5E6IB

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
241
structure length
241
Chain Sequence
AQVTQNPRYLITVTGKELTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSLIYPGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 241
sequence length 241
chains with identical sequence H, L, Q
ec nomenclature
pdb deposition date 2015-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iB02
1R3KA 3FO2B 1JJUA 4LSRL 4WW2B 2HTLD 1ODAA 1IAIM 4ELME 5CAYB 3MR9A 4DN3H 3LS5L 5K9OA 3BEVA 4Y5YC 4MSWB 3QEGL 5CGTA 3H9SB 5JO5A 4P59H 3GHBL 4UV7L 3NCJH 4BSVA 2YD2A 2MPAH 2EIBA 2DBLH 1YECH 1UADC 4N5ED 3BP5B 1ZHLB 2BXZA 1AO7E 5KS9B 4DKDC 1D9KA 5I1DB 1S9YA 4MZ2A 4Z18A 1JZ2A 3CDGB 4GQ9L 1OM3H 2V5YA 5GS0C 3GBLA 5MEND 1B6UA 5DA4A 2CK0L 1FVEA 2G75A 4P4KA 4D3CL 2OJZL 4PRPA 4JY5H 5SX5K 4RAUA 2YD3A 4GAYB 2APFA 2PYFA 1ZMYA 1UXSB 1KGCD 1KCVH 2J7LA 2C4XA 5GZOC 4CU6A 3P11L 5JW4N 1P4BL 1JYXA 2YC1B 5D7LD 1EO8L 1HHGB 4Y1AA 3W39A 1MJUH 4WDIB 1MFDL 3ULUH 1AY1H 1LO2H 3BEWA 3D0LB 3BD3A 4KRNA 5BOZG 4JFYB 3DRQA 4RZCB 2G5BA 3KR3L 4U49A 4W6WB 1AH1A 4Y4FD 4Z9KB 1OOAA 5HPMA 5ITBL 2YRZA 4WJ5B 5FHBH 3CPLB 4P2OB 3MROA 5DJ8A 2UUDK 5TGBB 3SOBL 1MVUB 5T33H 2FJFA 4OTXL 3EO0A 4F2MA 4JO4L 5D5MA 5CZKA 4NFBA 3PHSA 4P5TC 5C0BB 3D0VA 3UTTD 4X80L 5FUZH 5CKGA 3WSQH 4XZUB 4L9LA 1WZLA 4NZJA 1QBML 2GSIB 2VN7A 5KSVA 3QT2A 5D7JB 4ONOA 1FORH 3SKOB 5JW4Q 2Y7QB 4D8PA 2PYEE 4E0RA 1F3JB 5HYQB 1DJSA 4XXDA 2OXHA 4HUXA 1N5AA 3UAJC 1TVHA 2DWDB 4NZUL 1EIBA 3RL2A 3WNMA 5LGHL 5EBMB 2ICEA 3BZ4A 5IQ9B 4N0UE 1F58H 1PGRB 3GMNB 3NH7H 4I5BB 4MQSB 4X0KB 2NY6C 5C0CE 5IB5A 5C0NC 5EUOB 3GRWH 1CDIA 4IOFC 4UB0H 5CLTA 1C08B 3X14A 3TPUA 4X7DC 2YD4A 5T1DL 3SCMD 1WFNA 4PJEB 3FQXB 5IV2B 3O3UN 1BFVL 3STBA 2E6QA 3H42L 4S1DC 3ME0A 1GPOH 2GIYA 1BZQK 1T04B 3PDDA 4GKNB 4HXBH 1CDYA 4RFEA 4GG6E 1SJXA 2XNAB 3LQMA 3RKPA 4C58B 2O5XL 3MRHA 1EEUA 3LN4B 3BP7B 4AEFA 4KH2A 2FGZA 1BBDL 5F1IA 1QRNA 3F7PC 3INUL 3QRGL 1WZKA 4G7YH 4G8GE 3KLHD 2HT3D 3BPLB 3QULA 4R4FH 3QNZA 4TVPE 1MQKL 4WW1B 1D5BA 3GMQA 1GYAA 3SKUD 4EIZC 2F58L 3VXSB 3SGDI 3EOTL 3MXVL 3SJVB 4PJDA 1A1NA 4MA8H 4WU7B 4S1RH 5DSCB 1Q9WB 2XN9D 1KPRB 4KJQC 1NGPL 1CDGA 1CI5A 2Q20A 4DEPB 4G7VL 5ACLA 3LKOB 2QQLH 1J05A 4ZPVA 5GGSA 4GKSB 5DI8A 1NFDF 5L8LB 5HYEA 2KDGA 2PW1A 3BZDA 5MEQA 1FFOA 3QH3A 3WLWC 3TFKD 4UINL 4OF5A 2DWEA 5MENB 4FS0A 3ILQD 4JFXA 5D7KD 1A6ZA 5CMAB 3L3GA 5JXAH 4JVPA 5C0AD 3HAEB 1UH2A 5ETUA 5JNYB 4CVUA 5I8OH 3ZL4L 1I8LA 1XCTB 4OGAD 1M71A 3F5WA 1BBJB 5D7LB 1RY7B 1ZEAL 3TLRA 2X4OA 3RTQD 1LDPH 2F53A 3RKDC 4Q9CA 1GGBL 3GSQB 3V0WH 3IFNL 4R4BA 4Y4FB 4NQDE 1T0NA 1JPFA 3CFIC 4UDUB 2P24B 2MKLC 4GJTB 3HLAA 3UYRH 3HC0A 1V7MH 5B22A 2WM0A 3MLXL 4Y4HC 3AXLA 5DVMA 4W81A 2E9JA 1IGYB 2XPGA 4LLWA 1FLRH 4J8RB 3SBWC 1I7RA 3FAXA 5E08L 3WJJA 1JNHA 3AS0A 4KPHH 5LCVL 3EJYD 3VD3A 3THML 1JTTA 3MJ6A 2NW3B 3ZHDA 2DB8A 5T3XD 4MYWB 3MO1B 4H0HB 4I77H 1C5BH 4PG9B 4NQCD 3LRSA 3X13B 2PR4H 3LDBC 4K3GA 4Y16C 2D9QB 4HWEH 3TYGH 4Z76A 5BS0A 1XF1A 4WHYG 5D8JH 5T3ZL 3U6RB 1U8KA 4UDTA 5IROC 1BQUA 4EKXA 4P57A 5HVGB 1RVFL 4YPGB 3U46A 3WV0A 1HSAA 2X4RB 3QCVL 4OCMC 1EGJA 2J4WH 1HOCA 1YEEH 1WWWX 5GGVH 2X05A 2MCPH 5BRZD 5AG8A 1WTLA 3GB7A 1RU9H 3ULVD 3HE7C 1CFQA 5AWNL 5J1AB 2FHBA 3SGJA 5B4MC 4U3CA 5FUCC 5KSBF 1Z5LB 4TTGA 1NPUA 2YD7A 3SCMB 3C5SB 3ILPB 1JFQH 1KJMA 3IYLW 4K9EH 5L88H 3QCTL 1C5CH 4LPYA 1WSST 1HHKA 1K5NA 2DM2A 2VDKH 1L6XA 1EH9A 3ULUC 2AJ3B 1MF2L 1AGDA 4YDKL 5C9KA 1IQDA 5TDOA 1U8OB 2EKSB 1NGQL 4QHLA 4NO3B 3GUTA 1ZLVK 4KRLB 1RJLA 3BGMB 1AO7D 3TBYB 3NABL 4R0LC 5T5FL 2EDNA 4QHUB 2VNCA 3QQ3A 4MS8D 4WFEE 4J6RH 4V1DE 1Q9OB 4BQ6A 3DGGB 1KIPB 4M8VA 4WWKA 5IWLC 2H9GA 4UOW0 3QQ4A 4I4WB 2XN9B 3BW9B 3Q2CA 4KQ4L 3IS0X 3PIQB 1ZS8A 3JZ7A 1SMOA 1CR9H 4YR6A 3FL7A 4HCRH 4JFDE 5SWSE 3VFSA 3WDJA 3R06A 3AY4C 3BWAB 4Z7VB 3ARRA 4HH8A 3CVIH 4BM7A 3NACH 3B5HA 5GGUA 2VLKA 1OP9A 1XGRB 3T3MF 5D1ZC 2JJSC 5EFIB 3G5ZB 5A43C 5C0AB 4TSAL 3C6SB 3ZKNC 1KLUA 3MRBB 4ZTPH 4P2QE 1MRCL 2X7LB 4P2YA 1QHOA 2MQCA 4LIQE 1JWSA 2C7UB 3LEVL 3QIWD 1ZGLA 3VWKD 1FG9C 3RWJA 1E4KC 1FNHA 1T80A 4JO3L 4XPBL 2RIKA 3PNWA 3RTQB 1OAQL 2WUBH 4N0FA 3WIIH 3T1WA 2HWZL 4J3VA 4B0MM 1LNUA 4A6YL 1DBAL 4JDZB 4APQC 1LO4L 4JRYE 3S35L 3DYOA 4MHHI 4A6YA 4LARL 1CLZH 2YD6A 4HGWB 1J5OL 4XC1H 1YEJL 3RVTC 4DOHE 2PYED 4WV1A 2Z91A 4KTDL 3L5XH 4HKZB 3OXSB 3GMLA 4LRNH 1V7NH 2YMXH 1CE1L 3W0WA 2W07A 1GOFA 2AV7A 4X5WB 3SDXE 3RDTD 3VGFA 2VDML 4KI5E 3E6FB 3TBTA 3VA6A 4HDIA 4JKMA 3QUZC 4RWHA 8CGTA 1BVKB 4OLEA 1BZ9A 5HDBE 5C0CD 4NKOA 1PBYA 1CWVA 4NQCB 5MEOA 3NCCB 2GJJA 2KZWA 1HK6A 4U6YB 4HS3A 4K23H 1CXLA 1DE4A 3MRCB 1NL0L 4U1SB 3QIUA 4LAQH 4M6MH 4GQPH 3NCFB 1R24A 4PJ8C 2BVQA 3SKMA 3FB8B 2HH0L 3QAZC 3VFPA 3FMGL 3K4ZA 2DM7A 2H8PA 3LPGA 5I8EB 5GS2D 5FYJL 1I8IB 4LVNC 4KKCD 5BRZB 4LCUB 1K8DA 4EI5A 4G6KL 3QIBC 4KDVA 4YZFF 3TM6A 5EDXA 5E9DA 4F9LA 4GW5A 4G8GD 4PREB 2VDQL 1YEDA 3G6JB 3JV6B 4NHUB 3OAUH 1KTLB 2BSED 1F2XK 4JFQB 4TVPD 3WS6A 4FMKA 1EHXA 2W9DL 4GXVH 2AI0H 1A6UH 4NC2B 4PGBB 4JKWA 4OB5H 4KY1H 1KB5L 1H15B 4KAQL 5E94B 2AXGB 3OSKA 5IVXE 1FGNH 4HG4J 4QWWD 4PJIB 1X4YA 2YBRA 1U8MB 1WC7A 2XICA 1AXSB 1KB5A 4K94L 2YR3A 4B7IA 1A3LH 43CAA 4Q9RL 4C57C 3K4DA 1MUJB 1I1AA 3ULUF 1SEQH 3L1OL 2HAZA 2P8LB 1IGMH 4Z77B 2CXGA 1HI6A 2DQIH 1PKOA 5LQBH 3BI9X 5MHSD 4JZJC 4OLXL 5DD6A 4XAKE 3D69A 4B53A 3PV6B 4F7TB 4XHJC 2CRMA 3CC5B 1JK8B 1FFPA 1SYSB 5DJ6A 1OCWL 3QJFA 5BV7C 1AO7B 3PDOB 1ZHNA 4WO4D 2H6PB 2CIIA 4IIQA 5IOPB 1FNGB 2FL5A 5B21A 1A1MB 4FABH 4JG0H 4M7KH 1X5KA 5EO1A 4Q74A 4AG4H 4R96A 2X6MA 4Q2ZA 3DROB 4X99B 3VFWA 3RPIA 1S7QB 1A6VL 3K3QA 3AB0C 3U4EB 4OLZL 4BFIA 4LKXA 3V8CA 4I18B 4I2XA 1G7PA 2ZWLT 3QDAA 2DQCH 3TNNA 2OR9L 4WHTA 2BOBA 3ZHKA 2DKMA 1JP5A 5FO8B 4NM4L 2UY7A 1PZ5B 4X7CC 1RHFA 4RGNE 5AAMA 4MA3A 3UJJH 1SJHA 5H2BB 1UWEL 5HYFA 4WY7L 4RFNB 5EU5B 4JKPH 1JHLH 1IEAB 2IFFL 4MNGE 2IQAA 3C6LD 4F3FB 3X3FL 3JBG7 1P1ZB 4NOFA 5DMYA 5I30L 3QIWB 4KXZI 3VWKB 1I1YB 4XCEA 5ERWA 3S4SA 4I48A 3C60A 4M9OA 3BH9B 2HJLB 4HUUA 5CIPB 5CBAA 3JWDL 3MGTA 4RAHA 3QUKB 1UYWL 1KEGL 4QLRA 2OL3B 1KYOJ 2DMKA 1ITCA 2MHAA 4OCSH 1EBAA 5F9WB 4LSSH 1IC7H 4PJFE 3QJHA 5FKPA 4K9EC 2PYEB 4G5ZL 2DQGH 4OAWA 2OK0H 3RUGF 4PBVC 1MWAB 2VLLA 2A73A 3OAZK 2XG5A 4K3DH 4P2RB 5EBGA 4HIJB 4PJEF 3S7GA 5ISZE 2OYPA 3RDTB 1URLA 4ZOBA 1D5XB 4FQHA 1MCIA 2BC4B 3RL1A 1OTSC 2MFNA 1I3RA 5I1EH 5F88A 3U4BL 1H3UA 5C0CB 4IRJA 4LSUH 3KPSA 1DQQB 2A1WH 1JZ5A 4LOUD 2DICA 4XP6L 2VAJA 4Q0XL 5BO1L 5DRXA 3IAPA 3KPQB 3PP4L 2X1PA 4HBCL 4QHNB 1X6LA 5C7XL 1FAIH 2NXYC 3BO8A 4HMCA 1C8PA 1PKQE 1CFBA 4LPTA 3OB0K 3ZKSD 3GSVB 1VB9A 4FQLH 4GG6B 5D2LF 4OD2A 2HFEB 5CJXC 5M7QA 4NM8L 4MJIA 4WEMB 1JTOA 3BP4A 5GISL 5KSAA 5J1SC 5C0JB 2IBGA 5I1LA 4U6XA 4G8GB 1BLNA 1IC5H 2X70B 3VFNB 2VH5L 4EQ2A 1ZHBA 1OTTC 2AJXH 3V0AC 4G43A 2QR0A 1GC1L 2C3VA 4WIQA 4NSKB 5IFAH 4PJAA 2A6JA 1GZQB 4WFED 3O41A 3KYAA 4V1DD 4TSCL 4KKAC 1S8DB 1N6QL 4HPOH 4YQXL 5E5MA 5F6HJ 3CGTA 4LL9A 3DUUB 2JJTC 2BNQA 3FZUD 4M93C 4EOWH 3EO9L 4NZDA 2GW5A 3WO4B 4P5TD 3UO1L 1DQLH 4JFDD 3TBWA 2YSSA 2BK8A 2AVGA 5SWSD 1EGJH 5I73B 3VMPA 1I7ZA 4WO4B 5IW1B 1OHQA 3KPPB 3CVHB 3P0YH 3RNQA 1T7VA 4ONFH 4AEHL 1N59A 4OLYH 4DTGL 3HNTL 2A74B 4Z7QF 4RMTA 3JV0A 2J3SA 4P2QD 3QEHB 1D9KC 4HQQL 4JHAL 1YPZA 3UAJD 3BKCH 4FTVA 3GNML 1A9BA 5KVFL 3FKUS 3MJ9H 2I25N 1R5WA 3D1MC 3F6IA 1C16A 2QQQA 4U1JA 1H3PH 1HHJA 3W5NA 5DD1H 4XNZB 1Q72H 3T0XA 4JRYD 3SY0B 4KXZH 1BJ8A 3ZE2E 3ET9F 1UQSA 1XCQA 4NQUA 4JAMB 3RWCB 1AJ7L 1FC1A 5C0GA 5DD0H 1KJVB 4ODWA 4J3SA 2HLFD 2HVJA 3DMMC 3W2DL 3UTSE 3C6LB 4AQ1B 1DBKL 4B41A 2FYYB 4HZAA 3HTLX 2GCYB 3DI3B 4LPXA 2K7QA 2R2BB 3FQTA 4HIHB 4RFOL 4WI8A 2AK4A 2IH1A 4WENB 4KI5D 5EN2B 3PDGA 5E4IA 1UM6L 4K07A 3ARED 3IKCB 3KNBB 4NWUH 3UEZA 1J18A 1WCBB 2NY4C 3CU7A 5TF0A 1WICA 2DQHH 5J9PA 1BOGB 5D1QD 4QRRA 5HYSA 1R3IL 1ZVSB 4L9LC 4NQVB 3RRQA 4HIEB 4M5YH 3QUYD 1X4XA 4CL7A 1Z9LA 5CGYC 3FRUA 3LKSA 5JTWA 5EOCL 5IM7B 4NKDB 1LP9A 3OGCB 3EYVB 5DFTA 5DVNA 4UILL 3LV3A 3F6LA 3BN9D 4LU5L 4Y5YB 1Z9SA 2HA1A 4X4YA 1ZT1A 3MOAH 3ARZA 1NC2D 3FB7A 1RZKC 4ZFOB 4CKVX 4WHDA 3O6LL 2Y6SC 5F96L 1S7RB 1DBML 5SX5H 3H9ZA 2BRRH 2BMKA 2ITCA 4MD4A 1BGXH 4FRWA 4ZS6D 3MLWL 4HWBH 4YBLC 1EUUA 2VQTA 5AYQA 4CADB 3FB5B 3HZMA 3GMMB 4DGIL 3Q3GB 3H9HB 1ZSDB 2CLZA 2P42B 4PBWD 1LK2A 3OG4B 3PP3H 3CCHB 1DUYB 3I2CL 1HNFA 3MLUH 3BUYA 1JPSH 3G9VA 5GGTA 1EHNA 2WNGA 4XAKD 3T4YB 4XNMB 4PJCE 2CPCA 1LK3L 3IB4A 4U1LA 1ONQA 1IGCH 1KB9J 1ERNA 2AEWA 2BY1A 4N90E 3MBEA 3BSZL 5E8DH 4V1DB 3BHBB 3OHXA 4MAYC 1OSPL 4M6NH 4MLSA 3ZDYE 1B0RB 1H8OA 2YPLA 2ZCHL 3TO4D 4JQXA 1WFOA 3ESUF 4PV9B 5MERB 2QQKL 2V9QA 4UT6L 5DRNB 5JQ6H 4M43H 2E7LC 1WT5C 1OP5K 1VACA 4P5TB 3SDAC 4JHZA 1XGUB 5KAQF 2APXA 4JFDB 2X4SA 5F3HB 4BA8A 3O4OC 5SWSB 2ADJA 5IJKA 2EDDA 5FCUL 3W9DA 2FIKA 1KXTB 1RIHL 5C07D 4RGND 2I9TB 2YPKB 1S9WA 3CFBA 2R8SH 5JW3L 4P2CG 2X9XA 3RFZC 1NCUA 5CEZL 3S36X 1F97A 1RUML 1UG9A 4FP8L 3JWOH 3L9RB 2UVFA 5JA8B 4P2QB 4P5KA 3TBVB 2VLME 5D70H 4TSBH 3MUHL 2B1HH 4K8RL 4QOKA 1D6EB 1QHPA 2Z4QA 1VFBB 4GRWH 1CTOA 1S9XB 2FBJL 2WBWB 3CK0L 4MX7A 2X4NB 1KB5H 1CICD 4M3JA 2A9MH 1FYTE 2AXFA 5FDYA 1JZ3A 1YYML 4OZIE 2FB4H 4JRYB 1VGKB 1RZIA 2Z8RA 4P3WA 4G80B 5C70A 3RX8A 5FA4B 1DVFD 3B6SA 5DR5L 3CSYB 4OZHB 1QSEB 2EXWC 5I76A 2OLDA 3LKNB 4DOHB 2ZCLH 3GSOB 3HZVA 5CJQH 1CGTA 1IAKB 4PJXA 1G9NL 2YZ1A 3MRKA 4YHML 1MHEA 5GPRA 4WNQA 3U0WH 5AZ2L 1R3JB 4JN1L 5DZLA 1CD0A 4FQ1L 2HMID 2EE3A 4DW2L 4G8FB 5DWUL 2XA3A 3NA9H 4H8WL 1NCTA 3BDYL 2AABL 5TFSL 5D7IF 3FTGA 4U1KA 4ZPTA 3AREB 1OB1B 1PLGH 5FB8B 5CD5D 4IRZH 1INQB 5FIEA 3RZCD 2FWOA 1XF5B 3QB7C 1HH6B 5D1QB 2RAMA 1P7HL 1NSNL 1BQHB 4H25B 1NUNB 2P7TA 4C56A 1CG9B 3RY5A 5FO7A 3VFTB 3NPSB 3DIFA 3QUYB 3TH4T 2JK5B 4EUPG 1KCSL 5DD3L 3TIDA 3BISA 3KPMB 1NEUA 3QI9C 4GUPA 1TQBC 2APVA 3L3OB 1F4WL 1I1RA 2BOCA 4XBPA 3O6FD 3FHQA 1T89A 2YN3A 4J4PA 4ODSL 4LCYB 4KI1A 3L3KA 3UTQA 1UWEH 2NQCA 1FH5L 5HI4C 4IMKA 1NC2B 4RGOH 2P45B 4ELMF 4CVXA 5IQ7H 4DGVL 4X6DA 3LKRB 3P0VL 3TYFB 5F7MC 5F3BB 1JGUL 3ULSA 1KLFA 4KKBC 3NZHL 4NUGL 3SDCD 3HNVL 3GFUA 2NYYC 2Z8VC 3MV9E 2CO7B 2RCSL 5IVXB 4X9GA 3WUWG 4BH7A 4Q9BA 2FR4B 2NTFB 4OM0H 1FSKC 4FOMA 5EB9A 1SYVB 3QHZL 5GRWA 1OAUH 3I9GL 1KEGH 4QHMA 3MLTB 1CXFA 2WINB 3PWPA 4HGMA 4OGYL 4PRPE 2EDJA 5ADPL 5T1KA 5FM4A 5KAQG 4NT6B 3NGBC 1F3RB 5C08E 4MXVE 3HPLA 5DJYA 1L0XA 3TVMA 1EMTH 1IAIH 1JWUB 5AZEL 2DQEH 4ETYA 1E4XL 5DC4B 4D0CB 4LRIC 5IW3A 2BJML 3FFDA 3V6ZB 3C08L 2HN7B 3EYFA 3BGAA 4U1NB 3BGFB 3BZEB 3HMXA 4QYOA 2ATKB 4X7FC 2VR9A 2LTQC 3OJ2C 1Q9LA 2CRYA 1MY7A 4NP4L 3V5DB 2WLYA 3TO4B 1CT8A 1TZIA 4X5XA 2ZJSH 1T1XA 1S5HA 1XH3B 4O2FA 2W0FA 1MIEH 4OD1H 3WIHA 4WWKC 2FZ3A 3ZT7A 4PJBB 5JOEA 2Q3AA 4DZBB 3NCEB 3QXVA 1LO3L 2CR6A 4HBCH 1WITA 5C7XH 3T0EC 1MFEL 3CLFL 5C07B 4RGNB 2P47B 4ZUVB 2DTMH 4LLDA 5D5ME 4FQCL 5BXFB 4PY7B 3ZKMC 2DIJA 1QFHA 4HKJA 4LEOB 5IB3B 1MFAH 3UTSD 3QDMA 5DUMH 3CH1A 4MD0B 3OPZL 2D0HA 4N9GB 1QRKA 5DMIL 3UPRB 1W72B 5E2UL 1DSFH 1BQLL 2DLFL 5H8DA 3H0TB 2X41A 1FPTL 2Y06H 2HTKD 1FE8H 2D0GA 1DP0A 2R15A 4HS6A 2NPLX 4HF5L 5EO0B 4JRWA 3KJ6L 2AXJA 2DAVA 3FT2B 4L3EA 4NYLB 1CICB 2YPVH 2DLTA 3KPLB 4AENB 2P5EE 2EC9T 2OS7A 5DS8A 1R3HA 2EYTB 4NDMB 2CKNA 3BYTA 4MXQC 1DVFB 1DQDL 1T66C 2BSTA 4PJFB 4IMLB 4XP1H 1TMCB 2CLRB 4ZS7L 3JUZA 4HLZH 2NLJB 1TPXB 4MNQB 1CFVL 2AK1H 5EU3A 4JDVB 4WV1C 3MODH 4YGVB 4YDIH 4BUGA 1UJ3B 1ZLVH 5ICXA 3QUXC 5DK2B 3RZCB 4QF1A 1LEIA 3QXWA 4KROC 3O11B 1A6WL 5B39G 3V7AE 4EBQL 3GSWA 4QRTB 4JLRB 3HI1A 1QRNE 5FGBA 4D9RE 1YUHA 3P77A 4F33A 1PKQB 3KLAA 5ALBL 2R0KL 2R39A 3QUMH 4U1HA 4GW1B 2OJEB 1HE7A 1KEMH 1A6PA 5IBTH 1B0GB 3E8UH 3O6FB 4S1QH 3L3IA 2PXYC 1MEXH 4LVHC 3B83A 4F7CA 1R5IB 2C26A 3WFEL 4HWUA 3S3JA 5I16A 5C6TH 4XPGL 1DBKH 4PIRF 4ETQB 1FVDB 3DTXB 3S88L 1HIML 1AHWA 4N90D 2DDQH 4WTXA 1B2WL 5F9OL 4TOYH 1HWHB 1YZZA 3VGHA 1JNLL 1MJ7H 3JWOC 1G7QB 1MFBH 3BKJL 5D96C 5ANMA 3WS6C 3GSUA 3EDDA 1ZA6A 3DURA 5DRZB 2IPTL 5C0IB 2GITA 5FF6A 2YK1L 4LNRB 5JXED 4YDLC 1IM3A 4KZEL 1YMME 2D7MA 1EV2E 3KXFA 4OI7A 5J3HC 3QXDB 4HMEA 3P9WB 4B5EA 2Q76A 2C3WA 4WGVB 4OT1L 3D39E 2D7TH 1D5ZB 2X4PA 2PKDA 4OF0A 4UUJA 2VDLH 5HD8D 3IDNB 3WHXB 3VMOA 5C9JB 1MCDA 1OAXL 4LBEB 3RGVD 5AAWA 3ZKXB 1HQ4B 1KG0B 4DGYL 5H35B 1UCBL 1SVZA 2BXYA 1J9CT 5IT2L 3EOAB 5JQHC 2D7NA 4HMDA 43C9B 3EOBA 3IFOB 4IIQC 3V4VL 1FJ1B 1U58B 2VOTA 4WTZA 5B8CB 1CK0L 4UNTA 3FO0L 4GXUM 1LO5B 3HZYA 3E0GA 4S2SA 4NGHL 4JM2D 1BZ7A 4L3CA 3B3IA 4QTHA 3MLWH 1FO0A 3N9GL 4I13B 5TF1H 4RNRA 2UY6A 1D5MB 1A7BA 1QBBA 2XV6B 4P23D 1NEZA 3LPWA 1IAMA 2WSKA 1TQCC 3LEXB 5GGTH 3WDHA 3DRTA 1UWGL 3LZFH 3QFJA 3UTSB 4OZFA 1JV5B 2B4CL 4PYGA 5DD5L 2OXGA 1HHIA 4GS7B 5IR1A 3BT2H 5BQ7A 1KIQB 2B5IB 4NQEE 3QA3A 1REIA 2XXMB 4KK5C 3T4AB 4N0RA 1FRGH 4WVRA 3RP1A 4GLRI 5KVGL 5EWIH 5T3ZE 5JZ7C 4ZUWB 5D9SB 3NFNA 3BSZH 1S7UA 4Y4KD 3QPXL 5FYLH 4NO2B 3NAAL 5E95B 5HDQH 4PUBH 1CLYH 1CD1B 3IDXL 4XCCL 3V4PH 25C8L 3KLDA 2Z31A 3DBXB 1P9MA 2ADGA 3TA3C 3AS1A 2AEPL 4KJPD 3WCYA 4HW6A 1FBIL 3BP6A 4TVSa 4KJYB 4LGSB 3VWJC 3IF1A 4OIBA 4FQ2L 2V5TA 3B2VH 1EHLH 2ZOLB 5GIRB 2Q6WA 4MWFB 4BZ1L 1IFHH 1EJOL 1TETL 4JZJB 4GBXA 5HHVL 1SHMA 2R23B 1SY6L 3EGSA 1NCCL 1MSPA 1G0YR 4XPTH 1JHTB 3SE3C 1QR4A 1P7QA 1UCTA 1SY6A 4UNUA 4ENED 1N5YL 3M1BA 4IRJC 3W81A 1KLGB 4LNVA 5HHPA 4LSQL 2DL9A 1TCRA 3UZEA 4XBGA 1C12A 4X4XB 1ZHKB 4JN2A 4X6BB 4Z7WA 1Q9KA 3STZB 3FQNB 4NQXB 3WL9A 4TTDC 4P4KD 3MA7B 4Y19A 4PRPD 1LGVA 3ZSSA 4ZDHB 1N3NA 4CDHA 4J3TA 1FNEB 2LFGA 5DMKA 4PJCB 5C08D 3UJIH 3D2UA 3DXAE 4ODVH 2ERJB 5I2IB 3O8XC 1A7OL 3U9UB 1D7FA 4R7DA 1TZGL 4Y1AD 2GYSA 4D9LH 3PQYA 3HI6H 4PJGA 4I0PD 2BSSB 3X12A 2I07A 2GUOA 3OJVC 3U0TB 3U30C 5DK0A 1GCFA 5FGRA 3PWNA 3EYSH 3DETD 4HKXB 5C1MB 5I18L 4Z78A 3B5TA 2XQBL 5FCSH 1CFSA 4GRWF 3VH8B 4XMPL 2DQDL 1A3RH 2XZAL 3GDBA 4QRUB 2BVUA 1MCCA 5HHNA 5ITFB 5JMOC 1RK1B 4LK4A 5B38B 3SPVA 1FIGH 4HAFA 4E42A 4PR5B 1S5IL 1SJEB 1GRWA 1GAFH 4CUCA 2M2DA 3RGVB 3CU1A 2Z92A 4OCXL 5F97E 4WI6A 4IS6A 2XIDA 4HHAB 1U6AH 1FVCB 3OAZH 3U7AA 5LXGL 3GMOA 4FXKA 4IOSD 1GGUA 2PNDA 4XPAL 5DJ0B 1RUPL 3VI4E 1EZVX 3JUYA 1DQJB 1YEFL 5IEHB 4F58L 1GIGL 3IDJA 3R4DA 3LHPH 1O5DT 4M48H 2D31A 3HE6A 1OPGH 2DQJH 5DHXB 3FT3A 2A6IA 2P5ED 1IM9D 4JM2B 1JF1A 3SDXF 3G04A 3QNXB 5DUBB 4L5FH 4CJ0A 4KI5F 1JUFB 2XFXA 1CL7I 4AT6A 3OB0H 2R69L 3PE9A 4YWGH 1GXEA 4YDJA 2YEZB 1MI5E 2A6KA 5H37H 4EUPB 4N68A 3ZKQD 5D6CB 1U3YA 2YD5A 4HT1L 2ED8A 1LEKB 3PWLB 2ZCKL 3H7LA 1OW0A 2KKQA 3HMXH 5FFLA 3L7EB 4I3RL 4DQOH 1VSCA 1BFOA 2YRLA 4Y4KB 5IIEA 1AGBA 2FECL 3WN5A 3VFVB 4PRDB 4C55A 4KRPD 4UT7L 3WLBB 3WIHH 4JFFA 5FYJE 5JHDA 5IFHH 1QRND 4D9RD 1N8ZA 2I5YH 5EOQH 4MDIA 3GSXB 4DVBA 3WUWB 4X9IA 3RJDA 1I4FA 3HC3H 4JREB 1RZJL 1J0KA 4FQCH 4LEXL 3QDJE 3I6GB 3CXDL 3CZFA 4L9DA 3ZMRA 3CFDB 4G42A 5KOVC 5D72L 3MR9B 5K9OB 1KPVB 2NMSA 1NAMH 1IBGH 2WUCH 4HC1L 3H9YA 3ZYOA 5J06A 3HZKA 2Z0BA 3FRPA 4FG6C 1QKZH 2BY3A 4BSVB 1A4KA 2VDRH 5IMOA 3ZLQC 1BAFH 1S9YB 4RX4A 1ED3A 3D18B 1YMMD 1KF9B 1FVEB 1CD8A 2G75B 4P4KB 4PRPB 1Y18B 4PFEA 3D39D 4RAUB 1ZK9A 1J86A 2PYFB 5ACMA 2AJVL 3NIGE 5C08B 3O2WH 3CAFA 5CEXA 4L8BA 4Y1AB 3L7FA 3W39B 3ZE0E 5GHWH 1A6AA 4LSTH 3BEWB 1NJ9A 3CFCH 4YC2B 3DRQB 4RMVA 1RPQA 2VUOA 2DI9A 5DHYA 3SHSA 3K7UA 5HGHA 4HJGA 5IB4A 2VWEE 3MROB 5DJ8B 4F37F 4OCRL 1RULH 3RVUC 2FJFB 3G08A 3TJEL 2FLRT 2FEEL 3EO0B 5DTFB 5ALBH 4F2MB 5D5MB 2ZNWA 3V6FB 4PRIA 3D0VB 5KJRL 3GSNH 4Z95H 4LCCB 4JO1L 5CSZA 5C86A 5JOFA 1GSMA 4RGMB 4JJ5A 5KSVB 5IESH 1UEMA 2Q87A 4BKLA 3V6OA 1T6VN 1H0DB 4IDJH 1CL7H 4KTEH 3VFMA 2OR7A 4D8PB 2XZCL 1BEYH 4N8CL 5F8RC 4ZTOH 4E0RB 1RUKL 4J2XA 4PB9H 2FSEA 3EDJA 5T3ZD 4NQSA 1SM3L 4XXDB 4HUXB 4FZEL 1S7WA 2XA8L 2DJSA 3LKPA 1YN7A 1TVHB 1T1ZA 2P5EB 1IM9B 4JDTH 4O4YL 4G9DB 4P46A 3BZ4B 4GG8A 3VXRA 1F00I 3FN9A 2C9AA 4NRZA 3FAWA 1DFBL 5IB5B 4OI9A 3RWHA 3ZSTA 1BX2A 2CRIA 1F2QA 1T7YA 3KPSE 5HI5C 4F57H 5E70A 1ULVA 4LCIL 5H94A 3L3JA 5EU7E 3X14B 3TPUB 1CZ8L 2FATH 4XP4H 2BX5A 5I8CA 4CU7A 1INEL 1RMFH 2GTWA 1J0YA 4EVNB 3ZDXE 4RFEB 1EVTC 2IANA 1NFKA 3MRHB 3DVIA 3IDUA 4JPWL 1KN2H 2HKFH 4HUWA 1L7IL 5F1IB 1QRNB 3D25A 4Y5VC 3RBSA 3M45A 3VXQA 4LSVL 4PJ7A 5FECA 1KN4H 4HK3J 4P3DA 1ORQB 4UQ3A 3QULB 1G7LA 3QNZB 1FO0H 4V2BA 1J1OL 5KN5A 1D5BB 4QRQA 2CUIA 2DI8A 3O0RL 3NFPB 4PJAE 5JHLL 4LLYA 4CU8A 4E5XA 4RBPH 2FX8H 4PJDB 1A1NB 3T2NH 1J0JA 1WBZA 2RJMA 2V6HA 1QFOA 4LAJH 4K7FA 1F90L 3PABA 3A67L 3MLYL 5TE7H 3DXAD 4ODTL 4M4RA 3ZYJA 2BNQE 5J6GA 1PG7H 4YXLL 1AQKL 4OFKA 1H3VA 1AKJD 2UVEA 4JFEE 4IMKC 4ZPVB 5TDPA 1QFWM 4GRMA 4LVEA 1TFHA 5GGSB 5HGGS 2PW1B 4HJJH 4XNUH 5KVGH 2V7HA 3ZTNL 5MEQB 1FFOB 2G5RA 3I02A 2O5ZL 1QNZL 1T20A 3EJZC 1T22A 3RY6C 2DWEB 2X4UA 4JFXB 1A6ZB 3L3GB 3TJHC 1YMMB 2F8VA 2YN5A 1EJ6A 3O2VH 3MV8A 4GAJL 3D39B 1S7XA 3PGFL 4KUCF 1JWMA 1M71B 1YPZE 3I84A 2WWMD 2NW2A 4XI5C 1KACB 2ORBL 2XQYK 3MCKA 3MRRA 4NN7C 2X4OB 4Q6IB 3NIDF 1XGYH 4HLZG 4FQ2H 4NQTA 4WUUA 4P3CL 1WISA 1FCCA 2DQTL 4BZ1H 3TVMC 3ZE2F 3HNSL 1CVRA 4R4BB 2N7BA 1UT9A 3TPKA 3VFGL 1RZ7L 1JPFB 3HLAB 3HC0B 5IGXL 2N4IA 4X9FA 4JE4B 3AXLB 2N7AA 4OLUH 3QHFH 4LLWB 2XPGB 5EIVA 4ZUSA 1CQYA 1I7RB 1DN0A 5I1JH 4HGKC 2AK4E 3MLZL 1BIIB 2V2WB 3H7BA 4GRLC 1OLZA 2R4RL 2EO9A 2GTZB 3LRSB 1MI5D 1ZV5A 5E99H 5K9JH 4KKLC 4Z76B 5BS0B 2HYMA 3BJ91 1T4KA 2ZSWB 1FL3A 3QIUD 1U8KB 4JHWL 5DEGA 4G6AD 4XP5L 2P8PA 5I1HL 4NBXB 4FFVD 3SQOH 1EEZA 1HSAB 1LP9E 1T7WA 3DO7A 3BD4A 4UAOC 3O3AA 3B5GA 1HOCB 1HXYB 3GB7B 5K9QG 4EI5D 1N64H 2AQ2A 3HR5A 1HHHA 1G7IA 5FYJD 1CFQB 1QR1A 5DT1H 4FFWC 2BCKA 4HX1B 3U9PL 1QFPA 1ACYL 3HR6A 5D2NE 5F6IC 5HYSG 5E1AA 4XNXH 5J13C 5CUSH 2NZ9D 1V5JA 2ZG1A 1FFNB 4R7NA 1KJMB 2BRQA 4XMKL 1IC4L 1DTUA 4Y5XC 1HHKB 5TQ0L 5I6XC 3REWB 5J11C 4J3OC 1QFUH 2J1KA 4XWOD 5DJXA 5JLZB 4WEBH 4NIKB 4KUZL 1G7JA 2OP4H 4S1SL 1I1AD 2C3XA 1QYGH 4K55A 3RHWF 5ADOL 1UB6A 5EZOH 5HVHB 1AGDB 1IQDB 1P84K 1RHHA 5TDOB 1ZWIA 4YBQD 4XH2A 1YEFH 1P4IL 4PJCF 3T8XA 1PG7W 3GJEA 5GJTH 1RJLB 3IJHB 1R0AH 5IHUL 1FZJA 4HIXL 2HP4A 5FGBC 5DJAA 1FQ9C 4AIOA 2BNRA 3QQ3B 2ADIA 4OF3A 5DEFA 4LCWA 2Q86A 4OKVB 3F7QA 2O5YH 5HGDA 4LHJB 4GMSL 1UA6L 1NUDA 2H9GB 3KAAA 1AD9A 3QQ4B 2XY2A 5SWZA 2P8MA 4RCAA 2OCFD 4HXAL 3NCMA 2A0LC 2B1AL 4OQTA 1ZS8B 5GRUL 1Y6KR 2N1KA 3TWCL 4YR6B 2EH8H 1FNSL 2D7OA 1GGYA 1OAYH 3R06B 1P69B 2R2CA 3V8OA 2ARJA 1AE6H 4OIIL 3LCYA 5J12C 2P5WA 5GGUB 1AHWC 2WBKA 3IDYC 1YEGH 4NNPL 1EEYB 1KLUB 3BE1L 5CEZE 2E6PA 4ZO7A 5FOJA 1JWSB 1UVQB 5KVMC 4TNWK 1ZGLB 3RWJB 4FXGA 4YHOH 1CBVH 4GAGH 3PNWB 1MRDL 3C60D 3QEQA 1LO0H 3MACH 1B4JH 3DSFH 3RVVD 1LNUB 4OZIF 2NY0D 2HKHH 4UBDD 2YZ8A 3W9EA 4ERSH 4JFZH 2VDNH 2H32H 4A6YB 1GHFH 2ZKHL 4F8TA 2AJYH 4N8PA 3GHEH 5I1IH 1VFAA 1WWAX 1OF2A 2Z91B 3FO9A 3BPNB 3GMLB 4PJXE 5CJOL 5L6YL 3LOWA 4PGDA 1XF2B 4HIIA 3IFLL 5GRJH 2AV7B 5MP6L 1I8KA 1LWRA 1CFNB 1NCWL 4NJ9H 4W68A 4W4NA 3TBTB 4HDIB 3VCLA 3ARGA 3QDGE 4NKOB 2FX9L 4HFUH 5MEOB 3KPSD 5B3JE 3QQ9D 4HS3B 4IJ3C 3V4UL 2MCG1 1D6VL 35C8H 2I60L 5FYKH 3QIUB 2R2EA 2BVQB 3SKMB 1V3KA 5TE4L 3VFPB 1NDGA 3RBGA 1MH5B 3DVGA 5TPWL 1EAPA 3OF6A 3P4NA 4KK8D 4QGTA 4QXUH 1G6RH 3I3DA 3SE9H 4DAGH 1F6AA 3ARDC 1K8DB 4EI5B 5KTEH 3IXAB 4PLNC 3SEPA 4UT9H 5KSAD 1ROWA 3C5ZD 3GI9L 2D4FA 5E9DB 4YHIA 1A47A 2X9YA 4GW5B 1CQKA 3O2DA 4OD3H 1YEDB 1MHPH 5CFHA 3ARBD 1MCOH 2VR4A 5D96B 4J12A 4D0BB 2NR6C 3SDDA 4ODHH 4HUKB 4EN3C 6CGTA 2Z31C 4XCNA 1JZ4A 5DQ9A 3OX8B 5IB2A 5D7SH 5HHOE 4LPCA 2RFXB 1WC7B 2YBRB 1KB5B 4OCYH 3DV6A 4X8JA 43CAB 3EYUH 4DKEL 3FOMA 4NJAH 1I1AB 2BNQD 2E7HA 1IQWH 2G9HA 3PWPE 4C54A 4PLOB 1MIMH 4XBEH 4OFVA 1N6VA 4GBXC 2CDEA 5DD6B 5CINH 3D69B 4MVBC 4LSDA 4UTAL 3DWTA 1HQRA 3U36A 1FFPB 4MXVF 5C2BL 5DJ6B 1HEZB 3QJFB 4XPFH 1CLCA 1ZHNB 3LQAL 3ALXA 1JPTL 4LP5A 5J57B 4RMSA 1A1OA 3VGEA 2QQNL 4I3SL 5EO1B 2IGFH 4R96B 4Q2ZB 2HG5A 2V17L 3VFWB 3RPIB 2A9NH 3Q6GL 4FTVD 4MXWH 4YHYB 1CF8L 4BFIB 4LKXB 5JW4R 4BK5A 3VI3F 4I2XB 1G7PB 2YKLH 1WIUA 3TNNB 4U1IA 1KNOA 1QEWA 5E2VH 1BMGA 4WHTB 1A8JH 5H37G 2BOBB 5JDSA 1A64A 3MRPA 2WQRA 1MLCA 4FZ8H 2PW2A 3KPRA 4MA3B 5GRZA 1SJHB 3P4OB 5FDWB 4LQFH 2WMPA 1RV6X 5DRWA 1V3MA 3LH2H 4R90H 2IQAB 4OCWL 5HYJE 3QDME 2QHRL 1IKNA 1X4ZA 3B9KD 3G9AB 4NZTH 1NLDH 2VE6A 3TCLA 1CS6A 3F7VA 3Q1SL 3OMZA 4XCEB 1BD2A 4JR9L 2AK4D 5DYOB 5ERWB 5HHQB 3S4SB 1RIUH 4I48B 5IHZA 3C60B 4HUUB 4L3EE 5CBAB 1OAKL 2UWEF 5IK3A 3MGTB 2NY0B 2VYRE 5A3ID 4R2GC 1Q1JL 3QXUA 2H1PL 5I1GH 4ZFGH 4Q9QL 2MHAB 1AFVL 1K8IA 2EDEA 4GSDL 3QJHB 1IMHC 3L5WB 4OCNC 4OAWB 2EIZA 5GJSH 1KJ2L 5DFVD 1JNNL 1K6QL 4DFHA 4TYUA 2VLLB 2A73B 3VGAB 1MCPH 4R26H 2AGJL 5FXCH 3VA2C 1S7TA 4AEIL 4U7KA 3RL1B 5CZXC 2EH7L 3GMPA 5GS0L 1NFDA 3G6AA 3GBNL 5F88B 1MOEA 2VITA 4NWTL 1D3CA 3KPSB 4QY8A 3DECA 1X5IA 1IVLA 1U8JA 2BVEA 4JB9L 4HJ0D 3MOBL 3OKKA 5DRXB 3WKNA 4XHQA 3BO8B 5J4MA 1RD6A 1YN6A 4BYHA 2QSTA 3RVWD 5JUEL 4BFGA 4OD2B 1A9EA 1R5VA 3BP4B 4WCYH 5KSAB 2B39A 3PWJA 3X17A 3RAJL 5ICZA 5JMRA 3C5ZB 4L4TA 4U6XB 5C71A 2H2SD 3HB3C 1BLNB 1HINL 2CGRL 5E2TH 1I75A 1MRFL 4XVUD 3UPAA 1ZHBB 3STLB 4G43B 5HHXH 2C3VB 3GJFH 3MUGA 3EFFA 5F6HI 3WXVH 4PJAB 2A6JB 3D5OF 1A5FL 3IT8D 3MBED 5GGQL 1NMBL 1H3GA 1UACL 3LD8C 2LV4A 5E5MB 1A7QL 3K81A 1EPFA 3P73A 1U8PA 2BNQB 3L95B 3KXFE 2FJGA 5KVEL 2EC8A 3R1GL 4ONGH 4RA0C 1U93A 3TBWB 2YSSB 1MCWW 4LSPL 1I9IL 1PVHA 1I7ZB 2NY1C 4UZGA 1J8KA 3UJTL 3RNQB 3BKML 5KVDH 3D9AH 1N59B 2OSLA 1IZKA 2XWTA 5K9KA 2VC2L 5E5UB 3KDMA 5CEZD 4OZGE 5I8KL 3MUZ1 1ZANH 4YO0A 1IGIH 2K7PA 1YPZB 2CDGA 4Z0BL 1DLFL 5JR1H 4ZNCD 3C09C 4FTVB 3W11C 3CFKB 4QOKD 2CO6B 3C9NA 1H9VA 1ZLSH 3NFSL 4ZXBC 4FQIH 4NNXA 3D3VE 1TJGL 3OB8A 1R5WB 1VEPA 4K8RD 5D4QA 1KENH 1C16B 5T5NG 5IMMA 4U1JB 1HHJB 1I9JH 3RPKA 3FN0H 5KSBA 1S3KH 5L0QC 1NH6A 1NC4A 5J89A 3MNVB 3P2TA 2XY1A 3G6DH 5KW9H 1UQSB 1XCQB 2D2OA 1YYLH 3SDYH 4J1UB 2ILLA 1H8NA 4ODWB 3IU4L 2HVJB 1JPST 1NMAH 3QFJE 2AJUL 4PRNA 2QTEA 4MB5A 3DYMA 2CIKA 3FQTB 3HS0A 4WTZG 2AK4B 2IH1B 5F7NC 4YHKH 3RY4A 2XACC 3SKNA 2ZUQC 3WNNA 1BP3B 2ZPKL 1A7RH 1P4LB 1X5JA 5J9PB 3ARUA 2F5BL 4OQTH 4I9WE 1P7KA 5HYSB 1RIVL 1NEZG 2X1WL 4PP1D 5F89A 4C56D 1FFRA 1KCRH 3P9MA 3CDCA 3P0GB 3QSKB 1Q0XH 4XWGH 4F8QA 1SVCP 3GBML 3EYQC 3FRUB 3LKSB 2F54A 2HT4D 3MRGA 5I71C 3DX8A 4O00A 1VKXA 1LP9B 2KL6A 1PZUB 1I3GL 1QSFA 3LV3B 3KYKL 3TZVD 4NCC1 4XXCA 4DUVA 2AEQL 2ATPA 1TVBA 1RZGB 1DZBA 4X4YB 1ZT1B 4J4PD 1QFWL 1V05A 1TTFA 4PJ5A 4IRSC 3FB7B 1GGIH 4HEME 4P46C 5F93C 1VGEH 1J10A 3MXWL 4XP9H 2CKBL 4JG1H 4PRBA 1GGCL 5KS9E 4MD4B 4NKIH 2BMKB 3FJTA 1RZFH 5HHOD 5E2JA 1PD6A 2CKBA 1AP2A 4N0YH 1W0WA 2ZUTA 3HZMB 4PRHA 4ZSOE 4UQ2B 1YEKL 5KZCB 1G6VK 4Z7WE 1OT1A 1LK2B 4P5MA 3B9VA 3PWPD 3RJQB 4Y19E 1CLOH 5T1KD 3BUYB 4AM0A 1WGOA 1H8SA 4OF6A 3U7YL 3GKWL 4X7EC 3RA7L 4U1LB 3S36L 4DVRH 1ONQB 5CP3A 1BVLA 1DANU 4LHUA 4KMTL 3VXPA 3PQYE 4Y4HA 1QBAA 4YIQA 3QYCA 3MBEB 4PPTA 3FFCA 4ORGB 3SBWA 1DEDA 1W8NA 3OHXB 3P30H 3REVA 2YPLB 4H88H 4RDQG 5B3NA 2EDOA 2EEDA 4G6ML 4AEEA 4CMHC 1Q94A 1VACB 2I60H 3P9LA 4IOIB 2NXZD 4LLAA 3MRFA 2X4SB 5C0BE 3HMWL 2ADJB 2FH8A 5IROA 1S9WB 3CFBB 3ALPA 1Z3GH 4DN3L 1SBSH 1CE6A 2IH3A 3MCLH 2CUHA 3NIFE 4P59L 3O2DH 1DEEA 3HRZA 4K71B 3IJYB 5HYJD 3QDMD 3Q6FB 1KELH 3IRZA 3NCJL 2MPAL 1E4XI 2DBLL 3VI4F 3U83A 4M7ZB 2IPKA 1UKTA 4QOKB 1Y0LA 5HDOA 2Z4QB 1Q0YH 1RJZA 3MLRH 5KBNC 3K8MA 1OM3L 3VDAA 4N0CD 2Y25A 4MX7B 5E6IA 1LHZA 3VDCA 3FHAA 4L3ED 3S96A 2O61A 1A6TA 2C1PA 4JY5L 3A6CH 4M1DH 3X3GH 2FO4A 1KCVL 1UZ8A 2WBJA 3B6SB 1DQTA 2APWA 3JV4A 3RU8H 3G5XA 2JB5H 5EH1A 5I76B 1S7VA 4RIRB 2SEBA 4BQ9A 3HZVB 1I3VA 4Y2DC 1MJUL 3ULUL 1AY1L 1LO2L 4PJXB 5L2KA 5I1DA 5FA3A 3MRKB 4WNQB 5HXMA 3FO1A 2XWBA 5HI3D 1TZHA 3K2UH 4M1CD 4UMGA 3K8LA 4O9HH 5A40E 3N85H 4NPYB 2F8XC 4ZFFA 3FTGB 4U1KB 4ZPTB 5K59E 1J8HA 5FYJU 5FHBL 2Q8AH 2WAHA 3ARSA 4R0LA 5DJZB 2YC1A 4JPKH 1HHGA 5T33L 1YQ2A 2P7TB 5JHDE 4C56B 4KV5E 2DJ4A 2FH6A 2Y5EA 4KGLA 3D0LA 5FO7B 5CEYA 5IWLA 3DIFB 5EZIH 4M61A 4NFCA 3UP1A 2YXMA 5FUZL 3WSQL 2CLVA 4RZCA 4N8VG 4O2CA 5FGSA 2EE6A 3T65A 4GUPB 1TXKA 3TZVB 2BOCB 4XTRC 4P2OA 4XBPB 1ZTXL 3MMEB 4MJ6A 3L3KB 3UTQB 1GL4B 3AY4A 1CGYA 1AC0A 3BMWA 2VL4A 4CVXB 3AU1A 1A22B 3RWGB 4BZ2H 2VR5A 4X6DB 2ICWA 5D1ZA 4AIXA 2JJSA 2RHEA 1RFDH 1T2QH 5GSVA 1F58L 2NX5E 5HHOB 4BH7B 3NH7L 2R0ZH 1JYNA 3W82A 5MENE 5DMGC 3SKOA 3V5KA 5GSRA 4M00A 2X5PA 3GRWL 5FAAA 1JYWA 4YHPA 4UB0L 4QHMB 4OLWH 3QFDA 3PWPB 4FFZH 1IGJA 3KXFD 4APQA 4NCC2 5T1KB 1GPOL 5D7LE 2VXQH 3PWUB 1GJIA 4HXBL 3RIFK 6FABH 5F7EH 5DJYB 5IQ9A 5F1OB 4G8IA 3TVMB 4FQXC 2I9LA 3FRPG 4ZAKA 3ZE0F 3EYFB 1FAKT 3WMSA 1DBJH 5IVZA 3VRLF 3RUGA 2QADD 1Q9LB 4G7YL 3NN8A 4PJEA 1CT8B 5IV2A 1TZIB 3I6KB 4R4FL 2WWKO 4X5XB 4H0IA 3QUZA 1T1XB 1S5HB 5CS7A 4O2FB 2W0FB 2FZ3B 1MAJA 3D3VD 3MOBH 2NXZB 1MLBA 2IG2H 1FGVH 1PSKH 4X6EA 4MA8L 3LN4A 4S1RL 3F58H 2W9EH 5LGJA 2GFBB 2W0PA 4PJ8A 4LLDB 2VLRE 4FHBD 4PRIE 3AS3A 4HKJB 4TRPH 2QQLL 1OTUD 5HYJB 3QFJD 3QDMB 5D2LA 3CH1B 1JHKH 3V6OE 1FDLH 5FEBA 3QIBA 2CJUH 2FX7H 3LPFA 3RWDA 4PGJA 4LLQA 4HS6B 1UB5A 4L3EB 2Y07H 5JXAL 1ZE3C 1S7SB 2WWKT 5I8OL 1R3HB 3F7RA 3LKOA 4I9WD 1E27A 2VXSH 2BSTB 2HLAA 1OARH 1LDPL 5A2KH 4X5LA 1PG7X 4YE4H 3P40A 5J11B 1UXWA 5CMAA 3V0WL 5ID1A 5EU3B 5BV7L 1YNLH 3TV3H 3PWVB 3FQRA 3GK8H 5BCAA 3V2AR 4TUOA 3ZDXF 3OGOE 3C8KA 3BAEH 2HFGH 3IAQA 5ICXB 4OLVH 3UYRL 1V7ML 1MCRA 2GAZA 4R4ND 4QF1B 1LEIB 1TVDA 4ONHA 2OZ4A 3GSWB 3HI1B 1P7QD 4Z0BH 4KPHL 3FQUA 1QA9B 3ZE1E 3P77B 1U3HC 4TN9A 4F33B 3KLAB 4RISH 4M3KB 4I77L 1C5BL 3HUJF 4U1HB 1NCBH 2IAMC 2PR4L 3MUY1 4UDUA 3U4AA 4HWEL 4XC3H 3TYGL 5EU6A 5D8JL 3UBXI 4Y19D 4U1GB 5T1LA 1IAOB 1S78C 5LWYH 1DBBH 4PJ9D 4F7CB 2R9HD 3GO1H 5I16B 3WJLC 3D2UD 2M26A 3UTTA 2PTUA 4MQXD 2J4WL 1YEEL 5GGVL 1TJIH 3MO1A 2MCPL 3PQYD 1RU9L 1JF5A 2JCCF 1IEBB 3D87B 5HY9A 2P44B 5E4EB 1AI1H 3ISWA 5ANMB 3GSUB 1KSRA 1ZA6B 2XT1B 3DURB 3SDDC 4O51A 2GITB 5FF6B 2EYSA 3IAGC 2UV3A 3MJ7B 4YPGA 1IM3B 3KXFB 4YXKH 1JFQL 5C09A 2Q76B 4XCYA 4K9EL 1IZJA 1R6VA 1LDSA 5L88L 1C5CL 4YXHH 2X4PB 3EIFA 2OTPA 5TQ2H 2EDHA 2VDKL 2L4OA 5DHVA 4LKCA 2E8YA 2QEJA 3G5VB 4HZLA 4QTIH 4WUUE 2QADB 1GZPA 4OZGB 3EOBB 3ILPA 4DKFH 1DL7H 1NMCC 3EOYG 1XEDA 3D3VB 4J6RL 4AMKH 3O81A 3ARYA 3HE6D 3HZYB 3Q48A 3OL2A 1BZ7B 4L3CB 3B3IB 1FO0B 3GIVA 5E8PA 4RNRB 4RA3A 3NTCH 1INDH 4XX1E 5DO2C 1NEZB 4NO3A 2VXTH 4S0TD 5IMKA 1MCEA 1EERB 3MQIA 3DRTB 3QFJB 1CR9L 4OZFB 4HCRL 5E7BA 5CJXA 5DUPH 4ZMAT 4R97C 3TP4A 1HHIB 4Z7UF 4KHTH 4DFIA 1M05A 4HCRA 4LVOB 3CFJA 5BQ7B 3AGVA 3CVIL 3QA3B 3NACL 3LQZA 2HJKA 3MA9H 3PUCA 2XN9A 3C2AH 3NFNB 5AYUH 1AC6A 1F4XH 1I1FA 1TTGA 4ZTPL 3PIQA 3UTOA 4X4ZA 4XX1G 1PFCA 5JHDD 1NLBH 5IBUG 1CXIA 4H20H 2WUBL 2KH2B 2Z31B 2OMNA 3WIIL 2J12B 4X83A 4CADA 4JVWA 1QVOA 3CD4A 2JJTA 3BP6B 1A7PH 3KGRA 2JJWA 1XGRA 3CMOH 4H5SA 3IF1B 3AUVA 3G5ZA 2Q7NA 1CLZL 1Z0MA 5C0AA 1CGSH 3C6SA 2Q6WB 4XC1L 4NO5A 4U6VH 5F70A 4MCZA 5GGRA 4PS4H 1FL6A 3L5XL 4M7LT 4OFIA 3SE8H 1FZOA 3S37H 3EGSB 4LRNL 1V7NL 3WE6A 1NCNA 2YMXL 2ZG2A 3KPNA 3UC0H 5JOPD 5EOTA 1P7QB 1AXTH 2DM4A 4L8DA 4ZQKA 2HT2C 4GO6B 4K7PH 2NX5D 5HHPB 4WFFE 2FECI 1I9RH 2LU4A 4U0RC 4XBGB 5EO9B 5KANG 4RX4D 4ZSOB 4K23L 3I50H 2B0SH 4HV8A 2YA2A 4FQQA 4Z7WB 1YEHH 1Q9KB 2JLLA 4JPVH 3OXSA 4LAQL 4M6ML 1KFAH 4Y19B 3WFBH 1N3NB 4PJ9B 2X42A 5DMKB 3B9AA 3D2UB 3PP3K 4NRYA 4R7DB 1RI8A 5FYKD 3DMMA 3PQYB 1BVKA 4TUJA 4NQCA 2I07B 2GUOB 2OI9B 4M62H 4U6YA 5DK0B 3PWNB 3N1QC 3MRCA 1JRHH 4Z78B 3AAZA 1KXQE 4F80A 1CFSB 3OAUL 3FB8A 3O9WD 4GXVL 2AI0L 1A6UL 1KXVC 3SGEI 1KTKE 5D7IA 4OB5L 3EW3B 4KY1L 3WBDA 5HHNB 4MZ3A 5I8EA 1ZA3A 1I8IA 1FGNL 4R2GB 1A3LL 2WQ8A 2VLRD 4PRID 2FJHB 1F4YH 2Z92B 1Q8MA 4MAUH 2JE8A 3QEQE 1VERA 2DMBA 1JGLH 1SEQL 1ZTXH 1IGML 2GJ6A 2DQIL 3GMOB 4X98B 4E41A 5LQBL 1AGCA 4CVWA 4FXKB 1X5LA 3WXWH 3UX9B 2AXGA 1WZ1H 2YOCA 3WEXA 1RK0B 4RMRA 4PGEA 2QBWA 2WIIA 4P2RE 3BQUC 1AXSA 3IDJB 3CX2A 1E6JH 1WAAE 4FABL 4ELMA 4JG0L 4M7KL 3HE6B 3BX7C 5B39A 4FNLH 4AG4L 3FT3B 3OQ3B 1MUJA 3RX5A 1P6FA 3G04B 2P8LA 4Z77A 2XFXB 4AT6B 1U42A 3U82B 2W0LA 3HG1E 5IP4A 2DQCL 3WFDH 1WIOA 1AO7A 4ZOEA 1T5WB 1HKLH 4YFDB 3O45A 3ZZ1A 1JF6A 3JSSA 3UJJL 5IW6A 5IKCA 1HCFX 4X9BA 4JKPL 1BM3H 1JHLL 4X99A 1X5AA 5D1XD 3QO0B 5IIEB 1BFOB 2IAND 3WFHA 1AGBB 3KVQA 4MQ7B 4S11A 3WN5B 3T1FA 2EIDA 3PHQA 4QXGH 5JHDB 5CCKH 2XKUA 4MAYA 3V9FA 4X8XA 1N8ZB 3LB6D 4X4ME 1B4RA 4MDIB 2DIAA 1NGXB 3CX5J 2XTJE 5GGVY 2FLBT 4DVBB 1SMAA 4KK6D 3MLSH 1EBPA 3QWOA 2E7LA 1CXEA 1WT5A 2DKSA 1I4FB 1CN4A 1QG3A 3SDAA 2VKXA 4JFOA 1IEAA 4OCSL 2FEDD 1XIWC 4LSSL 1IC7L 1K4CA 2DJUA 2AQ1A 2AAVA 3CZFB 4FQJH 2DQGL 3EFDH 5L8JB 1P1ZA 2OK0L 1OAZH 3TN0D 3MRNA 3MRQA 4XXCC 3VWKA 1N26A 5MHSE 3WD5L 2ZUUA 4K3DL 4KVNH 1T21A 1YY9D 2K9UA 5CIPA 3ARFC 3HZKB 4A2MA 1JMZA 1NFIB 2NX5B 2PO6D 3QUKA 3RIAK 3E2HC 3CJJA 5I1EL 2Y23A 3PV7A 2IQ9H 5IMOB 4LSUL 4KK9C 4KJWD 2A1WL 2BHUA 4BZYA 1ED3B 2IFGA 3CXHJ 4XPHH 3DUHA 3MV8D 4EXPX 5JIHA 1FAIL 4HIJA 5IUSA 1AR1D 2VDOH 3WIFA 3EDFA 4FQLL 3VD4A 1D5XA 1TJHH 4N0UA 3SGEH 4L8BB 3L7FB 2NNAB 1A6AB 5BV7H 1YEIH 1NJ9B 3MLVH 3TESA 4WUUD 2VL5A 3VFUA 5FKAA 3VG9B 1IC5L 5JPNA 3O6KH 1SEBA 2OZ4H 1XR8B 3KPQA 3O9WB 5DMJB 2FGWL 5DHYB 2AJXL 4Y89A 5HGHB 4HJGB 1OD9A 3GSVA 4S10A 4RWYL 5IB4B 5IFAL 4KZDH 5EZJB 5E2WH 3KYOB 1BIHA 3ROOA 2FCBA 4U6HA 3QR2A 4LPVA 3G08B 2BDNH 4LASH 1V3JA 4RRPA 4HPOL 2VLRB 4PRIB 5CJ5A 2F9BT 1FG2A 4X7TA 4EOWL 4PRAA 3QISA 2X70A 4L8SB 5CSZB 5D6DA 5JOFB 3QI9A 5I74B 4JJ5B 3OKNA 4BKLB 1DQLL 3SO3B 2QL1A 1EGJL 5F7DA 3BKYH 5LGKA 3VFMB 3E3QC 4MA1C 4Y88A 5A2LH 4LLUA 3P0YL 2FSEB 2L7JA 4ONFL 4OLYL 2BNUB 1YN7B 2P43B 1T1ZB 5GRVK 1S9KC 1ADQA 4P46B 1JYVA 5DGQA 3BKCL 3VXRB 2E6JA 4WW2C 5E6IC 1TCMA 3MLPA 3ES6A 5TE6H 3MJ9L 4F37K 3RWHB 1BX2B 2XQYG 4FQPA 5DVOA 3CVHA 5H94B 1H3PL 3L3JB 5DD1L 2WBJC 3MJ9A 1Q72L 1ZAGA 2C4FT 3PL6D 1OT2A 3DO3A 5DHVH 4Z7OE 4YFLI 1G1YA 2AQ3A 4LLMA 4IEFB 2GTWB 2V5MA 1PYWA 2W60A 3NVQA 3QEHA 5DD0L 3QO1B 3SGDH 3DX6A 4UTBH 4RAVA 5D1XB 1T83C 1WK0A 1YA5A 4G9FA 1JTPA 5EA0H 2IANB 4LRIA 2HRPL 4X6CF 3WFZA 2VISB 4HUWB 3I3BA 3D25B 4L4TE 3VXQB 4TNWF 4PJ7B 1CTNA 4NWUL 4WFFD 4UIKH 4P3DB 4UQ3B 1EDQA 4YAQA 1G7LB 5KN5B 4JAMA 1VFUA 2PF6A 3RWCA 1VENA 4NQDA 2DQHL 4QRQB 3QZWA 2EZ0C 2BNRD 4NRXA 4KGJA 4OJFH 4WWID 4LLYB 3C6LA 2DYPA 4E5XB 4O5LH 2FYYA 4QRSA 3T0EA 4M5YL 3IDMA 1WBZB 4A2LA 1WVZA 4U7MA 3TN0B 4K7FB 3PABB 5SWZD 5IVOA 3PGDA 4K3JH 4P2OC 3TNMA 5MEPA 4LPWA 4H1LB 5J6GB 4NN5B 5DEZA 3IKCA 2J8UF 3KNBA 5KSUA 4XMLH 1EFQA 4GRMB 3BH8A 2PO6B 2KZ1B 3LMJH 3MOAL 1BOGA 3L5HA 2ESVE 3FONA 3VU2A 2E7BA 4JO2H 2V7HB 4HBQA 4EDXA 3U2SB 4WU5A 5LJYH 3I02B 1T20B 5CGMA 1TITA 4KRMB 1T22B 1ZLWK 2X4UB 2DIBA 5D7JC 3EHBD 5I17B 3MV8B 4NKDA 5IBLD 4PLJD 2BRRL 1B90A 4OZGF 4U2YA 1JWMB 1BGXL 3T0BA 1MCHA 4HWBL 3VXMA 5I9QB 3MCKB 4HWBA 2NY2D 3QEQD 1N0XL 5I15H 3DGCR 4WUUB 1XF4A 5KSBE 4OZHE 4PLKD 1QSEE 3MLUL 1JPSL 4HK0A 5F21B 3HI5H 4ZAKC 1JVKA 4ZO6A 1FZKB 5GZND 5C0FA 1OD7A 1IGCL 3QUXA 1P6AB 4P2RD 5E8DL 2Y1VA 5I1KH 4ZUSB 4M6NL 2AJSH 1DN0B 1E4WL 3A6OA 1NAKH 3KPTA 3CCHA 2EE2A 1QO3A 1DUYA 2Q8BH 3H7BB 5JQ6L 4M43L 3HG1D 3L3DA 3ARGD 3T4YA 4OKDA 4WHCA 1JBJA 2PXYA 5T3XH 1V8HA 2R2HA 2XXCB 1T4KB 1FL3B 1U8QA 2LVEA 3BPLC 1VA9A 1YY8A 1F02I 2H26A 2P8PB 2R8SL 1EEZB 1B0RA 1F8TH 2F54E 2Q1EA 4YNYA 3DO7B 3JWOL 4F7PB 4YHNA 4D0DB 5GGSY 4P99A 4MDJA 4WW2F 4BQCA 5D70L 4TSBL 3HR5B 4JQVA 1G7IB 2B1HL 2HTLC 3CDYA 4JFDA 2VQ1A 2BCKB 4TUKH 2XTJD 4DEPC 2YPKA 3ULVH 2Z8WC 4LF3A 2A9ML 2FB4L 3VXTA 3PL6B 1RAMA 7CGTA 4P9HH 5KS9F 3DARA 4N5EC 4G6JH 2DQFA 3OKLB 3TBVA 2ZCLL 5CJQL 1EUTA 1CU4H 4NO0A 4PRHE 3S97C 1G7JB 3OBAA 3U0WL 4Z8FH 3D85A 1PEWA 2PCPA 3HFMH 1UB6B 1RZKH 4U1MA 5C3TA 1XGPA 3NA9L 2DD8H 1ZWIB 3W5MA 4JRYA 4XH2B 5I0DA 4G80A 2DL2A 1PLGL 3QPQD 5FO9A 4JQIH 3T8XB 3GJEB 3RWFA 4IRZL 3O4LE 3B2UD 4KHXH 3CSYA 1MJ8H 4HD9A 5DJAB 2BNRB 2IPUK 3GSOA 2ADIB 3MJGX 5DEFB 3UXFA 2Q86B 3FFCE 1JGDB 1H3WM 3UTPD 3CLEH 4Y4FC 1P2CA 1AD9B 2RBLA 3DSNA 5SWZB 1C1EH 1L4IA 2NY3D 2P8MB 3SDXA 4PJBE 1YMHA 1C7TA 4O58H 1CGUA 1NBYB 3HPJA 1OB1A 1YNTA 5DJCA 5FB8A 1XGQA 5C07E 3VW3H 5L9DH 4PD4K 5IHBA 4LHUG 4RGOL 2R1XB 2ARJB 1CG9A 5IQ7L 1KIUA 3NIFF 3RHWK 5ACZA 3C5JB 1KV3A 3CFEB 3MRJA 4BH8A 1FP5A 5MI0B 4BUHA 3S8WA 5ESQB 4OM0L 1T1WA 4YZFE 1BD2D 3EZJB 1O7SA 2LE9A 4OZ4A 1OAUL 5JA9A 2NY2B 5I75B 1MNUH 3QEQB 1NC2A 3TA3A 5FUCE 3MYJA 3O3BA 2XWJA 3V7MA 1FL5A 3ROLA 3W9EB 3VWJA 3TCXA 5EUOF 1WBXA 5CIPH 1DCLA 1EMTL 1IAIL 2H2PD 3L6FA 2DQEL 5EORH 4MNQE 3WD5H 5BZWA 5E00A 4XVTH 2OL3H 1EHAA 3SCMC 5L2KE 3WS3A 4PGDB 1UFUA 2R1YA 2GT9A 4HIIB 3SE3A 1GOGA 1KBGH 5IFJA 2NZIA 3ULUE 3WKMH 2WINA 1I8KB 4X7SH 1BOYA 1AD0A 3N50A 5BMFH 2XG4A 2ZJSL 5K59F 1X7QB 3VCLB 3HG1B 1MIEL 1MWAH 3ARGB 4NC1C 5ABDE 3F12B 4OD1L 5SV4A 2OTUB 4LDEB 5GS0D 1IGTB 1YQVH 2GJZB 3V6ZA 3WO3B 3KLHC 2HT3C 4KV5F 2DTML 2R2EB 4OF7A 2ATKA 1NDGB 4YK4B 3DVGB 4YUEH 1EAPB 4FFYH 2YA0A 5GZOD 32C2A 3P4NB 3O8XA 4TQEH 1MFAL 4HH9A 4NBYB 4HS8H 4JRXA 5DUML 4GMTH 3RZWA 3U48A 4WRLA 1QD0A 4CVZA 1F6AB 2VTFA 1DSFL 1UM5H 4M1GH 1H3TA 5GRVL 2F19H 5CLWA 2FGWH 2Y06L 4L4TD 5GS2H 1FE8L 5F7FA 2XTJB 5EOCJ 4OSUH 4ZO8A 4ZUVA 4RWYH 2YPVL 2IADA 5BXFA 1PQZA 4JM4H 4PY7A 3SDDB 1J12A 1VPOH 5GRYA 3VXNA 4MNGA 4XCNB 5I19H 2BVYA 5DQ9B 4EEEA 5IB2B 2L7UA 4TVPH 3TFKC 4XP1L 1KULA 1CGVA 3WHE0 3ILQC 3DV6B 4X8JB 1JI2A 2G60H 3FOMB 2AK1L 4KVCH 1F3DJ 4M6OH 1KC5H 2VMFA 2G9HB 4NYLA 1WJ3A 1NDMA 5FYKU 3MODL 4YDIL 4AENA 2B2XH 2CDEB 2F5AH 4PB0H 3U36B 2ESVD 1ADQH 3RTQC 3DVNB 1DVFA 3N06B 1A0QH 5ILTH 2ICES 1YDPA 3ESVF 4EIGB 2ZP0T 3VD5A 1HDMA 5CBEB 1HZHH 4XVSH 1UM4H 1A1OB 5C8JA 1NMCB 2NLJA 3T77A 2HG5B 5IJVA 3CVHH 5ISZA 2NY3B 4W4OC 4PJHE 4AH2A 3QUML 5I66A 1UJ3A 2NY6D 3BUTA 1CFTA 1KEML 5C0ND 3PGCA 3E8UL 2QHLA 5IBTL 1LE9B 4U1IB 3QUMA 4O2EA 4S1QL 4IOFD 5JDSB 3OWEA 1MY5A 2PTTA 1MEXL 3MRPB 1TENA 3EJYC 1MLCB 1QSED 2PUQT 1NC4D 5IG7A 3KPRB 5KOMC 5A16A 5JW5B 4R97B 4S1DD 1RJYB 5C6TL 4LP4A 5CHNB 2HRPH 1IL1A 2APBA 2DDQL 2DM3A 4TOYL 1MJ7L 1MFBL 2VE6B 3TCLB 1B0GA 3O6FA 3F7VB 5L7XH 1BD2B 5DLMH 2IWGA 3L5IA 3MBXH 4NN6B 5IHZB 4TULH 4L3AA 3BPOB 1L7TH 4M03A 5IK3B 2ITDA 4JFPA 3ULVC 4ETQA 3RI5F 2D7TL 3DTXA 5J0BA 3SDCA 2OQJA 5HJ3A 2VDLL 4P9HC 4GKZA 1X5ZA 2EIZB 1V3LA 1KPUA 5I1CH 4KJQD 2F54D 3OKYA 1QSFD 3MRLA 1KJ2B 1S7TB 3A6BH 3HC4H 3MPCA 3MYZA 1NGYA 3GMPB 5FOBA 4DCQA 4ODUA 1NFDB 3G6AB 2V9TA 2VITB 1U3ZA 3WLWD 5DK3A 3U7WH 3IDNA 1U8JB 4Y0GA 3QG6B 4MCYA 3GEWB 3OZ9H 3OKKB 3R8QA 4DN4H 5H35A 3ZE1F 3I85A 5TF1L 5LAXA 4Z7QE 4EXKA 1HXMA 4CMMA 1XMWA 1FNAA 1YN6B 2MTPA 2R56H 3IFOA 3B8YA 5GGTL 1N0XH 4MS8C 3LZFL 1A9EB 1K9TA 1N7MH 1NBVH 1R5VB 4PRHD 4OV6F 1MFCH 4HPYH 1WWCA 5EU6E 3PWJB 3BT2L 3RKDD 5ICZB 3T3PF 1LO5A 4L4TB 4XCFH 3HA0A 1FRGL 4YBHA 5EWIL 1WBYA 4GAFB 4JGMA 1J1PH 5BJTA 1DQMH 3LAFA 4HSQA 2R29H 4I18C 3O4LD 5FYLL 5ESAA 4LHUD 3EFFB 5HDQL 4PUBL 2VDPH 1CLYL 4Y4HD 1E4WH 4Z7VF 5E1HB 4F9PC 2JJVA 3FFCD 4PV8A 3V4PL 3T0VA 1OSZA 1VCAA 3P73B 1U8PB 3TGXA 3DNKA 1PEZA 4RBPK 2FJGB 1BECA 2EDRA 3B2VL 1VADA 1QBLH 5C09E 1EHLL 1ZGLM 2G2RA 3VD9A 3QIWC 3BZFA 2V5RA 4NO2A 4Y16D 3VFRA 3VWKC 1IGFH 1IFHL 2ESVB 3LN9A 5F7LB 2Z8SA 2W9LA 1IARB 2YRPA 4Y8AA 5HGAA 4JCLA 3EJJX 2IBBA 2ENSA 4O02H 2D9CA 3MRIA 2NY7H 4XPTL 1NGWA 1N4XH 2XKSA 2OSLB 5K9KB 3KDMB 5F9WC 1YC7A 3ZYZA 4YO0B 3HE7D 2ZOLA 5GIRA 3C9NB 4MWFA 2NY6B 4DKAA 5FHAH 5LBSH 4NNXB 3LKQA 5B4MD 1JN6A 3K1KC 5JIKA 3TT3H 2X4TA 2FHFA 3DYPA 2W91A 5IMMB 4LIQH 3CH8A 5EZLA 3RDTC 5KSBB 2UZIH 1NC4B 4IDLA 1NQBA 3M07A 2A77H 1CDHA 1KTDB 3GM8A 3UJIL 3P4MA 2WBJD 4POUB 1F11B 1F13A 1RUQH 3IKKA 4ODVL 4MNQD 3S37X 4D9LL 3HI6L 3DUSB 2JELH 3E6HA 5L2KD 4YFLF 1IC1A 3B9EA 1ORSA 4PRNB 3ARTA 3EYSL 4Y5VA 3ULUD 4K7PX 3IJSA 3HS0B 5AUMA 1AXIB 5ESVA 3SKNB 3F7YA 1A3RL 2IF7A 3ULVF 4KKCC 4PJCA 1AGFA 3V0VB 3OV6A 1ZT7A 1FIGL 2QSCH 4K2UH 2LVCA 1WQVT 3G6JF 2NTSP 1JGVH 3CMGA 5F89B 1GAFL 3P9MB 5D6DC 3RIFF 1I8MA 4R3SA 5ICYB 4HKXA 1W0VA 4M8QB 5ENWB 2F54B 3MRGB 1U6AL 2AW2A 3DX8B 1VKXB 1MPAH 1EEQA 5JXEA 1QSFB 4M7LL 4PJIF 3VH8A 1WTGT 3O6MH 3OR7A 1TVBB 4QWWC 2BSRA 4QRUA 5E8OA 5B38A 4NZRH 5DQDH 4LLVA 5LG1A 4PJ5B 2DKUA 1SJEA 4ZOAA 3LHPL 4M48L 3RY6A 1OPGL 2VIRA 2DQJL 3WO4C 4AYFA 1P5UA 3HCVA 5D1ZD 2AKRA 3QNYA 5J1TC 3ZKND 4L5FL 4MA7L 3NOIA 5J56B 1MCWM 3T2QA 4WO4C 4YWGL 2CKBB 1MAMH 1W0WB 3MFGB 3I6LD 2YS4A 3CX5K 4PRHB 3ARWA 3QCUH 5IEHA 4P5MB 5D71H 4HFWA 2QKIA 2NY5H 5C0RH 5DZNA 4APQD 4BQ8A 3BVNA 1FYTA 2GY7B 1MHHB 1A7NH 1IT9H 4AM0B 4JANA 1MREH 4OZIA 3HMXL 4CRPA 1F4HA 4Y1AE 5EPMA 2R1WA 4DQOL 5E56A 3O4LB 3RVTD 3UTZA 5JPMB 1FNFA 1BVLB 4LHUB 4P23A 3VXPB 3VXUA 5M95B 4Y4HB 2A83A 4YIQB 4XNZC 3BN3B 3WIHL 1G7MA 3FFCB 3H3PH 2A38A 5IFHL 3TT1H 5JIIA 2I5YL 4YGAB 1IE5A 1M7IA 5EOQL 1OL0A 5D6CA 3REVB 2OTWB 1LEKA 4EQ3A 1K4DB 2R4SH 3QUZD 3C6LC 5D7IE 4GRLA 3HC3L 4TPRL 1Q94B 4D2NA 4AQOA 3LDBB 3MRFB 1NCAH 4Y16B 1IRAY 4HK3N 4PJ8D 2R0LH 1LQSR 3WLBA 4C83A 1AR2A 1NAML 1IBGL 2WUCL 1CE6B 2IH3B 5BZDB 2VXUH 4XNYH 2GJ6E 4H0GA 3PJSA 3HRZB 4E41E 1NAMA 1QKZL 1EFXA 1K2DA 5F72S 3HE7B 2ADFH 3QIBD 2IPKB 3M17A 2VDRL 1Y0LB 3IVKA 1BAFL 2XKNA 1RJZB 1T1YA 1T2XA 2BZDA 3CFDA 1WAAF 5E6IB 1J0HA 1W72H 3S96B 3T09A 2O61B 1A6TB 1KPVA 1ZXQA 2C1PB 2Y4SA 2FO4B 3BXNA 4YHLH 1UZ8B 3MRMB 2WBJB 4RSVA 3O2WL 3QEUA 3JV4B 3MV9A 3G5XB 1YJDH 1S7VB 4Y5XA 2SEBB 1T5XA 4LOUC 1KJ3H 3NPZB 5GHWL 3KWWA 4LSTL 5L2KB 3CFCL 4BSJA 1E6OH 5FA3B 4B7LA 3D18A 1F6FB 3NCBB 3FO1B 2XWBB 4IBLT 1TZHB 2AV1A 2MSPA 4GG6F 4IHOA 1Y18A 4ZFFB 3U0PA 4XHJD 5JORA 1J8HB 1FHGA 1T03H 3LEYH 3MGOB 5C08A 4R0LB 1I9EA 1FN4A 1RULL 3BD5A 5J7CC 4GXUN 3O3EA 3VFOA 1E4JA 4I0PA 5CEYB 2HVKA 4M61B 3GSNL 4Z95L 3RVXC 2CLVB 2IC2A 4O2CB 4OV5A 3AROA 3T65B 2AS5M 1YNKH 4Q7DA 2GK0A 3GSNA 5IESL 1R3LA 2Y36H 4PJDE 5INDA 4XVJH 2J8HA 4ODXA 5EU6D 4MJ6B 4IDJL 2UZYB 1CL7L 4KTEL 3BYYA 2CD0A 5T1LD 1BEYL 2RR3A 1ZOXA 2XTLA 4ZTOL 2J6EL 4PB9L 3AU1B 3FZUC 5DTFA 3O3DA 3MJ8A 3V6FA 1ZLWH 2ICWB 2J88H 5D1ZB 4JDTL 2J6EA 4JQVC 4LCCA 4MHHG 3ZT6A 3C8HA 3L5JA 3EO1A 3IDGA 3M8OH 7FABH 5GSVB 4ESKA 4GT7A 4YHZH 2RQ8A 3V5KB 4ZODA 1H0DA 5GSRB 3LN5A 4F57L 4YHPB 2EDFA 3FT4A 2EDLA 1KUMA 3QFDB 4ZNEA 2JKXA 2EECA 2FATL 3QDHA 1M4KA 1RURL 3TH2T 3WFCH 4XP4L 1IGJB 1VESA 4APQB 1NCDH 1RMFL 5C09D 2UWEA 2P5EA 1IM9A 4G9DA 3BIKB 2ARJQ 1G0DA 3OR6A 2F53E 4G8IB 2I9LB 3DJ9A 1T7XA 4ZAKB 1KN2L 4OM1H 2HKFL 5IVZB 2V7NA 4CNIA 5KG9A 3RUGB 3MFFA 2I26N 3MNZA 4FN0A 5D93C 1RUAH 3NN8B 1KN4L 1TNNA 5DVLA 5JW4M 1OTSD 4PJHB 1FO0L 2HLFC 4WGWB 3JTSA 3QUZB 1BJ1J 4NKQB 1MVFA 4EVNA 2FRGP 3B4NA 1MLBB 2VSDA 4M7JH 4X6EB 1JNJA 1IEHA 2FX8L 1U0QA 2EC9U 2YUXA 3MRDB 3T2NL 1DDHA 5LGJB 4KI5C 4PJ8B 3F65A 1WV7T 3AREC 3LIZH 3QAZB 4R8WH 5DJ2A 2NXYD 1U95A 5TE7L 3OXRB 4P48A 1QLFB 4KQ3H 2BHZA 1PG7L 5BS0E 5D1QC 1ORQA 4LVNB 5D2LB 4Z5RA 3ARDA 2R0WH 4ZD3H 2W65A 4YH6A 4HJJL 4XNUL 3NPSC 3P3YA 2FD6H 3NFPA 5E8EA 3QUYC 3QIBB 4K3HA 5HGBA 1ETZA 3RWDB 5DC9B 4LLQB 2JF1A 1UB5B 3BN9C 4M5ZH 5TJWK 2CMRH 3O2VL 1OTTD 5DDHA 4RRPG 1C5DA 1PY9A 4EN3A 3ARXA 1U41A 2XRAH 1E27B 4JJHA 1F4AA 4YX2H 2HLAB 5T1MA 1WEJH 4KKAD 1G9MH 1I7TA 1XGYL 1FC2D 2CDFB 3DVFA 1LD9A 3JVGC 3I3EA 4EDWH 3CUPA 2P49B 4R9HA 5E24E 1UXWB 2YHGA 4Z7OF 5ID1B 1YMMA 4N1CA 4ZS6C 3SKJH 2NY5C 3ARVA 4XAWH 3FQRB 5CD3A 3D39A 4OGZA 4TUOB 3TC9A 3FB6B 1QSVA 3C8KB 1MJJA 5BV7B 2VZUA 2D03H 3LRHA 4ZG1A 2GAZB 4G9FE 4JZOA 4G3YH 1B0WA 4OLUL 3QHFL 15C8H 1TNMA 1UC6A 2XZQH 4ONHB 4Q6IA 3V5HA 5I1JL 1JCKA 3FQUB 2HJFB 2O26U 3NCYP 1D9KD 3EYOA 3VXOB 5E03A 3AB0B 1CGXA 5E99L 5K9JL 1A14H 3BGFC 5EU6B 5M94B 4HG4K 5ALCH 3TO4C 3T0EE 5T1LB 5CILH 3IU3A 4XNQA 3C2SA 1QLEH 3SQOL 1JPGA 3UTTB 1BIIA 2V2WA 4Z7NE 4P9MH 3DMMD 3R0MA 1KCUH 1N64L 2GTZA 3GIZH 3IETA 4RGNC 5HY9B 5F9JA 2VLKE 5CZVH 4V2CB 5AEAA 5DT1L 4WI7A 2EDTA 1QUNA 4O51B 3QZWG 2ZSWA 3GJFK 2EYSB 4UV4H 4NQEA 4PYHA 4MQTB 4XNXL 4JFHE 3BPCB 5CUSL 2NY4D 5C09B 3V52H 5FV1L 1I85C 4XCYB 1E28A 2IJ0C 2ZG3A 1S9VA 3VE0A 1CXKA 1HXYA 4FMFA 2LABA 3VXME 4ZYKA 1QFUL 3RWIB 4WEBL 1CICC 4XGZA 4M7LH 1YJDC 5CGYD 5DHVB 4HX1A 2OP4L 4LKCB 4W6YB 1QYGL 4HZLB 5EZOL 2GJ6D 4OZHF 4J3XA 4E41D 1DVFC 1GZPB 1EXUB 4M02A 4KTYA 1FFNA 2QSQA 5EIIB 1IKFH 5GJTL 5CSBA 1R0AL 1TPXC 4LPUA 2DQUH 4PG2A 3GI8H 3W0WE 3REWA 2HMIC 2F74A 1B88A 2O5YL 5JLZA 3GKZA 4MA7H 4GLRH 4ALAH 1K3IA 4KMLB 1HILA 2Y6SD 3GIVB 1UJ3C 4JKLA 5HDBF 5E8PB 2NXYB 5CD5C 3ORJA 2Q7YA 3J8F7 3RZCC 3V79C 5IMKB 4N8VA 5HBBA 4X6FB 2EH8L 3IJHA 4PP2A 2ED7A 3G5YA 1RQ5A 1OAYL 3QG7H 1KYOK 4WUKH 3RIAF 1M05B 4OKVA 3CFJB 1AE6L 3GMRA 1RZ8A 3LQZB 3VRIA 2HJKB 4EUPH 3IXTA 1CCZA 4UI2A 2E27H 1YEGL 1HYRC 1I1FB 3DXAA 3O6FC 5HHME 5EC2A 5E9DE 3K0WA 4W70A 2GHWB 1AKJA 3UYPA 4YHOL 1CBVL 4MAYD 4GAGL 4TPRH 1LO0L 12E8H 1B4JL 1NANI 3DSFL 3MACL 5FM5O 2ZUWA 1QVOB 2X1QA 4TNVK 3S5LA 3SDCC 4M93B 5IVXF 1EO5A 2HKHL 4GRWE 4ERSL 3SDAD 4H5SB 1ES0A 2VDNL 4JFZL 1R3KB 1GHFL 1EEYA 4MB3A 2AJYL 3GHEL 3BEVB 4NO5B 5I1IL 4MCZB 5GGRB 4YPJA 2H32A 3OKEA 1FL6B 1UVQA 5JO5B 3BWUC 1FZOB 2HFFA 3WE6B 5A2JH 3KPNB 3RWEA 5GRJL 3GSRA 4PGCA 5EOTB 5SX4I 1GH7A 3SN6N 4NJ9L 4ZQKB 4L8DB 4JY6A 1D9KB 2I24N 1K85A 2AEQH 2PN5A 3C87A 3ZKXC 4LSRH 3DX7A 4HFUL 3LS5H 4ZXBA 3AM8C 4HV8B 3QEGH 4FQQB 35C8L 5FYKL 3GHBH 1J88A 1XF2A 4UV7H 1M7XA 4I2XE 4MJ5A 4PJBF 1CFNA 1X5GA 5DJDA 2F53D 2EXWD 4QXUL 4WFHE 5B8CC 2MWCA 4NRYB 1G6RL 3SE9L 4NHCL 4DAGL 4GQ9H 3DMMB 3SQBA 4TUJB 5KTEL 5AG9A 4RQQA 2CK0H 4UT9L 2G5BB 1MI5A 3QXTA 4D3CH 1G6RA 2OJZH 4ORZC 5HPMB 3AAZB 4OD3L 1MHPL 3P11H 1MCOL 1P4BH 5TDNA 1MH5A 1EO8H 5D7IB 3DX9A 4ODHL 2NY4B 1MFDH 4ELKA 4GS7C