5SWSE

Crystal structure of np2-b17 tcr-h2db-np complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
239
structure length
239
Chain Sequence
TVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLFYYDKILNREADTFEKFQSSRPNNSFCSLYIGSAGLEYSAMYLCASSAGLDAEQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsE01
4U4BA 5CILL 3MBEB 1NGXB 1X5IA 5J06A 4LLYA 3BQUA 2OR9H 4C57C 4TTDC 4NRZA 1V7NL 4YWGL 1INDH 4PJDE 1UYWH 5SX5H 5T3XE 3UTQB 4U1SB 3QT2A 3T0EE 3U4EA 3PV7A 4ONHA 3TP4A 4XB8A 1A1NB 4L9LC 2GIYA 3HR5A 4R8WH 1ND0B 1N2RB 2EDOA 1GPOH 1LE5B 1N4XL 4YXKH 5IROA 3RVVC 3LKRB 2OMNA 4XMLL 4AH2B 4YNYA 1KLUA 1DLFL 4HFUH 1C16B 4G6ML 5CJXC 3QJHB 5DLMH 1F6AA 3ARGB 5KSBB 2BNQD 3P4LA 4V2CB 4L3EB 5D7JD 3E6HA 2ATPA 4QTHA 1IFHH 5BV7B 5EOQL 4PRAA 2VISA 1IAKA 3O4LB 1QYGL 4XNMA 2OJEA 4WFFE 1IAII 2UYLA 3OB0H 1NFDF 4MWFB 3IS1X 3J8F7 5IJKA 5JQ6H 4LARH 2FBJL 1JL8A 2HT2D 4RNRB 1FO0A 1CT8A 4JG0H 1HHIB 4HEME 4ZUTA 5T5FL 4D0DA 3G6DL 2VE6B 1OQXA 1MUJB 4GKZA 4LKCA 4RGMB 4ZDHB 5EN2B 4CMHC 4TQEL 4NZRH 3AMKA 5DD1H 3I75A 4NZTH 3VH8G 5I75C 2RQ8A 3S36H 4RMTA 3ARED 4TSAH 3QR2A 5BS0A 1MRDH 1O7SA 1RUAH 1KG0B 2IPTH 4H25A 5C0BD 2ADJA 5JLZA 2HTKD 1NUDA 3WMSA 1J87A 3C6LB 3HI6L 1CFTA 3CXHJ 4LSRL 1JWSA 1OAUL 3VD4A 2X4QA 5C0ND 3VGFA 1L4IA 4ORGB 1GGYA 1MFEL 4JJ5A 4QHUA 3DECA 2ITCA 4YEEA 1JHLH 1N6UA 4JHWH 1V3LA 1GGCL 1TVBB 2OM5A 5GGSB 3U6RA 3WS3B 3CUPA 4RWHA 3AU1B 5ADOH 1WEJH 4XVUC 5FUOL 5IHBA 1BLNA 1T5XA 1A5FH 4Z78A 4X7DC 3NA9H 3PP3K 3RKDC 3L3IA 1RPQA 5FHBL 1TMCB 4B7IA 4EIZC 3HMWH 5AG8A 3F7PC 5DVLA 4R26L 2FJGA 2J5LC 2GJZA 2DJ4A 3B2VH 4UNTA 5EO1A 3QFJD 4JPWH 5D1QD 1ZGLA 4D0CB 4UB0H 4Z7WE 5IFAH 2WWKT 1H5BC 4X6DB 5DC4B 1UM4H 1BJ1J 4IBLT 5IUSA 2WBJC 5FM5M 2XZAH 2BFVL 3MLTA 4P5MA 1BOGA 2ESVE 3BQUD 4MAYB 5DF0A 1F4YH 5L88H 1X5YA 4X5XA 4PRPE 3C8KA 3HNVL 2UVEA 2OTUB 2R9HC 4M5YL 1G0XA 1HEZA 3UP1A 4NBXB 1MCHA 3VGAC 4HIJB 3DX8B 4ZPTB 4K7PY 4LDLB 5HI3D 3QRFM 3DV4A 4OIIH 4YHPB 1J9CT 1OF2A 3EYFA 1EBAA 3D85A 4EIGB 4PTUB 4IMKA 1JHTA 1IC7H 3IU3B 2APFA 4LLVA 1MIML 1E6OH 3JWOL 1I9RH 2DWDB 4N0UA 3WFDL 1GGIL 4KY1H 4LOUD 4XGZA 3T77B 2DICA 5F1SA 5EBGA 1CFQB 1FZKA 3MMEB 1S7XB 2OS7A 4TUJA 4Y19A 2W9DL 2AABL 4DW2H 2EXYD 5EZLB 5E0QA 1KTDB 1FAIH 4MXVE 4F37K 3FKUS 4K8RL 4NOFA 3QQ4B 1MAKA 2DJUA 6CGTA 3KVQA 2C3WA 3FQRB 3I9GL 2NXYD 4RQQB 3G08A 2E5EA 2P8PB 3NCEB 2VYRE 1EA9C 1QLRA 5IVXE 3SGDI 1XMWA 2PO6D 1NDMB 4G8GB 3GMNB 1YMHB 4JGMA 4ZUVA 1PKQA 2E7CA 5B3JF 5JMRA 1A7OH 1XGYL 1L9NA 1IL1A 4ZYKA 4P4KA 3GUTA 1D5IH 3OGOE 4MJ2A 3UEZA 5EFIA 4OCXL 1OTSD 5HVWA 4QOKB 3WL9B 4XZUB 2AV7B 5DJDB 1EFXB 1FFNB 2R4SH 3VI3E 1T3FB 4ZXBB 4FA8A 2VZOA 3JWDC 1TJIH 1HZHH 4FNLH 5C08D 5TDNB 5TE4H 1U93A 2IH1A 2ITDB 3CLEH 4ELME 5D7IE 5BS0D 5HYJE 1JVKA 3JV0A 3JVGA 4NN7B 4EQ2A 3EJYD 4KUZL 5DHVH 4X9GA 2VDQH 3SE9H 4S1SL 3MRQB 4KK5C 1JK8B 3SE3A 4ODHL 4PG9A 1OAZL 1FO0L 4DTGL 5DHYB 3I02A 4GG6E 5JXAL 1MFCH 3DXAA 4XNZC 3ZHDA 3P9LB 5TDOB 5ITBH 2ZZUT 3S3PA 5JORA 4M7KL 4UBDC 2JELH 2A6DA 4ZFGH 3S35H 2P5WA 1FNAA 4EOWL 1R5IA 1P4BH 1QFWL 3GHEH 3F7YB 4FFVD 1M7DB 4HZLB 4BQ6A 5JW5B 1HYSD 4Y2DC 3B3IB 4JY6B 3WNNA 2XG5A 1H3VA 2WK2A 5TE7L 3ARWA 3VWJC 3VXUE 4M7JL 4M93C 1S8DA 2A6JB 5IVZB 1IC4H 3TLRA 4YUEH 4ODSL 1CU4L 2ED8A 5I8KL 2E6PA 1GAFH 4N0FB 4OZGB 1DL7L 4J4PD 3WDHA 4L3CB 4WRLA 4FOMA 4JZJA 1U3YA 2FX9L 1BQLH 5DD3L 1IGIL 2ZCKH 1OP9A 1KJ3L 3HI1B 5D7LA 4WTWA 4TSCH 3QEHA 4MQXD 1FC1A 4U33A 4ODTH 1AD9B 4WUUA 1EZVY 1G9EA 2YN5A 2EIZA 3V4VL 2P1YA 5DR5H 2EYRA 3WXWL 4CN6A 1M7XA 3D85D 1U8JB 3VFGL 3WN5C 3IB4A 2I9LA 4MNGB 3ZT5A 2VH5L 4DN3L 4HLZG 1VADB 2IBZX 4MS8C 1T83C 3QA3A 2C3VA 3GSQB 3QEQB 4WI4A 1FFRA 3SDAA 3ARZA 5H37G 5I30L 1OW0C 4J1UA 5L0QB 2E9IA 1G7MB 4NCC1 4X0KB 3HPLA 5E2VH 3OKEB 3MA7A 3OGCA 3PHQB 4ZO9A 5SWZA 1VENA 3VXNA 3ZO0A 5H8DA 4QHMA 1S9VB 4OCLC 5CJBA 1KYOK 4HGMA 1CLYL 3ABZA 3TBSB 2FB4H 3QO1B 2MCPL 2K1MA 1G0YR 5D93C 4M6OH 4NUGH 4NQDE 3KJ4C 4B5EA 5B38G 2Z8SA 3X17A 3OKDA 1IRAY 4U0RB 2HRLA 4MGXA 1IBGL 2OJZL 3P9MA 4S1RL 4LCCC 3O3AA 3VGHA 5EU4A 5C0FA 4KROC 3CC5B 4HBQA 3O2WL 1A21A 2DLFH 3BP6B 3WNKA 3S5LG 3CDCA 1NFIA 3THMH 4TSBL 3RVWC 2D3VA 5CZKA 2OSLA 4Z77B 4XI5C 1T03L 5LGHL 4X6CB 2VZ3A 3I3DA 1MAJA 4GUPA 2HFTA 4KXZH 1IM3A 1WCBA 5FO7A 5BQ7B 3V5HB 3HE6B 3JZ7A 3BE1L 1CF8H 4QXTB 4XXDA 5F9WC 3SN6N 5HHMB 1NCCH 2BCKA 4W6YB 3WFHA 2B1HL 5DGRA 3OBAA 1NJ9B 3O0RL 4LAJH 4TUKH 1X6LA 3RNKB 4G9FB 4QNPE 4M61B 2C4FT 1PJ9A 3S36X 3IDMB 2DQTL 1I3GH 4OF7A 4XPTH 2YUVA 5T3ZD 1NLBL 2FEDD 2LABA 3D3VD 3IVKA 3LKQB 1YUHB 2HG5A 3PWVB 4YHKL 5JR1L 2QSCL 3QUZD 1OVZA 4X7EC 1S9WA 4JFYA 3MX0A 2LFGA 1RQ5A 5K9OB 4UV7H 2P8MA 3K8LA 4HS6B 4P2QE 2HA1A 1MI5E 4P46C 4XNYH 1AGFA 3ORJA 1H3WM 4KPHL 2EC9U 1WISA 2MKWA 3INUH 3WIFB 2GJ6A 1UXSB 1HWHB 1K4CB 1R24A 5IMKB 4BM7A 1WK0A 1CFBA 2BY0A 2NY6B 4UDUB 3OJMB 4LHUA 1BZ9B 1IGCH 3WS6A 1UM5L 4HWBA 3ULVC 4JFOA 2J3SA 5EB9A 4OLZL 5E4EB 3QJFA 1U8IB 4MMZC 4R7NA 1RUQL 3RL1B 2VLLB 1L0YA 4CVUA 1X5FA 1MRFL 4WUUD 3MV8D 2O26U 5E8OA 3E2HC 5GGRY 5IB2A 5HGAA 4KTEL 4RRPG 2NY4C 2MQCA 2P5EE 2H32A 4Y4FD 3VFNB 2XQYG 4F37F 3PWJA 1LO3L 4BYHA 3T2NL 4XRCA 4WWKB 4X4ZA 4PJ5E 4G8FA 4M7ZC 1M4KA 1BD2A 5C6TL 3SDAD 5FYJE 5E9DE 5HVFB 2YKLH 3GBLA 1IAMA 3HG1E 2X1XR 3BDBA 1JF6A 3JBG7 2J12B 4U6VH 1F3DJ 4V1DA 5EBLA 3DYPA 3IFOB 3QZWA 3WUWA 5FYLL 3VE0B 1WBZB 3ZE0E 5CINH 4Z7UB 2QLVB 3EFFA 3RUGF 5GGTA 1I7RA 1G6RH 1FG2B 2ICCA 4UOW1 4XBGA 3PL6A 1WFUA 1JGVH 3ZKMD 4XCCL 3M17B 5EORL 4HUMB 4KZEL 2LAGB 2W59A 3IDIA 1XR9B 2PTTB 2XICA 1WBXA 2X4PB 3AXLB 3HC0A 4EQ3A 1ACZA 2EEBA 3SO3B 3F6LA 3OB0K 4JM2C 5FF6A 4YDIL 1A1MB 4D8PA 1P2CA 1XF5A 2Z93B 2PYEA 5F1IB 3MRNB 4BZ1H 4DEPB 5DRWB 4XPAH 4Z18A 1NL0L 2IGFH 4KV5F 4ISVB 4DGIH 1J0YA 3MV9A 4TUOB 1AGDB 5DVOA 2XNAA 1XF3B 2CR6A 1UXWB 2VDKH 4C83B 5CEZH 3F58L 4P3CH 3RDTA 5DEFB 2LVEA 3QEUB 4JO2L 2WIMA 4NIKB 1F45A 2VIRA 5C0GB 3HAEG 4RISH 5FB8B 4KI5F 4KGLA 5GQBA 1EEUA 5CEYB 1XFPA 5GHWH 2Q6WA 4FFWD 4XHJC 3SE8L 5D2LE 5GRUL 1OWRM 3RTQC 1MLBB 3V5KA 1NSNH 4RGNC 3C87A 3DMMC 5IIEB 3ILQD 1UADC 1UCTA 2DJSA 5ENWB 3F6IA 1LE9A 1YNKH 1QR1A 1YPZA 4XP9H 4JFDA 2GUOB 3K4AA 3QCUL 4IRJC 4HDIB 4KRMB 4UTBH 1BMGA 4JRXB 3NCJL 15C8H 1YMMB 3QUYC 5ESAA 5E00A 4NWUH 1SYSB 4LSSL 4Y16A 3EGSA 2YUZA 2JIXA 3TO2A 1LK2A 4UT7L 4OV6F 5DD0H 4Y5VB 3O6LH 3MBEC 2AK1L 5D71L 5SWQB 4HK0A 2DLIA 2UUDH 2PXYB 3RUGA 4NJAH 1AIFB 4TPRL 3HRPA 2GJ6D 2HVJA 2BMKB 4UT6H 3QYCA 2FL5B 1AD0A 3TBWB 4LHUD 1E4WL 3W82A 5HD8C 4NQSB 3V2AR 4Y4KA 2Y4SA 3V4PH 4TULH 4Q9BA 1F02I 1QLFB 3B6SB 3L3GA 1A3QA 1X7QA 3QFDA 5TGBA 3A6CH 4FQCH 1MCNA 2K7PA 3V6FB 2ARJQ 1AC0A 1RULH 1ED3B 1KTKE 1RU9L 1YYLL 4P2CG 5ESVB 3C08H 4P5TB 4CJ0A 3AM8A 4WW2C 5HDQH 5F6IB 3SGKA 1NGYB 5GRVK 4G7YL 3VFUB 5BV7C 4J8RB 1MLCA 1IM9D 2I07B 4PJEE 4RAVA 4H0IA 1RZJL 2CUMA 4NKIH 3GMOA 3CD4A 4S2SB 3FT3A 4GKSB 3MRFB 4V1DD 5E2JA 1AE6H 4HF5L 4ZD3L 4HWBL 1DBKL 1HH9B 3F8UB 2YK1H 3U79A 3V7MA 1A9BA 4GRMA 1BGXL 5JIIA 3VFWA 2JCCB 3QHTC 3QXAA 4BUHA 5KVFL 1CBVL 1IT9H 3PL6D 1TJGH 4HKZA 2R8SH 4XNQB 5EH1A 5E03A 5D7SH 2VMFA 4NWTH 1TENA 5I66B 4QRRA 2XKNA 3A67H 3OKNB 5JHDA 2LAAA 2EDJA 1NH6A 2R2HB 4M6ML 2B4CL 1T4KB 4K3EH 4RGMC 5AZEH 3VG9C 2F8XC 5T1DH 3ZL4H 1ERNA 1MJJB 4X6EB 5EU6E 3ZKXB 2NY5L 4L4TB 1RIHL 1NDGB 4NP4H 1KTLA 1MVFA 5EC2A 4QT5A 3MV9D 1NGZA 4NBYB 5GZNC 3ULUD 2YRLA 4JDTL 4KTDH 1LP9E 5IFJB 3UX9B 5I1AB 5IW3A 3RDTD 4DJMA 3ULVE 4XBEH 1BIIA 1SY6A 2YN3A 1W72H 4RMRA 2EH8L 3OSKA 5GGTL 1ZT1B 4OLVH 4IIQB 1B2WH 4HIEB 1VESA 3GRWA 4HPYL 5F88A 5AYQA 2VQ1B 2FYYB 1UVQB 3L7FB 2I25N 1J1PL 2CK2A 2AEQL 4LEXH 3SE4A 3B4NA 2VXQH 3DRTA 3VFVA 1BQHB 1JF5A 2CLVA 4JLRB 3V0AC 3BKYL 3Q0HA 1U8KB 4JFDD 5EUOE 3DO7B 5HYFA 3PWPB 4MCYB 4I4WB 4PJXB 2N1KA 5DMJB 5C0CB 4IRSA 5IWLA 4HWEL 1KNOB 2F53D 2X4TB 2YR3A 3QWRA 1JGEA 3LD8B 4OLUL 1U95A 1A2YA 4Y16D 1UM6L 4HC1H 4LCWE 5FO8B 4UUJB 5I16B 1L7IH 3H7BA 3QPXL 4F7EA 2CKBA 2JIXD 5DK3A 3X3GH 3HPJB 4ONOA 2GT9B 4WI5A 4XP1L 2O93L 4P4RB 4PJ7B 1FYTA 4PJ9A 2Y07L 5HHOA 3A6BH 4LPUA 4L8SA 2EDKA 3EOAB 4I3SH 5BO1L 3CX5J 4JY4A 5IKCB 4MD4A 3S4SA 2VZTA 4HX1A 5E99H 5I0DA 1JPFB 3BP7A 2ADGB 2ADFH 2XA8L 3SO5A 1A7PH 4H0GA 4KK6C 1ETZB 4TVPH 2UV3A 1S7SA 2FJFB 3QIWC 2F54A 3R1GH 4OCYH 3NPZB 2R0ZH 2RCSL 4Y4HA 3KHOA 3EOYG 3LKOA 1CDJA 2VLJB 3ARPA 3OKOB 3GI9L 2DLHA 5FKAA 4KKNA 5KVDH 4JPKL 3UTPD 4OI7A 4Q9QL 1C5CL 1CICA 3KNBB 5L6YH 4S0TD 2V7HA 2AGJL 1E4XI 4K2UL 3E1F1 2IPUG 3C9NB 3GMPB 4RGNE 4DAGL 1UC6A 3DLQR 4KRLB 1S7TB 1SBBA 3K3QA 3ZE2E 1CQKA 2VXVL 4LNVA 2W9EH 3HTLX 5D6CA 5BRZE 1QPPA 3MRBA 1ZVHA 5I1CH 2EDXA 4PREA 5DO2C 4CJ1A 4X5WB 1K2DA 4OD3H 1CDCA 1JZ6A 3CCHB 1I7TA 5HHQA 2CK0L 4RDQG 3GSNH 4K9EL 4KJWC 2BVEA 3MRRA 2UZIH 4QRRD 5F1NA 2B1AL 5FAAA 3OMZA 2CLZB 1RK1B 5F3HA 2DTSA 3F65A 2NR6C 2IANA 1N3NB 3WIHH 3LKPA 5B21A 1YJDH 2GAZB 2JKXA 5A3ID 2HJLA 3MLRH 5SV4A 1TZGH 3Q6GL 2CQVA 3R06B 2Z35B 5DJ2B 5DWUH 4ZXBC 2Q8AH 3NIGE 5FA3B 5IR1A 4N8VB 2EXWC 1XGRA 3CVIL 1OARL 4QHKJ 4R7DA 5TH2A 4NN7C 5DRNB 3ZTNH 4O58L 3U83A 2KBGA 2YA2A 4LRIA 4NZUL 1HHJA 1UA6H 2I24N 3RY4A 3QDMD 3TBYA 5CZXD 2I60L 4JFPA 4EBQH 2OK0H 1U8LB 2R0KL 4I8DA 3KPPA 2WIIA 2XWJB 2VDRH 4YZFF 4ZS6D 4NO2B 2XZQH 1GHFH 1KEML 4WFGD 5CWSA 5I1JH 1HHGA 1A6VH 2IBGA 5KSBE 3F5WA 1NKRA 2XPGB 1WLHA 2H2SC 3QULB 1IEBA 4XXCA 4OKDA 2SEBB 4L3EE 4KQ4H 1W0VA 4QRUB 4PB9L 3TO4A 1PSKH 4KVNL 4DN4L 3R4DA 4UTAL 3GM8A 3W39A 5EC1A 4Z8FH 4S1DC 4EN3A 4Q6IB 1IAOA 4JZOA 1KCRH 3IXAA 3LPGA 1AR1C 3N9GH 3H42L 4JY5H 5C07A 4XH2B 1FGNH 3SY0B 4LGSB 3VXSA 3X14A 1RJYA 1U2HA 3O9WD 3T0DA 3FB5A 5EA0L 2BNRA 3DBXB 3Q5OA 3JTSB 2YA0A 2ID5A 1L0XA 3CFCL 3FB7B 3GK8H 5HVGB 3TFKD 1NGPL 3GRWL 5D1XB 2E6JA 1UZ8A 1G9NC 4JFXB 4I3RL 1IC5L 1WAAE 4IS6B 4EEEA 4WDIB 4GQ9H 3F7QA 1IGTB 4MLSA 1Z9MA 4J3WA 5DSCB 2W0FB 2E8YA 1J1OH 4L3AA 2VDML 4GG8B 4FTVA 2FR4A 4WGVB 3BRGC 1MFNA 3OXSB 3CFJB 2BNQB 4JN2A 2F74A 2D7MA 1ZS8B 3CFKA 4R0LA 1KIUA 1BQSA 4OCWH 5DFWH 4WHTA 4OF5A 3TBVB 2CKBL 3RWDB 1IGJB 5KSAA 1JGUH 1EEZB 1AGEB 1XR8B 3BISA 4RZCA 5KS9B 4OD1L 3IFLH 4D9QD 4MZ2A 4G6JH 3ARBA 1B0GA 3L5HA 5T1KD 2BSSA 3D5OF 1SBSL 1CICD 2X4NB 2ZPKL 4KMTL 3LQAL 5HGBA 2GCYB 5DK2A 4OF0A 3K4ZA 1F2QA 1IKNC 1U36A 3G6AA 4WCYL 4PGEA 1VFBA 1RZFH 5T3XH 1U8QB 4DK6A 3MRPB 1ZT4A 5LCVL 1BEYH 3OXRA 4V2BA 4ZTOH 3TIDA 1RZGA 1RUPH 4YPJA 1NEZA 4U0RC 3BAEL 5FOBB 4X6DE 4MB3A 4LSDA 5E94A 3WHE0 4WEMB 3L3JA 4A6YB 2DMBA 3TBTA 5ICZA 1MF2L 3AREB 2QQQA 4GAJH 4H8WL 4LLUB 2X4UB 2H2PC 2AEWA 2CGRL 5C0BB 5BVJA 1QFHA 1XF2B 1HXYB 3ALPA 5ACZA 1RZIB 4XNUL 3O3DA 4NC2B 3ES6A 1X5HA 4ACPA 3CFBB 2FD6L 2LE9A 4HJJL 2R2BB 5E8DL 3AS2A 1E4KC 2W91A 1WT5C 2NNAA 1KFAL 3BP4B 4NCDA 4FABH 3ARSA 5CMAB 1K5NB 3IAGC 1TZIB 5INDB 4XVTL 2D31B 3H9HB 2DDQH 1WQVT 3IFNL 4TRPH 2WWKO 2QQKH 4YO0A 3D25A 5D1QB 2CIIB 3IDGA 5BOZG 3TO4D 2YMXH 4FFZH 4FXKB 1ZT7A 2OR9L 2K7QA 1NBVH 1INDL 1WIPA 5C07D 3Q1SH 1UYWL 5DHXB 3AFLA 1T0MA 3M07A 4UIMA 3WBDA 4KHXH 5E2WH 1T0NB 1CL7H 3OJVC 1EFQA 2VKWA 3WNOA 2CRIA 1PZ5B 3O11B 1GPOL 4AIOA 5IMOA 4YXKL 5E8EB 2VABB 4YQXH 4G8GE 4MQSB 4M8QB 3RWJA 5IESH 2VNCA 4MSWB 2ZJSH 4HFUL 2FX7H 1A3RH 3C5ZA 5EDXA 2V2TB 3IS0X 4UZGA 5DLML 3WLBB 2NY6C 2Z4QB 2E7BA 2WMPA 1I1CA 1F4HA 1X44A 5HYQA 1KT2B 1S7UA 4C58B 4YC2C 2UUDK 3LS4H 1K85A 4X4XB 1NFKA 5DMKA 2VAAB 3FZUD 5KSAD 1Q0XH 1CGTA 3TN0B 1KPRB 1R3JB 5D2NB 3VFTB 5JZ7C 4I9WE 4P3DB 4WWKC 5DRZB 3MV7A 3HE7C 5DJZA 1OPGH 5GZOD 3ARBD 5DHVA 5K9KB 3MJGX 3GMLA 4IHOA 4YXHH 4YDJA 4MNQB 3FTGA 4LARL 3OAZH 1XGTA 5D9SB 3DRQB 4PGCB 2JJWA 2AVGA 4JG0L 5IMMB 1DANT 1I1AB 1OQOA 3KPSD 3MUY1 3P73A 2PO6B 3OX8B 2CO7B 3DX7A 4PY8J 4OLXH 4NN6B 4LSTH 1VFOA 1YEIH 5DS8B 1OAYH 4NZRL 5DD1L 3SKUD 1XIWA 4FQXB 4NZTL 4P2RA 2FSEB 1YEDB 3S36L 3UC0L 1QFWI 4TSAL 2YD3A 1B3JA 3V6OA 2APTA 3NCYS 5MP6H 3LN5A 1MRDL 1RUAL 2IPTL 1A6AB 5SX4I 3SO3C 4GXVH 2VERN 3QH3A 2AQ1A 1PW3A 4OD2B 3HCVA 2FECL 5C08B 1TTGA 4CW1A 4LCYA 5ID1A 4DEPC 4YBLB 2X70A 1VCAA 3N0PB 1DN0A 4OZGE 4I77H 1P7KB 3ARRA 4U1GC 2J1KA 2W60B 3UPRA 1JHLL 4JHWL 5F3BA 2V2WA 4NRYB 5ADOL 2V2XB 5C1MB 5D1ZC 1A5FL 3MCLH 3D39B 3NA9L 4MB5A 1MSPA 4OM1H 5E24E 3ZDYF 3HMWL 4FQQB 4UNVA 1KV3A 1YZZA 2O61A 3GI8H 3B2VL 1U8NB 5J13C 1ZWIB 4Z7QE 4MNGE 5A40E 4JPWL 4UB0L 5IFAL 2XZCH 2NCMA 4PPTA 4JFHE 1NCAH 1UM4L 1I9EA 4WV1C 1V3MA 1Z6JT 1ZGLB 1GRWA 3LEYH 2XZAL 4HIHA 2R23A 1IARB 3IAQA 1F4YL 5L88L 4H20H 1ITCA 1M05A 3MUGA 2FO4B 2V9RA 4XCFH 4KJYA 3ZYOA 2J8HA 4NFBA 1IE5A 3QI9C 3L3OB 1G7HA 3FT4A 3P0YH 4LP4A 1AC6A 5HDOA 2VZUA 1JPGA 3CU7A 1MY7A 5GRVL 4GAFB 3VWKA 4OIIL 5EU5A 4CN4A 3ARFD 4N0CC 1QEWB 4M4RA 4FXGA 4XP4H 1JNHA 1A14H 3C5ZD 1IC7L 1T80A 5IM7B 2X6MA 3UTSA 3MRHB 1E6OL 3MRKA 1HCFX 1I9RL 2B2XH 2OCFD 4KY1L 2H9GB 2Z31B 5B39A 2A73A 3BFOA 1KIRA 4N0UB 4CVXA 4X6CE 4DW2L 5T1LA 4P5TC 4DOHB 3LDBB 2R1YA 3WXVH 2VR4A 2DQIH 1FGVH 1MH5B 1G7PA 3DHJA 1BZQK 4TUJB 1KB9J 4LHUG 3U7YH 3MV7D 5HHME 3KR3H 1S9YB 2CPCA 3V7AG 4FQIH 1KPUA 4L5FH 1FV1A 1UH4A 4PS4L 4WI2A 1KOAA 3BXNA 4G9FE 1DVFA 3GMRA 4LPYA 3REVB 2DKSA 3FOMB 3KPMA 1A7OL 1VFUA 2ATKA 2YSSA 4NGHH 3UYPA 1D5IL 4ZOBA 1BP3B 2IH3A 3UAJD 1TQBC 4MJ5A 1TJHH 1EH9A 1EEYA 4XMKH 1C5DB 1GC1C 5CEXB 4EUPB 2R4SL 1N8ZB 1K9TA 1XIWD 2HLFD 2OQJA 2XTJD 4HUVA 2Q8BH 4YIQB 1TJIL 4NQVA 1HZHL 4FNLL 4PY7B 5TE4L 3CLEL 2ZUVA 1T7YA 1D9KD 2NXZD 5M7QA 5EOCH 3QZWG 1EJOH 3B5HA 2BRRH 2C1PB 3LN4A 2VDQL 3SE9L 3ARYA 4WVRA 2DMCA 4X9IA 2FZ3B 3U0TB 1P5VA 2WUCH 3D69B 3V79C 5L2KD 4G9DA 1OL0A 1MFCL 2OMBA 3QIBC 4RA3A 3UJTH 5JIPA 3O6FB 5GGVY 1YYMH 3BH8B 2HP4A 5EO9B 3FONB 2EDEA 4ZFGL 1F90H 3S35L 1OGAA 3GSOB 1PQZB 3L7EB 1P4BL 2PCPB 3GHEL 1AQKH 4RX4A 1U3JA 3TNNA 2DD8L 4P59H 3D3VB 5IOPA 4MA3B 1I75A 3ZKND 3PHSA 4RIRB 1FE8H 1HOCA 5KZCB 3QUZB 2IPKB 1SJVA 1IC4L 2F58H 3TCLA 3U7WH 1XH3B 1Y6NR 1ZLVK 4YUEL 1NAMA 1S8DB 1S7QA 1GAFL 1YQVH 5KW9H 1ZLUH 4LLMB 1N6QL 3UTZA 5J6GA 2FLBT 5C8JA 4LSQH 4XCNA 3BYTA 3O81A 3O3EB 2ZCKL 4OGZA 2IJ0C 4Z7UE 3TVMC 1P7QA 4TSCL 3V6ZB 2NY2D 4ODTL 2J8UF 5DT1H 3REWB 1G6RA 1KGCD 2IMNA 5D6DC 5HDBE 3MR9A 5FO9B 3G5ZA 4EDXB 2ZOLA 4RMWA 4CU8A 3MV8B 3MROB 3UTSD 1J8HE 1RD6A 3GB7A 4Q7DA 3BEWA 3N1GC 2ZOKB 4Y4FB 3BEVA 3C5SB 3U2SB 5HHNB 3OWEA 3MRGA 4H1LB 5E2VL 3TT1H 4OFPA 3RVUC 4ZAKA 2DM4A 5ICYA 3WKMH 2C5DC 3KPNA 4DKFH 5L2JB 3WEXB 1IGYA 4WHCA 4G8EB 2FB4L 1LO5B 2PKDA 5F7YC 4X7TA 5CBAB 3FO9A 1U42A 5I76A 4M6OL 1I4FB 1INQA 4GBXA 3VMPA 4ZNEE 2HT4D 4QRPD 4N0YH 2CUHA 4MCZB 1WTLA 4XWOD 4JRXE 1YMME 3DYOA 1CFVL 2DLFL 3QPQD 4MNHA 1BECA 4IJ3B 4PJAE 3BZDA 3TESA 5CSZA 3THML 1R5WB 1RJZA 3UBXA 3MFGB 3DUUA 5JTWA 1PY9A 1JYXA 3KWWB 5LGJB 1LQSR 5AD0A 4UIKH 4OGXH 2XI9A 2PR4L 4WI7A 1OGTB 4EXPX 3UTTD 2LU4A 4U1LA 4PJIF 3EYOA 3JWDH 4LFHD 1LO0L 4HJGB 2A6KA 1CF8L 2ZCLH 3QXDA 2B0SH 3HLAB 3VWJD 4OZFH 4PRHB 1NCCL 2IQ9L 4FFYH 5C6PB 1BZ7A 5CD3B 2EE3A 2ENYA 4NKMB 4Y7MA 4FG6D 3EKCA 5IB1A 1PG7X 1ZAGA 1WCQA 5HHPB 4JKPH 4OT1H 3H9SA 5FYJH 4PJ8B 1I3GL 4NNYA 12E8H 1FIGH 4P2YA 2KQNA 4XPTL 3PV6A 3N1FC 3QIUA 1OGAD 5ITFA 4O2EA 1QSED 3QQ9D 4JRWA 1RZ7H 1N6VA 4RX4D 2HAZA 1UCBH 1MREL 1JE6A 3G5YA 1MCOH 1LEIA 2XA3A 5CIPH 1ORQB 1T1YA 2HG5B 4LLQA 1F97A 4CNIA 1XGPA 3EO9L 1GOGA 4AIZB 4Q2ZB 3L6FB 2H41A 1FNFA 3ULSB 4F7MA 3RIFK 3WE6B 5C09B 3KLAA 4Q6IC 5FYKD 5KN5A 4XNYL 3WFBH 1CYGA 1IAIM 4X98A 2DTMH 5KSVA 1NMCB 3PWUA 2ZSVB 5ISZD 5KOVC 2QKIB 1T1XB 4L4VB 3VFPA 3BP5A 4J12A 3IJHB 2JK5B 2E6QA 1X9QA 3MJ7B 1UKQA 3ARDA 1NBYB 1IGCL 3RZCD 1UQSB 3QXWA 3ZYJA 2JCCE 1DFBH 5IFHH 3AROA 4LCUA 1A9EB 4Z5RA 3N85H 4CMMA 4JVUA 1NC2B 3LRHA 2R29H 1LO2H 3S96A 1TVHB 1U3HA 4LF3B 3LQZA 4PJIA 2BVUA 1IJ9A 2X4SB 4PRNB 3SDDA 5CP3H 3KJ6H 4L4TE 3JSSA 2X4OA 3ECBA 1HE7A 5TQ2H 1JIBA 2YKLL 4Y5XC 3S4SG 4G6AD 1F8TH 3U0PA 3DSNA 5D7JC 4KRPB 4OUUA 3E6FA 4ZAKD 3QDJA 4CVZA 1ONQB 4Q9CA 4PJBB 3RGHA 4U6VL 1ZKAA 1MCWW 3B9EA 1FP5A 4LKXB 1IM9B 2BNUB 1BFVL 4BELD 3B8SA 5CINL 1NAKH 1W72A 3OHXA 2Y36H 3EW3B 1CGYA 2V6HA 5SWSB 2MTPA 4YHYB 4OAWA 3IU4H 5IG7A 2EDQA 3AAZB 5HI5D 1JGVL 2XYCA 1E4XH 2HT2C 3QDGB 4HUXA 4NSKA 3PWPE 4PJXE 2A83B 3S88H 1MWAB 5H35A 4BZ1L 3X13B 2BHZA 1DR9A 5I9QB 2JB5H 1WITA 1AQDA 4XPAL 1Q9OB 1VEOA 2NW3A 2IGFL 1OM3L 4ZG1A 4HC1A 2A6IB 4DGIL 2R4RH 2PETA 4HV8A 2VDKL 4PJ7E 5CEZL 2HJFA 3H0TB 4P3CL 3NFSH 5DJ8A 5F7MC 5BJTA 2AJSH 3MV9B 2Z9TA 2XNAB 4Z7VF 2HTKC 2V17H 3VJ6B 3NGBB 3KXFE 3T0VA 1F42A 5GHWL 4OZHF 4K23H 3T4YA 2YD6A 3HS0B 1DE4A 1I7UA 5F21B 4LSPH 3GJFH 4IOIB 4LPXA 1NSNL 3SDXF 4QHKI 5C0NC 5D5MB 4Z0XB 4RFNC 3H9SD 1YEFH 3BWUC 4ODWB 2ARWA 1YNKL 5ESQB 1IKFH 4HS3B 1ZK9A 3L1OH 1N5YH 3MOAH 4FRWA 3PGCA 5GGUA 3WJJC 2OXGA 3VFRA 2CLRB 5INCA 4X80H 1J05A 2EICA 1OAKL 1F5WA 4NWUL 1MPAH 4PRDB 2VLJE 4NUJA 1MHPH 3MLZH 2F53B 5T1MB 4U1KA 5D1QC 5DD0L 3EGSB 2OLDA 3O6LL 2EH7H 4U2ZA 2J7LA 3SCMD 5DJ0A 5GSVB 4M00A 2JJTC 4ODUB 1DEEA 4NJAL 1C5BH 1I8LA 1U92A 3SKNB 3BQUC 5C6WH 3C2AH 4HK0B 4YBHA 1PX3A 4UT6L 4HK3J 1ORSA 2R2CA 3LZFL 3BPCB 2JE8A 5CGMA 1W8OA 1HDMB 4JPIB 3HN3A 4QXWA 1Q9LB 3V4PL 4TULL 1MCLA 2ICWB 2APXA 2VXUH 3NABH 2O5YH 3BZ4B 3A6CL 4FQCL 3ULVH 5HI3C 1YY8A 1RULL 3IETA 3MGTA 3KPQA 5IROC 1INEH 5IF0A 3GSNA 2L4OA 3C08L 4GQPH 3SKMA 4GH7B 3ZZ1A 3PWNB 5HDQL 5F7UA 1FNGA 5MEPB 3NA4A 4YHNA 2X9WA 4HIIA 4W6XB 3WIHA 5IB4B 4Z7VA 4K94H 2R0LH 1QKZH 2DBLH 4OZHA 4LOUC 3TNMB 1MQ8A 3FQUA 4U6YB 3W9EA 3SDXA 2J8OA 4MQ7A 4NKIL 5D2NC 3BO8B 1BBJB 1V7MH 2P8LB 1AE6L 2PTVA 3VCLA 4EZMA 2YK1L 2YBRA 3ZDXE 3B5TA 1ZA6B 3CH1B 2E7LC 2NTFB 4X99A 1DQJB 1QHOA 1ES0B 1BJMA 4E0RB 2NXYC 4P23A 2Y5EA 5IJKC 4E41B 1IT9L 1TJGL 4WI8A 5C0IB 4WO4D 2R8SL 3R8BB 5D7SL 3HUJA 4NWTL 1NMBH 2I9TB 2PO6C 4Y5YA 3EO0A 4YHMH 2IALB 4QCIA 4K3EL 1QRNA 2DQEH 5AZEL 4DFHA 5IHZB 3ZL4L 4ODBD 3HFMH 4NZDA 1ZHKA 1OTSC 3TYGL 3C60A 1SQ2N 4PIRF 3IDYB 4JB9H 1T04A 2CDEB 3VI4E 43CAB 4NP4L 3CDYA 3D2UA 1X6NA 3OR6B 4L29B 1A1OB 3FB6B 3TA3D 5HTSA 3OKMB 4KTDL 3VA6A 1H0DA 3CSGA 4LLWA 1OSZA 4XBEL 1R5VA 4PJHF 4NDMB 3X12B 2C7UA 3QQ3A 2AW2A 5LBSH 1W72L 3EJYC 2R15A 4JRYA 4YBLC 3QEGH 4JCMA 5GRYA 3RL2B 2XFXB 2E3VA 4OLVL 1B2WL 1BIIB 4HKBA 3VFOA 4ZMAT 4F57H 3SJVA 1CTNA 2NX5D 3QDMB 2D7TH 5I73B 4LEXL 1NEZG 2BFVH 7CGTA 4LEOB 2VXQL 3IKKA 2WW8A 1WFOA 2MHAA 2BVQA 2C1OB 3LEXA 4GXUN 2PUQT 4N68A 2BNQE 4NT6B 1MCPH 5C0RL 2DYPD 5M94B 1OWWA 43C9B 3RIFF 1I8MA 4NZJA 4TVPD 3I6LD 1FLRH 4D0BB 4ETQB 4IMLB 4JFEA 3UZEA 1TDQA 4HC1L 1L7IL 4FFVC 4Y1AB 4F15B 2WANA 1HYSC 1DBJH 2WP3T 2E9WA 3X3GL 4XCYB 1JFQH 4PBWD 1M6OA 1AXSA 1DUYB 2FCBA 2FIRT 4FQ1H 4QRQA 3VXTA 4JAMA 3NZ8B 1FSKB 2G75A 5EIQA 3A6BL 1QBBA 3HZYA 3O9WB 3OKKA 4L1HA 4XPHH 4I3SL 4P2OA 3UDWA 3SOBH 1Z3GH 1KTRL 4ZFZA 4ZUSA 2YD7A 5E99L 3MRJB 2M26A 3MOBL 1H8OA 1GGIH 3RWEB 2ADFL 5I1DB 5E5MA 2FLRT 1TTUA 3BGFB 4J4PC 2CRZA 3ZT6A 2JLLA 4EI5A 2JJUA 2AABH 2O5XH 4WW1A 3IDNA 3T0EA 3IXTB 4P99A 3FRUA 4PJDB 3T4AA 5A43C 3G9AB 4TVPL 1FVDA 1DQQB 4KZDH 2NZ9C 2DMKA 1N0XH 1IGFH 2LQRA 3R1GL 4MQXC 1NANH 2R0ZL 3BKMH 2H3NB 2NW2B 2KH2B 3I9GH 5FECA 1ZVSA 2NY3D 4PLKD 1Y18A 4JANA 1AHWA 1CIDA 3CK0H 3V52H 1WC7B 4PJHA 5D72H 5KVDL 3VFMA 5C0BE 3STLA 2VQUA 3EDJA 5L6YL 5KVGH 1HCVA 3IFPA 1K4DB 3KPLB 3DNKA 1ZV5A 5MENA 5T1KB 3LDBC 4U6TA 1CICB 4NKOA 5BV7H 1Z5LA 3QISA 5HGDB 3BH9A 5HXMA 2W9EL 4NYLB 3QXUA 3QAZC 1SHMA 3T2OA 5I1CL 5KANG 4Z7WF 5KVMC 5C0JB 1YNLL 4ODXA 2V5RA 4OD3L 5GRJH 2ZSWB 4X7CC 4KUZH 1YN6B 4CUCA 1KB5B 3GSNL 4PREB 2UZIL 3JXAA 1U8HA 1EK3A 3MNWA 1KXQE 3QFJE 4EI6B 3PHOA 1M7IA 3FN9A 3WIHL 1YJDL 3S7GA 1TXKA 4YDLB 5JXAH 3MLRL 1J12A 1TZGL 5EZOH 2Q8AL 5DWUL 3LH2H 4JDVA 4LVOB 1FPTH 1SEBB 2AK4A 3LMJH 4U1MA 4G6FB 2XKUA 5DEGB 3WDIA 4X8JA 5JDSB 2YXMA 5IP4A 2AJZA 5JO5A 3ZTNL 4ZFOB 4K7FA 4Z95H 1E4JA 1IQDA 1UA6L 3TCXA 3JVGC 5SX4H 1JZ5A 2F5BL 5LKNA 4JRYD 2C3GA 3EOBA 4EBQL 2OK0L 1XGQA 2VDRL 4HMEA 5HPOA 4OFIA 2XZQL 1GHFL 2ZUXA 1K8DA 3TZVA 4E5XB 5I1JL 1O0VA 2DM3A 5CGYD 3TWCH 3SE3C 2PW1A 4U6XB 4KKAD 2YC1B 1SJEB 3B83A 3B9KA 3W0WB 3RNQB 1DBBH 4KWUA 1KCUH 2BHYA 4KQ4L 5E56A 1PSKL 4MXVF 4Z8FL 4DVBA 3FQXB 1KCRL 3N9GL 1TFHA 2FEDC 5DDHB 2DQDL 3AGVA 5D2NE 5HY9A 5LXGH 3QUZC 2F8OA 1FFOA 4U49A 2X1PA 3MCKA 2ICWJ 5DURD 5I6XB 3SKOB 3GK8L 2GSIA 4Z7WA 2HN7A 1QO3A 4IEFB 1YQ2A 3OQ3B 4M6NH 3BVNA 3OJ2C 3GZKA 2XWTB 1S9KC 3MACH 2ESVA 1CFNB 5LAXA 3IJYA 1UZ8B 3K8KA 3VI3F 2JB6A 4PRPA 1J1OL 2R1WB 3EBAA 2ZUQC 1Z0NA 4JZJC 4ALAH 3BGAA 1JUFB 4ELMF 5D7IF 1G7QB 3OJDB 1JCKA 3DGGA 1HILA 4MVBD 4OCWL 3SDCB 4M3JA 5ACMA 3O3BA 5HI4D 2GW5A 1ZHLB 1JGUL 1JTOA 4KQ3H 5C08E 4NQUA 1NMAH 3IFLL 1KJMB 4G6JL 4Y4FC 3NFNB 4I0PA 3FRPA 4HH9A 4JCLA 3GMMA 4W81A 3OR7A 3D0VB 3KGRA 1IBGH 2BSTB 5FGBA 3WNLA 2IF7A 2GFBA 3ARBB 1Y6MR 5MEND 4MDJB 1RAMA 2AJUH 4NQTA 3SDAC 1BPVA 4PP1D 2G60L 3DURA 5I1LB 3D39E 4PRBA 4YAQB 3VXOB 1RZFL 5T3XL 1DLHA 3KPSB 2I26N 1BEYL 1JYWA 2P7TB 5B39G 3HC4H 2ERJB 3WJLA 4U1HA 4ZTOL 4HFWA 3C8HA 3QUXA 1QSZA 2RB8A 1RUPL 2GK2A 4NO0D 3HMXH 3HZKB 1FNEB 3IJSB 3WIIL 3ZKMC 1A6ZA 4GAJL 3O0RH 3E3QC 5IVXB 2YZ1A 4GMTL 1U9KA 1F3DH 4IJ3C 4JEGB 3FQTA 5GISH 1BF2A 1MFDH 3PJSA 2C4XA 3G6JB 4KUCD 2AK4D 1Q94A 2D4DA 4HHAB 4O2CA 5ECJE 2F5AH 2F19L 3VXRA 1JTTA 1YEKH 5F7EH 5SV3A 3PGDA 2DQCH 3D9AH 4M6AA 4WI3A 4QHNA 1V3JA 4TOYH 1PYWB 5I74B 3QHZH 5TFSH 3U9UB 2QR0B 4ELMA 5D7IA 5HYJA 1N7MH 4L9LA 3VRIA 5GS3A 3MSPA 4FABL 3TZVD 5DYOA 1VKXB 4M62L 4FFWC 2Y5TA 2DDQL 3GBML 4TRPL 1AY1H 5CP7B 4APQD 4YR6A 4QTIH 5EBMB 4LFHG 3B9KD 3ILQC 2J88H 5CJXA 3KLSA 2GSGA 3H3BC 2YMXL 4FFZL 5D4QA 4N0UE 4GG6B 3UXFA 1A7QL 1NBVL 3BDXA 3Q1SL 2DOCA 4DOHE 1EVUA 3M1BB 1PLGH 1KELH 5E2WL 3VXPA 3VA2C 5E6IA 1CL7L 5MEQB 3RAJH 4TNVK 5LQBH 4X5LA 1KXVC 3H2WA 4EKXA 5BXFB 4YQXL 4YFEA 1KIQA 1NMCC 5JW4Q 3VXUA 3CXHK 2ZJSL 3EYUL 2FX7L 1A3RL 1U91A 4QF1B 3ARFB 3RHWF 1KBGH 3P4OB 2ESVD 2D4FA 1EERB 3GSWB 1U8PA 2R2EB 2NZIA 2VLKB 1CE1H 1JHKL 4PRPD 4QYOA 2VR9A 4PGZA 3LS4L 1TZHA 3PQYD 1DDHB 4BH7B 3V0VB 5CUSH 3MLYH 4X4YA 3I6GA 4F3FB 3T1FA 5H94B 1T1ZA 1F6FB 1FNSH 1T22A 4L8BB 2CDFA 4CMHB 2HFEB 3PIQB 4GW4A 4Q97A 1Q0XL 2DQFA 2GTZA 4QY8A 1BBDH 3BJ91 4C56A 1C12A 3DX9A 1OPGL 4XCCH 4QNPF 5DI8B 5FYKU 4I0PD 4YXHL 5F7FA 1TCRA 1DN2A 3BHBA 3LKNA 2BVPB 4YDIH 4BSVB 2JF1A 4PBXA 2MFNA 1FVEB 3RVTD 5IBLD 5FUCC 4ERSH 2BOBA 3MRIA 1YN7A 3BIAX 3LHPH 4OLXL 5F8RC 5I8OH 1UB6B 4LSTL 1YY9D 5GJTH 1OAYL 3U36A 2PYFB 4H5SA 4YHYC 5DFVD 4QO1A 2FRGP 5T3ZE 4J3VA 3D3VE 4PJFA 3QUXD 1WTGT 3HZMA 5MP6L 2CDGA 4C55A 3CZFB 3EFDH 3PL6C 2Z0BA 2XTJB 4GXVL 3D0LB 4KDTA 4I18B 4AEIH 2J5LB 2B39A 4NQDB 5IEHA 3DUSA 2EYTB 3MJ9H 1H5BA 4NQXB 1D9KB 2NXZB 4XC3H 4NPYA 4PP2B 4D9RD 3O8XD 4I77L 4P5KA 3QCUH 3RGVD 2WBJB 3VXRD 4PR5A 3LS5H 1N59B 4ZS7H 1NPUA 1UWGL 5L2KB 4OKVB 2VDOH 1G7LA 2FH6A 3ULUC 4OM1L 3RDTC 4K7PX 3I6KB 1S7RB 3NN8B 4Z9KB 3GI8L 1TQCB 3UBXG 4AYFA 1G84A 2AK1H 4WUUE 3RFZC 3MV8E 3VGAB 2XZCL 2HFFA 1GH7A 1NCAL 4LBEA 2Q3AA 4FHBD 1MJUH 3ESUF 4JO1H 5CBEA 3LEYL 4YGAB 3JTTA 2RFXA 2YD2A 1OB1A 1MFBH 5FA4A 4TTGA 1OAXH 4H20L 3CZJA 5IK3A 3SBWC 1BX2A 2GK0A 1KJVB 5EO0B 4GKNA 1M71A 2GITA 5I8EB 3QG7H 3STZB 3ZE0F 4JHBA 3JV6A 4XCFL 5TF0A 2AXGA 1OD7A 3MJ8A 4Y16C 1SYVB 3BW9A 3MUGB 3P0YL 5E6ID 5B38A 2Q86A 4E42A 2APVA 3KYNB 2AJ3A 1MRCH 5JPMB 4G7VH 4XP6H 2X1WL 4XP4L 4OSUH 1A14L 5I17A 1SMOA 3S37X 5EU7C 4DCQA 2NY2B 1I1FB 4P2QA 1QSFA 1S3KH 4U6HB 1MI5A 2OX5A 3CMOH 3E3QE 5DJCA 2B2XL 1JPSH 2H6PA 1VPOH 3RP1A 4PUBH 2XZZA 2OL3B 4MA7L 5GSRB 5DXWA 1GZPB 4N8CL 3LPWA 3SKJH 1FZOA 5F44A 5HHXH 1SJHB 4L1DA 1XF4A 1N64H 3GM0A 1RJLA 3ZT7A 3WXVL 1CR9H 2DQIL 3RWGA 4C56D 3U7YL 2R0WH 4KXZI 3KR3L 4K9EC 5D2LF 1G7IA 3MA9H 1WBYA 4KKBD 2A74A 4W68A 5EIIB 3TPUB 1A64A 4FQIL 4OZFA 2DLTA 4L5FL 3HRZA 2P5EA 1WIUA 2GKIA 5IW1A 4LNRA 4AL8H 4Z76A 4UQ3B 2NLJA 4NQCA 3D18A 3PP3H 4PJ5A 4YDKH 4NGHL 4UDTA 5CJQH 5CHNA 5HYSB 5E9DA 3HG1A 1RV6X 1TJHL 3VGDA 4XMKL 2BC4B 1N0LA 3DIFB 4HPOH 4QRPB 5KVEL 4XNZB 5GS1A 2VLRA 3FO2A 4KU1A 1DEDA 1V05A 2GY5A 3JV4B 4FQHA 2WINA 1Y0LA 5CIPA 3C5JA 3VXQB 1A4JB 5EOCL 1EJOL 4LP5A 1S7WB 2BRRL 4Y2DA 3UTTB 1MAMH 3KYOB 4U0QB 1JGDB 1DBAH 2P24B 3PGFH 5F9DC 2WSKA 4L4VE 3DTXA 2GTWB 2XQBH 1OP3H 5A3IC 3VWJB 3V8OA 4PGDB 4M93B 5J6HB 3UJTL 1L6ZA 1QNZH 1SJXA 3E8UH 1YYML 3MLSH 4X6BB 2EEDA 3O45B 1F90L 3MUJA 1UM6H 5FM8A 5ERWA 3KDMA 1ULVA 4TNWK 3S6CA 4KMQA 4XTRD 1AQKL 4NO3B 5CJOH 2VZ1A 5IBUB 5CZXC 1QSEB 4P59L 2Y07H 2X89A 5H2BA 4ZS6C 1IGML 2A0LD 3MRLA 2QQNH 4XNXH 3BUYA 5D2LA 4HWZA 2F58L 4PJEF 5F9OL 3Q5TA 3SE4C 5CP3A 3WN5A 4ESKA 5E5UB 1JF1A 1HWGB 1YNTB 5KW9L 5C9JA 4PJBE 5I1GH 4F15C 5IJVB 5IWLC 5FUCE 3RWCA 2CH8A 1BVKB 1QQDA 5ISZB 4WI6A 1KPVB 3KYAA 4V1DE 5JHLH 32C2B 3O9WC 2RCSH 5C8JB 3C09C 1PG7W 5SWSE 4OZIB 2CKNA 3T65B 3ZKQD 1U58A 3GSVB 4NKDB 3RZCB 4PJ9C 5DT1L 3BUTA 4UQ2B 4L8SC 4O2FB 3TFKC 2W65B 4P2QD 1NBZB 1QSFD 4NOBA 3QDGE 1MI5D 1R3HA 1FL3A 2EEAA 4ZSOA 5D93B 2IADA 2OTWA 4RAUA 3KJ4B 2MOVA 4QRTA 2YEZB 1JMXA 2KZ1B 1I3RA 1LP9F 4JO3H 4U7MA 1KJ2H 3ULVF 1HIMH 3BEWB 4XCEA 1CE6B 2FO1A 4LCCB 3TT1L 2A38A 2EYSA 2L7JA 4BZYA 1V8HA 3WKML 3NCCB 4OBSA 4DKFL 1TVDA 1I9IH 1A6TA 2VDLH 3MV9E 3ULUE 4QLRA 3IDUA 3BMWA 1B4JH 2CK0H 2LU7A 5BZWA 3NBNA 1HSBA 4WU5A 2W0PA 4OFYA 4IOFD 4WNQA 2BOCA 1FN4B 4GOSA 1CICC 4O02H 5D5ME 3G04B 5EUOF 4NQCD 3GJFA 1H15A 4MD0A 5DMGD 3T2PA 5F9WB 4PJ5D 4F7CB 5K33A 5A1AA 1BFOA 4N0YL 5EPMA 3NCBB 3WKNA 3X11B 1F4WH 2X44D 1FVCA 3HG1D 4PJEA 4ZUUA 4G43A 3CVIH 1OARH 5HYEA 5IV2A 5DQ9A 1YPZE 3FN0H 4JFDE 4LPVA 3K80A 2VLRD 4DZ8A 4XBPA 3UBXI 1A4KB 4UIKL 4OGXL 1GC1H 2F53E 4HEPG 4DUWA 3EAKA 3JWDL 4DZBA 1WZLA 1XGUB 4FMKA 2ZCLL 2B0SL 4WU7B 1GGTA 4FFYL 2H26A 3MGAA 4MJID 4U1NB 4LVOC 5I18H 3KPRD 4PGBB 5EU7E 4NHUB 4MD5A 3CDGB 3MV01 3EO1B 4G80B 2V5YA 3MREB 2XN9D 3ARTA 4JKPL 4P46A 3MRMA 5FYJL 4C4KT 5EU6B 4ODVL 12E8L 2YD9A 5JNYA 2KL6A 5KG9B 3H42H 1JBJA 2BSRA 1NC4A 3MFFA 3RWIA 2IAMA 1RZ7L 4S10A 1LP9A 5ALCL 4JPVH 1RIVH 1UCBL 1JWUB 3B8YA 1R3LA 1MCOL 4YGVA 2X89D 1HHHA 2R39A 2UY6A 4PB0H 2EIBA 1CIUA 3CFCH 4X9FA 1ADQH 3QWOB 2GHWB 3K4DA 1HH6A 1QFOA 1RI8A 5HGHB 3GGWA 5KTEH 3UROR 2H8PB 3IGAB 3WCYA 1FZJA 1P9MA 1H3XA 1W0WA 4PYHA 1J0JA 2OTPA 4HXBH 3K7UA 4Q0XH 4WJ5A 2AKRA 4AENA 3WFBL 5ETUA 3ZE2F 1F11A 3UTPE 3TO4C 2VQTA 3SCMB 3IKCA 3PABA 1JWMB 3GSXB 4MJ6B 4NRXB 5ICXB 2XG4A 5DQJB 1ZANH 4QRSA 3P4NB 2PN5A 4LCWA 1ZGLP 4M9OA 1DFBL 2X5PA 5IFHL 5JA9A 2LVCA 3O6KH 4BH8A 1XCTA 4E41E 3CFEA 3N85L 4MHHI 5EUKA 3QXVA 1RZ8A 2R29L 1LO2L 2XWBA 2BVOA 1EX0A 1CWVA 3DROA 3VRJB 2FWOB 1IQWH 5DJAB 3NIGF 1IEAA 1Q9WB 1QFWM 3BJLA 1I1YA 3H7LA 5E6ZA 3U30B 5ELIA 5BCAA 5CSGA 5EWIH 1UENA 4HGWA 1FL5B 5TQ2L 1F8TL 4G3YH 4JM2B 1AGCB 1NGWA 5I71B 1II4E 1TLKA 4N5UA 3FOLA 4ZODA 3L9RA 3QDAA 5GIRA 1XCQB 3FZUC 1I8KB 3F12B 1XEDA 4NO5A 3ROOB 3UZVB 5KSAC 3P11H 1R3KB 1FORH 5KSBF 5C0DA 2Y36L 3TM6A 1KN4H 5BZDB 1EHLH 3P77A 3V0WH 3ARBC 3IU4L 3QDME 3QUKB 4BFIA 4BKLA 4PV8A 1UKTA 5GS0H 4DWHA 1EHAA 4WFGE 3RBSA 2CR3A 4PG2A 4WO4B 5L8JB 2IQAB 2F9BT 3S88L 2EC8A 3RTQB 1WVZA 2ERJC 3DMMB 2JB5L 5MHSE 4ZFFB 4I1NB 4Q6YA 5IHUL 2EE9A 5E8DH 1CS6A 5BRZA 2R4RL 4GAYB 4IRJB 4EVNA 5A16A 4X4ME 3EYVB 3QUYA 4YPGB 4ZOEA 4ENEC 1O7VA 4X7SH 3GIZH 1K8IA 3FQWA 3R0NA 2AJSL 4RWYL 4BQ8A 1HQRB 3TA3B 8FABA 4K3JH 1WAAF 2V17L 2D7QA 1D5BB 4I0KA 4JDZB 1MQKH 5F7DB 4TNWF 1P6AB 4K23L 3IFNH 4XWGH 5CLWA 4NC1C 3MBEA 1NGXA 4Y0GA 2VITB 1JYVA 3RIAK 1YEFL 5IB5B 4CKVX 2NX5B 5J11B 1IKFL 3UTQA 4U1SA 3L1OL 1N5YL 3MOAL 4P9HH 5TPWH 5I74C 1NC4D 1A1NA 2IAMD 2V7NA 4X80L 1MPAL 5DA0B 1ND0A 1N2RA 2DYPB 3BOVA 1LE5A 1KUMA 2HJKB 5F7WC 1D6EB 1MHPL 3LKRA 1U0QA 3MLZL 4XC1H 5FCSH 5HJ3B 1UH2A 4AH2A 2XV6B 4GW1B 2B7DT 4O00A 1VA9A 1K6QH 2WP3O 1C16A 2RAMA 2EH7L 3IT8D 3ARGA 2VDPL 1CGUA 5KSBA 1CFSB 4D9QE 1C5BL 4XX1E 1EXUB 2UWEB 3TF7C 1IC1A 4WW2B 2DQJH 3C2AL 5DVKA 4L3EA 4R96B 5TE6H 1DEEB 1JNLH 1HI6B 2QV2A 1R6VA 2AXHA 2EDLA 4XPGH 2YPLB 5CLTA 1FZMB 3ISWA 2A9NH 3O4LA 4LCWD 3DWTA 4X6DF 4HUUB 2VXUL 2YS4A 3NABL 2O5YL 4R90H 4U1IB 3SPVB 5IB3B 3ULVL 4MWFA 1P4LB 3ILPB 3ARFC 4Q9RH 5F6HJ 4OV5B 1INEL 4GRWE 4YDVB 3C5ZC 4RNRA 2Z92B 1VFAB 5HPMB 1FFQA 1HHIA 2NY3B 2MQ3A 1AO7B 1WAAA 3HZVA 2NYYD 2VE6A 4K94L 2R0LL 3MRCB 1QKZL 2DBLL 1MUJA 5E5RB 5EN2A 5FEBA 1E0OB 4QXGH 3VG9B 4DKAA 1BM3H 1A3LH 1V7ML 1CGWA 1EHXA 4FQJL 3UC0H 3RWHB 3FFCD 4AM0B 5IW6B 1FHGA 1KG0A 1Z9LA 3UO1H 4P3WA 2HMID 2M1KA 4DVRH 3C6LA 4YHLH 1F00I 5IQ9B 3CX5K 4OFKA 1NMBL 3KHQA 4YHML 3LB6D 3W0WE 1CLCA 4ORGA 2DQEL 5I2IB 3WFEH 3HUJB 5GGSA 1FQ9C 3SHSA 1TVBA 3HFML 3WS3A 4U2YA 3AU1A 2A9MH 2JJSC 4PJCB 3UAJC 3FRPG 5DK0B 4M7LH 3L95B 4JB9L 1MCIA 5B22A 2ZG3A 3CSYB 2HLFC 1XIWC 2XTJC 1CD1B 4I18C 1T7XA 3V6OC 4OF3A 1P1ZB 2R1XB 5F9JB 3V8CA 3CSPA 5LBSL 5C0AD 2Q87A 4D0CA 4GMSH 3JWNC 3QEGL 4X6DA 1D9KC 2NXZC 3LEVH 4A6YH 2OBGA 2DQHH 4HXAH 4F57L 3BZEB 1NFDA 3EJZD 2D7TL 4MAYA 3U0WH 3EDDA 3CU1A 3WFCH 2OTUA 2X7LB 3OV6A 1MCPL 3G9VA 1S5HB 2Y9RT 3LEXB 1TQCC 1OP3K 4K8RD 4D9LH 1FLRL 3U48A 4HIJA 3DX8A 4ZPTA 2AEIT 3AS1A 4OI8A 4LSVH 3UJJH 1CDYA 1FCGA 4YHPA 1C08B 5AG9A 1DBJL 1JFQL 1OY3B 3QIWB 1T20B 4K55A 4FQ1L 4PTUA 4UV4H 3IU3A 3ZKNC 3ARGD 4LAQH 5DC9B 4XPHL 1DSFH 3SOBL 5L8KB 4I2XB 1Z3GL 2DWDA 2NY1D 3DX6B 2G2RA 5DURB 3HZYB 2UVFA 3T77A 3MGOB 1AP2B 1CFQA 3MMEA 1S7XA 3TYFB 1NCUA 1WZ1H 4M1CD 3WO4B 4DGVH 4FZ8H 3KPSE 5EZLA 1KTDA 2O5XL 3O4LD 3QSKB 3QQ4A 4URTB 4KZDL 2HT3D 1N0XL 1IGFL 3FQNB 3FQRA 3BKML 3TJEL 2H45A 4RQQA 1HXMB 5CKAA 2NY2C 3FRUB 2P8PA 5DJ6A 3MNZB 3HMXA 3SGJA 1QOKA 4I5BB 1NDMA 4G8GA 3GMNA 4PS4H 1U8MB 4OZGF 1YMHA 2ZNWA 3V52L 3CK0L 5D72L 1HINH 3RJDA 3G6JE 3V5DA 2OI9B 5KVGL 4NC1E 4QOKA 3WL9A 2XACC 4XZUA 4NKQB 2AV7A 5DJDA 1AGBB 1EFXA 3VRLE 1IMHC 1FFNA 4GFTB 5BV7L 1XZ0B 1T3FA 3LKSB 4ZXBA 3OKYA 3HC3H 5TDNA 2ITDA 1HQ4B 4R3SB 1C7TA 2G5BB 4N9GB 1WFTA 1E27B 5GRJL 3PNWB 1HKFA 5EOTB 4BQ9A 1D3CA 3MRQA 2EDNA 1JK8A 3DI2B 3K2UH 1DJSA 2WM0A 4K7PL 2X4RB 5DHYA 4NO0B 1Q72L 3IYLW 1NBQA 1WJ3A 2HT4C 5F71A 1U8HB 3Q48A 3P9LA 5TDOA 5EZOL 1GGBH 4AG4H 4XWOC 3LH2L 1FPTL 3NVQA 5EIVA 3LMJL 5J3HD 1UB5B 3QPQC 3EYQD 2Z91B 4P57B 3CVHB 2VL5B 3F7YA 3EDEA 1M7DA 1MHHB 4HZLA 4Z95L 5JW5A 3I85A 1W0YT 3B3IA 4XAWH 2DD8H 4JY6A 3BPNC 4K7FB 1CL7I 2A6JA 5ID0B 5IVZA 4IOSD 4WI9A 2AV1B 3TWCL 4MAYD 4FG6C 2VLKE 3I3BA 4N0FA 4OZGA 5I1IH 1DBBL 4X6CF 1KCUL 1MCKA 3NIFE 4L3CA 2MNUA 1N6QH 4R97B 1DUZB 4APQB 1FH5H 3HI1A 5C0EB 3QQ9C 5DD6B 2NZ9D 4B53A 4M48H 3MO1B 1AD9A 4F33B 2AJXH 3KG5A 4JZNB 5LXGL 2Y7QB 1N5AA 4G6KH 4A2LA 1U8JA 4MNGA 1MY5A 2HTLD 3RZWA 1VADA 4M6NL 5LJYH 1H8NA 1CXIA 1VGEH 5JPNB 3GSQA 3QEQA 3MACL 3L3DB 4NHCH 3RPIB 4H26B 4X0KA 1G7MA 3OKEA 3PHQA 4Y19D 3ZMRA 3F7VB 4OLYH 5FGCB 1GIGH 2CIKB 5KSUB 4ALAL 1IKNA 3RZCC 1S9VA 3VH8B 4AK1A 4CU6A 1I3UA 3TBSA 3QO1A 3PQYB 2XTJE 2VZVA 5GGVH 2VWEC 3DGGB 4KQ3L 3FT2B 3HB3D 1NMAL 3ARUA 1Z0MA 4Q58C 1VFMA 3MJ9A 4P4KD 4BA8A 3NFPB 1ZEAH 1QLEH 3VFSB 1RHHB 2DWEB 3CC5A 4QOKD 5GGRB 2AJUL 3BP6A 1MCJA 2E7HA 1CFVH 1IZKA 4G6AC 3LRSB 2VN4A 3L3HB 3MLXH 4J7RA 2W1NA 4CN1A 5L2KE 2FIKB 4ZAKC 5F7NC 4X6CA 2PR4H 2MWCA 1MCEA 3HC4L 2C4FU 3V5HA 4D94A 3HE6A 4QXTA 1E4KA 1LO0H 1ZHNB 3HMXL 1KEGH 2IQ9H 1WT5A 1UJTA 1NJ9A 2BJMH 5HI5C 3MV11 3HKFA 3RNKA 3T8XB 4LDOB 3K0WA 2Q7YB 4G9FA 4M61A 3UJIH 1IVLA 5GISL 3DXAD 1HNGA 5ANMB 3IDMA 2BERA 4OZFG 1MFDL 4UILH 5DZLA 4F9LA 2FATH 3Q2CA 3IDJB 4Z7UF 4KJPD 4EUPH 2F5AL 2P5WD 3LKQA 1YUHA 3PWVA 4MZ3A 3O8XB 1YEKL 5F7EL 3DO3A 1YDPB 1P84J 2DQCL 3D9AL 3RGVB 3VW3H 5HDBF 3P0GB 1MREH 4TOYL 5JOPD 3ROLB 3ZDZE 5TFSL 3QHZL 2HFGH 2FJHB 1N7ML 5K9OA 3EO9H 5MI0B 4ELKB 1OSPH 1JV5B 4AEFA 4HS6A 4BSWB 2ED9A 5DGQA 1KGCE 1B90A 1X5LA 3BDYH 3LV3B 4RSVA 1AY1L 1MCSA 4QTIL 5IMKA 3WIFA 1H3GA 1UXSA 1K4CA 2J88L 5MEOB 3DVNB 4NM4H 1X3DA 4UDUA 3VXMB 5J8OA 1BZ9A 3RBGA 3DARA 1U8IA 5FYLD 5D7LD 1X5KA 2AXJA 3PDOB 3RL1A 4POUB 2VLLA 4YC2B 1DQMH 4CAGA 1PLGL 2VXSH 1KELL 1DP0A 5T3ZH 4OCSH 1CCZA 3RAJL 5LQBL 5A2IH 4F7PB 3FB8B 4UU9B 4ZOCA 5T5NF 1UG9A 3Q3GB 1OTUD 4JFHD 3QQNA 3T08A 5IBUG 4WWKA 3SCMC 4CDGC 2WUBH 4HKJB 3LQMA 4MX7B 3HE7B 3QEQD 1KBGL 1ZHBB 1BWMA 1OOAA 2BY2A 3EOTH 5FDWB 2D03H 3C6SB 4W4OA 3GSUB 1CE1L 4QRPE 3BIKB 2G9HB 5SWZD 4LRNH 3IFOA 5CUSL 2X09A 3MLYL 3VE0A 1EGJH 3BN9D 1WBZA 1QP1A 1BFVH 4O51B 4Z7UA 5DRXB 1FNSL 3K46A 4AQOA 1FG2A 1BBDL 3ZYZA 3UTTE 1FL6B 3U30C 3M17A 2EECA 1FDLH 1XR9A 4HUWB 4ONGL 4ZQKB 2X4PA 3AXLA 4PJGB 1VERA 4PLNC 25C8H 4QHLA 1A1MA 2GYSA 2HKFH 3G5VB 5I71C 2Z93A 1J8HB 5F1IA 3MRNA 1UZ6E 5DRWA 2AQ3A 4N5ED 3CPLB 4ZPVA 4H1LH 4ERSL 1UWEH 3Q6FB 3LHPL 5I8OL 4ISVA 4O5LH 2HVKB 4TUOA 2WLYA 4F7TB 1AGDA 1OM3H 5GJTL 4U1GB 1UXWA 4C83A 2YD1A 1OGAE 5DEFA 1QSEE 5KBNC 3QEUA 3HE6D 3RPKA 2AJVL 2WBWB 2W0KA 5L9DH 5D1ZB 2BK8A 5C0GA 3CDFA 4KAQH 5FB8A 5E2TH 5IVNA 5E70A 5CEYA 1SVCP 3N50A 3EFDL 2DI7A 4WO4C 4PD4J 1MLBA 4AEIL 1BVZA 5IIEA 2HLAB 4UOJA 4PLJC 5J13B 3DV6B 3MJ9L 5ENWA 1B0RB 4ZNEA 1T5WB 4XC3L 1MNUH 2GUOA 5J9PB 5FYKE 4HDIA 4WV1B 1P6FA 4JRXA 2JCCF 1VACB 1YMMA 1I7ZB 5ISZE 1J11A 3LS5L 4ZS7L 1SYSA 3IF1B 5E8PA 1OAKH 4KRNA 4PJAB 5BVPH 2VDOL 3TA3C 3U46B 4OZIE 4OGAD 4DQOH 1KB9K 3VD3A 4Y5VA 3QI9B 1RVFH 3T09A 5EZJB 5SWQA 3MPCA 2X05A 4LVEA 4YEFA 2PXYA 3BWAB 5K59E 2ARJB 5JW3H 2VWEE 4G42B 4GKOA 1AIFA 1FBIH 1MJUL 5J11C 1QR4A 5JOFB 4JO1L 2BMKA 5CAYB 3TIEB 2FL5A 4HCRH 1MFBL 1KIPB 5F89B 2P4AB 1OAXL 3LZFH 4NQSA 3FN3A 3OAUH 5J7CC 3QG7L 5JMOC 1QLFA 1KJ2B 3B6SA 4GW5A 5I1KH 1MIEL 5AAMA 3V6FA 4M43L 1ED3A 5MERB 3VG0H 5ESVA 4P5TA 3MJ8B 1MRCL 4MA1C 4G7VL 3CMGA 5B38B 4XP6L 4MJ4A 4OSUL 4R4FH 4JQVC 1T21B 5DJYB 1NGYA 2YPKB 2VLMD 4PJXF 2AAVA 1P5UA 1UJ3B 1CVRA 3VFUA 1S3KL 1BD2D 4J8RA 3CMOL 2I07A 1JPSL 1VPOL 4FQPA 4PUBL 3S5LB 4S2SA 4GKSA 3RY5A 3MRFA 1AXTH 1T66D 1UKSA 1G7JB 3SKJL 1HH9A 4LCIH 2NMSA 2VB5A 4PJ7F 2PW2B 5HHXL 1N64L 5FK9B 4ORZC 2JCCA 2P48B 1TQBB 4NNXB 5GRXG 1CR9L 1ZSDB 4KKLD 1KN2H 2R0WL 1I8IB 3OKLB 3MA9L 3LY6A 3MRDB 5J1AB 5I66A 2NY3C 2WNGA 1BVLB 3OKNA 4PLKC 3B9AA 2R2HA 1T4KA 3FHQA 3GSRB 2UZYB 4AL8L 1M1SA 1L6XA 3TH4T 1MJJA 2Q7NA 4X6EA 3I2CH 4TVSa 3RKPA 4YDKL 5TF1H 1FJ1B 4L4TA 1URLA 2PYED 1CXKA 3FO1A 5CJQL 4YJZL 4NQEB 4YXLL 1NDGA 3BZFB 3TYGH 1J0HA 5E1AB 1CG9B 3H9SE 4UDTB 4HPOL 5IFJA 5I1AA 4LVNC 3QIBB 4GRLA 4R4BB 4AIXA 3A6OA 4B50A 3ESVF 1F58H 1MJ8H 5CKGA 1ZT1A 1D5ZB 4Z7NF 2VLRB 3FO2B 4IIQA 4HIEA 1ADQA 1QA9B 1EEQA 2ADIB 1G9MC 2VQ1A 5DUPH 4LLDB 2FYYA 1UVQA 3L7FA 4Y5YC 2IC2A 1Q1JH 5DUBB 3GDBA 1MAML 4PTTB 4NFCA 1DBAL 1BQHA 3PGFL 4JLRA 4X6FB 1AI1H 2XQBL 1QZ1A 3DO7A 1MWAH 2XKSA 5CS7A 4CBPA 3QNYB 3PWPA 4MCYA 4I4WA 4PJXA 4JRXD 4MJIB 5C0RH 1QNZL 3DI3B 5C0CA 3E8UL 3G5XB 1LNUB 1KNOA 3KPRB 2X4TA 5B8CB 1JZ2A 5FO8A 4C4KO 4ZO8A 4UUJA 3MLSL 5I16A 1DQDH 3O41B 2XN9B 1A6UH 3PWLB 3BGMB 5DD5H 3HPJA 2F8VA 4YK4C 2GT9A 4P4RA 4PJ7A 5CJOL 3ULUH 3QG6B 2AXFB 2PXYD 5IKCA 4R4ND 3TVMB 1RK0B 2QQNL 1D5XB 4XNXL 1JPFA 5CGYC 5FIEA 5D6DA 1EAPB 2DS4A 3KXFB 3MOBH 4KKAC 2ADGA 3BPOC 2R56H 2X1OA 2BP3A 1X5GA 1ETZA 3ZDXF 4HUKB 5I1GL 2N7AA 1F3JB 4Y4KD 2FJFA 5BMFH 4LGRB 4U3XA 5JHLL 2VLJA 4JFQB 3GMQB 3MLVH 3OKOA 5FKPB 5IEKB 3ZKSD 1GSMA 3PP4H 5CCKH 3GKWH 3QNXB 3KNBA 3WO4C 4KI5D 3C9NA 4GO6B 3GMPA 3VI4F 1KULA 3T2QA 1S7TA 3VMOA 4OJFH 2ZUTA 1LILA 3K1KC 1EMTL 1E28B 3L5WB 3QUMB 3BKCH 2Q20A 1CZ8H 4JO3L 2IADB 3T3PE 1KJ2L 2OTWB 5EOCJ 1HIML 3GO1H 5F6HI 3LSOB 2GEEA 4XT1C 3GJEB 4MVBC 4X5WA 5HSFA 3CCHA 5HI4C 1I9IL 1YNLH 2VDLL 5FV1L 4ZTPH 4L8CB 3HAEB 3FCTB 1B4JL 5I1HH 4N90E 1QTYT 5GGQH 3KYMB 2OI9C 2CLZA 1RK1A 3R0MA 2DIBA 1LWRA 5JHDD 1N3NA 4O02L 2GAZA 1LK3H 4MLIA 2HWZH 5DJ2A 2Z35A 2NX5E 5FA3A 4HJ0D 4N8VA 5E8NB 1F4WL 4PP1C 3WLWD 2C3XA 5DMIH 4YHIB 5DRNA 5CJ5A 5JW4M 4D2NA 3FN0L 4YHZH 5KS9F 4GRLD 1NUFA 4EJ1C 5B3NA 3I6LE 1GC1L 4OZ4B 1U8LA 2OP4H 2F5BH 2MPAH 1ZLVH 2XWJA 5E95B 4NO2A 5TQ0H 2BY3A 1EPFA 2Z8WC 4JQXA 1MHEB 2XPGA 1LD9B 4JFFA 2ORBL 2UWEE 4MA8H 3QULA 4IDLA 5ILTL 2EKSB 2SEBA 5I18L 1HSAB 1HKLH 4QRUA 5JIHA 3ARXA 1D5MB 1VGKB 5C0CD 4Q6IA 2YPLE 3NZHH 3H3PH 4IRSD 4XH2A 3SY0A 4LQFH 3KS0H 3U1SH 3QWRD 2DQDH 2W07A 1BOYA 4C54A 3O2VH 4ZUWB 4N1EA 1H3PH 1CXLA 4JPVL 1RIVL 2KKQA 3DBXA 1FYTD 3JTSA 4PJ9D 3FB7A 5HHOD 4PB0L 1SY6H 5D1XA 5A2JH 1JI1A 1ADQL 5EBWB 3TZVC 4JFXA 1R3LB 2ZWLT 5KTEL 1AO7E 4IS6A 4R97C 4HXBL 4Q0XL 4WDIA 4APQC 1IGTA 2W92A 3B9KC 2KPNA 4MXWH 5DSCA 1TETH 2W0FA 1LEKB 1S9XB 2X40A 4GG8A 5C86A 3QNZA 3OXSA 4WJ5B 2BNQA 1SM3H 3CFJA 4P49A 1ZS8A 3F62A 4CADB 2NPLX 2F54D 3PABB 3TBVA 3J7HA 7FABH 1ZANL 4Y5XB 5CJ8A 1IGJA 3CXDH 3RWDA 5D7JB 1EEZA 1YA5A 4WENB 4Y4HD 1AGEA 1XR8A 3O6KL 1B6DA 5KS9A 1MHCB 1WUNT 4JJHA 3BYYA 2WZPD 3T1WA 1KC5H 4M02A 1MCWM 5GS0D 4LU5H 4LASH 3NTCL 2X4NA 1IQWL 1U8OB 3HUJE 4MB4A 3MYJB 2GCYA 5FXCH 3EZJB 4L8DB 4WFHD 1QVOB 1Q9KB 4PJCE 5JOEA 2HYMA 5EWIL 2G60H 1IEAB 4G3YL 1U8QA 4OCRL 3MRPA 4JG1H 4EDWH 3BKJH 5J1TC 4JGUA 1CGXA 1J7VR 4U1JB 1VEPA 5JW4R 5FOBA 3P11L 1CTOA 1FORL 4KFZC 4EXKA 4G8IB 4Z7OE 4I48B 2YOCA 3MNVB 1JNNH 1FLTX 1KN4L 1EHLL 4A6YA 2FEEI 3AREA 3WIIH 1EDQA 3V0WL 3CFDB 4JRYE 3L3KB 4LLUA 2X4UA 3FFCB 4I0PC 5GS0L 4GMTH 2IAND 5C0BA 1C1EH 5FGBC 1XF2A 3V4UH 2J6EH 1HXYA 3CLFH 1RZIA 4PRIA 3RWFB 1PBYA 5JA8B 1JN6A 3RVTC 5IBLC 1QG3A 2YUXA 2HH0H 4F2MB 3W9DB 4N8PA 3CFBA 2F19H 4KDVA 1QUNA 4RFNB 2R2BA 1YY9C 4ZO7A 5E7FA 5DFVC 1J0KA 3WJJA 3WJLC 5IHLB 4WUKH 5BW7A 3BP4A 4NM8L 3QUXC 5LG1A 1EO7A 1WSST 1QBAA 3GIZL 4X7SL 1KB5H 4OF6A 3FFDB 5CMAA 1K5NA 1TZIA 1S7VB 5INDA 4AQ1B 4K3JL 2D31A 3H9HA 4I2XE 4JFFD 4M62H 2APWA 4PV9B 1VEMA 4GRWH 1MQKL 1K8IB 2NY7H 4XWGL 3DVGB 3GBMH 5D1QA 5A2LH 1HHKB 2CIIA 5C0AB 4HKXB 3QFJB 1GZQB 4AT6B 4HWNA 4FXKA 3O8XC 4H88H 1CDUA 3KPOB 2QSQA 1A7QH 1ZLWH 5AUMB 3RGVC 4EN3D 4P9HL 4LGPB 3HNTH 5TPWL 4LLYB 3BQUB 1IILE 3VXSD 5ADPH 4NRZB 5MI0C 1T0NA 1QD0A 2QEJA 1YC8A 3CJJA 1PZ5A 3O11A 2BNRD 3U4BL 3U4EB 5E8EA 2VABA 1NANI 2V7NB 4AY0A 4ONHB 4XC1L 4M8QA 5D1XD 4MSWA 1ZA3A 1K6QL 3HR5B 1A7RL 2V2TA 3EYUH 3WLBA 2Z4QA 3UYRH 4PJHE 1PX4A 4YNYB 1KLUB 1KT2A 1RURH 4OLEA 2DQJL 1JHKH 5F7LB 5TE6L 1F6AB 4FTVD 4X4XA 1JNLL 2NY1B 5MENE 1I3VA 2IEPA 4XPGL 3RY6C 4AEEA 1CGVA 2A9NL 2VAAA 3E6HB 3TN0A 1AH1A 5E6IC 1DANU 1KPRA 1R3JA 2ATPB 5D2NA 3VFTA 4WEBH 4R90L 4P3DA 4QTHB 3KYKH 5DRZA 4W6WB 4PRAB 2X41A 2EDYA 2VISB 5K9KA 4Q9RL 3WDJA 1IAKB 1EV2E 2E7LA 1KLGA 1T6VN 4MNQA 4XNMB 2OJEB 5D9SA 2UYLB 3DRQA 1T7WA 1WWAX 4PGCA 3KLDA 4K3HA 1JMZA 2NXYB 3E0GA 5IMMA 4UT9H 1I1AA 1J18A 2PO6A 4F9PC 3OX8A 4KKCD 3BRDA 1PGRB 4QXGL 5DS8A 1FO0B 3D6GA 1CT8B 3BPLC 2QTEA 3HZVB 4ZUTB 2AK4E 4D0DB 1BM3L 1A3LL 4FQXA 2YRZA 4OF8A 4Y88A 1PG7H 2FSEA 1JZ7A 1YEDA 1ZVYA 4GKZB 4LKCB 5EG6C 3MYZA 4ENED 1A6AA 1A47A 3UO1L 3I75B 4DVRL 3WHXA 4KKBC 4OD2A 5C08A 4HULB 4YHLL 5BS0B 2BDNH 1C8PA 4H25B 2Q76A 2ADJB 5JLZB 5HGGS 1P7KA 4PRID 1YEEH 3WFEL 1CFTB 2VZSA 2W60A 4NRYA 1JWSB 2MJWA 2A9ML 2V2XA 2X4QB 4M7LL 1R0AH 3D39A 1NGQH 1UWGH 3O3UN 4FQQA 4JJ5B 4QHUB 3TEUA 2ITCB 3U6RB 3CUPB 1BLNB 1T5XB 1U8NA 4Z78B 2BHUA 1ZWIA 3L3IB 4GAGH 4GMSL 3QO0A 3LEVL 4KDTC 2QL1A 4A6YL 4ZO6A 2FJGB 2KQMA 2GJZB 2DQHL 4HXAL 1RSFA 5E2UH 5EO1B 1V5JA 3U0WL 3WFCL 2FO4A 3VGBA 4BK4A 1NFDB 5FGCE 2YPVH 3LPFA 3MLTB 3QDHA 4P5MB 1BOGB 5AAWA 3L3OA 4YBQD 4X5XB 3C8KB 4D9LL 4J4PA 5EU3A 1WIOA 3PQYE 4LSVL 3UJJL 1ITBB 4XTRC 3QCTH 1QEWA 1HEZB 2B8OT 2HRPH 1G1CA 1B6UA 1LGVA 1B88A 2A0LC 4UV4L 5IM7A 3DV4B 4LAQL 4DGYL 4RMSA 3MRHA 1DSFL 1OF2B 3UPCA 4M8VA 3EYFB 5FUZH 3D85B 2H9GA 2Z31A 3C2SA 1JHTB 2VDNH 4MA7H 4LLVB 4N8CH 1WZ1L 4DGVL 2G2RB 4FZ8L 3U9PH 1I85C 4RA0C 4ETYA 4XGZB 1UWXK 1NCNA 2V9QA 4DKEH 3W81A 3TN0D 1MH5A 1WGOA 1FZKB 3NPSB 4JGJA 4Y19B 1MCDA 1S9YA 1PEZA 1UJ3C 3FAWA 4UOW0 2XY1A 3QAZB 4MNQD 1QFPA 5AZ2H 1S78D 3REVA 5GGSY 3FOMA 5DJ6B 3G08B 4NJ9H 1HINL 1EJ6A 1I1AD 5ANME 1OT1A 1QLRB 5B4MD 4ZUVB 1PKQB 1RZKC 1J88A 1YEGH 5HHVH 1C5DA 2V5SA 5CEXA 4D9RE 4EUPA 4ONFH 1QRKA 1IL1B 3V5DB 5F96H 4ZYKB 4P4KB 1N8ZA 5KVEH 3GUTB 4FQXD 5EFIB 4YIQA 1T2XA 2J4WH 5JXEA 1JPST 3VXRE 4P2RD 4AEHH 4PY7A 3HC3L 3U4AA 1JRHI 2NQCA 2QADD 2C1PA 5J57B 1ZMYA 2IG2H 1U93B 2IH1B 3SEPA 3VDCA 4IOFC 4RAHA 3K2UL 2FZ3A 3U0TA 1PKOA 2E9JA 5DMGC 3D69A 3WHE1 4J3OC 3VXME 3S97C 3ZHKA 2VRAA 5CGTA 4AG4L 1GGBL 3O6FA 3BH8A 5EO9A 3BESR 4PG9B 5CZVL 3D39D 3AUVA 3FONA 3OL2A 3CX2A 1PQZA 3GSOA 3I02B 3L7EA 5GRZA 5JQHC 3DXAB 5GS1C 2PCPA 5T33H 3W11D 5JORB 2A6DB 3D3VA 2P5WB 4XAWL 4MA3A 5E08H 5D7KD 5I19H 2VC2H 1R5IB 4RIRA 3QHFH 3QUZA 2IPKA 5FHAH 3CH8A 1IGMH 1NLDH 5ABDE 1Q0YH 1XH3A 2F15A 4F58H 5F9OH 5CSBA 4YFLF 1J5OH 2QQLH 5B8CC 2A77L 4QWWD 5I1IL 4L9DA 4LLMA 2JJVA 1DCLA 3O3EA 1FH5L 3O2DH 5T5NG 1QHPA 1U6AH 1EGJA 4MXQD 3V6ZA 4M48L 4OLWH 2AJXL 2ZUQB 3REWA 4JZJB 2YUWA 3VWKD 4GS7B 4G6KL 5E7BA 2DBJA 1CD9B 4LIQE 5D7LB 5FO9A 4EDXA 1LDSA 2OR8A 3QEHB 4DUXA 4C56E 4PJGE 3VD7A 1EUTA 3MV8A 2CJUH 3MROA 1N5AB 4U7SA 3RRQA 4WUUB 2DL2A 2EIZB 1T2JA 2EYRB 2ZOKA 2Z31D 4Y4FA 1VGEL 2I9LB 3C5SA 1A0QH 3DSFL 1A6WH 3U2SA 4NHCL 5HHNA 4H1LA 2W9LA 3MJ6A 4OLYL 5T1LD 1GIGL 3QA3B 2D7PA 2C3VB 2P44B 5I15H 3AS0A 3SDAB 2YZ8A 5L2JA 1QFUH 3WEXA 1OAQH 4J1UB 3HPLB 1QBLH 4G8EA 4Z0BH 3MA7B 1LO5A 3OGCB 5SWZB 5CBAA 3VXNB 2FGWH 2L0DA 4QHMB 3O4OB 5GGVL 4PJFE 4HSQA 1I4FA 1FRGH 1DVFD 4MCZA 1QBMH 1ZEAL 1QLEL 2L7UA 3OKDB 5F70A 1ACYH 2OL3H 5I8CA 3BD3A 3P9MB 4XPBH 1R5WA 5CFHA 2XXCB 3MLXL 3O3AB 3KWWA 5EU4B 5LGJA 5JXED 1OT2A 5C0FB 5IMLA 2BY1A 2XTLA 1OGTA 1NEUA 3SDYH 3BD5A 1NFIB 1B9ZA 4HJGA 3TH3T 1KCSH 3UYOD 2OSLB 3HLAA 4PRHA 5CD3A 1IEHA 1KEGL 4HBCH 3N1QC 4OCMC 4JE4B 2VUYA 4GUPB 3NIDE 1IM3B 2BJML 5DA4A 1WCBB 4NKMA 4KC3B 5FO7B 2J8UA 4XXDB 4POZD 3AY4A 4PJBF 5HHPA 2BCKB 2MCG1 3UJIL 1T6WA 4HCRA 3QCVL 3WFHB 4OGYH 4PJ8A 2GQHA 4Y2OA 3O6FD 4UILL 2FATL 4ODVH 4CVWA 4I3GA 1F4XH 5D96B 2Q1EA 5ALCH