2L7QA

Solution nmr structure of conjugate transposon protein bvu_1572(27-141) from bacteroides vulgatus, northeast structural genomics consortium target bvr155
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MNELDIQQEYPFTVESMPVADEIAGDETVEIRLEIKPSGNFIGTVYTLRYFQPDGKGSLKMEDGTVLKPNDRYLLNEWKFRLYYTSQSDKEAQTIDLYFEDNWGNLQQLTYDFNGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein found in conjugate transposon
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides vulgatus
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7qA01
2L3BA 4LBAA 2L7QA
chains in the Genus database with same CATH superfamily
4WGWB 5CLWA 2DB8A 3EOAB 1F4WH 1F3DH 4K4KA 4NM4H 4LESA 1N5AB 3ARED 4U3HA 4D0DB 2FAUA 3EOAA 4ZXBD 2VTFA 3FJTA 4PIRF 3SCMD 1NIAA 2OSXA 1FYTE 1N5AA 1ZT1B 3FB6B 5MERB 3ARSA 1B90A 3OBAA 3UFIA 1K9TA 3A6CL 4NAMA 1J10A 1KCSH 4D0BB 1B2WH 3FB6A 5TQ2H 5MERA 5JTWA 5KBLA 2QL1A 1JF6A 4KQ3L 4TLSA 3Q8BA 2BPBA 4D0BA 4UINH 1RIHL 5C97A 4NJAL 1NA8A 4G59C 5L0QC 5L88L 2CM6A 3RP1A 2F19H 1H8OA 1J0ZA 4I8DA 4M02A 5F70A 5HJDA 2FO4B 1R5IB 2MMXA 3I50H 5JOFB 2G9KA 3S5LG 1ICTA 4XNAA 2D0HA 1WDAA 1W15A 5IB1B 2DWDA 3FL7A 2EH7H 3FXIC 3HZVB 2FO4A 1R5IA 4RBPH 4ZYKB 5TGBB 5JOFA 4QRPE 3WCYA 2BNRD 1XB6A 3FTGB 1LEIB 3F04A 3LJ3A 2WN3A 4FNLH 4IBZA 3V52H 4OFYA 5TGBA 4ZYKA 3FH5A 3FTGA 2V0AA 1LM8V 1ZEAL 2MWCA 3OJVC 3ZLQC 1F13A 2F7PA 3TZVC 1LEIA 1QEXA 5LKNA 2WLJA 3LPOA 4MCYB 1ZTXH 4B9ZA 1FZOB 3DX9B 1AZCA 3TNMB 5GS0C 3ZE0E 1BFTA 1FZOA 5I74C 3TNMA 3IE9A 5K9QI 3EG9B 1KGXA 3V10A 1PG7H 4K7PL 4H40A 4K9JA 2Q5BA 3GI9H 4Y0GA 3STBA 4FI7A 3BJ91 4N0UB 1RUKH 2V6HA 3MRQB 3I74A 3NJLA 5DWPA 5A7EA 3WUWB 3PWLA 1MFEL 3ARBC 4KZDH 4KK8D 1MEXH 4KTGA 1ASQA 3LTVA 1JGUH 4N0UA 3DV4B 3MRQA 1YJDC 25C8L 4TNVK 3SBWC 3WUWA 2WXLA 3X1FA 4F57H 1QZ1A 3MJ7B 3DV4A 4WJ5B 4MMZA 1QR1B 1TTCA 3DIVA 3MJ9H 3ZMEA 2PR4L 3FUJA 3MJ7A 2C3VB 4WJ5A 1QR1A 3VFPB 4Y88A 2GCYB 5EO0B 2BSTB 2C3VA 1XFPA 3MLTB 2YEZB 1DZ0A 3VFPA 4LGRB 4BHUA 2GCYA 5EO0A 1S7TB 2BSTA 3PWPB 5FV1L 3T1FB 1BPLB 3ZE2F 5CCGE 2YEZA 1EFXD 3Q2CA 1LXMA 1QRKA 4PJ9D 3IDIB 4FJZA 2DYSB 1BECA 2H3NB 3NJMA 1AR1C 1A14H 3PWPA 4YDLC 2CMRL 3T1FA 5B38B 5HHOB 4IRJB 5EUKB 4F7MB 1OHZA 3IDIA 5ISZD 2BJML 2OJZH 1O7SA 5B38A 3MCKB 1U8QB 2DYRB 4IRJA 1EBPA 5EUKA 4F7MA 3PXHA 2VSDA 3RX9A 5C0NC 1DANT 1XH1A 3TIEB 4P5TD 1U8QA 4W9JC 1RLWA 2MTAA 5IROD 1E8XA 3HI1B 4YSOA 3TIEA 3OKOB 2CJ3A 3QG6A 2BSCA 1EO8H 1DSYA 4HJJL 4PSPA 5IT2H 4WW2F 3HI1A 4JEGB 1P7BA 2J8UE 2GABA 2VO5A 4K5NA 5IBLC 4PAZA 3K80A 1QMUA 1WZ1L 3MLYL 3SKMB 4OLXL 2X4SB 5FK9B 3OB0H 4X4YA 1QHQA 4F9LA 3S5ZA 4PRAB 1AS8A 3SKMA 4ATWA 2X4SA 1ITBB 1HXMB 5FK9A 4LHJB 1CE6B 3NCEB 3R8QA 3D3VB 4PGJA 5ITFA 4IGBD 1HXMA 1YZZA 5F0LB 4CBPA 2Y69B 1CE6A 2TRHA 1Z2KA 3LRKA 4PGBB 1KJMB 1W6WA 4AVIA 5IBUG 2WBWB 3HRZB 3LQMA 3QIUB 4YDJB 1URZA 4PGBA 4M4PA 2KPWA 1KJMA 2CCVA 2Z7UA 3SOBL 4EI5B 4H8VA 3HRZA 4YDJA 2L4OA 4JQIL 4PW9A 4HSAC 4H8WH 4NNPL 4EI5A 1OB1B 5BZWB 5E5RB 1OP3H 1A6TB 5GRUH 3C9NB 1DLHB 5ESAB 4I0PC 4EBQL 1HFUA 1OB1A 1DQTA 4PJEB 5BZWA 4U3SB 1A6TA 4QTHA 3C9NA 1DLHA 5ESAA 3M8OL 4PJEA 2WXOA 5D2NC 4U3SA 4YWGL 5BS0E 5T3ZH 5C2BH 2Z7ZA 3IMUA 4B7LA 3CMOH 2ZOKA 4XOEA 1FH2A 1RFDL 4H0IA 1G6RH 7PCYA 1PNCA 3IVKB 5DUML 3J27A 3MNVB 2QGEA 1IAMA 1P69B 1Y6MR 4ZOBA 2ZF8A 1NCWH 4RQQB 3IVKA 4LHUD 2XU9A 3SEPA 3MNVA 5DLMH 3FQUB 3QRGH 1F58L 5LHDA 4XC1L 2XXCB 4P3CH 5JHLA 1V3MA 2X3AA 1UM6H 2WUBH 3D85D 3K72B 4RQQA 4WEEA 3FQUA 5F8QC 5AVRB 4XP6L 1F4XH 1KWKA 3WEXB 4K15A 1A4JB 3MC0A 3K72A 4W9HC 1MELA 4X8GA 4GO6B 5JXAL 3K46A 3WEXA 1A4JA 3SD2A 1FAIH 3BSZH 3KDPB 4EN3B 1TTAA 4Q8BA 1CGSL 4DOHE 3CU1A 2QSVA 3H54A 1K6QH 3K81A 5CLXA 3W3BA 1W72B 2A77L 1IKOP 3VTTA 2W95A 1UWEL 1DTUA 2VGLM 3HS8A 3RQ3A 1W72A 3DNKA 1NCTA 5F7KC 2OMVB 2ZD0A 4NCDA 1I4FB 3KVDD 1CBJA 1U95B 3DXAD 5I1DB 5CD3B 2OMVA 3N2JA 4HPOH 4JB9H 2Z9TA 1I4FA 1U95A 1I8AA 1U21A 5I1DA 1FBIH 1G9NL 4YLBA 3H9SE 5CD3A 1JZJA 1BLIA 4HLZH 1AQKL 3O2VH 5IJDC 4ZMVA 2ZXWB 4QY8B 4XH2B 2JQMA 4PUBL 4Q2ZB 5D6CA 1C5BL 5KVEL 2FRGP 3DBSA 3T3MF 4QY8A 2YPVA 1P84J 1PJ9A 2LQRA 4XH2A 3S7GA 4Q2ZA 3MI6A 1WPCA 1TZHB 3MRKB 4G5AA 5GZNC 1Z66A 1I3UA 3GBNH 4K7PX 4LBEB 1O7VA 5CR1A 1QBLH 1T66D 2XWXA 4LVHC 3C5XA 3X1GA 1OHQA 1I9IH 1TZHA 3MRKA 2JFCA 3V4PB 4CGTA 3WIIH 4ORZC 4LBEA 4KXZH 1T6WA 2WC7A 3W56A 5DR5H 1J5CA 4XMPL 4A63A 2CHNA 5FC9A 5IFAL 1X5KA 5E4EC 1NCGA 3Q1EA 1QKZL 2MRYA 4JJOA 2IWEA 3CMGA 3V5HB 4NFCA 1YEFL 4PRBB 5EEXA 2WP3O 5IHBA 3VDCA 3WOVA 3MFFB 5D7SH 3BZ4B 2CBMA 1A0QL 2NY0D 4PRBA 4QHLB 4LVNC 5EHFA 3MFFA 2F5AH 1F2QA 3BZ4A 4N5EC 5A16B 1LP9F 3NN8B 4QHLA 1HJCA 1Q9LB 1YEIL 3FULA 1X9LA 5A16A 4G8GB 3NN8A 4X7TA 5CEZD 2DIAA 2Y25A 3BQVA 4TOYL 1Q9LA 2VQUA 3GTVA 4NC1E 4O2FB 1M7UA 4G8GA 2VDPB 1CDJA 3UAAA 1C12B 4X5QA 2IV8A 2XX0A 3FS9A 5JXEA 4FTVE 1WA0X 1IKFL 4GRWF 1ZLSL 4MJ6B 3O81A 3B9DA 4O2FA 4G7SB 1C12A 1BJ8A 4FYTA 3S2CA 5I6KA 4MJ6A 2E8ZA 2VR5A 1ULVA 2AV1B 4F7TB 2EYTB 5IUCA 2DQJH 5DWUH 2KH2B 3KYNB 3FU8A 1T1WB 3NA9H 1OW0A 2D7TH 4KO7A 4NX0A 4PLJC 4X0NA 4F7TA 1QQDA 2AV1A 3DK0A 3M17B 2EYTA 1UD6A 1KJ2A 4OLWL 3RFRA 4UQBA 4NZUL 1T1WA 1XF1A 3JQOB 3L1OH 4KQ4H 2BP3A 3M17A 2VDNL 1IBGL 3F3HA 2R1YB 2CGRH 2YN3A 4IKJA 3VU2A 4LZKA 4UTAA 5L4MA 3D07A 4TVPE 4NBYB 5I19H 2R1YA 4XNQB 3VRJB 4RRPA 3V0JA 4GMSL 1J18A 1A7PH 2ZKWA 1DLFL 2XV6B 3NESA 4ILDA 4XNQA 3VRJA 2WMPB 2R59A 4FG6C 4NZTH 4KPHH 2W9DL 2ARJQ 4YPJA 2FWUA 4UQ9A 5F71A 2FJSA 2WMPA 3JT0A 5F1NB 2VXVL 3EYQD 2OZ4A 1GY2A 3MVSA 4UCFA 5BO1H 3WUZA 3CX2A 4ZS6C 5AZEL 4C47A 4Y9GA 4FABH 5F1NA 4P4KD 2BX5A 1RXLA 4HS6B 3L3HA 3NFNB 1ES0B 5LN8A 4KH9A 1JYNA 1UA7A 3B7YA 3L6FB 2HAZA 3I3BA 4KHTH 3ULVH 3QPXL 2W9EH 4HS6A 3EO9H 2ZCZA 3NFNA 1ES0A 3WFZA 1VFUA 2VN7A 4LDEB 3K6OA 1ASOA 5HGDB 5DUPL 3UGXA 3EAKA 2YD1A 2GHZA 4L4VE 1C08B 5HGDA 4KKCD 2O5ZL 3WS3B 2QVFB 4Y16C 5D93C 5DK2B 4ZMOA 4FLSA 4FQHB 3D4GA 1KBGL 4XCFL 1C08A 1TETL 4DQOL 1T1XB 3M1CA 4JM4H 3WS3A 2H1LM 5DK2A 1QRNB 4FQHA 4U6XB 1KN4L 2YAEA 1T1XA 4MAYC 1NTDA 4LOFA 1Z9LA 1QFOA 2F58H 2VLRD 1QRNA 3DO4A 5AYUH 1I9JH 2E46A 3PV6A 4U6XA 4Y4FD 2HUHA 2BZCA 4E9YA 1ZS8B 1CC3A 3RVWC 5ANME 3HC3H 4N2AA 5T5FA 3RUGF 3KBPA 4X6BB 3ZE2B 3FPYA 4P9ML 3B7UX 1ZS8A 4IU2B 3GFUA 4X6BA 2XIIA 5FYKD 2DQHL 2G30A 3KS0H 3L48A 4FQLH 4IU2A 4UIKL 3RZWA 2CE6A 2R8SH 5KTEH 3KYMB 4PI2A 1QNZH 4XPFH 5AG9A 4JO5A 1CGVA 5JHMA 1TZIB 2YBGA 3KYMA 1IC4H 4RMSA 3ARGC 1AYOA 1XH0A 5DUBB 4P04A 5GIRB 4I3RL 3IU3B 3QJTB 5DUBA 1VFMA 5GGVH 1AD0B 4M1DL 4WW2B 1NGWB 5GIRA 1IGJB 1RQ5A 1SLWA 4HKJB 3WTXA 3IU3A 1C5CL 3EJYC 3HFMH 1AD0A 3W57A 1NGWA 4PWGA 5GZOC 5KJRL 1IGJA 4HKJA 4N2MA 1W0VB 4ZW6A 2H6UA 4IOFD 3L17A 2ZUQB 1W0VA 1KCUL 2WBXA 1E4KA 2Y1AA 5F0JB 3L9RB 1IBDA 2NNAB 4BFRA 5A2LH 2HT4D 3WO4B 1AS6A 4PD4K 4J39A 3JT2A 4GXVH 4EMZA 1OP5H 3L9RA 2NNAA 4BQ8A 4YHLL 1OALA 4DW2L 4WO4C 5DO2D 4M7ZC 1UYWL 4UQ3B 1JPTL 2CJSA 2Z31C 4MA8L 4OQTL 4TTDD 5EN3A 1R0AL 4WFHD 3HLKA 3U6XS 4MCZA 3VGHA 3FT2B 4B41A 4JFXB 1JD9A 5E2UH 3EJJX 1WCQA 1ZCRA 4J8RB 4JE4B 3WJJC 4KAQL 5D70H 3FT2A 3HG1B 4JFXA 4N87A 5IJKA 5GSVB 5LNGA 5SV4A 2YZ1A 4J8RA 4Y4HC 3WFCL 1BD2E 4L5FL 4JHUA 2HKAA 5GSVA 3S37H 1NIDA 2EIZA 3GF8A 4A6YL 1A2YB 2H6OA 4K8RD 1UH3A 3FT4B 4HJUA 2KQMA 5AAPA 3MTXA 1A2YA 1H3VA 4YO0B 3UTSB 3IAQA 3FT4A 2Y5TB 1OAKH 2QR0B 4HGMA 1FNEB 1T2QL 5CIPB 3RTQB 4YO0A 3UTSA 5CILH 1A6VH 2EDDA 3TCLB 3TN0C 5I8OL 1MREH 2Y5TA 3ZHNA 2QR0A 1FNEA 5CIPA 4P46B 1P84K 2P1YA 3RTQA 1RVFH 3TCLA 1TPXC 4IOSA 4CBZA 4P46A 3NP4A 4MVBD 1TTUA 5KYUB 5IY5B 2IDUA 1JNHB 1Y07A 1DJZA 1RHFA 2CGYA 1JNHA 4A2EA 1EZSA 2XRAH 3FUEA 1GW0A 3N40P 2BW5A 2H2PD 3DJTA 4HWUA 5GJTL 4LSVH 2Z93B 2FB4H 4Y1TA 2Z93A 4YVNA 3WS6A 5IOPA 2OLDA 4O58H 3RLSA 1NKOA 4PWHA 5AVUB 4AEIH 1BLNA 3KL3A 2FD6L 5HI3C 2J8OA 3UZEA 2PP9A 5B4MD 1XTLA 3BPNC 3KE0A 4KU1A 4O02H 1BVLB 5DEGB 1JNJA 3FQYA 4G1EB 4DGYH 1PFOA 3SY0B 2GHWB 4JPQA 3WXWH 2VB5A 5BO0D 4F5CE 1TO4A 4NGHH 1BVLA 5DEGA 3SY0A 2NY3B 1MJ8L 3GRBA 3RWIB 4R84A 3FHEA 4WI4A 1ZLUK 1UM4H 4KI5E 5TF0A 3WL9B 5ABDE 5C6WH 3BPOC 2F53D 4OM1H 5TFSH 2OTWB 3N41F 2VABB 3WL9A 1GZQB 4QHUB 1NWOA 5H4ZA 4IKNA 2AZUA 1SHSA 5IHHA 2VDLB 1HQ4B 3T3MB 2OTWA 4ZAKC 4PW3A 4KDWA 1GZQA 1NIBA 3FHQA 4QHUA 4DFIA 1SGKA 1J5DA 4I77H 5FKAA 5HY9B 3FBKA 1HQ4A 3BCFA 4CVXB 1YYML 1AXTL 2B0SH 2QDVA 3NJXA 3RRQA 4IK6A 1Z0MA 5HI5D 1S5IH 3RL1B 1X9QA 5B39G 5HY9A 1IGMH 2BK8A 4J3XA 3ZDXE 2R51A 2AJVL 3GJFH 2Q8AH 3RL1A 1F8TL 1CIUA 4MZIA 3ZL1A 1D9KB 4WK0B 5SWSD 4K3DL 2JLLA 1W0WB 4PLKC 3NRFA 1WFUA 1ZPUA 1D9KA 3DVGB 5GHWH 5A2BA 4DO4A 2VDKH 2Z35B 3QCUL 1W0WA 2Y2WA 3GXIA 5HYJE 3DVGA 3CFJB 3WY1A 2JB5L 35C8H 3CC1A 4CKQA 2CZNA 1CLVA 2MKLC 2Z35A 5FYLE 3UIYA 2D2CC 3CFJA 1A6WL 1X4XA 2EDWA 4F9PC 3CN0A 5BVPH 1LP9B 4CSTA 4PEEA 3WTYA 4TLUA 5I8KL 1LP9A 5LDSA 1TO5A 2CO2A 1MWAB 4QNPE 2N1TE 4RISL 1YMMB 5CJQH 5EOQL 1QSZA 1UKTA 4BFKA 3NJIA 3FTYA 4IHBA 4DTGL 1MWAA 3N9GL 4N2NA 1WZLA 1YMMA 3FNKA 1JFQH 5F7MC 5EF1A 4GRWB 5I1EL 2FHFA 1KCWA 1HWGB 1I7UB 1W0YT 3FUIA 4N4YB 5HHMD 1H3UA 3W5NA 4F80A 1EGJA 4XNZC 4A2GA 2DQDH 4GUPB 1ROWA 3OMAB 1I7UA 1H8LA 4FNPA 1EDHA 3L54A 1J9SA 2R29H 3PL6C 4GUPA 4JHZA 1EEYB 4CU8A 3KH4A 4HWBA 5DURD 4M7KL 1ETJA 3VE0B 5CUSH 12E8H 2QSQA 3QHFL 1EEYA 1H19A 4JGJA 5D7HA 3VE0A 5E6UB 5DD5L 1HIMH 4N9GB 3CZJA 4YC2C 3A6BL 3C08L 4YN3A 3V95A 2J88L 2E59A 4N9GA 2B1HL 3HB3B 1Y1UA 2DQGL 3ZX1A 1TDQA 2Y1ZA 4GT7A 1IE5A 2YUVA 3FCTB 1ZHLB 5D2LE 2BVQB 3CIQA 1KG0B 3B9KC 4LCUA 4CSZA 2DKUA 1RK1B 2Y36H 4KJPC 5GISL 5FWQA 3FCTA 1ZHLA 2H0JA 1AFVL 1AKJB 2BVQA 4MZ3A 5FHAH 3BKML 3RILA 2N7BA 4QRFA 3HZMB 4F8QA 2WIIB 3P0YL 1AKJA 3FCBA 3HZMA 2WIIA 3V6ZB 3L95B 4HF5L 2HKHL 5DHVH 4FD0A 3HNVH 3QUYB 3CZEA 5HDOA 2YLHA 3L95A 1TEFA 4J3OF 3BQUC 2E7HA 1ZT7B 1MCQA 3QUYA 3ZDWA 1XT5A 2GC4C 4R2GC 4DP2X 5DQDL 2HMIC 4FXGC 2D9CA 3ZL4H 1ZT7A 4H2CA 5GS0D 3BDYL 4LL1A 4DZ8B 4CN1A 2EE2A 2ODHA 4FNUA 3O4OC 3O41B 3QQDB 4BELD 5JOPD 3QCVL 3V55A 3QUMB 2QMJA 1MF2L 4DZ8A 1PD0A 2BNQB 5GGSB 4A7TA 3UTTE 4QTIH 4X9YA 3O41A 3QQDA 1ACXA 4GSXA 4H44C 4XMLH 2I69A 3QUMA 2IEPA 5D4IA 2BNQA 5GGSA 1IGYB 4ZMTA 4BDVB 3GZPA 4MQXC 3RUGB 5E6IB 4AKQA 1OB0A 3TYFB 1NC2B 1R3IH 4XNYL 2J25A 1MI5D 1IGYA 5GGRY 1IX2A 4I5BB 4BDVA 3RUGA 2VRKA 5E6IA 1BWMA 3CUPB 3TYGH 3AB0C 1XSOA 3PY9A 3TYFA 3DGGB 1NC2A 4FXTA 3ZE1E 4OZHF 2A4EA 3LHAA 2OL3L 4I5BA 4N25A 1DVFC 3CUPA 3JTBA 4XN8A 1NCOA 1RPQA 3ME0B 3DGGA 3BMVA 4YDMA 4I13B 1L7TH 4NENB 3Q9PA 4JO1H 3ME0A 4LEXL 1OGTB 3UBHA 1WEJH 3KGSA 4NENA 3T2NL 2ENJA 4HUXB 2CIKB 1BQLH 1OGTA 3FTUA 3DOSA 4FQ1H 5EU3B 4OB5L 4NQEB 4OD3H 3DA0A 2VKXA 4HUXA 5SWZE 2CIKA 2KDYA 2Y6TE 3JYBA 4YE4L 1E9OB 5EU3A 2J56A 1UENA 3RVXC 5JW5B 1NUNB 4PJCF 2FX9L 2DWSA 2VN5A 3HLAA 4W4NA 1E9OA 3ZO0A 3VNYA 1S7VB 5JW5A 4JN2B 4LGSB 1FVEB 4DEWA 2VR9A 4GQRA 3EF7A 1V7NH 1S7VA 4M6ML 4JN2A 4P2QD 4Q0XL 1FVEA 3S34H 4NCC1 4DT2A 3BAIA 5JIMA 2NY6C 1MW0A 5CJ5A 4HUMB 1EDYA 3E9TA 3CNKA 4TSCH 5EFIB 3U2IA 1RZKH 5CN2A 3ATDA 5EIIB 2FNBA 2GBTA 1R75A 3PREA 1J1PH 4WZ9A 5EFIA 4N8CL 2OM5A 5KVFH 2CKBH 3O2DA 3ZDZF 5EIIA 1YEKL 5ETUB 4IRSB 5GGSY 3BGFB 1TR7A 3V7AG 4A7UA 5KUMA 4R7LA 3F64A 2FUQA 4P2RE 5ETUA 3LMJL 1L9TA 4L9LB 4YOKA 1TCMA 4RNRB 4G2AA 1KGYE 1GYAA 3IWUA 4L9LA 2F2HA 4L1TA 4Y7MA 1VFBB 4RNRA 2AEPH 2ED8A 5C09D 4V1DB 1UZGA 3O6MH 5CZRA 4F58H 2UYLB 3MLUL 1VFBA 3PWUB 4ZXBB 4C4KT 1TNNA 1VGKB 5GJSH 3OKLB 1KIRB 3K2UH 4FZEL 3C75A 4V1DA 2DF3A 3OHMB 2UYLA 3PWUA 4O9HH 4ZXBA 1FFOB 2O6EA 4GO8A 4I0PD 1VGKA 1MY7A 3T65B 1LDPH 1KIRA 2VW7A 3OKLA 4PWJA 5CJOH 4FQJL 1FFOA 1X5AA 4ZW3A 3P3RA 3T65A 1OAUH 4KRPC 4AW4A 1IFGA 3U7YL 2I5YL 1LK3H 4KXDA 4XTRD 3NT0A 4KO6A 2R69H 4XAKE 2UZXB 5FGBA 3TVMD 3VXUE 2IOOA 2ZE0A 3COOA 1CL7H 4XPGL 3BYYA 4HZAA 4JUSA 3SO3C 4U1MB 2FECI 2YD4A 3VG9C 2C4FT 2PW2B 2ROYA 5I1JH 4FMVA 5EOCH 2GSIB 3NP3A 4LL9A 3B2VL 2WAHA 4U1MA 5HGBB 2PW2A 4NPJA 1KB5B 3G5VB 1SEQL 4PU2A 3NH7H 2GSIA 1TZ8A 3QK0A 1I7TB 1L6ZA 4GI9A 3Q2NA 2WTRB 5LGKA 3ASOB 2B5IB 5HGBA 1UOWA 4X9GA 4XP9L 3WLWD 1KB5A 3G5VA 5B8CC 4CMHB 1I7TA 5C0CE 3QZNA 2WTRA 4HFWB 2ITDB 3KPTA 3QEGH 3PFUA 1HKLL 4K3HA 4B53A 2OI9B 5SV3A 3WKPA 2X0UA 3NPSC 4HFWA 2ITDA 3UX9B 4DUWA 5FPIA 4KI5C 2MQGA 3QWNA 5DMIL 2IPTH 4YZFE 4HYTB 1DL7H 1O0VA 4YHOL 1PLGH 3ZK0A 3BRFA 4ZUTB 1Z9PA 3N41B 3SE9H 3T4AB 1MRDH 2EXYD 4OJDH 4CU7A 2QPUA 3F5WB 4KKLD 5HGGS 3U30C 4ZUTA 5ITBL 1QFHA 2ZOTA 3F01A 3T4AA 2NY1C 2DQFB 1RV6X 4HULB 2FWLB 4ABQA 1JZ3A 3F5WA 4H20H 4BH8A 4X7EC 4EPSA 1MW2A 4AVJA 4K3GA 2DQFA 3ZZ1A 4YEEA 3RIFF 2VLKE 4AZUA 2GQHA 3QJHB 4QOKE 3SE4A 1F45A 5JHDD 5KWYC 1SJMA 2XWZA 3SZ6A 3QJHA 3CFQA 1IAIH 3LZPA 1ECZA 2QV4A 5H37A 5IFHH 4RDBA 4AUUA 4UT9L 3INUH 1EFXB 3BPLC 4U7KA 4AQ8C 4PJ9B 3RNQB 3I6GB 3FFCE 1DJIA 3I3EA 2FECL 4PG9B 5I30L 4LEEA 1WS8A 4GKNB 5GZND 1QR4A 4PJ9A 3RNQA 5ISZB 2YRLA 3I6GA 3B9EA 1GGYA 3GTNA 4J7RA 4IJ3C 4GKNA 2BFVL 5I6PA 2VXSL 4X6DF 4ZPTB 2YPLD 3IETB 5ISZA 1L7IH 2MHAB 1F6AA 1S4IA 4NQQA 1WBYB 3WKML 4P5TB 2Y5EA 3CFCH 4ZPTA 4PJ5E 1U2HA 3DLQR 2MHAA 3RDTD 1ID2A 1MKFA 1Z6JT 4P5TA 2X12A 2FH6A 2WXIA 4I1PA 1AZBA 2XWBB 5A3ID 4F33B 2AQ3A 2PYED 3V0FA 3RPKA 2YXVA 4PWFA 1RP8A 2XJLA 3C6SB 1UVQB 4F33A 1KXVC 2EDHA 2G4EA 4GS7C 4WFGD 2VXTH 2X53A 1JPFB 1SMAA 1RD6A 3C6SA 1DDHB 4X7SH 2IFFH 1M57B 3AU1B 1DSFH 3BAJA 1SN5A 1JPFA 4N5ED 1QSED 4ETQB 4HALA 4LRNL 2VZVA 1DDHA 2AQRA 5DVMA 3AU1A 1KCRL 3OAYK 1A3RH 1JVLA 1OLLA 4ETQA 1ZD6A 4ZX3A 1DQML 1X6LA 3KBFA 5EH1A 1CGUA 3LQAH 1E4WH 1EMTL 3U4AA 2VISB 1U42A 3EFDH 1HCFX 1KENL 1BQUA 1RUPH 3QFJE 4S1SL 5C2UB 3NSXA 3D33A 1P6WA 5GS1C 2VISA 1UWXH 2QHLA 2YXFA 4CA4A 3VACA 5E99H 3L9BA 4UTBH 4PLJD 5DD1L 3X17A 1TJGL 3FU5A 4UZUA 3DJZA 1JZ5A 2VN3A 1SQ2N 4D3CH 3B43A 3QUZC 4BWUA 4NWUH 4TVPH 1MLBA 4HZLB 5H35B 2WKLA 3MJGX 2V2TB 3WJMB 5I0YA 4NXKA 3D05A 1CVRA 5CP3H 4D7BA 4ZZKA 3OPZL 1UWFA 3OF6A 5A2IH 3UJIH 4HZLA 5H35A 4QRPD 2V2TA 3UXFA 3WJMA 2NT1A 2H1XA 4XP1L 5E51A 2DBLL 4DO5A 1AAJA 1PG7W 3TO4B 5DFTA 5TPWH 4FMFA 4FG6D 4QRQB 4DERA 4J2QA 2X6CA 3TO4A 3RJQB 3QUXC 4JHAH 3DX1A 3O9WC 2O5YH 5DFVD 4E0RB 3IDGB 3D85B 3O3AA 4ZS6D 2D3NA 2NW2B 1EO7A 5KW9L 5EA0L 2VDMH 1G7QB 3IDGA 2EXWD 4AL8H 3D85A 1OARL 2HRLA 5DFWH 2NW2A 2H41A 5KAQG 2OCCB 1G7QA 2GTZB 7FABH 4JPVL 5GRZA 4LOUC 4YHPB 2MTPA 2R0ZL 2YGOA 2UVEA 1QFPA 1TTBA 2GTZA 1EK3A 3NOIA 3U4BL 1MFCH 3EHBC 4YHPA 5L4FA 4FFZH 4NI6A 2YRBA 4Y16D 4NUGH 4PJFE 1Z0NA 1OAXH 4OZHB 1YYLL 3MCG1 4GEJA 2YK1L 3V5DB 4ZUVA 1K5NB 3IMWA 3KPSD 3DXAB 4OZHA 2VNCA 4YFDB 3V5DA 4L2LA 2WJ5A 1K5NA 4MAZA 4KJWD 3DXAA 4NRXB 2XFXB 3MACL 1MFDH 2XBZA 3VWJC 4YVUA 5IMOB 4TVSa 3K7UA 4X4ZA 3RBSA 3RY4A 1BV8A 1ESOA 4X8XA 4JHVA 4NRXA 3RHWF 2XFXA 4ERSH 5FCUL 3HMWH 1ZVSB 2E8YA 4XVUC 1WS7A 3S35L 4CL7A 5DZAA 2B39A 2JCCF 4R97C 3UAJC 4RIRB 2DJSA 4AG4L 3BZEA 1ZVSA 2DM2A 4PJCB 3L3OB 3NIDF 4RIRA 1NCAH 4BWWA 3KPOB 4UT7L 2B2XL 3U7WL 5KANI 4M93B 4PJCA 3L3OA 1ZV5A 4Y89A 3ARGD 3WKYA 3KPOA 3GDCA 1WCBB 2IDSA 3C5SB 3FB8B 3N85H 3VSUA 3IJ7A 1OT1A 1Y0LB 1T0PB 2X9ZA 1QSFD 4YBHA 3NBNA 1WCBA 3C5SA 5TE6H 3CSYB 3EFOB 1OSEA 4BZ1H 4EDWH 1OF0A 4XN1A 1Q9OB 1NM4A 3HI6H 1HILB 3CSYA 3EFOA 5FV2A 2ZWZA 4BCYA 3FW6A 3IDNB 1NICA 3FSOA 2LOEA 3MLPA 1Q9OA 2FT8A 4LCWD 1BVKB 2VDOB 2C7FA 1HILA 3ZDZB 1FDLH 3IDNA 5AOIA 3GMPB 3QAZB 5D7EA 3QWRD 1BVKA 1TQVA 2IANB 3CN1A 2G0LA 3HVDA 4HS3B 2VMDA 3GMPA 3P0VH 3PGDB 2W1NA 5DC9B 3UTQB 2IANA 4JY6B 1IBFA 1QWHA 2Z8RA 2B1AH 4O4YH 3BYTA 4YK4B 1NL0L 3L9EA 4HS3A 5KVDH 2Z31D 3UTQA 2ILLA 4JY6A 4N2IA 1JTTA 1YEWA 2BIOA 4P23C 3S88H 4RX4A 1I8MB 2AGJH 2BVEA 1A7NH 2X38A 3MA7A 1DFXA 2G3XA 2WW8A 1TJIL 1I8MA 3MJWA 4M4RB 1NBVL 2X9YA 2XZAL 3FQRB 3GLEA 3HAEG 4WUUE 5JW4N 3MUGB 2BXZA 2FX8L 3GKWL 4M4RA 2DWXA 1R6VA 2WY3B 3BD3A 3FQRA 3OG6B 3RI5K 4BV1A 3GSQB 4UZGA 4GKLA 3FKUS 4XP5L 2VZSA 4G3YL 1DFBL 5JZ7D 3EXLA 3GSQA 4JREC 4FQQB 1WWAX 1A8ZA 4FQCH 1YEHH 5HHQA 3IBOA 4FQQA 3MNWB 3Q43A 3PWPE 3FTWA 4ZODA 5D7LB 2X42A 3ATFA 3MNWA 5ADPH 1WWBX 4PGCB 5HHOE 4X9FA 3UCQA 4KNSA 5D7LA 3RJOA 1FRGL 2D7OA 1SM3H 4PGCA 5IQMA 3D9AL 3L3JB 5LCVA 2H5UA 2M83A 3DARA 3OJ2C 4RMVA 1W8OA 4LLDB 2PTTB 3L3JA 5I26A 3VDAA 1AC6A 2AXHA 1YNLH 3M7OA 4LLDA 2PTTA 3OZLA 1UCTA 4QRRD 4CAGA 1ZV9A 1F4WL 4PV9B 2X1WL 5AL0A 4NM4L 2Y6SC 4AJYV 1UKQA 5H2BB 4E5XG 1SPDA 1WVZA 4JFZL 4PV9A 3W11C 3UBXG 2A74C 1RJZB 1JCVA 2JJTA 1WK0A 5H2BA 3LPFA 4RMTA 3ESOA 1KCSL 3ZU8A 3ATAA 1B2WL 2PW1B 5TQ2L 1RJZA 4BE5A 3D3VE 5JQHC 5LVEA 5GGTH 3HS0C 5LJYH 1ANUA 4UINL 2PW1A 1HEHC 2G2PA 2VLRB 2CWRA 2FZ3B 2F19L 2OQJB 3FO1B 4Z1PA 4Y4FB 4YSEA 4PLOB 3I50L 4YL4A 1UXSB 5CLZA 2NQ3A 4GG6F 4HOWA 3DOIA 2VLRA 2UZIH 1B4LA 2FZ3A 1ETZB 2OQJA 3FO1A 2EH7L 4Y4FA 1KDJA 4PS8A 3WHXA 1UXSA 3ECWA 2ZICA 1OVZA 1ETZA 4FNLL 4ZAKD 3V52L 3P4LA 4IOIB 3R0NA 3CVDA 2A73B 3DHJA 3VFSB 5BV7H 2WKGA 2X9WA 3HKFA 1KCVL 1VEOA 4IOIA 2A73A 3OLDA 1ZTXL 3VFSA 5AVVB 1OTUC 4X6DB 3WDIA 4KOCA 2LABA 1BQ5A 1OLZA 4C56D 1XF4B 1U9KA 3FYIB 4X6DA 1X5ZA 3CPUA 1XF4A 3S3PA 1NGYB 1XCTB 1IIIA 2X3CA 1GGIH 2N4IA 1PG7L 1YUHB 3V0EA 3Q6FB 5D72H 3GI9L 2JV6A 3G5XB 4KTEH 3LEYH 4QRSB 1FFNB 3BEWB 1NGYA 2D7PA 1RUKL 1IZJA 1YUHA 2HT2C 3Q6FA 1HINH 1RUAH 4KZDL 3G5XA 4LKCB 4QRSA 2Q8BH 4ZTPH 1FFNA 3BEWA 3WG7B 1JGUL 3ZKMC 2EIBA 3FF7A 5DQJB 4PRPD 4ELMF 4KJQC 1I85A 3CVHL 1Q1JH 4LKCA 1PJWA 4AZ8B 4HQQL 2CBQA 4AX3A 2NY2C 3K71A 5DQJA 4LCCC 5MEOB 3HOGA 3A6OA 2CO1A 3MJ9L 3S35X 4AZ8A 1ZVNA 3VH8G 4GEIA 4PJXF 1CXEA 3QQNA 4GOSA 5F7NC 4M48L 3ZTCC 1MCWW 5MEOA 2BSSB 2P26A 3K74B 4JRYD 4ABWA 4FL4C 3V0HA 6TAAA 2Z1PA 4XCEB 3QZMA 3X13B 1BXXA 1JK8B 5KS9F 5FX3A 2FBJH 5FYJH 2O5XH 1T2JA 1V55B 1WFOA 2RA1A 2AFNA 4XCEA 4YHKH 5IB5B 4OLEA 1JK8A 5IMKB 3P69A 1A14L 4TXVB 1A6PA 3GSRB 3FQWB 5IB5A 5JPMC 4NC0B 5EZLB 4Q9RH 2OJZL 5IMKA 4AVKA 3PL6D 1WAAF 3LH8A 1OAQH 4JFFD 3GSRA 1HVXA 3BESR 3FQWA 5L8LB 3V7AE 4BKSC 4NLAA 1CR9H 2X1XR 4A7GF 2UUDK 2PLTA 5GS2D 1SOQA 3SJVD 3PDGA 3DRTB 4TF4A 2WXGA 4JPKH 4MBRA 1EO8L 3DRTA 2P4AB 3D12B 4JZOB 5HYSG 1T21B 4QIRA 1WP6A 5DVPA 4JZOA 2NY4B 4XNUL 3SBQA 3OHXB 3MJ8A 1T21A 4GXUN 1D5IH 4HV8B 3MU3A 3OHXA 2WYTA 3H9HB 2NDFA 3IAGC 2E86A 2WWMC 2ZXCA 1AVAA 1H3XA 2ZYSA 2P43B 3N1QC 1TQBC 4K0OA 2PPAA 4GSRA 3O0RH 3WYRA 2VN6A 3MA9H 4R6UA 3QORC 3E38A 3SDDB 1EA9C 3VWKC 1UJTA 1Z7JA 3BUTA 2WM0A 3SDDA 4OI7A 1LO4H 2LTQB 4Q6IC 4H8WL 2AAVA 1HE7A 3NACH 4R2GD 5GRUL 2HMID 4UV7H 3VD5A 3QYNA 1E42A 1NH6A 3TBYB 1UWGH 3ABMB 4IBQA 1P4IH 2FJGA 2W38A 3HNSL 4MDIB 2J57A 2XZCH 4ADIA 4EIBA 3TBYA 1I82A 4G8GE 4LCIH 3QJXA 2NQDA 5IBTH 4NZRL 5AW9B 4MDIA 4YXHH 2IQ9H 3DHMA 4LLYB 1AYRA 5T3ZL 5EZIH 5E6ZA 5C2BL 3GBDA 1YNKH 3CMOL 4MQXD 5E5UB 4L2YA 4TMPA 4LLYA 1G6RL 3GKZA 4PV8B 4OZFB 2A38A 1W80A 2BH0A 3RJDA 2JCCB 3ECQA 4JRXE 1TFPA 4Y19E 4PV8A 2APVA 2KZWA 4OZFA 4OLUH 1NCWL 2EADA 4JRLA 5LGHH 1I1RA 2JCCA 2XTLA 1NCIA 3NIDB 5DLML 5I23A 1SMDA 3QDJB 3QRGL 4QHNB 1YEJH 2AS5M 3BD4A 1UM6L 2WUBL 3SQOH 4YH6A 1KZYA 5EG6C 3QDJA 4QHNA 4FZ8H 1F4XL 1PKQB 1E30A 3PHQB 2H0EA 1TJHL 4H2AA 4UQCA 4IW4C 5CBEB 3MKKA 2J8HA 1PKQA 4KFZC 2VXQA 1D5ZB 1FAIL 4DEPB 1J8HB 5FYKU 1XGTB 4AI7A 2Q3XA 2AJ3B 1D5ZA 3IJYB 3RVXD 1J8HA 1K6QL 3BZFB 1XGTA 2BIPA 5E9DA 5I82A 2AJ3A 3DMMD 3BZFA 3OAZK 3VB8A 1VADB 1XGZA 3BN9D 2J1XA 2CKNA 4GBXB 3AFLA 3VD2A 2Y3NA 5EB9A 1B3JA 1VADA 2IH1B 3CK0H 4HPOL 4JB9L 1UD5A 4CGUB 3QNZB 1VSCA 4QJ4B 1EX0A 1C9SA 4GBXA 1FBIL 2KPNA 1L9NA 1NCHA 1RUQL 3PCYA 2IH1A 1OTSC 4Y5XB 1NCBH 3QNZA 5ADOH 3HCVB 3TLRA 4IBLT 5J6GB 2GYSA 4J6RH 2LLGA 2CUIA 3QDGD 4JO4H 4MNQD 4XVSL 4Y5XA 3N3EA 5HHMB 2PABA 4Y5VC 3HCVA 5J6GA 3ZO9A 2P80A 5LNDA 3I6KB 3NFSH 4RSVA 4QRBA 4MLSA 1CS6A 4KRNA 4MKTA 4TRPH 2L0DA 4UM9D 1PG7X 1PLCA 3BH9B 3I6KA 5JW4Q 1QBLL 5DURB 1I9IL 2CPUA 3K6IA 5DC2A 3WIIL 3BH9A 2Z92B 5SWQB 1JNNH 3BOVA 4W81A 1TVDA 4OI8A 3VD1A 3KGUA 2R1WB 2Z92A 5SWQA 4F24A 3I9GH 1QFUH 1S6NA 5CJBA 4W6WB 4B97A 2HZHA 2R1WA 3ZE2E 2Z91B 5E70A 4HAKA 1JZGA 2OMUB 4TULH 1KTKE 1EHAA 1YECH 3CGTA 5D7SL 1MCCA 2GJZB 4N5UA 2R4SH 3UMTA 5E5LA 1DCLA 5ICZB 2EDNA 2E75C 4NN7C 2XKNB 2WV3A 3WMQA 3HNTH 1FNHA 2B8OT 3TFBA 2AANA 5ICZA 43C9B 5L0QB 4KUCF 1TMCB 2F1AA 2XKNA 5AD0B 3I9IA 4K94H 2OYLA 4JFDA 1H0DB 1GHFL 1WITA 43C9A 4ABUA 5HI4C 5AD0A 2XWTB 5DU7A 1DJXA 1H0DA 3UG4A 1EXHA 4D9LH 1HXYA 2XWTA 3QRBA 1FGNH 1NCDH 2EQDA 3HW7A 3LS4H 4ANVA 2XXGA 3PAUA 3UTOA 4IBUA 5KSBB 5A2AA 3TZVB 1K2DA 3NSYA 2Y1YA 3ZE0F 4GAFB 4JCMA 2DQJL 3EDKA 1ED3B 3LPGA 4L8DB 5KSBA 1TZGH 3BRDA 3T0DA 3NA9L 2D7TL 5EV7A 3TZVA 4LSTH 2AK4D 4K55A 3V2AR 4MQ7B 1L0XA 4L8DA 1ZT4B 1ED3A 5I74B 2P5ED 1F11B 3QRLA 5JOEA 4KQ4L 4WCYH 3DX7B 3QIUC 1BAGA 4MQ7A 5FO8B 2CGRL 3CXDL 3II2A 5D7JC 1F11A 4JDZB 3DX7A 4GG6B 4JFHE 5E0FA 3W39B 4WY7H 5FO8A 4G6KH 5I19L 3SHSA 3ARBB 2OMTB 4HCFA 4JDZA 1EZVX 4GG6A 2C8NA 1A7PL 3W39A 3WTTA 1MI5B 4KZ0A 1IJNA 3ARBA 3CBRA 4NZTL 4KPHL 3REWB 3QYMA 3HG1E 1B0GB 1P0SE 1MI5A 2R2BB 2YFOA 3SBWA 2DQTH 3REWA 2O6FA 3O6FC 4Q56A 1B0GA 1NBQA 5BO1L 2R2BA 4G70B 4R3SB 2GI7A 4FABL 1L6PA 2OTUB 3K8KA 3AG2B 2WTOA 5IHUH 4NRZB 4R3SA 1NBYB 1U36A 3D25B 3L8QA 3FTVA 2YD3A 4KHTL 2OTUA 3ULVL 3HIZA 3BEVB 5J7CC 4LGPB 2W9EL 1WFTA 4NRZA 1NBYA 1WISA 3D25A 2JTYA 3FN0H 4U1JB 1HOEA 1DVXA 1AZZC 1EFQA 1AR1B 3KDMB 4J28A 3BEVA 4YDLB 4Z8FH 3ARZA 4KXCA 4U1JA 2AXJA 1HNYA 2BY0A 3KDMA 4AV4A 5B22A 4ELMB 3QZLA 2LLLA 1W2KT 4P2AA 2WWOA 5CM1A 4JM4L 3QZOA 4ELMA 2VSKB 4GUCA 2KC0A 3A47A 3FMGL 4FKEA 4TUKH 1BF8A 3JV4B 1RHHB 4P2QB 3BVNB 3HPLB 3ISRA 1ML0A 1T04B 4PJXB 2BIQA 2FBOJ 1IVLA 4MRBA 4APQC 4UB0H 3D0VB 3WN5C 2F58L 4EN3C 2ZAIA 5AYUL 3CSGA 3JV4A 1I9JL 1RHHA 2BS71 3DVNB 3P4MB 3Q9QA 1GC1H 3BVNA 3HPLA 1T04A 4FNQA 4PJXA 1Y1DA 2O5NA 5AOJA 4FYRA 3W38A 3ULAB 3HC3L 3DVNA 5KS9B 3PS6A 1QLFB 3E80A 4KBPA 5KS9A 4OCMC 1BGXH 1JF1B 2WQAA 4PRHD 4ZOAA 2FEDD 4KHXL 2R8SL 5KTEL 1QLFA 2D3LA 3ARPA 4XPFL 1JF1A 1QNZL 1T1YB 3ESPA 3VFWA 2LLNA 3RX7A 4JKNA 3GXMA 1AI1H 1WAAA 5EEYA 1T1YA 2JQZA 2Q76B 4Z7NF 2ADIB 1N12A 5T3ZD 4AENA 3HHSB 5FDWB 4LPWA 2BIMA 4MRCA 3ZY7A 3QWQB 2Q76A 4A7GA 4UNVA 1J8SA 2ADIA 4XZUB 4KX8A 5C09B 1UZ6F 2Y22A 4FP8H 4H8UA 4OCWL 3HHSA 3LZQA 5FDWA 5GGVL 4L4TA 3L2MA 2NNXA 3UABA 1Y6NR 4CDHA 5AB0A 5C09A 1VLXA 2MNUA 2B08A 2C9RA 3T3ME 3HFML 1UEYA 1HCZA 3E7JA 3MGOA 2HFEB 4I0PB 3DVIA 5DHMC 1WIOA 4PCYA 4Y1AE 3EUDA 3SGKA 4P4RB 3VSQA 1HEZB 2NZ9C 4QRAA 4W9IC 4I0PA 3QUZD 1I31A 5D2NB 3VTMA 5LAXB 4U49A 4R4ND 4P4RA 3RU8H 1HEZA 3RVTC 3WD5H 4AYDC 3B2MA 5JDSB 4WRLA 4GXVL 2A6JB 5D2NA 1ZLEA 5LAXA 2XBDA 4YGVB 3TVMB 3EJTA 5JDSA 4OKDA 2EYSB 5EZJB 2A6JA 1URLA 4UNUA 5KJ7E 1KPUB 2DIJA 4JHWH 3AQXA 2Y23A 3FTSA 4ODBD 5CINH 4YGVA 2AJUH 3N40F 5KSUB 1EAQA 2AERT 2EYSA 5EZJA 1KPUA 4L48A 1WWWX 5KSUA 3TFKC 5E2UL 2Z34A 3QUXD 3ARDC 4K9EH 4PCSA 2JNZA 3H8NA 5D70L 5DT1H 4LSQH 2BIHA 2WINA 5D1ZI 2G3MA 1WD9A 4AIZB 2MPVA 4JL2A 3JYCA 1L9RA 1JZEA 4L1DA 5GRWA 5AOLA 1F56A 5C9JB 4Z6AT 2YRZA 3S37L 1JERA 5SX4H 4ZJ9A 1WBZB 4N2FA 3IPBA 3NCFB 1FNSH 4RGNE 3UC0H 5C9JA 2EUWA 1WBZA 2YMOA 3Q2VA 3EFFB 1GPOH 4HPYH 2P45B 1OAKL 4GRWE 3EHBD 4LF3B 3TH4T 3MO1B 4FF9A 4Q4EA 3EFFA 5CILL 2GAZB 1MREL 2VJ0A 4BQ9A 4LF3A 2J44A 2EE6A 2BWIA 4JFOB 4I85A 4B9CA 1CLCA 1RVFL 4PBWD 3DRQB 1GZPB 2C9SA 2GAZA 3DETC 4YJZL 5I75B 3H56A 4Z7VF 4MA1C 5LBGA 5FFOA 4JFOA 2XWJA 1KUMA 3DRQA 1GZPA 3ULUE 1FGVH 1TQSA 1K3ZA 3VWJD 3K4AA 2K9UA 4QXUH 2FQEA 2XRAL 1UA6L 1IFHH 3MV11 5SWZD 2ZIDA 3E6HB 3HMXA 3UTZB 3PQYD 4XVUD 1G7JB 4LSVL 4JDVB 5C3TA 4HIHB 2FB4L 1BXAA 2UXFA 1RCYA 4B9IA 3E6HA 3UTZA 4GG8B 4JDVA 4N2BA 4HIHA 1RZPA 4O58L 3CC5B 3CFDB 3QQXA 4QDGA 4U1KB 4GG8A 4LVHB 15C8H 2GBUA 2DPKA 5GZNA 3CC5A 2YPLB 4O02L 2JJWA 3CFDA 2P5WD 5I0DA 4U1KA 3QXTA 4DGYL 2CJUL 3GZQA 4KVCH 3WXWL 3WUWG 4N22A 4IMKC 3RZCD 2YPLA 3H3BC 4NGHL 3F6JA 3RDTB 1ECYA 3KJ4B 3CH1B 5E4EB 3D4YA 1OXYA 3VGBA 3BHBB 3SDCC 4JKKA 2N59A 4YGAB 1UM4L 4DUVA 1IEAB 3CH1A 1RKRA 3QA3B 3TBSB 4CVZB 3GXFA 4OM1L 5TFSL 4ZRGA 4XNBA 3C60D 1OIOA 3C2AH 2YD9A 1IEAA 1ZV2A 2XLLA 3QA3A 3MRBA 3TBSA 4CVZA 4LVNB 1BFVH 2DWYA 5AVSB 4I77L 2B0SL 4XCNB 4WW1B 5IF0B 5DRXB 2KBGA 1SRDA 3MRIB 1U58B 4C4UA 1S5IL 5DVKA 1IGML 4XCNA 4WW1A 5IF0A 5DRXA 3MRIA 2IPUK 1U58A 2KHAA 1BEYH 2WBJC 2XHNA 3BH8B 2MNWA 3K0WA 1JYVA 1J88A 4HMEA 1CBVH 3BH8A 1X5MA 2DKSA 2ADGB 1WT5C 2QV2A 3E8VA 1N64H 3OB8A 5DK3A 5GHWL 2BSBA 3IN2A 1LO2H 2K7QA 2VDKL 2WXFA 4IBVA 2ADGA 3WY2A 2MCMA 1B0RB 3FT0A 3Q2WA 35C8L 4OAWB 1LL1A 3EH2A 5FM5M 2CLVB 4Q97A 4XZ4A 2BRQA 5K1NA 2XPGB 1B0RA 2YXMA 4OV6F 4OAWA 3RWCB 5DS8B 2KZKA 3M1BB 4FYQA 2APTA 2CLVA 4N20A 1RMFH 4AK2A 2IF7A 5A2CA 5BVPL 2XPGA 2HLAB 3P3UA 1N8ZA 3RWCA 5DS8A 5JW4M 3KLHD 3APDA 3MOBH 2BXYA 2HLAA 4QRPB 5CJQL 1H15B 1T4WA 3V5KB 4WW2C 2PPCA 3BDBA 1Z9NA 3Q44A 4NI3A 1OCWH 4NQEE 3RWJB 4QRPA 1H15A 1JFQL 3HS9A 3VRLF 2QELA 2CHDA 3LKOA 4WQOA 1CFSB 3RWJA 5E08H 1EAPB 2O4EA 4TKWA 3IJEB 3RVUC 3ZIYA 4QAWA 5EIVA 2AV7B 2DQDL 4JFUA 1PX3A 1WBXA 3DX8B 1EHXA 3WU1A 1JTPA 1C16B 4X42A 1EAPA 4YWGH 3ZE0B 3IJEA 3WO4C 5T33H 3HG3A 4P05A 2R29L 1HYSC 3DX8A 1C16A 1E2VA 3PFQA 1TFHA 5CUSL 12E8L 5IQ7H 4J8QA 3K2IA 3OSKA 3TF7C 1U4EA 3QIWC 4L29B 1MOEA 5J56B 1I1YB 2IWGA 5EULV 1HIML 2Y6SD 4YDKH 1U3HC 1XGRB 4L29A 4TNWF 4X98A 5D1QD 1I1YA 1WFMA 3ZUCA 1TG8A 1WQVT 1XGRA 1YHPA 3F85A 3O4LD 1F02I 1WHOA 4I2XE 4Y16B 5D93B 4ZMNA 1A4CA 1CFTB 3HR5B 2DI8A 3VMOA 2VLKD 4YLQT 4Y16A 4AC4A 2EUZA 4YSPA 3AY2A 1MIMH 4ONFH 3ZRSA 1CFTA 2Y36L 3HR5A 4P9HC 3KPSB 3OSVA 3T6QC 3V0WH 1HTYA 3GZKA 4MAYB 1MCKA 5FHAL 3WMSA 5A6MA 2ATAA 4A2MA 3RFZB 3KPSA 2H2SC 4U31A 1QASA 4MAYA 4XI5C 3KMDA 1GGTA 3CFNA 3JWNG 3RFZA 2A77H 2GJ6D 3FU9A 3D51A 3PNRB 1OGSA 3S3BB 1S7SB 1FI8C 4POZC 4QPEA 1I1AC 2MNJB 3HNVL 1DVUA 4BCXA 2CCWA 3CHOA 6FABH 1P7QD 5LDUA 3S37X 2V2XA 4LP5A 3VXSD 3KEHA 4LU5H 1S7SA 5DJDB 3R1GL 3F7RA 3QNFA 1OTUD 4H88H 4L0YA 2QKSA 4N2DA 5DJDA 4LB8A 1WGVA 2NY5H 2XJKA 4TM9A 3ZL4L 3ARGB 5HDWA 1QNIA 1AG6A 1VZHA 1EIBA 1P1ZB 4KITB 1KIQB 3ARGA 4HCRA 4QTIL 2JE8A 3KR3H 5JHLH 1ODUA 2IG2H 3JWNH 4QI3A 1KIQA 2BNRE 3GLZA 4BCZA 3F00A 2V2WB 2AJZB 4QCIB 1TSRA 1R3IL 4LCWB 3MGAA 2V2WA 4J6IA 2AJZA 3AG1B 4FNRA 4QCIA 3TYGL 4G6FB 1X5FA 4LCWA 4CC4C 4F2FA 4GSDH 1T03H 4GKZB 5AKRA 4DEUA 2P8MB 2EKJA 1Q0XH 4KKRA 3QWRA 1L7TL 2NY3C 4GKZA 1UXWB 3IJSB 3LCYA 4WO4B 2P8MA 3ZYJA 4JO1L 4M7ZB 4Z7NB 2Z31B 1W72H 1WEJL 4I0KA 1YEFH 1UXWA 5LB1A 3IJSA 3QDMD 4WO4A 4X99B 5EBGA 1BQLL 2JKSA 2Z31A 4CSSA 4FQ1L 3GXDA 4OD3L 1HOCA 2WNXA 5PCYA 1IT9H 4W4OC 4XVOA 1UWYA 1TXKA 3ECUA 5JIKA 4IJTA 2BVUA 1OD9A 4NO0D 1OWRM 4YSAA 2E27L 4GI6A 3MGTB 4EUPB 1IFRA 1N3NB 4KOBA 3WJJA 4Y4HB 4XRCB 3F8UB 1OGPA 3MGTA 3QJOA 5CP7B 4EUPA 2BOBB 1GJIA 1MJ7H 4QTFA 1N3NA 4TOYH 5BS0B 1P6AB 4HAGA 4AYGA 4F7PB 4FQ2H 4PP1D 1OZUA 1T6VN 4XRCA 4Y4HA 1V7NL 3GSUB 2YPVH 5F7LB 2X41A 1D9KC 5CP7A 1OTTC 1CD1B 2BOBA 2FVNA 5BS0A 3Q8FA 4RMWA 1L0PA 4F7PA 3G6JF 4N2EA 1QZNA 2LT9A 3GSUA 3S34L 5HVFB 4HP5A 2AAAA 1CD1A 3OQ3B 2RIKA 2APSA 4FKKA 4YHNB 4TSCL 1ZE3C 1BQHB 3TN0B 1RZKL 4LASH 1KXQE 1KLUB 1V3KA 1WIUA 4J4PC 4HW6A 4YHNA 1J1PL 4YSCA 1YA5A 1BQHA 3TN0A 1TPXB 4TNFA 5KVFL 5ISZE 2CKBL 3EDDA 2GB2A 4KKPA 1ZK9A 4H13C 5J6HB 5CCKH 3BDXA 2WNGA 1A25A 2E7BA 4JO8A 4HBQA 1OCRB 4HS8H 4PBVC 5D1ZD 4Z7IA 2HSIA 5J6HA 4P8QA 1SY6A 4RGNC 1UTDA 1R34A 2COVD 2NX5D 2E3VA 2P24B 2VZ3A 1IBBA 4BH7B 4DOHB 4N85A 3VWKD 1MHEB 4BZ2A 1SZNA 2P24A 4WI6A 4F58L 2COQA 3O6ML 4BH7A 3ROOB 3ZKXC 5E2WH 1MHEA 4X6FB 3BT2H 1DBKH 4GAJH 5GJSL 1A64A 3K2UL 5ELIA 3ROOA 4O9HL 4KMQA 1N5YL 4O00A 4X6FA 3SE6A 2QHRH 3BPNB 2EEFA 3GSOB 1LDPL 5CJOL 2C9UA 4OFVA 5AB2A 4Z7VB 1X5XA 4BUHA 2VDPH 3BWSA 3RGHA 3GSOA 4FKHA 6CGTA 3N44F 1OAUL 5I6MA 3ULUC 5E1AB 3H9SB 4JPWH 1H8NA 1ZWIB 1IGCH 1LK3L 3AG4B 4KI5F 5G4NA 4Z7VA 1R1CA 2CAKA 4S1QH 3KHQA 5B7EA 1IAII 2R69L 4UOZA 1IC7H 5E1AA 1JYXA 3H9SA 3BPOB 1ZWIA 4MJHA 3ATBA 1CL7L 3SE8H 1XV8A 3VO0A 2W60B 1KJ2H 4RFNB 2JJVA 3VYPA 3LZLA 1G0DA 1T1ZB 4QRTB 5I1JL 4UI2A 5EOCL 2RQEA 1T5KA 4XCFH 4ZAKB 4CMMA 3KLLA 2RAMA 2WYHA 3TC9A 1T1ZA 4QRTA 4PBXA 1NMBL 2L04A 4UTAH 1GCFA 4HJIA 3NH7L 4LMQE 4ZAKA 1KN4H 3N43F 3T2QA 5DXWA 1EO5A 3O3EB 1AO7D 3OG4B 4UQ2B 4YSDA 4C56B 2HPOA 3NGBC 3NCWA 3QEGL 2ZNWA 3O3EA 5KVGE 4UQ2A 1J0KA 3FUKA 3DV6B 4C56A 4XO8A 3MV7D 1UOVA 1Z32X 2NRDA 3E8UH 5D7IF 4HD5A 3WIHA 2IPTL 2OZ4H 1DL7L 3DV6A 2E7MA 1PLGL 5ESVB 4XNMA 2IDTA 4ZTEA 3N6YA 1BP3B 3SE9L 3THMH 1MRDL 1H6TA 5ESVA 4AH2B 4PJ6A 5AAMC 4NOFA 4AEHL 4PRPB 1VGEL 1XO8A 1ZOXA 3NSDA 1HHKB 1T22B 1XCQB 4U4IA 3ZBMA 2Y7QB 3MRMB 2IGTA 3IB4A 4H20L 4AH2A 3S8WA 5KBMA 1T89C 4PRPA 1HHKA 1T22A 1XCQA 2Y7QA 3MRMA 4F9PA 4XMKH 5D71H 4MXWL 4N1CA 2H26B 2R7EB 4R0LC 1KY6A 1SHWA 4FTVB 4PRDB 2B4CC 2H26A 1M4KA 5BXFB 1CFBA 2R7EA 1JHTB 1IAIL 2B15A 3P2DA 3VMNA 4FTVA 5IFHL 1RZQA 1USZA 3INUL 4PRDA 1SDDB 2VW6A 3GBMH 3BI9X 5BXFA 2ZCLH 1JHTA 4EZJA 3BW9B 3HE6C 1SDDA 3IDJB 3F62A 1O5DT 2BHZA 4OZHE 1MLCB 4RFEB 1J5OH 3BVWA 3BW9A 3PL6B 4JFFB 1QG3A 3BAKA 5T5FH 1U8LA 4GUQA 1KB9J 4AE0A 3IDJA 2XWCA 4PYGA 4WEBL 3DXAE 1S3RA 4RFEA 1MLCA 3PL6A 2LV4A 4G9FD 4OQTH 2V7NB 3CFCL 3S48A 3UO1H 4PREB 3PUCA 4B3VA 3DYMA 3BC9A 4MXVE 5AOZA 2PTVA 2I60H 2V7NA 3OLEA 1INEH 2YAQA 4PREA 4IDLA 3R7QA 2PF6A 1PY4A 1D2PA 3LPPA 4LSDA 2VQ4A 5D2LF 3HG4A 3LH9A 3U7AA 4XODA 4G6AC 2J6EA 3UYPB 1A6AA 1E50A 1Z9SB 3B9KB 3GPEA 4CC1A 3D69B 4LRIC 4R7NA 4X7SL 2IFFL 3ABGA 1DSFL 3UYPA 2XX1A 1Z9SA 3B9KA 3IDMB 3MBXH 3TESA 3OMIB 4TSBH 2BVYA 5I16B 2CR6A 5CSBA 1A3RL 4ESKA 3NVQA 3IDMA 3LN9A 3MDJA 4KUZH 5I16A 2CO7B 2Z7WA 4EIZC 3ARTA 3A4DA 3ILQC 3LQAL 2Q20A 4YNYB 5A6IA 3EFDL 2X89D 1DDTA 2XNAB 3Q13A 1GMEA 3DIFB 1ZGLP 4ZO6A 4YNYA 4QKTA 1XMEB 3A22A 1R33A 3FRPG 2XNAA 4IRSC 4FFYA 3DIFA 2OJ1A 3ZDZE 5ICYA 5AL8A 1DQKA 2GJPA 4R2GB 5E99L 3KWVA 4UTBL 4FXGB 1SXSA 2Y5QA 5HVWA 2AZAA 3FC8A 5L6YH 4D3CL 3CBJB 3O4OB 4FXGA 2RGSA 4NWUL 4TVPL 2E7CA 5CEZE 3FB5B 3ZIMA 1F6FB 4E9LA 1X7SA 2F0CA 3CHPA 3UJIL 3AREC 3P11H 5FW8A 4QLWA 3FB5A 3ZJAA 3WMPA 3SCMC 2LGNA 2QVMA 3APMA 5KN5B 1DJYA 5E4OA 2ZONA 4JG5A 2FD6H 1CQYA 5TPWL 3V6FB 5IQOA 3QZWG 3MRRB 3DVFA 5KN5A 1GA2A 2B14A 1J0YA 3X3FH 4OCRH 1FC1A 1TYRA 3MRJB 4W68A 5AEAA 4GKSB 1DVFB 4JHAL 3V6FA 3MRRA 2L8AA 1B6DA 2O5YL 5IESH 5T3XH 1RIVH 3MRJA 2A3TA 3WNOA 2VLLA 5BUAA 1NBCA 1DVFA 1QYGH 2O93L 2J1ZA 3F7YB 5H94B 4HMCA 5MI0C 4HOXA 4FADA 1UD4A 2VDML 2XV0A 4AL8L 4F93B 3FTZA 1JGLL 4XMZA 2DH2A 4A04A 5TE4H 3F7YA 3NABH 4IBTA 5H94A 5AYQA 1XB3A 7FABL 2ZUTA 3R19A 2FWSA 3B56A 4GKOA 4LHQB 4NUMA 2X0VA 1YVLA 3CDZB 2V8MA 5IIEB 1MFCL 1J0HA 2OCFD 3CLFH 3IM1A 4FFZL 1G87A 2EIDA 4OI9A 1I9RH 3DMMB 4NUJB 4NUGL 1A9VA 1QUNB 5DGQA 4CMHC 5JR1H 1OAXL 4RESB 1DVYA 3CQPA 1ONQB 3TA3D 4YDVB 4PY7B 4HLJA 3DMMA 4NUJA 1NAKH 1QUNA 2DM7A 2CDGB 4NO3B 5FO9B 1ONQA 3VD3A 3S3DB 4YDVA 4PY7A 2CDGA 2XOTA 3R0MA 4NO3A 3W5MA 5FO9A 1MFDL 2NY6B 1OM9A 4B95C 3QSKB 1MW1A 1PLBA 5DD0L 3S4SB 4KK8C 1KY7A 4TQ8A 4LFHG 4ERSL 3HMWL 2X4QB 4JHBA 1JGDB 4MNQB 4KKBC 3L3IB 1NFDE 1HJBC 4ZZFA 2F68X 1R47A 3SOTA 4G7QB 2C3WA 3S4SA 4BE6A 4CN6A 2X4QA 5E24E 1JGDA 4MNQA 2WB7A 4JGMA 3L3IA 1WV7T 2ENPA 1BD2B 3GLAA 1GYWA 4H1LB 4M61A 1J8KA 4UM9B 3LZOA 2H0FA 4M3HA 1CZ8H 1NCAL 5LUMA 1LO5B 3HE7D 1O6VA 1VACB 4XE0A 1BD2A 4RISH 4H1LA 5EOQH 4UM9A 4F92B 3IGUA 1LO5A 1VACA 2VLRE 2RB8A 3N85L 4DVRH 4F8OA 4OD2B 2NPLX 2VDLH 4X83A 3G6JB 2W92A 4FLHA 3FUDA 5TE6L 3UL4A 4BZ1L 3APCA 1CTMA 4EDWL 4PJ9C 3G6JA 3NMEA 3H85A 1R19A 1PX8A 3HI6L 4YAQB 4IMLB 3QPKA 4Y2DD 1NDMB 5FYKE 5B1BB 5A43C 2PCFB 4K3EH 4YAQA 1FDLL 4IMLA 1JL8A 2NZ9D 1NDMA 1QEWB 4MLIA 1F97A 3SDYH 2RJMA 4P5TC 4X6DE 4KRPB 2A83B 2KUTA 2PCFA 2QADD 4JPIB 5IMMB 2CU9A 1EAOA 5FHBH 3RVTD 1QEWA 2P7TA 3NJGA 3P0VL 5IROC 4L8SC 3SYAA 1AHWC 2A83A 4HIJB 5IMMA 4JPIA 2B1AL 4KRMB 1XZWA 3OWEA 4OT1L 4MASA 5KVDL 3S5LB 3TCTA 1LJMA 1KYFA 4UT6A 4HIJA 3VG9B 4X4XB 4Z9KB 1A7OH 4A55A 5CNHA 3S88L 3ILDA 2AGJL 2APBA 3RVVD 1A7NL 4NOBA 2AC0A 4X4XA 4P07A 2ICWI 5AW1B 5GISH 1S3KH 3ARFD 3BKMH 5B8CB 1MWAH 4CVUA 2DD8L 4IGBC 3LHPL 1PPIA 2X4TB 4JANB 4KNUA 4HFUH 1JUFB 2KYIA 4HGKC 5B8CA 2P5EB 3N44B 4UMGA 3NPSB 4QHKI 3UJJH 2V3EA 2X4TA 5E8DH 3RKDD 1JUFA 2P5EA 1FE8L 1HQRB 3MKGA 2D2OA 4FQCL 4WFHE 3IYLW 1YEHL 3P54A 2ITFA 1I7RB 2ALWA 5DJZB 4YXKH 2B1OA 4HWBH 3L4UA 1NWPA 3VD7A 2NNCA 4NKIH 1HQRA 4LCYB 4OLZH 3KPPB 3U30B 1XTMA 3EDFA 5GGQH 1I7RA 5IW6B 5LGJB 3UBXI 4Z3FA 2VMCA 5T1KD 5ADPL 2NY1B 2Y24A 4LCYA 2EUVA 3KPPA 4APXB 2LU7A 4PGZA 2OA9A 5IW6A 5LGJA 3CG8A 2ZYIA 4HKXB 3N43B 3TWCH 1U91B 3NAAH 1SM3L 3QCVH 2XQ0A 1QA9B 2QSTA 5HDQH 2V3FA 1KB9K 5CGYD 5DDHB 2CBOA 3DX6B 2A0LD 4HKXA 4XBPB 5J3HD 1U91A 2XVKA 4DKEL 3W0WD 5DDHA 4P59H 4P06A 3DX6A 3FQ2A 4FNTA 4IYKA 4XBPA 2X44D 3HVNA 5D7IB 1YNLL 2FEEI 4XNYH 3QQ4B 5FGRA 1PAZA 1LNUB 5HYJB 5KVEE 1I3VA 3BPLB 1LE9B 1E90A 1KDIA 2ZPKH 3QQ4A 4W9CC 5HYJA 3NCMA 1SHXA 1LE9A 3DGDA 3ZUNC 1BHGA 1M7XA 1QVOB 3LZNA 5CZXC 3V7MA 2YEQA 1GYCA 4IJ3B 5DI8B 2OYKA 2HTKC 1QVOA 3E6FB 4B50A 3ARRA 3A5VA 4MXQD 4IS6B 5DI8A 3VXQB 4HGWB 1AOZA 4KQ0A 3E6FA 4AYFA 2Y4SA 2N56A 4IS6A 3ZPDA 3VXQA 4HGWA 3T1WA 2OR9H 1JK9B 1U3ZA 4YE4H 4MNHB 4HK0B 1DR9A 2UZIL 1KLGB 1REIA 2GTQA 2X3BA 3U0TB 1FYHB 4ALAH 3BFQG 1JK9A 2DQCH 1LO3H 4GS7B 4MNHA 5DHEA 1K8IB 4HK0A 4P3WA 1YC7A 1NJ9B 1KLGA 3U0TA 2GPZA 3GDBA 1KXVA 4JO2H 5M94B 2FTAA 3J2PA 1Z3GH 1K8IA 4PRHB 3EF4A 1FP5A 1NJ9A 3QUMH 5BV7L 2DLEA 4UAHA 4FC3E 3LNGA 3WBDA 4EZMA 2BWDA 3MBED 4YDIH 1XX9C 1CYWA 4IIQC 2VC2L 1JPEA 4X4KA 4ENED 3GSVB 1XGPB 1ND0B 4WJKB 5AVQB 4Z0XB 1RZJH 2FSEB 4RETB 1NANH 1EERB 1CDYA 1XGPA 3GSVA 5IBUB 3U1SH 1ND0A 1GGIL 3T71A 4Z0XA 2FSEA 2F53E 5D72L 4KTEL 5GS1B 4N2HA 3LEYL 3B9VA 4QD2E 1HL4A 2FEEL 3CDGB 3MV9D 5D2LB 1HINL 5L4JA 1ETA1 3LNIA 5GS1A 2AKRB 4UTCA 5J1SC 2Q8BL 4NHUB 4ZTPL 1CCZA 3CDGA 4UNIA 6PAZA 1T66C 1BWWA 1Q1PA 3NIDE 5D2LA 5ALBH 1Q1JL 5GXBB 2AKRA 1R3KB 2O1AA 2F8VA 4NHUA 4OZGE 4UAOC 4CUCA 3FH8A 5J11B 1G84A 3QUZB 5DD6A 3CBKB 1PEZA 5JYMA 1R3KA 4PCTA 3QI9C 1PKQE 4UQDA 1MUJB 3MSPA 3QUZA 4XO3A 4M8UA 5SWSE 1D5XB 2ZOLB 1MUJA 3AAZA 4Z3JA 2CK2A 4L9DA 3BSZA 2DMGA 1D5XA 2WXMA 4AXWA 5DJ8B 1XIWD 2GC7C 2ZOLA 5FYJL 2O5XL 3SGDH 1X5HA 2W0KA 3WNKA 1KPRB 2NY0C 2VDRB 2KDGA 3RVUD 4MJID 2XA3A 5CD5D 3QUXB 3PP3H 5DJ8A 1TYEB 3QAZC 3O9WB 3T77B 2GUOA 4N28A 1KPRA 5F1OB 2I5YH 4Q9RL 3QUXA 1HYSD 2EDQA 1RUMH 3O9WA 1NSNH 1OAQL 2FEJA 3T77A 4D7PA 1RURH 2K78A 4HK3N 4OM0L 5EBMB 1YUKB 5IR1B 3AS0A 1CR9L 3O2DH 1U3YA 2PCYA 5EBMA 4NKOB 3V9CA 2QEJA 1QI4A 1UG9A 3UTTA 5IR1A 4UIMB 5AW0B 4JPKL 2L3BA 1U3HD 4NKOA 2E9BA 4UIMA 3EHBB 1OK8A 3Q5OA 3CLWA 5HHME 3ESVF 3DOHA 1SUHA 4ICXA 4FERA 3LY6A 5D55A 3WE6B 4D9RD 1E67A 1KXHA 2VJXA 3GIZL 1NM9A 1D5IL 1E5YA 2IGFH 3WE6A 3VXNB 4XAWH 4WTZG 5A2KH 5HSFA 2CBTA 1J0JA 4U3XA 3VXNA 3QE5A 3OWRA 4OVVA 3OAZH 2I26N 2XN0A 2GJJA 4OCXH 3VWJB 3O0RL 3VSVA 4PS4H 4TV3A 3JV6B 3MA9L 1CD8A 2PNDA 3FZUC 5B3NA 3CFIC 2EC9T 4ORGB 5SWZB 2QQLL 2A4ZA 3PQYB 3VWJA 2CRMA 3GGWB 5DSCB 4POZD 3UROR 1KTLB 4R97B 2WZPA 1G7IB 4ORGA 2APXA 3BWUF 5SWZA 3HN8A 3PQYA 3WO3B 4Y5YC 1LO4L 5DSCA 5HHXH 4ZUWB 1KTLA 1BYPA 3UAJA 3H42H 1V8HA 1G7IA 3O3DB 1PTZA 4ZFOB 4F2EA 1ERNA 4RZCB 4UV7L 3MNZB 1CICD 4MNGE 2ZT9C 1UWGL 3O3DA 1SVCP 4LO9A 2P5WB 1P4IL 4P4KC 4PM1A 1NOAA 4ZFOA 3TIDB 2XIDA 2WHVA 4RZCA 3MNZA 3QCTH 2XZCL 1YQVH 1OT2A 4JFED 2IOIA 5EDSA 4LCIL 5IBTL 2P5WA 1P1VA 3DUUB 2HH0H 2VERA 3TIDA 1XZ0B 4YXHL 2DKMA 2IQ9L 4OF3A 4R7XA 4XNXH 4NHCH 1KB5H 3EH1A 4URKA 5EZIL 5I28A 1FORH 1XH2A 4J23A 1BJMA 1XZ0A 1YNKL 2FIRT 4KTYA 4Z0BH 3JTTB 4MJ4A 2ENYA 4A1RA 2NXZD 3VX0A 3VQ2C 1WA1X 4Z7WF 1PFCA 3JTTA 5IB3B 3SD5A 4OLUL 4JZJB 5LGHL 1Q38A 2E9IA 3IDYC 1JMXA 5L2KD 3VFUB 5IB3A 3ZT5A 1YEJL 2DL2A 1HCVA 3SQOL 4O51B 2MFNA 5JOPE 3KJ6H 4DVBB 3VFUA 4FZ8L 1U8CB 1IM9D 3QH3A 4U1IB 4O51A 4P23B 1UKSA 1HX0A 1ZA6A 2J55A 3IGAB 1U8CA 2E56A 4GG6E 5K59F 4U1IA 1JDAA 4EXPX 1XB8A 1ZHBA 4P23A 3IGAA 4ZTOH 2X6VA 5F9OH 3T09A 4EXKA 3Q3GB 1F3DJ 3ERXA 4Y9BA 3P9LB 1CYXA 2OXHA 4Y1AD 5I1HH 2EVIA 5J0BA 2K9FB 3Q3GA 3MCYA 3P9LA 2JB6B 2EIKB 4L5FE 4WI3A 5J13C 2OPCA 2CNZA 4N2KA 2VCOA 3GM0A 2JB6A 2C9AA 2AEQH 3GMMB 5TF1H 3VXUB 2XN9D 1KENH 2NLJB 3CZLA 3CK0L 5IQNA 4AEEA 4ZMZA 3DBXB 2NXYD 3FU6A 3D30A 5KBPA 5DZVA 3VXUA 1MDAA 3T4YB 2NLJA 4GINA 3UADA 5C0FA 4HUUB 1KLFB 1NCBL 3DBXA 1I85C 3SPHA 4EIGB 5ADOL 3J8F7 4J6RL 4Z7QF 1ZLWK 1RPUA 1RK0B 4J4PD 3BPCB 4JO4L 3T4YA 3EYOB 4QGYA 4HUUA 4MSWB 1KLFA 4IOFC 3TL5A 1DUYA 1II4E 1V05A 2WXRA 1RK0A 3WEAA 3BPCA 3NFSL 2Q1EA 1QW9A 3K4ZA 3EYOA 3QISA 5C0CB 3RY6C 3NZHH 4MSWA 2HT4C 4TRPL 3ZKQD 4WHDA 4I4WA 4EF3A 3L4XA 2QSCH 3OPZH 3TEYA 5C0CA 1URIA 4JG0L 4P2QE 3JWOH 5DO2C 2WLKA 4PJXE 4OJEH 2BP0B 3OLIA 1JNNL 4OIIH 4TTDC 1EJOH 2EINB 3RGBA 5HDRA 3WJLC 2HFGH 4UWQB 2BP0A 3PGFH 3OJMB 5CEYB 3GO1H 1PZUB 1FJ1A 3I9GL 1QFUL 3BIBX 5KS9E 1D2OA 3CFMA 1P4LB 2A74B 2C9XA 4TULL 2J2ZB 1HT6A 1YECL 8FABB 2HG0A 4NYLB 1P4LA 3GRWA 1BCIA 1XBDA 1XVSA 2QTEA 2R4SL 2A74A 2VLKB 2J2ZA 3N04A 4OUUB 4DK6A 5FGCE 4NYLA 8FABA 3M7FB 4HMDA 4QOKB 4GAYB 3KPRD 3HNTL 3LS5H 3ULUD 1J0IA 1G9NC 3APFA 4OJFH 2VLKA 4OUUA 2BMKB 4QOKA 3P30H 4GAYA 4K94L 1DHKA 1F4HA 1ZVHA 3MUHL 4EKXA 5ID0B 2AP2A 4J3OG 1SN0A 5C09E 1HS6A 4AWJC 1JZ8A 2GJ6B 3FFCB 4BA8A 4K07A 5ID0A 4XMTA 3L16A 1CFVH 1HN1A 1IGIH 5E6YA 4D9LL 3CLEH 3FB7B 3OHXC 1FGNL 1NCDL 2GJ6A 3FFCA 4JL1A 1P7QB 3LS4L 4WF7A 1QPPA 3QUKB 5IB2B 3FB7A 1HHGB 3BO8B 3OV6A 3WKNA 2VL5B 1FCGA 4G9DB 3WNLA 1P7QA 3OC5A 1V10A 3QUKA 1TZGL 5IB2A 4E9WA 1PY9A 2NQCA 3BO8A 3DGCR 2QKIC 2VL5A 4G9DA 1PQZB 4LSTL 2XQYK 1QATA 4UYQA 5DC0A 7TAAA 2ZSWB 1EJ6A 2JKJA 3PJSB 2LU5A 1PQZA 2H2PC 3JWDH 4WCYL 5FCUH 3Q06A 2XI9A 1YLBB 3BUYB 2ZSWA 3CZNA 3H2WA 3D08A 4BIKA 1QLEH 2V8LA 3PJSA 4J3OH 3SDXF 1P5VB 1LK2B 5FYJD 3QO1B 4AG4H 3BUYA 4WY7L 4G6KL 4LCVA 2ED7A 3OM3B 1P5VA 4X5RA 3FO2B 3QO1A 2MSPA 2VO8A 1CMOA 5IM7B 3SQBB 1GOHA 4PJIE 1W8EA 3IDXH 5B4MC 3DHPA 3FO2A 4B27A 2NY2B 2PWDA 1KGIA 4KY2A 2DMKA 4LCCB 4GQ9H 5IM7A 2VWEE 1SXZA 1LILA 5CHNB 2IMMA 4YSUA 2JH2A 2DQTL 3F7PC 1H5BB 2N1KA 3U1PA 4LCCA 2E0PA 4JLRB 3U0PB 2E6QA 5DJCB 5CHNA 1WFIA 4FL4B 1CXHA 1H5BA 1HU8A 3QFJB 4LSPH 5FUZH 4XMVA 5JMOC 5IHUL 2J1WA 4JLRA 3U0PA 1FG2B 5DJCA 3QDMB 4WI2A 3QFJA 4LARH 3DJ9A 2X87A 3FN0L 2G60H 1HC1A 3Q7JA 3QDMA 1CGXA 4PMFA 4Z8FL 3HE6D 5F89B 5JPMB 3Q8CA 4LLQB 3FAXA 1ORQB 3NCJH 4TNWK 5F89A 3HKZA 3MRCB 4ES9A 1ZIAA 5JPMA 1FFTB 2QZ5A 1ORQA 1BG1A 4WDIB 1LE5B 4TUKL 3MRCA 1JZ6A 4EI6A 4TNGA 5JHDE 4WDIA 2Z6FA 4UB0L 1LE5A 1SQMA 4WTXA 4FA7B 2QFPA 4KO5A 1GC1L 5AZ2H 1XL4A 2FCBA 2F54D 2ZP9A 3IT8D 5DYFA 3TF4A 4LPUA 5T1JA 4HHGA 2E9GA 1B9KA 4EJ1C 2CR0A 2GIMA 1A6ZB 4JN1H 3VFNB 1IUZA 1BGXL 3SB3A 1OE2A 1A6ZA 3VFNA 4NQUA 2YPLE 3V4VB 1A4KB 5SX4I 2ESVD 3SDAD 5M7QA 1AI1L 4ZO9A 1E4JA 3V4VA 4PTUB 1A4KA 1FIEA 1BAWA 3QORB 1UD8A 5E2VH 2YR3A 2R56H 1F3JB 2NNRA 1XEDA 1XD0A 5IOKA 3LNHA 3VWKB 2PYEE 1AE6H 2VDOH 4PTUA 3QORA 3E9UA 3LKNB 1F3JA 3SBPA 4RCAA 2DM3A 3VWKA 1Z5YD 4G8FB 4Q6IB 4WFGE 3LKNA 2KS0A 1IKNA 2ED9A 2Y2TA 3D9AH 4AE1A 4CADB 1PYWB 5K69A 4G8FA 4Q6IA 5B1JC 5CEZH 1QSEE 1WLHA 2AABH 1PYWA 3II3A 4POUB 4CADA 4N8UA 2OJEB 4ZOCA 2FT6A 3C5ZD 3HHMA 3S5YA 3RU8L 4N0CD 2W07A 3WD5L 2OJEA 1OAJA 2BCMA 4Y1SA 3D2UD 1IU1A 3AXHA 4QGTA 3BVTA 4AKPA 4JFZH 3B5GA 1OAYH 4FA8A 4JHWL 5CINL 4D0DA 1TLMA 5KUKA 4Q9BA 2AJUL 2OFQA 2QPSA 3FFOA 1ZT1A 4KC3B 3GHEH 2YFNA 3D5OF 3TONA 3CHXA 1BREA 2HA1A 4K9EL 3B4NA 1FH5H 4F8LA 5DT1L 4LSQL 3T0VA 5B39B 4HIPA 1A4BA 4L3EE 1SFDA 1MCDA 4ZDHB 4HJSA 5B39A 1TQUA 5I2IB 3MV7B 1G9MC 2H4EA 1FNSL 4FLRA 3UC0L 4DKFH 5IB1A 4ZDHA 4U4BA 3HZVA 4V33A 5LCVH 5I2IA 3MV7A 4NKMB 3ZSTA 1GPOL 2FLBT 4HPYL 2KL6A 2OX5B 2ZAHA 2WXQA 4MBOA 1Q0EA 3FAWA 3LB6C 1KCVH 2VQ1B 4Z7WB 4NKMA 1E27B 3M86A 4RBPK 2OX5A 5EBLB 1MFAH 1SEBB 3B34A 1H6UA 2VQ1A 3L5HA 2XVLA 4Z7WA 4MCYA 2E9WA 1E27A 3RIAK 2EDFA 5EBLA 3IWVA 5DS1A 4G11A 3DX9A 2PPEA 5D1XE 1SEBA 3DPBB 4LNVA 3F84A 4GQZA 1AOHA 5FCSH 4O5LH 3KW7A 3U4KA 4WI0B 4LSUH 4PBDA 1G5AA 1KACB 2HLFC 3DPBA 3KPQB 1FGVL 3EG9A 5E1IA 1X5JA 3LKQB 3CZUB 3CHSA 4QXUL 4WI0A 1SLXA 4ZSOE 1IFHL 3KPQA 3D0AA 3RB5A 4KKBD 3LKQA 3LX9A 1I3RB 2WZ0A 4U6VH 3CVHH 4WUUB 1L3NA 4Y5VB 5A2FA 4M29A 2BZDA 4HQQH 2EUXA 1ZDSA 3U2JA 1I3RA 4MKMA 5BMFH 4OIAA 4Q14A 4Y5VA 3PDDA 4WUUA 1HL9A 4DSYA 1OOWA 15C8L 3U4EB 4M48H 2YQBA 3KPSE 4OLYH 5JORB 1DVZA 2CXGA 4G9FB 5MHSD 1TU2B 1MPAH 4KVCL 1DP0A 2FATH 1A6UH 2J4WH 3QEQD 3WGUB 3ZT6A 4NQXB 3NTCH 4PMEA 5JORA 4G9FA 1TU2A 3MLTA 5EORH 1GOFA 4JKMA 4Y4KD 4C8XA 1S7TA 4NQXA 2OMWB 4PJAF 4FMKA 4QYAA 4XXWC 2V5YA 1U2YA 4JCWA 4Z7QB 4NZJA 1CLOH 3O6KL 3QXWA 2H3NA 2OMWA 1KZQA 3C2AL 1F3RB 1J7VR 5ACLA 5HHOA 2L7JA 4FS0A 4HETA 1QUPA 4NN7B 1BFVL 2DN7A 4OH2A 2JKWA 4XX1E 5GS3A 3MCKA 2Q86B 3RG1C 3SYPA 1VHPA 2BNUB 4ZI8A 4BKLB 4HKZB 4R9HA 1ZJBA 4XVJH 3PG2A 2O72A 2Q86A 3EBIA 3I6SA 4FG2A 2BNUA 4BKLA 4HKZA 1JAEA 5T5NG 5K93A 4TL4A 1BEYL 1QSFE 3OKOA 5I0XA 2O61B 2Z4QB 1E8YA 3T0BA 1DEDA 4XNUH 1CBVL 1VCAA 3DHUA 2O61A 3D52A 3H2PA 1N64L 2Z4QA 1LO2L 2X89A 2A6IB 4LCWE 1NEZB 3B3IB 1JFHA 2GT9B 2VIRB 3F2LA 5FW7A 3GZOA 2A6IA 3AVEA 4CDGC 4PRAA 3D34A 1IM3D 1NEZA 3B3IA 2GT9A 2VIRA 3QO0B 5FWRA 2CD0A 3QZBA 3D3VA 3DK2A 2LFGA 1RMFL 3HPJB 4AGPA 3ULSB 5HTSA 3QO0A 3WHE1 1CN4A 4Z7NE 5D7JB 3KM1A 4XT1C 5KAQF 3HPJA 3MOBL 3QIUA 1J9TA 2C4FU 5D7JA 1CDUA 1UZ6E 1OCWL 3CVIH 5I66B 3SGKC 4WUKH 3EXJA 1KBPA 2QDWA 3T6XA 3IS0X 2WYZA 1P4UA 2TSAA 3LN5B 5C7XH 3I6LD 5E08L 3QR2A 5I66A 5EOTB 3L81A 2A5UA 3HNSH 3MV8D 4K8RH 1ZVYA 3LN5A 2H47C 1SJXA 3O6FB 3IS1X 3PGCB 1XBRA 4NZRH 5EOTA 5T33L 3KS0J 1YY9D 3Q0HA 5D4HA 3VXTB 3MPCA 2OSLB 3ILEA 3QNXB 4XTRC 4Z7UF 3O6FA 4ODHH 3PGCA 2WWKT 3CH8A 4OGQC 3TVMC 3ZHFA 5IQ7L 3VXTA 3QNXA 2OSLA 4E9VA 1BA9A 4F2ME 4U7SA 4LL4A 3SDXB 5E03A 3AM8C 4ACPA 3LYRA 2F5BH 4YDKL 3SPJA 1OD7A 5AKSA 5J12C 5CZXD 2WQXA 5C0BD 5DJAB 5F96H 1IBHA 3J7HA 3VB9A 3WLWC 2HTKD 1CG9B 3EBAA 2VWEC 5F2FA 4HXAL 3FHAA 4PD4J 4ODUB 3TA3B 5DJAA 3VTAA 5KZCD 1PCSA 3BAWA 1TJHH 1CG9A 1MIML 4ONFL 5F93