKDB 4ACPA 2R4RH 3NABL 4IRJD 5DT1H 4WWID 1BFTA 3QPXH 3RGVD 3ZTNH 5EC1B 3F7RA 5F7HA 4GRWB 4Z0BH 5A16B 2NY2C 5C0AA 3E6HB 1UH3A 2X7LA 4OIBA 3GSXB 3W39B 4OCNC 3KDMB 1FHGA 3SCMC 2X5PA 1KJ2L 5F96H 1MWAH 2H9GA 1D5MA 3G9AB 3RDTB 1I4FB 5IJVA 1FORH 2CUMA 2F54D 4JCLA 1ACYL 4WI9A 5IQ7L 2J4WL 2J88L 4L4TD 3TCLB 4EUPA 2EE9A 1KJ2H 5BXFB 4XPTH 4CVZB 4OFYA 2HA1A 3BZFB 4YHPA 2YA1A 1QNZL 5F7YC 3ET9F 3O3DB 4R2GC 3SDXA 1RZFL 1T4KA 3L3OB 4POZC 5DURD 3BP5A 3TCXA 3GJFK 1KTDB 2Q7NA 1CT8B 1V8HA 2E7BA 1XGUB 2VLME 4JZNB 4H0HB 5C71A 3L3HA 3S34H 2NXZC 2VXSL 5C0AE 2PTVA 3OAYH 5SWZD 5MEQA 1TVBB 1YYLL 2J8HA 2VXVH 3V5KA 2HN7A 3P4MB 1CF8L 1NBZB 1T2QH 4XWGH 4TUKH 3BGAA 4E0RA 2NZIA 4NM8H 3I2CH 1ORQA 1U41A 3PJSA 1AKJB 3D3VE 4JGUA 2BNRD 1RURL 4KK6C 4YDLB 3AU1A 4GMTL 1I1AD 25C8H 2R23B 3QDGA 3FB8B 1JGEA 3RWGB 5ISZB 5D1ZB 1CQKA 5L0QB 2ADFH 2VB5A 5DMIL 4ODBD 5ESQA 4QRRA 3TZVC 1UWEL 3ES6A 1ED3A 3HHRB 5EO1B 1FJ1B 1YNLL 4LSVL 5J13B 1RHHA 2Z92A 2BDNH 3F7QA 4IMKA 2AV1A 4NZUL 5IIEB 1J0ZA 3EJJX 1QRKA 3LEYL 5LJYH 4OJFH 5F9AC 1LE9B 1Q94B 4NC0B 5HHPB 1H3XA 3SO5A 4MXQC 5F7UA 4MD4B 5GGUA 2NCMA 2XWTB 3RWDB 3FJTA 3MJ8A 3PGCB 3ABZA 5EOTA 2VXTL 3UBXB 5F7EH 5EC2A 3MA7B 4PD4J 4NC1E 3WN5A 3MGAA 3KXFB 2X4QA 2FJGB 2YOCA 4FQXC 5CILL 5I1IL 2JJSA 2EC9U 5C0CA 5C8JB 4ELKA 4LVHB 5E08L 5F7FA 1QEWB 3D1MC 2NPLX 1YY8A 1OF2A 3CDFA 2VE6A 5C9KA 4PJGF 4OLEA 3FL7A 1UQSA 2XA3A 3BZ4B 3U30C 4OLYL 5E6IA 1A6PA 1BZ9B 1MLCB 4BSWA 1NFKA 4ODVH 3H8NA 3WS6A 4JRWA 4Z7UE 2V17H 4RMWA 3U0WL 3GSUA 3DTXB 4U1SA 1WSST 3DECA 3QUMA 5MEPB 3BDYL 4ENED 1QEWA 4Z7QF 2DF3A 4M1GH 4K3GA 3E2HB 3CZJA 3RZCD 1TDQA 3WV0A 3K1KC 4KRPB 2FJGA 2H26A 3V7AG 4Y4HD 4PJ8B 3MLUL 4X4YB 1HH9A 1EH9A 2GY5A 4L4VB 4FFYL 3AM8A 1VGKA 5F9JA 3KR3L 1YQ2A 1QLEL 4CL7A 2DJSA 2E9WA 1XH3B 3T8XB 1DBML 5T33H 4G8IA 4FZEH 5GS1C 1F3DH 1DUZB 1T0NA 4I3SL 32C2B 3T2NL 3DI2B 4JFEA 4X6CE 4V1DA 1N4XH 4ODSL 1RHHB 2Z92B 4HIEB 3LH2H 5DTFB 3HR6A 3CPLA 3HZMA 3VMNA 1JNNL 1SVCP 3SPVB 4APQB 5C8JA 2FHFA 2VLKB 1RK0B 2ZOKB 4WW1B 4XCEB 4EDWL 4EBQL 2MHAA 1A6TA 4BZ1L 2EE6A 3WKMH 4OZ4A 2ITDA 4ZOEA 1CE6A 5CZVL 2AI0H 1U8MB 2EIEA 1FSKB 1I9RL 3OAZK 5DD0H 4U1LA 1G6RL 5E56A 1YJDC 4YHML 3G5YB 3EDFA 5C2BL 3KPQA 4PJ7F 4D9LH 1H8SA 4PJGA 1T6WA 4X5LA 1FZMB 5GRVL 4YDKL 3QRGH 5ILTH 1FQ9C 1JGEB 5GGVL 4GAGL 4G42A 4G9DB 4D9LL 4WW2F 2A2QT 4ZTOL 4K7PL 2QR0B 1EVUA 4AEIL 4LKCB 1G9EA 4DKAA 2VLJA 1S7UB 2JCCF 1YUHB 1NSNL 3P0VH 3QISA 4X9GA 2B7DT 5MP6H 1A1OA 4LPVA 4KZDL 1I3UA 1CXLA 3AY4A 4R4ND 4ORGB 3KS0J 5SWSA 1EO8L 1GGIH 4RISH 4M3KB 3D6GA 1C12B 4GBXC 3RBGA 4HKZA 3I50L 1Q9LB 4HGMA 4LLWA 4C56E 1OLLA 2EH8L 3MRBB 3SDYH 4JDTH 4NKDB 1N7ML 4NHCH 1J9CT 1ZOXA 3MRPB 1HNFA 2A6DB 3S34L 4QRSB 3ZE2E 1AQKL 3FT4A 3FMGH 3B9KC 3NCYS 3TIEA 2G2RB 5GZND 2XZQH 4Y5XA 4ZUWA 5K9OA 4OFDA 2V5TA 4NN5B 3GB7A 2F53A 3GSNL 2E3VA 4CVXA 4UUJB 3RAJL 2XZAH 2NMSA 3ORJA 3MUJA 3HC0B 4PJFF 12E8H 2XT1B 5FXCH 2ADFL 3JWDC 4NQCE 4X98B 1FZKB 1S7XA 5D2NE 1RULH 5SV4A 5I73C 4RRPA 2AK4B 1CGTA 2O5YL 5JIIA 1RMFL 5TF0A 3MV11 1R5VA 2HFTA 4M5ZL 5IT2L 2Q86B 4PJHB 4YE4L 4YK4B 2NY6C 3PNWB 1DL7H 1TENA 2CDGA 4MZ2A 1J05B 2OI9C 4S11A 4HT1H 3VWJD 3GGWB 4MJID 1ACZA 3IJHB 1EV2E 4TRPH 4WEBL 3PWPE 2BC4B 3GSWB 5TE7H 4B41A 1TVDA 4TQEL 4AM0B 5MEND 4FMKA 1AH1A 4CAGA 3L3KB 1X5LA 4Z7WB 2I24N 5DSCA 3NA9L 3LIZH 2VDNL 1BLNA 2OTUB 4NHUA 4PR5A 1A2YB 1A6ZB 2VZVA 3O81A 5IMMA 1MREL 5DJYA 3OKKA 5T1DL 4RWYL 1FZJB 3CFJB 3W2DH 1BFVL 3BH9A 1W2KT 5HHOE 4HJGB 4ODXA 5SX5H 3V6FB 2FIRT 4KRPD 1VFBA 3D9AL 2ADIA 4NNYB 3DVGA 3FN9A 1GZQB 1G7JB 1WIUA 4PBXA 5JQHC 5BVPH 4PJ8C 4HWUA 2VR5A 1AC0A 2H41A 2VL4A 3ARWA 3I6GB 4OZHA 3PDOB 3QXAB 1M1SA 3T0WA 3EYVB 4G6FB 5CINH 5HHVH 4NNXA 3CH8A 4I5BA 2IAMB 4PLKD 2PYFB 2CLVB 3QUML 5HGAB 1IAIH 3L6FA 4PRIA 4MDJB 3V8CA 4ETQA 4TSBL 3LKRB 3MRCB 4I18C 5C7XL 1BAFL 1I8LC 4LRNH 3MRLA 2OJZH 1CLOH 4QHMA 3LQAL 2W9LA 3C5ZA 3Q48A 2HYMA 4KFZC 3O8XB 1YNKL 3M07A 2X2YA 1YUHA 5I1LB 1QG3A 1UH4A 3IF1B 1NBVH 1FH5L 2EKSA 3SDCB 4GKOA 4NP4H 1A14L 5AUMB 3VW3L 5DJ0A 1NQBA 4OTXH 3WHXA 3OKYA 2H32A 5SWZE 2P4AB 3FOLB 3QDGD 2IANB 3FQNA 1JZ8A 1I8MA 4R90H 3UTQB 5K59F 1I9JH 3T4YA 3NN8B 4Z8FH 3DXAB 5MHSE 3QJHA 1OWWA 2PW1B 4EDXA 3LPGA 1INEL 3LKOB 4M8VA 5HD8D 2GT9B 3DX8A 5ISZD 1G9ML 5HDLA 1R3JA 1XAUA 4XNYL 5JLZA 4HIJA 4YPJA 3BKYH 1CDHA 2DI7A 5DJXA 3SE8L 4P46D 1SJVA 4LLDB 4XCNB 1QD0A 4IRSD 4X99B 1C16A 5E6YA 5ELIA 2G9HB 4XNYH 4NO0D 2OMNA 4TVPH 5FF6A 2XTJE 1N0LA 1SQ2N 1UWXH 4DGIL 4XC1L 1INDL 5DK0B 2VAAA 1EZVY 4Q6IC 4JFQA 4JFFA 3TNNA 5FO9B 1EDQA 1RPQA 2N1KA 3EJZD 1E28A 1HZHH 1M71A 2F5BL 4LU5H 4CKVX 4JFPA 4P9HL 5F9JB 3PL6B 4R2GB 5E70A 3LRSB 5GQBA 3MPCA 4NBYB 4G9FA 5BO1H 5ID0B 1SY6A 4QWWC 5HGDB 2O93L 3HE7A 4MXWH 2V2WA 4MLSA 4JFDE 5D7JC 4Q6YA 3O6MH 3BEWB 3RIAK 4ZO8A 4XPHH 2X4UB 4GW4A 5CJQH 3L3GA 3FB6A 1RUKL 1U2HA 1JGDA 5K9QG 2IFFH 2QL1A 4MQ7B 1LK3H 1U8OA 3B9EA 4XX1E 1EHLH 4YO0A 2CD0A 4GW1B 3BP6A 3EHBD 1EBAA 3QI9A 3P0VL 5E8PA 2HMIC 1L7IH 5FECB 5K93A 5IK3A 3W9EB 4OBRA 2WUCH 4WV1C 5FGRA 2Y07L 3DWTA 4NWTL 3IXAB 5I30H 4I0CC 4MS8C 4MCZA 3WN5B 5I18L 4LNVA 4LAQH 1QSFE 5C07A 3O2WH 3DIFB 2H8PB 2EH8H 1A7QH 2XWTA 3QAZB 3RWDA 5FKPB 1RZGB 2WK2A 4XCFL 1NCTA 5DI8A 4K8RL 2WV3A 2Y23A 3IFPB 3VXTB 4JHWH 1UVQB 4G8EA 2IAND 1G7QA 5E8NA 1U8MA 3MRRB 4TPRH 5FM8A 5IVXF 5JW5A 2APXA 2DDQL 1T04A 4LIQE 2YPKA 4E5XA 1AE6H 2EC9T 5D7LD 2VKXA 1B3JA 1GIGL 2IBGA 5DWUL 1HSBB 4ZQKB 4WUUA 4HH8A 1HINL 4GT7A 2ZWLT 2XNAB 1QRNB 2PO6A 3HMWH 4MB4A 4PY7B 4OAWA 5HDQH 1NGWB 3MUGA 1PKQB 3IFPA 3VXTA 2E27L 5IVXB 2A6KA 2C3WA 1A6VH 2R69H 4UBDD 1JWSA 4R96A 5J0BA 2ATKB 1QR1A 5IHZA 1KCLA 2KDGA 2Y6SC 4KJWD 4P3CL 3S4SA 2PYEA 5CD3A 1QQDB 2R56H 2ZJSL 5TF1L 1JYWA 1M4KA 4X8JB 5FA3B 3GSOA 5D7JA 4YHPB 4ODHH 4IIQA 1NAMH 4PRDA 4IMLB 1XF2A 4UAOC 3MLVL 4P4RA 5DJZB 3L7FB 1SJEB 1B6UA 4FTVB 4DJMA 2Q7YB 4QOKA 1WWCA 4MNHB 5TF1H 2ORBL 4PJIF 4NDMB 5CEYA 3BH8B 2FCBA 5JO5A 5TQ0H 4PJIE 1HOCB 1S7VB 1CD9B 2JB5H 3KXFD 4MS8D 4J23A 2CRZA 3KHOA 5IWLC 1YY8B 1WIOA 2X4UA 4GW4B 5EU4B 1CFQA 4LGRB 3FFCB 5DRWB 3JXAA 5BVPL 4FFYH 5I0DA 3LQAC 5F8RC 3TBTA 5IB3A 3FT2A 1IGCH 3PWPD 2NX5A 4AJ0A 1MI5D 4D8PA 5IB4A 1N64H 3ZSTA 3GI9L 1L9MA 4I3RH 1EO5A 4GKZA 5DC9B 4GKNA 5HHMB 1D9KA 4Z7UF 3O45A 1T3FA 3CSGA 4JJ5A 4PB9H 3PWNB 2CKNA 4NSKB 3TA3D 1OP5H 3NZHH 4D9RE 1I1AC 3NZ8B 3ARYA 2HKFH 3OHXA 1LWRA 2AV1B 3G6AA 4S10A 3GJFH 3CSYB 3QFDA 1QVOA 1GXEA 1C5DA 5DK2B 4Y16B 1JHLH 4G8GE 2AW2A 3O9WC 1CZ8L 1CR9H 4XVTH 1ADQA 2Y9RT 3CXHJ 3VW3H 2BRQA 5DFVD 4HS3B 4I0PB 5J3HC 1AKJA 4M6OL 2HT2C 1TETL 4X9IA 3O3EA 1D5IH 3IU4L 3JTSA 3HE6A 4X6DA 5GHWL 2DKSA 3I85A 3P30H 3MRFA 1IZJA 1Q9OB 3BPCA 2DQHL 5DD6B 4YDKH 5F7WC 1TETH 1UC6A 4KV5E 1P7QD 4P46C 3WLWC 4GG6E 2XKSA 4DEPB 3QIUD 4PRNB 4NGHH 4YX2L 5E4IA 4IS6B 2VISB 4YHLL 4XXDB 1JJUA 4XTRC 2NX5E 5GGRA 3VFUA 4J3TA 1MHEB 1YNTB 4K94H 3WNLA 1YPZF 3QB7C 1NGQH 4M02A 1T0MA 3KYOB 4O4YH 4I0PC 2B5IB 5DDHB 3TM6A 3LQZA 4XP6L 4PJ7E 4LSSL 1F8TH 1I3GH 3C5JB 4LHUA 1Z3GH 3RL1B 1TTFA 1WFUA 3WIIL 2VLRB 5DZNA 5I2IA 4X7EC 3OWEA 4TTGA 2E6JA 4UZGA 4UU9B 3V5HB 5KVDL 3QEQA 1HZHL 5DYOA 3ZYZA 2XFXB 3N50A 3WFBL 3L5IA 2ZG2A 4XI5D 1JK8A 3PGFH 4PUBL 1IGFL 4RAVA 4WFEE 4W4NA 3U7AA 5LGJB 4C4KT 5JPMA 4F7CA 5SX4H 3RGHA 3QYCA 4M7JL 4XWOD 2AJZB 1YDPA 1XCTB 3DVFA 1GZQA 1IFHL 1DBBL 4LCYB 5E8OB 3U46A 3VRJB 4U1JA 1RJZA 1HDMA 1OP3K 4M5ZH 5IT2H 5EORH 4NHUB 3FHAA 4APQC 5IESL 1NUNB 1GGBL 4QHNA 5DC0A 1I7ZA 5J56B 3KWWB 3ZL4L 2W0KA 1KLGA 3P9MA 3FQRB 3JZ7A 3F58L 4G6ML 3KJ6L 2X1QA 2YXMA 2V9RA 2AK1L 3VXQB 1EFXA 3SGDI 1MJ8H 5FYJL 3FOMB 1A7PL 4WFFE 5HDOA 1MWAB 4KDWA 2DQUH 3MCLH 4WDIB 1L0XA 4RAUA 4F7TB 3BKCL 4WHTA 1OT1A 2CDGB 3B9DA 5D6DA 4M7KL 2OL3H 1U95B 4U31A 4W4OC 4KI5D 3MC0A 3SKNB 1G9NL 2Z93A 2XYCA 2N7AA 4ODHL 4Z0BL 2X9YA 4N9GA 1ITCA 4NQEA 2WM0A 2UYLA 1BFVH 3CFEB 4PG9B 4JY4B 1S7SB 1H15A 2HFGH 1S7RB 1YC8A 5IFAL 4AT6A 3NIGE 5IUSA 4MD0B 2OM5A 4HWZB 5KSUA 2SEBB 4NYLB 2WBKA 3DUSA 4Y5XB 1WZ1L 3KPRB 3QUMH 5BS0A 4YHNB 4QT5A 1QO3B 1QPPA 1MFCH 2BY3A 4DKFH 3DOSA 1A4JA 1YA5A 4JM4H 3QNXB 3C08L 1S78D 2E7HA 1KPVA 5TE4H 4JFEE 3PP4H 1DN0B 5KOMC 1AKJD 1PG7H 2OSLA 5IBTL 2VH5H 2WBJD 1HXYA 1A4JB 3OGCB 4Z7WF 3IFLH 3HC3H 5E1HB 5BV7H 2ESVA 1VKXB 2BJML 2LU7A 5CZXD 1KN2H 3GJEB 3KYAA 4AZ8A 5HGBA 3NH7L 1N4XL 1LO3H 3MV7A 1J8HE 2H2PD 4HQQL 1CTNA 4UTBL 5IVZB 4QTIH 1MAMH 3HR5B 2PTUA 3UO1L 4G9FE 3GHBL