2L7QA

Solution nmr structure of conjugate transposon protein bvu_1572(27-141) from bacteroides vulgatus, northeast structural genomics consortium target bvr155
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MNELDIQQEYPFTVESMPVADEIAGDETVEIRLEIKPSGNFIGTVYTLRYFQPDGKGSLKMEDGTVLKPNDRYLLNEWKFRLYYTSQSDKEAQTIDLYFEDNWGNLQQLTYDFNGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein found in conjugate transposon
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7qA01
4LBAA 2L7QA 2L3BA
chains in the Genus database with same CATH superfamily
5KYUA 3K7UA 2HJFA 1N6QL 1JNJA 4NHCL 3BP7B 5E2VH 2B2XL 4TLUA 1XX9C 1BDYA 5FO7A 3BHBB 1T66D 1Z5YD 1XCTB 5J8OA 2GW5A 5D7IB 2XA3A 3DA0A 4G59C 3C75A 1BGXH 5B7MA 3ZZSA 4G6MH 3A6BL 3WHXA 1DBAL 1PIGA 2X4QA 5LVEA 2H2PC 4HPOH 2H3NA 1X4ZA 1PX8A 1CU4H 4TVPL 3QEGL 3VDAA 1SJVA 1EFQA 2DJMA 1VLXA 4YHKH 2FZ3A 4BCZA 3AQYA 5A16B 5JPNC 3N42B 4G8IB 3LTVA 2GY7B 5DDHA 3V55A 4EOWH 4LFHD 1FE8L 5KSBF 4NCDA 4FQIH 4FX5A 3IGKA 5E8PB 4EVNB 4YBQC 4QYAA 2BNRE 2P8LA 2R1YA 3BH8A 2ZCKH 4P4KC 2BM3A 4WEMB 4ZSOE 2J44A 3RWCA 3KJ6H 3W0WD 1T2QH 3FU0A 4G6FD 3OWRA 5G5DA 3OD3A 5FFGA 1U92B 3Q1SH 5CS7A 1KFAH 2W91A 4FA8A 1Q72L 1PVHA 2NX5D 4JY4B 2BFGA 3RNKA 3GI8L 2P49B 4PJFF 4XNQB 3MRKA 2OMWB 1DTUA 1S7TB 2DWSA 3CFBB 4XMPL 1I7RA 2A9NL 3JZYA 3PXLA 4TNVK 1CF1A 3RKDD 1MQKL 2PTVA 2OMTB 2GVYA 3QULB 4HKZA 2Y1ZA 4XGZB 2XKNB 4D9QD 3UAFA 3ULUL 1U8LA 4FJZA 4PMFA 1Z1WA 4BFIA 2PUQT 4HETA 4WZ9A 1FGVH 1E65A 1KZYA 2E9IA 4PJHF 4PRNA 2JK5A 1BG1A 1N3NB 1W8NA 2E86A 5CJQH 3N85L 2DKUA 5GRWA 4EBQL 3QUMB 4DETA 1YMMA 1BBDH 5KVFE 3BFWA 2BZ7A 1BZOA 2JSFA 5BS0A 2IO5A 5BRPA 2A73A 4KTEL 1P84J 4Q9RH 1VPOH 3MRHB 4LOUD 4XWOD 3OKKA 2YLKA 2AKRA 3MODH 1ZHNB 3QZMA 3T71A 3ZE1F 5GRYA 2VGLM 3AU0A 1E4XH 2CGRL 5AB0A 3G7TA 3KEDA 1KLFA 4W93A 3ZXAC 5F2FA 1D9KA 1JMXA 1CDCA 1BBJB 3RIFF 5HBBA 4O2FA 4FQHB 3Q2CA 4P4KD 3MJ7B 4MCZA 1IQWH 4ZUWA 2D7MA 4TRPL 4WW1A 5MEPB 5SWQA 4WO4D 3EYOA 3VXMD 3QWRA 5C0DA 3OJVC 4LARL 4JFEA 3X2QB 4DKDC 3GPSA 2QGEA 4IJTA 4KOCA 4Z5RA 1AG0A 1ZHNA 3P0YH 2R8SH 3L4VA 4E41A 4K55A 2TSAA 1K6QH 4QRPD 4XO5A 2VDLB 3VH8G 4DT2A 2ADJA 4J4PD 1F6LL 3EOBA 1Q9OA 1HEJC 5K39B 1J1XL 4QJ5B 3DTUB 5DHVA 1F4HA 4L4VD 4UDUA 2ZSVA 1OEZW 4UZSA 3SPVB 4KX9A 5CEZL 3D25B 2J6EA 1IBHA 1N18A 2EXWD 3X14A 5KAQF 4K4KA 1S7UA 3MRPA 1JGVH 2ISDA 3LYRA 2Y36L 3HZVA 2P8MB 3AXHA 5TH2B 4KTGA 5AD0A 3CU7A 3RNQA 4BFKA 4MS8C 4NC0B 4FHBD 4TTGA 3KM1A 2GSGA 4WK2B 3LZPA 4XVUD 1ZJBA 3P0YL 1NJ9B 5AW6B 3B5GA 1OAZH 2H8PB 2BSRB 3BZEB 3FO9B 3L5JA 1GW0A 1K6QL 3A47A 4RH4A 1HL5A 3WY2A 4JQIA 1A6AB 2VMCA 1TYEB 1JYVA 2D4DA 2VO5A 1UZ8B 3GMOA 4G9DB 4Q2ZB 3PQYA 1G6VK 3NSDA 1CQKA 4TF4A 5I66A 4X7DC 5AW9B 1C9SA 1O6SB 4G6AD 1IKOP 3NCXA 4AJ0A 3D85B 4UTBA 3U1SH 5M94B 1BECA 3GSOB 3R1GL 3T0EE 1JWMB 3OQ3B 2CO6A 1TVHB 3NCYP 2UZYB 2V2TA 4OGAC 1ZT1B 4A6YH 3WLWD 1NCUA 3KM2A 4OUUB 3V0HA 3MKKA 5EO1B 4L3ED 1NL0H 2F74A 1RZKH 3O3AA 5E4OA 2XIDA 2HXAA 2JXMB 2QT6A 5LN4A 5T1KB 3T65A 1CGWA 3L17A 2QMKA 4QT5B 3O6FA 4Y5VB 1R24A 1LO3L 5FGBA 1NDMA 4UINL 5GGSY 4MXWH 4F57L 3QZWA 4Q4EA 4WWPA 1X5LA 3RI5F 2YR3A 3FFCE 3QYCA 2WQ8A 2CKBB 2MJWA 1S7TA 3HA0A 2VL5B 2DJ4A 4AQ1B 2JB6A 3O4OB 2AVFA 1RH8A 3M07A 4RMSA 4LOVA 1XXFC 3UAJD 1H6TA 1L9QA 2Y5EA 1RPKA 4ONGL 3D39E 4FQ1L 2Y69B 4Q6IC 4OKDA 4U1LB 1XR8A 4AQEA 5KG9A 3QQNA 3TO2A 1I7UB 5BOPA 5KW9L 3MKGA 2E47A 5ESQA 2BWIA 4JR9H 2E59A 1I1FA 2OMZA 2YRZA 2B9AA 4WHYH 1CFSB 3OAZK 4YPJA 3FO1B 1J8SA 3U9PL 4IEFB 1SVBA 4NZRH 4Y16A 3ZHNA 5IR1B 5FX3A 3QRLA 3CLEH 2A6IB 1VFAB 4EOWL 5TE4L 3FQTB 3JV6A 1CLZH 3VB8A 3S35L 3LB6D 1NKGA 4UT9H 1QNZH 5DUPL 5CHNA 4AT6A 2BSTB 3P73B 4U7SA 3C5SB 1ZTXL 4XPAH 4MA3B 2NDGA 1I9EA 2FB4H 4XWGH 3U4AA 4Z7OE 1KT2B 5BCAA 3ATBA 4XMUA 4YHOH 5BO1H 5L0QC 4R4BB 3CZJA 1S5IH 3HE7D 3WFCH 1QLEB 1DUYA 4ES9A 3VSUA 1EEUA 2V2WB 3FB7A 3S5ZA 3WFHB 1NCOA 2L7UA 1WAAE 2RIKA 3PIQB 4IBZA 1EO5A 4MD5A 2XG5B 5GZOD 4MHHG 4FTDA 4S1RH 3IN0A 4HIXH 4UU9B 4EE2A 4PP1C 4M48L 4XVJL 3ILQD 2X4SA 1MCIA 4DK6A 3A24A 4BYHA 3DDFA 4R96A 2EEDA 3G6DL 1YEHL 4JFFD 5KAQG 3P02A 4DO5A 3FOLB 5GXBB 3WY1A 1E5AA 3BRFA 2VZTA 1U95B 3KXFE 4K5PA 3FFCA 1IM9D 3SPVA 2R29A 3IDGB 3J7HA 4N20A 2PP7A 2AXGB 3CX5J 3OKOA 2H3KA 2C34A 1AHWB 1Q9KA 4JKMA 5E2TH 1PZUB 2F53D 2BX5A 1SGKA 1A4JB 1QVOA 5IB1B 3C5ZB 3SJVB 3KDMB 5EN2B 5LNEA 4DVBA 1UD5A 2ITDB 4GI9A 5EF1A 2YAHA 4PY7B 4NXKA 4P23A 1QX1A 4AQ1C 3V6OA 4E9RA 3WNNA 3HLKA 3IPBA 4KMTH 4R2GC 1HQRB 1COBA 1NOLA 3B2VH 3MDJA 1UD4A 4JGJA 4TUKL 1BXVA 2AQNA 3U1SL 3K6OA 5I6XC 1KTLA 2C9SA 5I1CH 2IPTH 1RCYA 4AITA 1JPSL 4OY9A 1K8DB 3D07A 2NY3D 3QS2A 3AWFA 3QCVH 5HJDA 5TQ0L 2CCWA 2UZXA 3C6LD 1RUPL 3REWB 3V52H 4HPHA 4YXHH 1LO4H 5HY9B 2QQKL 2ZUUA 3WKPA 3QUKB 5AZUA 5I18H 2EICA 3V5DB 4W4NA 3LEVH 4MFHA 4KVNH 5D2LF 1YEKL 1MCCA 2G3ZA 1DSWA 1GHFH 4FHJA 5EU3B 2WQVA 5IHZB 1KB5H 3MV7B 4NFDA 4NZTL 5JIMA 1YMME 4HPYL 4YSUA 2VLRA 1DBJL 4CJ1A 5I17A 4ABQA 4V11A 4LKCA 5I0ZA 5AOIA 2GJZB 2BWDA 4OJAA 3CU1A 4L23A 4AZ8B 4KK8D 3CQPA 1NGQL 4JN2A 5DEGB 4ZW8A 1Y18A 4U6YB 4IRJA 4NJ9L 1NGPH 2MTAA 4Z7WE 2YD0A 3BDBA 3US1A 3MLUH 1C1EH 5DLML 2FD6H 2B1HL 2X70B 3QO1B 4R7DB 1OTTD 3COOA 2OMUB 4GMTH 1D9KB 1GGYA 1AGCB 1EX0A 4N2KA 2VDPL 2NZ9C 3V5KB 3VI4A 4BXSV 3B7SA 1P1VA 5CM1A 6FABL 1GIGL 2VRQA 1W9XA 3EJPA 4YUEL 3POCA 3HMXH 3OKDB 1CVRA 3ECQA 3E38A 2BHFA 5C08E 4G8EA 3S35H 5A2IH 5ERWA 3IMUA 1YJDC 5GGVH 4EO5A 1WHOA 3VXUB 4D9LH 1MVUB 1UH2A 2ALAA 3Q44A 5KSUB 2KZWA 4GRWH 3VFUB 2K4WA 4M93B 2R2HA 4HU8A 4ZX5A 2BHZA 2DPKA 3CD4A 1MHCB 4HISA 5IB1A 2ODHA 3QQ4A 1CFQB 3M86A 3VI4B 1NGQH 1JD9A 2ATPA 3G9AB 5T33L 2P46B 2PW1B 5TD4A 3QDGA 3DPDA 4Z77A 3GIVB 4GRMB 4EN3D 4IS6A 3QK0A 4HIHA 1HOCA 1GRWA 1NQBA 1M7DA 2IOOA 1TQWA 3FUFA 3K72B 5INCB 4ZO7A 3FCSA 2Y1VA 4JN2B 1S9VB 3CFEB 4G11A 1WV7T 3L2LA 3T2PA 3SJVE 2J88L 3NIDB 1GYCA 1E5YA 4ZS6D 2QVMA 2JCCA 1BX2A 1GZQB 2EDOA 5KN5A 2X88A 4S1QH 2AJZB 2R4SL 3K1DA 3WIIH 1TOXA 1WGVA 4Q0XH 1M6OA 2W0PA 4XXDA 2AABL 2LQRA 5I8OH 4KJQC 3AGVA 1JNNL 1EO7A 2DM4A 5BQ7B 4NHCH 5JPNA 5HVGB 2VMFA 1SYSA 5C86A 5E1IA 1XGRA 2CUHA 3REVB 3WL9A 1OSYA 5EBMB 3PDDA 3DMMD 4GT0A 3HN3A 3R06B 3AMKA 1U91B 4N5EC 4BRJA 4CVZB 2HTLD 3BSHA 2V0AA 4JZJB 2EDKA 4XCNB 3B9KD 3AC0A 1SM3H 1O5PA 3DXAD 2G3MA 4XODA 5KOVC 5DRXB 5EO1A 5D7IA 3DX7A 5EUOB 4AOFA 4DZBA 4NWTH 4BH8A 1BZ8A 5CP3A 3NQIA 1XB8A 2M83A 3FFCD 4UMSA 3FU7B 5GS0C 1I8KA 3OKNA 4JFQB 1ILUA 2AZAA 1OK0A 1XH3B 2DLFL 3D0VA 4X5XA 5I1LA 1IQDA 4GSRA 3O3EA 1NCCL 2GIYA 4KVNL 3OAUL 5EEUA 4JUSA 4AXWB 1TETH 3IRPX 3G6AB 1FL6B 5I5RA 2EEXA 3WO4B 1YY8B 4YZWA 4U1JA 5I26A 3CSYB 2R2BB 2R9HD 1KYUA 2XJKA 1JUFB 2JIXA 3OAYH 5DJXA 4AUUA 1DQDL 1VFBA 1PFCA 1XMWA 1J5CA 1IIKA 5EZIL 1XBDA 4G6KL 5GS1C 3QQXA 2Q8AL 1X7QB 3VXSD 4ODXA 4J3OG 4WWKC 1G0XA 1NBQA 2LTQB 3MA9H 4BSVB 4C59B 2OX5A 4KJPC 3ZIMA 3UPCA 1AGDB 2B9BA 2X41A 3K2IA 2APWA 2ICCA 1PQZA 1RJLA 2UVFA 3Q9PA 1TZGH 3BWUF 3FK3A 3QORB 4DUVA 1YPZF 1KIQB 1NPNA 3DVGA 3MOBH 3OKEA 4BIKA 4HUWB 5I19L 5IGXH 4LT7A 3VGDA 1G6RA 3LZLA 1CR9H 5DMIH 1B9ZA 2QSCH 3CK0L 1AZNA 2ZIDA 1RZKC 2OJ1A 3LH2H 1OLZA 4Z7IA 5CLWA 2X3BA 2YD6A 4LCYB 1MH5A 1EDHA 4N8CH 1U8JB 1HH6A 5LDUA 1M2OA 4ZQKB 4DHLA 1MLBB 3BVWA 5HYJD 3U6RA 3QJRB 4EI5C 2G5RA 3C12A 3RIAK 1I9IL 1XCQB 3WKNA 4IYKA 3OC8A 3OB8A 4KKNA 3EKCA 4HIIB 4XN5A 1JDAA 1SHXA 1YEKH 3GUTA 1DBBL 4OFYA 4YDJA 1PYWB 5JHDB 2IQAA 1KPVB 3NIGB 2ICES 1U8JA 2NDFA 2ZJSL 2VN5A 2ZCZA 2B2XH 2HN7B 5B3SB 1BVLB 4KC3B 2WLJA 4M7JH 2Q86A 4CJ0A 4XPHL 3CPLB 1ECYA 2VDPB 4PHZA 4A7TA 5BO0D 3DVGB 1M1XB 3B2UC 3FZUD 1GL4B 1NA8A 1XEUA 1B9KA 5ABAA 5E6ZA 1QFWH 4ISVA 3R0NA 3F05A 1ZHKB 1NTDA 4OTXH 5CBAA 1J8HB 1WC7B 3WXVH 4U2ZA 5AW2B 2OYPA 1C16B 5CFHA 3DV6B 2CGYA 5I1IL 3GB7A 1W16A 1XIWD 3QULA 4HKZB 3LXAA 4FFVC 1HQ4A 1JHKH 4C54A 5B39G 1NIFA 3EJZC 3LSOA 3F04A 5LDSA 3L3KB 1V7ML 4AG4H 2DN7A 4M6OL 2MQGA 2Z1KA 4JQXC 3WSQH 2X4RA 1DVTA 5JHLL 4G43B 4KO5A 2J56A 5KEZA 4GG6E 1F86A 5DHYB 2P8LB 4ZTEA 1EDYA 1Y0LB 2GITA 3MBXH 4B9CA 3LMJL 1LO0H 2AJYL 2A9NH 4F7EB 2DM2A 3OZLA 4WK4B 5E4EB 2B16A 1P7QB 1F4YH 4UQDA 1F3DH 5L9DL 2PKDA 4U1HB 1ZLUK 4FNRA 5I74B 2IGFL 4IRZA 2FIRT 4M7LT 3VQ2C 5DD6B 2OSLA 5E1QA 4LGPB 5HHNA 3WIAA 4D9RE 1EZUA 3VXOA 3WE6A 1CFBA 1FN4A 5I6OA 1U3ZA 2Z0UA 2WBWB 3M17B 5JIPA 1VERA 5DUPH 2WQSA 4R7DA 1MLCA 4QOKA 3DSFL 2DB8A 4OVVA 3D09A 4P57A 3BH9A 1WJ3A 4AV4A 3QEQD 4XHQA 4ETQB 5JPMC 3NIFF 3VTAA 2WKGA 5DZNA 3I84A 5JDJA 1OCZB 4XB7A 1IQWL 5FW7A 3QFJD 2YOCA 2Z91B 3GHBH 5LBSH 3QNZA 3MBWA 4HAGA 2MKLC 4P5TD 3IYLW 4Z7VB 5BRZB 3P2BA 3FQRB 3GMPB 3MRMA 1PFOA 2PLTA 3ZT6A 3F12B 5EOCL 1YNKL 3IETB 1TZIB 1EEQA 2YBRB 3UPAA 3DOSA 3PGFH 5KJ4A 2WSPA 3MJ7A 3QEQB 5E99L 3WY4A 2CLRB 5GRVK 4R90H 1U6AL 1A7QL 3EYOB 3OF6D 2WKOA 4IS6B 3RX8A 1QSFE 4GRMA 3QYMA 3VG0H 3MRNB 1AXTH 3Q05A 5BRQA 5JHAA 4NBYB 2LR4A 2B0SL 2ENJA 2V9TA 1KYOK 1JK9B 1NGYA 1OTUC 3F12A 4IRZH 2AK1H 1MRCL 3ETBJ 4U3SB 5I6PA 4PJ6A 3WCYA 4DVRH 2DD8L 5GS3A 3T6QC 5EEZA 3BVNA 3TBTA 3NSCA 2R7EA 3PF2A 5DFTA 5E9NA 3M1BB 1HVXA 2RQEA 5ILTL 2KYIA 3H3PL 2ZPKL 2ZOLB 1H3PH 1KXVA 3LXBA 2WXGA 5C6TL 3TH2T 4L37A 1IC5L 2FEJA 2JK5B 2BNQB 4HK0A 4HEME 2VZ1A 1Z9NA 1N4XL 4LDEB 4K2UH 1UWXK 4A2EA 2YZ1A 3DX0A 4QT5A 4NN5B 1OAQL 3P1VA 4G6AC 3MV9B 2EECA 2ZQKA 3FAXA 5EV7A 3LY6A 2XWBA 1MHEB 3PUCA 1IKNC 2X6BA 1KB3A 1IKFH 5D4IA 1F1DA 1RL1A 3BUIA 4PU2A 4P2RA 3CQQA 1FN4B 3V4UH 5EU6D 3WI9A 1YMHB 4XHJD 3QEQE 5FHBL 3SGEH 5LGHH 2X2YA 4A2HA 5CZRA 2BVEA 4QMEA 3MYJA 3NZ8A 1QW8A 4Y0GA 5FM5M 4N1HB 3LKSA 3RU8H 1M7IB 4MD0B 2OJEA 1KTDB 4PJEF 4PTTA 4L1SA 1PNDA 5CNHA 5IJKC 3ABGA 3MGOB 1TQUA 2ZUQC 1AXSA 3NIDF 5IW3A 4HC1H 1JYNA 1XH3A 3D0VB 5B1BB 3LMJH 2X4RB 4HKJA 4RQQA 4Z3FA 4Z7VA 4XXCA 1QBAA 5E5LA 1NAKL 4P07A 3WLBA 5EUKB 4HIEA 2V9RA 4KRLB 4AEHL 2CALA 5F96L 4HHAB 1ZLEA 2X2UA 3L5XH 3ECVA 4R2GB 4LSQH 3V0IA 4DEUA 2DYPA 3RGBA 4YSAA 5FHAL 4GS7C 3QNXB 2UY6A 2X4OA 4HFUL 2VKXA 1ZSDB 4ZD3H 1ZDSA 5DHVB 3ILEA 3NIDE 3RGHA 1T03L 1VRSA 1S2EA 1XF4B 4PJGE 2DQUH 4PWKA 5FYKU 4ODVH 3B34A 1JZDC 5DRWA 4PJHA 1DQJA 3MX0A 4G2AA 2IWFA 2F7PA 2Z8SA 4S1DD 4X6EB 4XPBH 5KG9B 1DBML 3DECA 4HZ1A 5LKNA 1LL1A 3GGWB 5FGCE 4NO0A 5CJ5A 4UTAA 2YXVA 3GLAA 3QXAB 3CLEL 2I60L 3ZO0A 4EN3C 4LOEA 4PJ9C 2P1YA 3HE7C 5J1AA 4XCYA 4K3EH 5J11C 4PJ8A 1AYOA 1DVXA 3HC0B 3GF8A 4FF9A 1JWUA 1BIIB 4UV4L 1QHPA 4WNSA 5JXED 2I27N 1JGEB 1N70A 4JK0D 1CZ8L 2RGSA 5DHXB 1RMFH 5TE7L 4Z3TA 4MMYB 4JRXD 1E3XA 3TPKA 1NDGA 2VDQH 1KOAA 2F54E 4J27A 5C70A 5E4EC 2EH7H 1R75A 3CSPA 1M4KA 2OYMA 2GJ6E 3GHEL 2D7TL 1N6VA 1ZLUH 1FL3A 3O3BB 5IQ7H 5ABDE 2F0CA 1IC1A 3ABMB 4WY7H 2GJRA 3QJOA 1LO4L 1JGVL 4Y5XB 3MXVL 4MQ7A 4KXCA 3VXUA 1T0PB 4P23B 1HIMH 4Z9KB 5D2LE 3BWAA 1REIA 4MYPA 5B7EA 2GI7A 3AT0A 1NBYA 1RUQH 2MHAB 2WXRA 4B3VA 1KBBA 3B5HA 4AIZB 1T0MA 1BXUA 4FC3E 2P52A 4N2OA 3EJUA 2PN5A 2YD4A 5LG1A 7FABL 3ARBD 3FRPG 3SSGA 1NOAA 2NXZD 1TJGH 5E95B 3AADB 1K72A 1ROWA 1HYRC 1MREL 4LU5L 5JZ7D 2EVJA 4ODBD 4M6MH 4WTXA 2P24A 4OCSL 2WAHA 4HGWB 4UOW0 4KKAC 3KYMA 1P4IH 1RK1B 1IKFL 3H7BA 3KHQA 2RQ8A 3ILPB 4BGLA 3H4HA 1QSZA 3F7KA 2XQYG 4OZGA 2R29L 5EEXA 3FFOA 4NM8L 1UA6L 1IAOB 2K6YA 1RUPH 3CVCA 4L8BB 4I5BB 1WSST 4RESB 4KROB 1F5WA 5D7JD 2ZZUT 3MV9D 3C5JA 3L7FA 1CC3A 3ULVL 3GO1L 1MFCH 5IBUG 3ALPA 4MA3A 3MODL 3K81A 3PFUA 4JDZB 1DVSA 3MV8D 2IANA 1HDMA 4JY6A 4YFLF 1L7IH 3ARUA 3KHOA 3H9SE 4PPTA 4WI7A 5EO9B 3HC3L 4N6QA 4Z0XA 5HY9A 4YS4A 4G5ZL 5DJZB 2ED7A 4WFGE 1S7VB 5DVNA 5A7BA 3KJ6L 5IMMB 3QFDA 5I1AB 3N41F 1H8NA 2DBJA 4V2CB 1I8LC 5LUMA 2FWOB 4NN5C 1QPPA 3TF4A 2KH2B 2DKMA 3L6FA 4HWNA 1H3UA 4RRPA 5GS1A 4NC2B 4PFEA 4YXKH 5F3HA 4C57C 1J7VR 4WVRA 5CIPA 5D7KD 5MEOA 3SOTA 4XPGH 4R5VA 3GSWB 3DX9A 3JZ7A 3VXUE 4HUCA 1MJJA 2HG0A 3MXWL 1P1ZB 1CFNA 4O5LL 1OZUA 5JHMA 3ESNA 4KY2A 2QR0B 4QR7A 3TFKC 3U1PA 5I1EL 1F45A 4L0PB 3U7YL 3QNZB 3U83A 3UGUA 1OAQH 4XXWA 5BQDA 5BUAA 2VMJA 4LLYA 1UXWB 3O2DL 5E8EA 1FL5A 4OAWB 5DQJB 3VG0L 3D3VE 3GXDA 1N5YH 4DKFH 4KK8C 4PJHB 5DHVH 1S3KL 3ZDYB 1EVUA 2EO9A 4BHUI 5DK2B 3WXWL 2NTFB 4WO4C 4UM9A 2Y7SA 4E5XG 5KYNA 3MRLA 5CU9A 4A7UA 1BPLB 4F24A 2OV0A 2XDHA 2C5DC 5D72L 4XNXL 1SJMA 5DZAA 4HYTB 2D0FA 4YR6B 3PL6D 1RPUA 2AITA 1ZE3H 2MKWA 5JR1L 4HFWA 1KCSH 2FJUB 1MHCA 2H4EA 4XNAA 2EUWA 1R5IB 2N01B 4NWTL 4NYLA 3B6SB 1DO6A 3WL9B 1T1ZA 5E0QA 3Q6GH 1CICB 3NIFB 1GZPA 1WAEA 1TSHA 2D3NA 2FYYA 5KVFL 4XMXA 2BSRA 4EQ3A 2X40A 2CA3A 1SXCA 2BSDA 2VXVL 3MI6A 3V9FA 1FYTE 5FPIA 5CJOL 3L7EB 5E2JA 2EIDA 4Y5YC 4LVOB 3VYNA 2ZXQA 2WXNA 4UDTA 4GAYB 1PS3A 3BLBA 3MOQA 1OPGL 4MX7B 3AB0B 3Q2NA 5L2KA 1ZA6A 3EFDH 4N5ED 1MAMH 4OGXH 5C09A 3MRRA 4IDJH 4PYGA 4UAOC 5CP7B 3T0EB 4W9JC 1MFDL 1WBYA 3HBQA 2NY2C 2PO6A 3ALXA 2IBZY 4EPSA 1MRDH 4Z7QB 1FA4A 3BQUC 3CXFA 3ZL2A 1TFHA 1RKRA 3F00A 3FU9A 4CMMA 2C1OB 5F9WC 5C08A 3FW6A 4KJQD 3HEIB 4HK3J 4UTBH 3IFOA 1J1OL 4Y4HD 5I0XA 1VEPA 3C60D 4M43H 4DTGH 4WFHD 2J8HA 3HLAA 1YEIH 4D8PA 3ZZLA 4MNQE 5JDSB 1FHNA 3HE6D 4WEUD 3V4VB 3WTYA 1WBYB 3V4LA 2X1PA 3BKJL 4L4VA 2FEDD 4GRLA 4DZBB 1H5BB 1UB6B 4F8OA 3UYPA 2ICWJ 1D6VL 1KIUB 4I0PC 4OLEA 3SYPA 5L8LB 2N7SA 4O2FB 2BW5A 2EDYA 5CD3A 3CZLA 4K07A 4FI6A 2FBOJ 4QRPA 4MSWB 3T2QA 4PGJA 3SYQA 1W91A 1JPST 2F7RA 3DGGA 3DTXB 4KWUA 3RZCD 3DSNB 1M57B 1KENH 2Y2WA 2DH3A 3Q3GA 4D0BB 1KEMH 4JREB 1E5CA 1DBKH 1ID2A 4GRWF 3GI9L 3GK8H 1RVFL 5IVZA 1NEPA 2E56A 3ECUA 2QADC 2AV7A 4BSWA 2ZKHH 1RERA 3K6NA 2F6AA 3B4NA 5F70A 3UBFA 5CSGA 3IDGA 3P0VH 3BIKB 5D2NC 3MJ8B 5AAMC 1XTLA 3A21A 5L2JB 1ZGLB 2EE2A 1OPGH 5I15H 4P2QD 5FA4B 3MGAA 1NC2D 1HL8A 1RJLB 2YSSA 1MIMH 3WIFB 2IOIA 2JKXA 2A77L 4M7KL 4R7VA 4MJ6B 2BDNL 3IFNH 3SE9L 2ZE0A 5L7XH 5GGRB 1TSRA 4E0RA 3KR3H 3HG1A 2KUTA 3ROOA 4PS3A 3QR1A 4RMQA 2CE6A 2O1AA 2R0KH 5ESVB 3AS0A 3FQ4A 3BEWB 2FQGA 5I2IB 3HZYB 4XVTL 3B2DC 1A6WH 2WVTA 3EHBC 1M7XA 4JANB 3WTVA 4GSXA 3ZMNA 4IBUA 1PY0A 1AQDA 2EDBA 1GPOH 3QC5X 2AAAA 2X87A 2XVKA 3HVNA 1K8IA 1A9EA 1I7ZA 5K9OA 2RBLA 2ADFL 4PH8A 2QKSA 4X9IA 1G0YR 2X4NB 1E4XL 1OB1B 2CGRH 1KV3A 5DC2A 1ZXKA 5FKAB 3D87B 1JYXA 1XGTA 4F80A 1W8EA 5SWZA 3F6IA 4CGUB 5FUOL 3QCUH 2K70A 4OVUA 3U25A 2CD0A 1Y7VA 1TKWB 2PCXA 1PZ3A 3VRIA 4WTQA 1M9SA 3CVIL 2GJ6D 1IARB 1BJMA 2F9BT 4AZ8A 3Q0HA 2GBUA 3B7RL 1E4XI 1WS7A 3VE0B 2CK0L 5JNYB 3JT0A 1MUJB 1Q1PA 2WZAA 3WEMA 5ANHA 3U9PH 3ZYJA 1N8ZA 4QJ4B 5I1JH 1LLAA 2CIIA 3UMNA 4EDXA 5I5MA 1G7HB 3TBSA 4YHML 5CAYB 3QUMA 4LMQE 5EZJB 3GBDA 2VLKB 5ESVA 3GRGA 1CD1B 2AEPH 3V7AE 1QWNA 1U42A 5C3TA 4OJFH 2WYTA 2R69A 1IEHA 1NCAH 2AEQL 4AEHH 5AEAA 4HOWA 3QAZC 4PG2A 1ETA1 1YEGL 4APQD 2CO7A 4AQZA 3QNXA 1WA1X 4JG1H 4X6CF 4FFWC 5EC1A 3TJEH 4CMHB 1P69B 4IK7A 2YPKA 4JO4L 3NSYA 4KITB 1S7VA 2VLRD 1X5XA 4PRIE 1UUSA 2NY7H 1HILA 1QQDA 2CIKA 4Y16C 4Z3IA 3SZ6A 5JR1H 4Y1AA 4HU2A 3MLYL 1N0LB 4PJXF 4DP1X 2P80A 3Q2LA 3T1WA 2R4RL 4YHKL 3NJIA 5DRZA 1XCQA 1WH0A 2BSBA 1GXEA 4QRUA 3GM8A 1E90A 4LSVL 4NQEB 4OF3A 3NEOA 3H3BC 1PMYA 2IADB 1I8IA 2DQDH 4MJIA 3AREB 4GXVL 1AR1B 1HILB 2R39A 2VN4A 3B6SA 4DEPB 5C71A 2NSQA 1ILSA 2F8OA 1U8QB 1RK0A 2IAND 3BE1L 5ERWB 3VFMB 1TJXA 1XGYH 1QW9A 3EJTA 1JRHL 3MBEC 2XJLA 4LSUH 3X3GH 2B15A 3AY2A 4H8QA 3IKCA 3VTMA 2AEIT 3EF7A 3F62A 3K8LA 4F3FB 5EDSA 2KZBA 4HZLB 1JV5B 5D5MB 2RCSL 3MUHL 1CURA 1UM6L 5IROC 5DD5H 5BMFL 2X6VA 4I7ZC 4RX4D 1NFDB 3QUZC 4Y5YA 5F0MB 4FXKA 1QA9A 2AGJL 2UZPA 1GGCL 1QFUH 25C8L 3N41B 3QDAA 4U4IA 5JOFB 3KLKA 3R8QA 4DTGL 1B4TA 1HIML 3KR3L 3O8XC 4XAWH 5JHDD 2EINB 2EE9A 4YDZA 1JWMA 2V2TB 1FNHA 1AXTL 1TXKA 2M26A 1JZ6A 5DD1L 1QTYT 3D3VD 1DVFC 1OSPL 3TA3C 4WKXA 4FGMA 4NQVA 1I9RH 4X7CC 1ORSA 3WGVB 5CINH 3W11C 4ZUWB 2FECL 1Y0LA 2GITB 1GYWA 4PUBH 1F4WH 1ZDQA 2JKSA 2Y2TA 4NQEE 3H9SB 4G9FA 4UQEA 2ENYA 5AL0A 4ZMZA 3HAEH 3QR0A 3NJGA 5BJTA 3FUIA 1UEMA 2BIIA 2WXMA 2UZXB 1IAMA 2I7SA 1H3PL 5CXPA 3FTZA 4LRIC 2EACA 4OCRH 1HE7A 3DPBA 1F56A 4OZIA 1BVNP 1VHPA 3EIFA 4P46A 1IU1A 1KTKE 1YYMH 1J48A 3LJ3A 3RVWC 4N85A 1G1YA 5FDYA 1UXSB 5B8CB 1KXTB 4DKEL 4APXB 2WGNB 4UNTA 2Y7QB 1S9WB 1FFQA 1P9MA 5DR5L 2VZVA 3V6ZB 5IQ9A 5KYWA 4PW9A 2B08A 2ERJC 1KIRB 4L0ZA 3UC2A 2G4GA 5JW3L 4KTEH 5ICZB 1OQXA 6TAAA 1J05B 1W8OA 5IVXB 3BGMB 5I76B 1BWMA 5T3XH 1A6UH 1KJVA 1WBXA 3QRGL 4PP2A 3UAJC 4AC4A 3RUGB 4Y89A 2HKHL 3SDYH 3EGXB 3FB8A 4Q56A 5IEHA 3WS3A 2N3JA 3OVUB 4JG9A 1U21A 3EBIA 3PP3K 3BJLA 4LHUD 3RIKA 3WJMA 2FATL 1A1MA 4FG6C 5FK9B 5T33H 4LL4A 3PABA 1R3IL 1U92A 4OLXL 3SD5A 1NAKH 2Q7NA 5TE6H 3SO5A 2B14A 4GKZB 1A6WL 3C2SA 4PJAE 4XNUH 4Z3EA 3L3DB 3OJDB 1HEHC 5FW6A 1IGJA 1GA2A 2YRPA 4CW1A 3VXTA 1R19A 1P53A 5I73C 3A4EA 5INDA 3HB3C 3SIKA 4ALAH 5KSAB 2GSIA 3CTTA 4E36A 3Q3GB 3LRSA 4XCCL 2B39A 2P44B 3QJVB 3QNYB 5EIIG 4FXGA 1UH4A 2PTTB 3C6SB 4U3CA 1YEDA 3QWNA 3VD9A 1QSFA 3U7WH 3WFDL 1NMBH 3G5WA 3MNZB 5AW1B 5C0FA 1DR9A 2X4QB 2CKBL 2R59A 5G4MA 5EG6C 4A6YL 2HLAB 5CEZH 3IMVA 5J12B 1DQTA 3IDXL 4UYQA 3UTTA 2DL2A 1XT5A 2QDWA 2FJFA 2NUPB 2QSTA 1YZZA 1AY1L 2Q3AA 3FS9A 4AM0A 2ZKMX 4YHZL 1J8HA 3TIEA 4AW4A 2Y7OA 3AWEA 3IFLL 3KWWA 4QWWC 2Q20A 3SCMA 4GSQA 4NZTH 1M6OB 1OAZL 4I87A 5JA8B 1AHWA 3RNKB 1NCGA 4N2GA 5GRUL 3BUYB 1NM9A 4DFIA 4YWGH 2NNAA 4L1LA 1P1ZA 4UNIA 1MQKH 2IDCA 2GYSA 1XHHA 5HDWA 3UH8A 1OP9A 1MJUH 1HKFA 1AO7D 2YOAA 1LE5A 2GBTA 1KYAA 1S3KH 4L3CA 4X7SH 1NIBA 4GAYA 5BOZG 4BHUA 3I02A 2E5EA 2DI8A 1ZA6B 4H8UA 3QZWB 1B6DA 1GSKA 1K9TA 2X4SB 5DJAB 5FUCC 2HZHA 3SKJL 1X5HA 4EZKA 1T6WA 3T8XB 2CO3A 4EQ2A 3U2SA 5GGUA 5TE6L 2W9EH 3VFTA 2EADA 3I6LD 1DLHA 2BY2A 2X4UB 3OGCB 3KPQA 1XGQA 2E4TA 5C2UB 4URTB 4YIQA 3WFHA 1RP8A 1HOEA 3LPWA 4OJDH 1CXHA 3GSNA 3P3TA 5F97E 2YRLA 1GZHC 2G5BB 4HGKC 1N64L 4S0TD 1MFEL 1X44A 3C5ZA 4OM1L 3T4YB 4M1DL 2ZJSH 1OE3A 4X6DE 4QHMA 3WLWC 4GIOA 1F0LA 2ITDA 3GZQA 3GLZA 3LRLA 1ZLWK 1R3JA 1GGTA 2VDKB 3QZLA 5BUGA 2EUVA 4NP4L 1DLHB 3NQKA 4P2OB 4MRCA 4OZFA 4LRNL 4PJAA 5AVUB 4FQ2H 4BFIB 2DQJH 4KUZH 3W5NA 3GWJA 1O7SA 3CDGA 1YJDH 3W0WB 1Y18B 4XP6L 1S7WA 3QIWB 4XVJH 2CSPA 4AQOA 1NMBL 1P2CA 4YDVA 3BIAX 1FNAA 4HF5L 1WVZA 4K9EL 1SFDA 2YPKB 5KWYC 1AE6L 1SUHA 2FRGP 4X4MA 2MNJB 5A3IC 2E7CA 5EU6E 4RMWA 2VDLH 3RY6A 3HCVA 2BHUA 2JH2A 5GSVA 3LAFA 4HJUA 1UA3A 2E9WA 4XWGL 5DI8A 1RVFH 2ATPB 1OF2A 5CINL 1OL0A 3ARXA 3Q13A 4NO3B 2HTLC 1S7SA 3VQMA 3UTTE 3P9LB 3LHPH 4KMQA 2R2HB 1ZRUA 3EOAA 2MQCA 2YS4A 3JWDC 2YGNA 4X5WA 1FLTX 3REWA 4DWHA 3NTCH 3DTDA 2ED9A 1BJ8A 1OT4A 1BQKA 1ADQA 4JBSA 2IF7A 2WBJB 3QUKA 5M7QA 2MCMA 5BVJB 4QTIH 2V7NA 3MVSA 1A4KB 4UQCA 4J3VA 5GZOA 3NFNB 2YN5A 3P4MA 4GBXD 2H2PD 1INEH 2AXFA 1ZA3A 3H9SA 4G9FB 3U7YH 3BHBA 3NOIA 1A1OB 3ARFC 3EH4B 3VCLA 5HHME 2HVJA 3D2UB 3X1NA 2VOTA 2Y1AA 4NQDE 1CVSC 4YAQB 1E2ZA 5L88L 1CFSA 3HMWL 5PCYA 1M42A 3ESVF 3MPCA 1BYPA 4CL7A 3VXMB 4ZOCA 4IKJA 4ODWA 3WDJA 4IMKC 2IH3B 5GGTH 4F1SA 2WSKA 2Z31B 5AUMB 3QIBC 2BOBA 3HC4L 1C5CL 2MEJB 3MOAL 4QHKI 4LP8A 3MNDA 4JZNA 4QRPE 2IGTA 5IUSA 2R27A 4R97C 3KPPB 5KSAC 1LK2A 1MRDL 1XIWA 4LXFA 3ZE2E 4NZ8A 4NP9A 3CH1A 4PREA 4DESA 1FORH 1DN2A 1K4CB 4MX7A 2JJSA 3ESPA 2XV0A 4IOSA 4IKKA 2V17L 2FT6A 3E8UL 5D71H 4F9PC 1IAIL 3QYNA 1A9BA 4BUGA 1OTSD 4AEIL 3HNSL 1PEWA 3QJUB 3ARGB 2BNQA 3MNMA 4PGEB 3LRMA 3DUHA 3HBPA 4YH6A 3HUJE 5DUBB 5IMLA 4FQQB 5EUKA 1ORQB 5TPWH 1JG9A 5EO9A 1NANH 3IU4L 4OQTL 3EBGA 3GSOA 1OTTC 3DARA 3THML 1MJ8L 4RGNE 2DQCL 4IU3B 3GMRB 5DVPA 1RUAL 4AEFA 4ZNEA 5HGHB 1ZHLA 4L3AA 1XB3A 3Q06A 1I1YB 3NK3A 3TN0B 3BD4A 1YRKA 3O9WD 3AFLA 3DSFH 4JRYE 4AENB 5SWZE 4X4ME 4NX0A 4NO3A 5IJDC 1DFBL 5KVDH 2FX9H 1AGCA 4YN3A 4OD3H 2FATH 2ITEA 4FLQA 4FFZH 1N59B 3QR2A 15C8H 5B22A 1XMEB 3ZO9A 4D0DA 1K4CA 3SCMD 2LVEA 3S36L 3ELAT 3H9HB 4HUUB 3Q2VA 4HIPA 3QFGA 5L8KB 4G6ML 2XZAH 4I3RL 3SDDA 1VZIA 2XWTA 2BO0A 3MC0A 1EJFA 5BZDB 2DQ6A 4WFEE 2GK0A 2XHNA 1IGYA 4HV8B 4FG4A 3UTTD 3EO9L 1KTJA 1NMCC 2Q9OA 2PPCA 2D3JA 4NNPL 4KRMB 3EG9B 5HJGA 3F5WB 3WNJA 4PJ5E 2F8VA 2IG2H 3N0AA 1QFWI 1B0GB 4U6HB 4FQJL 2VZUA 4ILDA 1UASA 2Z7YA 2AJ3A 2QFPA 4D3CL 3NACL 1FL3B 4NPJA 2BIPA 1OGAD 1MI5B 3KPLA 3LQMA 4HZLA 3P77B 2P5WE 5DWPA 3AU1A 3QRBA 5CHNB 5B4MD 3UGXA 2BJMH 3MCKB 5D1ZC 1SVCP 1UGKA 3KNBA 4PJEB 1UM4H 1UT1A 3MROA 2Y4SA 4GKLA 3FULA 2HLAA 5IVXF 2DYRB 5TDOA 5A6MA 4OLUL 5E94A 2GK2A 3GUTB 4MMXA 1AP2B 2Q10A 1KXQE 3BJ91 4LEXL 3FSZA 4FABL 2HMID 3OXRB 3VYOA 1DL7H 43C9A 5A3ID 4QXWA 1VADB 4HXAH 1W0WB 1XGRB 1T21A 2LGNA 4JFDD 4MJ5B 4ZPVB 2YC1A 1HHKA 2FO4A 1NMAH 1OWWA 4YSDA 5FIEA 3VFSA 1W0YT 1RURL 4JFED 4CAGA 2VAAB 2WLNA 2WLLB 3A0OA 1FZOB 1WWBX 5T1KD 4ERSL 3IJYB 3PV7A 3P0GB 5DK0A 3UP6A 5I1KH 3FO9A 4AVJA 1BQ5A 2WMPA 5D6CB 4MMXB 1D9KD 3ARPA 4OCYH 5SX5K 2QQKH 5EBLA 4MCMA 2Q3ZA 5C0JA 3APDA 5EO0B 3KEHA 2EYTA 2DJSA 1CJYA 5FLUA 3HI6L 5J6SA 3QISA 3D2TA 2DQFA 4BDVA 2DTSA 1CYWA 4ALAC 2OMTA 3KBFA 4LU5H 4G6KH 2EVHA 5AZ2L 4YSSA 1AQKL 3M7OA 4M8UA 4JRYB 1GC1C 1EUUA 3O3AB 4HWBH 2Y7QA 2VLKA 2GJZA 1CR9L 4K7PX 1KIRA 1JUFA 3RHWF 3CN2A 2GK0B 1N68A 3HN5A 3P30H 4ODSL 2VIRA 1P7QA 1OT2A 3MUGB 5CJ8A 5IK3A 1TTUA 4TPRH 1BZEA 4AT6B 1OM3H 3TURA 1ZIBA 4Z7WA 3T1FA 3MRBB 4FFZA 2EUXA 3R1GH 4YDJB 4OKVA 2H41A 4M1GH 3QG6B 3IVKA 4LASL 4OFDA 4IGBA 4ZTOL 5DMJB 1T1XA 5I8EB 4L8CA 3RBGA 1BFVL 5EU4B 2F5AH 1KBWA 1BQSA 5K9JL 3O2WL 5IFJB 2AKRB 2YJLA 3LN4B 3LSOB 5I8OL 1SEBB 3UJIH 1H3GA 5IVOA 3V9CA 4K7PL 5GRZA 1N10A 4U1GB 5EU5A 1MRFL 1GC1H 3BMWA 3ZDZE 1VA9A 3W39B 4F57H 3P4NA 3GMQB 2EDNA 5HPOA 1BZ7A 3MRIB 4EIGB 4QXVA 5FM4A 3HPLA 4HPYH 4PD4J 4OF7A 4Z7VE 3FCTA 3DRQB 5ID1B 3GBML 1OM3L 3K5SA 1JGLH 1A5FL 4WHCA 5KANG 3UJTH 3UL4A 2XRAH 3TYGH 3UBXA 5J1TC 5DHDA 1F3JB 2HFGL 5FCUL 5F6HJ 3NN8A 5AG9A 5I1IH 3T09A 2FLMA 3D34A 1KGYE 3FRPA 4C83A 2GFBB 3QI9B 1AKPA 3SQBA 1BX2B 1GZQA 3C60A 5KUMA 1MCRA 4HLZH 1PSKH 5HDBB 2EVIA 3D69B 2PPAA 3K2UH 3UGEA 3AQDA 4LCIL 2HJLA 2BOLA 3V79C 1R0AH 2BVOA 2YKLH 2XCMC 1XGYL 1JCVA 4A7GF 4ZMTA 3B7YA 5E8DL 3HMXL 4GW4A 5BS0E 1S7XA 3B9KC 5GJSL 3MA7B 5JORA 1T4KA 1JZFA 1KY7A 4PJHE 5A16A 1P4BH 1PLGL 4DGUA 1EV2E 5D7KE 5J11B 1PNCA 2XWZA 3CHOA 4JHZA 3UJTL 2FBJH 3MRDA 1AI1L 3MLWL 1E3ZA 2UV3A 2E0PA 1NCBH 3FTGA 4HUWA 3DXAB 1J9QA 4P04A 4HFWB 5E4AA 4DO6A 2VT0A 4PBVC 2AQPA 4NDMB 4PBWD 4PV8B 5DZVA 4WUUE 3EGDA 1YHPA 2VLKE 2ORBH 3W5MA 1QBBA 4XGZA 4JQVA 1A7PH 2P42B 3CSGA 4IOIB 4N68A 1T89C 4RBPH 4ZK8A 4X99B 2BXZA 4KI1A 2O6DA 1JDCA 1KJ2H 3S7GA 4UMGA 2YPLE 4YHIB 3KL5A 2E7LC 2HJFB 2WANA 3ZR6A 5D6DA 4ZMAT 3AJ7A 1MDTA 2UXVA 4U1JB 5J3HC 3V6ZA 4QKTA 1JF6A 1AACA 4WFED 5EIVA 5ACMA 4Y4FB 3ARFA 3PDOB 3G5YA 4YHOL 4R4BA 4MMZB 4N22A 3TX4A 3V0WH 2K9FB 3CSBA 1H15B 4I9WD 43CAB 2HJKB 2L3BA 4PG2C 1O9WA 1J8HE 3BWZA 5ICXA 5F9OL 2DQJL 4KUZL 4LCUB 1ADQL 1IC7L 4U1KB 1PTZA 4IOSD 4OGYH 4ODTL 2PCPA 3EYUH 2EIKB 2XN9A 2ZWKA 2WWOA 3IMSA 3DJZA 3VSQA 4A37A 2BP8B 5K9QG 5FA3B 1WF5A 2X6UA 2XXFA 1ASPA 3NFSH 4UAOB 3T0EC 4HUXA 2BNUA 3ESUF 2NY6D 2DBLL 3KYOB 4YXLH 4XB8A 3HZMA 1T5XB 4LLWB 4OFQA 4X0NA 4UUJB 4XP9L 3MJ6A 4BV1A 2VXQA 4Y4KD 3AB0C 4PJEA 3ESMA 1OW0A 4PJGB 2XZZA 4I0PB 5HHMB 4BZ2A 2IAAC 4OKVB 5ABZA 4NCC1 12E8L 1BZ9A 5EEWA 2WP3T 4B9FA 3UMTA 4U1IA 3GM0A 5JMRA 4FFYL 2ALWA 1H6UA 3OZ9L 3WFEH 2ADIB 4ANWA 1ACYL 2QVTA 4ZMWA 4QPEA 3EG9A 3KDMA 2NTSP 1PKQB 2WTRB 4Y5YB 3QDMA 4PJIE 4K3GA 3PP4H 2SODB 4JFYA 3GBMH 4LZKA 4C4UA 4FLSA 4MAYD 4BFRA 1LO3H 2AJSH 4IW4C 2J3SA 4LSTL 1LVEA 5CIPH 4N0UE 3L3GB 5IB2A 3UPRB 3ARED 3MACL 1V55B 1BSIA 2BOCB 5E1AB 1DL7L 2HT3C 1E3FA 4XPTL 2P8MA 4NDMA 5BO1L 5AD0B 3ZVVA 4LO9A 3ZTJH 1H3VA 4Z7AA 5FUCE 5KVFH 2C1PB 3Q5YA 4U31A 5SX4H 1J87A 3OLGA 5AW3B 3FCSB 5F21B 1V3JA 5FKAA 4PJ7A 4DGIL 4L37B 3RAJH 2ZCHL 4M93C 1AG6A 4ZQKA 1EEYB 1OAUH 1UFGA 2FO4B 1FP5A 2J43A 1GMEA 4K71B 1C12B 3IRCA 2O5YH 3QJZA 1J9RA 2YD3A 4AKOA 4G1MA 5EMYA 3F64A 3D2UD 2FVNA 5IB3A 4Z7UF 3S5LG 4DSYA 2V2XA 4HZAA 4R7LA 2OCCB 2OTUA 2OJZH 3S3BB 3H0TA 1HZLA 1HKLH 1PG7X 3WD5L 3RG1C 1DQML 4TL4A 4JZOA 3MRGA 4TTDD 1KZQA 2X4UA 1YYCA 3RVUD 4EDWL 2A6IA 3Q5TA 3QNFA 1SLWA 2JQMA 3L9RB 4P2RE 3C6SA 1WP6A 3BKJH 3L4ZA 1WD8A 3DO4A 3ZT7A 2L7JA 3KPTA 3EJYC 2CLRA 2H0PA 2XFXB 3L13A 5LAXA 1G5GA 5EZPA 3K8KA 1E50A 3LQZA 1YUKB 4ADGA 3J07A 4EIBA 1XL4A 4M8VA 4F7CA 4GG8A 3QUGA 3UBXG 3X12B 4HJEA 2OW6A 4A6YA 3HC2A 1QLFA 4YXKL 5IHZA 2EEAA 1AGBA 2K8QA 1U8IB 2BIQA 1CLOL 3E3QC 4ZUVB 1YPZB 32C2A 3RY4A 2BSCA 3HRPA 3OWEA 3P3UA 4JO1L 4M5ZL 4PB0H 4ONFH 2PCFB 4QRBA 4J3UA 1D7FA 5CJXC 2AFNA 3FT2B 2JI2A 4JFPB 3T0VA 2AJVH 3V4PA 4E2OA 3DX6A 3TYFA 5I6XB 2WUCL 1XF2B 3CFDB 4OD1L 2KERA 4ZAKD 3AZUA 4F8TA 5ANMB 1NH6A 3U0WL 5EEVA 5I23A 3DYMA 3QORC 3HS9A 2CDFA 1LQBC 1A25A 1TVHA 5IFAL 3RVUC 2J6EH 1WA0X 4YVNA 5EN2A 1HHIA 5C0AA 1W15A 5MEND 1D5XB 5DJDA 3TH3T 4P4KA 1EEYA 4NKIH 5F7MC 5JPNB 1LM8V 1CLOH 4G8EB 1H9VA 1FF5A 1D6EB 1ZD6A 2CAKA 1M7IA 4MD0A 4PTTB 2ESVA 3S88H 1A8JH 1RIUL 4OM0H 3TJHD 3TP4A 1TJGL 2W0FA 1KBPA 3NCBB 4AE0A 4DVRL 4N0CC 1SOKA 2WXQA 4JY5L 4NQVB 2VLLA 3SYOA 3X1BA 1BM3L 4KX7A 4DN3L 4PTUB 5FYJE 3CN1A 4FS0A 4HS8H 2COVD 4WUKL 3X13A 1UZGA 4RMVA 4L9LB 2ZOLA 4BZ1A 5B3NA 3ZHLA 4NKDA 3BAEL 4YHYB 4X5XB 5I1LB 4R7NA 1SN2A 4MAYB 3BP5A 3LPPA 3ZKMC 3B9KB 1RHFA 2V3DA 3F7VA 3HPJB 3QUYB 3LQAC 2VLME 4L4VE 2AQ2A 4LLDA 3FUEA 4PGDB 4UILH 1BXAA 2BNRB 4ZSOB 1NC4D 3W9EA 1XF4A 4DNLA 3J8F7 3ET9F 4P23C 4Z7VF 5MHSE 5F89B 5KSUA 1WPCA 2WLIB 4NEHB 1P5VA 1TTAA 4BWWA 1MWAH 3BGFC 4Y9EA 4V1DB 2XPYA 3O2DA 2XA8H 4QYOB 4W9CC 1VPOL 3FU6A 5DZOA 4BWTA 1HINL 2IFFL 3M8OL 4ZJ9A 3CZKA 4HWEH 4HS3A 3MCKA 4UB0H 4B7IA 4W9FC 4KK9D 3GBLA 1TKWA 3LKQB 3RWFA 2AMUA 3JT2A 4YHPA 3PE9A 1E6JL 3FT2A 3SE6A 3KLQA 2HLFD 3Q48A 3WFCL 3HZMB 5KZCB 1YEGH 3K3QA 3MJGX 4J23A 1D7BA 4KK6C 3SKUD 3UZVB 4PCKA 5IF0A 3E8UH 5D71L 2YPVL 2C3HA 5DD3H 1AOHA 1LEKB 1MF2L 4ZS7L 4X80H 2FHFA 5JOPE 5KSBA 4Z7WB 4L9LA 3VI3A 1SBSH 5D5MF 3TT1L 5C6TH 3BPOB 4M7ZB 2EILB 3HCVB 4HAKA 4OF8A 3J2PA 1WG3A 4RMBA 5C92A 3RIFK 4Y1TA 4TUJB 4D0DB 4UV7L 2ZXDA 4XC1H 5ICYA 2LU5A 3WFZA 5TDPA 4OFPA 4POYA 5CFAA 1BREA 2JB5H 5HYEA 4M56A 4UM8A 3L3GA 2A6KA 2PNDA 3WXWH 1NBYB 2MHAA 3IAQA 3OR6A 2F1EA 1BF5A 2H2SD 1SBBA 2ITCB 4QXTA 5L8JB 1U9KA 4JN1L 1L9NA 4XN9A 3TGXA 2NQDA 1D2OA 3IJEB 4JVWA 4MZ2A 3ZE0E 4EZJA 1DUYB 1T89A 4Y19A 1ZT1A 3CLFH 4UIKL 2XNAA 3VGEA 3QXWA 4PVLA 2YWZA 4X4YA 3C8KA 1KLUA 5DO2D 1LO5B 1G43A 3EF4A 2WNGA 2PWHA 4PG9A 3K0WA 4H8WH 3UXFA 5DEFB 4KI5D 4B27A 1A02N 4RGOL 4BCYA 2NUTB 2VDKH 4WV1C 4I3GA 2QQLL 2X2JA 4MQSB 2V5YA 2KHAA 1CGYA 3O3DA 3O4LD 4F1ZA 5F1IB 3BZEA 1K5WA 3LZQA 4LESA 5E03A 5E23A 2VNCA 5KUKA 5EUOA 2SEBA 2Y9RT 3AWGA 2WINA 4XOCA 1TZAA 5I0DA 3CAFA 2Y0SA 5HHXH 3TBVB 3M8OH 2IAMC 4D3CH 3GSUB 4U3HA 1MIEH 2L7QA 2XQBH 3B2MA 3GXTA 5ETUB 1V54B 2R1WB 3CIQA 4KGJA 4LDOB 3O6FC 3HZKB 3OMAB 4YHLH 4CDGC 1MFCL 3H3PH 3IU3A 4H8PA 3ZPDA 5IUCA 5J1AB 1BVKA 5D96B 5EZOL 4V1DE 4G8GD 4AVHA 3C6LB 1NAMB 4U6HA 3GMNA 3LS4L 1H3WM 4XOAA 5SX4I 1IL1B 2DY2A 5ACLA 2R15A 4K23L 3SGDH 5D1XA 1IMHC 1QBML 1PZBA 3I2CH 4O02L 5BZZA 4QGTA 2RFXB 1IGYB 1CD0A 4JKKA 4EUPB 3EOTL 1IM3A 1RUML 1ZGLA 4HLEA 3CVHH 4W6WB 2MCPL 1A7QH 4QRAA 3SDAB 1R5WB 5IBTH 1MDAA 5KS9E 3VVWA 4QNPF 2X09A 3RL1A 4HCFA 3CZNA 5TTRA 1UD3A 4KXBA 3IDJA 2XWCA 4N2IA 4FQHA 5I5JA 1IE4A 2XTJE 3SDYL 3CGTA 1MWAA 3KPRB 3VJ6A 2ZONA 4GRWE 4KROD 3GKZA 1HXYB 2K7PA 3CMGA 5D1QA 5IK3B 4TSAL 4F7EA 4YK4B 5F9AC 2EAEA 3OAYK 3CXHK 1LD9B 5IQNA 5AYUL 1KNOB 4LARH 2JLPA 4OBRA 4PRPD 4YDKH 1PZSA 4FG0A 4K0OA 4L9DA 1A7OH 5IB5B 1EBPA 4HD5A 1A6ZA 3LKSB 4JDEB 4XXCC 1PLBA 2NY5L 3QJFB 2HFEA 5CD3B 3LNEA 4XPFH 3RX7A 5DRWB 2AV1B 1QHQA 2NYYD 4F9LA 4UIMB 1JZ7A 3OKMA 4I18A 1TQBB 1L5GA 4PV9B 4X4ZA 5I74C 3S37L 2WCGA 2OMYB 4BQCA 4L48A 3EGXA 2DV6A 4JRWA 4XMLH 5EC1B 4XN8A 1EAQA 4PI2A 4YC2C 2Q87A 2X6AA 5E7FA 3KYNA 1YEWA 1Z2KA 1KB9K 1HL9A 3NABL 3QCTH 4PJ5B 3L4YA 4XO4A 4Z7UB 5IJVA 2HWZH 4RFNB 5I6NA 4I48B 5AVSB 1IGFL 3VXOB 1U3HA 3WE6B 3AREC 3CFMA 4TUJA 2EE3A 4JPSA 1J5DA 3SD2A 3UERA 4B6ZA 1ET8A 3BKCL 2F5AL 4ABUA 1E8ZA 4FOMA 1FL5B 5K9JH 1R33A 1VACB 3FAWA 3OKMB 2MMXA 1OW0C 1XR9B 2FR4B 1GJUA 1JHTB 3BZ5A 4GO6B 1QUPA 3IU3B 4Z5RB 4B9IA 3JQOB 1UVQB 1KEML 1TCMA 3QG7H 5D1QB 2DM7A 4K3DL 4MNQB 2BMKA 5DVOA 1JPGB 1FSKB 1XEDA 3IB4A 4J3OD 4KRNA 3O9WC 1UOKA 4OR1A 4B0MM 4BH8B 3VFSB 1T1YB 5D7JA 1SEBA 3ZTCC 3I3EA 3V5DA 3A6OA 3DBXA 4NCC2 4XP9H 3QFJA 5MENB 2BP8A 3CBJB 1BCIA 5HI3C 4S1DC 5F0PB 5FYJL 3N5AA 4PLJD 4P2RB 1FRGH 4K8RC 3HFML 1F4XL 5I6KA 3U36A 4HWZA 3LD8B 5CLXA 2AXJA 3ZLQC 3N1FC 3ARDA 5JLZA 1W2KT 5I1GH 2DICA 1VKXB 1AXIB 1UURA 1J12A 3UBXB 2CDGB 2WXFA 2JTYA 4U6XB 5I0VA 1M1XA 5AAPA 5F1NA 1XSIA 1L9PA 3B9KA 1NOFA 1O5DT 3F7VB 3FHEA 3FU3A 3PHAA 2UZIH 4W6XB 3MNWB 4XC1L 4XN4A 1JP5A 4Z76B 3ETSA 3L3JB 1URLA 3HZKA 3PY9A 5CEZD 5L0QB 2L0DA 1FFPB 3CHPA 4HSQA 4QY8B 2Q6WA 4AQAB 2NY1C 1VJSA 3P2TA 3D4GA 2OXGA 4Y4HA 1L0PA 1VCAA 2EDWA 1B0IA 5IM7A 3MRCA 3AS2A 4BFFA 2OMWA 5DD3L 4FQ2L 2UX7A 3BGAA 4O2CB 3ZRFC 4Z3GA 2D9CA 4HMCA 1J5OH 3QO0A 1I8IB 4XO8A 3LRGA 5A2BA 4N8CL 1A9VA 2Y5TB 3BO8A 5E7BA 2PW1A 4Y16D 1N67A 2FE0A 1TYRA 2VCOA 2DYPD 5KTEH 4R3SB 4KXZI 3U82B 3PXHA 4XMZA 5CEYB 5GS1B 3NZ8B 5GGQH 5C97A 3C60C 3BW9A 1KSRA 1KT2A 4WRLA 4BBWA 1NFIB 5B1CA 1CQYA 2GI0A 4GEIA 1OAXL 3QT2A 4IRZL 2EVGA 3GMRA 1NEZG 3GUFA 3DO7B 3JUYA 4NQCD 4HJ1A 4JFOB 3OKDA 3LN9A 1KFAL 4G8GA 3WDIA 2XZCL 1FC1A 5ADPL 2VUOA 4CA4A 1TF4A 1TR7A 2F8XC 1E4WH 1IZKA 1F4XH 2LW3A 3TV3L 5J7CC 2GC4C 4MQTB 4FZ8H 5JHDE 3ZMEA 1E5UI 2AJ3B 3KPNB 3CMOH 4JFFB 1DE4A 2YA1A 4OF5A 2CRMA 4I18B 3PHQA 1FBIH 1RD6A 2HWZL 5LXVA 3G08B 3A6CL 5EU6A 5LO7A 2R7EB 2WQRA 4HS6B 4HEMA 4N0FA 3VD5A 1UXSA 5B8CA 5JOEA 3LKOA 5DUMH 3ARDB 1J1OH 3UTZB 5JLZB 3CFKB 3SDXE 1BVKB 2JJTA 3NFPB 4RGND 4ZW5A 2F1BA 4JDVB 3S88L 5CGTA 3BQVA 2JJSC 4ZW7A 2YC1B 2ZCHH 2ARJB 2JQZA 2W80C 4N0RA 2CPUA 1ZV2A 1YEJL 1PG7H 2OLDA 3D9AL 3ULUE 2NUTA 2YQBA 1UM4L 4RFEA 4ORGA 3HE6B 4K5OA 5C0BE 2R9HC 3T3ME 2Y6SD 1WAAF 5J3HD 3TBCA 5ALCL 3UTPD 4JPQA 2ETWA 2VMDA 3WKYA 3NP3A 1A2YA 2ED8A 4P99A 4OH2A 3DMMB 3VWJC 4LSDA 3TFBA 2MOQA 5EBMA 1ZLVH 2V8LA 1NWOA 3UG4A 2Y06L 2Z8VC 3WIHA 3UROR 2YAQA 5E70A 1N7MH 4P2QA 3R4RA 4NNYB 5F89A 4ORZC 1UA6H 5IHHA 2E7LA 1G7MB 3DVFA 4JL2A 2AXGA 1IL1A 3OKOB 4L8BA 3NZSA 4FKHA 3QHZH 1UUNA 4XCEA 2DWEB 1QFOA 2A1WL 2WZPD 2YMXL 2GIXA 3FFCB 2NYYC 4K15A 5AKVA 2WKLA 4QRSA 2V9QA 1ZANH 5J4MA 2H1PH 3FNKA 4HH9A 1UWGH 5D1ZD 1IT9L 1GJIA 5D72H 2VR6A 1KJ2A 3AS1A 1UKQA 2X44D 4LEEA 2C1PA 4AV5A 2YPLA 1WTGT 4FNTA 4NFBA 1FLRL 3IF1A 1H6FA 3AAZA 2LVCA 2I26N 5KVEE 1DVUA 3F7YA 5E51A 5AYUH 4EEEA 1JPSH 3NEXA 1JVOA 4F7CB 3ES6A 3MX0B 1NICA 2MNUA 1F1AA 2DIJA 5IZ7A 3HHSA 2WN3A 2V6HA 2YD9A 4P2OA 4WW2B 3QUZB 2VXUH 3GKWH 4GRLD 3TN0A 3UAEA 1TU2A 4M6AA 4XT1C 1FHGA 5ENWB 3PS6A 2FYVA 5IV2B 2A99A 1IVTA 4TOYL 1X9UA 2YUXA 3NH7L 4ONGH 4UQBA 3W39A 4Y5XA 1IJ9A 2VISB 3WN5B 4LLUB 3N2JA 3DI2B 4ZFGH 4XNYH 2OSYA 5IHUL 3BVXA 1QFPA 1KUMA 1KIQA 3GS7A 1HSAB 3RL2A 1TUPA 1KIPA 5F7DB 3QUXA 3O2WH 2EC9U 1A3RL 3IWUA 1VGEH 1R46A 3BW9B 2VE6A 2Y07L 5HDLA 4GRLB 1N26A 1F3JA 5IV2A 2J5WA 1SDYA 1DBKL 1TEFA 4G80A 2J7LA 3W56A 4GAJL 2X1OA 3DGCR 3AXLB 2Z6FA 1R3KA 3WBDA 3ARBC 4ATWA 1WUNT 2B77A 3OG4B 4M5YH 3FQRA 1AGBB 4UTCA 3ZW3A 4PGCA 1JHTA 5CSBA 3NZUA 1SDDB 2F7OA 2J8UE 2DQTH 1MW1A 1QUNB 4ZMQA 3JVGA 5FYKE 2X53A 3RUGE 4ZDHB 3IXAB 5I75C 3ZN6A 3LKPB 1CFMA 1X5YA 1QNIA 1NFDA 2Q0ZX 4GFTB 1JPTH 5T1KA 3NJMA 3TLRA 4OIFA 3QRFM 3B1UA 2GTWA 2NZ1A 3K6IA 5E2UL 4CC0A 4MA7L 4X6DA 3C5XA 3FXIC 3L1FA 3PL6A 4UU9A 2NXYD 3TPUB 2XG4A 4EMZA 1SY6A 1WHPA 2WSDA 3MMEA 2PETA 5CP3H 3UTSD 2J55A 4AYID 4JLRA 4PCTA 2JLLA 4P2OC 3HUJF 3H42L 3N1GC 4DKFL 1JWSB 1AMXA 4X5PA 5HYJB 5HPMB 4HGMA 4I5BA 1FZOA 5LXGH 4BKTC 4ATTA 1YO4A 4FJ6A 3LZRA 3TPUA 5LBGA 3U2SB 2DLEA 1IGJB 2YXFA 3QP3A 5TPWL 4CW1B 1MJUL 2YD1A 1WK0A 4RAUA 3GTNA 3MRQA 1IGTB 4XH2A 5JPMB 1CE1H 1NL0L 4N8VB 4WI4A 1AR1D 5FO9B 3RL1B 3MGTB 2CA4A 3BLPX 4FXGC 5HDBF 1MOEA 1YY9C 4NS0A 1KJMB 3ZKSD 2IH1B 2YFOA 1QTPA 3A3YB 3B3BA 4ZMOA 1ZTXE 1OGAB 5B38B 4K3JH 4Y4HB 3DX8B 1G7IB 1UG9A 2OSXA 4GAGH 5AVZB 4CKQA 2JFCA 3LNFA 1NBZA 3L48A 1FLRH 2VLMD 2Y07H 1L7TL 3NZHL 1EHXA 3NCJL 4K3EL 4UDUB 2J8UA 2YK1H 1HHGA 2QQNH 4N26A 3ME0B 4PEEA 3S34L 3W81A 2WXLA 1HSBA 5IT2L 4ZO9A 5AL8A 1ECZA 3S3JA 1KB5L 3CZSA 4G71B 3RB7A 3PGCA 4KFZC 3FCBA 4FTVB 1E9QB 4PB9H 4Y2NA 1UJTA 5HYJA 1CGSH 1QKZL 1FVDB 1UWFA 3FUKA 1NM4A 4S0SD 2AJUH 4PJ9B 3VU1A 1ZGLP 3TEUA 2ZICA 2DYPB 2VDRL 4U3SA 2OPCA 1BAFL 2XWJA 1EHKB 4IHOA 3QIUA 2W07B 2KLTA 1NUGA 1FGVL 5K1JA 1A22B 5IMMA 4X98A 2OL3L 3UO8B 4JDTL 4UT7H 5FFOA 4WTZG 4DEWA 1Z3GL 5IFHL 4XP5H 5AOMA 1TEYA 1OD7A 1E9QA 1U4EA 4J3TA 4XBEL 3WN5A 1AZZC 2HFFA 3S4SB 1CPUA 3VFNA 4HX1A 3QNYA 4QJ3B 1XCWA 1WZAA 1ZTMA 3KGSA 4EZMA 6FABH 5HDOA 2W38A 4GKOA 2FX8H 3QWRD 5GGVY 2XI9A 2FJGB 5JW5B 4PW3A 5C8JA 2XTLA 3QXAA 1TYJA 1I1YA 5AW8B 4RMTA 1T2QL 1XGPB 2D7NA 3T2OA 3ZQXA 4PGZA 1JAEA 2WZPA 1F3DJ 1NFDF 1G7QB 1DEDA 3JTTA 1XZ0A 2JV6A 1R3KB 4NZUL 5I0YA 2HX8A 2Z93A 4MCYA 4H44C 5DEZA 3HZVB 1KJ3H 3FQWB 3LDBC 3GMLB 3NABH 2GFBA 1T3FB 2G75B 3QI9A 3QW9A 5H4ZA 4J3SA 5J6HB 3O6FB 7PCYA 3FF7A 4FTVE 3Q8BA 3T3MF 4XNBA 1WAPA 1OB0A 1BAGA 1FZJA 2NY7L 1M71B 2HVKB 4B9KC 4HWBL 2AERT 5JIIA 4G7QB 5DD0L 4F3FA 3R4DA 5CUSL 3VW3L 1AANA 1T22B 2EDEA 3BZDA 3H9SD 5DZLA 4BFGA 1G9MH 4G7YL 5CCHE 2BVUA 1ASOA 4JRXA 3O0RL 2VR7A 3TBBA 4WFFE 3H6JA 4N4YB 1RLBA 4XP6H 3MSPA 3RJDA 5FLVA 4RDQF 5TDNB 3GRWL 3ARZA 3BCFA 2E27H 2IQAB 1RJZB 1X9RA 3FQXB 2MCG1 2H3NB 2PXYB 4M5SA 4E9QA 4BK8A 4QRRB 4PGEA 4POZC 4KRPD 4A04A 2Y36H 2DQGL 3BC9A 3BRDA 2WQAA 3ARGC 4HDIB 2H2SC 4OCWL 3MV9E 2WB1A 3QCVL 5TQ0H 3V52L 3LDBB 4JE0A 4DF9A 1QBMH 4HJTA 4NPYA 1GGCH 2FL5A 3S36H 1CFTB 2XWJB 2LTQC 1MELA 1DEEB 1I3RB 2EKJA 2V3EA 3MOBL 4V1DD 1JVLA 1I75A 3CFCL 3UTSA 2WZ6A 2XA8L 2W65A 1G9MC 2J1ZA 4XNDA 1CBJA 4OZGE 3VGAC 4JKNA 4FQXD 5FYLE 3P9MB 4GEJA 1J1PH 4Y4FA 3LKNB 3T0AA 3MLRH 1LQSR 1YNLH 1QD0A 2NY0D 1FH5L 2DLFH 1V3MA 3OJMB 4P9MH 3A23A 3GSXA 1DQLH 3G5XB 7PAZA 4KGLA 4ZO6A 3QQDA 4P5TB 4AL8C 5C07D 4O51A 5B3JF 4MZRA 3LPGA 1G9NL 4LPWA 3AGWA 4NQQA 5E4IA 2XBTA 2MSPA 3OHXB 2Z92A 1GGIH 3FQTA 3JV6B 2LAGB 2H32B 2N0KA 2OP4L 4BWUA 1NC4B 3LKRB 2WQUA 5C0IA 2Q76A 1WFIA 4ZUUA 3C8DA 3MLTB 4E42B 3EOAB 4M9OA 3Q6GL 4MVBC 1JV2B 3JWOL 3C8HA 5EZLA 3M7FB 2Y5TA 3BO8B 3SQOL 4PWIA 3QUXD 5F7AA 2E9BA 1EHLL 3N3EA 3L3DA 1JE6A 4H25A 2A9DA 3E1F1 4U1NA 3CK0H 5DRZB 1G6RB 1MCPL 4RFOL 5FDWB 1UOVA 4XBGB 5EU7C 3WNKA 2GSMB 1RQ5A 5FOBA 3WFBH 1AZUA 1NJ9A 2WTPA 3ZDXB 4HGWA 3FT0A 1QPXA 4JNXA 1WT5C 4OLXH 1JFQH 3DLQR 4K5NA 2VRAA 2DLIA 3UPRA 4I18C 4P2OD 4JPKL 3MRLB 2A9AA 4NZDA 2H5UA 4O9HH 3IDIB 4J3OF 3WAJA 2WTOA 1HXMA 3M6DA 3G5VA 1FNLA 1KB5B 1Y1DA 3ZKND 2WV3A 2Z3FA 2EJ1A 3LEXA 4Q74A 4AMXA 1UENA 3OJ2C 5FM5O 2CDGA 2CNZA 4JFZL 5IVXE 4TVSa 4NNYA 3DNKA 3IDYB 1P5UC 2OR8A 4WGWB 1DUZA 4JFXB 5JIKA 4BKSC 1T04A 4KKQA 2C9VA 5F1NB 5FYJH 1OPOA 4WI2A 4F5CA 4OT1L 4AXWA 3ZIYA 2V17H 2XXMB 4X4XA 3N04A 3WTTA 2RALA 4EXPX 1RZQA 1SRDA 2DIAA 3KLAA 3PUUA 5L4MA 1JZJA 4L5FE 3TVMB 2CBTA 5AAMA 2RB8A 1O6VA 1XO8A 1YAZA 1EHAA 4PJEE 3NK4A 4WI9A 3N1PC 3F58H 1XSOA 4P59H 2LLLA 3RTQB 4DFHA 4RAUB 1IC5H 3MRGB 4RIRB 1L7IL 2NT0A 2BMKB 1KLFB 3ZKNC 3RVVC 2JKNA 4KKBD 4LVEA 3TO2B 1J10A 3KPLB 5D7EA 3P4LA 1N6QH 2AJYH 4UANA 5AW7B 3KPSA 4BA0A 1EZLA 1MVUA 4MB3A 3MCLL 4WFGD 4CN4A 5F7YC 3W11D 2MCPH 2XWRA 3I6GB 1MEXL 3SN6N 1U3JA 3VX1A 2ZKYA 4G1EA 1HHGB 1A4BA 4GI6A 5DF0A 1HI6A 2J8UB 3ZTNH 4I48A 2WOYA 1AC6A 3HHMA 4ODSH 1HSBB 3HUJB 4Z78B 1F4YL 1NDMB 4NGHH 4CBZA 1JI2A 1TENA 4GRLC 1R3HA 1X5ZA 2C26A 1UH3A 3MJ9H 3B7TA 5BZWB 5BRZE 2A74B 4JFWA 1M53A 5B1KA 1KCRL 3LHAA 4Y2OA 1X9LA 3CZEA 3MA9L 1QSEE 2EZ0D 5D6CA 4HIEB 3TH4T 3VD3A 3FF8A 1EAOA 5C0JB 7CGTA 3GBEA 1PX4A 1RZIA 1AHMA 1DQQB 1DCLA 3MREB 2APFA 4MNGB 4LQFL 4DKTA 2PO6C 4PRIA 3VFNB 3FL7A 1I7ZB 4ENZA 2XSKA 3IJ8A 3T0XA 5FUZH 1FG9C 3D08A 3MLZL 2HRPL 4JO5A 2P7TB 1CFQA 3LZFL 4OIBA 3MCG1 3L5IA 3ISYA 4ES8A 2ESVD 2GT9A 1DJIA 3QFJE 4H8WL 2IXQA 4R5XA 4BFOA 3H6AA 1WWCA 5C3IA 4N0UB 3N43F 2YWYA 4IRSB 1KCRH 3CC5B 3O9WB 4M4PA 4GO8A 4OLZH 3PL6B 3ZKMD 1MSPA 4XVSH 4HXAL 4YR6A 1JZIA 2AK4E 3B9DA 2Z31D 1VB9A 3JV0A 2YQ2A 4HJ0C 4BJLA 1DZ0A 2DEYX 3WGUB 3EZ8A 2ESVE 5HVWA 3UAJA 4HCRL 5I28A 3AUWB 1KMGA 2ZOOA 1V7NL 3O6LH 4FI8A 3FQNA 3CDYA 5TFSH 2I07B 4K71C 2X6MA 4QLWA 1EAPB 1UCBL 2MH4A 1CD1A 1RHHB 5C07E 1CDUA 4A66A 2R56H 2XWDA 4FKKA 5GZND 5C0AE 3UYRH 3VWKC 5JXAH 4P9ML 5T1DL 1NUFA 2ZAIA 1AFVH 4FKEA 4APQC 5EBLB 4I8DA 1S9WA 3FUDA 2GEEA 4NKDB 5J13B 4A7GA 3TC9A 3PFQA 3RPKA 4FXTA 1AIZA 2ED6A 5HGGS 4WJ5A 2JB6B 2O6CA 4NRYA 2VR5A 4PJCB 3MGTA 3WOVA 5IW1A 2H1XA 3ATAA 4OLWL 1G84A 4NM8H 2F5BL 3L9RA 3NEEA 5EU3A 5CCGE 2Q5BA 4UNUA 4L4TD 4NGHL 2WYIA 3EYFB 3OX8B 5E2WH 2RAMA 4C58B 4X5LA 3S8FB 5DT1L 5TFSL 1RIHH 3Q1EA 4JPVL 3W57A 2F7IA 3TWCH 5HGBB 3MZTA 4WIQA 3WTXA 3KXFB 3BWAB 4AM0Q 4XPAL 3ZTJG 3MRJB 2BNQD 3DO7A 3MTXA 1OY3B 3MUGA 3PQYE 4U6VH 2OYLA 1DJZA 1MHPL 5F0JB 2B1AL 1HH6B 4HQQL 4BZ2H 4UF7C 3KVQA 3PYCA 1ZANL 4UT9A 5DMKA 1Q0XL 5KVEH 2VR3A 1C7TA 1CICC 1A3RH 1TNMA 3CVHA 4JL1A 3X1FA 4KROC 2FX9L 1JWSA 4JAMA 4LCYA 4CADB 5DUBA 2BSTA 2ZXEB 3P73A 3PV6A 3GTVA 2OCJA 5D7SL 1NEUA 1OHQA 2EO1A 1KCVL 1R6VA 1SEQH 2H45A 3SDAC 4OZFG 4OLWH 3EBHA 5D7HA 1Z3RA 4QTHB 5DJ2B 4AKPA 1U30A 2CM6A 4HV8A 1AGEA 4AIOA 4WWID 2YAFA 4AYFB 3EYSH 1X5FA 1IEAA 1R3LA 2XV2A 3IF1B 4O5LH 5E9AA 5HHVL 4LSTH 1J88A 2EUZA 3K6SA 2OX5B 2BCKB 2PCFA 1W6LA 1FNSH 4LCWE 3EDKA 1EFXA 4PRBA 4TLSA 4YDNA 1NGZA 2NNFA 4ZFOA 3MO1A 3HBZA 1Z9MA 2J6WA 4JDVA 2RHEA 3MRPB 2X1XR 1UJ3B 4LLMB 2QZ5A 2GHWB 2R56L 3C6LC 5ANME 4R96B 1AS6A 1U8NB 1HAWA 4JX0A 3BAKA 5DJ2A 1WUZA 1T83A 1KCUL 2AW2A 3FT3B 4AYFA 1R9FA 2VSCA 4TSCL 2WBJD 5LGKA 2J4WH 2WNKA 4QHLB 3LQZB 4WV1B 1RV6X 2X1QA 3EADA 5EZLB 4HD9A 3OPZH 4PBDA 2AI0H 4QLRA 4X99A 4Z7UE 43C9B 4M4RB 4H8VA 1HHJA 4X9YA 3DMMA 3RDTA 5B4MC 4OW6A 1JRHI 2Q8AH 5GPRA 3RPBA 2C3VB 2KLRA 1Y6MR 2GPZA 5BVJA 1A6TB 3L95B 1E28B 2OL3H 3RPIB 5CD5D 3C2AL 3ZKQD 1ZWIA 4NQCE 3P4MB 3GT6A 2C7FA 2O6FA 3UBGA 5D70L 1RZ7H 4GXUM 2P43B 3RTQA 1LE9A 1W72H 5AVTB 3HG1D 5E08H 2ZT9C 4M02A 4W9IC 3BP5B 1BZQK 4AL8H 1NCCH 1FCCA 4R9HA 5KW9H 5DJ0A 5DJ8A 4R7XA 4PJ7E 5E5MA 4DQAA 1SDDA 1U8NA 4G7VL 3SKOB 1CF8L 3TWYA 4OQ1A 3U7AA 2KQMA 2GKIA 2X4PA 3WMQA 5GSVB 1UOLA 4FEMA 1ZMYA 4KRPC 5IMOA 3AS3A 3QUMH 1RU9H 2RACA 5LLIC 2NY4C 4XBPA 1ONQB 1T7YA 3DUSA 3PABB 3VFOB 5B1JC 3IGLA 2XY1A 3DV4B 4MB5A 1QSVA 3D7PA 3W0WA 3X14B 4YDKL 3V6OE 4YHIA 3M46A 3FHAA 2YEZB 5L4JA 1Z5LA 1IEAB 1R3LB 2VN6A 2AJXH 1TZ8A 4FERA 2ZCLH 3VMOA 3V0FA 3HG3A 4DCQB 4F7KA 5CJOH 4JRLA 5B21A 5C0AB 5FYLD 3MLZH 1J0IA 3S0PA 3LV3B 1XF3B 3AY4C 2YEQA 1JXGA 2WXOA 4JFOA 1HQRA 1UM6H 1YEDB 1YG9A 4UOJA 2X3CA 3BXNB 4HIXL 4KZEL 1A7RH 1OK8A 4X6FB 2YRBA 5D1XE 3L3HA 3V7MA 3IMBA 4U1GC 3ISWA 4KI5C 4U1HA 3STZA 1ET7A 5DURB 3O2DH 3FO2A 3ZGHA 5EU5B 1IGMH 2QPDB 5I1KL 2HX7A 4WCYL 4DCQA 1QBLL 3ZDXE 1EVTC 4HCGA 1URIA 4ACTA 4PJ7B 4EI0A 1L9SA 2GC7C 2KT6A 1NBVH 3CFDA 1QNZL 4NUJA 3D18B 3X13B 3FT4B 4KDTA 1XH1A 4FCHA 4EI5B 5ICYB 2WUBH 5HDRA 3WHXB 3V2AR 3X3FL 3LVEA 3JWDL 3QIBD 2GJPA 4XMKL 2BNRD 3FHQA 4YNYA 5GZNC 1TCRB 3QPQC 4LIQH 2FWSA 3P3RA 4LLVA 2XQBL 3CSYA 3ALWA 2HJKA 4LP5A 4C83B 1BV8A 3K8MA 3KCPB 5DFVD 5C0ND 3S3DB 3SQRA 4FAAB 3FB6B 3KWTA 2Y24A 4HJIA 3ZDYE 1ZE3C 3B2VL 2HLEB 3U0WH 2NMSA 3K74B 1BA9A 5H37A 5KSBB 1KTCA 3N40P 3KGUA 4ZYKA 3US9A 2WWKO 3F5WA 5T3ZD 1MJ7L 2ZKXA 5CIPB 3NDYE 2VJ0A 3AG4B 1GGBL 3SPCA 2XTSA 4JJ5B 2Y5QA 2HKFL 3LKQA 3QEUB 3RWFB 1IUZA 4X98B 4I0PA 3T2NL 3TF7C 4YIQB 2IVFC 4LAQH 3L2NA 3BPNB 4Q97A 1FO0H 5TE7H 3SGKC 2EDJA 4DGYH 2F15A 1BFVH 4FRWA 8FABB 4K23H 5KYYB 1NSNL 3D18A 3SHSA 2FGWH 3FTGB 4UT6A 2H0FA 1A47A 4OCXL 4B9JA 3B5TA 2NY2D 4F91B 1JXJA 2PWEA 1F18A 5MP6H 2NNXA 4EVNA 4NO2A 2EXWC 1KTDA 5D7SH 3DURA 1UJ3C 3P11L 4OD3L 3VH8A 4KKZA 2FJHA 3S96A 2X9ZA 4WHDA 5D6DC 1MAKA 1BFSA 4AL8L 3KLAB 5E2UH 4AQEB 2XTJC 1X5AA 5JUEL 1UWXH 1Q9KB 3IE4A 3VO0A 2UVEA 2ZKWA 5I2IA 3LRHA 1BVOA 4R4FH 1E6OH 5F88A 1PAZA 2FK9A 4F37K 1HC1A 2WXHA 2VDNL 5D2LA 4PW4A 3ROOB 1G9ML 2P48B 1QO3A 1SNRA 2VJXA 4QXTB 1IO4C 4H13C 2XFXA 2AEPL 4ONHB 1INDL 2RMNA 4N8PA 4RZCA 1QSEB 2CO7B 4ZTPH 4XCEB 3K71B 3US0A 1YMMD 3IDIA 3F01A 2VXQL 1CDBA 5IQ9B 5KYWB 3HW7A 3HNTL 1E6JH 2KZKA 4Y4KA 4PJDF 3ZTDC 1EBAA 1V5JA 1BF8A 2PR4H 2N1TE 3IT8D 4F33A 1BQHG 2ZG1A 1FNEB 1KGIA 1AKJD 1DDHB 3RGVC 3BKYH 2GTZB 3SPGA 1TJHH 1FVEA 2ATAA 2XN9D 4JREC 4WAFA 3S2AA 5H2BB 4NENA 2CRZA 3DVIA 4HBCH 4MJ5A 1DQIA 1CGVA 3EW3B 1C5BL 1Q90A 2DI7A 1IM9B 3VD4A 3TYFB 2F53E 3GEWB 5E6IA 3MNVB 1E9PA 2HVJB 1AD9A 4NRXB 4KOBA 4H2AA 3O4LE 3SGJC 2YD2A 3BT0A 2QGDA 4NAMA 2CBQA 2JWYA 3BP4B 4IHBA 5C0AD 4TNGA 3U1QA 1YQ2A 2FLBT 3FO1A 3FJTA 4U6YA 3T2NH 5IFAH 3RPIA 3ZYIA 3E8VA 3GMPA 2XN9B 4LQFH 2QPFA 3GJFB 1KENL 5GRJH 1FV1B 1MNUL 2YUWA 2CXGA 3OZ9H 3IDXH 3WEBA 1F00I 3RKDC 4GG6B 5D1XB 2VLRB 3G08A 1J5HA 2X9XA 3ZBMA 3P9LA 3PXJA 3WNLA 1KN2H 3GZKA 3ZQWA 1XVSA 3BN9D 3DX3A 2FCBA 2VXSH 4K8RH 4RWYL 2Z4QA 2QVFB 4G80B 4UCFA 3BAXA 3BDYL 5CILH 5JQHC 1SOXA 2DBLH 2P4AB 4JPWH 4X6DF 1MFEH 3FB6A 3Q2WA 4JHBA 5HHOA 3BN3B 1VENA 3F83A 2JXMA 2OMVA 4J12A 4LFHG 4MXQD 1PZAA 1CI5A 1U8QA 1OO2A 5FHBH 1TQVA 5GGTA 2D31A 3HMXA 4WW2F 3BFQG 5HGAB 1WITA 1LEIA 1SXAA 4I4WA 1T1XB 1Z9PA 3K72A 1LD9A 4J7RA 4LVNB 4MXVF 2A9ML 4ODVL 1GOFA 4NN7C 1Z66A 3MRQB 4OI9A 5BNXD 3PQYB 3EYQC 1MN4A 5E6SB 5CD5C 1LNUA 4OFKA 4Q89A 1IGML 4IRSD 3F85A 3I6KA 1BD2D 1S9YB 1QASA 5MEQA 5HDQL 3CNKA 1DQDH 3LB6C 3NAAH 5T1MB 5J9PA 4HC1L 4JFQA 2VIRB 4K8RL 4GW4B 2X4TB 3ARQA 3ROLA 5DHYA 2Q2LA 3L5WA 5FKPB 2R1XB 5DZJA 2H26A 3HJEA 4NQXA 2VXVH 4GW1B 1QR1B 2XN2A 4DKEH 2D2CC 4XMVA 3CPUA 4DP9X 3GC3A 3I9AA 2VDQL 1KB5A 5EFIB 3V5KA 3DJ9A 4G5AA 3GSXB 2D0HA 4MKMA 5FYLH 2X70A 2VYRE 4OB5L 4BSVA 2ZOTA 1S7SB 3ETTA 4ZFZA 4G42A 2IGLA 3D39A