5J13B

Structural basis for tslp antagonism by the therapeutic antibody tezepelumab (medi9929 / amg-157)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
SYVLTQPPSVSVAPGQTARITCGGNNLGSKSVHWYQQKPGQAPVLVVYDDSDRPSWIPERFSGSNSGNTATLTISRGEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Thymic stromal lymphopoietin
publication title Structure and antagonism of the receptor complex mediated by human TSLP in allergy and asthma.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j13B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j13B01
1G7PB 3QXAA 5BS0A 1L6ZA 4E42A 3BH8A 5FOBB 4LVHB 2HJKB 2JJVA 4GW5B 1MWAA 5FKPA 3SO3C 5C86A 3MLZH 4L4JA 5M95B 4N0CD 1NGXA 3NCJL 3MCKA 5CZVH 1LNUB 1OQOA 3OZ9L 4BSWB 5DVOA 1EO7A 3PWLA 4H25A 3RIFK 1G0XA 1JPTL 1WAAA 2PN5A 3H9ZA 1KCVH 5T1DH 3DPBA 3U7YH 4XMKL 3HC4H 1HE7A 3NCFB 4HS8L 4ZQKB 3MLUH 4PRNA 4FQXC 4M6OL 3VFSB 1S7QB 5CGTA 2YA1A 1OTUD 1A6TA 1SEQL 3I6GB 4ZAKD 3VA6A 4EDWL 5F7UA 4KZEL 2VZTA 2BNUA 1KLUA 4Z5RB 4KY1L 5T3ZL 3EJZC 4ZODA 4OZIA 4X9FA 2BSSA 1PDKA 5I1AB 3HUJA 4LSUH 3VFMB 5I74C 4K23H 4PRAA 3FFDA 1R3IH 1OQXA 3QG7H 3S37H 2O61A 1W0VB 5AZEL 4PY8I 1JHTB 1IC5L 4HPOL 1V8HA 3NTCL 4I0PB 3WLBB 2VDPH 1I8MA 2V6HA 4CDGC 5JIPA 1HI6B 4JZOB 2E6PA 2XNAB 1J8HB 4X4MA 4Z7NE 4P46C 3GHEL 1XGTA 1GGYA 4D0CA 1YEGH 4JFZH 4M6OH 1VFOA 5EA0H 1MLBB 5LXGH 2FX7L 4QCIB 4Y19E 3RVVD 2NW3B 5DQ9B 4M93C 4WIQA 4KZEH 1HXYA 1TJGL 3DETC 3LRSB 3QXAB 4E42B 1DLHB 4LK4A 3WUWG 4HAFA 1MWAB 3R06A 5FKPB 5IHUL 2ZG2A 2YD1A 1C12B 4GRWB 3KPSB 2D7PA 2K7PA 4PJEF 3A6BH 3S35H 4XPGH 1NGXB 5ACLA 3B83A 4PYGA 4DGIH 3S5LA 4LCYA 3NTCH 4MJ6A 3JV5A 4JAMA 2V9RA 4NQEA 2DI7A 3SDAA 2NYYD 4YX2L 3IGAB 4DTGL 1T2QL 4WUUE 4OCXH 2FYYB 1ZOXA 1ETZA 1SM3H 4PRNB 4Y1AD 4B0MM 2R0KL 5F96L 1EPFA 3NIGE 2APXA 1A6TB 2VR5A 3RGVC 3H0TA 5HYIA 3U9UA 1KLUB 1FYTD 2DQJH 3PWVB 3RWGB 5IFJB 3VXTA 4HS3A 4OZIB 2BSSB 2OQJB 1YECH 2D0FA 3HUJB 3CX5K 3VWKD 1UB6A 2Y07H 3T0VA 5EIIA 1V7ML 2CGRL 2DI9A 4NQUA 1KXQE 4N5EC 4CKVX 4Q6IA 4XH2B 2LU7A 2I25N 4DTGH 1I8MB 4U31A 4B53A 4AT6A 8FABB 1INEH 1XGTB 3KJ4C 4MHHG 2XZQH 1EMTH 1BWMA 2R0KH 5KSBB 5KG9A 5F96H 5JQ6H 2C3GA 5I1JL 1QHPA 1YN7A 5DJ6B 4P5TD 2NLJB 3OJ2C 4CVZA 4KI5C 3I6KA 2IF7A 5C07A 4HS6A 4M03A 3D3VD 2PNDA 2J8UE 5E56A 2C4FT 4K3JL 4Y7MA 3BQUD 1FZKB 3AFLA 3KPQA 5HDBE 1NMBL 3C8KA 4U7SA 2CLVA 1IAII 3VXMD 5D93C 2YK1L 4QWWD 2HRPL 4Y4FC 4YHLL 3V5KB 1BM3H 3S5LB 1J86A 3WIHL 4LCYB 4MJ6B 3LQAC 4JAMB 1V7NH 2XFXA 4TRPH 3KPPA 3LZFL 4DAGH 1JFQL 3SDAB 1TVBB 3BZEB 4KGLA 2VXSL 1HDMA 4YXHH 1KLGA 3WD5L 4MCZB 1ETZB 3FB6A 4EVNB 3T08A 4U1KA 3D2UA 1BPVA 1MCOL 5C92A 1F8TL 3GMOA 1AD9A 2CH8A 3H0TB 4HIEA 4WWID 5A43C 1IILE 1KLFA 5D7JD 3RP1A 1BFTA 2IAMA 1I8IA 1NMBH 4GQ9H 4HS3B 5EZLA 3VXTB 3RWDA 5E95B 4YNYA 2YK1H 4S1RH 2HRPH 4R4BA 1NMCB 2DIBA 5EU6A 5DVNA 5J9PA 3M45A 5EU4A 3QEQE 2ZSVA 5D7IE 3IDJB 5HDLA 4Q6IB 3GNMH 2AEQL 3PQYB 5DURD 1I1CA 2C1PB 4Y5YB 4NNPH 4C4KO 3V9FA 2JJUA 1K85A 3U0PA 4QRRD 2ZJSH 1JZ2A 1TTGA 1A7PH 2R2BA 4G42A 5KG9B 4ZO6A 5A3IC 1JMZA 1MCOH 1QBBA 1YN7B 2WMPA 1ACYH 4KVCH 3QH3A 1FN4A 4XC1L 1BREA 4N90D 4E41A 4HS6B 2CO7B 1BFVH 4P3DA 3ARPA 2R23B 1UT9A 2D9CA 5GGSY 5GJSH 4EIZC 3AC0A 3MBXH 5E4EB 3MXVH 3QNZB 1MCJA 1LO5A 1EHAA 2EXYD 1LP9A 1HSBA 4LBEA 5E2TH 3DSNA 5L2KA 4GH7B 2XFXB 2HFEA 2CUIA 3KPPB 2DBLH 4XZUA 1JZ5A 1EXUA 5LKNA 3OJVC 2GJJA 4FQHA 4P9MH 2YXMA 1KLGB 1CR9H 1Z0NA 2XQBL 5BVPL 1I7TB 3FB6B 5HHMD 1TDQA 3WO4B 4HHAB 2RIKA 1WISA 4XC1H 1Q0XL 4L8SA 5ICZB 5HHOA 3GMOB 4UILH 3WHXA 5SWZD 4Z7QE 4OZFA 3E8UH 3RUGE 5F6IB 4HIEB 1MOEA 4GMSL 4PRPB 1HH6B 4X0KA 2A9ML 2IAMB 1I8IB 5EZLB 3TBTA 3OTTA 3RWDB 4EUPA 1H5BA 1ZLVH 2EDXA 3CFKB 5ADPL 5D71L 1EX0A 4OLZL 4R4BB 5EU6B 5J9PB 4IRSB 5EU4B 4P2RA 4U6YA 2IALA 1JCKA 4UBDC 4UIKH 1OCWL 3DX7B 3SDXA 3VJ6B 3F7PC 4LLAA 3ESUF 1J0KA 1QVOA 5KS9E 3U0PB 4PLJC 4PREB 5HHPB 1YPZE 3BKJL 2PETA 4G42B 4XPTL 1NLDL 3W2DL 1HQRA 4JM4L 1V3KA 3NN8A 1CLYH 1PY4A 2P5WE 2E5EA 2W60A 3HTLX 3QH3B 1IGMH 4NQTA 4Q2ZA 2WBJD 3IU3A 1FN4B 1RZGB 3L3JA 4OSUL 4S1DC 1RZ7H 3GUTA 3VXSE 4M6NL 4QGTA 1HCFX 2GJ6A 3SJVD 4MVBD 4P3DB 1UM4H 2H6PA 5IFAH 3QUMA 4NCC2 1CICA 4ZFOB 1OY3B 4JO1H 2X1WL 4OLZH 1FNSL 2FX9L 4CU7A 1J87A 1LP9B 2ICWI 4OCSL 1QUNA 1YEEL 2VR4A 5E99L 5GS0H 2HH0L 4NHCL 5JMOC 1T03L 3G9AB 3FOLA 2HFEB 1GIGH 4PPTA 5IEKA 1LE5A 2VDMH 5JTWA 1EAPA 1JZ7A 5C0CE 4FQHB 4XPTH 3L1OL 4G7VH 1DFBL 2NR6D 4NRYA 4Y2DC 5C0RL 4X5LA 3KJ6H 3KPRE 4ENEC 4P23D 1O0VA 4GT7A 4ELKA 1UXSA 4GRLC 3DROA 3FZUC 4D0BA 2VR9A 1F97A 2UV3A 4L8SB 4M61A 2G75A 5HI4C 4HKBB 1RURL 5F7LB 5HHOB 3HE7D 4XC3H 1K4DA 4GXUN 1QYGL 2AAVA 3TBYA 1LGVA 4X0KB 12E8H 5K9JL 3N85L 4HAGA 4FP8L 4EUPB 1H5BB 4XVUC 1PG7H 2WAHA 2HH0H 3EUUA 3VXRD 1FVDA 4U6YB 2IALB 3C09C 3LQMA 4BFGA 1SBSH 1TJHH 1XF4A 4ONHB 3B5GA 4DGVL 1S7TB 5JW3L 4UV4L 1QVOB 3L1OH 5C0RH 1H3UA 5A16A 4GG6A 4LF3A 1V3JA 4NO2A 3T0EE 1HQRB 1BZQK 1RURH 4LDLB 1F90H 2KH2B 4K3GA 2O93L 3RDTA 1XGPB 4Q2ZB 1OTSD 1QYGH 5FGRA 3GUTB 3OKMB 4L29B 3ZKNC 2DM2A 2H6PB 4FP8H 3QUMB 5I1LA 1CICB 4APQA 4L9LC 4OF6A 5F7WC 1FNAA 4YZFE 3OGOE 5HTSA 4R8WH 1SMAA 3HE6A 2VZOA 4BA8A 4U6HA 5EZIH 1QFPA 4XPFH 4WFHD 1PLGL 1LE5B 5EBMB 3J8F7 3J7HA 4YHIA 2Y6SD 1JNNH 5CGYD 1E6OL 3KNBA 2DQIL 4XP4H 4NRYB 4ZFGL 1EAJA 5DJ0A 4BKLA 3PV6A 5JORB 2R8SL 1UXSB 1MCFA 1INQA 1S7RA 3DROB 2G75B 4ZD3H 3K8KA 1R5VA 4P3CL 3DWTA 5GRUH 1RFDH 3EOAB 2OLDA 5E2UH 4WV1C 3TBYB 5JHLH 1CXIA 5LGHL 4KAQL 4KTDL 2VDOL 4DQOH 3STBA 5D7SH 4EXKA 5K93A 1MI5B 3BT2L 3UBXA 5D4QA 4KHTH 3WFBL 4KKAC 4WRLA 4WW2C 2EDEA 1XF4B 3D85D 4JFYB 1GGTA 5CUSH 4KPHL 4JLRA 4P49A 3K2MC 3HG1E 4D9QE 1C7SA 4FQXA 2UUDK 3HN3A 1P4LA 5A16B 2G60L 1NLBH 4GG6B 4RGNC 4FQPA 4LPVA 3F7RA 4LF3B 4NO2B 3OXSA 4JFQB 3DO7B 4PBWD 3SOBL 3FN0L 4O4YH 5FYJE 3RDTB 3HR5B 2ITDA 4NKDA 2F54A 4MSWA 2IC2A 2AXGA 4M9OA 1Q8MA 2P24A 5CWSA 4MJIE 4NQDE 4OZFH 3GDBA 4WI5A 3SE4C 4KTDH 3VRLE 3GSOA 5CBEB 5I1LB 1CLCA 5IB5A 1JTTA 3O11A 3TH4T 3MRJA 1G7HB 4UTAH 5I15H 2NY5C 1TNNA 2H2SC 3SKOB 3VMNA 5DQDH 3LH2L 4I1NB 4OD2B 2W0KA 3CCHA 4P46A 4PFEA 1FPTL 2YD5A 2WP3O 5HPOA 4QXTA 4HEPG 3NH7L 3KNBB 1CGVA 1LK2A 2OS7A 5DLML 1E4XH 1QFWL 2DTMH 3U4BH 4AY0A 5IESL 4X80H 1IGFL 5C08E 4G7YL 4YWGH 1P7HL 4N0CC 1INQB 3MZTA 1HNFA 2AGJL 3MGOA 1R5VB 4HBCL 1Z9MA 4ZUTB 3QRFM 3LV3B 3MRBA 3QHZL 3ZYJA 1K2DA 4WFGE 1X5XA 3SKJH 2GW5A 3P3YA 1JGEA 4R26L 3L5JA 4PY8J 5GJTL 3HNVH 2NX5E 1G9ML 3UBXB 4GAJH 3SE9H 1Q9KA 2VUOA 3ROLB 3MRFA 3P11L 2V7HA 1H3XA 3LH2H 4GS7C 5DTFB 4W4NA 1R3HA 4JQVC 2CKBL 4LCWA 3FQXB 4OT1H 5I66B 4X6CA 1U8IA 1I1YA 3BXNA 3D5OF 1BD2D 3T0BA 2B2XL 3UTOA 1ROWA 5EC2B 4ZUVA 4JLRB 1IVLA 4FQXB 1ZA6A 4V1DA 5C71A 2VLLA 3ZE0E 2QQKL 1RUAL 3FHQA 3OXSB 1NL0L 3ILQC 3HCVB 1YY9D 2EDLA 1CDCA 4M48L 4OGYL 2QHRH 2Y72A 5J89A 2F54B 4MSWB 2AXGB 5DC0A 5HVHC 5CWSB 5DT1L 1QLFB 1CFQA 1YEKL 3GSOB 2XN9A 2BVPA 5JW4Q 5KZCD 5IB5B 4NT6A 3SKNA 1IRAY 4IDJH 2J12B 3P11H 3RVTD 4LLYA 1FG2B 2F53A 1EBAA 4WEBH 1LO2H 3IKKA 3RVVC 5L9DH 4G6AD 4DGYH 2VWEE 1TQCB 5CJQH 2EIDA 3BISA 1AQKL 4FQJL 3CCHB 2VXVH 5DRNA 3JWDL 4JJHA 4Y5XB 1WGOA 4TNVK 4MA8H 2X1PA 1BQHG 4M93B 2MMXA 43CAA 4DKDC 2YMXH 4U6TA 2CXKA 5IHZA 2NMSA 3MGOB 1BBDL 2PXYA 3INUH 1TENA 1YEKH 2CJUH 1SYSA 5LWYH 4G6ML 1K2DB 3I84A 5I75C 5TE7L 5CKAA 1AGBB 3DHMA 1JGEB 3MV7E 1N2RA 4Y4FA 2BNQA 1KIQA 4ZTOH 4TTDC 1Z3GL 4WI4A 3V2AR 2BX5A 4U3XA 3MRFB 1S7UA 2ADFL 4R7DA 4K7PH 1YNKH 4D8PA 1AQKH 4MWFA 1R3HB 2HTLC 4LCWB 3FO0H 1U8IB 2DYPB 1I1YB 3JWOL 3BXNB 3D39E 2Z8WC 4U1IA 1IKFL 4ZUVB 3ALWA 1ZA6B 2E9IA 2HKFL 4V1DB 1RZKC 2CR3A 4P4RA 4F9PA 1IAKA 1ORQA 5C0EA 4L4VD 4YDLC 4YJZL 4JY5H 2VERN 1X5LA 3VWKC 5KSVB 4KUZH 3MV8D 2DQUL 4AH2A 4PR5A 4HUWA 4ORGA 1FFOA 3BKYL 4RFOH 4YO0A 5TE7H 2W1NA 4WGWB 4MD4A 3LN5B 5ENWA 1P7KB 4IBLT 2XN9B 4I4WA 4NT6B 2DWEA 4OB5L 4ODWA 4TVPD 4NKMB 4LLYB 2F53B 1PG7W 3KXFD 4JFDD 2F5AH 4RFEA 2IWGA 3K4DA 3W9EA 1V05A 5HYJA 4HGMA 5DRNB 4CRPA 3KJ4B 2HKFH 3VMOA 3BQUC 1JPST 1BVKB 1F4XL 2FEEI 3HNSL 4AM0A 2DJ4A 2DQUH 5TDOA 4ALAH 2Z92B 1DUZA 4PJDB 2PXYB 3JV4B 4N0UA 4UI2A 5B4MD 1SYSB 2IBBA 5ILTL 4RBPH 2AJSL 2DI8A 5EBWA 5EB9A 3NCCB 3LQZB 2NXZD 1JPGA 5IW6A 4DN4L 5D93B 5BVJA 1N2RB 4XBGB 4Y4FB 1KIQB 3FAXA 3PHSA 1B4RA 3EZ8A 4N9OB 3EO0A 1QO3A 4JRYB 1S7UB 3TO2B 4NO0A 2BJMH 1ZLWK 5H35B 4MWFB 3V4UL 3GMNA 2WUCL 2XT1B 4U1IB 3U4AA 3RZCD 1KENH 3OAZK 3O2VH 3N1QC 3ESVF 2D3VA 1J1PL 3MCG1 1OGAD 4P4RB 1IAKB 5J1AA 4OFIA 4RX4A 4TQEL 3VFTA 2J88H 2X9YA 4HGKC 4AH2B 1E28B 5KSAC 4PR5B 4F3FB 5ILTH 1F3JA 4HUWB 1FFOB 4FFWD 2J6EA 3UP1A 3VRIA 2EDFA 1NEZA 5L88H 1DQML 3FRPA 3TA3C 4DN4H 3P9LA 4NZJA 1NPUA 1A4KA 1J0JA 1JV5A 2DWEB 2Z31D 1KXTB 4RFEB 4KKNA 4G6JH 4FTVE 4RAVA 3JXAA 3E6HA 3BIAX 2Q7NA 4F8TA 4YBHA 4Y19D 4JO3L 4AMKL 4LSQL 3WXVL 4OV5A 5CFHA 2ZUXA 1OTTD 1U8LB 3FN9A 1RAMA 1KNOA 1N0LA 2WWKT 4PGEB 1VEOA 4YXKL 5TDOB 3QEUB 2V5RA 2VITB 4WFFD 5ECJE 1KB9K 3PXJA 2DBJA 1OHQA 1DSFH 1HQ4A 3EYSH 3N50A 4W6XB 1VPOL 2V2TA 5DFWH 1J8HE 5TFSH 3MA9L 3W0WE 1FNHA 3DSFL 4YH6A 5EBWB 5B39G 3TFKD 2I24N 1HHHA 2JCCA 1JPGB 4PRBA 5JO5B 3OKDA 3O6FC 5BVJB 5BO1L 2J7LA 3GJEB 4DW2H 1ONQA 3EO0B 1QO3B 3QUYD 1LEIB 5DVLA 4GMTL 1CFNA 4NO0B 1AXTH 3FRUB 3NA4A 1U3JA 2A2QT 3GMNB 4NKIL 4BQ6A 5IB3A 1KN2L 3KPSE 3HI6H 4Y2DA 1OGTA 1SEBA 3DYMA 1IGTA 4OCRL 3CK0L 4GRLA 4LQFL 1VACA 5J1AB 4MCYA 2UZXB 2HVJA 3LPFA 3VFTB 3B6SA 3MA9H 1MREL 4GSDH 1F3JB 1NEZB 1OAXL 1KTRL 2XWJA 2ICWJ 1PKQE 4NWUL 3O6KL 1ZLUK 3S3SA 2YPVL 4U0RB 4WI2A 1TETL 1A4KB 1JV5B 3SY0B 3EJYD 5IVZA 3U30C 4K3HA 4Z7QF 1CFBA 2AK4A 3QDME 2EDHA 4U1HB 4HXBL 1WJ3A 3I9GH 3LQAH 1FL3B 4RAVB 1BAFL 1GC1L 3P9WB 2I60H 1UYWL 1BECA 4QOKD 4WU7A 2D4FA 4OV5B 4FFZL 4NM4H 1F45A 5ID1B 4LAQL 1KNOB 2BNRD 1LO0H 3LOWA 4XP1L 4U6VH 4TNWF 1P7QA 5F1OB 5KVGL 4XBEH 1HQ4B 2V2TB 4LVOC 1A7OL 1N0XH 4Q7DA 4OF0A 5I1HH 1QFWM 1YPZF 1T83C 1NFDF 4K7PY 4L9LA 5KSBE 4X98A 1N3NA 1HHHB 3S97C 2VIRA 2JCCB 4PRBB 2LABA 2DQEL 3VXUE 3K0WA 4EXPX 1YYLL 2ENYA 3AVEA 1ONQB 4P23C 1AGFA 4X4YB 4GKZB 3O41A 3MNZA 3ZYOA 3HE7C 3DXAA 4XWOD 4Y2DB 1SEBB 1IGTB 5DJAA 4GRLB 5TDNA 4RAUB 4PJ8A 3AXLA 4FMKA 5EO1A 4OLUL 2GKIA 2I27N 2HVJB 2R0WH 4I9WD 4X6DB 1A7OH 4OLVL 4LCUA 4XP5H 2A6JA 2IQ9H 3B6SB 4WV1A 1KV3A 2FX8L 3TCXA 4P2OA 1RUML 1R6VA 4JE4B 4NQCA 2Y25A 4M7JL 4YPGB 5IVZB 3SGDH 4G8FA 1RUPL 2AK4B 3DX9B 3IJHA 5D1QC 4WW2A 3UDWA 1IZKA 2XKSA 3BD3A 4EIGB 2EC9U 4M9PA 1N6QH 4OZFG 5D1XB 3RI5F 5E8OA 3VFUA 4WU7B 1M1SA 2IAND 3TWCH 2UY7A 4FG6D 5CLWA 3EOBA 3DV4A 1XH3A 2MCG1 4C83A 3QHFH 4Y16C 2HWZH 1P7QB 3PQYE 1QSEA 1NJ9A 1EFQA 3GBLA 4EI6A 6CGTA 1OAQH 2FX8H 3SCMD 3SE4A 4MJ5A 2UWEB 1PFCA 2QADD 4J3UA 5D2LA 4L9LB 5SV4A 2Y6SC 2J6EH 1KUMA 5CGYC 4M7JH 5LBSH 5C0AE 3MLVH 5CLTA 3ME0A 2E8YA 1ZT4A 1AGFB 1IKNC 3P73B 3IAPA 3VW3H 3MJ9L 5HDOA 5DWUL 1KBGL 2CQVA 2HFFA 4NQSA 4HT1L 3WXWH 1HILA 3L5IA 3O41B 1MCDA 5DK2A 1NSNL 3U2SA 1KN4L 3QCVH 4KGJA 1C1EH 3BPLC 4YDJA 1CD9B 5HI3D 1H3TA 3QIUD 5IB4B 2GUOA 2V2XB 1IM9D 4PJ8B 3AXLB 5EO1B 4PRHE 4Y4KD 1Y6NR 2EDBA 4MNQD 1BQLH 4RWYH 1GOFA 3RY6C 2BVQA 2A6JB 3KPMA 5HHQA 2YRPA 1AY1L 4YDKL 4D94A 3MNWB 2BK8A 4P2OB 4R4ND 2PYEA 4L1DA 1A7QL 3THMH 3C5ZA 4NQCB 2X4RA 2XTJD 1CGYA 4N68A 2FO4B 5A2LH 2RFXA 4JQVA 3F6LA 5DWUH 5IMOA 4MXWL 1CVSC 4HG4J 2R9HC 2Y9RT 4PRPE 1T5XB 3NZ8A 1TXKA 5F88A 3T2NL 1KN4H 3T3ME 4QRSA 5E8OB 3TLRA 3VFUB 1D5MA 3CNKA 1AKJB 2DICA 3DV4B 1XH3B 1KEMH 1NGYB 1GXEA 4C83B 4H1LB 1H8OA 4P59L 4QXGL 3RKPA 5TH2A 2OMNA 4LLQA 3G5VA 3NOIA 1QSEB 4EI6B 5BZWB 2BC4B 1NUNB 1LILA 3IFNL 1R3JA 4M5ZL 3C2AL 4R7NA 1FIGL 4MJ5B 3MXWH 1U8PB 3BGMB 1PY9A 1NGPL 3CFIC 1A4JA 1WSST 4H20L 2XPGA 3SDDC 4S2SA 4FOMA 2VLRE 4FXKA 4NRZA 5KVFL 3GO1H 4I3RL 5BJTA 2WBKA 4NQSB 1DN2A 4DUVA 3KPRD 4L5FL 4NWTH 1A1NB 1Q0YH 3BAEH 2YS4A 3RIFF 5DVKA 1CD1B 1SQ2N 3V7AE 4N0YH 2GUOB 3QWOA 1A3LL 3E3QE 4P59H 4YFDB 1ZHBA 3NFSL 4G8GE 3ULVD 4R9HA 3ULUE 3IFNH 5J13C 3TT3H 3WLWC 5BXFA 1FIGH 1KACB 5HHQB 3RWCB 1LDPL 1JHKL 2CLRA 3NABL 3F62A 3AROA 2PYEB 1IGYA 5DUML 3C5ZB 4AG4H 4GXUM 3MRHA 5FFLA 2NZ9D 5I1GH 3I50L 2AJUH 4I3RH 2RFXB 3SGJC 4HC1L 2BVYA 1K4CB 2QV2A 2F19L 2Y36H 5FGBC 5DHXB 3ZHKA 3NZ8B 5F88B 3HMXL 2DL9A 1Q72L 2VL5A 4QRSB 3MJ7A 4XPBL 5E9DB 1D5MB 1F02I 3ARGB 2EYRA 3LDBC 1NKOA 2F74A 4OV6F 3K7UA 4XAWL 1MCRA 1NCBL 1CGSL 3V4PL 2EO9A 4NHUB 1N4XH 5TH2B 4LLQB 1T7XA 4JGUA 3HZMB 2AV7A 2XIDA 5MEPA 4ZYKB 3IJYA 3ZE2E 2ZUWA 4U1GB 3KG5A 1UWGL 2H3NA 2WV3A 4UINL 2HT4D 1WT5C 2ZUTA 2ZKHL 1EUTA 1NGQL 2XPGB 5K9OA 1A14H 2E9WA 4S2SB 5F9JB 4NRZB 1LVEA 5D6DC 5BJTB 5HVWA 2DWDB 5MHSE 4IRZH 1JZ4A 3T3PE 4XPAL 2NY2C 3FJTA 3IYLW 5SX5K 1GGIH 1MF2H 2VMFA 3OAUL 4JB9H 3TF7C 3VXMA 5JR1H 1ZHBB 1AC0A 4OF3A 4FQIH 3K8LA 4D9LL 5HGAB 5I8KL 4WO4C 1KELH 4PBVC 1IQDA 2X1OA 5CJ8A 4LQ1A 3KYMB 3MA7A 4CMHC 2CLRB 2FBJL 1QFOA 2EDJA 4U1MA 3LHPL 3GSNL 3CVIH 4WGVB 2ZKHH 5DFVC 1NGQH 3H42H 1OAZL 3MRHB 3V0WH 3WFHA 2MTPA 5C2UB 4DUWA 4BFIA 1RPQA 5C7XL 2BVOA 2NY5H 2I26N 4M62H 3Q6FA 5DO2C 1A6AA 3N1FC 1ZV5A 2VL5B 3MJ7B 3R8BB 2H2PD 2B1HL 4K9EL 1RZ8A 1MI5E 4YDLB 1RULL 1IC1A 4CN6A 2VLJB 2C3HA 5B3JE 4NQDD 5I8KH 3WL9A 5KSAA 2OJZH 1AXSA 1PZUB 2AV7B 5MEPB 3TA3A 3IJYB 3UO1H 3IFPA 5DXWA 3SE8H 1I9JL 4NZUH 1QFHA 1M7XA 3VWJB 5DUPL 2ZCLH 4LOUD 5GQBA 3FOMB 5C7XH 4F57L 2EYSB 3SDYL 2ZSWA 1PGRB 5C09B 1N5AA 5KTEH 1WWWX 3MBEB 1WFTA 35C8H 4NRXB 4IJ3B 1GAFL 4PS4L 2DQCL 5J11B 1YC7A 4H88H 5C08D 1NC2D 2HFTA 3ARXA 5B4MC 1AO7D 5T33H 5AZ2H 2ARJA 4IDLA 2EE6A 2CMRL 4NUGH 2PYFB 2E6JA 3EDFA 3QUZC 1ZSDA 2F8VA 5INCA 1I9IH 1OF2A 1FQ9C 1TCMA 3A0OA 3MRPA 4U2YA 3CFBA 2IH1B 2BDNL 1IQDB 2ESVE 3FB8A 3RNKA 3MA7B 1I9JH 2NX5D 4F37F 4U1MB 5ALCL 3OB0H 2RB8A 3O6FA 4KKLC 3T0WA 5IV2A 2DB8A 2GCYB 1Z5LA 2VLKE 3WFHB 1R0AL 1CXFA 1HHIA 3N9GH 4RRPA 1YUHA 2F5BL 4XX1E 5IVOA 4BFIB 5CINL 2BVOB 4OQTL 1P1ZA 3Q6FB 5I1CH 3Q2CA 2XXMB 1S9YB 2NY3C 4ZXBC 2FJFA 3SQOH 5DMGD 5F7EL 2ERJC 3ALPA 2A1WH 3OXRA 4KC3B 4PJ5E 1FLRH 5GS1B 5I30L 4Y89A 3GSQB 1ZEAH 1BGXL 3MRNA 1RIUL 1ED3A 3WL9B 1B0GA 3MYJA 5KSAB 1MIEL 4RISL 1DBBL 1Y6MR 4G8EB 1CFTA 1RJCA 2OZ4A 1RZJC 3IFPB 3EGSA 4PJEB 4EN3B 5FO9A 2HAZA 2VZUA 3QIBD 5DD5L 1I3RA 5ESQA 2A9NL 3GMRA 5L6YH 1G84A 1MEXL 2YPLA 4OKVA 5DD3H 2ZSWB 3MRLB 5MERA 1E4WL 1MY5A 3PP3H 5IFHL 2NPLX 4LHUG 1NMAH 1SVCP 1CGTA 3DO3A 3GK8H 3SJVA 1WIOA 4EJ1C 4XMPL 43C9B 1KIRA 2GK0B 4F8QA 1S7WB 1U3ZA 2X7LA 1RZKH 1EEYB 2CR6A 2OMBA 2AXFA 1ZSDB 4PP1D 5INCB 1FBIL 4LSDA 4HKJB 3FT2B 5FUCE 2W07A 3PUCA 1OF2B 2OJEA 3QUYC 1KYOK 3MRPB 1J7VR 4LCIH 1T83A 5D70L 3FB8B 3RNKB 2EKJA 2I07A 3OHXA 3QQ9D 3TIDA 4PJFF 4E9LA 3CVHA 2CK0L 1UQSA 3O6FB 1B0WA 2B7DT 2I5YL 5CZXD 5IV2B 1ITCA 1Z5LB 2A9NH 2PUQT 1QRNA 1T20B 2M8XA 2VJXA 4P23A 1QKZL 1YUHB 2ZUQC 5F1NB 3VDBA 1B90A 1EVTC 1ZWIA 2IPTH 4U1NA 3HE7A 2P5EB 3QCTH 4XMPH 2FJFB 2LAGB 4HWEH 1QEWB 4MJ4A 1QR1A 1U42A 2VISB 3QCUH 4F7CB 2YKLL 5BV7L 3OXRB 1ZGLP 4RAHA 3H9SA 3VXRA 1CFVH 3WFDL 1D3CA 4L3EA 5FYJL 2RQ8A 3MRNB 4KJQC 1ED3B 1RVFL 2V5TA 1B0GB 3MYJB 5LCVL 1A1OB 4RFNC 2E27H 5CEZE 4X7CC 3RKDD 4M1CC 1CFTB 2I5YH 1KB5A 1NFIA 2MQ3A 4XVSH 1NCCL 4MYWB 3U30B 5IKCA 1KCUH 1QKZH 5D1QA 5D5MF 1IFHH 3GMRB 2YPLB 1J0IA 5MERB 1WVZA 3C8HA 1VERA 5H94A 3CMOL 5J57B 5GXBB 1J8KA 2V5YA 2MJWA 1CXEA 3DI2B 5GS3A 4KKCD 1BBJA 5E1AA 3CZJA 4JJ5B 4XCFH 4Y16A 5DMIH 4HV8A 3S7GA 3FQRA 2HN7A 2X2YA 2IBZY 4LVOB 4YDVA 2XY1A 4G9FD 2I07B 3TCLB 1CL7L 3OHXB 3X12B 3V5HA 4EI5B 1GHFH 4R2GB 4OCWL 2B8OT 4XWOC 2O5YL 3WMSA 5ISZE 1UZ8A 1U8JB 3VGHA 1QRNB 3TYFA 1T22A 3UJJL 1D7FA 4N8CL 1IKNA 4O2CA 3TYGL 1XGRA 3ZTNH 4E0RB 3T04D 4HXAH 5BRZA 1FL5A 1A6WH 1ZWIB 3BPOC 4MXVE 2UZIL 4Z78A 1MUJB 3S4SA 1REIA 4ZPTB 1W72L 4ERSH 5L8JB 1CLOL 4X7SL 3C9NB 1XF5A 3QRGH 5ERWA 5C70A 4P4KA 4PTTA 3VGFA 4PJIF 2X4SA 2APFA 1FGNL 3L9RB 4PV8B 5F7HA 4JRYE 3H9SB 1MJJA 5E5UB 4P57A 1IC7H 4L3EB 3RY6A 5EU3A 4X4XB 2FECI 3HPLA 4FA8A 2A83B 5EUKA 5I1EL 1Q9LA 3FQUA 4LIQH 1JYWA 1NFIB 4LLVA 5C6PB 4R90H 4B41A 2QLVB 5IKCB 4PP2A 3TYGH 2VTFA 3HNTL 4U6XA 5D1QB 2IADA 3IRZA 2D7TH 4RZCA 5D8JL 4H5SB 5H94B 3IT8D 2ORBL 5I73B 4MDJA 1D6EA 4I48B 3SCMC 1XF3B 4JKPH 3MJ6A 2BOCA 5E1AB 2ADIB 3O3BB 5A2KH 4RSVA 3MV9E 2QADC 5DMKA 4I18B 2E9JA 4I0PD 4LCCC 1MH5B 1EJ6A 3MODH 4Y16B 3DHJA 1UB5A 1JE6A 1OAYH 4HV8B 5B38A 1J8HD 4C56E 1FE8L 3SO5A 4TSCL 3FQRB 2HN7B 4Z9KB 2Q8BL 3FAWA 5CP3H 5KANG 3V0VA 1KFAL 4JG1H 5FK9A 4L9DA 1D6VH 1TITA 4ZOCA 4KKBC 2XZCH 3NZHH 2VE6B 2OZ4H 2WUBH 3LKPA 2A77H 4HUNB 3SDDA 5BS0D 1T22B 5EULV 3E6FA 3QIUC 2YOCA 4XCEB 4QKXB 4O2CB 1XGRB 3IETB 4IRJC 4CMMA 3KPSD 2ORBH 2I9LA 5BRZB 1FL5B 5A1AA 1CDIA 1FL6A 4Z78B 2BXYA 3BPLB 3KPOA 4XMLL 1TFHA 5ERWB 3KYKL 3PGDA 4P4KB 4PTTB 2X4SB 1EJOL 1OSPL 5DJYA 5K9QI 1MFBL 1T0NA 1MJJB 3OGCA 4P57B 32C2A 2XKNB 2B5IB 3HPLB 5DA0B 3MLYH 3WIFB 5HGGS 1Q9LB 5TPWH 5TQ0L 3MOBL 5LQBH 3CVHH 2V5SA 3UEZA 4LSRH 4PP2B 3SGJA 1MAMH 1DLFL 1JTOA 1K8DA 2VO5A 4U6XB 1CBVH 2IADB 3W5NA 3QBTB 2DMBA 5FGBA 3ZKMD 1BJ1J 1CLZL 5DMYA 1R24A 1ZA3A 3ZSTA 3I85A 1BZ9A 2IMNA 5C6TL 1U93B 2DD8H 4IIQC 1QZ1A 5IHBA 5DMKB 2BHYA 5FYKL 1Q94A 1NCUA 2IEPA 4RDQF 5B38B 1JWSB 4XAKD 3UTTB 5JNYB 4D3CL 2QSCH 3PWNA 5EU7E 3U7WL 3V0VB 5BOPA 4TSAH 5FK9B 4AYFA 2X9XA 1FORH 2AI0L 3OG4B 4X6EA 3I3EA 2F58L 5GISH 2AW2A 2EDWA 2H26A 4FN0A 1WT5A 4W6WB 5JA9A 1OP5H 1NDMA 1KB5H 1KCRL 3SDDB 5DS8A 5D6DA 4A6YL 5CJOL 1KIPA 3ORJA 1FGVL 3S3JA 5AWNH 4XCNB 2I9LB 4BQ9A 2R0ZH 5M94B 4PJGA 2CUHA 4PRIB 4GBXA 3S96B 4L4TE 4DK3A 4O51A 4X7TA 1LQSR 3JZ7A 3ARWA 3PGDB 4QRPA 3SDAD 1S7VA 3O3DA 2NZ9C 3OGCB 3P0VH 5I71C 2OP4L 5H37H 5J13B 1MIML 32C2B 3BYTA 4WO4A 1FO0L 1BX2A 3O4LA 2BSTA 3CH1A 3DUUB 2JTDA 3QQ4A 5F6HJ 2R4SH 2PF6A 3T0EC 4K07A 5LVEA 3ULUF 4ODHL 2QTEA 1K8DB 4X6DE 4OZHA 1UC6A 4JQIL 4JG0L 5DHVA 4BH8B 2MSPA 3T2QA 3LKOB 1BZ9B 1PJ9A 4QRTA 1AP2A 1D5BB 2HJLA 1TIUA 3QFDB 1Q94B 1MAJA 2OP4H 1MIMH 1EK3A 3LS5H 5FB8B 4P5KA 5E8DH 4TNVF 3GIZH 2EZ0D 3WNLA 2W9DL 4LPTA 3LIZH 4I77H 4TULL 5T3ZE 3PWNB 1BFOA 2AABH 3I6LE 2Z91A 3MREA 3R4DA 3RVUD 3UPRB 1A02N 1PVHA 3BUYB 4CVXA 1A7NL 1S7XA 4U1SA 2CIIA 2H26B 4LSPH 1NDMB 2FJHB 3CLEH 1MVUA 4N5UA 1A21A 2W9EL 5DS8B 4AEIH 2JB5L 5J12B 1FDLL 3QDJB 5J3HC 4K3DL 4RMSA 3FO1A 4ZSOE 4HZLA 2NY2B 4PJGB 1QSFB 4Z8FH 4GBXB 5DK3A 3QUZA 1I9RL 4J1UA 4O51B 4X7TB 4QRPB 1BQUA 1JNLH 5EO0B 1EVUA 2W9DH 3MV11 4XNXH 4YR6B 2DIAA 4WO4B 4LLWA 1KTDA 2VDQH 4CMHB 3O4LB 4WUKL 3CH1B 3WNKA 3QQ4B 5D2NC 5DQJB 3NMEA 5IP4A 3A67H 3LD8C 1T80A 4LGRB 3WN5A 3ILPB 2BY1A 5GZNC 3OQ3B 1H3WM 4QTIL 2A74A 4F7TA 4XNMA 4QEGA 4KROB 2AK1H 4PRPD 1FDLH 2D7MA 4G6FB 4G5ZL 1B0RA 3QZWA 3QDGE 4U1JA 2IAMD 3BZDA 4HIXH 3GEWB 5DHVB 3G9VA 4ZXBA 5HGBB 5EU6D 5IW3A 1YQVH 4IRSD 4LMQI 5HPMB 4OFKA 5E8EA 4QRTB 3LKRB 2C9AA 1GGCH 5T3XH 5BQ7B 2HJLB 4FZEL 1NUFA 2DLTA 1V3MA 1HXMA 1F5WA 1T21A 2X42A 4P5KB 2ZPKL 2XKUA 1MJUH 3LSOA 1OD7A 3BEWB 1GZPB 4GRMA 2QQNH 2Z91B 4MS8C 4CVXB 4I3SL 4Y19A 2NTFB 4U1SB 4L8DA 5DGQA 2AV1B 4PLOB 1MFCL 4F15C 3QO0A 3FO1B 4M7ZB 3NIDF 4LRNH 3B2UD 3A6CL 1RK1A 2NY6D 4LLUA 3QUZB 4J1UB 3P2TA 4O58H 3BRGC 4N0FB 3BP5B 1B2WH 4XB7A 1FNGB 4KJWD 1FG9C 4P9HL 3MQIA 5DRWB 3QUYA 1AXIB 3FCTA 1NBYA 4POZC 4WUUA 5DEGA 5GZOD 1RZFH 2OK0L 3CDCA 2X4UA 3MV01 2IPUK 4MD5A 4K55A 4UOJA 4YFLF 3UJIH 4KUCF 1FVEB 2PW2A 5DSCA 4ZS7L 1PW3A 5HHOD 3WN5B 2BSED 4F7TB 2A74B 2MKWA 4XNMB 5KJRH 4PJ7F 3FTGB 1CG9A 1B0RB 1U8QA 2BRQA 4LLDB 4POYA 1FCCA 1ZLSH 4FHBD 1K6QL 4EEEA 5C9JA 3KYNA 4QRUB 2NY3B 4M1GL 4JANA 3PDOA 2R0LH 2ERJB 5AYQA 1KB9J 3BPNB 3HZKA 3GSRB 2XXCB 4NBZB 1H3PL 2C7UA 2FH8A 3OL2A 4NQVA 1YQ2A 5SWSE 4QY8A 4NGHL 5L8LB 2FBOJ 2VWEC 1M71B 2Z4QA 1JHLL 2VQUA 4LVEA 2OK0H 3L5XH 5E08H 1WZLA 4ODVL 3V52H 1A6UH 4M4RA 4TVPL 4HIIA 1Q1JL 4ZS7H 1X3DA 2Q7YA 5E9DE 5EZOL 3OMZA 2XZAH 3WFEH 4JZNB 1U91B 4WI7A 2YC1A 5CEXA 3VD4A 4L8DB 4HF5H 5CEYA 3EYUL 5DJDA 4DOHB 4ONGH 2GJ6D 4NFBA 2HT3D 2J8UA 4HJGA 1CICD 4G43A 3QO0B 4Z7UF 3UTPE 2B0SH 1AI1L 1S9WB 2IFGA 5FYLL 5IVXF 2N1KA 3P4NA 3L5WB 3QQ9C 4LLUB 1QQDB 4YBQD 4N8VA 1AJ7L 3UTQA 4NNYA 4PJHF 5CZXC 4UDUB 2M2DA 4ODVH 4M5YL 4YGAB 1QA9A 4WUUB 1NBYB 3GBMH 4WJ5B 2WP3T 1JZ6A 4YC2C 5C2BL 1CD0A 3ARDC 4MD5B 5IW1A 3BMVA 4HKZA 1BJ8A 3FO2A 2PW2B 4NKQB 4XPHL 1OAUH 2EKSA 1DQLH 3T77A 1S3KH 1LO3H 3TV3L 1X5ZA 2GTWB 2W0FA 4MA1B 1CG9B 4GO6B 4GUPB 1SY6L 2AEWA 3HC0A 3GGWB 3QQNA 4WDIA 1K5NA 5DD1H 5C9JB 3KYNB 1ZT7B 5IT2H 1MI5D 1B3JA 4JANB 3F6IA 3PDOB 5BZDA 5D7KE 4HCRL 3HZKB 4ZTPH 1WK0A 4Q74A 3QEQA 4O5LH 4TPRH 3FL7A 4YAQA 1X9QA 4HC1A 4NQVB 3OKLA 5D7IA 3FT3B 4QY8B 5I18L 4ODSH 1DVFA 4O02H 3V5DB 1ZE3C 2HFGL 2BCKA 3MRDA 2DQGL 5EUOE 4PJBE 4RRPG 5C2BH 3EDJA 3ULVF 1YYML 2RCSL 3SPVA 2R2CA 3N1MC 1MCEA 2VQTA 2CRZA 4PJAF 1UEMA 4PTUB 3MLXL 4MA3A 4G8IA 4KVNL 3RDTD 4KKCC 1CZ8L 2FH6A 4QHLA 3TV3H 4YEFA 1NCTA 1MLCB 2DQFA 1UWEL 4CUCA 1H15A 5CBAB 2VLJE 1SY6H 1ZTXH 5DJDB 2R2EB 1BOYA 1A9EA 2J8UB 4HJGB 2GEEA 1P9MC 4FQCH 3IDGA 4FZ8H 3SCMA 4P2CG 5CILH 4WW1A 3VDCA 5EU5A 1G6RA 4DKFL 5I18H 5GHWL 3FMGL 4GG8A 3UTQB 4G80A 3V4VH 3LKSA 5C09E 3D18A 5I1DA 3ULUL 4HFUL 3PV7A 4PUBH 3SDCB 3GMLA 3L3DB 2HG5A 2OSLA 3ZTJH 2BOBA 3RAJH 4I5BA 4Z77A 3I02A 4YHYB 1U8MA 4M4PA 3U46A 3FO2B 1A7RH 3I75A 3QNYB 5EPMA 4HMEA 2EKSB 3DVGA 2W0FB 3QNXB 3RUGA 4F2MA 4IRJA 5GGVL 1CS6A 1YEIL 4W81A 4ZOBA 3BPOB 3HC0B 3BZ4B 1OPGL 4WDIB 4RA0C 1C7TA 1WZKA 3RGHA 4K94L 3RPKA 4Z7VF 4M7KL 5HJ3B 5F7MC 1WBXA 2ICWA 2KBGA 5CJ5A 5BZDB 1Z9OA 1RK0A 3QEQB 5HHVL 3GSVA 2DAVA 3OKLB 5D7IB 4XRCA 4XVJL 4YXLH 1DVFB 3TPUA 5K59E 3RY4A 2MPAH 2BCKB 3MRDB 4FQXD 5KS9A 2NY7H 1CGWA 3SPVB 4GKSA 3S36H 1YPZA 1INDL 2X70A 1IQWH 2XZZA 1AH1A 4MA3B 4G8IB 2D03H 1MPAH 3H9HB 4U7KA 1X5JA 4QHLB 2F54D 2DQFB 4QHUB 5H8DA 3MFGB 3BHBA 3VXSA 3CFDB 1QRKA 1A9EB 3EJZD 2AJXL 1YJDC 3CLFL 3NCEB 5DZNA 1IGCL 2FD6H 1FFNB 1YMMB 2EH7L 4S11A 1I1AB 5E1HB 1KF9B 4KWUA 4WW1B 4IIQA 1G7IB 4OLWL 5EU5B 4PLNC 1IAIH 4PJEE 5EN2A 1G6RB 3V8OA 5J4MA 1AC6A 2MQCA 3STZB 4XVJH 5E2WL 1AIFA 5JUEL 3G5ZA 5GRYA 1LK3L 3ZL4L 1YN6A 2Q3ZA 2W9LA 4G80B 3LKSB 3BW9A 1MJ8L 4JN2A 3D18B 4JFFE 2FGWL 4Z76A 5C0CA 3CXHJ 4LEXL 4R0LB 3GMLB 4ZUWA 3Q5OA 3QJHB 3IAQA 3DOSA 3KPRA 1F4AA 2OL3A 4I5BB 3VD3A 4Z77B 1YY8A 1J1XL 3DETD 4KQ4L 3I75B 5EPMB 2CDGB 2B4CL 1JPFB 1D5XA 5ALBL 4M00A 1B4JL 2EICA 4QYOA 2AJXH 3BVNA 4F2MB 5H37G 5ICXA 1LO4L 1KJ3L 2EH7H 3KYOA 4B7IA 4UZGA 1U8KA 5F71A 4IMKC 5L7XL 1F3RB 2HVKB 5BW7C 5DD0H 3WSQH 2ZP0T 2P4AB 4MA7H 4QLRA 4C55A 1RK0B 4PJCF 5SX4I 3IF1B 1T2XA 4LCWD 5JQHC 4Q9RH 4IMLA 4XRCB 2DYPD 4OUOA 3D9AH 5CEZD 4LEOB 3FT4A 3O6MH 4HK3N 5CJXC 2BRRH 4LEXH 3TPUB 4FFYL 1LWRA 2DLEA 4V1DD 1EHLL 4UT9H 2P5EE 1Y18A 4GKSB 1YPZB 3ZKMC 1ZAGA 4KQ4H 1ZANH 4Z0XA 1NFDB 3MROB 2X70B 3T0EA 3WKML 4X7FC 3S4SG 2P5WB 1B4JH 5ADOH 5FV2A 1ORSA 4RNRA 1JRHL 3RBGA 5D6CB 4JO2H 3VXSB 4QT5A 1QBML 3EDDA 5EZJB 2BSRA 2XN9D 3K1DA 5B3NA 4LAJH 4K71B 3NGBB 1C8PA 1F4HA 3MLSH 5DEFA 2F53D 1KJ2A 5GIRA 5CCKL 1I3GH 3BDBA 3L3KA 3UTSB 2XRAH 1DANU 1AIFB 2V2WA 3VFNA 1QP1A 1A3RH 3BW9B 4JN2B 4JHZA 4UV7L 5C0CB 2NY0C 1G7LB 1MRCH 4NNXA 2OL3B 3EYQC 4OBSA 4HQQL 4KI5D 5JXAH 3H3PH 3IDXH 2PXYD 5GRWA 1R5IA 1D5XB 2D7QA 5F89B 3OJDB 4QHKI 2CSPA 3SBWC 1Y0LB 3BVNB 2Q76A 3IKCA 3KYOB 3VI3F 1JGUL 1RMFH 5IB2A 4Y4FD 3DUHA 1VEMA 3EYFA 2R1WA 3GFUA 1YEHL 5I17A 5F1SA 1FFRA 3ZO0A 3EFDH 4C59B 5I2IB 4IMLB 5IBUG 3ECBA 7FABH 4XNZB 1UXWA 3FT4B 1ND0A 4NC0B 3HG1A 3NAAL 4WWKC 2VDRL 4OJFH 5GGRB 1Y18B 3GI8L 2QQLH 3CSYA 2H1PL 4UB0L 3BEVB 1ACZA 3NCBB 3T0EB 2BVEA 3IS0X 5CIPB 4XHJC 2QQQA 1VGEH 3CSGA 1ORSB 4EZMA 3QPXH 4RNRB 3CPLA 4GJTB 3TJEL 4EBQL 3F58H 1BQSA 4Y5YC 4ODTL 4QT5B 3GIVA 4S0SD 1I1FA 4RMRA 4MJIA 4NQDA 1JK8B 4HWBL 2V9QA 2EZ0C 4NJAL 1CK0H 4R96A 1ZHLA 1F4WL 3H7BA 4J12A 4AIZB 1HINH 5C3LD 1QFWI 2B20A 3RVUC 3IB4A 1KJ2B 5GIRB 3Q0HA 4CDHA 1DBML 4LSVL 4OZGF 5BMFH 2V2WB 2DQHL 1N5YH 4EOWH 3MRRB 5DD6A 3GI8H 1OM3L 3A6OA 1NCAH 1AFVH 4NO3A 4TUJA 4UTBH 4JPVL 4NNXB 3EO1B 2A6DA 1D9KC 5C08A 3G6JF 1P4IL 4KHXL 3LEYL 3CFJB 3GJFB 4XXDB 1R5IB 4OUUA 1EO8L 2EYTB 5GGUA 4EDXA 2FZ3A 3RWEA 2Q76B 3IKCB 5EOCL 3ZT6A 5I8EA 3WUZA 4ZNCD 2YEZA 1T6WA 4TSBH 1OP9A 3O2DL 3OX8A 2FO1A 2FIKB 1GPOL 3ULVL 2NX5A 2R1WB 3WO4C 3T8XA 4UAOC 5I17B 2D0GA 4LSVH 4PG9B 4NO0D 4NYLB 3MUY1 4WHCA 5FDWA 1T1ZA 2DQHH 2R1XA 2YHGA 5MENB 4PB0L 3ECBB 3ALXA 1UXWB 3HAEA 4TOYL 1U6AL 3L3OA 1WEJL 1IC4L 5GRJL 3BIBX 3EHBC 4ZO7A 5JZ7C 1WUNT 3TT1H 5KVDL 3BRFA 2A73A 1U8HA 3BDYL 3QXDA 3HG1B 4JPVH 3BI9X 5C0IA 4X6FA 3CSYB 2APVA 5BV7B 1P4IH 5FGSA 2IBGA 4KHXH 1I7RA 3WE6A 3LD8B 4GKNB 1NAML 4ODBD 3B2VL 4IRSC 3UTZA 4PG2C 1MRFL 1QPXA 4JDTL 2IFFL 2WIMA 1NBQA 1Q9WB 2OL3H 2ZCKH 4YDIL 2P8PB 1FFPA 3B43A 2ZNXA 3GIVB 1T0MA 4JHAL 1UM6L 5E70A 1I1FB 4HLJA 1N7MH 2MOVA 5GGQL 4HUUA 3QA3B 1ZHLB 3H7BB 4OGXH 3OKKB 4X9GA 3QI9C 5AUMB 4ZO9A 2C5DC 5JHDE 3NPZB 1NCDH 1N26A 1DBJL 1Q9OB 4DVRH 2P48B 1U6AH 1WV7T 1WEJH 1A0QH 5EDXA 4X9HA 4PLJD 3BDYH 2N4IA 1BOGA 3IDIB 1AE6L 4NO3B 3PJSA 3K8MA 2AERT 1BIIB 1OAKL 2A6DB 1RSFA 3MLRL 4M1DL 1N64L 2GT9A 3E3QC 4P2QE 3T1FB 2ICCA 1HZHL 4F33A 2HA1A 3P9MA 3UTTE 1HNGA 1LD9A 2FZ3B 4KJWC 5GGQH 2NY1C 3UC0L 2YEZB 1WCBA 5ICYA 2EEBA 3MV7A 4XCCL 2QKIA 2L0DA 3D69A 3T8XB 4S10A 5FCUL 2RAMA 3Q5YA 4L8SC 5I8CA 2R1XB 3I3DA 4ZS6C 3BE1L 2P1YA 3HAEB 3D39A 4Y2DD 3HS0A 3FB5A 1C5BL 1TLKA 4PD4K 1W72B 3ARDA 2A73B 1U8HB 3QXDB 4GRLD 5C0IB 3FZUD 4PRIE 3C8DA 5HI4D 1F00I 1I7RB 3WE6B 3MRGA 3RNQA 1UEYA 2CD0A 1DBKH 4JPIA 2PR4L 1H3GA 1X5FA 4CW1B 5C3TA 3VFRA 4LPYA 1FFPB 4GAYA 5CSZA 1L7TH 3ARSA 2MCPH 4OI7A 4JR9H 4XVUD 1I7UA 5ACMA 4OD3L 4POUB 3EOTL 4OCLC 4CN1A 1FZMA 1T3FA 2AK4D 5AYUH 4YUEH 2X4NB 3PHQA 1KYOJ 1KPRA 5T3ZD 3UX9B 5D1XD 1RV6X 5EBLA 4JZJC 1JUFA 1WAAF 2BXZA 5FM5O 3LEVH 2HT3C 3QZWG 1CICC 2AEPL 3NA9H 2IG2L 3DX8B 3G04A 3MSPA 4OD1L 3PJSB 3KHOA 1HHJA 4UT7H 3ETBF 4J3OC 3BOVA 1PBYA 2PR4H 3UPAA 1P7QD 1XGQA 3RI5K 1CDGA 2GT9B 5EORH 5IK3A 5CMAA 4UIMA 3P9MB 4KMQA 4YBQC 5KW9H 1P9MA 3PWUA 3KWWA 3PP3K 1NCWH 1QBAA 1WCBB 5B8CA 4OZIF 1T2JA 3MV7B 2NW2A 3HUJF 2WZPD 5KSUA 3D69B 2C1OA 4WTZA 2P47B 4BK4A 5I8CB 3K3QA 1KGCD 3C08L 5FOBA 3V6BR 1DL7H 4S1SL 1F3DJ 3QDJE 3DXAD 4GW5A 3D39B 3G6AB 3HS0B 4RQQB 3FB5B 4YC2B 4Q0XL 2FB4L 3ARDB 3GRWL 3V6OE 1QSFE 4K8RC 2OR9L 3REWA 4PJ8D 2YD6A 4OFVA 3TN0B 4OM0H 1WZ1H 3MRGB 4HSQA 1UH3A 3TO4B 4PGCA 3RNQB 3ARVA 3ZDYF 2DIJA 3L7EB 2Z35B 4MAYC 4WY7H 1PX4A 2VH5H 1D5IL 3VFRB 2AJVL 4P2OD 5A40E 4H26B 4OLXH 1UA6H 4GAYB 3O9WC 5CSZB 4LHQB 1XF1A 4OLYH 1I7UB 3C6LA 3RA7L 4NQCD 2OTPA 3I2CL 4Q6YA 3VFSA 5IGXL 1IT9L 1S7QA 3LPGA 5I1KL 4KKAD 3O2WL 4HX1B 2V5MA 1NBVL 3PHQB 1ADQA 1KPRB 4S1SH 3HA0A 3IFOB 3BJLA 3P4OA 4FTVA 1A8JH 3GJFK 4Z5RA 1R5WB 3ARRA 5EBLB 3CUPB 1BJMA 2HTKC 5IUSA 3HAEH 1AKJD 1DDHB 3HRZB 1P69B 1YNLL 3MLZL 3G04B 3QJFB 1HHJB 4YBLB 3F65A 5F9OH 4OLEA 1W0VA 5CZVL 3ROOA 1QSED 4PJ9C 1JHTA 2V9TA 3WLBA 5EUOF 5IK3B 4PJBF 5KN5B 4UIMB 3MOQA 1HI6A 3BSZL 5ESVA 2XNAA 3Q3GB 1J8HA 1S5IL 1KCVL 3PWUB 3PHOA 5T1DL 3KWWB 5IGXH 3U7YL 3HC4L 4TUOB 2NTSP 2H8PB 5B8CB 3MLUL 2H2SD 2VL4A 4KXZI 2NW3A 4B7LA 4U4BA 3EKCA 3TBVA 3LRSA 5ID0B 2AJZB 3QUXC 1DLHA 1RJLA 2GHWB 2P8MB 1DQDL 1RHFA 1L9MA 1C12A 1YNLH 2AXHA 3KPSA 3IU4H 1ZGLA 1H3VA 3QQ3B 4N0UE 15C8H 3REWB 1PD6A 2L7JA 4ZOAA 1A47A 1X5YA 4LSUL 1GYAA 1BEYL 4K23L 4PGCB 1R3IL 1YEFH 3QG7L 3S37L 1A6ZA 3BSZH 5E24E 4N8VG 3IGAA 2VDPL 1BHGA 1U3HB 1S5IH 4P5MA 4RGOL 2PYED 4IMKA 2FYYA 5T1KB 5BW7A 1PKQA 3C5ZD 3LB6C 3C6LB 3JV6B 3PF2A 1YEGL 1PAMA 4JFZL 5EA0L 5LXGL 3PWPE 5FKAB 2OYPA 3QUKA 3QDMA 4FQLH 5JOFA 5CJXA 5JW4M 2J1KA 1DQDH 3P4OB 4FTVB 3PWVA 4Y4HC 3RWGA 5IFJA 1JYNA 5GS2H 5E9DD 3ARGD 2FEDD 2OQJA 3ILQD 2DJUA 3OG6B 1BEYH 4PJFB 3A6BL 3S35L 4XPGL 1T6VN 3STLB 1AD0A 4XH2A 3B5TA 1XZ0A 3ROOB 1KT2B 4NPYA 4DGIL 5K59F 4JQXC 3MUGA 3UTPD 1TQCC 4RGOH 5FUCC 5ESVB 8FABA 3QFJB 4Y5XC 3W0WB 1G7JA 3PHOB 1QSVA 5KSBA 4OCXL 3P30H 1EHXA 1SM3L 5EO9A 5DJ6A 2NLJA 3VXUA 4J4PD 3QEGH 1MCWW 1OWWA 4DOHE 3TBVB 5LAXB 1LE9B 4JGJA 1RJLB 1FZKA 5TJWK 1AGDA 2DQJL 1ZGLB 4XNYH 3UYPA 3B8YA 1YECL 3U82B 5TDPA 3V5KA 1TZGH 3T2OA 5C0FA 2Y07L 3R0MA 2ADGA 4XNQB 3SBWA 1U95A 1A6ZB 1TVBA 2VQ1B 3HKFA 2VDKH 3BZEA 3DV6A 1M7DB 1S8DB 3TH2T 4P5MB 1SYVA 5KOVC 5D7KD 4MCZA 1PKQB 3C5SA 1INEL 4TTDD 5LJYH 4EVNA 2XZQL 1EMTL 2Y5TA 4GW4A 1QOKA 3X11A 5JQ6L 3UXFA 2HTLD 3QUKB 3QDMB 5IROC 4P99A 1CIDA 3KR3L 5JOFB 1GGBH 4LSSH 3KS0J 3WFCH 4WWKA 1NGWA 4ORZC 1J05A 2F9BT 2VLJD 4X9IA 4HMCA 3IDJA 4M02A 1AD0B 1XZ0B 4X5XA 4NPYB 1BM3L 3PQYA 5HYSG 3MUGB 2C1PA 4XCYA 4Y5YA 1V7NL 2BMKA 4TRPL 2IGFL 4DAGL 4LARH 4ISVB 1G7JB 3VWJD 4YXHL 2OR7A 3QG6A 1UENA 5EO9B 4NN7B 5C0AA 3VXUB 5C09D 3KR3H 1EZVY 5FV1L 3MBED 3E0GA 1BP3B 4XP9H 2PXYC 5C6WH 3FFCE 3SDXF 2R23A 1ADQH 3SKUD 2NY0B 1AGDB 1MHPH 2ZG1A 3MLWH 3QNZA 5D1ZA 4FRWA 4GQ9L 4JO4H 1D9KA 4JRXE 1WFUA 4S1RL 1MWAL 2Z93B 5TDPB 2GI7A 2AJYH 2P8LB 5C0FB 2XA3A 4PRHA 4QXUH 2ADGB 2DM7A 1U95B 2IGFH 1OP5K 3S8WA 3GNML 4F7EB 3DV6B 4NNPL 4FABL 2JJTC 1SYVB 4G3YH 1UCBH 3EYOA 5KANI 5D7LE 1I7TA 2ZJSL 3C5SB 2Q86B 4YHNB 4JN1H 1IBGH 1SVZA 5EWIL 1A7PL 2ILLA 3C87A 4HHAA 2Y5TB 3GHBH 4GW4B 4F9PC 3BZFA 2ATKA 3X11B 3GSXB 2COQA 5ICZA 1J11A 1ACYL 4A2LA 4JDZB 4KVCL 4J7RA 4F37K 1UACH 4PRPA 4DVBB 1HH6A 1MCIA 1BFVL 3JV0A 4WFED 4WWKB 3KDMA 4ZDHB 1NGWB 3VG0L 1J05B 5GJSL 3CFKA 1MWAH 1UKQA 3MBXL 4NP4H 3MXVL 4GRWH 4WI8A 4IRSA 4PG2A 2X40A 1D5ZA 4YHOH 1S7SA 4LP4A 5E2TL 5KSAD 4JREC 5C8JB 4X5XB 3DX7A 1BF8A 4XCYB 3VJ6A 2BMKB 4FABH 2DBLL 3HC3H 3TA3D 1RD6A 4OIBA 5C9KA 3BP4A 4WNQB 4PREA 4H8WC 4EN3D 5HHPA 4P9ML 5EWIH 2E7LC 2WW8A 3F12A 1HHKA 4M8QB 5GGTA 3QG6B 4QF1A 1CR9L 3OV6A 3QI9A 5C0AB 5T1LA 1G7QA 3MRIB 4MX7B 1DEDA 1VESA 2VLRA 3VXPA 4NM8H 1RZGA 2FHFA 1FRGH 5GSVA 1VADB 4UILL 3NBNA 2ZCHL 1EGJA 3E8UL 5CS7A 1YMME 1RY7B 3MRQB 3VG0H 4ZFOA 3PP4H 2FWOB 4I0KA 5E00A 5CSBA 3QYCA 5D1ZB 2ZNWA 1D9KB 1MHHA 2AEIT 4GG6F 4NFCA 4GLRI 5GPRA 4XNUH 3LMJH 5I8OH 1ZHNA 4G8GA 4PRHB 5MEOA 5JDJA 4UIKL 2FLBT 2PCPA 3ZDZE 1PSKL 3O6FD 2KQMA 3EYOB 3B4NA 4JM2F 1TJIH 5AD0A 4UAOB 3HI5H 3BZFB 4KJYB 2ATKB 4HKBA 5TE6H 1CLYL 2ZCHH 2VC2L 3RFZC 1IGML 1AHWB 2VZ3A 4CVWA 2P5ED 1RZ7L 1MCHA 2FIRT 1P53A 1QLEH 1NGZB 1UM4L 3KDMB 1A22B 5IFAL 4JO1L 4PRDB 4U0RC 1D5ZB 3DLQR 1S7SB 1ZK9A 2X1XR 5GS0L 3QP3A 2X10A 2X1QA 1FAIL 4ONHA 1S7TA 1PSKH 1GIGL 2VDML 1NQBA 4UNTA 5EU7C 3RRQA 3BP6B 3BP4B 2GK2A 3DVFA 3F12B 1HHKB 4G7VL 4QF1B 1L6XA 1NFDE 3CFCH 4WEUD 1PZ5B 2EIBA 1MY7A 3QI9B 3KJ6L 2LQRA 3LS4H 5T1LB 2V7NB 3L5HA 1G7QB 2YPLD 2VC2H 1XGPA 3RX7A 2VLRB 3VXPB 1MAKA 2A38A 5GSVB 3OKMA 4JZJA 3B5HA 4HEME 4XC3L 2P44B 4L29A 5MP6H 1YEJH 2JIXB 3IXTA 3WIIH 1YEDA 5E00B 4JHWH 12E8L 3VH8B 2Z8SA 3GI9H 3K46A 4LFHG 5I16A 1MHHB 3UROR 1PG7L 3UTSE 1FAIH 1ZHNB 4G8GB 5MEOB 2R56L 5IBTH 3M1BA 3EW3B 3LN4A 4KH2A 5EBMA 2PCPB 1SBSL 1TJHL 2R4RH 4JGMA 4EI5D 1L7IL 2NY1B 4R2GD 1ODAA 6FABH 2XV6B 4G9DA 4Y5VC 1QRND 1A2YA 2KZWA 2XWTB 5AD0B 1CFSA 5JORA 4J8RB 3V6ZA 1W2KT 1O7VA 2PW1B 5TF1H 1F90L 1FJ1B 1JL8A 3EOAA 3OF6D 3U9PH 3QWRA 4YHMH 1JGVH 1H0DA 1XEDA 3VXOA 4XP6H 5FGCB 2YUZA 3BX7C 3N1PC 1MI5A 3H9SD 2R56H 3VD5A 2Z9TA 4L3ED 4R8WL 4MAYA 4KMTH 4Y1AE 5EZIL 4Z0BH 4XPFL 3CC5A 1L7IH 4JFYA 4DKEH 3O9WA 3VFVA 5D1XC 4U33A 3ARQA 4X83A 2X89A 1JNNL 4R4FH 3QO1A 4XP4L 5D1QD 4KDTC 4N8PA 1FYTE 5DJZA 4JFQA 4UU9B 3DO7A 1EDQA 1X5IA 2WWKO 3HR5A 4ZD3L 2O5XL 5JPMA 5GRUL 4JZJB 1RFDL 1MSPA 4X6CF 5CBEA 5E2UL 3IXTB 4MNHA 2AJ3B 1YEDB 3O3EA 5JHLL 3DBXA 5IWLC 2G5RA 1BJ1H 4M7LL 4Y16D 1G7HA 4AL8H 4DQOL 5I16B 5D7SL 5J6HA 4PJ9A 3SKOA 5FHBH 4KHTL 4OD2A 4WCYL 3M1BB 4JFOA 3LN4B 3GB7A 2ESVA 3JWNC 2YUVA 3PGCA 4HWZA 5CUSL 4G9DB 3MLPA 1I9EA 2CRMA 3D3VE 1A2YB 2VLKA 1NLBL 1CFSB 5FUOH 4HFWA 5GGTH 4PJ8C 3V6ZB 2EIEA 5BRZD 3QUXA 2ZOKB 2O5XH 3SGEI 4O4YL 4JHBA 4ZUTA 3LV3A 1IGIH 1DE4A 5F3HA 1NH6A 2VYRE 4NQXA 2DKMA 2VUYA 5INDA 4P2OC 2Q8AH 1EGJH 1H0DB 4M7LH 3VXOB 4P4KD 2C3XA 3C60A 2HRLA 4PJ5A 2GY5A 3MRKB 3ROLA 4PIRF 2GFBA 4UTAL 4WCYH 4X8JB 5DTFA 5MENE 4MAYB 4KI5F 5I15L 4DZBA 4LKCA 3FQXA 2GSGB 5I66A 1TVDA 3RPIA 4XGZA 5DQDL 3UDWC 5HD8C 3CC5B 4JY6A 3VXQA 5DJCA 1IEHA 1CF8H 3O9WB 3W11C 5EC2A 3RU8H 3VFVB 3HMWH 4YK4C 2VZVA 3QO1B 3U4EB 4P48A 1MJ7H 4UDTB 1TZIA 5E2VH 3X17A 5FF6B 1E4XL 1I8KB 2DTML 3U4BL 4JFXA 3HCVA 3G08A 2W59A 5DEZA 5DJZB 3JUYA 3V8CA 4X80L 2R9HD 4YWGL 3BIKA 1IE5A 2BY2A 4WI9A 3QISA 5JPMB 4F7MA 3WUWB 1QLFA 4Y4HA 4YIQB 5KVMC 4MNHB 3SKJL 3O3EB 3DBXB 5I0ZA 3B9KB 4I2XE 1NKRA 1FG2A 3S37X 3QUML 4EUPH 4QRRE 3HNVL 5J6HB 1XCQB 1QBLH 2VDNH 4LVNB 4PJ9B 4JQXA 4GAJL 5K9KB 5DDHA 3SE9L 3VGAC 4N9GA 4JFOB 1I7ZA 5TQ2H 2VKXA 4OT1L 1P2CA 3TZVB 4Y5XA 3GB7B 2ESVB 3PGCB 4HWZB 5I0DA 3GKWH 4N90E 3V6FB 3O45A 3SDDD 4KJPC 2VLKB 4HFWB 2YD2A 4R97B 2GITB 2QHRL 2YUXA 3QUXB 5H2BA 4L8CB 2JKXA 4GKOA 1DE4B 5F3HB 3KLHD 2D7NA 1IM9B 4PRID 4NQXB 5T3XD 1DEEA 4CN4A 1CDJA 5INDB 4HH8A 4FQ2H 1AGBA 4MNGE 3S35X 3V0AC 4Q97A 1EA9C 3C60B 3QIWC 3QUMH 1ES0B 3S88L 5DR5H 3C5ZC 1FIEA 4PJ5B 4BUGA 2HP4A 1EFXA 4IDJL 3WLWD 4XHQA 2GFBB 2LTQC 4WEBL 5DVMA 1LO2L 1SBBA 4DZBB 4LKCB 5HHME 5L9DL 4DGYL 3RPIB 4XGZB 2DYPA 4JY6B 5CJQL 3VXQB 5DJCB 2EDQA 2VXVL 1IMHC 4X5WA 4HUMB 5ANMB 4Z7UB 5SWZE 5IVXB 1EERB 1TZIB 3ARGC 2G2RA 1CWVA 2FEDC 3ZKSD 3KAAA 4JFXB 4QHNB 3G08B 4MA8L 5HI5D 5KSVA 3PIQB 5IROA 1MHCB 3BIKB 2YMXL 4U0QB 3T4AB 4PJHB 5ABDE 2YD3A 4F7MB 3INUL 4Y4HB 3PGFH 5KAQG 2CJUL 1FH5H 3LN5A 1P7KA 4U1GC 4Z7OF 5KVEH 5LWYL 1CL7I 3VGGA 3S88H 1QFUH 2YPKA 2AKRB 4NKMA 4K8RH 4ZTOL 2WK2A 5DDHB 2X44D 4J4PC 4N9GB 4K7PL 1YNKL 1I7ZB 1UGNA 3FO0L 4NO5A 1P2CB 3RWJB 3CH8A 1S9VA 4EQ2A 5FUZH 1BVKA 3BYYA 2MKLC 3O45B 5ISZA 3QDJD 4NBXB 2Z92A 5HY9B 4JY5L 3U0TA 4YQXL 1ZLWH 4KUZL 4PJDA 5H2BB 3JV4A 2NY2D 3G6DH 1QSFD 3MCLH 1AGCA 4GBXD 1DEEB 1RJZB 3OAZH 1GGUA 4RFOL 3LAFA 3LQZA 5E5RB 1QPPA 4QRPD 4XBGA 3MO1B 3MR9A 4ONOA 4HIHB 1MNUL 1EFXB 4K3EH 4JRYA 5F7DA 1ZT1B 3TO2A 4WO4D 3H9YA 3VG9B 5H35A 4F58H 2F5AL 3O4LD 2JJTA 5F9WC 2EXWD 2EEDA 5DFVD 4X5WB 5HHNA 3PWJB 4UT6H 4KROD 1CN4A 2G2RB 2JCCF 4G6FD 1CDBA 2XA8H 2E6QA 4YQXH 1KTKE 5DO2D 3ARBC 4JPWH 4ALAL 4FNLH 1E28A 1JGLL 3L7FA 3DUSA 4BZYA 1E27A 3T65B 4F3FA 4RGMB 3FQTA 2QEJA 5F44A 2DQTH 5CHNB 2Q6WB 3JSSA 2QR0B 3RJDA 3CZFB 2YPKB 3MV9A 4HZAA 3ARYA 1MNUH 3VWJC 4M6MH 2R29H 2FSEA 5ESAA 4C56A 4Q9CA 2BFVL 2ED8A 3N0PB 4HK0B 4OGAC 4KRLB 2BJML 2J8HA 3MBEC 4NO5B 1S9KC 4IJ3C 4M6AA 2E7LA 5J11C 1JVKA 3RVXD 3VMPA 1S9VB 3TVMC 1KENL 3HB3C 3O2VL 1U8LA 1JF6A 5FYKE 3B8SA 2OCFD 5ISZB 3O6LH 4PGEA 2C3WA 4I8DA 3QEUA 2VITA 1DCLA 2VLME 3E2HC 1CCZA 3G5XA 2WNGA 1P4BH 3U0TB 1JGLH 1T1XA 4UNVA 1VKXA 2N7AA 5HYFA 2BY3A 2J88L 1ZVYA 1AGCB 1HN1A 3BPCA 3HR6A 5L88L 2E7MA 3QUZD 2NNAA 1VSCA 5JO5A 3MR9B 3QXTA 4MD0A 4HDIA 1MFAL 3GJEA 3TNMA 2BFVH 1G0DA 4J3SA 5F7DB 1LEIA 3FRUA 3M8OL 3B3IB 4LP5A 3X14A 4G6JL 3OKOA 1B88A 3GRWA 1KTLA 4KKLD 2EC9T 1ZLUH 1RIHL 5HHNB 3BGAA 4OZ4B 2N56A 2EH8H 1I8LC 5GS1C 4YHZH 4FFVC 5HDQH 3S5LG 4XWGH 2NY3D 4ZXBD 1I4FA 1DSFL 3EYSL 3DUSB 3L7FB 1E27B 1MCPH 5EOQH 3U36B 4HIJB 3FQTB 4N1HB 5TFSL 3RHWF 4NZRH 1IARB 5FECA 3LKQA 1MFAH 4KRPB 4CADB 3MV9B 4EN3C 3SY0A 2FSEB 3M8OH 3DMMC 5ESAB 4JREB 4OCMC 4C56B 3EYVA 4U1HA 3BKMH 1QNZH 4DW2L 5A2JH 1AGEB 3RTQC 1FL3A 3Q1SL 4PGBA 1OARH 3LY6A 3DARA 4BQCA 3R1GH 1AXTL 4L8BB 1MFEH 2M26A 3HLAA 1RIHH 3Q48A 4MQXD 2VDLH 5CEZH 3VFGH 1RIVH 3HI6L 4OCYH 4PJFE 5ID1A 4O2EA 3BD4A 4J23A 5GGSA 5HYEA 1HIMH 4PJCB 3G5XB 5E8PA 1T1XB 4WW2F 1VKXB 4Y88A 1UCTA 3R8QA 3OKNA 3QFJE 5FM4A 4GSDL 2W91A 3BPCB 4U1LB 3UYRH 2NNAB 1TPXB 4WI6A 4L4TA 4MD0B 4HDIB 3O0RH 4KTYA 3TNMB 4X4YA 3Q1SH 4WUUD 3TESA 4GKZA 3HZYA 3X14B 2DLFH 5AEAA 3F7VA 4MDIA 3ZZ1A 3I9GL 3LQAL 3OKOB 4CJ1A 4MAUH 1KTLB 3NVQA 2I60L 1OW0C 4Y5VA 5D2LF 4MMXC 4MXQC 4OQ1A 3WNNA 4RAUA 4NM4L 3MUZ1 2OTWB 3ELAT 3E1F1 4X6DA 2FR4A 1LO0L 3ZDZF 1DR9A 2L7UA 4U6VL 3CGTA 5D5ME 2YN3A 4KTEH 1I4FB 1VEPA 4XBEL 1FC2D 5I1HL 1N0XL 4KMLB 2R15A 3ARFA 5FECB 3LKQB 1PG7X 3O3AA 2DL2A 3ZDXE 4YPGA 1BD2E 1JMXA 4KJQD 2YRLA 1KJVA 3DX9A 3S34L 5I1IH 3EYVB 2J4WH 1JNJA 3TBSA 4PGBB 3U1SH 1HOCA 4M1CD 2BERA 4Z7WE 5D1XA 1LHZA 3HLAB 2CKNA 4HPYH 5F21B 1BFSA 1WTGT 3JTSB 4LGSB 4NN6B 3ES6A 3UPCA 4KDTA 4O2EB 1N6VA 3S9DB 1PYWA 1PKOA 5GGSB 1F4YH 4PD4J 5J0BA 1NUGA 5E8PB 2R0WL 4X6BA 1HEZA 3DX6A 5CD3A 1MQ8A 2PKDA 4XP5L 4ZSOA 2UWEA 3OKNB 2IQ9L 4OFYD 5J56B 1GL4B 5C0DB 4LPWA 1UH4A 5IWLA 4EI5C 5E7BA 3LCYA 1J0HA 2VRAA 4R2GC 3K4AA 3O8XC 4L4TB 3MPCA 2HMIC 2HYMA 1WITA 5MI0C 2I9TA 3QAZC 3S34H 3CIQA 3EO9H 3SHSA 3WHE0 5JIHA 2LV4A 3F7YA 4PJIE 3P73A 4URTB 3HFMH 2HT2C 3HZYB 2XG4A 1FC1A 2ID5A 3F7VB 4MDIB 3GBNH 1J1OH 2DDQH 1N6QL 3QXWA 1S78D 4Y5VB 1G9MC 5DZOA 5IB4A 3TWCL 2XWBA 2V2XA 1MRDH 4M3KB 4YHPB 3D1MC 3EIFA 4LDOB 3V7AG 2FR4B 3QHFL 2HWZL 3QDGA 3BKCH 1C5DB 5FM8A 2NY4C 3MNWA 4Q9QH 1OAQL 4K7FB 3EFFA 4CJ0A 2DQDH 1IJ9A 1EBPA 3QEQD 4M43L 5C0BB 3ARFB 4HUVB 3O3AB 1WZMA 2J6EL 3PABA 1KEGH 2FO4A 1DVFD 5LBSL 1DUYB 3G6JB 2QSTA 1KJVB 4FQQA 3MLVL 4JFEB 1WBYA 5FAAA 5F8QC 1T5XA 3TBSB 3VW3L 1HOCB 2DKSA 4L4VE 4DJMA 1B6DA 5I73C 3WXWL 3T2PA 3MV8E 1T89A 1P6FA 3ES6B 1AKJA 3QCVL 1NGYA 3F5WB 4JM2C 1C1EL 4I18C 3ZT7A 4EUPG 5BOZG 1UM5L 1PYWB 4H1LA 4Z95H 1YMMD 1RUQH 5BZWA 2BC4A 3JWDC 4X6BB 1I1AD 2J3SA 1BQLL 1HEZB 3DX6B 3AS0A 3KLDA 4MLIA 5CD3B 4RWYL 4TVPE 5EOTB 4ZSOB 4M43H 3DURB 3KXFE 1U8PA 3BGMA 3P4MA 4JFDE 1CDHA 4HG4K 3THML 2I9TB 4G9FB 3F7YB 1RUKL 4OIIH 5IJVB 1T04B 1ZXQA 3QDHA 5FYLE 3AREB 4KKBD 2O5ZH 5LGJB 4PJXE 1A1NA 1U3YA 3KLSA 3VCLB 3MJGX 1CD1A 1UM5H 1VB9A 3WIHA 5HXMA 2B1AH 2XWBB 4P4KC 5F3BA 4IRJD 3DVNB 1KEML 1DBAH 2JB6B 3K2UL 2OI9B 1N59B 1KC5H 3QDGB 3JWOC 4QNPF 5SWQA 3RWCA 2B5IC 1G7MA 1EV2E 3CMGA 3EFFB 4LRIC 3MXWL 3NIFF 3EZJB 3QIWA 1DJSA 1EHNA 3RL1B 3PNWB 2AQ1A 4J3TA 4ZUSB 3PABB 5SWSA 1RUKH 1L0QA 3H7LA 3NACH 4FQQB 3L3HA 1K4CA 1WBYB 5K33A 2GJZA 1OGAE 2A6KA 3GO1L 3U0WL 3BJ91 2F8OA 3U83A 3UZQA 5HGHA 2EDTA 4YK4B 3DGCR 2P5WD 5E9DA 3ARGA 4NWTL 5JW4R 3IFLL 1Q0YL 3BAEL 1HYSC 5IEHA 3NCJH 4MQTB 1BQHB 3K2UH 3VXSD 4N0YL 3OZ9H 3QT2A 4NHUA 2YXFA 2D9QB 2YWZA 2RBLA 3OAYK 1JPTH 3HZMA 3TT3L 4ZYKA 4AQOA 4XMKH 2Z8RA 3P4MB 4HS8H 2J2ZA 4LPCA 1S5HB 2Y7QB 3UTSD 5SX5H 2ARWA 2CDFB 3UJTL 4AG4L 4R6UA 2W0PA 4B5EA 4DUXA 3VGAB 5I1GL 4OGZA 5F9JA 4J4PA 5DZLA 3U0WH 2AJUL 5C0CD 3O4OB 5HGDB 5DJ8A 3KGRA 1SEQH 2DWDA 4EDWH 1TCRA 5E5MA 2Y36L 4KK8C 2YD8A 5BS0B 4FMFA 1NBZA 4KY1H 3BH8B 4WFFE 5T3ZH 3KLHC 3IFLH 4HLZH 4OAWA 2H9GA 2D4DA 5FA4A 4E5XA 3ZLQC 5F3BB 1UJ3C 3MCKB 5AZEH 1IC5H 4HPOH 5HGAA 2PTTA 2YA0A 3NFNA 1N4XL 5SWQB 3PWLB 1R3LA 3KYMA 4H25B 2VN4A 5F7YC 1G7MB 3GHEH 1J0ZA 3K4ZA 3QIWB 1HHGA 5DUBA 3UJTH 2FX7H 2EC8A 2XYCA 2LAAA 5SWSB 2LTQB 4K7PX 3L3HB 2K7QA 1A14L 1TJGH 3MRMA 4N1CA 5EUOA 5HI5C 2GJZB 4PJBA 2A6KB 1DQQA 4XX1G 5FEBA 4IRZL 2BNUB 2H32A 3T0ED 5IHUH 5HGHB 5FGCE 5JOEA 1CE6A 1F6LL 5IEHB 1GGIL 1MF2L 5JXED 2VLJA 4JB9L 3ARBA 4PRAB 3FFDB 3UBXG 5JR1L 2O61B 4FQIL 3JVGA 4YX2H 1T2QH 1KELL 5B39A 1T4KA 1WIPA 3ET9F 3V95A 3VWJA 5E2JA 4D0CB 1JF1A 2A6IA 3CVIL 5DK0A 3FOMA 3H42L 3V0WL 2EYSA 1ZHKA 4LKXA 4QOKE 4KRMB 1J10A 5J12C 5C09A 5DJ8B 3MBEA 1HXYB 2NY5L 4NRXA 1TCRB 2BNRE 5E5MB 4M62L 1P6AB 1NBZB 1F58L 3TVMA 1MCLA 3V6OC 1JYXA 3R06B 3FB7A 4GBXC 4FXLA 2PYFA 4OAWB 2H9GB 2J8OA 5FA4B 1V7MH 2CGRH 4E5XB 5J3HD 1A7BA 2FDBP 3MOAL 4H1LH 3DYOA 2PTTB 3NFNB 2IH1A 3CX5J 1E0OB 1U41A 4NQEB 2OJZL 1R3LB 3U48A 3UO1L 1HHGB 2EXWC 3SE8L 5MEND 2GCYA 5DUBB 4NZUL 1NC4A 5I1JH 3VFOA 5CD5D 4KROC 3GMPA 2ZCLL 2XICA 3MTRA 3HG1D 3MRMB 5EUOB 4D9QD 4PJBB 2AQ3A 2WQ8A 1DQQB 5F9WB 1Q38A 4K3JH 5KTEL 1F58H 1S9YA 5GZND 35C8L 3U9UB 2H32B 4I9WE 3AS1A 4H88L 1CE6B 5KOMC 5FYJD 2E7BA 3RZWA 5T33L 5AZ2L 5CSGA 4YHLH 1I8LA 5GS1A 4NUGL 4RMVA 3GSQA 1UB6B 3ARBB 3MOAH 3WIHH 1IAOA 5EIIB 4MJID 1YNTA 1F42A 1GC1C 3LZFH 1JFQH 4LFHD 1I9IL 4MZ2A 5EC1A 1L4IA 3U79A 2VXSH 4G8EA 4AT6B 5B39B 1T4KB 3WD5H 4PJEA 4EN3A 3NIDE 2NXYC 2OM5A 1JF1B 5FCSH 3RVXC 1M6OA 2A6IB 2OXHA 4HUKB 3UZVB 5DK0B 3DMMA 4V2CB 3OR6A 1G0YR 1F8TH 1ZHKB 3N9GL 4LKXB 3RTQA 4LU5L 2IANE 3MRLA 4JFFA 4MS8D 4CVZB 3ARZA 2XI9A 3Q6GL 3I6KB 4UNUA 5C07B 3CAFA 4M7ZC 5I1CL 2R39A 43C9A 4QGYA 3TVMB 2GK0A 3KPQB 3RWHA 1S7WA 3IDYB 3FB7B 3SQOL 1EEYA 2O26U 2DM3A 3C8KB 2A1WL 2CLVB 3E2HB 1MCSA 1FLRL 4HKJA 3FT2A 2AEQH 4WFGD 4PJ7E 1QACA 1ZEAL 1FVCA 4YFEA 2OR8A 2XTLA 4KV5E 1XGUA 1HDMB 3OBAA 4ETYA 2W65A 3WN5C 1NC4B 1T20A 3L3IA 5ELIA 3VFOB 1SJXA 4LU5H 4POZD 3GMPB 4U1KB 5F1NA 3D2UB 1JRHI 3Q6GH 5L6YL 3ZE1F 2E3VA 2J5LB 3REVA 5DD3L 1E4KC 1AD9B 2QSQA 2P5EA 1OW0A 1NMAL 4QTHA 1F3DH 4MNQE 1QEWA 3GK8L 2W92A 5ITFA 3BPNC 2VISA 1W8NA 4F7CA 4WHTA 2DJSA 4ESKA 1WIUA 1U2HA 2HJFA 4YNYB 2PO6C 4YFLI 2P42B 2XQYG 1RZKL 1AR1D 2Q20A 1IAOB 3T09A 2ZSVB 1YNTB 4KDVA 1A1OA 5EC1B 2XTJE 4LCIL 2ED7A 5ANME 4Z7UE 2DTSA 1H8NA 3QULA 2XQBH 5IVXE 5BVPH 4MQXC 1MCKA 1FCGA 2R2BB 1M6OB 1WF5A 3DMMB 4PLKD 3OR6B 1Q0XH 3DIFA 5F8RC 4O2FA 2VKWA 1J0YA 4ZFZA 3RTQB 4BM7A 4PJHE 4JFFB 1HYRC 1I85C 4GMSH 2VAAA 1XIWC 1PEZA 4JEGB 5MEQA 4WU5A 4E41B 2IPTL 4KU1A 2A9MH 3QCTL 1CGXA 4HWEL 3RWHB 3SGKC 3TPKA 2H32H 4NN5C 5D71H 5ADPH 4JJ5A 3QCUL 1LO5B 3C2SA 1IEAA 3IDMA 5K9QG 4CL7A 1HSBB 4LBEB 1VDGA 1OCWH 1CFVL 8CGTA 2NY6B 5L2KB 4IHOA 4AIOA 1FVCB 4KK6C 4XZUB 1F6AA 1EXUB 3ARUA 2E27L 3BMWA 3MV7D 3TCLA 3X12A 3RL2A 1G9NC 4EI5A 1XGUB 3DNKA 3O8XA 3BKJH 3W9DA 4MHHI 3B9VA 4PV9A 1NLDH 4XVSL 3W2DH 5T5NG 2NCMA 2W65B 1U8JA 4XI5D 5DC4B 3L3IB 4JM4H 5GS2D 4NCDA 3RX5A 3TNNA 4JCLA 1KCUL 1NEUA 2D7OA 5I76A 3D39D 4MA1C 1P5UA 1IFHL 4E0RA 4OSUH 3ARDD 1IM3A 3REVB 1IL1A 2C4FU 3WHXB 4M6NH 3OF6A 4OZFB 3TN0D 1OWRM 1MUJA 3NPSC 4QTHB 4ZPTA 2H41A 3ULVE 3TJHD 3TO4D 3C9NA 5ITFB 1FNSH 2FX9H 4PJAE 3K74B 4WHTB 1EEZA 3TBTB 2HJFB 3L9RA 2CKBA 3QSKB 1YEEH 4OCSH 4PV8A 5E99H 1CTNA 2VAJA 4NHCH 4XCFL 5DMIL 4P2RB 1T03H 4X4XA 5LGKA 2OBGA 2A83A 1W0YT 3SDXB 1BWWA 2YD4A 1DFBH 3QULB