5SWSE

Crystal structure of np2-b17 tcr-h2db-np complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
239
structure length
239
Chain Sequence
TVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLFYYDKILNREADTFEKFQSSRPNNSFCSLYIGSAGLEYSAMYLCASSAGLDAEQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsE01
1VEPA 3EJYC 4PB0H 4X98B 5DWUL 4YHLH 4GKOA 1S9KC 2JCCE 2V6HA 3T0WA 5EIIB 5J12B 4Y4HD 1T2QH 3PHOA 4GW5B 3HTLX 5EORH 3SCMD 4DZBA 2I27N 4KI5F 3I85A 2ZP0T 4MQ7A 5F1NB 3WLBA 4OLVL 2O5YH 1T0MB 4JPIA 3VXMB 2VNCA 4ZUWB 4P2YA 5JXEC 2PR4H 2D0GA 2OX5A 3ARUA 3MV8E 1R0AL 1CQKA 2E27L 4PJBF 5MEOA 3D5OF 3G5YB 2WK2A 3QNXB 4XAKE 2Y7QB 2JE8A 4Z7WF 4PJDB 1N7MH 5B8CC 2NXZC 2NY6C 4J3SA 4Y5XA 4JG0L 4I2XE 5I0ZA 4LASL 3ARGC 1MVFA 4KRPD 5E2WL 3VFSA 2XPGB 2HT3C 2VZ1A 3CD4A 4MXWH 1JRHI 1HXMB 3CPLB 5GGTH 1CR9H 5HY9B 1NJ9B 2FJFA 2DYPA 1GAFL 3U4EA 3U83A 1E4JA 5FF6B 2MOVA 5FKPA 2APWA 4GKNA 1JHKL 3SPVA 4YWGL 1VESA 4XBPA 1C5BL 2YK1H 4NZUL 2D0FA 4Z7NE 4JO3H 5HYQB 5HSFA 3MRBA 4IIQB 1BQLL 4GG6E 1WJ3A 3P0VL 4CVXB 1OD9A 4JEGB 4JJHA 3BISA 2A6JB 4JFQA 2WUBL 4RRPG 3O4LE 4WV1A 5DYOB 1OPGH 4YXLH 3TVMB 4WENB 1MCFA 1JFQH 2Y5TB 1E4XH 5GGVH 2PTTA 5HPOA 4MD0B 3LN5B 4K7PY 1B0GB 3DLQR 4MJ5A 4GRWH 1L9NA 3DROA 4LHQB 1QSFD 3HUJF 1DP0A 1ROWA 1QNZH 3QFJD 2I9TB 3TZVC 2BXYA 5DZLA 4PJXA 3WIIH 4BKLB 1A6UH 4UNVA 1FH5H 1AD9B 2DQFA 2X9YA 2A73A 4HS8L 1DBJH 1RUQL 3HE6B 4FXGB 5IMKB 1CFNA 4P3DB 3EDDA 1HHKA 3TIDB 5A40E 4YX2L 2XTJD 1I75A 5D5MF 5LWYL 5C0AA 3MV7E 1FZKB 3ZTJG 1JIBA 3QG7H 4HS6B 1MFEL 4HJ0D 4EI5D 2EE9A 5JPNA 2E8YA 4HK0A 3IDGA 1KTLB 3J8F7 2BNUA 4P23D 2HFFA 1G7LB 3MV9E 3QIUD 1YY9C 1UCBH 5D1ZA 1OWRM 3O41A 1CICC 2VDRL 2H8PA 1I3GL 1INQB 3UPRA 4L4TD 4UT6L 4GW4B 3M1BB 4W6WB 5BMFL 4I3SL 1JCKA 3E3QC 1MAMH 4L29B 1YEHL 4M1CC 4JY5H 3MJ9A 4YH6A 5SWQA 1N0XH 4X4YA 5K9QG 3E3QE 3HFMH 1CFBA 1GZPA 2BERA 5IMLA 4OLXH 2VLJD 3S4SB 2UY7A 2XKSA 5TE4H 2D7QA 5FEBA 1H5BA 5GXBB 5D93B 1DLFL 1B6UA 3CZFB 5T5NF 2OP4H 5IMOB 1KENH 3F6LA 2Q8BL 4XCEB 3KPQA 5I8EA 3ZL4H 1TITA 4NHUB 4KZEH 1WC7B 1YUHA 2EE2A 2NY5C 3NCFB 4G42B 3TA3A 2GSIB 2A77L 5DA4A 3UTSE 3VFWB 2VTFA 3I3DA 4RA0C 4HKZA 5C0RH 4LCUA 4PP1D 4F33B 5CMAB 4D9RD 4PRAA 3GMMA 1JL8A 3LRSA 1KN4H 2XY2A 1AHWA 3INUH 1W0VB 5IFHH 3IVKA 4M7JL 3MRNA 4E5XA 5EOQH 3N9GL 1IQWL 4HWZA 3WFCH 1H8SA 3KPRD 2YRZA 2Y4SA 4HH8A 3QQ4A 5IT2H 3MJ9L 3H7BB 3K2UL 2VABB 4LP4A 3BZEB 3P9LA 5KVEH 2P5EB 1CIDA 5F93C 3HCVA 5JOPE 3ILPB 1XFPA 4LHUG 1ZANL 5FUOH 4G80A 4ZUVA 3HNVH 1U3JA 3VJ6A 1WCQA 2VDQH 3UBXI 1NUGA 1A7QH 1XZ0A 4CN6A 1Y0LB 2C1PA 5HI5D 3U48A 1ORQB 3O8XC 4TUOB 1KLUB 4QRRE 5C9JB 3X11B 2AK1H 2WBJD 4WWKB 1YNKH 3KPSA 2P49B 5E9DE 1QP1A 2F5AL 2VIRA 5FK9B 1LGVA 3O3AA 1FGNL 4JKPL 2R0WH 5ADPL 1MAKA 2W9EL 3RL1A 4JY6B 1JNLL 4ZPTB 2DWDB 1J11A 2ZCLH 1RZ7L 2AXGB 4FOMA 5SWSB 4WTWA 3SEPA 1RUAL 4JO4H 5J1AB 1LWRA 2R0LL 3PP3H 3GIVB 3DURA 5HHNB 4XGZA 3E6FA 3TO2B 5L0QC 3ZYZA 1WWBX 3UDWA 1T7ZA 5D2LE 4AEEA 3NCCB 3QDGB 1K8DA 5DK0B 5JOFB 1CGSL 1KELL 3P73B 4Z7VA 1J05A 3FO9B 4MSWB 3QG6B 2FJGA 4RFEB 5IEKA 5F7NC 5IB1A 3TBVB 4OZFB 3ABZA 2IAND 3ZKSD 1W0WA 1NFDB 4ZNCD 3WEXA 2DMBA 5HYJA 4LVOB 2BVTA 3FB7B 3W2DH 1QFWM 1TVDA 4RMVA 3VFTB 1P9MA 4KJYA 4ZFZB 1AO7D 4PY7A 5CLWA 1G0DA 5L88L 2F53A 1OAZL 1JE6A 1DDHA 4LEOA 5D1XD 4OCRH 1EMTL 1MFCH 5IW6A 3DYOA 1MCLA 1I8IA 5KTEH 5F6HI 3TYGH 1S3KL 4QXGH 3VWJC 4J3XA 43C9B 1N6QL 4QRPA 3GUTB 3GBNL 4P9HH 2RQ8A 4OTXH 3SDAA 5CFHA 3DTXB 1FZMB 5CUSH 4LGSB 3UTZA 5JXAH 2WWKT 4AL8L 5C08B 1ZT1A 4ACPA 2D03H 4M61B 2Z9TA 4OD1H 1QFPA 3V9FA 4LKXA 5B38A 2YUWA 4DN3H 3CUPA 2NMSA 4PS4L 5FYLL 1W0YT 2LFGA 4H0IA 4K7PH 2EICA 4P3CH 3TYFA 3LKPB 3QNZA 4L3EA 5D8JL 4UQ3A 1SJEA 3P4OB 1BFVL 2D9CA 4RCAA 3HC3H 5A2IH 4QCIB 3BVNA 4HHAA 1HDMB 3OXSA 3QWOA 3WFHB 2ZNWA 3JV4B 3ULUD 3A6CH 4C56A 4MA3A 1ZT4B 5DEGB 3DVIA 3L95A 3QZWB 4DKEH 4XCNA 4I0PC 3TH4T 4DUVA 3VFRB 4OGAC 3S3JA 2DJSA 5J6GB 2DL9A 4XI5C 1OP3H 5EUOF 1DVFA 2UWEF 1A7NL 3NA9H 5K9OB 3MUHL 2JCCF 5IVZA 5EPMA 5DD3L 1MQKL 2WP3T 3P40A 1JGUH 2UZXB 4KKCC 3C8KB 2OL3H 3CSYB 3HLAB 1NDGB 2OXGA 3MCLH 1JGVL 3HAEA 5FUZH 5LGHH 1VKXB 3LS5H 2X44D 4MAUH 3HNTL 4XCCH 1RFDL 3DJ9A 3E0GA 4QHNB 4PJFF 4Q7DA 3H7LA 4JR9H 1F3JA 5GGQL 4ZAKB 3QDJA 1UZ8A 3SDDB 1VGEH 2XACC 1BGXH 1HZHL 3BPLB 5D1QA 3DX6A 5ESAB 1IC5H 3K74B 5FHAH 2ZZUT 2YD3A 1E4KA 1FVEB 4WCYL 5F8RC 1P7KB 3IXAA 1QSEE 5I1GL 4N0UB 5BRZD 3SDCD 4Z76A 4Z78A 4U49A 4LCCC 4M4PA 2XFXA 1TQBC 2R4SL 3Q5OA 2N7BA 1ZLUK 2F54E 4GKSA 2IH3B 4P9MH 1OLLA 1EX0A 5F96H 5H2BA 2C3WA 1JGDB 2VQ1B 4LSVH 3EYQC 3O2DL 3QRGH 1PVHA 1Z3GL 1MRDL 1A6AB 1JPGA 1J12A 4HUWA 2G9HA 3GSWB 4GG6F 2APTA 3PDOA 5F7YC 3RWCA 2O26U 3Q1SH 4JPWL 1GSMA 3QCTL 5JQHC 4WRLA 5IG7A 1XH3B 2G75B 3EFDH 5IB2B 2W91A 2EC9T 2WINA 5D7JB 5E7BA 3CIQA 3DETC 2XXMB 1VA9A 4XXCA 2FX7L 4OLWH 3VXTA 4K55A 1RI8A 1CQYA 3BYTA 3RTQC 3QIBA 4HX1A 1WBXA 1JK8B 1FIEA 4O58L 1CLOH 5TQ0H 3G08A 1S8DA 2CR6A 4FXKB 3BI9X 5ITBH 2VDOH 2IQAA 3MRGA 4PJ9A 2C3GA 5I8OL 2BHYA 1BM3H 4PJ5B 4M1DL 1WFNA 3BGAA 3L5WB 4XHJC 3LQAC 1YEGH 1QR1B 1YY8B 1KPVB 2CDFA 1S78D 3K4DA 1WUNT 3SE3A 3BRGC 2H2PC 3IKKA 4HPOH 3G6JA 4XMPH 3OKEB 4J3UA 2G5BA 4R26H 1OD7A 4OQTH 4J3OC 2D4DA 3ILQD 2X4TB 2CIIB 5GHWL 3T1WA 4ZYKA 4L8SB 3W39B 4S1RH 1MIML 1ETZB 3EJZD 1U8KB 2E7BA 1BD2E 4J1UA 3H0TB 5FA3A 3RGVA 3CFBA 5L6YL 4DQOL 2CH8A 4I13B 3O2WL 2UVEA 5C0BB 3CK0L 4LLDB 5D6CA 1ZTXL 3OTTA 5ADOL 1QKZH 1CE1H 4MWFA 3IAQA 1KCUL 3DXAA 4JLRB 1YMMD 1KT2B 2ICES 1P7QD 4G8FB 1RZJC 8FABB 1BFSA 3JSSA 2EZ0C 3GRWA 4OM0H 2CLVB 2OK0L 2FWOA 1CL7I 2J8UE 1QRKA 1NAMB 3NPSC 2RCSH 2HT4D 4OZIF 3HE7D 3OAYH 2FZ3B 4P46D 5IVXB 2X4SA 1QA9B 1NGXA 3MRIA 4X9GA 1N6VA 3BDBA 4X80L 5CBEB 1SEBA 4AY0A 3ZDZE 3M8OL 5DJAB 3FFDA 4J2XA 5GPRA 4Q97A 4MAYD 2YMXL 3P11H 3VRLE 5E2TH 1J8HD 4HFUH 4YHZH 4ZFGL 1AD0A 2WWMD 1LHZA 1JPST 2P24A 5E8DH 2NY3C 2AS5M 1FNSH 5CZXC 2PYEE 1EFXB 3BP4A 4DUWA 1V7NL 3L5HA 5EUKA 2PO6B 4NZJA 3B9KA 3WJLC 3EHBD 4XNMB 4LLYB 5E5MB 3QUXB 5EOTB 2ZSWA 4ODSH 2W0LA 4UV4H 3VXSB 2AXFB 4OI8A 3PJSB 3BKMH 1CD9B 2Y72A 4AENA 1BF2A 5IVNA 1HOCA 5DMIL 4A6YH 1NBYA 3WCYA 4XPHL 1OARH 1A14H 3U0WH 5E6IB 1T0MA 3GNMH 4YDIL 2B4CC 2VR9A 3VFNB 3R8QA 4DGVL 5DI8A 2E7LC 5D7IB 1SQ2N 4ZPVB 3GI8L 3MOBL 1DQTA 3NCBB 3NGBB 5F1IB 5LQBL 3D39E 4H26B 1SJVA 4XVUC 5I1DA 3GRWL 4IMKC 4KKLC 3L3GA 3LIZH 3P4NA 2FNBA 4JRXE 2E8ZA 1X7QA 3BAEH 1RURH 4OI9A 4U4BA 4N8VB 2IMMA 2AKRA 2XZZA 1BOGB 3CNKA 5JMOC 1QQDB 3ZSTA 3QUYB 5DVNA 4NQEE 3BZ4B 4H88L 3S35H 3D2UD 3V5KB 2XPGA 3VXUA 4JFZL 1LO2H 3F7QA 4WHYG 3CPLA 1ODAA 5CWSB 5DMKB 3GHEH 5L8KB 3JWDH 5HHXL 4KQ3L 4IOSD 5F1SA 4KRPB 1MWAB 3PL6A 4Y4FC 1F6AA 4NC1C 5HDLA 1FL3A 4ELKB 3TH3T 5EZOL 5DD0H 4NC1E 2NW3B 3QHFL 5B4MD 1H3PL 3GI9L 1P4IL 4F15C 2YPLE 5SWZA 3W0WA 4LVNB 2A6JA 4JO2H 3EDFA 4HGMA 1DE4B 4GS7B 5EC2A 4O5LL 1L6ZA 2BJMH 2Y5TA 4G6JH 2Z35B 4NCC2 2EDJA 1B0GA 1B2WL 5D6DC 3LN9A 2MKWA 1Q9KA 3EYUH 3FMGH 2XQYG 3VWKD 1E4XI 3K8LA 1I9IL 3TPKA 9CGTA 1GGYA 3MRMA 4ZO8A 3IKCB 3ULVD 4LAQL 2AJXH 5I1LA 4HKJB 2I9TA 3WIHH 3DV6B 1F4WL 2IAMC 4NCDA 4X6EA 2VYRE 2VXTL 1PG7L 3MUGB 3QEQD 1BPVA 3HE6A 4LSUH 3I6KA 3IDJB 4IRSD 1NMBL 2ATKA 4HH9B 1ZEAH 1S9WB 4NYLA 4EQ3A 4I18C 4M4RA 3QCVL 4X5LA 5DUMH 1PLGL 5I73B 3G5VB 1L4IA 3OZ9H 2VRAA 4MLSA 5I1AB 4TUKH 2W9DH 3GO1H 4YZFE 3QQNA 1RUMH 2VXSL 4MNGB 3KJ6H 4G9FD 3RHWK 3IJSB 3CCHB 3C6SB 3IETA 3ARFD 1G7LA 1U3HC 1S7SA 1MFAL 4RGMC 4JANA 2EDOA 4JN1L 4NUGH 1INQA 3CDYA 1LEIB 4R97B 3K2MC 4L29A 4G9DB 1MCKA 3IU3B 1YJDH 4PJHE 3QO0B 4RSVA 4JG1H 3PIQB 1QBBA 4P5KB 3UJTH 2LU4A 3TWCH 2CUHA 1VPOH 5JW4Q 3Q3GB 2QEJA 1TJGH 2X70A 5DD1L 1WFOA 4FTVA 5IMOA 3RVUC 1OL0A 2IGFL 3QI9A 1NCBL 2XZQL 2CSPA 3QUZA 5T1KB 3K3QA 2SEBA 2ZOLB 4JFPA 4MDJB 4NP4L 4Y1AA 2YRPA 3IFPA 2FL5B 4PB0L 2NW2A 4YHLL 2BRRH 3VFWA 2MJWA 1D9KB 1MVUA 1T2QL 4F33A 1RJCA 4YGAB 5CMAA 4Y5XC 5EORL 1T89A 3GMQB 1FV1B 4U0RC 1BJ1J 2O5YL 4KVNH 5ESQB 3MTRA 5MERA 1R6VA 2PR4L 1LO3H 2H2SD 3FRUB 4NKMA 4PJGB 4MS8D 1ZSDB 4PRHB 2ICWJ 1Z9LA 1DBAH 1NMCB 1AFVH 2BOBA 3U30C 1EVUA 4Y5YB 1N7ML 4FABH 3LKSB 2PW1A 5KSAA 4WFGE 2BC4A 3BDYH 3QCUH 3ARDD 3RZCA 3H7BA 2VZ3A 4Z7QE 2MHAA 2CO7B 3VXOA 4BA8A 1XGPB 3OB0K 4HIHB 3BXNB 5CSBA 3MV8D 4MXWL 1ZHKB 5JXED 5GGTL 1CR9L 1CXFA 5F7DA 2ZUYA 2AABH 4EKXA 3V2AR 1YYMH 4WV1C 5E8EB 4XPFH 1YEDB 4ZUUB 3S35X 3HC4H 5JIIA 1WFTA 5DRWB 2AEQH 1OSZA 3KLDA 1CWVA 1WAAA 4TUOA 2DTMH 2DKSA 4YXKH 2YK1L 5TDOB 1TIUA 1HYRC 5C9JA 4JO3L 5EBMB 2XWBB 5HTSA 4YDVA 4OCXH 3D3VA 5A2JH 3QXUA 3NVQA 4NQCA 1DQQB 3ZYOA 1JTTA 4PJXE 5GGSA 1EO8H 1OPGL 3Q5YA 4YXLL 1JFQL 4JY6A 1HIMH 5GGVL 1HQ4A 4TSAH 4Z18A 2EDRA 1I9EA 2X1QA 5SWSA 2ILLA 1FFNB 4O2FB 4UBDD 1KB9J 1A8JH 1ZS8B 3HMXH 5C0AE 1AP2B 3FFCD 4BH7B 1QNZL 3WS6A 5FDWB 3GIVA 3WIIL 1A6UL 4YBQC 2CDGB 4MJ2A 1FH5L 2DI8A 5I71C 2MCG1 1DBJL 1T1YA 4ZOAA 5HHME 1U91B 3QDGA 3MOAH 5D1ZC 5JOFA 4WFEE 3LY6A 3QG7L 2J12B 2W60B 4N5ED 3QG6A 4NZRL 4XX1E 4APQD 4RFEA 1QBLH 3ETBF 2X42A 1MCIA 4OZFA 1U8PB 2I07B 4NWTH 1NC4D 4F7PB 1MUJB 3L3HB 4JFEB 3U46A 1NFDA 3U79A 1UCBL 4JFXA 2WLZA 1H5BC 3EDJA 4JM2A 2O61B 1CE6B 3GSNA 2C5DC 1UG9A 1L0QA 4ODWB 3NACH 3DX8B 1OQXA 1MAML 4ZFZA 2X09A 2YD1A 4JY5L 3T04D 3HZVB 1N0XL 6FABH 3DPBA 2H6PA 3HFML 1PFCA 4LSTH 4UOW1 1UWGH 5HI4C 4P2OA 3FB8B 3TA3C 3SDXA 2D9QB 4OLXL 1G0YR 5TE4L 3MCG1 1ZLWH 4EVNB 43C9A 2HT2D 4NCC1 5GRWA 2BVQA 1C16A 5KG9B 3GUTA 2OP4L 1KENL 3ZL4L 4ODHH 32C2B 4KZEL 1AC6A 3LHPH 4M61A 1AHWC 5DJYB 2Q20A 3T4YB 1YEIH 2Q7YB 1DL7H 5MEQB 2J8UF 2EIEA 3Q6FB 1Z9SA 1D6EB 1KTRL 4M5YH 5D7LE 1CXKA 3LKPA 2DQJH 4YQXH 5C0RL 2NLJA 1BEYH 1RZFH 1ZVSA 2VR4A 2RBLA 3A6OA 4QCIA 5I75C 1KN4L 3FN0H 3ZDZF 3WFHA 3INUL 5IFHL 3SOBH 5EOQL 3UTSD 5BCAA 4KQ4H 1RUKH 2WLYA 5DEGA 3WFCL 2OQJB 3UTQB 1NBZA 4KK8D 4G6AC 2FYYB 2WBWB 2EE6A 5IT2L 1WBZB 3CVHB 1FNFA 5KVEL 4UIMB 5K9OA 4TTGA 3T8XA 4KHXH 5FUOL 4G8GB 5HHQA 3HNVL 3KPSE 3HS0A 4K8RH 2VDQL 3HLAA 1NDGA 3MGTA 1A7QL 3L3KA 3L1OH 3R06A 4GAYA 4TULH 4L5FH 1MH5A 3HR6A 4RQQB 3S37X 3W82A 3DHJA 2D7MA 4BFBD 2AK1L 1YNKL 4DOHB 1CFTB 3QEHB 1MCQA 1DLHB 3SDDA 3KHQA 2H26B 1XIWA 2VXQH 4PJBB 4Z5RB 4WO4B 5A16B 2R0WL 5ID0B 5DRXB 5ILTL 4Z7WB 5GS1B 2B8OT 3RFZC 3IFNH 5DHVB 5CZKA 3GB7B 4QRRD 1EZVX 2E9IA 2ZCLL 4OUUA 3O8XD 3D18B 2FATH 2M2DA 5FYLE 3TLRA 5E9DD 4JO4L 3RKDD 2VQ1A 4FNLH 4Z7VE 4KK5C 3T65B 4WWID 5KN5A 1A6AA 3CU7A 1AIFB 1U8MA 1BVLB 5LBSH 1YNLH 4U1LB 4DN4H 1QO3A 1L7TH 1MRFH 2DD8H 4OJFH 5HYJE 4K3JH 1J0IA 4H1LG 2VLME 5LVEA 4HKXA 4LPUA 4PGJA 1EH9A 1VACA 4M62H 5JORB 1K8IA 4EN3C 2F53E 4V1DB 5EBLA 4TVPE 5FCSH 5C0IB 1XCTA 3U7AA 2WSKA 3CH1B 3HUJB 5IMMB 3CFCH 3HZMA 3W2DL 2XA3A 1BHGA 3CLFH 2NCMA 3VH8B 3SDAC 2M26A 5L8JB 3MRLA 2AXHA 4PJ5A 2F8OA 5F70A 3MJ8B 1JNJA 1KPVA 5FHBH 4OCRL 1MFCL 1A6TB 4EDWH 4Q58C 5TF0A 1U41A 5D5MB 4PLKC 5KTEL 3TYGL 5JW5B 4QXGL 3KLHC 2HMIC 4L8SA 4X6FA 3W39A 3U2SB 4F3FB 4OTXL 3IGAA 5CUSL 3GMNB 4HEPG 3TPUB 5JXAL 4IHOA 4L3EE 2IJ0C 3T09A 5L2KA 3BWAA 2D03L 5H37H 4OD1L 1T83A 2YXFA 4YHIA 4DN3L 1NCUA 2EDWA 5ESVB 4F2MB 2EO1A 4K7PL 4PJHF 1YQ2A 2EDKA 4C56E 1ZWIB 4P3CL 3VWJD 5TJWK 4G8FA 1WZ1H 4Y2DB 3ZHDA 3BESR 3S7GA 1KF9B 4RMQA 1G9NC 5F44A 4AQ1B 2V17H 3HC3L 4HGKC 1FFPA 4O2CB 5DJCB 1DVFC 1YMMB 4OLYH 1P7QB 4QGYA 5DD6B 1FN4A 2HVKA 4OFDA 3HG1A 2WV3A 5T3ZE 3A6CL 4NFBA 2FZ3A 2MWCA 5IVXA 4JREB 3GSOA 1U93A 2HTKC 1GGUA 3LB6D 4HLJA 4PJCF 4Q2ZB 4NN7C 5IB4B 4NKQB 2Z31B 1J0KA 2O5ZH 4AMKH 4HZAA 5C7XL 3NA9L 5EO9A 4RMSA 2P5WA 5D1QC 2DF3A 3QDJE 5DR5H 2CGRH 5IQ9A 1W72B 1JGUL 1E4KC 2OL3L 4XNMA 1GJIA 1H8NA 5E5MA 1BVKA 3OG4B 5EOTA 3BHBA 2BVUA 4I0PD 3C60B 2AXFA 3MCLL 5FUZL 4HUVB 3LS5L 3RRQA 4MAUL 4XCCL 3ISWA 3KLSA 3ZDXE 4WJ5A 4JR9L 3WV0A 4BQ6A 3T0DA 1BIIB 5E6IA 5J11C 1VGEL 3MREB 1F58H 3EGSB 1IC5L 1T20B 3O6FD 4E0RB 3WKNA 4H26A 4Y8AA 1NCTA 2K9UA 1CTOA 1U8QB 1J88A 4OQTA 1LD9A 2PYFA 1BOGA 4P9ML 2VAAB 1GZQA 4POZC 5F96L 4WW2C 3EYFA 1MCWM 3CLEH 4GBXA 3KYNA 4R0LA 1T80A 4LSVL 4PRDB 3V0AC 3V6ZA 3QRGL 4NRZB 2IPUG 2Q3AA 3TN0C 4XXCC 1F4YH 3H8NA 2E5EA 1QUNA 1MWAA 5KANI 2NY0B 3QIBC 3STZB 3MO1A 4ELKA 3Q1SL 5DMGD 3FQXA 4K3DH 1FVCB 4KK9C 3KNBA 5IF0B 1LEKA 4G6ML 1M7DB 5ALBH 1X5IA 3EFDL 1IEBA 1SYSA 2QADC 3EYQD 1G6VK 1K9TA 2GAZB 43CAB 4OLWL 15C8H 3SE3C 4NT6A 3I75A 5TQ0L 4Y4KD 1CLOL 1DN0A 3KLAB 3G6JE 3DV4A 1ED3B 2YD2A 4RBPH 1WCBB 5BXFB 4OM1H 5IM7B 5ITBL 4RFOH 2VDOL 2YWZA 1KJ3H 1BLNB 1S7QB 1AQDA 4OCLC 3RGVC 5FB8B 1BM3L 2F58H 1TVBA 1YEGL 1Z9OA 1S7RA 2OTUB 1T0NB 3OX8B 4Z0XA 4O02H 4PLJD 4HPOL 2P8MB 1FJ1B 4R26L 4XMPL 2FHFA 4OQTL 3IDJA 4JGJA 1R3HA 3D85D 5E4EC 2EDBA 4DGYH 3VG9C 1HKFA 4HH9A 4S1RL 3DXAE 4KJQD 3F12B 1KOAA 3QIWD 1T7VA 3UBXG 2PXYA 4M6MH 5F88B 3DO7A 1R5WA 4U7SA 1A1MA 4IRSB 5CEYB 4A6YA 5I1AA 4YHPB 5JDSB 1A9EA 4OF6A 4HDIB 1QKZL 1CE1L 1R3JB 2H2PD 3MGAA 4R96A 4MNQB 5HGBB 1Y6KR 4ODVH 1BD2D 3D0LB 2QR0A 1J8KA 1LEIA 4OM0L 2JIXD 5C0CB 4WI6A 1WSST 4X5XA 2J7LA 2V5TA 4U1IB 4QXTA 3W81A 3NTCH 3W9DB 4PRIB 2RCSL 1MREH 4P5KA 3PIQA 2OR7A 3V7AE 1UC6A 3WXWH 1UB5B 1NPUA 2J3SA 3B9KC 4QY8B 5EC1B 1VGKA 4K2UH 3U82B 1FFQA 3Q3GA 1RJYB 4OBSA 2IALA 5J12C 4PYHA 2A74B 3C5SA 3P11L 3OJDB 3SO3B 4NDMA 1GRWA 5E2TL 1JYXA 4HFUL 4YHZL 1HWGB 4JFFB 5E8DL 1EBAA 4QYOA 5T1KA 1ZLVH 1FNSL 5IB3A 4MDJA 1KJ2B 1UJ3A 5DK3A 1NCAH 2P45B 3QUMB 2CDEB 2FL5A 4ODSL 4UV4L 4R2GD 3BKML 3VXNB 1BQSA 1TZGH 4JFDD 4A6YL 3SGEI 1S9YA 4UU9A 2W9LA 2XNAB 1A14L 1H15A 4JN2B 1T1ZA 3U0WL 2CR3A 2NY3D 1RZIA 1XGUA 3GNML 4NRYB 5CZXD 4FQXA 5KAQF 1UZ6F 3HAEG 4CVZB 2E9JA 1KGCE 4L3CB 3UX9B 2L0DA 4KRLB 3VXUE 4J8RA 3MRJA 3PL6C 3LIZL 5EWIH 5FO9B 1U95A 2IQ9H 3BAEL 1RURL 5EUOB 2UWEB 1AE6H 2DLGA 5AD0A 2JCCB 3AXLA 4LF3A 2XKNB 3SQOH 2C1OA 1XGPA 5F7EH 4HIHA 3H9ZA 3BXNA 3R0NA 3S35L 3W11D 1QVOB 1LO2L 1ZHKA 1GOHA 3D39D 1G1CA 3ROOA 1DEEB 1JV5A 5SWZE 3W0WE 1HH9A 5HBBA 3GHEL 3JWDL 1FCGA 2ORBH 5F6IC 5T1MA 3NIFE 4FZEH 1YEDA 3ARBC 4PJFB 1ZLSH 3BH9B 5DD0L 4WEMB 5EBMA 2XWBA 1LK2B 5DSCB 3UXFA 3P77A 3KS0J 5F9WC 5B8CB 2NXZB 2NY6B 5FA4A 4LLUB 4JO2L 4X7FC 3RVVD 4R4FH 2BNRD 1OGAD 1CFQB 2NXYD 5ENWB 1F3RB 3ARGB 3NFSH 1IJ9A 2BJML 4G6JL 4U1NA 1YECH 2UYLB 1FORH 3WD5H 4BK4A 4HFWB 1S5HB 3EYUL 4NIKB 3FMGL 3ZYIA 4BSWB 4S1DD 1KJMB 2Q3ZA 2AJXL 1YN6B 3DWTA 5GJSH 3WIHL 5J8OA 4GG6B 3LCYA 1E27B 1HQRA 4LSUL 3DYMA 4C55A 5JIHA 3O4LB 5EU5B 1M71B 1OHQA 1EXUA 2OS7A 4BZ1H 1E6JH 1NBVH 1ZEAL 1FC2D 1UADC 2WNGA 3ARSA 3KPNB 5DUML 4NO3A 4JJ5B 3OZ9L 1I7UB 2A9MH 2A83A 2FBJH 2G60H 4TUKL 4ALAH 2W9DL 1NDMB 3GO1L 1I1FA 1MPAH 1RUML 3KJ6L 3BOVA 2ICWB 3NFPB 2CKBB 4F7PA 2FSEA 4JFEA 1MLCA 2Y5EA 1Q38A 4JQXA 4RMWA 4NUGL 3TZVB 1T22B 2O61A 3U36A 1CE6A 1TVHB 4YEFA 4PTUA 4ODWA 4WU5A 2O93L 1M7IB 3WE6A 4O2EB 3QI9C 5K9KB 4FTVE 1YJDL 3MV7B 2VITA 3QUZC 4JG1L 2DN7A 4LKCB 1RIVH 3UJTL 1GC1H 3O11A 3CDGB 3VXQB 3FB8A 3TWCL 1I3VA 1W8OA 1G7JB 2EKSB 3QT2A 5E5UB 1YN7B 1VPOL 4P2RD 4Y1AE 5GIRB 1TLKA 3MV9B 1TJGL 3MUZ1 2BDNL 1NAMH 4N0RA 1E4WH 5E1HB 2C7UB 3NCJH 2LE9A 1T89C 32C2A 1CICB 1F3DJ 1ZE3C 3F7RA 5IW1B 2CIKA 3QXDA 4F37F 3T4YA 2Q7YA 4OCWH 3R4DA 3UTTA 4L8CB 2FR4B 2BRRL 2VL5B 1TDQA 2Y06H 1SYVA 1GHFH 3QXTA 4P4KD 4HPYH 5KSAC 1EHLH 5DJZB 3RZCC 4ZUSA 3U9PH 3U1SH 1GOGA 2IPTH 2JJSC 4R7NB 2PF6A 4LCYA 2X7LB 1T1XA 4JZOB 3HMXA 1IEHA 1LO3L 3EO1B 3M17B 1CGWA 3O9WB 4FQHB 1JHTB 3FB5A 5INDB 4LP5A 4MB3A 5EA0H 4Z7OE 1DBAL 2OR8A 1AFVL 1CDHA 3O3EA 1T6WA 2FYYA 4FABL 5BQ7B 3NFNB 3RWFB 3UTSB 3BDYL 3QCUL 3RVWC 1VFOA 3LMJH 3VGBA 1WBZA 3CVHA 3FQNB 4PJ7F 1I1CA 1RJLB 1UH2A 5DQ9B 3T0ED 1WAAE 3LOWA 3AB0C 1K5NB 3FAWA 2DLFH 1N8ZB 4YAQA 4S1SH 1S7TA 1ZGLM 3EFFB 3CVIH 5DZOA 1KSRA 2AABL 3D3VE 4XH2B 1YYML 1DFBL 2D2OA 4XPFL 3PP3K 4NQCE 2J6EA 3MXWH 3HC4L 2BSED 5I6XC 1QFUH 2AEQL 1Y6NR 2YR3A 2C3VB 1A4KA 2DI9A 2DTML 4RQQA 4YXKL 2A38A 3O3BA 3BPCA 1HI6B 1BJ8A 5SWSE 3VE0A 4OCXL 1DLHA 3WS6C 2VXUH 3RNKB 1X5HA 4PJBA 5DJDB 4Z5RA 2B20A 5A16A 5ID0A 5DRXA 2ITDB 1EO8L 4LEXL 1K2DB 5F7KC 5K9JH 1HIML 1J10A 3DRTB 4KH2A 1HH6B 3W9EA 2C3XA 4TSAL 4OLEA 3CC5A 5A2FA 4CMHC 4WW2F 3QDGE 3RWJA 3ZKNC 4H0GA 1AKJA 1DR9A 4MD4B 4PJ8D 5E2UH 4HG4K 5DUPH 5E7FA 3HR5B 4BK5A 3HMXL 4UT9H 5EBWB 3ARTA 1UQSA 3LEVH 4QRRB 3ARQA 1Q1JL 1ZOXA 2YN3A 3BP7B 3IAPA 1AIFA 1EJ6A 2FIKB 3KXFD 5H8DA 3MOAL 4CJ1A 3GSQA 4WHTB 4YHMH 3TESA 4HK3J 4HCRH 1NFDE 4JM2C 5IOPA 3THMH 1PY4A 5AAMA 5C0FA 1CGUA 2I9LA 1Y18A 1QBLL 1G7QB 5C3TA 1FO0A 3I84A 1HSAA 1OTTC 3G6JF 5HHMD 4NWTL 3IDYC 1KCRH 4P2OC 4V1DA 1JMXA 1EEUA 3SDXE 2H3NB 3CH1A 1RUPH 5L0QB 3HUJA 5IMMA 3MQIA 5GSVB 2NY4D 4PR5A 3DX7B 3NACL 3QPQD 3GJFH 4BUGA 1QSVA 2RHEA 2V7NB 3ZT5A 6FABL 4FQPA 3RP1A 4NKDB 3MRFB 5SX5H 4LSTL 4DAGH 1UWGL 4F8QA 4DK3A 3GMOB 1X6NA 5E8OB 1WLHA 4JKWA 3GBLA 4M6AA 4R7DA 2H32A 2WW8A 1F00I 3U2SA 2AJSH 4GKZA 1RZ8A 3JV5A 3TPUA 4IS6B 4AIXA 3QXWA 3LHPL 5JLZA 2BSRB 3LSOB 1OP3K 1YEIL 4X0KB 4Y7MA 4HIEA 3RZWA 3TA3D 1DL7L 1S5IH 1AGEA 5J9PB 1KEMH 4AM0A 4F2MA 1F11A 3DIFA 1R3IH 2XA8H 2F74B 3BP6B 1ZWIA 4M5YL 5BZWA 3RVTD 2DQJL 4YQXL 5E4IA 2GTWB 4P2QA 1BEYL 2B7DT 1E0OB 1RZFL 3NAAH 4LGRB 1MHHB 4ISVA 1UVQB 5DJCA 4LLMB 3X14A 4D3CH 3VWJB 1IKNA 1HYSD 4OGZA 3KPPA 3FN0L 5DD6A 5I1HH 3STBA 3OGCA 1HSBA 2GUOB 3SOBL 3BJLA 4N0FA 4F9LA 3BZFA 4C57C 4KQ4L 1RUKL 1G7HB 2GJJA 4ZUTA 2DJUA 4Q2ZA 1A7BA 1CDGA 3QNYA 1WGOA 2YEZB 3S36L 4BQCA 1KIUA 2G2RA 4WHDA 4OV6F 1S9XB 3VFPA 3WUWG 3ZDYF 5DJXA 4KHXL 4G6FD 3K81A 5EBGA 1XIWC 4U1HB 3TJHD 5CP7B 1Q9OB 4K8RL 4OF3A 2XZCH 4L8BB 2VDKH 3ZE0F 3L1OL 3FT4B 4NNYA 1I1YA 4TULL 4L5FL 3SKUD 1PYWB 2NY2C 5CD5D 3KWWB 2FX8H 4I0PB 4U6YA 5I17A 5I1EH 2VXQL 4RIRB 2C3HA 2NX5D 3GSXA 4E0RA 5EU4B 4W4NA 4HZLA 5K93A 2UVFA 3CGTA 3IFNL 4QHUB 4I9WD 4PTTB 3JV6B 4LOUD 1YDPB 1NH6A 2FATL 3PWPA 2VAAA 3OR6A 3HPLB 1KBGH 5C0DB 1J87A 3IFOA 1S7WA 1ULVA 4BUHA 2VDNH 4FNLL 4B5EA 4PRDA 3X12B 1R5IB 1CGXA 1FGVH 5CSZB 1MLBA 3DOSA 5I2IB 3MRCB 5E56A 2DTSA 5LBSL 1YNLL 4DN4L 1L7TL 1MRFL 2DD8L 4J6RH 1QSEB 4OJFL 4K3JL 4M6NH 2GSGA 1FVCA 4MHHI 1P5VA 3NCEB 3FTGB 3KYOB 5IF0A 2ERJC 4LGPB 2PCPB 2HH0H 2F54B 4LCCB 3X13A 4Y2OA 5IP4A 4RRPA 4M62L 4Y88A 4JM4H 1P4LB 2AV7B 3FO1B 4JQIH 3MLPA 4PJ5E 3UC0H 4QNPE 5IR1A 3SKMB 5HYJD 4KMQA 1XF3B 3CFCL 3KLAA 3RBGA 5DQJB 5CGYC 3EOBB 3CLFL 4YIQA 1ED3A 5BXFA 5IM7A 4LVHC 2PW2A 4ORGB 3L9RA 1EIBA 3LEXB 4HJJH 1ZHNB 4LLAA 1NGWB 1ZT7B 3ZZ1A 1T83C 4TVPD 3UPCA 4HIIA 2Z4QA 5FHBL 2GITA 2ZOKA 5L2KE 4J3VA 4EDWL 1CT8A 2A6IB 3V6OC 4QRPD 3F12A 1R24B 3SGJA 2WIIB 1V3LA 3SDAD 5F88A 3NZ8A 5ITFA 4UAOC 2DQHH 1T04A 3QA3A 3RTQB 1WVZA 5CEYA 4CW1A 5F6HJ 4HQQH 3I3BA 5JDSA 5HGDB 1F6LL 3MLSH 1LDPH 3CX2A 5EOCH 3UYOD 3HG1E 3GMPA 1OVZA 1H3XA 2V2XB 3KLHD 2HMID 3H9HB 5IVXE 5HGBA 4LLWA 2DL2A 3PGDB 1WZ1L 4D94A 4NPYB 3D0LA 4QTIH 1H3UA 4L3ED 4RGNC 5C0CA 2V17L 1C5DB 3LPWA 1JI1A 4OLYL 1IBGH 4RGNE 3PQYD 1ZGLP 4D0BA 1LMKA 1S7VB 4LMQI 4F57H 3K80A 1UB5A 1I3RA 5EC1A 2IPKA 2P5WE 3RWHB 5HJ3A 3ZKMD 3FO2A 1RJYA 12E8H 4RZCB 3SJVD 4GRWF 5C07B 1MFDH 4IOIB 4OBRA 2ZPKH 2O5ZL 4AMKL 1C12B 3D69B 4JFFA 3QWQB 1RIHH 2P8PB 5T3ZD 3K8MA 5DT1H 2J8UB 1KJ2A 4IRJA 4KUCF 5DR5L 2CGRL 4JCMA 3QUMA 2HYMA 2NZ9D 4UDUA 4WHCA 1B9ZA 3C5ZA 2AJZB 2CDEA 3ARXA 3BEVB 3GJEA 3MOQA 3VXRD 3ULUH 3NPSB 2DDQH 5I1JL 3BEWA 1T2XA 4C4KO 4F9PA 3MJ7B 2X4PB 3VDBA 1KB5H 4NO0A 1XGQA 4M48H 4E41A 4QF1B 4GBXC 1A5FH 4R0LC 4ZQKB 3BRDA 2XN9A 4LCWB 1F58L 5D1QD 4CVZA 3F7YA 4QRUA 4QOKA 2PYEB 3MPCA 2QLVB 1SJHB 1DZBA 3OJ2C 2NY3B 4CMMA 1PW3A 3KDMA 1CVRA 4Z77B 5KVMC 1Q72H 3VI3E 3HN3A 3TT3H 2YKLH 2ZCKH 1AGFA 5EUOA 4OUOA 2UWEA 3ROLA 4F7EA 2XKNA 7CGTA 1AXSA 3CLEL 4FFWD 4LHUA 5IIEB 1HHIB 3KYMB 1QVOA 4ZXBA 3RVXD 1A02N 5CEZH 5DHVH 1G6RB 1DEEA 4XWOD 4OF5A 1F4YL 4B7IA 4NBZB 2MSPA 3C6LD 3CSGA 4KV5E 4PJFA 4ODTH 5I8CA 2R23A 3H3KA 1T66C 4ELMA 3H3BC 4HWEH 1B90A 4XRCA 3BH9A 4K3DL 4JRXB 4POZD 3AAZA 2VL4A 1D5XB 5HGHA 4M1GH 5ALBL 1REIA 5B8CA 4NQEB 4A2MA 1CFQA 1ZHLA 5ENWA 1R3KA 5I74C 15C8L 4M7KH 4M6OH 2LAGB 1TTFA 1JZ6A 2PKDA 5KVDL 1A1NA 2FD6H 4OM1L 2PXYC 4RFOL 5FV1L 4BSWA 1KJ3L 3EJJX 1T21A 4Y4FB 4PJ9D 2F58L 1MHCA 5TPWH 3WBDA 2HKFH 2ZUUA 3Q6GH 4P57A 3H6JA 2IFFH 4YEEA 2ARWA 2ID5A 3JVGA 2YPLB 3IJYB 4JM2F 4O02L 1BVZA 5FKAB 2ATPA 3P0GB 4LPTA 4RDQG 5HHVH 4DGYL 4HUMB 2KH2B 2EIZA 5LGJB 3RIAF 4WW1B 2GTZB 3QHZH 1J0HA 3L3JB 3MA7A 4GMTH 2XWJB 4M6ML 2AJYH 4JJ5A 1I7UA 4I0KA 5F9JB 4Z8FH 1NDMA 1K85A 2HRPH 3MRHB 1QEWA 2CKBA 2XYCA 3PHQB 1NGZA 2X4OB 5MHSD 1QFWH 3VU2A 2ZUWA 5INCB 4YR6A 3TZVA 4UDTA 2Z93A 4J3WA 3WFEH 4C54A 4U1MB 4ODVL 2IAMB 4MQXD 4KRMB 2YZ8A 4KDTA 2AQ2A 4O51B 4O2EA 2P43B 1M05A 3LKQB 3NTCL 4M8QA 4K3EH 4BFIB 4Y19A 1MREL 1CLYH 4I18B 4KAQH 1D6VH 3WXWL 2ICEA 1UJ3C 2ZUQB 5BS0D 3OAZK 1N26A 4K2UL 1A2YA 1YN7A 3UTPE 2KL6A 1RV6X 5GIRA 1FYHB 2X41A 3KVQA 3CFKB 1A3LH 3L3IA 5GGRA 2N7AA 2BXZA 1NC2B 3WL9A 1U3HB 1UCTA 4HS3A 4X7TB 2A6KB 3B4NA 3QDHA 4RGMB 2DM7A 5EU3B 1IM9A 4F7CA 3TO4A 5SX4I 4RAVA 4FQXC 3EO9H 1WWWX 1NCAL 4LFHG 4PJHB 4X9IA 3V6FB 4A2LA 5IB5B 4N1EA 3HB3C 5BV7H 2FR4A 5ALCH 1KCLA 4H8WH 3TCLA 5L2JA 1TZGL 1U8LB 3IXTB 1XMWA 4TOYH 1FVDB 1T1WB 4OZIA 1EAPA 1EHAA 1EEYB 3RWEB 5GRXG 3T3PE 1W72H 3ZLQC 3EOAA 3VXMD 1B88A 3BT2H 3V95A 3QJFB 4PJCB 4DZBB 3O9WA 4WVRA 4FQHA 4MQ7B 2HVJA 5INDA 3WLBB 4JPIB 5EWIL 2CLRA 2IQ9L 1NEZA 5FYKU 3RWFA 1LE5A 2QBWA 1AE6L 5D2NA 2YUZA 4ODUA 3FOMA 3SQOL 5MEOB 2YPKA 1TNNA 4AZ8A 5F7EL 3TH2T 5IBUG 3EFFA 5D72L 1IGYB 5KSBF 1YJDC 4Y5XB 1JRHH 1YEEH 3EZJB 4U0RB 2ORBL 3U0PA 1HILB 2FB4H 3BKYH 4FZEL 4XT1C 4YFLI 2LVEA 3RQ3A 3VFSB 4LU5H 3ZHLA 2DQUH 2X89A 3G04B 3CJJA 4X7SH 1ZLSL 1ADQA 5I16A 4LIQH 2DYPB 1HI6A 2NY1C 1MCEA 2CK2A 3U30B 5FKPB 3W0WD 2CQVA 3DX9B 4ETQA 4GKNB 5HD8C 1KN2H 4R4FL 4XBPB 3UMTA 3MRBB 4OD2B 3RNQA 5IBLD 3TVMD 1Z2KA 1HH6A 3FQTB 1YECL 4HMDA 3VRJA 1PG7W 4ZD3H 1FORL 3WD5L 3I3EA 1IAOB 4WV1B 3IDMB 1IZKA 1WV7T 3HR5A 4OSUH 2PTTB 5GJSL 2CUMA 1VFAA 2LABA 3DROB 4Z7UF 2XT1B 5D71H 4FA8A 1L7IH 3HE6D 4OQ1A 2LTQC 5GZOC 3LD8C 3LEYH 4JQXC 2IFGA 3V6BR 4JFEE 4RDQF 4BZ1L 1E6JL 1NBVL 2DQTH 2L4OA 5C6TH 5T5FH 2AV1A 2IF7A 2FO1A 4QNPF 3SDYH 4OIAA 4U05A 2RJMA 1CFNB 2A9ML 3NA4A 2FBJL 4P49A 5FYJU 2G60L 4ALAL 1HHKB 5CEXB 4UUJA 4P59H 1MPAL 5C0AB 2FH8A 3ULVH 1HNFA 1T3FA 2EYTA 3HI6H 1BWMA 5LAXB 3MLXH 2H45A 1MNUH 3RX8A 3IDGB 1QHOA 2BNUB 1FZOA 3WNOA 1T7WA 2HFFB 2FIRT 1OAQH 4KGLA 5D1ZB 1BQHG 2X1XR 3FZUC 1X9QA 2H8PB 3DUUB 4RNRA 4Y4HA 1RIVL 1GC1L 3UPRB 3SCMA 5DVMA 1AGBB 3GMOA 2QTEA 3I50H 4H25A 2R2HA 3EOYG 3KYAA 3PUCA 5T3XE 1TMCB 1JVKA 1VSCA 1GZPB 2Q76A 3UTTE 1NAML 4X9BA 3PGFH 3ZTNH 5IMLB 1E4WL 4RAHA 3C9NB 3NCJL 5KANG 3WFDH 2HFGH 4QXWA 1H5BB 1MSPA 5DZNA 4X0KA 2BVPB 3KPQB 3K4ZA 4OCWL 5I8EB 3MCKA 2C4FU 2I24N 2F74A 2A0LC 1YUHB 5FGCE 2Y06L 2VH5L 5I18H 1G0XA 1GHFL 4HPYL 4JDTH 3E2HC 1EHLL 4L1DA 1MHHA 3U9PL 1UVQA 3U1SL 4O9HH 3B5HA 2IPTL 4XBGB 1IKFH 5DFVC 2DM2A 2CO6B 5E0QA 1FG9C 4LCUB 4XP4H 4IMLA 4PRAB 3KPOA 4RA3A 3ARWA 4K94C 3GMMB 2IADB 3VMOA 4HUKB 5EA0L 1AHWB 1N4XH 1QYGH 3VXPA 1OAUH 4E5XB 5KSAD 2YEZA 1NUNB 3LMJL 5D7LB 4KI5E 3JUYA 2P5ED 2DLFL 4S1SL 3EO0B 4DOHE 3CVIL 4UQ2B 2Y07H 3P9LB 3RGHA 5I75B 4PJBE 3HCVB 3QEUB 3MXWL 1QFUL 3FT4A 1JPTH 2A9NH 4G80B 3RVWD 4JZJA 4RMTA 3VJ6B 5GRUH 2WWKO 4WWKD 1XZ0B 3GJFA 4BH8B 3VI3F 2VXUL 3D3VD 5GS0D 3IDNA 4RIRA 1TQCC 3OKYA 3LDBB 5K9JL 5EU4A 4EI5A 3KPSB 3FONB 5DD5H 2VIRB 1CG9B 1UXWA 3O3AB 3JV6A 4P23A 3QIUA 5SWSD 4CGTA 4NKOB 1YNTA 5E2UL 1FL5A 5DUPL 3HPLA 5CHNA 3RUGF 1V3KA 2RR3A 1TJIH 4UT9L 3LEVL 1TCMA 1NFIA 3PE9A 3X12A 4NUJA 4NZDA 3QEGH 1X4ZA 3PDGA 3D9AH 3MLTA 1A4JB 3QDGD 5ICXA 1MHPH 4V1DE 4YHML 3DURB 4XGZB 3E6FB 4HCRL 1A0QH 5CJXA 3THML 1FYTA 3HUJE 4ERSH 5A2LH 1FL6A 3FTGA 1K8DB 2EH7H 2BK8A 3ZKXC 4LCCA 2MNUA 4JFHE 2YWYA 3CSPA 3T4AB 3RJDA 3FO1A 1KCRL 4Z7VB 1J05B 3P30H 3OHXA 2FJGB 3S97C 5IEKB 5FFLA 1EO5A 5IB1B 2W65B 5H35B 3K1KC 1RUPL 1RULH 5MEPA 1DANT 4X83A 3HKFA 3X3FH 1W0WB 5F3BA 3WEXB 3A6BH 5HYJB 5EZJA 5BVJB 4MJ4A 3LEXA 1ZHNA 4YHOH 1OTTD 4DAGL 1JPFA 1U92A 2VZVA 5M95B 5FYKE 3AMKA 4BQ9A 4EUPH 1N59A 4KJYB 3MUY1 4PY7B 1ZK9A 4FMKA 2R0ZH 5I66B 2F53B 5IHUH 1NCWH 3KJ4C 1DDHB 4LEOB 4EN3B 2AJSL 1NKRA 2NTFA 1R24A 2HKHH 3KPRA 1I8IB 3RTQA 4KROC 5C08D 4P2QE 4QHLA 1IKNC 2PN5A 4G7YH 5JQ6H 2E7MA 1U3YA 1S5IL 1JF6A 3SQBA 1KEML 3UTZB 4Y16B 1R3IL 3EYSH 2O5XH 1ZT1B 2XA8L 3OGOE 2XRAH 2K1MA 1VADB 1WIOA 5D4QA 2WANA 4I3RH 3T3MF 4LKXB 4NPYA 2YOCA 5B38B 1FIGH 2DIAA 3M07A 4I4WB 2HWZH 2DQEH 4HAFA 3NAAL 4NQUA 3MLWH 1E28B 3UZEA 1C5DA 5CKGA 4D3CL 4HWBA 2B0SH 3TYFB 5I1HL 3QNZB 5F89B 4UQ3B 4FQJH 1SJEB 5HHOB 2VMFA 4K9EC 3VI4E 3GSVB 4GRLA 4WTXA 4HHAB 3OXSB 2ZKHH 3QWOB 5C07A 4LLQA 3AGVA 1OTUD 4C56B 1XR8A 4MA3B 5KS9F 4ZS6D 1RY7B 5DC9B 4KKNA 3L95B 3EBAA 4XCNB 1LO5B 3HC0B 2E9BA 3LKRB 5JIKA 3T77B 4OCNC 2PTUA 3QQ9D 1DVFB 2XZCL 2VDKL 4XAWH 5GRVK 5C0GA 2K3TA 4JPVH 5FYJE 5EPMB 3LVEA 2OSLB 3MJ7A 4FG6C 1J18A 2UUDK 2YUXA 2HTLD 4TN9A 3LAFA 1XF5A 2FX8L 3UPAA 3VA2C 4NN7B 5DMJB 3PWPE 1Q0YL 4RMUA 4ZAKD 4EIGB 4QF1A 3QFDB 1IAIM 3HAEB 3SDDD 5I1EL 4LCWA 5CIPB 3FQWB 4XZUA 1INDH 1UJTA 1F3JB 1SJHA 4PGBA 3WLWC 1ORSA 1A64A 3QDJB 3N1QC 3D0VB 4UOJA 1UZ8B 5D1QB 3DX6B 3WJLA 2NY2D 1FDLH 2F5BH 3IXAB 1KBGL 3SBWA 5DVOA 4MNHA 2VDNL 4Z78B 5IIEA 4LRNH 1FGVL 1URLA 3X17A 5I1KH 3QULB 4JHBA 2DLEA 1T7XA 4KK6C 4YFDB 5H2BB 5J11B 1PD6A 3IU4H 2VN7A 1NGPH 4PPTA 1AGDA 4J6RL 2YA2A 2B2XH 4M6NL 4XNQA 3BGFC 2EXYC 2G9HB 1D5XA 3NOIA 2ADGA 4IMKA 4OAWB 3U4AA 2Z91B 1H9VA 3RWCB 1AR1D 2HH0L 3E8UH 4LVEA 1KXTB 1A1OA 3EIFA 4JM4L 3K8KA 4JQIL 3UC0L 2EH8H 3MBEA 4G8IB 4WW2B 3V4VH 1F8TH 5CJOH 4NN6C 1UM4H 5IG7B 3RX7A 2WINB 2AEIT 3TN0B 4ZDHA 4WDIB 1RK0A 4Y4FA 4HJJL 3QIBB 4PJ5D 1WBXB 3G08B 2E7HA 4U3CA 4CVUA 1IC7H 2VQTA 3T2OA 5E8PB 5FKAA 1T2JA 3MRGB 2CMRH 1OGTA 2QADB 5DRNA 3V4PH 5CGYD 4FQ2H 2CDFB 4HWUA 4U31A 5CD3A 1YEKL 2DQHL 3G6JB 5EU7C 2G5BB 5F9JA 3LKNA 3MGOA 2R4RH 4HQQL 3BIKB 5C0CE 3ZMRA 1EBPA 2B5IC 5EU7E 3MLSL 3V5DB 4ZYKB 1LDPL 5EOCL 5C0BD 1D7FA 3KPMB 4J1UB 2X4OA 2HJFB 5FA3B 3RGVB 1SM3H 3CFBB 5INCA 2CK0H 4CNIB 1IGTA 2IAMA 4WI5A 4QTIL 3RDTC 4DVRH 1QFWI 5D6CB 5J3HC 2JTDA 4MWFB 3DXAB 5E4EB 1IBGL 1P1ZB 1CL7H 3VG9B 4BFIA 2X1WL 2JJTA 3MA9H 1CN4A 4JFFE 5F7HA 3FOLA 4YGVA 3ARZA 4F57L 3KGRA 2ADIA 4IRJC 2FWOB 3C5ZC 3UZQA 4CBPA 1AJ7H 4Z9KB 3HZKA 3BN9C 3PP4H 1XEDA 3MMEA 4GFTB 1MFDL 1HXYA 4F9PC 2YD8A 4ZTOH 1YPZF 2ZPKL 2X4SB 3MRIB 4Q6IA 4UOW0 2X05A 1RIHL 1SEBB 3ALXA 4ENEC 5DT1L 1EFXD 5HHPA 1U8NA 3G6DH 3JWOH 2PO6D 3SKOA 4E41E 4MZ2A 4GQ9H 2XN9E 1I8KB 1AD0B 2GK2A 3ULUL 2P24B 2LQRA 3QUXD 3RPIB 1X5ZA 4P4RB 3VFMB 4QOKE 2YC1A 2DDQL 3VXSD 3MLRH 3BP4B 4KJWD 3MRKB 1RK1B 4U1GC 4NO2B 3B9KB 1KPRA 1HKLH 3ARRA 4CDGC 1KB5L 1EEYA 2ZSWB 5EUOE 2UWEE 4M48L 5E6ID 1A5FL 4N0CC 4AENB 4ZXBC 1K3ZA 1HOCB 3QJFA 1NBYB 4PJCA 3STLA 5F7UA 2JJWA 1YQVH 5E99H 1Q72L 5DI8B 3TT3L 2YKLL 2ZCKL 1JWSB 5DC4B 1KB9K 4PJFE 2Z92A 4P0DA 4QHMB 2AGJH 5SV4A 4ELME 5I1DB 3NCYP 4J23A 3QUYD 3L3GB 2FGWH 3P4NB 2YPVH 1WF5A 1X7QB 1AI1H 1IGYA 5CEZL 2AKRB 5C0NC 3P4MA 5I15H 4ZOBA 1HILA 2ADFH 2J8HA 3VXUB 1NCCH 3G04A 3E1F1 1V8HA 4HWEL 1CXIA 5H37G 3S4SG 4N1HB 3C08H 5HVHC 3PL6B 4M1GL 1F6AB 2JJUA 3DX9A 1FL3B 4G43A 4Y89A 1EGJH 1AXIB 1QACA 3JVGC 5KSVA 4OD2A 4M7KL 1XCQB 4M6OL 4AH2B 5SWZB 2EYRB 3FQTA 3O2VH 2CXKA 3T0AA 3W0WB 2BY1A 4E42B 1IAOA 2ENYA 5DJ2A 2FD6L 3IDMA 5F6IB 1FQ9C 5EC2B 4WU7A 2VDPH 3IFLH 3ARBB 4WI3A 1IARB 5TPWL 2HKFL 3DUSB 3JWNC 3Q6GL 5JHDA 2IFFL 1Q9KB 5HDOA 1OAXH 2ADJA 4ZMAT 1UFUA 3HE7A 5HHVL 3MRMB 2VE6A 5F9WB 5IKCA 5I1LB 4IOFC 1G7PB 3QHZL 4X6EB 3LV3A 4H1LA 4JRYA 4JPKH 1LE9B 4KDTC 4GMTL 2DB8A 3DUHA 2AJYL 5IFJA 3I6KB 3OQ3B 2FEEI 2ARJQ 5CEXA 4Z8FL 2HRPL 4MAYA 2ATKB 5IESH 4NYLB 1V05A 2AJUH 2D31A 1J8HA 4KI1A 1SBSH 4Y19E 3MNVA 1A7PH 1ACYH 5LAXA 1QFWL 5ANMA 3LH2H 3WFEL 4U6HA 5BOPA 3IETB 3F65A 3EDEA 5E24E 1EEQA 1S7SB 1NUDA 4JANB 5ID1A 2KZ1B 5AG9A 4K3EL 4RFNB 3DUUA 3TO4C 1CLYL 3DGGB 3B43A 4KAQL 1D6VL 1AGBA 1UWEH 3B6SA 3LQZA 4DGIH 4JHZA 2P46B 5C70A 5KOVC 1A3LL 2DQCH 1VEOA 1CDUA 1EFQA 5AZ2H 3C9NA 3HNSH 2OM5A 4TVSa 5ACLA 5T1KD 2X70B 4OZIE 5GZND 3EO9L 3P0YH 4NQDB 5C2UB 4K71B 1JGLH 4FTVB 2XV6B 4MHHG 3K1DA 2BVPA 3QI9B 3O9WC 3TC9A 1J1OH 5BV7L 3QUZB 3D2UA 3B2UC 5ALCL 5E95B 2SEBB 4JFPB 4H8WL 5JPMA 1D9KD 1Z9MA 4Y1AB 1FAKT 3VI4F 4TOYL 1RZJH 2JKXA 3BYYA 5D2NC 3VDAA 3IFPB 2NW2B 5EU6B 4WEBH 5D2NE 1W72L 2GJ6B 4XBGA 2ENSA 4K7FB 1MVUB 1UWXK 4FQXD 2VZTA 3BT2L 3TFKC 5DQDH 2CRIA 5GRZA 3B9AA 4GRWB 2IADA 1FNEA 4HW6A 2P8LA 4I48A 2VDMH 4POYA 4HUUA 4PRHD 4UTBH 5HI3C 3QPXH 4ZODA 5MERB 1TFHA 3DSFH 1P7HL 4WI7A 2FEDC 1PZ5A 4NKMB 5D7LA 1ZLUH 4KKAC 3WUWB 2V2TB 1PX4A 1Z5LB 2COQA 4PV8A 2BOBB 5JNYA 3EO0A 2PW1B 4AIZA 5KSAB 2VO5A 2BC4B 4NRXA 4POUB 1JRHL 2CRZA 3RZCB 4UQ2A 1YEEL 2HAZA 3MLUH 1J1PH 2MHAB 1GC1C 2FB4L 3VXOB 3BKYL 3QEUA 1JN6B 4QXUH 4CN1A 4ONHA 2DQUL 1IQDA 4X7SL 4JVWA 4YFEA 4JFOB 5F7DB 4LIQL 3ELAT 4Q9RH 4KTEH 4V2CB 3OV6A 4BH8A 1NBQA 2M1KA 1OSZB 4QHKJ 1KN2L 3UO1H 4JKLA 4BFEA 2AK4A 2B4CH 2BZDA 4M9PA 4X6DA 3TJEH 1N3NB 1HN1A 3AB0B 5T33H 1JF5A 4EOWH 2V9RA 4YDVB 3FONA 2E6PA 3D3VB 1P6AB 5ETUB 1CG9A 4ZD3L 4PIRF 3ARFA 3BKCH 4NQCB 3T2PA 5F71A 4EIZC 5GGSB 4NKOA 2NY1D 4OSUL 1HQ4B 5EDXA 5I6XB 2VJXA 2DIJA 5HD8D 4EQ2A 5D71L 3GGWA 4U3XA 1KXVC 1L7IL 3V0WH 4WUUB 2H9GA 2QQQA 3LEYL 1A4JA 2Y6SD 3MRPA 2FEEL 5C6TL 2DQTL 5T5FL 3T0BA 3AROA 1BP3B 4D0DA 3SDYL 1T1YB 5D70H 2FECI 5E2JA 5J06A 3QZWG 5I9QC 2Z8WC 4CMHB 3BD5A 1P4BH 1ITCA 4Y4HC 3L7EB 3QH3B 3T4AA 3ULVL 3SCMC 1FAIH 3HI6L 1NAKH 3MLXL 4D0CA 4JFED 4E9LA 3LRGA 4TYUA 5GRYA 4HULB 3VW3H 2W65A 4MVBC 5H35A 1MNUL 3KG5A 1BWWA 3QB7C 4R4NC 1OAQL 3U46B 3VD4A 3MZGB 5DWUH 4JFXB 5BVJA 4JM2B 3W5MA 4GJTB 1OP5K 5DJ6B 3GSNB 3MLZH 4R6UA 1LK3H 2ICWI 2IBZX 3I50L 3MXVH 4XP6H 5I66A 4YE4H 3H42H 1RVFH 2H6PB 3IDYB 3ZTNL 2BP3A 3PGFL 4P2OB 4EN3A 3SDXB 3UBXA 6CGTA 5KZCB 5J1TC 2XQYK 3WFDL 2HFGL 1EVTC 35C8H 2BOCB 1ZA6A 1FNGA 1YEFH 4FQLH 2BVQB 1KACB 1C16B 3ARDA 3GK8H 4U1SB 5GRJH 1IGMH 3IT8D 5T3XD 1NCNA 2BVYA 5DFWH 1OTSD 4Y16A 5GS3A 4DW2H 3PV7A 1VADA 5I18L 4JVPA 2V7HB 4JDTL 2FLBT 3H9SB 4I4WA 1U8IA 4G8EA 3GKZA 1E28A 1SBBA 4LCIH 4O9HL 5F21B 2DRUA 1IKFL 1KC5H 3PWJB 3OMZA 3ULSA 3S3PA 5F89A 4XP4L 1TPXC 5HHOA 2NLJB 5CJQH 3IYLW 1ZVSB 3GSVA 5F9OH 1QFHA 3L5XH 2A0LD 3BZDA 3OJVC 1N4XL 1QYGL 1AGCA 5DJ8A 1OAUL 1I3UA 3QYCA 2W0KA 5DRZA 3O2DA 4JZJC 1LO5A 1BZ9A 3HC0A 2GFBA 3LKRA 4O4YH 1NBZB 4XXDB 1JBJA 1WT5A 1QLRB 1NEZG 3T77A 4G8GD 3RI5K 3PWUA 2Y07L 4PYGA 3FFCA 2W38A 4EI5C 3I6GB 4XNUH 3T8XB 3CH8A 4B7LA 5TF1H 4KI5D 2OSLA 3DSNA 1JPTL 2A9NL 2GT9A 4P23C 5HHQB 1T5XB 3QIUC 3HS0B 5CP3H 3VRIA 3MGTB 5GRUL 4MZ3A 1PAMA 3L3KB 1GGIH 4DJMA 3QFDA 3R06B 4GAYB 3AU1A 5CIPA 1MH5B 3FQWA 1PDKA 4ODXA 5CGMA 4WO4D 1MCBA 2KQNA 1QHPA 4ELMF 5MENB 4B53A 3D0VA 5E8NB 4EUPA 1ZVYA 5DD5L 5CEZD 3B9DA 1XIWB 1RJZA 4KTYA 4PJ7A 5CJXC 3FT3A 4TSCH 5EFIA 1TJIL 5ICZA 1FYTE 4OUUB 3FKUS 1DQLH 2NY2B 3QULA 3QEGL 4UV7H 3D9AL 3HRZA 3MZTA 4HMCA 2DQDH 1WISA 1XGRA 3G5ZA 3MYJB 5IGXH 1G7MA 1I4FB 2FECL 1MHPL 3N1GC 1A0QL 4OKVA 4FRWA 5KN5B 2YRLA 5C09A 1U8MB 3DMMB 4ERSL 4MQTB 1X5JA 2EH7L 4OAWA 1QO3B 1X5GA 2Z91A 3KHOA 3V79C 3S3SA 4PP1C 3QO1A 1V3JA 4V1DD 1PKQB 4G8IA 3P30L 4WW2A 4HKXB 4D9RE 1KNOA 4PGDB 1RULL 1RQ5A 1VACB 4QLRA 3C5JB 1K8IB 4HJGB 3TN0A 5EBLB 3X3FL 1CFSB 4WDIA 4M8VA 2RFXA 3MFFB 1XCTB 3A6BL 4JFHD 4Z7UB 5JZ7D 1BX2B 4GW1A 2IH1A 3KPRE 1D5MA 2VDLH 4YHOL 5I8KH 3HZMB 1UACH 3TBTB 5E8PA 5K59E 4OFKA 3MRRA 3F5WA 3MRLB 3TBWA 2ERJB 4OZGA 2R0ZL 2EC9U 2P44B 3MJGX 5IHUL 4M7JH 1NCWL 2GW5A 4MMZC 2GIYA 4V2BA 2RAMA 2HKHL 5F72S 2E6QA 4HXAH 4EBQH 1RSFA 1CLZH 1ZVHA 5FYKD 3BIKA 4G7YL 2BMKA 3V5DA 5JQ6L 4X6FB 4N8VG 3DYPA 4M03A 2DWEA 3ECBA 4LVHB 3IGAB 3KPMA 2WBJC 2HJFA 4GRLC 4IHOB 1JPSH 2O5XL 3EYSL 2XRAL 5L2KB 3BWAB 3QR2A 4CNIA 4DCQB 4I3RL 4YHIB 1N2RA 1FIGL 4Y2DD 2HWZL 2DQEL 3MLWL 2HLAA 5C07E 4IM8A 5ACMA 3V5HB 4HF5H 1CLCA 3HPJA 1P1ZA 2B0SL 2KPNA 1R5VA 2GJZB 4FQJL 4NQXB 4UAOB 1FFPB 3BO8B 4GAGH 4P5TA 1HHJB 2OR9H 4NM4H 3S34H 2ZKHL 1FN4B 2AERT 4PRNA 2HVKB 3HG1B 2Z31D 1EZVY 1H0DA 4XMLH 3GSOB 1U93B 2QV2A 1A22B 1KCSH 3OB0H 5TH2A 1ZV5A 3TNMB 4RGNB 3UP1A 1QBMH 1OAKH 2HP4A 1I8KA 3PXJA 4LCWE 4XAWL 5EO9B 3RPIA 4JPVL 4P4RA 3VFMA 3C60D 2P5WB 3QBTB 5AUMA 1JYNA 3MRKA 1RK1A 5IQ9B 4NO2A 2EDYA 1OF2A 1KIQA 1BVKB 2ZJSH 4JAMB 3BHBB 2F8VA 2A1WH 3SBWC 4YHKH 3NCYS 3AVEA 1CD8A 2WM0A 2FDBP 1INDL 1JNNH 4WJ5B 4S1QH 5FYJD 1CXEA 5FO8B 5JHLH 2BNQA 4WY7H 1KCVH 5D1XC 1JWSA 4LDLB 1FDLL 2F5BL 2LU7A 4QHMA 2D7PA 4LRNL 3VA6A 2JJVA 4IDLA 5I1KL 3V0VA 1WBYA 1LD9B 2PYFB 2VKWA 3MBEC 5C71A 1GZQB 3U7YH 3EYFB 1SY6H 2OI9C 4GBXB 4R0LB 3KYNB 3IU4L 4GT7A 2NY0D 3KPTA 3V6ZB 1NGPL 2B2XL 3JUZA 1YA5A 5FM8A 3L6FA 2F19H 1A6PA 3E8UL 1T6VN 5GQBA 2OJEB 3MO1B 25C8H 3CZJA 2EH8L 3FQXB 2MQ3A 3KNBB 1F8TL 1LEKB 5CJOL 1XCQA 4AH2A 1UM4L 5ELIA 2EYRA 1IEBB 1SYSB 4IDJH 4LDOB 3DVFA 3TIEB 3ULUC 3WO3B 3RUGB 4E42A 2ESVA 5DHYA 3WHXB 2YS4A 3ULUE 2EXWD 5GISH 4NT6B 1CCZA 3ARBA 3I75B 1FRGH 1F02I 5HYIA 2ARJB 1DN0B 3DUSA 5M94B 3DV4B 1IC7L 7FABH 4LK4A 4WFFD 1FP5A 2EDNA 1AQDB 3NH7H 1IFHH 5E2VH 1P2CA 4TTDD 1TVBB 2VLKB 3V4PL 1S7RB 1G7PA 4FQ2L 4NGHH 4HD9A 4Z0XB 1LE9A 1WQVT 2LAAA 5I74B 5D7IF 5IUSA 2J4WH 1G84A 3AUVA 4OT1H 5JO5A 2R4RL 1R3HB 4YFLF 4LLVB 2JJTC 3NCMA 2PXYB 1QR4A 5L7XH 4PY8J 1A9BA 1R5WB 2ZUQC 4TVPH 3DO7B 2BSSA 1SM3L 1JYWA 1A1MB 1FE8H 1GXEA 4A6YB 2CK0L 1WTGT 4MNQD 1A9EB 1QTYT 3FB6A 4DVRL 5C3LD 5C0CD 2AAVA 4Q6IC 1N0LA 4R96B 2R29H 1CL7L 2Q7NA 4PRID 3DGGA 4PREB 2QR0B 5J56B 1HHHA 2DBJA 4G3YH 4X5XB 3TCXA 1AJ7L 3A67H 4QXTB 2R1WA 4WIQA 3EW3B 3PP4L 3GDBA 3JTTB 4DFIA 3MR9A 4ZTOL 4OGYH 1NGYB 1VGKB 2JK5A 5BW7C 5GGTA 4YBLC 1F5WA 4JFFD 3MRDA 1IVLA 2IALB 3GM0A 2VZUA 3PWVA 4NQDA 3RL2A 3C5SB 3G6DL 2NYYD 3JWOL 4IRJD 4NDMB 1DUYB 4GQ9L 1EGJA 3C5ZD 3FL7A 4HIJA 2XG5A 4YDJA 4QYOB 3ZE1E 4PJCE 5IB3B 1NLDH 3MLRL 3C2AH 4UZGA 5ABDE 4KVCH 1IEAB 1L9MA 1UJ3B 2EEAA 3MACH 5F3HB 1HKLL 1MCJA 1FLRH 3SGEH 5EU6A 3OAUH 1G9NH 2GJ6A 3IRPX 4K7FA 3DI3B 3DNKA 5T3ZH 5DS8A 1S9YB 4UU9B 4L9LA 4OIIH 3BMVA 1WITA 1H15B 1T1ZB 1ONQB 1RZIB 1XGUB 1YQVL 5E99L 1GGCH 5KS9B 4FQXB 1FPTH 4MCYB 4MGXA 4X6BA 1I85A 1S78C 1CF8H 2C26A 4HV8A 2AGJL 4J8RB 3EJYD 3WUWA 1GL4B 2V2TA 3MRJB 3ILQC 4Y4KA 1Z5LA 1U95B 2YPVL 4LHUD 4N0CD 1AI1L 3EJZC 1INEH 1J7VR 2R8SH 5AD0B 4AT6A 3AXLB 3J7HA 4LF3B 5I15L 3OXRB 2C1OB 2JJSA 1JN6A 2ADFL 4ZFOA 1NCCL 3ROOB 1JV5B 1M1SA 4JFOA 1HH9B 5D7KE 5EZIH 5IROA 5F7FA 4XAKD 3S37H 3IAGC 3QXVA 5T1MB 3C08L 3D85A 1TJHH 3RWIA 2F9BT 5SV3A 2P47B 2NXZD 2NY6D 3QIWA 1EGJL 4N5UA 1FFOA 4MA8H 5JDJA 3HRPA 4LPXA 5JHDE 1N3NA 3ARGD 3O2VL 3HE7C 3P77B 1PSKH 4HGWA 4NQVA 4NSKA 5ETUA 5TGBB 2HT3D 5FA4B 1XR9B 5B3JF 3FN9A 4P46C 5ADOH 5MI0C 3BSZH 4H8WC 1JUFA 3NN8A 4WTZG 2VDPL 3IFLL 1E4XL 4JRYE 4LSRH 4U1NB 2R2BA 4DKAA 5EB9A 4MAYC 3T2QA 4U1KA 1XGYH 5TDPA 4JDVA 2WWMC 3PWNB 2NY1B 1OAXL 4U6TA 4WUUA 1DN2A 1J8HE 2QSVA 3O4LD 5JA8B 5B39G 1WICA 2EO9A 5EZLB 5HYSG 1A6ZA 5ANME 4NQSB 4JPKL 4X99B 3EHBC 2ZG3A 1HQRB 3OKLA 4PJGF 1LO4H 1EXUB 3LKOA 4I8DA 1NFKA 5IJVB 4UIKH 5IESL 2YMXH 2A6DA 2AJUL 1MCNA 3L7EA 3QH3A 3H3PH 2IPUK 1SBSL 4NO3B 4GXUM 1A7PL 1ACYL 2GY5A 4ZFOL 2A83B 3LH2L 1XF2A 2MMXA 3REWB 1QRNA 1I1FB 3TZVD 4IOFD 5K59F 1MCDA 2FSEB 2DLTA 2LTQB 1MLCB 1XF4A 3LD8B 3MV01 3RKPA 3MV7D 4EI6A 3U36B 4BSVB 2JB5H 2X1OA 4JFDA 5DJ6A 3I9GH 1I1AA 1U58B 4PTUB 3WNMA 4C83A 4LIQE 4WU5B 1UWEL 3WE6B 1ZA3A 1BBDH 3VMNA 3Q5TA 4DGIL 3DBXA 2VITB 4KXZH 4TSBH 3MV9D 2DQCL 2VSDA 1HE7A 3O11B 3N1PC 3ZO0A 5F7MC 5AZ2L 4M02A 1BAFH 2YD9A 3IDIA 3RI5F 1Q9WA 1YY9D 2ITCA 3O45A 4W4OA 4EDXA 2KDGA 1IM9D 1S9VA 1CICD 2BOCA 4PUBH 3P0YL 3GSUB 1JGLL 4U1SA 1PY9A 4X4XA 2BCKA 4TUJB 5B4MC 4M1CD 1J1OL 2BHUA 3DRQB 5T1DH 5IV2A 2CIKB 3QXDB 4Q74A 1JWMA 2V7HA 5GGSY 4LSPH 3H9SA 2Z8RA 1RZJL 1KPUB 5E6YA 3BKJH 2BVEA 3UTTB 4BM7A 4AEIH 3BPNC 4WEBL 3MROA 4FFYH 3T1FA 1SYVB 1JF1B 1LP9F 3PWJA 2D7TH 5DQDL 1IGIH 1FG2A 3HHRB 3O9WD 4ZUSB 2VDML 3ULVC 1B4RA 4R4BA 1YPZB 4UTBL 2EDLA 1U6AH 3QPXL 2RB8A 4LCYB 1T1XB 2BNRA 3DSFL 3GM8A 1OGAA 2QHRH 1P84J 5FGCB 1MRCH 3FB5B 5C0JA 1LILA 1CD1B 5H94B 3O3EB 2X1PA 4XXDA 2YUVA 4LBEA 1UZ6E 1QLRA 4KWUA 3E2HB 3TFKD 2VSCA 5BVPH 1L6XA 3MLUL 4LSQH 1J1PL 1VB9A 1U8JA 3LDBC 3PGCB 2AK4E 3I6GA 4QXUL 1Q8MA 4X6DE 5GGUB 4YAQB 1S7TB 1MY7A 4MCZA 2X89D 1G9MH 3ARFC 4AG4H 1T5XA 2X9WA 1MJUH 4Q9RL 1WIPA 4KTEL 4C4KT 4F37K 1A4KB 3UO1L 2I25N 2B4CL 1TTGA 5JOPD 3O3BB 1RD6A 3BPCB 3TJEL 4PJEA 5T33L 4EOWL 4TNVF 3VE0B 1B0RA 5MENA 5E8NA 1TCRA 1U9KA 4BFGA 3BKCL 3FRPA 4U0QB 5IJKC 2IC2A 1WZLA 5F8QC 5L9DH 3W9EB 1CGVA 5KSBA 3ES6A 3CC5B 5HVGB 1IAKB 3RWJB 1AKJB 4XNYH 5IEHA 3V0WL 3VGAC 3MYJA 1I4FA 1UQSB 3MYZA 1FCCA 3SE4A 2BRQA 5I19H 1TQCB 4KPHH 2LU3A 3CFIC 5DTFA 3WUZA 3ARYA 4X6CA 1LNUA 4P2RA 5D70L 4XBEH 3DMMA 1W8NA 1ES0A 3VFUA 3GSQB 1P4BL 5IOPB 4PJIA 3BGMA 4F7TB 1OY3B 1FAIL 3ULUF 1NAKL 5C0FB 2I9LB 4R9HA 4PG2C 1DBMH 1KUMA 1PKQA 5C92A 1Y18B 1KFAH 3VW3L 1FO0B 1HSAB 4PGDA 4OZHA 4ZOEA 4HT1H 3C5JA 4XCFH 2H2SC 1N5YH 4HJGA 4MS8C 2Z8SA 2DICA 1CFSA 4DZ8A 3MFFA 4HLZH 3PHSA 4Z7UA 3WN5A 1BX2A 4P4KA 3NABH 3CDFA 2ED7A 4XPTH 4PR5B 3MLZL 3ARDC 1MFBH 3TBTA 4IEFB 1LK3L 4YLQT 4OIBA 3MXVL 4XP6L 4Y16C 3ZKXB 5IQ7H 4WNQA 4YE4L 3H42L 4MVBD 1RVFL 3TP4A 3WFBH 5IBTH 4R3SA 1C7TA 3BUTA 1GIGH 1NUFA 4R4ND 4Q9CA 1LEGA 35C8L 1UB6B 4R7DB 5CP3A 2CPCA 2OL3A 3QXAA 2H32B 1YEFL 4FQLL 4D9QE 1FZJA 3GK8L 4P9HL 5GRJL 4XCYB 1IGML 4GKZB 1RZ8B 3T0EA 4PLOB 1TZIA 4XPGH 1F2XK 5HHOE 4DW2L 3BFOA 4U6XB 3H9YA 5JLZB 4DCQA 4KTDH 5D7SH 4HIEB 4KKBC 1MIEH 1AGEB 4AM0B 1F11B 3DIFB 3OKOB 1JGEA 3V5HA 4LCIL 5DXWA 3V6OA 4X8JA 3KJ4B 2W0FB 1QPXA 5BZWB 1KC5L 2H1PH 1WT5C 2GJZA 1TETH 4P2QB 3O6MH 2CD0A 1N5AA 4UBDC 5CJQL 4ZNEA 4NQXA 5EO0A 1F4HA 4ISVB 3BO8A 4KROB 5F9OL 3L5XL 3X14B 1HHJA 1AH1A 3KPPB 2J5LC 3FFCE 3OGCB 1HSBB 1FSKC 2EDXA 4N0FB 3RAJH 3BZFB 1R3LA 1UXSA 5CBAB 4DKEL 4ZUTB 4O4YL 5DURB 5F97E 3ZE1F 5LJYH 4KMTH 4GQPH 2NY7H 1PGRB 3T08A 4YK4C 3VD7A 3GMLA 3QNYB 3TNMA 4PJ8A 4QRTB 1Q94A 4QKXB 2G2RB 4N5EC 4APQC 4S10A 5DGRA 3BJ91 1BFTA 3VFPB 1QSZA 5E00A 4XNUL 3ZHKA 5DJXB 1MI5B 5TF1L 5D96C 3GSRB 1F2QA 1OM3H 3KXFA 4R8WH 2MTPA 4NKIH 4JAMA 4PJ7E 1QBAA 2NR6C 1GGIL 2GQHA 2FRGP 4DUXA 4NNYB 1I1YB 1PG7X 1Q9LA 5LGHL 4OGAD 2CLZA 5DF0A 3LZFH 1QD0A 1F6FB 4MXVE 4NZRH 4XI5D 4U6YB 5FO8A 5I17B 5BZDA 1A3RH 1ND0A 3S8WA 3TNNA 1BGXL 3OJMB 3PNWA 1VCAA 4FXLA 3B8SA 5FHAL 3P4LA 3GSXB 1KIPA 4KKCD 4TSCL 4HZLB 5DA0B 3IS0X 5JOEA 5C09E 2VISB 2HT2C 3CDCA 2UV3A 2B1AH 1QLFA 3BW9A 4JDZA 1DQLL 5CSGA 1X5XA 3PWPB 1UENA 4UV7L 5GS0H 2DQDL 3OR6B 1YMHA 5IGXL 3IFOB 1S7WB 3PABB 3PDDA 4BYHA 3TM6A 2HLFC 1MLBB 1QSED 5FOBA 3ALPA 4JGMA 1FYTD 1J9CT 1I7ZA 5HGGS 3ZT6A 1D3CA 3FQUB 4Y5VC 2F54D 4LSDA 2OJEA 2XZAH 3FT2B 3I6LE 2GSGB 3V4UH 2XQBH 1DSFH 4K23H 3MNZA 2ZUXA 3AY4A 3T0VA 5E1AB 2FBOJ 3X13B 5ISZA 4YPGA 3TIEA 1IM3B 4OZGE 4M7ZC 3CAFA 3RUGA 5IR1B 3X3GH 4JRWA 1T7YA 3WHXA 1UGNA 3NIDF 4PJAA 4KK8C 3HZYA 4URTB 5EN2B 2VDLL 1BZ7B 2ARJA 5I8KL 5DDHA 3OR7A 1UACL 3BGFB 3LN4A 5BJTB 4L4VB 4YIQB 3L3OA 2PW2B 1Y6MR 4OZFH 5ERWB 3FCTB 3L9RB 1CGTA 2K7PA 3BX7C 2VLKA 3N85H 2DM3A 4NNPH 2Q1EA 3DETD 4HIIB 2Z4QB 2GITB 2ZOKB 4OLUH 2MFNA 2R1YA 3GSNH 4IJ3C 4NN6B 4X7DC 4EBQL 1CT8B 4HXAL 3RTQD 1CLZL 1OLZA 1RZGA 1VEMA 4LLVA 3R1GH 5CZVH 4WEUD 3BIAX 3DVNA 4XC1H 3WIFA 3NZ8B 5ITFB 1T04B 3QA3B 1JPSL 2V2WB 4CW1B 4P5TC 3WDJA 4XHJD 2R9HC 4HUXA 1WWAX 4X9FA 3U7WH 5FO7A 2EDDA 1BQHA 3GMPB 4PGEB 1UYWH 1HEZA 4HF5L 4LRIC 1ZGLA 3OF6A 1O7VA 3WS3A 4LLWB 3HI1A 1NSNH 4PREA 5EOCJ 1VFBB 5M7QA 2FO4A 4YC2B 2UZIH 3RKDC 4PRBA 4GRLD 4GAGL 1G7IA 2OR9L 2AW2A 3BUYA 4NM4L 3B8YA 3SKJH 4WGWB 3S34L 2B5IB 1X5FA 3CSBA 2X4QA 3UROR 4D0BB 1SY6A 1B4JH 3JTTA 2NX5A 5C07D 1WZMA 3VFOA 5AEAA 5ILTH 5KW9H 1I3RB 4XMLL 2IPKB 1NGYA 5AWNH 1IT9H 4NM8H 5HJ3B 1IILE 3FO2B 1KCSL 4PD4K 4LNRA 3G5XB 2OXHA 3RDTB 5T1LA 2EZ0D 1MJJB 1QBML 1OAKL 1DUYA 4W68A 3F6IA 3QJHA 2MPAH 4XTRC 1EEZA 2BNQE 1IEAA 4IRJB 4UDUB 5F3HA 4OKDA 3C5ZB 5LXGH 2BSTB 3GJEB 4I5BA 2D7NA 2ZJSL 2A1WL 4YHKL 1L0XA 3MLYH 3ZDYE 3BEWB 4HIXH 3ET9F 4PGZA 3ULVF 2MCPH 4LCWD 5KVGH 3NIGF 1F97A 1JNNL 2ZG1A 1NKOA 4S1QL 2PYED 4OCMC 1LVEA 1OARL 4NO0B 5JHLL 1XGQB 1MEXH 1ONQA 3ZE0E 4E41B 4WY7L 4CAGA 5KS9A 1RIUH 1UH3A 2XN9B 1BZQK 1KCVL 4MCYA 4JCLA 3F7YB 3VD9A 4JO1H 4QRUB 4QOKB 4U7KA 1BF8A 3P2TA 3WIHA 3CX5J 1ZAGA 4CMMB 2DQIH 5I0DA 3KDMB 3IF1A 4X6DF 1DUZA 4EUPG 3TBYB 1AGFB 4U1GB 2HG5A 3F8UB 3ROLB 4F7EB 1I8LA 3CXDH 1P6FA 3U7YL 3OXRA 4HSQA 1SY6L 1AXSB 1JTPA 4LHUB 4ZXBB 2AI0H 4KMLB 3CFEA 1F90H 1T03H 4JRXD 2F19L 4XVJH 4XVUD 2ESVE 4QT5B 4KKLD 5I8CB 2R23B 4ELMB 25C8L 4XRCB 2CUIA 4NQED 3QHTC 3O4OC 3MBED 3AAZB 2AJ3A 5HGHB 3MNWB 3JWOC 1OOAA 4IDJL 2VOTA 5TGBA 1XR9A 1JWUA 1ZHLB 2EIDA 1R3KB 5GISL 3LB6C 1KG0A 2FHBA 2EDHA 4Y4FD 3SY0A 4XC3H 1FRGL 1MQ8A 2HFEA 2FX9H 5LCVH 1A1NB 3QWRA 4MJIA 1RHHA 7FABL 2YPLD 3PWNA 5HVHB 4KUZH 5HDQH 4Z95H 1T21B 3NH7L 3PQYA 3F7VA 1IFHL 1MHCB 4LPWA 5E2VL 4OZ4A 5EZLA 4X5WA 4P57B 5TDNB 4NQSA 4NGHL 5JW4N 4X99A 3D6GA 1BREA 2ATPB 2J4WL 1RPQA 4OT1L 3SJVA 3BP5B 1HWHB 5IJVA 2EIZB 4RFNC 5C8JA 3RX5A 5IVOA 1A6WH 3MA7B 3C8HA 5L7XL 5C7XH 4TVPL 3UZVB 1FE8L 1Z6JT 3O3UN 3E6HA 3REWA 1II4E 3O6FC 2IAMD 3VXRA 1QEWB 1K6QH 1NGZB 2R2EA 3QDMB 4JFYB 4YR6B 4HBCH 5F1OB 2R29L 4UDTB 2Z93B 4BSVA 4NJ9H 3VFVA 1U58A 4TQEH 4K71C 4G3YL 2QQLH 1M05B 4NQDE 3A67L 5TFSH 1AC0A 4NNXA 4K07A 4M8QB 4Y19B 3BQUA 5CILH 4L8DB 1VFMA 1NC2D 2ICEB 4OGYL 4HXBH 1U3HD 4KXZI 1A2YB 5HGAA 4QRQA 3TT1H 3L3IB 5GGRB 5DMGC