5E6IB

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
241
structure length
241
Chain Sequence
AQVTQNPRYLITVTGKELTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSLIYPGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
total genus 24
structure length 241
sequence length 241
chains with identical sequence H, L, Q
ec nomenclature
pdb deposition date 2015-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iB02
5CZXC 2CRMA 1I9RL 1MFCH 5KS9B 5GGSA 3GNMH 5AWNL 4E5XA 1UXWB 1P4IH 1QYGH 4AMKL 2Q86B 5ANMB 1NBVH 3GMQA 3P9LB 4U1LA 2A77L 2MFNA 5IB5B 3TM6A 4LCWA 2VXUH 4G7VH 2X09A 3W11C 2NY4C 3MLPA 4YX2L 2GCYA 1RZGB 4JM2F 2YEZB 4LQ1A 5JW3L 4HIIA 3WJJA 2Y36L 4N9GB 4U1IB 4XPHH 5ALBL 5LWYH 4P3DB 3RVUD 4KTEH 3WIHH 4U1NA 3DO7B 3BGMB 2F19H 3ARFC 2F58L 2GIYA 4M6ML 3VXTB 3OAUL 2IH3B 3U1SL 5DT1L 2C7UA 4GBXB 1D9KA 4Y8DC 1XGRB 4EIZC 1XF4A 3LY6A 2Q20A 1JGVH 5FHBH 1E6JH 1J11A 1E0OB 2VISA 3OPZL 1FDLL 4WU5A 3UYPA 4HUXA 1F11A 4LLMB 4P4KB 1BOGB 4J8RB 4NKDB 5BOPA 2ADGB 1H9VA 1H0DA 2K7PA 3RVVD 2FECI 3RTQA 1S7SA 2YMXH 1JWUA 5KSAD 5TDPB 1QBML 4Z7UB 2HFFB 4FQXC 1MCOL 2VLRB 2XFXB 3EDKA 4QEGA 2E6QA 3F5WA 3MV9D 4JQIH 4AEFA 1HKFA 3FRPA 1QTYT 4EI5D 4JZJA 3P73B 5D7IF 1UB6A 1JZ3A 3UXFA 4KK6D 2J3SA 3VXNB 1PLGL 4QRQB 1MRFH 4NQXB 4CAGA 1UXSA 1ZGLA 1AGFA 3V4PH 4S1RL 5DJXB 1MPAH 1HE7A 4TQEH 1N6UA 4KGJA 2I60H 3CXHK 3OBAA 1KTLA 4MJIE 5JUEL 3EGSA 1BQHA 2WQ8A 1J8HE 5HHVH 4G8IA 1R5IB 4X4YB 4JFEA 2WANA 4Q9QH 3RIAF 2HFEA 4L3EE 2HT2D 2EDNA 1UH2A 3NGBC 1IQDB 5I1KH 5L6YH 5GHWL 3TIDA 1TVBA 3R4DA 3VXPA 1LEIB 2VAJA 4PJIA 1WZMA 3T0EB 2WUBL 4F9LC 4Y5XB 5L8JB 4PJXA 5DD0L 2MHAA 5D7LB 1JGLL 1FPTH 1TTGA 4XWGL 3NA9L 2VO5A 4RAUB 3LRSA 5BQ7B 2VQ1B 4OV5B 3B8YA 3QNZB 2N1KA 4NC0B 2X1XR 2HLAA 1G6RH 2I24N 4K3JL 1HHIB 4ZTOH 3EOAA 4CBPA 5FK9B 1I8MA 5FYKL 2LVCA 3V6OA 4F3FB 1DDHA 4EOWH 5A2LH 4RCAA 1JPSL 4JRXA 4XXDA 5IBUB 2PO6C 4OF8A 1KFAH 5DJ6A 4WI3A 1RULL 4YIQA 4BFIA 5FB8A 3NCYP 8FABA 4DCQA 5BZWA 4JJ5B 4R4ND 4C4KO 2YD6A 1NDMB 4YGAB 4Z5RB 3DGGB 3C60A 1NDGA 3QWOB 4RMWA 3VRLF 4PUBL 4JJHA 2I9LA 5E99H 1I85C 1Z9OA 5A2IH 2YD8A 4KRNA 5D7IB 4HJ0C 3OB8A 5B39B 1A6ZA 4MJ6A 1IC7H 2EIZA 3ET9F 4JO3L 1XEDA 4WO4B 1MCIA 3CUPA 4L3ED 4YE4H 1CGTA 1WZ1H 4D94A 5FA4A 1TJGL 4LCYB 2WBJA 3HC3H 5C0EA 4WENB 3RL1A 4YHZL 5BZDB 4LHUG 4WEUD 4N0FA 3NIFE 3KXFB 1EEYA 2XZAH 5CEZL 3S3PA 5KSBF 1IAII 4MNGA 4QHNA 1EEZB 2JELL 1EFXA 5E6ID 5JNYA 5HGBB 4P99A 1OAUL 4XP1H 3WUWG 3QG7L 3WNPA 4XH2B 2AJVH 3BKML 1RI8A 3HLAA 4N8PA 4PLNC 5C0FB 5IWLA 2NY5L 4EBQH 3MRDB 3PG2A 4J1UB 4WI8A 5F1KC 3MUY1 2HVJA 3QPXL 4OLWH 1CU4H 1J5OH 1V7ML 4XNYH 4B5EA 1AHWB 1AQKH 5LGJB 3D2UA 2X1WL 4K3EL 4X98B 3L5JA 2PYEA 4WWKD 2IBZY 3PV6A 1T5WA 3INUH 3ZTJH 3I9GL 3HPJA 4TN9A 4JFED 1ZOXA 1U8OA 2VR4A 4PJEB 3MOAH 3RVWD 1KJ2H 2W0LA 2OTWB 4P3WA 3JWDC 4F8TA 3C5SB 3NN8A 1RU9L 3MJ9H 4Z77A 1QG3A 2Y06H 5CEXA 3LH2L 1GOHA 4ACPA 5L2KE 3MJGX 3BMWA 2PTVA 2CIKA 5GS2D 4PV8A 4LSRH 5DK2A 4QXTB 2OJZL 1F6LL 1T2QL 4R4NC 4ZS6D 5SWSE 3QZWA 4L8SA 2Y72A 3B9VA 3QI9C 4I77L 3U30C 3B83A 2WQRA 2KKQA 5LGHH 4X7TA 3K7UA 1NBVL 5C0BE 3SJVE 2NY3C 2L7JA 3BW9B 3RZCB 1TIUA 4GRWE 3DUHA 2EIBA 2DLIA 4O9HH 4GXUM 3I02A 2GITB 5HI3D 4G7VL 2WBKA 1R3LB 4JRXD 5DVNA 4U1SA 1MVUA 4G8EB 5F71A 1KB5A 1Q9OB 1Z0MA 4XPHL 3GO1L 4KTEL 5EIQA 4PGCA 5T3ZH 3C60D 2NY2B 5KSBB 1R3HB 2VZTA 4CL7A 5C0IA 2QL1A 4GW5B 3H8NA 1A4JA 3A6OA 5E7FA 1RIVH 4IJ3B 3X12B 3K0WA 1V3MA 1JGVL 5FHBL 4W4OC 2R69H 3AS3A 2N56A 3ARDA 4K3DH 3FQRA 5B3JF 3FB7B 4G6AD 2AXHA 1EO8L 2ZSWA 3DX9B 3HZYB 5AYUL 5J57B 1NGPH 1SJEA 2NW3A 1U93B 1FFOB 1BD2B 5DHVA 1RIHL 2WBJD 1FNHA 3QDGA 1NAML 4WWKC 4UZGA 3TA3B 4LBEA 4JPIA 3EUUA 4S1SH 4TNWK 5DEZA 1QBAA 4BFBD 4JQIL 1EFXD 5EUOB 4PJFA 5FYJE 4E42A 4G6FB 1DZBA 1IAIL 1PYWA 5EZOH 1HHHB 1MRDH 1ZKAA 5F6HI 3SJVD 2FCBA 3O11B 4V1DB 1RJYB 5I74B 3TBYB 3WXVL 1QNZL 3PIQB 5I18L 1WCQA 2PYED 4Q7DA 1UC6A 4K7FA 1NCWH 4Q9QL 2ZCKH 1KGCE 1NCBH 4YDIH 2DM4A 3EOYG 4HUVB 2FX9L 2ITDB 3K2UL 4N5UA 4BH8B 5L6YL 5FF6B 2IBBA 5I1LA 1CDJA 1TLKA 4FZEH 4WHDA 4X6CE 2C3VB 3HZKA 3B9EA 3FN3A 1QLFA 3MRJB 3GI8H 2B4CH 3FO1A 3DX7A 2R4SH 2X41A 4J7RA 4H0HB 2FJHA 4AIZA 1ZE3C 5IMKB 1FIEA 4GRLC 4J3OC 4PFEA 1JPFA 1QQDB 5HHXH 4LSUL 2X4UB 1HIMH 1MWAL 2DM7A 4HIXH 3K8LA 1AD0B 5IHZB 1CGYA 5ETUA 4WHYH 5I8CB 1AD9B 5CJOL 1WISA 1LO3L 5KN5B 3GSUA 3VWKC 3QWRA 1P9MC 4EOWL 1EUTA 5IKCB 3OKKB 3HHRB 1KFAL 1MCHA 4HHAA 1ADQH 3MRPA 3QO1B 4UTAL 2R0LH 1SVZA 4JZOB 2Z91A 5JHDB 3AGVA 1FO0H 4JREB 2ESVB 4X4ME 4URTB 4M5YH 2IALA 5DHYB 3K1KC 3IDYB 2XWJA 3HNVH 3PWJA 1EERB 5FXCH 5DQ9B 3UCRA 3EDFA 3SE3A 2XNAA 1TQBB 4XBGB 1EEUA 1O5DT 5CILH 4JGJA 4ZYKA 2MQ3A 2P5WB 4JKWA 1I9IL 3VFMB 4MCYB 5F9DC 3GSQA 1MEXH 1JGDB 3LN5A 3MOQA 3R06A 3DUUA 3HB3D 1JV5A 1T1WB 3RRQA 1YJDH 4LDLB 3QXAA 1KGCD 3EDDA 1KPVB 1JI1A 1SJVA 2DQUL 3ARDD 4YE4L 2B0SH 3ESUF 3T04D 3WO4C 2Y5TA 1X44A 3ZKSD 2HMID 4TUJB 3M8OH 4XB8A 1A6AA 4MMZC 3JTSA 1MAMH 2FLBT 3D18A 3HC3L 3QA3A 1YUHA 5F1OB 1DEEB 1YMHA 4M9OA 1QOKA 4POYA 2R2BB 1IM9B 1G7QB 1MH5B 4C54A 1LDPH 5D1ZC 3EYQD 1WAAF 3CNKA 3VXMB 2Q7YA 4NM8L 4LLQA 3LHPL 5D7JB 1DUYB 4FHBD 4XP1L 5MEQB 3ZE2F 3OHXB 3T65A 3RUGA 3O45A 5B8CC 3UZQA 2XA3A 4FQIL 3HAEG 1P5VA 1OD9A 4L9LB 4OLWL 5CGYD 4XNYL 5J13B 4XP5L 2EDTA 3LKRA 5TQ2H 4B7LA 2X05A 3MPCA 4NT6A 4OZIA 4PJ8A 4LDOB 5EOQH 3DETC 4YFLF 1KCVL 1YNTA 3MOAL 4JGMA 2D31A 1KJ2L 1IEAA 3Q48A 3MYZA 4NBZB 2E8YA 2NY0B 5GGQL 5TGBA 5C8JB 5E7BA 2ADFH 2P1YA 4Z7WF 3AY4A 5E8EB 5IROC 2FDBP 4POUB 5HYSB 4JVWA 4LQFL 4LSRL 4JQVC 3I2CL 3QCVL 2DQHH 4R4FH 3EYUH 1RV6X 1GC1L 5GRYA 3ZL4H 4QXGH 1FGVH 5GQBA 3BSZH 4KDWA 2VMFA 4LPWA 2X4SA 5IW3A 1JBJA 4PY7B 3PWUB 3WLWD 5KVDL 4U1KA 2BNRA 2IQ9H 3TVMB 4XP4L 1ED3A 4R7NA 4BSVA 5IR1B 3QWRD 4K94C 5DUBB 3VE0A 2LE9A 2NY6D 1AI1H 3GJEA 3K1DA 2DICA 3GIVB 4FTVE 4CNIA 3VFWB 3ZSSA 4HC1A 3MX0A 4QLRA 4PRPB 2NXYC 5ESAA 4G42A 2HKHH 1DN0A 4M7LH 1NANI 2OJEA 4P5KB 1ZT4A 4CDGC 4CDHA 3KJ6H 1JPTH 1CD1B 3UZVB 4XZUB 4PJGF 2HWZL 3FQXB 1AP2A 4NQDA 3KAAA 2Q6WB 2D03L 5CLTA 3OR6B 1CBVL 4JFQA 4YBQD 4I0PB 3E6FA 2YD3A 2R23B 2XI9A 4J12A 2JB6A 1DQDH 5CEYA 2H45A 2DQIH 5C0CB 3BQUB 4JFPA 1GOGA 2AXGB 4PJ7A 3MNWB 1TZHA 4HUWA 5DJDB 1RMFL 4J3WA 3M17B 4S11A 1IQWH 1GPOL 4CVXB 3HE6B 2IQAA 3LS4L 4QWWD 2J6EH 1BOYA 4S1SL 1U8LA 5HDQH 4N5ED 3V4UH 4KUCD 3O3DB 4Z7WB 2BVYA 3VWJA 3HFML 4MD4B 5F44A 1A6PA 4NQVA 1S9XB 4NJ9H 2ED9A 4DAGH 1U8PB 4I13B 4HJGA 3HZMA 5I1AB 4G6KL 2R2HB 4YDLC 1IEBA 3BIKB 2FATL 4AQ1B 2DIAA 5GJTL 2EDJA 2NR6C 2CRYA 4P46B 3SO3C 5C71A 4PJ9A 2VXQH 4LIQE 4EN3A 3PWNA 4AIXA 4LGSB 3D85A 5HYJE 1NCWL 2UYLA 5BOZG 1NUNB 3ZTNL 4PJ8D 4P57B 4YR6B 5FIEA 1FC2D 2RCSH 4G6JL 3X13B 2CQVA 2ZJSH 1OP3H 3U36B 2D7MA 3O4LA 3UPCA 1RUKH 4ODVL 4CUCA 1UKTA 3FFCE 3TBVB 2R4SL 1J0YA 4F2MA 4YXLL 3G5XB 5D70H 5D72L 3GMMA 3U7WH 3QP3A 4NUJB 2P8LA 2NXZD 4LCCB 1FBIL 4GKZB 3B6SB 4PJGB 2PXYD 3ZT6A 2BNRD 1FORL 2F53D 3BN9C 4WFHD 3WNKA 2BNQA 2DYPD 2K9UA 4H26A 4BH7B 1HSBA 1KLGB 2XKUA 5EC1A 3NCEB 1XGUB 2VDPH 3DWTA 1FO0L 1DE4B 5D2NA 4M5YL 3OXSB 4DOHB 3T77B 2HTLC 4Z78B 4NRXB 5IBLD 3TFKC 5CILL 1GGCH 3SE8H 2VLME 2BC4B 1WBZB 1BJ1J 5GZNC 4L4TA 4N5EC 4NQDD 1YJDL 1BF2A 2SEBA 3BYYA 4RZCB 5I8OL 2J2ZA 3I50H 1IJ9A 1YC7A 3FB6A 5FKAB 4P2YA 2FHFA 2R1XA 2HYMA 3EW3B 3TZVA 1A47A 3RP1A 1VFAB 3TH3T 3NFPB 1XCQB 1OQXA 1P6AB 3IU3B 4KY1L 5SWZE 5B4MC 2A6JA 4HULB 2DQEL 1KIQA 1OHQA 1QSEA 1LDPL 2R29L 1NC4A 2VDQL 3VWJD 1FLRH 4Y2OA 1PZ5A 3ROOA 3ORJA 4JFHE 2ITCA 1JK8A 4E9LA 5JXEC 3D0VA 4LU5L 3T09A 5AAMA 4MA7H 3IDXH 1I8IA 1UJ3A 5JO5A 4MQTB 4FMFA 3GSXA 3LS5H 4F58H 5IB4B 4PJ9D 1ZXQA 3F7YB 4JVUA 3QIUB 4HS6B 4EN3D 4YWGH 1MVFA 3X14B 3RWJA 1OAKL 3WHXB 4Y5YB 1NBZA 3EYVA 3WN5C 2FYYB 3QG6B 2PXYC 3CDYA 5ITBH 1A21A 2ADFL 1CQKA 2HLFD 3O4LD 1S7QB 3WIHA 2CLZA 3ME0A 1PAMA 3O81A 1I1RA 4JPVH 3BN3B 3UPRA 4YQXH 1K4DA 3D87B 2DQFA 1MCFA 1JNHB 3ZKMD 5HY9B 5ICZA 1OOAA 4R4FL 2BNUA 2APXA 2APWA 3ROLA 1N5AA 2EDOA 4GQPH 1ZA3A 3IYLW 5T1DL 5TF0A 5BRZA 1X5YA 3CPLB 1DLHA 3IB4A 5LCVH 2G60H 1ZMYA 4OLUH 5ESQA 3GHBH 3EDJA 5DSCA 5D2LF 3HN3A 1RZJH 1I1AA 1EX0A 3G04B 4XP6H 4Q6IA 1N2RB 3HRZA 4QHMA 5MHSE 2B20A 3LQMA 4HUNB 4ZFZB 5FO8B 4LCUA 4M5ZH 5E94B 3KJ6L 4UUJA 5T33L 1J1XH 3G5VA 4ZAKA 5FO9B 3A0OA 1VA9A 5IG7A 5E95B 3VD3A 4KJWC 1IGTB 4L4TD 2BVQB 3T2NH 1TCRA 3CMGA 4GG8A 5KG9B 2EH7H 5DTFB 5HYQA 1KPUA 1OAYL 4C56B 1AC6A 4HT1H 1FSKC 2WUCH 4ZUTA 3PJSB 2JK5B 2NW2A 2FB4H 4MS8C 3RDTB 3TZVD 1IQWL 2H3NA 1AQDA 1LD9A 1IRAY 5K33A 1IAOA 5HDQL 1IKNA 3V4UL 5MEOA 1QSED 3M1BA 2JCCA 1UA6H 1X5FA 4KKNA 3NCYS 3F7VA 5CINL 5ISZA 4NJ9L 4N0YH 5E2UH 3HC4H 3OKOA 5C9JA 4XI5C 4PGEB 4Y4FC 3L3GA 4NN5B 4MAUL 2NCMA 4Q58C 2XV6B 1PEWA 3HKFA 1MCJA 2VTFA 2XZCH 5IVZB 3QFDB 3L3IB 1URLA 3DVIA 1HH9B 4JFDB 1INEL 4KK9C 5D2LB 2VUYA 1WICA 4L8CB 5E8NA 2P5EB 1JE6A 3F7RA 4DVBA 2HKFH 4HWEL 2NNAA 3PABB 3S96B 1FP5A 4N9GA 4U1IA 2YHGA 4P3DA 1YDPB 3RA7H 2D0HA 2IADB 2DI9A 4I2XE 3RX5A 5D70L 5E08H 3DO7A 4LSQL 3VMOA 3QUXC 4U1MA 5BV7B 4PLJD 1XR9A 3CFIC 1IC5L 2ZUVA 4OI9A 1C1EL 3P4OB 4FA8A 4GBXA 5TE7H 1DR9A 1U8JA 1XGRA 1QFOA 1BFTA 1P69B 4C83A 2XZZA 4MB3A 3B2VL 4XBPB 3GDBA 3EYOA 1MJ8H 2WMPA 4MNHB 3CSPA 4LLUA 1CG9A 4TOYH 4J8RA 1A6TB 2IMMA 1I1AD 5JIKA 3B2UD 1U8MA 4P0DA 2EH8H 2BSTA 1S5HB 2P8PB 4KKLD 4NO0B 4Y2DC 3MODH 5EO1B 1MHEB 1X5KA 2AJ3A 4CMHB 3NFNB 2XTJD 4G5ZH 3TN0B 4FQLH 3NVQA 2DWEB 4YGVA 2F54D 3P73A 3IAGC 4ZAKD 1ND0A 3VXNA 4RAHA 5IMOA 1DBMH 1JMZA 1ACZA 4Z18A 4PRIE 5DJXA 5JXAH 4AIOA 2AK4A 2D9QB 1TTUA 2CDEB 1TJIH 3BZ4B 3EJZC 1TXKA 3TPUA 4ELKA 4C58B 5HD8D 4LSVH 3UX9B 1IQDA 4JG0L 3QUZD 4MLIA 5DMYA 5CWSB 5EBGA 4JM2A 5GS0D 1I9EA 2EDRA 4M02A 2XTLA 4HKJA 4LLVA 4Y5XA 4M1CC 5I0DA 1KG0B 4I4WB 2DJUA 1A7NH 1OARL 3NTCL 5D5ME 4U6VH 2VQ1A 4RDQG 4OD3L 3LS5L 4F58L 1N64L 2A1WH 2XYCA 3PV7A 3RPIA 1CR9L 15C8L 4YWGL 5BW7C 5JR1H 4JE4B 2EDKA 5TF1L 4M3JA 2RFXB 2E7MA 3L5WA 35C8L 5D7KD 2VL4A 1M4KA 2X6MA 5JIIA 2VDOL 4GSDL 3L7FA 4CU7A 1UYWL 4M43L 4PR5A 3SDXF 2VSDA 4HLZG 4JPVL 3UBXG 3VXUE 1P1ZB 3VXSE 3MREA 5FHAH 4Z5RA 4XGZA 2J8HA 3QWOA 2BSED 2J88H 3NBNA 2OR9L 5HDBE 1X4ZA 2EEDA 4NHUB 3PQYE 3WIFB 4PRID 2BJMH 4WHTB 1QSFE 5BV7H 1L0XA 3QEGH 4NQEE 5D8JH 1XGPB 4OLUL 3GHBL 2F5AH 3VG0H 1QLEL 4WO4A 3RJDA 1RZJL 5INCA 1H8SA 4MD0A 1WWBX 3V6ZB 1ZHBB 2ZZUT 4O5LH 1LK3H 1M05B 2BHZA 1TJHH 5KVFL 4QT5A 4XP6L 1KJ3L 4LHUD 3EYSL 4WUUB 3O4OC 4MGXA 1P4BH 4PJHA 1T03L 1UWXK 3RIFK 1C5DB 4UQ3B 4NQSA 4GS7B 3RNKB 3KXFA 3GSRB 2Z93A 4KVCL 1F4XL 4O2CB 4WW2A 4O58H 5F72S 2DWDB 3SGEI 1J1XL 1UM4H 5IESH 3HR5A 5TFSH 5K9JH 5I0ZA 1JZ6A 3QUZC 1DLFH 3HI5H 3ARGB 4YXHL 4DN4H 5GS0C 4ORGA 1NGQL 3MO1A 4KK5C 3DECA 4F7PB 5CIPB 5HVHB 4X98A 4CRPA 4OM1L 3QIWC 4HMEA 3KYMA 2AK4D 3L95B 2G2RB 1S8DA 3RWFA 3HPLA 1GL4B 4GMTL 2A6DB 1FL6A 4K8RH 1UEYA 4N8CH 3K80A 3RWCB 2EXYC 2X4OA 3W81A 4WV1B 1YQVH 4JM2D 3UJTH 1LEKB 3T2QA 5F21B 3HC4L 3QUYC 4Y1AA 4QRUB 4JFOB 4XC1H 2FGZA 4IRSA 1W72B 4MNQE 5EU4A 1B88A 3ZDZE 4ELMA 1FAIL 3M45A 1HNGA 2NX5E 2X42A 3MRBB 2MWCA 4H25B 2WZPD 4H8WC 1N3NA 5IVOA 3EFFB 2VAAA 1ZA6A 2OZ4L 2GITA 4LF3A 1M7XA 3P11L 4KJYB 1RJZB 4HWBL 2QSCL 2HKFL 2R1YB 3D39E 4HFUH 4P23B 2DB8A 4MA3B 5GS1B 3RA7L 3ARBC 3V6FA 2V7NB 3DX6B 3ZDXF 4JLRB 5T1KA 1OSPH 2V2WB 5DWUL 2GFBA 1NFDF 3STZB 1GJIA 3FT3A 4NKOB 5TE7L 4XX1G 1QKZL 1IAIM 5BS0B 1A6VH 1J05A 5J6GB 4YHLH 1BZ7B 1NMBL 3B8SA 3ZE0F 4UT6L 2DD8H 1RUQH 3ZKND 3W9DA 3WE6B 3WFCH 4TOYL 3UTQB 3BPOC 2EH8L 4OFDA 3BWUC 1OVZA 4R26H 3H9HB 1FN4B 5D1QB 2ICWA 4GMSH 3DRQA 3KXFD 1RFDH 3RFZC 5E2WH 3N1PC 1U95B 1WEJL 4NDMA 1CDGA 1A22B 1J8KA 1SYSB 1R5VB 4R8WL 3O8XA 4V1DA 1RJYA 4X6DB 2DLTA 1ZHNA 4HK0B 3TBYA 1ZS8A 2VJXA 2QADD 5CIPH 1CXLA 1TFHA 4HJJH 1OGAB 3X11B 4HUVA 5HPOA 3Q3GB 1UVQB 3TPKA 4Q9RH 4LLAA 5CD5D 1PGRB 3MLXL 4JN2A 2JJSC 1YN7A 4HDIB 5FO7B 1HI6B 1LWRA 3MRJA 2Y07H 2V2TA 2PW2A 5I1DB 4AG4L 5IMKA 1A7NL 4OF7A 4Y1AD 4KQ3L 4U6VL 4TVPD 5D1XB 1QQDA 5FCSH 4X99B 4IRSD 4R3SA 4IS6B 2X4UA 1MCDA 1N0XH 3NFSH 1W72H 3R0MA 4C4KT 5F3BA 1QRNA 5F7LB 1CE6B 1R3JB 4NKIH 1TDQA 4CADB 2OP4L 3G5ZB 4MX7B 4I3RL 5I75B 1IGML 1QVOA 5C70A 1FVDA 5IKCA 3OKKA 4WFFD 1G7LB 1N4XL 4LLDA 4Q9BA 4N0CD 4WTXA 4JZOA 5ADOH 5JHDA 2ESVA 1K8IA 2F8VA 2YPKB 3QEHA 3FO9B 5FHAL 5DHYA 3OXRA 3QEQD 5DQ9A 3ECBB 1D5MA 4BUGA 5T1KD 2AS5M 2ZKHH 1N59A 2BJML 5BV7L 3BPNB 3BKYL 3QEGL 1QR1A 1RUMH 4YHMH 3KJ4B 1JGDA 5D8JL 1T1WA 3HZVA 1JFQL 3HUJE 2FX7L 1RZKC 4WI2A 4YHPB 4PRAB 5GRJH 3GRWH 3H6JA 3BIAX 4ZNEE 1BQUA 2O5YH 2G75B 5LKNA 2VDRL 2AK1H 4Q74A 4LFHG 1KBGL 1MCLA 4QKXB 2WWMC 4O58L 5IHLB 3SQBA 1GHFH 4TNWF 5CBEA 5F1SA 5TFSL 1BBDH 2ZCHH 3LV3B 5FOJA 1OL0A 4P2RB 1RUAL 4NJAH 5E5MA 3TCLA 3SHSA 4JAMA 4NO5B 1S9YB 3O8XD 1OPGH 3MR9A 1DSFL 1QHOA 4K55A 1K2DB 5C3LD 3BD5A 4OLZH 4RISH 1QLRB 3EZJB 5JORA 4NNYB 4U6YB 4GO6B 1SY6L 4N8CL 5C8JA 3QJHA 4PREB 2AQ1A 5IOPB 4OF3A 4PV9B 3P4NB 5HYEA 4MXQC 3P0VL 1MIMH 4Y16B 1YECH 2PW1B 5MERB 3QHZH 1NFIB 3SCMD 5JZ7D 4JRYA 5B22A 2D7OA 2OMNA 3RBGA 1NMCB 3OKEB 2ICES 4JHWL 4MQSB 1T0MA 1ZT1B 4XC1L 2RJMA 3UAJC 3FTGA 1I1YA 2G5BA 1DN2A 2ICWJ 4YFDB 3QUMB 4PY7A 3PWUA 1BIIB 3WNMA 5FGSA 4PJ5E 1QRND 3TYFA 4EDWH 2HMIC 1YY9C 5E8OB 4HGMA 3H9YA 5DUBA 4J3SA 5F7KC 5JLZA 2GHWB 1ORQB 4Y4KC 3O2VL 4YHNB 1XH3B 1Q1JH 4QCIB 4APQB 5KVMC 3MUHL 2Z92A 1WV7T 2CRZA 3LKOB 5HHOD 4PRHB 5K9KB 1D7FA 1D9KC 1BIHA 2WIMA 5CHNB 4ZFOA 5JHLH 3MGOB 5BXFA 3VFNB 1T04A 1OSPL 1WAAA 3P30L 1A4KA 1K8DA 3CVHA 4ZODA 4NNPH 5ICYA 1F90H 1KEML 4OCYH 3RTQC 3N1MC 2YSSA 1RUQL 1CICC 4I0PA 3H9SB 1CLYH 2B1AL 3FN0H 4ONHB 3WFCL 4P2OD 4EI6B 2R4RL 3N50A 3FB8A 4OCWH 3O0RH 1CXEA 3MV7B 2PR4H 2B5IB 4K2UH 4S1QH 5DJDA 3V8OA 1Q8MA 3M17A 4WEBL 4WI5A 4XCYB 4PGZA 5F7DA 4JZJC 5F7MC 3ULVD 5FOBB 3F7PC 4CVXA 1ITCA 3CU7A 1RFDL 4LNRB 1EJOH 3EDEA 4XCCL 2VZ3A 3ZMRA 4KJPC 4Z7WA 4U33A 4F7CA 2J8UF 5I19H 1F45A 4KROB 3CCHB 3F6IA 2CMRL 1P7QB 4PGDA 1XIWA 3BKJL 3OG4B 1VGKA 4PP1C 1E4WH 4JVPA 1U58A 1TZGL 1WWAX 1KCUH 4P46A 5C07A 3V0VA 1RZ8B 3LQZB 6FABL 1T89A 2BERA 4F57H 3PP3K 4P57A 1RD6A 3KPMB 4KRPC 5CBAB 5JQ6H 4JY6A 1MFEL 3MA7A 4M7ZB 3MRNA 4TULH 4Z8FL 2C3GA 3CFDB 3RU8H 1C08B 4ZQKB 5GSRA 4RIRA 5J12B 2Y07L 3C2AL 3QO0B 3DMMC 1KT2B 1EO5A 2LABA 1T20A 3IRZA 3ULUE 3H0TA 3CVIH 4JRYD 2H32B 3KHQA 5DEFB 4HXAL 3A6CH 4NUJA 1N0XL 3NFSL 4LCCA 4GKZA 4XTRC 5JPMB 3B6SA 3MCLH 4FQ1H 5IFJB 4DWHA 4NKIL 4IRJA 3QUMH 4K3GA 1C12B 4O4YH 4QRTB 1MI5A 4JR9L 4P2QE 3NZ8B 3GB7A 4KV5E 1KLGA 2LQRA 3DXAB 4WHYG 1JWSA 1XGUA 1PSKH 3PHSA 4PRBB 5ICXB 1SBSH 3G08A 4I18B 5EC2B 4D0BA 3OXSA 5E00B 4AQOA 1JGEA 4GUPB 1YEFH 3TO4C 5BVPH 1JHTB 3WNOA 2GTWA 4Z78A 4NRXA 5D93B 3UO1H 5DJ0B 1IGYB 4UDUB 3MYJA 5I15H 1IMHC 2Z31B 2J8UB 2P48B 3WFDL 4YHML 2BC4A 3BJLA 2YOCA 4OUUB 3MRCA 3FT4B 3NIGF 1BAFH 4QOKE 4LCIL 3JWOC 4U1JB 3OGOE 2WP3T 1UCTA 1YPZE 5DUPH 4RZCA 5GRJL 4OLXH 3F12B 4K94L 1VFAA 2VQTA 3HCVA 4IEFB 3U2SA 3IU3A 5KZCD 4XNXH 5E4EC 1FRGH 4ONGH 3RKPA 3VFTB 4KZEH 3VGAC 5FKPA 3CK0H 3C8HA 1BBDL 2QR0B 2YK1H 2D3VA 4NJAL 1IKFL 5EWIH 5EBLB 5IB2B 4UILH 1XIWD 3CX5J 4I5BB 1XF2B 4ZFGH 3HTLX 2EE2A 2GSIA 1INDH 5DJZA 3BOVA 1AO7A 4U7MA 5C07D 4PB0H 5DUMH 5FGRA 1LEGA 4ONFH 3VD9A 3O3EB 4OLZL 1U3HB 4LRIA 4M7KL 3RY4A 3MBED 1I8LA 3K3QA 2YUVA 3DIFA 5E1AB 3WHXA 1J0JA 4Y5YA 1CFNA 5D96C 3QG6A 4J4PD 1L9NA 3REVB 3DYOA 1WJ3A 3MXWL 3O6FB 4LARH 2A74B 4IIQB 3BWAB 3HI1A 4OB5L 1MIML 4IDJL 1R5WA 3QDJB 5E56A 2QHRH 1MCPL 4XNQA 1R24B 1JNHA 4M1GH 2CRIA 3QIBB 1G7PA 4JFFA 4XPTL 2H32H 4D8PB 5DZNA 3UTSB 2O61B 3IVKB 3CPLA 4OFYA 4HEPG 5HDOA 4RGNB 4IRJD 4E41B 2QKIB 2Q76A 5GGVY 1T83A 4KI5E 4W6WB 4X7EC 5DURB 4CW1B 1MI5D 3L5XH 3VI4F 3G04A 1C7TA 2NY1B 1NGZB 4HIHB 1NAKH 4PJCF 4TRPL 2X7LA 1NEZG 1MSPA 4XNZC 5FO8A 2HRLA 1QEWB 2IFGA 3DJ9A 5E94A 3BZFB 4BKLA 1WBYB 4NNPL 3ULUC 4QRPA 1C16B 4J3TA 2WLZA 2HJFB 2BVQA 5JMOC 1G7HA 5DTFA 5EZIH 2BX5A 4LKCB 4S2SA 1PKQE 5KANI 3NACH 3SKOA 4QNPE 4LKXA 4KDVA 5SV4A 4QTIH 3HE7C 3RDTA 3DLQR 4FQQB 3T1FB 3C6LC 1CI5A 3RY5A 3LN9A 3UJIL 1I3GL 2LTQC 5HGGS 4K9EH 1UZ8B 4OQTH 3MBEC 3ARUA 3L3JB 3CZFA 5I71B 3HG1E 4Y5VC 2QTEA 1WFTA 3OKLA 3THML 1T1XA 4BK4A 3WMSA 3SDAB 3TCXA 3TT3H 3LEYH 4HGKC 3T8XB 3O9WA 1V3LA 4N0UB 1KCUL 1DL7H 1Q0YH 2VH5H 1AO7D 3OR7B 3K46A 4F57L 3U0WH 3UJJH 1HH9A 2ZPKL 4JFDA 4FQPA 4HKBB 2OR8A 5JQ6L 2Y25A 4NN7C 4HH8A 5FA3A 3UBXA 1F58H 5EU6B 1T5XA 4ODSL 2Y7QB 2MOVA 3S96A 1A1OA 1FVCB 4PJCB 1DFBL 1U3YA 4DKAA 1HYSC 3VXRB 3GMRA 3AAZA 4NHCH 5C6TL 4FXGB 3A6CL 2AV1B 4JFFD 1IGJA 3P4OA 4R96B 4MSWA 5E2VH 3MCLL 4FQ1L 4X9FA 2BVUA 1G1CA 1FZMB 3PL6C 4OFYD 1OT1A 1CK0H 4XBPA 1FV1B 5HJ3B 4O4YL 1CFTA 2BVOB 3H3PH 5T3XH 3X3GL 3FO0H 5C92A 4JFYA 1FYTE 1Z2KA 2XPGA 4ZPVA 5KSUA 1JGUH 3MRHA 5EOCL 2XRAH 1F4AA 1S5HA 1QRKA 3WV0A 2VL5B 1MHEA 4TTDD 1HYRC 3TN0A 5FYKE 2DWEA 3C9NB 3LIZL 4XVTL 1KN2L 5IEKB 4QRPD 2VIRB 3UTOA 4YPGA 1EZVX 2EDWA 2NYYD 2QSTA 3B9KD 3NIDE 1PVHA 3ZHKA 2X4QA 5DVKA 2XQBH 4KDTC 1JCKA 3MLTA 3HMWL 4EUPH 4LIQL 2VABA 5EU3B 4KI5C 2IC2A 2ATPB 2HG5B 2Y23A 5K93A 5I1GH 2KH2B 4GRMB 1SEQH 4UOW1 2BNQE 5C08A 4O2FB 2FHCA 1PG7X 4JO2L 4NSKB 1ACYL 2FWOB 4I4WA 4UILL 4FQXB 1DQLL 4U6XA 1KULA 5CSZB 1CLOL 5CCKH 1X5GA 2YS4A 1S7UB 4RA0C 3O9WD 5CEZE 3VA6A 4GW1B 3UTTE 4FN0A 2ARJA 3CFEB 4ONFL 4BSWB 5FFLA 4JFXA 5ADPH 3AY4C 1AGBA 1A7QH 1J0IA 3X3FL 1FNEB 1QBBA 3GMLA 3VW3H 1AFVL 1D5XA 4AK1A 1G7JB 4LL9A 4LARL 2APBA 4E0RB 3EAKA 1AGCA 3WBDA 4FQCL 4ZO7A 2IAMC 4Z0BL 5I76B 1V05A 3SDDA 1EBPA 3LEVL 3DHMA 2AJXH 1FJ1B 5AG9A 2F5BH 4BZYA 2AQ2A 4LEXH 5JOFA 1Z3GH 3MRQB 4NHUA 3NCFB 4K71B 1BFSA 1UB5A 2H6PA 4JZNB 5KW9H 4RMRA 5HPMB 1A7RL 1QFWH 2R0ZH 3KPQB 5F1NB 1GRWA 3UYRH 4Y19E 5I17A 4LLYA 1EK3A 3LQAH 4JQXC 5HHME 1DVFA 5FGCB 4JANB 5C86A 2E9BA 3ABZA 4WUUA 1TTFA 3FQUA 3IJYA 5D71H 1C5DA 4QHKI 4U1GC 1NAKL 3O41B 4MA8H 4AEHL 3GSRA 4I9WD 3S37H 3WNNA 1J10A 2ZG1A 2Z9TA 4YNYA 1NAMA 3PWPE 4YC2C 5K9OB 5JIHA 5CEZD 2D7QA 4OZGA 3OKMB 3VCLB 1I75A 3ARGA 3LZFL 4XX1E 4ZPTA 5CMAB 43C9B 3VGFA 4KVNH 4F7PA 5KSAB 5F7YC 2NY7H 3L95A 2G2RA 4FFYL 2W92A 3MV9B 4WNQB 2A6DA 2UY7A 2HJLA 3L3DA 3QXWA 1BEYH 5ERWB 4UNUA 1A1MA 1QACA 2YPVH 3P40A 2H41A 1YEKL 3MRKA 4XVJH 3OX8B 3SDXA 1LEKA 5C08D 1M7IA 4OIIL 4ZSOB 2C26A 3TT3L 1Z5LB 3KYOB 1LE5A 1J87A 5FDWB 4Y19D 3VFGL 1OF2A 1ZVSB 2PKDA 3IT8D 4OAWA 5EH1A 1F2QA 2LU3A 5H35A 1AXSA 1DL7L 1SEBB 1RK0B 1XGQB 1A7PH 4ZD3H 3MRBA 3FOMA 5F70A 3RVXD 4UIKH 3SOBL 3EFDL 4H25A 2Y6SD 3QCTH 3IDGB 5A43C 2PCPB 3U46A 4MCZB 1RVFL 1ZLSL 1AE6H 1JWMB 1MRCL 3HMXL 1H3WM 1AXTL 1K5NA 3LKQB 3E1F1 5DDHA 2R1YA 4OZHA 3O3AA 1I7ZB 3O6MH 3MGTA 3G5YA 3SGJA 4L8BB 5GS1A 5DFVD 3SDDD 3UMTA 2V5YA 4WWID 4GT7A 2V7NA 4HQQL 3DX6A 3UEZA 3NZHL 1QFWI 4JLRA 5DMKA 4E5XB 1JTPA 3I6LD 4MVBD 3GMQB 1UH3A 4PJAA 1CLZH 3PGFL 5E2VL 2V7HB 1D5IL 3DSFH 2IPTH 3V6BR 3WHE1 5BS0A 1Q94A 5K9QI 5MEPA 1CK0L 4WU7A 2GCYB 1UCBH 1Q38A 5T3XL 4HIIB 5ISZE 4PJIF 5F7WC 5MI0B 3FO0L 2MPAH 1DVFD 3RY6C 3EHBD 1JGUL 4U1NB 4MXWH 2VWEE 4DEPB 2IFFL 1KYOJ 4HCRL 1S9VB 2NY5C 1RUPH 5KS9E 2VN7A 4IOFD 3U9PH 3RIFF 3MLUL 1XF4B 5ANME 4Q9CA 1MHPH 2VISB 4WU5B 5I2IB 4HUXB 1U95A 3MROA 3NIFF 4L3EB 1F11B 4KQ4L 4OGYH 1L7TL 2Y4SA 2OTPA 1NKRA 3MZTA 5IMMA 3MLSH 4X9GA 1H0DB 1NBQA 5EORH 4BM7A 1S7SB 4HX1A 3IRPX 2XQBL 4M00A 4OGXH 1JWUB 1B2WL 1MLCA 3U7AA 1YNLH 2HT3C 1ES0A 4PYHA 3MA9L 2YD7A 3B3IA 1GAFH 3GBMH 1YNKH 5E6IB 1OGAA 3F5WB 1JF5A 3Q3GA 2YKLH 2H2PD 2CLVA 1UB6B 4HK3N 4N68A 1OWWA 2K7QA 1SEQL 2EZ0D 3PGCA 1UXSB 2GJZB 1AGFB 2X5PA 5A2FA 1HOCB 4HGWB 4ESKA 5I1DA 4WWKB 4JKKA 3HC0A 5L2JA 1KTLB 5E03A 3EGSB 1BQHB 1NFDA 4G8GE 1WFNA 4JPWH 1FGNH 4JFEB 2J5LC 4Z7UE 1FE8H 2HFEB 3GBLA 4B53A 2VLRE 3IFPA 5I1EL 1TVBB 1A7QL 1T7VA 3D9AL 5EO0A 4XBEH 3K4ZA 4MX7A 4BK5A 4NCDA 4PJIB 3MLYL 3GBNH 4QF1A 1G7LA 5I8KH 2VYRE 4PJXB 2MHAB 4ODXB 1DQQA 2N4IA 4UNVA 1S78C 4GRWF 1S7XB 4BZ2H 4KU1A 5HYFA 2NZ9C 3ECBA 3SY0A 2GI7A 4OTXL 1Z3GL 2D0FA 2HLAB 4NCC2 1CD8A 3EOAB 1A64A 3VXQA 4GKNA 5IV2B 1I8MB 4U0RB 1DDHB 2Z0BA 4PB9H 3BDYH 1QFWL 4JRXB 2ADIA 5D4QA 2J4WH 5DJ6B 3RKDD 4P5TA 3L9RA 4TSAL 5DD5L 3T0EE 8FABB 4DCQB 4H8WL 1U8QA 4DGVL 3PGDA 2X4TB 3C60B 2JTDA 5D7LE 5C7XH 4LFHD 3OAZK 2I9LB 5D71L 2G75A 1A6UH 1I9JH 3QFJA 3S34L 1UM6H 4N8VG 2KQNA 4M4RA 4IRZH 4PJDA 2VRAA 2CK0H 4G8GD 2EIZB 4HBQA 5I6XB 1JZ5A 3GKWH 4H88H 5KTEH 1JPGB 5MP6L 4TUKH 2Z8RA 3ARPA 3SBWC 2WBJB 1S9YA 5C0EB 3RL1B 3N85H 2NY7L 1NQBA 3KPPA 4N0FB 1K2DA 4DFHA 1EEYB 1CF8H 4KTDL 5GRUL 2AGJH 5AD0A 4NNYA 3DRTA 4KK8C 5CUSH 1BEYL 1EFXB 5I73C 4XAWL 4U6YA 3WO4B 5D7IE 4IHOB 2ZG2A 3SDCA 2VWEC 4NNXA 1EA9C 2I5YH 3SJVB 1MCBA 3P4NA 4PV9A 4GRWB 2HVJB 4P9ML 4HZLB 1NFIA 3KDMB 3CFCH 2A38A 4UB0H 2PYEB 1GGTA 1X7QA 1ZHKA 1XF3B 1D6VH 5CP7A 5AG8A 1HZHL 2Y1VA 3C09B 1U8OB 4Z7NF 4J3VA 2IG2L 1BIIA 3FL7A 4HS3B 1RURH 4POZD 2ZUWA 4GAYB 2YN5A 4ZO8A 2R0KL 1CVSC 3NN8B 4L4JA 4Z77B 3BZEA 4LPCA 3WKMH 1ORQA 4GG6A 2YC1A 4FXKB 4APQA 2QSVA 4PV8B 5DK2B 2VLJD 1V7NL 3RKDC 5AAWA 5GS2H 4PRHA 5K9KA 3E6HB 4CU8A 4KHXH 5CHNA 5C6WH 5E2TL 2AJYL 3D1MC 1UWXH 3MMEA 5F6HJ 3MLWH 4P4KC 4PJEE 5IJKC 1BQLL 1I3UA 1MOEA 1T1ZA 2IPTL 5IT2L 3TT1L 1KCSL 1A3LH 1KTKE 4U1SB 3QCUL 1KB5B 4FP8H 4P5TD 4PGCB 3RGVA 3PWVA 3VRLE 2V6HA 5AZEL 1E28A 4JHAL 4MQXC 4NUGH 3MV7A 1ZEAH 5C0IB 1A4JB 2BRQA 4XCYA 4FQ2H 3V8CA 3TBTA 5IW6A 1RUPL 5FOBA 5CS7A 3U9PL 3QFJD 5E5RB 4I3SH 2Q8AH 4V2BA 2DBLH 5IGXL 1KSRA 2OYPA 5M7QA 3DTXA 4KJQC 4RMQA 3ARDB 3FQRB 3KLSA 4A2MA 1HQ4B 4KMTL 2A0LD 1T21A 3CX5K 3GSNL 2ZSWB 4MMXC 1JHLH 3AMLA 4X7DC 3MV11 3MLSL 2N7AA 2YPLA 3U82B 1SJEB 2NW3B 1K85A 2W65B 5CSGA 1DBKL 5DHVB 4OGXL 2P43B 2V2XA 1RZ8A 3LQZA 1IARB 5KSBE 2AXJA 4IMLB 4L1DA 5DLML 1YNKL 1D5ZB 4C57C 3T0EC 4YFEA 3KPMA 1W2KT 1W8OA 4Q2ZA 2YKLL 3WFBL 5JW5A 3STBA 1DUZA 3VFSB 3BP7A 2UWEA 4FNLH 3P0YH 5FUOH 2AI0H 3CFDA 1VADB 1C08A 3SDCD 1PYWB 1L9MA 4ZQKA 1A3RL 3QO0A 4MA1B 4MB5A 1IAKA 1KT2A 5CKGA 5C0AA 1BQSA 4GRWH 3MQIA 4LHQB 5MENE 5I1HL 2H32A 4FABH 2OR7A 2PNDA 5DEFA 5K59F 2CUHA 2Z8VC 5DS8A 3BP5A 3L1OH 3EO0A 4K7FB 3HI6L 4X0KA 1BD2E 1IC4L 1B0GA 3GMOA 1FE8L 2E6PA 4HW6A 5JPMA 3C5ZA 2G9HB 3QUKA 4M3KB 1OT2A 3FZUD 4KUCF 1NCCL 4WTZA 3RHWF 3RVTD 4XBEL 3IJHB 2P44B 4H20L 4QRTA 4YHOH 5EUOE 4M9PA 1QLFB 3NZ8A 3GBNL 3FO1B 3DXAA 2FJHB 5IHBA 1NEZA 1CGSL 2A9MH 4PGBA 1JPFB 4PRBA 5ICXA 4F33A 1D6EA 4YO0A 4V1DE 4WFED 4PJBE 2CGRH 5EPMA 1OAZH 5ETUB 2QQKH 1X3DA 3O6KH 2WM0A 4WO4C 4N0RA 2BRRL 1WWCA 3NABH 2IH1A 1QSZA 2HJKA 5I1IL 2Z31A 2NY6B 3BDYL 2J8UA 3OJDA 1UZ6F 3QAZC 3T0AA 4HV8B 3AXLA 4HHAB 1VFBB 2ZUQB 4ZXBD 1A3QA 3JVGA 5GZOC 1KCRH 2EXWD 1G9MH 1KB5H 3MJ7B 2VDLH 2XWJB 2FEDD 3F12A 2WWKO 4U2YA 3RGVD 5C7XL 1KF9B 2XNAB 1NLDL 4M1DH 3WXWL 3LPGA 4W70A 4WRLA 5MEND 5JW4Q 3GSQB 2XWTB 3LN5B 1BVLB 3R06B 3VFTA 1MJUL 1H3XA 1JV5B 2CK0L 1MJ7H 4OJFL 1AHWC 5KTEL 4NZDA 1LO0H 2A73B 2Y5TB 2W0FA 4FFZL 5H37G 5IB2A 1A6AB 3AM8C 3JTSB 2ESVE 3D18B 2LAAA 1YUHB 2YPLD 3N85L 5GPRA 4OGZA 5A2KH 1CF8L 1UH4A 2B4CC 3O3EA 5DHVH 1ZTXH 4DQOL 1KC5H 1F4HA 4X9BA 4YZFE 3C08H 2Q7YB 4LLQB 2P5WE 2DM2A 1L0QA 2X89A 1NUGA 2FIRT 5E6YA 3RUGB 3REVA 2I5YL 3O45B 2D9CA 3RVTC 3WSQH 2XXCB 1CZ8L 3BWAA 3KPNA 3LKNB 5F1IA 1FC1A 1EHLL 3QDJA 7FABH 3WIIH 3J7HA 5C0AD 3EJYC 4BFGA 4D9QE 3RZCC 4OZIB 4PJ8B 4D8PA 1YNTB 4OGAD 3IVKA 3TP4A 2D31B 3C5ZD 1IEAB 1FL3A 3IFNH 4N90D 3VXME 2UZIH 4PTUB 2QKIA 1WZLA 3DROB 4X6BA 1MF2L 2NY2C 4KPHL 3WFHA 4XT1C 1A9BA 4ZXBC 2BVTA 1BFVL 1A1NA 4ISVB 1NGZA 2VDNH 4IJ3C 4NZTL 1X5AA 2NXZB 4NC2B 1YJDC 2X4SB 3JTTA 3M07A 3RNQB 5JA8B 4Q0XL 2PXYB 4U1KB 1A6WH 3W39A 2BNRB 4K7PX 2F53B 1ED3B 1F8TH 2BK8A 3ARXA 3QWQB 2DYPB 3MLWL 5ITFA 4R7NB 3FRUA 5EBWA 5DO2C 3VE0B 5KBNC 3VDBA 1KEGH 3G6DH 5CLWA 1LNUA 4KUZH 2XA8H 4M62H 5IVXF 4OI8A 3TA3C 3QQ9D 5HHPB 2ZG3A 4LP4A 4NUGL 1DN0B 1ZEAL 3UTPE 4FQQA 4FQ2L 2OJEB 1ZT4B 3D3VE 2JJUA 3BT2L 1IT9H 2XZQL 4D9LH 2DBLL 3LKSB 1AP2B 3LKPB 4KKBD 4NC1E 4NQDB 4MAYA 1T80A 1CTNA 5I74C 4JFQB 4HAGA 3E6FB 3SDAA 1IAMA 3CMOL 5CEYB 4NQCA 4JFPB 4PJ7B 1GXEA 4OFKA 2H2SD 1TZHB 4HUWB 4PRPE 1RIUL 3JUZA 1KNOB 1YMMA 2OXGA 1OAQH 1ZT7A 2IQAB 3ALXA 3JWOL 1U8LB 4XHQA 2ERJB 5LG1A 3H7LA 3P2TA 4O02H 3VWJB 3ZE2E 5I16B 3Q0HA 4FNLL 4XP9L 2DF3A 4W81A 4NQVB 3Q2CA 5F7HA 3PP4H 1IC1A 1MIEH 2XACC 2NTFA 3A67L 4UV4H 2Y7QA 1IEBB 1UQSA 3KS0H 2GSGB 4PJCA 3AB0B 5CZVH 1GIGH 3AREA 4PJ9B 4FABL 4NGHL 5C0CE 4EN3B 3PWNB 1II4E 5DD1L 5T5NG 3L1OL 3MCKA 2UYLB 2AV1A 3OKYA 3NPSB 5KJRH 2KZ1B 4PY8I 4D9RE 3H42L 4JREC 3UTPD 2RHEA 4DFIA 3O4LB 1Q0XH 4Z7WE 5IFHL 2BVOA 3Q5YA 3D3VD 2DMCA 3IDYC 4N1EA 5IVXB 3NMEA 2W38A 4HKXB 3I3DA 4YDJA 4L8DA 3QDHA 1TQBC 5B38B 3GMMB 3QNYA 2X4NA 1WTLA 4P59H 2CGRL 2CLRA 1I3VA 2QQKL 3A6BL 5EZLA 3GIZH 1IBGL 4K23H 2GJ6A 4M7JL 4H26B 4P48A 5J11C 4JFZH 1H3TA 3O6LH 3S35H 3DHJA 4OLEA 3ARFA 4MJ5A 1T0NA 3MNZA 4Y0GA 2KZWA 1C5BH 1KCRL 1ZVHA 5D2NB 1KB5L 2VDLL 3CLEH 4HC1H 4ZOBA 5JIPA 3TJHD 3BYTA 1DQML 4DN3H 3ULSA 5L88L 5D7JC 1QBLL 1TENA 2OSLA 5ACLA 2E9WA 3QDMA 4PJGE 3GI9L 4ODHH 2EC9U 2EEAA 4HLJA 4L4TB 2R0WH 2MQ0A 4L9LC 5LQBL 1LP9E 4MAYD 4JB9H 4O2FA 4NWTL 5FM5M 5KANG 2FWOA 5F7EL 4FQXA 2KPNA 2R1XB 3ULUL 4NQCD 3TZVB 2VC2L 2V9QA 4HBCL 5J3HD 1MREH 4JRWA 5GGTL 4DOHE 2NY0C 4UQ2A 2QQQA 1YMMD 2A6JB 1CD0A 1KIQB 1QSEB 5FDYA 3VDCA 1ZANH 1ZLVK 5DFWH 1VDGA 3IS1X 4LPUA 1F02I 5BMFL 2FGWH 2P4AB 2BVEA 1PZ5B 1JK8B 4E0RA 3D0VB 5INDB 1TQCB 1MQ8A 5I76A 4LAQH 3ZKXB 4HPYL 4HWBA 2W91A 1I8IB 1UJ3B 1QPPA 5JO5B 3RZWA 1TNNA 1FJ1A 3GSXB 5I8EB 4UT9L 3TVMC 4NC1C 3OSKA 3O2DL 1T22A 1UADC 3ARED 3MRQA 5IFAL 3RWJB 2X4PA 4MXVE 1YY8B 3EYVB 2EDHA 3WEXA 4F9LA 2VLKA 2YA0A 2EYTB 3CLFH 1IGCH 5DHXB 1AKJD 1XR8A 2CLZB 5TQ0H 5JA9A 5IUSA 4JANA 5CZXD 1K4DB 1F13A 1LVEA 4I1NB 3E3QE 2VDNL 1HDMA 3ROLB 3W2DH 1N5AB 4G9FA 3O41A 3VGGA 3N9GL 2PO6A 1A6WL 1DLHB 4NO3A 3W11D 4I0PC 2NY4D 1QR4A 5ESQB 1N0LA 3KLAA 2GJ6D 3FN9A 4ODWA 4QRSA 3NCJL 1U0QA 3BQUC 4LOUC 3BKCH 5C0GA 3ESVF 1I1AB 2OTUB 5EIIA 1KEGL 3G6DL 1MCQA 4Z7VA 3ARFD 4Q6IB 1I85A 4KUZL 3PDOA 3HE6C 4MZ3A 5KSAA 4EJ1C 2MQCA 1WC7A 1DBBH 2XTJB 3FKUS 4OCSH 2L4OA 2YXFA 2F54B 3MV9A 1T1YA 4L3CB 4UUJB 5ERWA 3G5VB 3BISA 4ZAKB 3G6JE 1EGJA 3QDMD 1TVHA 4RMSA 3OX8A 1TCRB 4GG8B 2MMXA 4GLRH 2GK0B 5HYQB 1KPUB 1BJMA 5DD3H 1FFQA 4WCYH 2XN9E 1Z5LA 5T1LD 4ZUTB 1LILA 5FDWA 2NW2B 3AS1A 2AJUH 5LXGH 3WL9B 1AIFA 5DQDL 3RWGA 2H3NB 3BHBA 3S4SG 4F37K 1AQDB 1LD9B 1FZJA 3QUZB 4AL8H 3LMJL 2YA1A 3IDGA 4R97B 5D5MF 1JMXA 5MEOB 4WFGE 3M1BB 4PRDB 2JCCB 1ZWIB 1JWMA 3F7VB 1X5XA 1G9NH 2D7NA 4TSBL 3G9AB 3PP4L 1MIEL 4HXBH 3OKOB 4U05A 12E8L 1BP3B 2BOCA 3KYKH 3LPWA 1MFBH 3L3GB 4MB4A 4LCCC 5TPWH 4IOIB 1GIGL 1R3IL 2IF7A 4C56E 1RZJC 2YA2A 4MDJA 5C09E 2XKSA 1X5LA 1K6QH 2H8PA 4FQHB 1X5HA 3GHEH 4ZTPH 2V7HA 5HGAA 2QQNL 1JUFB 4R2GC 5E8NB 1JN6B 4TPRH 2V17L 2VLKD 1MLBA 2R8SH 2CKBL 5IK3A 1U92A 3KPSD 1H3GA 4DVBB 2NNAB 2FBJL 3QBTB 5F7UA 4NRZB 5AZ2H 1SJHA 3L6FA 4JDVB 2VR5A 5CJBA 4U1MB 1N5YH 1UKSA 1S9VA 1X9QA 1XR9B 4PRIB 5ILTL 4P59L 4G9FD 5AUMB 4OV6F 1ZLWK 1U8JB 4MJIA 2XN9D 1CTOA 1U2CA 2PO6D 43CAA 4K23L 4C83B 1HWHB 5KVEL 5JDJA 1T0PB 1J1OL 2I9TA 3SE4C 1YYMH 5I2IA 1Z9MA 5D2LE 4L3EA 3EYOB 4LLUB 1CG9B 1ETZA 5I1JH 2P5EE 1UWGH 4LHUB 3WFEH 4WFGD 1U8MB 1S5IL 1AR1C 1N7MH 2BSTB 3BEWA 4HEME 1MNUL 5DC9B 1YEHL 2HT4C 4LSSH 2AJ3B 2LU7A 3WUWB 4HJ0D 5D5MB 3B9DA 5DGQA 2M8XA 5E6IA 1QZ1A 4YGVB 2FO4A 1J12A 4GLRI 2C5DC 4ODHL 3QNXA 5ALCL 3QULA 3TWCH 2R0WL 1ND0B 5C09D 3E3QC 5IMOB 3ZYJA 4ODTH 4EUPG 2GJZA 5FEBA 3KNBA 1HOCA 4HIJA 4HGWA 1XGYL 3QIUC 4WWKA 1KIRA 5F3HA 2AK4B 3H7BA 5TE6H 2X40A 4Y5YC 1VSCA 3TPUB 2QJDA 4ELKB 4PJHF 1JZ4A 1IM3A 4AENA 8CGTA 4WI7A 3KPLA 4L4VE 5L9DH 1PG7L 1PY4A 1W0VA 5T1MA 2BFVL 4WW2F 1FQ9C 4X8XA 4JM2B 3ZDZF 3S97C 4PS4L 4J3XA 1X5ZA 1R0AL 4HKJB 4LLVB 5CJXC 1TMCB 4ODXA 5J06A 4KZDL 4DVRL 1UJTA 1Z0NA 1S7XA 1IL1A 2VDMH 4G7YL 2VDKH 2ZUUA 2Q8BH 1BF8A 5A2JH 3RPIB 2QEJA 5E8DH 1PX3A 5DMGC 1CDYA 2VXSL 2W59A 3ZZ1A 3IAQA 2NTSP 3FO2A 4DUWA 5H8DA 3OJMB 5IV2A 3AVEA 4LSTH 4NCC1 4A6YL 3D48R 3L5WB 3VDAA 3CLFL 1GZPA 4M7LT 4X80H 2KQMA 1NUFA 3L5IA 1IGCL 1XT5A 4GRLA 2YUXA 1YC8A 1EV2E 3L7FB 1ONQA 4YHKL 4PR5B 5M95B 1FFRA 4RWYH 1LK2B 3F58H 4D3CH 3MREB 2X4TA 4XGZB 3R8QA 3QI9D 3W5NA 3W2DL 4YUEL 5ID0A 4YDKH 5JOPE 1P9MA 2NY3D 1KACB 5CJQL 4ELMF 1Q9LA 4S10A 4MJID 5K9QG 5TE4H 1J8HD 4DGYH 4XNMA 4ZFFA 5INCB 1UM5H 1VGEH 2ZUXA 2E6JA 4MD0B 2BOBA 1JPGA 1VFOA 2UUDK 4L4VD 4QT5B 3GUTB 5C2BL 1A2YA 4PJHB 5L2KA 5DGRA 5IM7A 4NQSB 1FVEB 1KELH 4GAJH 1E27A 5HI4C 2Z93B 4XWOC 4WW2B 2FECL 1HHKA 2ZUSA 5SWSA 3VH8G 3E0GA 2DQDH 3HR5B 3I75A 3OB0K 4IHOA 1GGYA 4NN5C 5C0BA 3SJVA 2AEPH 3SE9H 1OSZA 1AGEA 4ORGB 4F7EA 3MO1B 4PBVC 3T0VA 2E27H 4HZLA 1SVCP 3BXNB 3KDMA 5DD3L 1CGXA 4JN1H 2QADB 4CJ1A 1NBYA 3TJEL 3KYMB 4YXKL 4XCFL 5D1ZA 1A7OH 4P4RB 2V5TA 1S8DB 1XF3A 3HPLB 4JKPL 3RWFB 5CAYB 1FL6B 4DZ8B 3SDYL 3U0PB 4HS3A 4PD4J 1ZV5A 4GAYA 5B8CA 2X4OB 1I7RA 5L8LB 3V7AE 2EIEA 4YEFA 1YEJL 2DOCA 3N0PB 3V52H 5EN2B 4FXKA 4HXBL 3V0WH 5BV7C 3KYKL 4Y1AB 4XPGH 3MFFB 4IRSB 1T66C 4XC3H 3E6HA 5TPWL 4KRMB 4EBQL 5EU4B 4S1DC 4ZUWA 4ELMB 1MFCL 4U6TA 2FH6A 3GNML 1P4IL 1QYGL 2LVEA 5GJSH 1N3NB 1PQZA 1A14H 5IROA 2VAAB 5AYQA 2CUIA 1ZA6B 1F3JB 2VXUL 3EZ8A 4LF3B 5D6DC 4OBSA 4JQVA 4GRLD 5LWYL 5AZ2L 4PG2C 3QEQB 4CMHC 3WIHL 3V6FB 1YEDB 2F19L 1U9KA 1OM3H 5T1KB 1P4LA 4WGVB 2GFBB 4Y4HD 4G9DB 4G8FB 5IIEA 3VWKD 1HXYA 3FT3B 4RFOH 1O0VA 4XMLH 1E6JL 1J05B 1XF5A 5BCAA 3U9UB 4ZUSB 3UC0H 2FZ3A 1A5FH 1HQ4A 4JEGB 3W9DB 1WBXA 2E7HA 4K8RC 2EYSA 4X6CA 1I8KA 4JCMA 1CN4A 1E4KC 5C0NC 2YMXL 1N7ML 3MV8E 2W65A 3TIEB 2ICWB 1FZKA 5L2KD 3DRQB 4LRNH 1UT9A 1WSST 4XNUH 4HD9A 2BSSA 2E9IA 4IMLA 1D5ZA 3T0BA 3LD8B 4ENEC 1ZSDB 5SWSD 1K3IA 3HAEB 3VFSA 3TWCL 4NDMB 4NOFA 4PPTA 2ADJA 4JG1H 1NMAH 2IMNA 4UV7H 1VADA 2QHLA 1MRFL 5DK3A 3Q5OA 4OSUH 4UIMA 5C0BD 1XF1A 2UZXB 3V4PL 1GSMA 1MPAL 3O8XB 4TQEL 1MQKH 2I60L 1ZHNB 1ZS8B 5HHVL 2E7CA 4X4MA 3U79A 1QA9A 5D1ZD 3BD3A 2IGFH 3ULVF 2KL6A 5SX4H 2G9HA 5L9DL 3GSOB 3K8MA 5I1KL 4YHIA 1G7MA 4JN2B 1YN7B 4YHYB 3NA4A 4OLVH 1JNNH 3IJHA 5HI5C 5CGTA 5KVGH 4FS0A 4X8JB 2XQYG 3SCMB 2PW2B 2V2TB 3BUTA 5C0JA 1P84J 1MCKA 2J1KA 5DA0B 2GKIA 1FPTL 4OCRH 4DW2H 3FQTB 2LU4A 3H3KA 4R3SB 3FHQA 4X6DE 2BDNH 4TVPH 3DETD 4NM4H 1G6RL 5F3BB 1QRNB 3VJ6B 4ZTOL 4Y4HC 4BELD 3T4AB 3MV8D 1OW0C 4HV8A 1QVOB 1FVDB 2HA1A 25C8H 4R90H 4X80L 4LLDB 1VFBA 2W9LA 4JO1H 4OKVA 1XCTB 5HHOB 2YXMA 1K8IB 3EOBB 3BRFA 3EOTH 3QEHB 3F58L 4JM4H 5DC0A 2VERN 5FYJD 3KPOA 3OXRB 3MJ7A 1K3ZA 4OCMC 1D5MB 2A2QT 5E99L 2DLFH 4TSCH 1N59B 1KENH 1OTTC 4J6RH 3ARGC 1MCWM 1QR1B 2DQJH 2XWTA 1BVLA 2VXTH 1OTUC 2ICEB 3HZVB 1IC7L 2OL3B 1E6OH 5HVHC 1K4CA 1LO2H 3VD4A 4OD2A 4XMKH 1SYVA 4P2OB 3BAEH 4M93B 1WZ1L 2NXYD 2A73A 3BPCA 5I66A 2XY2A 4FG6C 3MXVH 4G3YH 3MJ8A 1FNGB 2XZAL 4GAJL 4YK4B 4Z95H 3RBSA 4WV1C 4FFWC 1U36A 3IU4H 1QD0A 5GGVH 3HNSH 4RFEB 3DVFA 2DQDL 4OZ4A 5CBEB 2WNGA 2A6IA 2IANE 2AJVL 5E5MB 3TCLB 3U7YH 4UTBH 3LKNA 4JAMB 1CU4L 2C4FU 5L8KB 1J5OL 1VFUA 4UT7H 1AQKL 5SX4I 1UGNA 3MR9B 1MHHA 4JN1L 4BZ1H 4FTVA 1G9EA 2AAVA 3ISWA 4CN1A 1RHHA 3DV6A 3INUL 3FRPG 5FUCE 1NC2A 1YEGH 2F15A 5JORB 4RQQA 4HKZB 1L6ZA 4LPYA 3LN4A 3CXHJ 5JXEA 1JHKH 3C8KA 4X7CC 5ACZA 3QJHB 3WS3A 4P23C 2VNCA 3QT2A 3MJ9L 5GS1C 4PTUA 2Y06L 1F3DH 3DROA 4P2RE 1BQHG 3V0WL 2NR6D 1NPUA 4JRYB 3V95A 1T0MB 4ISVA 1EHXA 3FTGB 4AEIH 1I1YB 2G5BB 4XXCC 4KV5F 4Q6YA 3RNQA 1GGBH 3WN5A 5LGKA 4R9HA 1TETH 2BY3A 5LGHL 2PXYA 1QFPA 3OAZH 5ENWA 1FZOB 4U0QB 1H3PH 2F53A 1EO7A 3TYFB 1I1FA 2DYPA 4X5WA 4O9HL 5JLZB 5A3ID 3HNTH 3BH9A 3I3BA 5C0RH 4MWFB 5BVJB 5D1QC 2Z92B 4Q97A 4FQJH 4K7PH 5T3ZL 1FL5A 5HHPA 2IAND 4ZFOB 5BXFB 1T04B 1M7DA 1EVUA 1RIVL 3MUJA 1EBAA 1A4KB 2F8OA 3BN9D 1K8DB 1QP1A 3VRIB 5J7CC 4KAQH 3CVHB 5ICYB 2C3HA 2R69L 5HYJA 3LKSA 3LKPA 2EC9T 2I26N 2X10A 4LLWA 2YSSB 4K3DL 4OCXH 3CSBA 2LV4A 1XAUA 1A5FL 2OL3H 1ITBB 3SKNA 3BZDA 1NGPL 2YD1A 4G43A 3FB8B 2DS4A 2HTLD 3FFCA 3TFKD 5F7DB 5KZCB 1KNOA 4GW4A 4NO2A 2BZDA 4RFNB 4OFPA 4M48H 3ULVH 2OQJA 2J8OA 5F96H 4BSJA 5GZND 2WV3A 2YRLA 4F7CB 5I16A 2ID5A 1JTOA 4JG1L 4PGDB 5D1XC 1XIWB 1ZGLP 1FG2B 5EZOL 1MRDL 3ILPB 4OSUL 1VGKB 5ECJE 3EYFA 4F15B 1U58B 4J2XA 3H9SE 1MQKL 2GSGA 4WTWA 4DKFH 2R9HC 5C07B 2WINA 3V0VB 3P9MA 5B4MD 4U7KA 3MRRB 3MBEB 2HP4A 4FTVD 3BJ91 4JO4H 5I1CH 2IGFL 5FECA 2ZCKL 5I75C 4YDIL 1NCBL 5T5FH 1NC2D 4OM0H 1OTSC 3S5LG 4WW1A 1HHJA 4JY6B 1ZVYA 4HPOH 3VGDA 4EIGB 3MA7B 3MRNB 5JPNA 4FZEL 4OLVL 5JXED 1JNNL 3UZEA 3V9FA 4Y4FA 2HFTA 5GSRB 1GGIH 4RIRB 1A9EA 3GI8L 5L7XH 5A3IC 3E2HC 2B4CL 5IVXA 5GISH 4HKXA 1T20B 3H0TB 4DKEH 5B38A 1CL7H 4OCRL 5C1MB 2E7BA 5HHXL 4H1LG 3BPNC 1HIML 4TVPL 2YZ1A 5L0QC 4NWUH 3KJ4C 4HIXL 4HUUA 4NN7B 3DX8A 4X4ZA 4L29A 2WWKT 2HH0H 4MHHI 4IRJB 3IF1A 1ZLUH 1FIGH 1BVZA 5SWZA 4CJ0A 1FG9C 1MI5B 4CN4A 1NGWA 3GB7B 1ADQL 1KUMA 1BWMA 2YD4A 2R0LL 2VITB 1JWSB 2A9NH 5HGHB 5FUCC 3QUXA 4QXUH 3QZWG 5DJYB 3WLBB 2W1NA 4JM4L 3G08B 2JIXA 3QDAA 2DTSA 4D0BB 3HNVL 5DI8A 1JGEB 5F8QC 1D5BB 1MHCA 2GTWB 2DLFL 4PLKC 3MYJB 4NQUA 4W68A 4J6RL 4QHLA 3TEUA 7CGTA 1MEXL 2OBGA 4WEMB 3NOIA 4RGMC 3MRCB 3CVHH 5HYJD 32C2B 1E6OL 4HFWA 5CGMA 5F6IB 4XMKL 1HN1A 2B0SL 2DTMH 4Y2DA 3S4SA 3M8OL 4MYWB 1MAML 1JYWA 3HCVB 1KIUA 3FFCD 1DQTA 5EOCJ 4G3YL 3BGAA 3U2SB 4UU9A 2AJSH 4KJWD 4Y16C 1KOAA 5FKPB 1FHGA 2ORBH 3MC0A 1ULVA 1NMCC 3ZO0A 3N1GC 3U7YL 5INDA 5EO9B 3D69A 1IEHA 3RWDA 4NKQB 4MS8D 1UG9A 2GSIB 3MTRA 2NLJA 5I8EA 5DJZB 5TQ2L 1AO7B 2ED8A 2OM5A 1LEGB 4OZFG 5EOQL 1I7UA 2RBLA 3RGHA 1Q72H 3DIFB 5IQ7H 4NZJA 1YY8A 1I7TA 4XCEB 1CFNB 1NLBH 4APQC 4XPAH 5IBTH 2EYTA 3T3PE 3JWNC 5F9OH 2EYRA 3BVNA 1I3RA 4XI5D 4KKCD 3HI1B 4Y4FD 3W0WE 1R5WB 3EBAA 1OP5K 2VLMD 4XNQB 4RDQF 3GSVA 1K9TA 2DQHL 1AY1H 3EYUL 3ILQC 3ZL4L 4QXGL 5BW7A 4AEIL 1FGVL 3KPRE 1G7PB 3BSZL 2X9XA 3QB7C 2J12B 4JFFB 4H0GA 2VE6A 1VKXB 1GGBL 2EC8A 4KK9D 2FL5A 4KMQA 5EU5B 4HCRA 1TETL 4B7IA 2IQ9L 3K8KA 2V5RA 1M1SA 4XHJD 3KG5A 3QYCA 1OGTA 1GZQB 1AI1L 2Z8SA 2Q76B 5SWZD 4LMQI 2CPCA 2WIIB 3SKUD 4UINH 2OTUA 2ARJQ 2B5IC 1QHPA 1N8ZA 1NSNH 1IFHH 3QUXD 3GGWA 3WJLC 3FB5A 4FQJL 2BCKB 3QDJE 2R56H 4K7PL 2HKHL 2JIXD 4JFHD 2X7LB 4FFVC 4FXLA 4MZ2A 4M7LL 4L3AA 3NIDF 1ZK9A 2F54A 3FOLA 4L3CA 4BKLB 1JPTL 4L5FH 3UTSE 3PXJA 4QRPB 2A83A 2YN3A 4RSVA 3UDWC 3B9KB 5IJVA 3AU1A 3NIGE 5A16A 5T3XE 4RGNE 4E41E 4F80A 2GK0A 1G7HB 4S2SB 4U1GB 4PYGA 1T7XA 1J7VR 3SKOB 1DQDL 4Y2DD 2DQIL 4YFLI 4LKXB 3MOBH 3WL9A 2H9GB 3W0WD 4I2XA 4M7ZC 4M48L 2J6EL 1AC0A 3QUZA 4FZ8H 5F96L 4XMPH 3NCMA 5J12C 3SPVA 1EAJA 3NH7H 2W9EH 4PRDA 3KPRD 1ZWIA 5JW4N 3CZFB 4DAGL 3FMGH 1UENA 1KPRA 5E70A 3OKLB 3QIWA 1T1XB 4KKCC 3TV3H 1WVZA 3O9WB 3EJZD 5DA4A 4IOIA 4DKFL 1CQYA 2VKXA 1FYTB 2VXQL 2CJUH 3GK8H 4JO4L 4FQHA 5SWQA 2FX8H 1EJ6A 5MHSD 2RCSL 1JUFA 1TZIB 2FD6H 2ZJSL 1JN6A 1I9RH 5FA3B 5TH2A 3UBXB 1R6VA 3QUYA 3MBXH 4XHJC 4M1CD 1T5XB 4AMKH 1RUKL 2HTKC 4I18C 2A77H 5GISL 3ZHLA 1A1OB 4NRZA 1FNFA 3IJSA 4WY7H 4JDVA 5D93C 3U7WL 3GMRB 4YX2H 3AAZB 2FEEI 2Z31C 4PRIA 5JW3H 4N0UE 2Y36H 5ALBH 3TO2A 1KJMA 4K3HA 3FJTA 3DI2B 5AUMA 1IGJB 4MSWB 3GEWB 3L3HA 4M6MH 1CT8A 3JVGC 3WD5H 1Y18A 3U1SH 1CFTB 5DT1H 5IMLB 1RAMA 4IMKA 3ARBA 5EU6E 1VEMA 4M8VA 5J9PA 3VI4E 4JFYB 4PTTA 4LHUA 2XPGB 4ZPVB 5KSUB 2VDPL 4K9EC 3MRHB 5DJ2A 3OPZH 1WIOA 3CFBA 3ARVA 4LVNB 3EKCA 1SMOA 3VH8A 3VXRE 5DRZA 3L3OA 3WUWA 3SGDH 5D5MA 3U6RB 4ODBD 1GGCL 3MUGA 4EXPX 3SE8L 1RK1A 3VGEA 3ARZA 1QBMH 2I07A 5E9DE 3MRFB 5FUZH 4YPGB 1G84A 2E8ZA 2W07A 2KUTA 4BYHA 3MRLB 3HS0A 2X4QB 2DTML 3CH1A 3I50L 1U3HC 3MLTB 1NKOA 1GCFA 1PLGH 3I85A 4WIQA 4HF5H 5CD3A 3MRMB 4S1RH 2VABB 1BBJB 2UV3A 4PD4K 4D2NA 3O6FC 4IIQC 4F37F 1WFUA 5FCUH 5JUEH 1S7RB 2H26A 4V2CB 3PQYA 4HZAA 2AEQH 5DRWB 4F7TA 1QSFA 1S7TA 4OZGF 4KK5D 1FLRL 5C08B 5FYLH 3L7EB 4NQEA 4QHKJ 1VERA 3QQ3A 1NCAH 3QIBC 3QIWD 4U6XB 4Y19B 4MA7L 3IDXL 3RWIA 3WS6C 2GAZB 3QH3A 3BFOA 1KXQE 2ARJB 3W5MA 5DD0H 1A8JH 4RGNC 1JGLH 2JJSA 4XWGH 4JFXB 4NKMA 5IQ7L 2EXYD 1BLNA 2DMBA 1AGBB 5DZLA 3GMLB 5FV1L 5DVMA 3IFOB 2CXGA 1D5XB 1MJJA 1F6FB 5F9OL 5ITBL 2NY1C 4K3JH 4QYOA 3QUYD 3U4EB 1AGCB 4HLZH 4HH9A 2DQGH 3CAFA 3SDDB 2C3XA 1LK2A 4M4PA 5EULV 5IB1A 4YQXL 1JPSH 5E9DD 3WCYA 1RULH 5JOFB 2HFGH 3MRGB 2IBZX 3DBXA 5GGRA 1UB5B 2H6PB 3TNMA 1FLTX 2Q87A 1B0RB 5LCVL 2G60L 3B43A 4PUBH 3VFRB 1F4YH 1G0XA 2FEEL 4LGPB 5I17B 1X5IA 1UWEH 3S37X 2YBRA 1AR2A 4LLYB 5KS9F 2EIDA 1DVFB 3ARBD 4BQ6A 3PWLA 3SGDI 4QRRE 1VACB 3RJQB 4R0LB 3GUTA 2BY0A 4OZHF 3KVQA 3GSNA 4UBDC 3FQUB 4JO3H 3IJYB 2R56L 1BX2A 1F5WA 1FVEA 3EO1A 1EH9A 4M5ZL 2JLLA 1TJGH 1NAMB 4MNQA 4YNYB 2FJFA 4L5FL 5I71C 4PJAF 2A6KA 1INQB 4OZGB 2NX5A 4YBLC 3SDAC 2Q3AA 4MJ2A 2CR6A 1ZLVH 3T2NL 5LVEA 2CXKA 4ZPTB 2EH7L 4DTGH 4PP2A 5FGBC 1SMAA 4I3GA 1X6NA 3BXNA 3QG7H 3P0GB 1RZFH 5EOTB 4HT1L 1FNSH 2WUCL 3BKMH 4IM8A 2FB4L 4P4RA 2VUOA 4R7DB 3CC5A 4EQ2A 3VXUD 2HJLB 3L3DB 3VXSD 2F9BT 4DZ8A 4K3EH 3U0PA 1A1MB 4U1HA 4B50A 2W9EL 1UA6L 1CFQA 3MRKB 1DCLA 1HILA 3PQYD 3SDXB 5EB9A 3FMGL 1QSFD 4Z7UF 1JTTA 3FCTA 4N0YL 5EN2A 5E2UL 1TPXB 1H5BC 1M7IB 2FNBA 4NQED 3TV3L 2AVGA 3MFFA 2GK2A 1LE5B 1RU9H 3F62A 1A7BA 4RMTA 1OF2B 5C9KA 2DJ4A 3LH2H 4OAWB 3BO8A 5H35B 3U83A 1AXSB 5I73B 2YWZA 2XZCL 2CJUL 3FOMB 3LQAC 4QRRD 1MWAB 5GSVB 1T2QH 3MV9E 1U8HB 3U46B 2FD6L 5DD6A 1F3JA 1W8NA 3NCBB 4I77H 3MBXL 1K5NB 2W60A 5DDHB 3CZJA 4OZHB 3O3AB 3MGTB 3G5YB 3KR3H 3QEQA 3SKMB 4YPJA 4WY7L 5E08L 4ZSOE 1YEDA 5EUKB 2R39A 2MKLC 5DMKB 4G8FA 4G9DA 1Z6JT 3VXOB 4PJAB 3GO1H 3MLRH 3I84A 2BMKA 2X4RB 4Y4KA 3BH8B 2E7LC 3UTZB 1Q94B 5MEPB 3WD5L 3ALPA 4WU7B 1T7ZA 3U9UA 4U2ZA 3BPLB 1GGUA 4ZUSA 1MJ8L 1ERNA 3DUSB 4XVUC 3LRGA 1GOFA 4LSDA 1M71A 3MGAA 3TIEA 1LE9A 3MODL 1EO8H 2X2YA 4YH6A 5AYUH 4G5ZL 4FQLL 1WCBA 4G8GB 4MNQD 1ZSDA 1CICA 1RIHH 3HAEA 3LB6D 1NAMH 4LCWE 5E8PA 2NX5D 3MROB 5FUZL 1MAKA 3HRPA 1DBML 5TDOB 1H8NA 4Z7QE 5IMMB 4L1HA 5JXAL 4HX1B 2C4FT 1MLCB 3VMPA 1IAIH 1TJIL 3KLHD 4HF5L 1ES0B 2WWMD 3D39D 3B3IB 3P77B 1J88A 3L3KA 3MRIB 4LSVL 3GSOA 3WXVH 1QNZH 2CLVB 5I18H 5FCUL 1FFPB 3SN6N 2AEQL 4PJDF 1KJ2B 1OY3B 3PGCB 2FX9H 4X8JA 5FYLL 3SCMA 3K2UH 4U3CA 1NCAL 3VG9B 3DYPA 3ZKQD 3HC0B 3HUJA 5L2JB 3T4YA 4K71C 3FQTA 1NFDB 2X9YA 2A1WL 3ARTA 1HXMA 4WUKH 3IFPB 4ZNEA 1ZHLB 2AXFA 3VJ6A 5CP3A 5JR1L 3CJJA 5FM5O 3T4AA 3ES6A 3RVUC 5EO0B 4LSUH 3DMMA 1MWAH 1ZLWH 4MXQD 3VMNA 4QF1B 5HDLA 5CJOH 2VLJB 4GXUN 4JDZB 1U3JA 3IDMA 3JZ7A 1LO3H 5EBMA 2DQGL 1XCTA 1DQQB 5HHOA 3EOBA 3TNNB 3UAJD 4EDXA 4PJEF 3S3SA 4W4NA 4LCWD 5LAXA 3VFOB 4KKAD 2EECA 2J88L 4UTAH 3SY0B 4LEOA 3W9EB 2HFGL 1RY7B 1YYLH 2ZCLH 4JFEE 1YY9D 3RWHA 4O2EB 4GKNB 3VXQB 5HHNA 4M8QB 1V8HA 4NRYA 1HK6A 5FYJU 2ILLA 1FNAA 1WF5A 3RVVC 4Y4KD 2JB5H 1F4YL 2ADIB 2ICEA 3N1FC 4UDTB 3T0DA 2OL3A 2F5AL 5BJTA 3VG0L 5JTWA 1UWEL 5KSAC 3LB6C 4P5TB 3L9RB 1T3FA 4MDIB 4RGOH 5GRWA 4PJIE 4P2OA 1I9IH 4O5LL 3BESR 1LK3L 1D9KD 1U8QB 1TJHL 1C8PA 1SM3H 4GG6F 3PGDB 3TO4A 4PJXE 2DMKA 3WKNA 3FONB 4XVSH 1P4BL 2EDXA 3V0AC 4R6UA 4EI5C 1KXTB 3AFLA 2GEEA 2DQUH 4KK6C 1FNGA 3QAZB 3QFJB 3ZE1F 3KLHC 2F8XC 2VQUA 4PJDB 3FAXA 1UM4L 3RTQD 3K2MC 4RFEA 5F9WB 4TUOB 4PGJA 3V6OE 5IESL 5K9JL 1CICD 2GW5A 1MUJA 2FBOJ 1JZ7A 4JRXE 1DLFL 3HI5L 4OT1H 4PJ5A 3H9ZA 5FV2A 4DN4L 3ARWA 4DTGL 4NM8H 3LHPH 1AH1A 2HT2C 1RZFL 1FNSL 3KPPB 3S5LA 5HHQB 2X70A 1EFQA 2COQA 2Y5EA 4FQIH 5AD0B 4KJPD 2N7BA 2RR3A 3DRTB 4HKZA 4HUKB 4K8RL 4XP5H 4NYLA 2HVKB 3SDCB 4NNXB 1DJSA 1YQVL 4K07A 4PP1D 3UJTL 2HRPH 3ZTJG 4Y8AA 4F7MA 1W0WA 1WT5A 1KCVH 4H1LA 3T08A 3BP6B 5EDXA 1MCCA 5GGQH 4WJ5A 1I4FA 5HVGB 4HWUA 1X7QB 5KAQF 5EUOF 1ZHKB 5CP7B 4KRPD 1F6AA 4KKAC 1S3KH 4GAGH 4LQFH 4WI9A 3RHWK 2VZUA 3I2CH 3QCVH 1FZOA 5DF0A 3VGHA 1GC1H 4MNGE 3WJJC 2VOTA 2GUOA 1CDHA 5MI0C 3BZEB 4Z7OF 4PJBF 3DMMD 2UWEF 1HQRB 3CFJB 4MWFA 4GG6B 5KVDH 2YC1B 4DEPC 4LASH 5ACMA 5BVJA 4HFUL 4XP4H 2GTZA 3CH8A 3KR3L 2UUDH 3GMPA 1FO0B 4X5XB 4XTRD 2PYEE 5DQJA 3ZT7A 1G0DA 3P3YA 1G7IB 5IBUG 3MLRL 3VRIA 3AC0A 3MMEB 4PLOB 1KTDA 1LGVA 3ELAT 4LVHC 1T1ZB 2GY5A 1A6VL 4Z0XB 3GMNB 4ZXBB 2CR3A 4YHLL 4P9HC 2DD8L 3DURB 3OB0H 2HWZH 3RGVB 3PWVB 3TO4D 5E6IC 3ZDYE 1E28B 3AS2A 2D03H 4R26L 5B21A 1CBVH 3TBTB 5IW6B 1R3KB 4GMSL 5B39G 3JV0A 2JJTA 5MENB 1CDUA 2PYFA 1P7KA 5GGTA 5E2WL 1EEQA 1RMFH 3DTXB 1GPOH 2ZSVB 3LS4H 1JYVA 1T21B 1FG2A 3ILPA 4PJ5D 4YZFF 3VI3F 3HE7A 1EVTC 4OZFA 2YPLB 3C6LA 3RVWC 3HFMH 1EXUA 4P2QA 2O26U 4G80A 2IPUG 5HSFA 3CSYB 2V2XB 2F74A 3MRRA 1IILE 3MBEA 4QXWA 3QJFB 4G6KH 4HJJL 3O2DA 2FATH 4P5MA 4Q2ZB 5GJTH 4O00A 5JW5B 4J4PA 4PJBB 1IVLA 1DUZB 4M61B 4Y5VA 3BP7B 3DI3B 3D2UD 2UWEB 4Q9RL 1TNMA 3BD4A 4EEEA 4ZS6C 1G1YA 3ZTNH 5GGRY 1BM3H 3K4AA 3GKZA 1IAKB 4G6JH 5C0AB 3VFVB 1AGDA 4QOKA 5IEHB 1VEPA 3V6OC 4ODVH 4U0RC 3BP5B 4X0KB 3EO0B 5DS8B 2PN5A 1YPZA 5HI3C 1B0GB 3GMOB 3QDGE 3VA2C 3ZLQC 1W72L 4Z7NE 4WUKL 4YXLH 3C5ZB 5D72H 3QUKB 1LO5A 2P8MB 4QY8B 2CK2A 5I9QB 3AS0A 4MQ7A 4KH2A 1FBIH 3B5TA 3C60C 4PJFE 3V5HB 4D0DB 4OIBA 2VITA 2C1OA 5HGHA 4X9IA 5ADOL 4I0KA 4AT6A 5DJYA 1FORH 1NEZB 3WLBA 2ED7A 4PGBB 1KJVA 4F33B 1D6EB 4YO0B 3LEXA 5EPMB 1D5BA 1YYLL 2ZCLL 3PL6A 5I6XC 2ZKHL 4NN6B 3F7QA 5DJ8A 4G6AC 2IH1B 2HJKB 1RUML 1KLUA 1KCKA 3OJDB 3CU1A 2JB5L 5DEGA 3AXLB 32C2A 2WBJC 4RGOL 3IETA 1SM3L 3S36X 3GRWL 1NANH 2ZNXA 3P4LA 4XVSL 3C6SA 3V5DA 1HWGB 4PG9B 1MFAH 2O5YL 5DJCA 3OTTA 2AK1L 4NZUH 5I8OH 5J11B 5EZJA 3ULUD 5IWLC 1N6VA 4ODUA 1GHFL 4ZDHB 2ZCHL 1HSAA 1PDKA 4KY1H 1EPFA 3QDGD 4KDTA 1U91A 1WIUA 1XZ0B 4OT1L 2DQEH 2MNUA 2P42B 5EO9A 5DYOB 2R29H 2W0FB 3PHOA 2WP3O 1QFHA 3OKDA 1U3ZA 2ZWLT 4CVZB 3HE7D 3C09C 2VDQH 1OPGL 3FQWB 3C6LD 4AZ8A 5GGSY 4P2QD 1Y6MR 1I1CA 2Q7NA 2WW8A 2C4XA 4LU5H 4RISL 5KAQG 2ZOLA 3IXTA 4AY0A