2L7QA

Solution nmr structure of conjugate transposon protein bvu_1572(27-141) from bacteroides vulgatus, northeast structural genomics consortium target bvr155
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MNELDIQQEYPFTVESMPVADEIAGDETVEIRLEIKPSGNFIGTVYTLRYFQPDGKGSLKMEDGTVLKPNDRYLLNEWKFRLYYTSQSDKEAQTIDLYFEDNWGNLQQLTYDFNGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein found in conjugate transposon
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7qA01
2L3BA 2L7QA 4LBAA
chains in the Genus database with same CATH superfamily
2WMPA 1N0LB 3A6OA 4RIRA 5LBSA 1F97A 4U1KA 5BV7B 3DGDA 3B4NA 3RBSA 1A5FL 4G8GD 3ZKND 2CK0L 1IAIM 3QS2A 2YD5A 4PSRA 1NPUA 4AV4A 4EI5B 3HPLA 5E2WH 4IKJA 2QV2A 4RQQB 5B39B 1BAFH 3SHSA 4WDIA 2A9ML 3S36X 4J39A 4AWJC 4A67A 3N06B 2HT3D 1NGXB 4FG6D 1ECYA 4LOUC 5KTEL 3D3VA 1RPQA 4D2NA 3FT4A 2Z35B 1XF3A 1H3XA 1NICA 1PIGA 2G9HB 3HZVB 5FCUH 1LWJA 3DKHA 4GQRA 5DYOA 5FYLD 4BHUA 4G6KL 1JZHA 2YUVA 2PTVA 1DBKH 2D0FA 4YLCA 2BIQA 5C0BE 3BAEH 3QJVB 1AZZC 5AZUA 3S2CA 4ZUSA 1AJ7L 4JKPH 2WQ8A 3UIYA 4F57H 4M4RB 4OZGE 4W9DC 1WA2X 1NCIA 1HSAA 1QSVA 2IPUK 1TXKA 5FOJA 3ZDYF 5BZWB 4DVBA 5L6YH 3B2MA 2MTAA 1HL9A 3DYOA 4CC4C 3FHEA 4UB0H 5F7LB 5IUSA 1T83A 3O3BA 4AQ8C 3GT6A 1FORL 3EZ8A 5EO0A 3GMMA 5I5JA 3DV6B 3QZWG 1E2ZA 2X28A 1I9JL 4PRPA 1IKNC 4AXWB 2C3HA 1MJJA 4P4KB 2ZCLL 2QPEB 5JHDD 4AYMC 4LEOB 4PUBH 2B20A 5GRWA 4UOZA 1FNAA 2COQA 4XMKL 1D6VH 3FB6A 5EN3A 3UTTB 1OE2A 1C5CH 1PD0A 3BMWA 4YHNB 3QEQD 3ZDXE 3VXRB 3TBWB 2GJZA 4KXCA 3RB5A 3OB0K 1AY1L 4NOBA 1CFSB 5E5MA 1G1CA 3GRWH 3PP4H 1CDYA 2MPAH 1KB5L 3HLAA 1I8IB 3S3JA 4BFFA 3TF7C 1U93B 2YLKA 4K23H 4HUWA 3BKJH 2VN5A 2APWA 1TJGH 2NCMA 4JRYB 5KVGE 3DXAB 3VVVA 2XIBA 4BINA 1JI1A 1NGZA 3V0VB 1OAYL 3V0EA 3NFSH 5J1AB 1KSRA 1RZ8A 4PRIA 3ROOB 4NQXB 2ICWB 1TQCC 4MLSA 3TNNB 4DP1X 1LP9A 2DM3A 4KUZL 2IO5A 5DEJA 3C6SA 2P48B 1DQIA 4U6XB 3VO0A 3HS9A 4O9HL 1AO7D 1BEYH 4UWQB 4EQ3A 4FAAB 3WTVA 4LPTA 1GGIH 3BVTA 4R7NA 4CVZB 3KR3H 1BAFL 2Y7QB 3ATFA 2HFEB 1XIWD 4NUJA 3KWUA 5IGXH 2J8UA 1F3JB 2XUWA 2BNUA 4PGZA 5LKNA 3FT9A 4PM1A 2WZ6A 4PY8J 4KKCD 2J25A 4RWYH 1G5GA 4ANWA 2WJ5A 3BUQA 3TGXA 3G6JA 2AANA 1JWMB 4O02B 4H0LC 1WAEA 5IJKA 3ZO0A 3OJMB 2ZYIA 1CZ8L 1NGWB 2OA9A 4Y5VB 3THMH 1JZ4A 4PY7A 2VDRH 2W88A 3BAEL 1W16A 3O4LD 5IMLA 4DEWA 4HGKC 1SY6H 4F57L 4MD5A 5H35A 2XN9B 5DJZB 3L5XL 1EMTL 1IGFH 4XODA 2F1BA 4TRPL 1DBBH 1DE4B 3FQRB 2ZXAA 4A66A 2FYYB 5L6YL 1WLHA 2AERT 3TFBA 4ZX3A 4TQEL 4J8QA 1QABA 2R1XB 2XETA 1Q1PA 1FO0B 3E3QC 3KH3A 1QFUL 4WEBL 5FK9B 3BH9B 1N6QH 1CE6A 1OGSA 4FX5A 5D96C 3N91A 4UNTA 4XN9A 2WO4A 3U46A 4L3EB 2CLVB 5KG9B 3F7PC 1XF4A 4FQLH 5DJDB 2N7BA 2RD0A 3OKEB 4L8DA 5KJ7E 2PXYD 3WBDA 2C4XA 4PUBL 4QWWC 4NM4H 1WAAA 3Q5OA 4L9LB 1N59A 3F7YB 1E28B 5MENE 2LE9A 1D6VL 1Y7VA 3GIVB 3AS1A 2Z65C 1A1OA 4PRAA 2H2PC 1VB9A 2EVGA 3DHMA 5BUGA 3JUYA 4YHIB 4ODUA 1FV1B 2UUDK 3KM1A 2R7EB 4PRDB 3PGFL 5SWZA 3PP4L 4PJIA 4CN6A 4LMQE 1G6RH 4PBXA 4S1RH 4XP6L 4JREC 2XVGA 4DOHE 4LP8A 3CSYA 1UXWA 3PHQB 5D93B 1LEGB 1BM7A 1IARB 1LM8V 1DQKA 3LAFA 3W57A 2AJSH 2FGZA 3QUZB 3G6DH 4JQIH 2I24N 3L3HB 4XCYA 1I7RA 3HUJB 3X11A 1V3LA 4YUEH 2CBPA 4Y5YA 4DZ8B 2GEQA 2NNAB 2CUHA 2Z7WA 3G3LA 3NIGF 4H20H 5BPPA 5HHXH 2WVVA 4LPYA 2JKXA 1BEYL 2JCCB 2JNZA 4L3AA 1A6AB 3P02A 1KN4H 3D1MC 4FERA 2ZXQA 1GGIL 3NIDB 3E9TA 3KR3L 4FQJH 2XQYK 3FCGA 5ERWA 2P3YA 5IGXL 3QQ9D 3X1EA 2VLMD 5E6ZA 3Q44A 1LO4L 4F8TA 4M7LT 4ZTPH 4QAWA 4RWYL 4E9LA 3FSOA 1SGKA 5FFGA 2D8KA 3RE0A 3ARDB 4X8CA 3THML 4KROB 3ZE1B 1E4XI 2VDRL 2Z8RA 3FPXA 3K72A 3WS6C 1SY6L 2NY1D 4WHTA 2B1AH 2GUOB 5FECA 4UT6H 3DLQR 3P9WB 1FL3B 1DBBL 1PFOA 1EJFA 2IBZY 5DHMC 3QDJD 2NY3B 1R5VB 1F3DJ 1TTRA 4MA1B 1G0XA 3OWRA 2NZ1A 1JP5A 4FTVE 2WXNA 3QEQE 4HKBB 3SBWC 5IFAH 4EXKA 4GBXA 2W5PA 4HKXA 3LNIA 4JFPB 4KOBA 4NO0A 3BPLC 2EINB 2UY6B 1O7SA 1QRKA 5DS8B 1DDHB 4KKBC 4JKMA 1E40A 4I0PD 5AZEH 4N2MA 4J3OH 5KSAB 3KVDD 4Y1AD 2P44B 2D2CC 2F19H 4GJTB 4LVNC 4GQ9H 4QXVA 4S1QH 3MOAL 5LG1A 3T4YA 3ZX1A 3P3YA 1AS6A 4P5RA 3WMPA 1XCTB 4DO4A 4NQDA 4GUCA 2FO4A 4TVPH 1XCQB 4XGZB 3H2QA 1FBIH 1QR1A 4JCWA 2DYPA 1AIZA 1P2CA 4RZCB 5A16A 1XGRB 3ISWA 2DI9A 4PB0L 1F00I 5EUOA 3IGAB 5JYLA 1DLFH 1AO7E 4PLJD 3QXAA 5IQ7H 2NY6D 1G6RL 1SM3H 3H42L 1J8KA 4OBRA 3K81A 4FMFA 1FQ9C 4HH9B 3SDCD 4XVJL 5HYJE 3ZR5A 2YIHA 1OWWA 4IKNA 3EFFB 3MSPA 5I6KA 3FW6A 3KYKL 4JQIL 4Q2ZB 3G6DL 1L9SA 3C5ZA 5DTFB 1T7WA 1I8AA 2P45B 3VYPA 4AE1A 5L2JB 4HALA 4PVBA 3OX8B 4YUEL 3BAXA 4LCIH 2EO9A 3GMNB 4H20L 1R0AH 3BQUB 3R4DA 2H32H 4XMUA 5A2LH 3ZGHA 1CFQA 1KN4L 1OM3L 4EKJA 3RGHA 2WHVA 4TUOA 5DMJB 2FSEA 2YC1A 3SO3C 4FQJL 4DK3A 4QLRA 1U3NA 4ODBD 1EH9A 3U4AA 3O2DA 4FMVA 4PLNC 3FT0A 3VM5A 4ZTPL 1QSZA 3DSFH 4OR1A 3D8MA 5BMFH 5AW4B 1IUZA 2EXYD 1E2WA 4HIEA 1XH1A 1B4LA 4OI7A 1XGYH 4FFZA 4W6XB 2BSRA 3HI6H 3LN4B 1BGXH 2ATKA 2NR6D 3MODH 2WINA 1EZVY 2AV1B 2ZCKH 3ABZA 2B1AL 4XT1C 4X9YA 2XT1B 3RUGF 4EF3A 3NZUA 2OTWB 4UT6L 4PB9H 3TN0C 1Q90A 1UG9A 3QO1A 5GSRB 2NW3B 3S3CB 3Q06A 1NGYA 1G7MA 5E6IB 1KG0B 3B8YA 1IIIA 1R3HB 3CFDB 4OF5A 1ASOA 1H3VA 1M71A 1U0QA 4U1LA 1C16B 1P4LA 3F7LA 5C0CB 2WUBH 4PJHE 5J9PB 3VTTA 3OJ2C 4XE5B 1ESOA 1QRNB 2E74C 2E6JA 1ZHLA 5CN3A 2F19L 2WLIB 4GQ9L 4HIXH 5EA0H 4WO0A 3T8VA 4TUJA 1HYSD 4UM9B 4M8VA 3NA4A 1MAMH 2IALA 2D31A 1FBIL 2WNGA 5KYXB 4HX1B 1BFVH 1PZ2A 1V8HA 2BNQE 2Q86B 2OTUA 3UJTH 3EFOA 2R0LH 1ZJAA 3L3OC 2PWHA 3B83A 1KULA 2H6PB 2FO8A 1SM3L 3CVCA 1RZQA 4Q6KA 5IFHL 4U6HB 3ZRSA 3WLBB 1INEH 2Z93B 3P3TA 4GSRA 4HLZG 4KI5D 1CJYA 4TS6A 3B9KB 3PL6B 5K9JL 2ZUVA 1FDLL 1QLEH 3ALXA 5MEOA 1TYJA 5D1ZI 2OMYA 3IE9A 4QRQA 3K7UA 3KPSB 2GCYB 3K46A 2X6MA 3IDXH 3ZT5A 5C0IB 4CBPA 3GSWA 2DJSA 1FP5A 1I3GH 2FT6A 3DJRA 4F92B 4P2CG 2OSXA 3I9GH 3CN3A 1E5BA 5LXVA 1G7QA 3BVUA 2ICEA 2YZ1A 1M7DA 2EYRB 1ZJBA 5F21B 4E9SA 5KVMC 5I71C 4F7PB 5GRYA 4H0GA 3B2XA 4MXQC 2XBDA 1KB9J 4N2AA 5D7LA 3D3VD 3MODL 2XYBA 2PPAA 4OF3A 2ZCKL 4OGYH 2J5LC 1TEYA 4GAYB 1RZJH 1YECH 2ZE0A 4ZTOH 2ZUQB 1QQDA 1FE8H 2OR9H 4GRWE 4HIJA 4PJ8C 4C56B 1B9ZA 4HKZA 2JKNA 3G5VB 3NJXA 5AB2A 4PRBB 1CLZH 3MKGA 5AYUH 4B3VA 3ETTA 4A7UA 1JGEA 2WUBL 5CSBA 4YZFE 1MF2H 2BDNH 4HF5H 5DUBA 3FQXA 3B1TA 4B60A 3OMAB 4BUQA 2DZEA 4YSQA 3R0MA 2VR3A 1T5XA 2BY3A 3OKNA 1A6UH 4LIQH 4B0MB 3ULUD 1CYWA 3LD8B 4NRYA 1BIHA 1QSFB 5EA0L 5KJ4A 5IVNA 4I18C 1NEUA 1GJWA 2DN7A 2YGOA 3JTTB 4P59H 2EACA 5CIPA 1AGBB 1KTBA 4WK0B 5EBMB 2PF6A 1D2OA 1BFVL 4G1EB 1QTSA 2F18A 4PRPD 3VGDA 4IDJH 1PEWA 1T0MA 4X6CA 1GS7A 1FZMB 5C0NC 3PHOB 3CBJB 4LSPL 4FG0A 4FXTA 1INEL 2AXFA 1A7RH 1MHHB 4NFCA 3RTQB 1THAA 3G5YA 2XBZA 4MA7L 5C6TH 4NAQA 5DVMA 5I6LA 5H37H 3WJLC 4A38A 3PJSB 2BIOA 2N1TE 1YNLH 3SE6A 3BPCA 4JFDD 4HJEA 1QLEL 4GG6E 2V2WB 2JVUA 4UU9A 1AHMA 4LAQH 3KBFA 2VL5A 4QRSB 2B59A 4UQ2B 4IOFD 5T1LB 3QNXA 3ZY7A 4ICWA 3UTQA 1DDTA 3WLWD 4KGJA 4OFVA 1NFIA 1VPOH 4ZFGH 1BZ7A 1I3GL 5CKGA 4PRID 1X5MA 2CIKB 2HG5B 3I9GL 3MR9A 4LPWA 4CKVX 2ITCB 1ITBB 2EDFA 3HE7C 1HOCB 1XZWA 1GW6A 3CLEH 4YEEA 1KLUB 5SV4A 2YS4A 4QRRA 2Y07H 3KBEA 1L6ZA 4K2UH 3I9PA 1K5NB 1AGEA 2DI8A 3QPQD 5CN1A 4K3EH 3AS3A 4HJGB 4ZDHA 3D85B 1NBVH 4FLQA 2IMNA 3VD7A 3X1FA 5L2KA 5T3XD 3VGAB 5BNXD 5CLTA 1EDQA 1XMWA 3E0GA 4N0UE 2DQJH 1LD9A 1YECL 3D25B 3DOHA 3GLEA 4RFOL 3MRHB 3VXUA 4ZTOL 1JNHA 1DVZA 4QRFA 4G42A 4OCSL 5LVEA 3O4OC 1WSST 2FE0A 4O2CB 1KY6A 2XWTB 3SZ6A 1ULVA 1SFHA 1CXIA 4P46A 4RMVA 5K9QI 4HS8H 3O8XA 4UNIA 4IBTA 2N7SA 2P8LB 1MF2L 2EH7L 3UMNA 2YD8A 4Z7UF 1T6BX 4M43H 5L9DH 3JV6A 3QWQB 3QUXC 3ZDXB 1NDGA 4LIQL 3UPRB 3UOAB 4U1GB 3RWEB 2OYPA 3HMXA 3P73B 4KI5E 3TONA 4CU8A 4ATWA 3FQNB 4AEIH 5JIDA 1QX1A 5EMYA 4G80A 4N6RA 1QZNA 1U8LB 4GP4B 1CLVA 4IDJL 3MV9A 4FFTA 4R0LA 4HS3B 1SMOA 3SPCA 3D18B 5CM1A 1IQWH 1BQRA 2CDFA 5J57B 3WFCH 2ADYA 3IGLA 3LV3A 4QHMB 3UAJC 3FTXA 5GIRB 5B1AB 3W11C 5E08H 4KC3B 1A7RL 4ECNA 3R1GL 1YEKH 2XG5B 5C6TL 3ZO9A 3ASOB 3PNWA 2MIZA 3PWLB 4ZYKA 1B88A 2BSSB 4YDKH 4J3UA 3TT1H 3GYRA 3UYRH 4F8PA 5K9QG 1J0IA 4JPWL 5IW1A 1OK8A 3UTSB 5BVJA 2TRYA 1Z5YD 1JZJA 3O3DB 1HOEA 5ECGA 5I8CA 1UH4A 1IL1B 2CUMA 2AI0L 1F3RB 3F12A 3DJTA 1NWPA 3H2WA 3OAZH 3SDAA 2CO2A 4ZFGL 5DVKA 3QIUD 3NFNA 4XC3L 4BZ1H 5FUZH 1WEJH 4JRXD 4Z77B 1CI3M 3RWFB 4ESKA 1YLBB 3HRPA 2Z1PA 5LAPA 4I13B 1OSZB 1SDDB 5TH2B 2DMCA 3L9RA 4L8SB 1F41A 2Y07L 3CSBA 4LHUB 4UTBH 2P80A 1B4JH 2JELL 3MU3A 4K2UL 5TE7H 3BI9X 4JPIA 2E75C 3Q8BA 3RIKA 3OQRA 4ZO7A 3NK3A 4K3EL 4ELMA 4F2FA 4XZUA 1AGDB 5B22A 3KYAA 2HVJA 4GMSH 3BD5A 4Y19E 2KZWA 5B39G 5KS9A 4U1HB 3TX4A 3SBRA 3RPBA 1E9OB 2DBJA 2QJDA 3MJ7B 4TNWF 5F96H 4PG9A 1XTLA 1P9MA 4G8AC 4KJYA 2VDLB 4HS8L 1AC0A 4PRPE 3GHPA 1J5IA 3MTXA 3F83A 5MENB 1EVUA 3D0VA 8FABB 3DX7A 43CAA 1FAIH 5D7IF 2OI9B 4M43L 3B7RL 2AEPH 1EA9C 2PNDA 4MNHA 4UIMA 4LEBA 5FGBA 4KUCF 4BYHA 1NGQH 2TSAA 5MEPB 4M8UA 5J12B 3FB5A 2B0SH 4G8GB 4ONFL 4CNIB 3L3IA 4WFHE 4NO0D 5FO7A 1GL4B 3MRIA 2Y7NA 4GKSB 4ZMAT 2CJUH 4JFDE 3ULVH 2IGTA 4R5VA 4LZKA 4XXCA 2R4RH 4CDGC 2NDFA 1WWWX 2BY0A 2ICWI 1IQWL 3C60D 4WNQB 1S7WB 2A6KA 4YC2C 4DGUA 3WFCL 3IS0X 5F9DC 1MCQA 1BP3B 5E4EC 4NQDD 3V7MA 4MZ3A 2HJLB 4HSQA 4Q58C 5AD0B 4K5OA 5E08L 2DYPD 4V2CB 2GJRA 2QPDB 4O00A 4PGJA 5B3NA 4JPKH 3DVFA 3D5OF 5C09D 3U30C 1J5OH 5LQBH 4N20A 4YDKL 3RX5A 3DX9A 5D5MF 2MCMA 4DCQA 3ATDA 4J3WA 3RTLA 4LLAA 1SOQA 5IESH 1LMIA 2WBXA 1JNNH 2L3BA 2V33A 3IXTB 4PJCA 3WHE0 1A1NA 4XBGB 2YN5A 4XR8C 3C5ZD 1XGQA 1K5WA 2VWEC 1MLCA 3WFHB 4ZNEA 3HE6A 3TYFA 3BEWB 3AT0A 3KYNA 5T3XE 5KN5A 3ARGB 4A2DA 1IJNA 2K6YA 3WAJA 3AQZA 3G6JE 1CYGA 1AD0B 2NY0C 3BVDB 1JTOA 3MBEC 2NTSP 3QUMH 5DRXB 5DHYB 3SGKA 3JYCA 4TLUA 4XB3A 1KT2A 1JZIA 3CJJA 1HVXA 1RY7B 5HYSB 5TE7L 4BJLA 1R47A 4F27A 6FABH 1J1OH 4HCRH 4CADB 5JHDB 3M8OH 3LEVH 3EXJA 3MBXH 3NJKA 5LDSA 3FTZA 4KKPA 1ERNA 2G3NA 1XF5A 4AKQA 3UG3A 4NLHA 2V9RA 4M6AA 2PO6C 4GAGH 2CHXA 3VX0A 3L08A 5K5YA 1EHKB 4ZFOL 3GBNL 4DP2X 5F96L 4UTCA 4AENA 2OSLA 3CLFL 2FJFB 4XI5C 1H3GA 3GS0A 1ZT7B 3IKCB 3NJVA 2IPTH 3TA3A 4PN6A 1HHHB 4KRMB 1QD0A 1FAIL 4EZKA 5KVFL 5D4IA 4KJWC 4X4MA 2AEPL 3L4ZA 1DN0A 2V7NA 4FI6A 4N9OB 1KIQB 5KOVC 3DRTA 3TFKC 3CDGA 3BN9C 3IJYA 4HBCH 5CJ5A 4DN4L 2H41A 4JGJA 3H3BC 4X8XA 2B0SL 2YQ2A 1AO7B 2J56A 4WGVB 1CO1A 1OGTA 4Y7OC 5IVOA 3KJ6H 3KGUA 3NEEA 1BG1A 4JN1L 3FCTA 2F54E 2W95A 3HS0B 3I50H 3IT8D 3ULVL 2EYSB 4H8HA 1O7VA 1C08A 4D0BA 2R4RL 4GKLA 1NM9A 1AHWB 1XIWB 3T8XA 1YEHL 5CEYB 1P5UC 1FNSL 1FFPA 3RZCA 1A6ZB 5C9KA 4IBUA 43C9B 1U8MB 5T5FA 4WWNA 2E7MA 4LKXB 3R7QA 1PAZA 4PH8A 4YK4C 4JRXE 4MJIA 5D1QE 1QLRB 4JPKL 3CBRA 2VDKB 4HHAB 3LXCA 1J5OL 5LQBL 3S3DB 3GDCA 2DS4A 4KTEH 3MLPA 3O4LB 3GGWA 3GM0A 1DJWA 2VQ4A 3ESPA 1DR9A 3S4SA 5IESL 3ILDA 4HMEA 1ZGLB 3GMQA 4F9PC 2E47A 1L7IH 3LCYA 4BCYA 4FQXC 1WJ3A 2DIEA 5CGYD 3PGCA 2PCFA 5DD3L 5EF0A 3DK2A 3GJFA 1QASA 5L7XL 3EF4A 1G7PB 1OGPA 2BSEA 3GIZH 1JSYA 3EJPA 4ZQKA 2AGJL 5IREA 4J3TA 4WU5B 2E8YA 4HWNA 4WV1A 5E8NB 6FABL 2W0LA 2ED8A 1J1OL 4HCRL 2PXYB 4PTUB 2D4DA 5EN2A 3U9UB 3RWIB 4FNUA 2UZXA 1TCRB 3ZU8A 5I5RA 5CSGA 3FB8A 4D7BA 3DHPA 4X99A 1JZ2A 2GT9A 1JRHI 4WEUD 4YDVA 1JE6A 3CFKA 4ODXB 5AVSB 4GAGL 5KBPA 5F7FA 3WTSA 4PJHB 2ZYSA 1N2RA 4AITA 2D3VA 4HOWA 1OSPL 5JHLA 2E0PA 3KGRA 1TR7A 3VSVA 1CF1A 1U30A 3CHOA 1RHHA 3VXSA 2IPTL 3H1ZA 3INOA 4GS7B 3L6FB 1A9EB 3QI9A 2QGBA 4ABWA 2HFGH 1ETA1 2A9NH 2QQNH 3L2NA 4NQEE 4NQDE 4B9CA 3MCKB 4E9YA 2HKFH 1H0DA 4MA8H 4B9KC 1I1CA 4FQCH 5EU4B 5BO1H 1Z3GH 5C09E 5JXEA 1VACA 3L3JB 5FGCE 4HOXA 1NOAA 4IMKA 4LCVA 4K5MA 3P3SA 3WY3A 2VXSL 3P1VA 3P9LB 3TURA 4QHLA 4OUUB 2X7LA 4HP5A 3MFFB 5DJ2A 4FQ1L 1SN5A 4QD2E 3EG9B 4WO4A 3MV01 4S1SH 1YCSA 2BS9A 5TGBB 5L0QC 1ZTXE 2VLLB 2HPOA 1PYWB 4UQCA 3GUFA 3OHXA 3SKNA 2VITA 4Z7VE 5TDNB 5IV2B 3S88H 3RU8H 4PJAE 4F5CA 2NT1A 1KFAL 3NG5A 2FNWA 3AG1B 1IEAB 1OW0C 3CC5A 4KTEL 3NT0A 2WLLA 2COVD 4B95C 5FA3A 2NY1B 3KW7A 4U6YB 5B7MA 3DTXB 1X5XA 1P7HL 2B5IB 2QFRA 3RX7A 1M6OB 2FZ3B 2CRZA 2MOVA 4XB8A 5INDA 3GBML 1OAXH 3C5SA 2G30A 1S7TA 3QDJB 4JB9H 3DA0A 3G7TA 4K3JL 1JTPA 1PGRB 3ARBA 3PS6A 1JF1B 5JW5A 3TH4T 3FRPB 4B9ZA 1UHVA 3EBHA 3U25A 1JHKH 3BKCH 5EIIB 3DOSA 3HUJF 1NGPH 1OQOA 1E9QA 1IAOA 1H5BC 2FQEA 1RZIB 4I0PB 2MCG1 4MWFA 3ZKMD 4I1RA 3T0EC 4Y1AB 2JCCF 3FZUD 3H4HA 4IRZL 4QCIA 3NIDF 1JRHL 3SQRA 5IB2B 4JN2B 2IH1A 4PWHA 2A38A 4H0IA 3II2A 1Q9OA 2NUTA 1MUJB 4MRCA 2EXSA 2FD6H 5IEHA 2X4NB 5IMOB 3B2DC 4M9OA 4BM7A 1DSFH 2IXQB 2X2IA 2OJEA 1SOSA 1D5IH 1J8HE 4NCC2 2IF7A 2H3NB 3FTGA 2NY6B 4XWOC 1LO5B 2Q8AL 1NCTA 4X7TB 1Y07A 1IGYA 1WPCA 2QR0A 3MXVL 4HIPA 4N8VA 3ZE1F 4OFYA 5L2KD 4ZX6A 2TRHA 3SDCB 2Y6SC 2F58H 4U1JB 4XNDA 3VXUD 4DUXA 2FK9A 2A74B 1AGCA 2TAAA 3TIDB 3QJFB 1B3IA 2QQNL 2A9NL 1F56A 1VGEH 4GRLA 3CFEB 2HKFL 3N42B 4UI2A 3GTTA 1JHLH 1KYDA 3ZIYA 3C08L 4LL1A 5CLWA 2PUQT 2YQBA 4HLJA 3WUWA 3O8XD 5JDSB 5BO1L 5FF6A 1IGIL 3GJEA 1Z5HA 4DP9X 1U3HC 1FCGA 2YAOA 1RSFA 1HHIA 3KPOA 2EDDA 3N2JA 2HFTA 4OZIA 5GJSH 4S1SL 4LEXL 4KKLC 5SWSB 2W60A 4H44C 1HNYA 1S7XB 3ZYOA 5DJYB 5AYTA 1WO2A 3LHAA 4GO9A 4AGPA 1NFDE 3S88L 1N5AB 3CNKA 2NW2B 3RU8L 3F01A 3MV9D 3ZL4L 1JZ8A 4W6WB 3IRCA 3HPJB 1GCYA 4QRTA 3D12B 4K7PH 1I1FB 2DICA 3VGEA 2HN7A 4HUVA 3B2UD 5HTSA 2NYYC 5KSBA 3OKLA 3VFUB 4P99A 1MNUL 2XQBL 3CN2A 3E6FA 2CKBB 4UT9L 1XSOA 2OW7A 2WXOA 5KWYC 3KYMA 2Z8SA 1OAXL 3RVWC 1OCZB 3OGCA 3FCSB 4JB9L 1H3PL 5EC2A 3BP6A 2Q3XA 4K07A 2CBOA 1L9PA 3CWGA 4J3VA 1HHJB 4EVNB 3C75A 4R4FH 4P3DA 4WUUA 1JHKL 3DX2A 3BKCL 2X70B 1J1XH 3PUCA 3AREC 2XG4B 3E8UH 3IXAA 1DO5A 4GG8B 1BBDH 3OR6A 4QRUB 3SDAD 2K4WA 4EZJA 2FLRT 3HJEA 4IM8A 5DDHA 3NZ8B 1FSKC 4N0UB 2JJVA 4YHYC 1U8HB 1ZVSB 1UA3A 1S4IA 5ICXB 5ITFB 2I9TB 4L8BA 3QRGL 2DTML 3ZN6A 1U36A 4HJSA 3QEHA 3U0PB 1FA4A 4ETQB 1AVAA 3H6AA 2GTZB 4J12A 2A0LD 4LSQH 1DSFL 2OJZL 2P80D 4HWBA 1D5IL 1T66D 2FYVA 4NUPA 4FTDA 3E1ZA 2WKOF 1KTDA 5T3ZD 1U8OB 5HDBB 3QFJA 1KTLB 3NSYA 2ZP8A 1FFOB 4JHWH 1NPJA 5F71A 2FJGA 5IQNA 1YPZE 3S7GA 4Q6YA 3CFIC 3MRJB 4LKCB 4IRJC 3IEAA 3ZQWA 4JL2A 3WS3B 3BZEB 1CICC 1KLFB 5LWYL 3D06A 5KJRL 1VGEL 2QGDA 5I24A 1HINH 2Y3NA 1RZ7L 1G7LB 2NXZC 1JHLL 4WNSA 3KPMA 5D71H 4HT1H 3WY2A 5AVTB 1MCKA 3M17B 5D1ZC 4KXAA 2R2HB 3KLKA 2X4OA 1PJ9A 1HU8A 2OMZA 3GMOB 1MVUB 2HX7A 2WMPB 3HHRB 4YPGA 1G5AA 1ZA6A 2QPSA 3Q2CA 4JM0A 4RIRB 1B90A 4U1KB 5I6XB 4AY0A 1HTYA 2WZAA 5E4IA 3HG2A 4P2OC 4JQVC 3A67L 5E4OA 5HHNA 4HOZA 1RP8A 3ZUNC 3HPLB 1R6VA 1SHMA 2EE9A 4LT7A 4DH2A 1TMQA 3PAUA 3JUZA 3EOBB 4WDIB 1CC3A 2CMRH 4OGQC 4QXUH 3I6SA 4F58H 4MQSB 1DUZA 2MQGA 2NXYC 2YD1A 4HJ0D 4JFUA 4UZSA 1MHCA 2ESVD 5I16A 3D3VB 1URZA 1FVEA 4LSTH 3N40P 4GSUA 3FT4B 1G1YA 3LVTA 3LKOA 5JPMC 5DYOB 3BVNA 1E4HA 3CVDA 2HT4D 4GI9A 5FV2A 4E42A 4NN5C 2AK4E 2YKLL 4LARH 1T89C 1LTXA 2FX7H 3IJSA 4PJBA 1QMUA 4ZUSB 1BXVA 1KGJA 2RACA 3GSNA 3FHAA 4RSVA 1IKFL 1HSAB 2RHEA 4YBHA 3GEWB 1J1XL 4XHQA 4RESB 2ZD0A 2A9CA 1XGZA 2EO7A 3E8UL 3I3DA 1B0GA 4DVBB 3OJVC 5EU6A 1SXCA 1MWAA 2JE8A 2V3FA 4NDMA 1QYGL 2EAEA 3LIZH 3IU3A 5L2KE 3HE6D 2RJMA 3TO4A 1ZGLP 4CBZA 3O3BB 4A7VA 3OPUA 3IAGC 4ODTH 1DLHA 3H9SA 5EO0B 3GMMB 4ES8A 3BSHA 4L2YA 4PRPB 4XOCA 5I1KL 2EZ0D 3ZKQD 5DUPH 1MJJB 3DJZA 3VFPA 1EDYA 3FB6B 5I26A 2WBJC 4JHWL 5DEZA 5KVGH 1J8SA 1NCUA 3ZE0E 1EGJA 2GJZB 2CR0A 1UUSA 1AXTL 2IOIA 4H2CA 4JM4L 3BDYL 5E5MB 1J1PH 4ZPVA 1F0LA 4XVTH 3HLAB 4JFDB 3ZZSA 2OULB 3U48A 5AWNL 3L1EA 4HUWB 5D71L 2OYKA 4HCIA 4HT1L 1BHGA 4X9IA 1UKSA 2F53A 3AB0B 3RZWA 4DK5A 1NGZB 3APFA 2WOBA 5F3FA 4OB5L 2QKIC 1RZ8B 2DDQL 4PRIB 1CTNA 1PEZA 3GHEH 1LP9B 2EVIA 1ZWIA 4B7LA 4WFEE 3C6SB 5DF0A 4Z95H 4I5BA 1I9RH 5A7BA 3HG5A 3RVXC 1XSJA 4I3SH 3GF8A 3HAEA 4QTHA 2Y4SA 3U6XA 4R7NB 1OSEA 3EGXA 1RLWA 2WSKA 1FVDA 2NYZA 4MMZC 4NUJB 4F58L 4V1DE 1U8QA 3ARUA 2J8UB 2BNUB 3SY6A 3RZCD 5I5IA 4RGND 3ZL2A 1HT6A 5IB3A 4NN6B 1HH9A 2K8QA 3G6JB 4MJID 4RRPA 4KRPD 3N1MC 4LARL 4PY7B 2FX7L 5IMLB 3HC4H 4MD5B 4JDVA 5H35B 3MV11 5TK2A 2PPEA 4LXFA 3B3IA 2F9BT 4W1TA 3U4EA 1BSIA 5AOLA 5HYQA 4MA3A 1QFWH 2FWSA 2PYEA 4XAWL 4CC1A 3L3DA 1A4JB 2VERN 3LIZL 4OF8A 1NLBH 1RJLA 2N59A 3AG3B 3AVEA 3D39E 4FADA 1XZ0A 1CPUA 3IFLH 1WIUA 1ZY9A 2I69A 2BSED 3CSTA 1CE6B 3K80A 4K8RH 4MZRA 3GRBA 3U46B 4I88A 2F08A 3AMKA 1XF4B 4Y4HA 4DETA 2Y06L 4DAGH 1I1YA 4F15B 4PGDA 2YO3A 4N6QA 1JD9A 4L8DB 2G75A 4OM0H 4UYQA 1N59B 1DVUA 1CFNA 2RCSL 4YSUA 2D7TL 5I0YA 5BV7C 1A1OB 4PRAB 4XX5A 3GJFH 1DYZA 5DVPA 4LSVH 1E8WA 2OW6A 4IW4C 5D72H 1RU9H 5E0FA 4EI5C 1A0QH 4ODUB 2PWEA 5SWZB 5FAAA 1W2KT 4PJIB 4ZS6C 4E9WA 5DZVA 3FH5A 3HBGA 1UD6A 1BM3L 4NKMB 3CSYB 1UXWB 3MUHL 3R7RA 3ETBJ 3VXSD 4AYID 4QGYA 1D3CA 4ZMNA 3EGDA 1WH0A 3T0VA 3N1FC 3LRSA 1UGKA 2ESVE 3QI9D 5EHFA 4JKLA 1R46A 2WWMD 2X4QA 3MJWA 4XNMA 4ELKA 4XCYB 1I7RB 3X11B 4KKZA 2P43B 1RSYA 5TF1H 4JRXB 1JOIA 3WXWH 2EKSA 4PRHA 4Y5YB 5CCJA 3ZDXF 1JPEA 2D03H 5FO2A 2WVVB 3SYCA 2F7RA 5JHLH 3QR1A 1V05A 4XPFL 1OE1A 4G2AA 4IMLA 2RALA 1KGCD 2HFFA 4G59C 5DGQA 4GT7A 1EXHA 1LL1A 2WXFA 1QWHA 2RMNA 5ERWB 3U83A 1MRCH 4MJ4A 1VFOA 4M03A 5CJOH 4PJCE 4URKA 4W4OA 5FYKD 5EH1A 4JJHA 3CXHJ 2VZ1A 2WYIA 1FNEA 3G5WA 5GGSA 2YWYA 4CSPA 5HGGS 3D87B 2DKUA 1JPSH 2PR4H 4FL4C 3K72B 3ZT7A 1YY9D 3KGSA 2VABA 4WWKC 4WHTB 4F91B 2DM7A 2DBLH 3L9EA 5FECB 4G8FA 1OT2A 4P9MH 3T0WA 4G70B 2ZWLT 5IEKA 3NRFA 2VDLL 4Z3FA 4MJ6B 4OLXL 4WI0A 4QLWA 1NLBL 4LLMA 5JQ6H 1TZAA 2DLFH 1HJCA 4NQTA 5DJAA 1S5HA 4F2ME 2D73A 2LU3A 4YBQD 4HKXB 2V9QA 1YYCA 5JIQA 1DVFA 2MTPA 3FN3A 2DQIH 4NO0B 1RP9A 4K8RL 4BIKA 1U8IA 2VL4A 1TTFA 1YAZA 4KNQA 12E8H 1JHTA 2XIDA 3T4YB 2F7OA 2C7FA 3TM6A 5CD3B 1EBPA 2VYRE 1WBXA 4HFUL 5E8DH 3I74A 4MAUL 3QFGA 5CHNA 4NQDB 4F80A 2FO4B 4L1DA 4K5LA 3ULVC 4UDTA 3ZMEA 2DYPB 1QR1B 1P2CB 4MAYC 5A16B 5HYSG 1RU9L 3VGFA 1DFBH 5C09B 3BFQG 4GI6A 5EUOB 3QXAB 1X9QA 3BYTA 4PS7A 1XR8A 2P5WE 4C4UA 3EBAA 2CO1A 2F8VA 4HK3J 4JPVL 4PREA 3J27A 3ARFA 4OFYD 3FTUA 5GS0H 3BIKA 3NEOA 3QP3A 2DEXX 1ZPUA 4CMMB 3WTTA 4OI8A 3C5ZB 1JMXA 2VLKA 5HVFB 4UCFA 3IN2A 1N64L 4M5SA 4MD4A 4RMRA 3DJ9A 3EGSA 4GRLD 5TF1L 5C0DA 2XV6B 1PY0A 4HUMB 5B7FA 4MJIE 4YX2L 3B37A 3FYEB 4ZSOA 4RGMB 3K71A 2JFCA 4U7SA 1CFQB 3O41A 2DEWX 2XTJD 3SIKA 4ERSH 4TUOB 1BQKA 2FSEB 2A6DA 2XJLA 1TVBA 1PCSA 1P84K 1JAEA 1EHXA 1MRCL 3MXWH 4L37A 1UCTA 4X6BB 2K6WA 2AEWA 3QULA 1V7MH 3F7RA 3QIBA 1NAMH 1A66A 1MCHA 3ZRFC 3IDNA 9PCYA 4XN5A 5GHWL 1QPKA 4HIEB 4MVBD 5DQJA 3S37H 2DIBA 5IMMA 1D9KA 1JPSL 3FULA 2ZIDA 3MA9L 3TBTA 4AH2A 4HMCA 2BSRB 1SXBA 2ATKB 2WINB 3FN9A 2DBLL 1ZK5A 3CZNA 2P26A 3APCA 2Y2TA 3G04A 1RZPA 2F5AH 5ABZA 5JIPA 1NGYB 1G7MB 1CLCA 1OWRM 1B2WH 2D7OA 1ED3A 2O6PA 5JQ6L 2DLFL 4UM8A 1M71B 4YNYA 4U1LB 4KO9A 5C0RH 2RA1A 4PJXE 4WUUD 1AQKH 1P4LB 1Q72L 4DFIA 3PQYA 1T1WA 2ATPA 4YXHH 2MCPL 5GZNA 5D93C 1R5IA 5I15H 1YSOA 1ZHLB 3QUZC 1Y0LA 4TSBH 2YJQA 4KMTH 5FHBL 2W9EH 1YHPA 5ABAA 3D2UA 4XPHH 1JZGA 3GXMA 4TUJB 1IGJA 2ZYHA 3D34A 3EOTL 1KJ3H 1DVQA 2IALB 2D31B 3GLZA 1HAUA 3I2CL 3US1A 3V4PA 4W9EC 1KIUA 4U3CA 2OTUB 4AVKA 3EFOB 1VHPA 4GKZA 1KGXA 1IAKA 1TJIH 1Z9LA 1OY3B 2JQMA 2YD9A 5HVWA 2A99A 3QFJD 2YGQA 4OBSA 3ESOA 5TQ0H 4B53A 1RJYA 1J9QA 4OSUH 3WFEL 1T1XA 4J28A 2ITDA 5GISL 1KGCE 1EO5A 4X50A 4DEPB 1D5BA 1H6TA 4B97A 5I1GL 3HI5L 4FABH 2A7BA 5MEOB 3WKQA 2OMYB 4QRQB 2W9LA 5ESQB 4F5CE 4IGBD 2ADFH 4OD3H 35C8L 1IE5A 1OSYA 3TIEA 3GSWB 1MREH 4ERSL 3WKYA 3KJ4C 4P5TA 1A7NH 1BOGA 4K7FA 5LDUA 2N7AA 4OLUL 1A3RH 3GPSA 2NY3C 4MA1C 3MXWL 1JBJA 1G7QB 1T80A 1M57B 2K8MA 3W3BA 4TKWA 3N40F 2ICEB 1NAML 1M7DB 2K45A 3NCEB 4EN3C 3GI9H 3CVBA 4GRWH 5F6IB 1AG0A 4L0PB 5EC1A 3VW3H 1BYOA 3WEXA 1L3NA 5HJBA 1GS6X 1ND0A 3H7BA 3PWPA 5D7LB 3WN5A 1T3FA 4JM2A 4G7QB 4YH6A 2LU4A 2WNXA 1SEQL 5K1JA 3ARPA 4QHKI 1R19A 1QQDB 1UB6A 3L81A 1QFOA 2ZJSL 5IROA 5CR1A 4HIJB 1JXFA 2ZOOA 2NX5D 3CX5J 3I6KA 4GMTH 1B2WL 2VRKA 3MNWA 4HKZB 5CJBA 4NI6A 1SF3A 5C0RL 3UEQA 3RGVD 3ZKXC 3H54A 4I4WA 2AEIT 4BQ6A 1JGEB 1GVIA 4DVRH 4YXHL 3KEDA 5DUBB 3FQXB 1MW0A 4D8PA 5IG7A 4N0FA 1HL4A 1T5XB 3FONA 3PV7A 5EU6D 3OKNB 3RVUD 4PBDA 5I15L 3D0AA 2BW4A 4NRYB 4TSBL 3TO4D 5HYFA 1CFMA 3SD2A 5FKAA 5EZIL 5LGKA 2W9EL 4TUKL 5JXAH 5EIIG 4NYLA 3H9SD 5CIPB 1NINA 1VRSA 3K6DA 4BRJA 4PD4J 5IFJA 1Z7JA 3RY4A 4E5XA 3GSNH 3BQUC 5E2UH 3P4LA 3OAYH 1IQDA 1T0MB 1T03H 3BRFA 4X6CB 1TJIL 2VZUA 1P0SE 4WI8A 3T1FA 5TQ0L 3QG7L 2Z34A 4OU3A 4PJHF 4OSUL 5E0QA 3B9AA 2DJUA 3IGFA 1F90H 4JY6A 1I7ZA 1P5VA 2AXFB 3L4CA 3H53A 2VZVA 2Q8BL 1IRAY 3G5YB 4LESA 4MNQA 2IG2L 2XXMB 4V11A 1KXQA 1KN2H 5DZOA 4M48H 3BPCB 4TXVB 1JFQH 3SOBH 4UU9B 3A4DA 4WU7A 3WENA 4D9QD 2VL5B 1AP2B 3B34A 2B59B 2H6OA 3QNXB 2BOBA 2ADFL 3UTQB 5I1DA 2MH4A 4KK6C 1Y6MR 3L45A 2F53D 1NFIB 1GYUA 1BZ7B 1EGJH 4UBDD 1S7VA 3MR9B 4DP8X 3JVGA 5FM5O 5IW6A 4TTDC 5E6IC 4UQEA 4WLCA 5D6CB 4DP4X 1CVSC 2WWNA 3UBFA 4B5ZA 4AJWA 4QRRB 3WCYA 1TZHA 4ENZA 3GI9L 2WQRA 5I1EH 3EFDH 3JV0A 4KY1L 3VW3L 2OSYA 1AGEB 4Y2LA 3EYUH 3WTWA 1MZYA 1F6FB 2JJTA 3IRZA 4JGNA 4X6FA 4ZDHB 5F1NA 4C54A 5L2KB 1U2CA 1A14H 1VAHA 1JPFA 4FNQA 4B3EA 4KHTH 4WW1A 1AYRA 1LD9B 4I87A 3VXUB 3B2PA 3VFRA 3NIFB 1JNHB 4G42B 3B43A 4OLZL 3RWHA 2J7LA 4GMTL 2O61A 5BRPA 4XMLH 4WENB 1JDDA 5EEYA 3UYPB 4ZX4A 2PPCA 1TPXB 3UZEC 4ISVA 4P2RA 3O8XB 3VDAA 1TVHA 1NMBH 2QBWA 2VAJA 1NIEA 5C07D 5LGJA 1J87A 4DVRL 3SBPA 4H8WL 4PP1C 1HH6A 2OX5A 3WIHH 1KPRA 1PKQA 2JK5A 2PYED 2XPYA 3CH1A 3NCWA 3JV6B 5EU7E 4C4KO 3BWUF 1E8XA 1N12A 5F9JA 2ZOTA 1NDGB 4M6NH 1PZUB 4YQXL 3B9KC 3PL6C 4PJEA 5I1AA 1EWHA 3L1FA 5DLLA 3TV8A 2VLRE 3VD3A 4LAJH 4QRAA 3W2DH 1N0XH 4G80B 4N6RB 4PJ5A 5E2UL 1S78C 3MV9B 4R0LB 5I8KH 3F6JA 5I18H 1GZPA 2G0LA 1LWHA 2CDFB 3BVXA 1HWGB 3CPUA 4O2EA 3GQFA 2OZ4L 2PTTA 3LV3B 1KCVL 2F1EA 1F90L 4DKEH 5E5LA 1ACZA 2GIMA 2XV2A 1L5GA 1SLXA 3PNWB 2A1WH 2BOCA 3KXFA 4XRCA 1UACH 4ZYKB 3MLRH 2CKBL 2F7QA 4M48L 3A0OA 1BQ5A 1HWHB 1O7DC 2B7DT 4JKKA 3RKPA 3SOBL 1Z32X 4DO5A 2F7PA 1IC4H 4HULB 5IW1B 3V5KA 3GI8H 3QUYA 1DN2A 5BVJB 1X5HA 4GNKB 2EICA 5I8CB 3N42F 4OW6A 4L4TD 3V8OA 3F12B 2DMHA 4XC1L 4BHUI 3B9EA 5F9WB 3IK2A 3SDAB 4X8GA 4K3DH 3LKSA 3TPUA 4CSSA 2ZUQC 3NFNB 3LQZA 2YFOA 3LH8A 4P2AA 3QDME 1NCBH 2E7DA 2I7OA 4PRHD 3BLKA 3CSGA 2C1PA 1OTUC 4AC2A 4BK5C 3ESMA 2CPUA 3DX4A 4Q6IA 3WJJC 1UWXK 2KYIA 1DQML 1ZANH 2NX5E 1CR9L 3L9RB 4KXDA 2YA1A 1WA0X 5DXWA 3EFDL 5EU3A 3B7YA 3TOPA 3PDGA 4JPIB 5FWRA 3KWXA 3EYUL 3SDXA 4ELMB 1I9IH 4XZUB 3QIWD 1EAPA 1NCAL 2X41A 3BKML 2XDHA 3LD8C 4HPOL 4LSUL 5FW8A 3REWA 4HIIA 4Y2NA 3KLHC 2HVJB 1A14L 1E6JH 5K9KA 5F6HI 2DQ6A 1ADQA 5DVNA 4QKTA 1K8IA 5KS9B 4NHCH 5LCVH 4P8QA 4OJDH 3MLUL 1GGYA 2X88A 5I23A 3H9SE 3BAWA 3HJ0A 4PG9B 3U2IA 4HJIA 2G2PA 3SGJA 1CN4A 4KJYB 4C8XA 2C7UA 1EAJA 1C5BL 1NMBL 3W56A 2AXWA 3DX7B 3EH1A 4R97B 3WIHL 4LPUA 5IVXE 4Q14A 3RTQC 2X2JA 3AABA 1KZQA 2A9DA 3K6OA 4FQIH 4MNHB 4M6NL 4OGAC 4UIMB 4ZAKA 3X12A 4A6YH 1JWSA 3FB5B 4OM1H 3B56A 4U6TA 1AIFA 1DVFD 4V33A 2YMXH 3L3IB 3UGEA 5LBSL 5FO7B 3MRIB 1GJUA 4LSRL 2VDPH 4PY8I 1S3KH 4OGXH 3W2DL 1BPVA 1N0XL 3P2DA 1RJCA 4RAVA 4QR7A 2JB6A 4AYDC 4Z78A 2Q2LA 2XV3A 1KELL 5I8KL 2KBGA 1J5DA 2A6KB 5L8KB 4ZUVA 3GWJA 2ZAIA 4ZT1A 4B5EA 5DQ9A 5IZ7A 5HDBF 5EU5A 2VUOA 3BWSA 3T2PA 4DKEL 5CFAA 3WDJA 7FABH 4POYA 3FU7A 2I07A 1SQMA 2ENJA 1UACL 4KI5F 2WZPA 2CPCA 5EZOH 3DX9B 4F8OA 1IC4L 1ZE3H 3MUZ1 4NO5A 1EQWA 3ARFD 2IAMC 4DCQB 5GGRA 5IHWA 4QI3A 4KI1A 3FTVA 3VRJA 2A6IA 1JZ6A 4ACPA 3VGAC 4PJCB 1EVTC 1W8EA 1GAFL 1A1NB 1MIML 1XGQB 4IYKA 4K3DL 3T0BA 2VLKD 4AIXA 3HE6B 3TYFB 5KN5B 3KYNB 4P5MA 1NCBL 3ISYA 3MN8A 5F88A 3PAZA 3MDJA 1Z3RA 5JHAA 4Y2DA 1ZANL 3JWDC 3F6IA 2WP3T 1QW9A 1ILUA 2X42A 2KZ1B 3QZPA 3RFRA 3DMMD 3V5DA 1NIFA 1RD6A 3MNZA 5C07E 4JHAH 5C6PB 1GY1A 1U8CA 3QR2A 3PWUB 1N8ZA 4U1GC 2ZAGA 5AW3B 1E6JL 3QIBD 3EDEA 3GBDA 2C26A 1XF5B 1NZRA 2X9WA 3DVGA 3DWTA 5AAWC 1OB0A 3RA7H 2X1XR 5LCVL 5J7CC 4O5LH 1D9KD 1K85A 1CI5A 1NMAH 2NY4D 1BF8A 5FUCE 4AENB 4PBVC 1R3KA 2OSLB 2BIPA 5KBLA 1DCEA 1Y18A 1FVCA 4MCNA 4WY7L 3TA3B 3N3EA 1U9KA 1SUHA 2QQKH 3IJ8A 3VWKA 3ZSTA 1U3YA 3HZMA 4M6ML 4FQIL 1DN0B 3GO1H 5BXFA 1OF0A 2V7NB 3HG1E 3ML8A 5BJTA 5J56B 3DRTB 1UUNA 4J4PD 4GQPH 4RBPK 1CGSH 4A6YL 4BQ8A 2LT9A 5JHBA 5SX5K 2WB1A 3ULUF 1HEZA 2YMXL 3L17A 4MQXC 1P7QA 4BKLA 3PQYD 2V2TA 1OGTB 1AHKA 1S3KL 3A6BH 1HE7A 5GZND 3FCTB 2BZDA 4LF3A 3VCLA 2EXTA 4CC0A 2PWFA 1C08B 4ENED 4D0BB 1REIA 3T8XB 3SGDH 1CGTA 4L4TE 1E90A 1CTOA 1FFPB 3D2UD 3FNKA 4FXGA 4JFYA 3RZCB 4HHWA 4RGNB 2NUPA 4M1GL 1Z9SA 1IVLA 7FABL 2WIMA 4PW9A 4MJIB 2A77H 5T3XL 4PRHE 3V6OC 4L8SC 2NSXA 4KRPB 5IB1A 2K3HA 1WT5C 3GGWB 5EZOL 5HXMA 3Q1SL 5HHME 3OXRA 1WP6A 2UZPA 4APQA 2K9FB 1JI2A 4Q8BA 4Y9GA 4YHOH 2UX7A 3GMQB 2W59A 5K33A 3WFDL 5BUPA 1IGMH 4YXKH 4N2EA 3V6BR 3PGCB 3BO8A 2PCFB 3KS0J 3GJFB 3Q8AA 3LNHA 1MI5E 3V55A 2Y5QA 1OPGL 5D4HA 1O75A 1G7JA 2OXHA 1CFVH 3OF6A 3C09B 4XMZA 1LP9F 4LCWE 4ZQKB 4G9FE 2LVEA 2GBAA 4M1DH 4MMXA 5D4JA 1H6UA 2ZKHH 3D4CA 4P5TD 3LRGA 4WV1B 2VNCA 2APTA 3L5JA 2HTKD 4TF4A 3K91A 4LU5H 5EN2B 4HYTB 1WA1X 1ACXA 2M83A 4JHAL 5EOCJ 1H8SA 3IMWA 2WQSA 3ZDYE 2UZXB 4RX4A 5IB5A 5JPNC 2BY1A 2C9PA 5GZOC 3FB8B 5J12C 2J8UF 4X99B 4P48A 2GT9B 5ETUA 4MBRA 2MHAA 3CFKB 5E9DA 1OP5K 3RA7L 3H9YA 5F3BA 4Z7WA 4UV7L 1N2RB 1UD2A 2ZUSA 4O5LL 4YFLI 2XN2A 3O3AA 2WYTA 1NMAL 3G6JF 3HVDA 4HC1H 4PI0A 3WI9A 4NERA 2VZSA 4JM2D 4RMTA 1DQDH 3GSXA 1NKRA 2HT3C 1ETB1 1RHHB 3VXSB 5GPRA 3UABA 2W65A 2JXMA 1GZHC 2YPVH 2QQKL 1THCA 5ILTH 3QI9B 4QJ5B 5IROD 3SQOH 1AR1D 2V0AA 4F24A 1TYRA 1EAOA 1H0DB 3JZ7A 2BIHA 2XZQL 3NRPA 3S96A 3WD5H 2YD2A 4W93A 1UD3A 3S3SA 4EMZA 4QHLB 5AL8A 2X7LB 4O58H 2WUCL 4OCWL 5DJ2B 2R1YA 4FDWA 4JFHE 2CJ3A 4WO4B 4AQEA 5AW7B 7TAAA 1NL0H 1WAAF 2BWQA 1TENA 1WD8A 4GSQA 3L7FA 3OHXB 3SKNB 2VITB 4NZRH 5JW3L 4X2UA 1TUPA 2A77L 1NBZA 4XN2A 3T6WA 3CC5B 4MX7A 2WLLB 2XWJA 2GFBA 3MJ9A 1S7QA 5FA3B 3TZVC 4S0HA 3NUKA 1IAIH 1G0YR 2RB8A 4ZUWA 4PJIF 3TWYA 1DANU 4JZJA 1G1KA 3V4VH 4JHZA 4YHOL 3BDXA 3NJHA 3GSRA 1IGCL 3WEBA 4MNQD 3C5SB 4X42A 4YXKL 1A6PA 1S7TB 2Y3AA 3UACA 3ARBB 1VZHA 5ABDE 4C57C 4Z0BL 4LVHB 5JW5B 3EAKA 2OMWA 5KOMC 2VDQB 4QHPA 3RIFK 3DOSB 1E9QB 2F8OA 1IAOB 4LFHD 4ZOAA 2GJJA 1MCRA 4M1DL 3PYCA 4MWFB 3QORC 1J18A 3I75A 4FXKC 4QCIB 4KK9D 4LNVA 3ATAA 4KQ3H 4M3HA 2IH1B 1Q9OB 2NUTB 2CCVA 2BWIA 3WL9A 5IEHB 4YL4A 3LX9A 4KZ0A 3FS9A 1KCUH 2OJEB 4YSOA 2AJ3A 1IKNA 3HS0C 3EF7A 3L48A 2QKSA 3F05A 3FTGB 1MCWW 1XIWC 2QR0B 1IGYB 3HB3D 4N8VB 2Y5EA 4BUGA 5KW9H 2SODB 4MDIA 2VGLM 1DVTA 2LV4A 1YJDL 1GC1H 4KKCC 1AGCB 5LO7A 1W0WA 2B08A 2XOTA 1PLGL 3SQOL 4HW6A 4PU2A 3SYQA 1SDAB 4KZCA 4GRLB 4KFMA 5FM5M 2G4EA 4BFJA 1ZTXL 3QEGH 4OAWA 2QDWA 3LKQA 4P2RD 3WUWB 3B5TA 5FF6B 4YSEA 4JDZA 4LLUA 3BC9A 3QWNA 3N1QC 3GJEB 2XTJB 1M6UA 4C4KT 1TFHA 4L23A 1HQ4A 3QZLA 1HHIB 1A22B 3KPOB 5HHVH 2G60H 2AXHA 5J1TC 1HSBB 3VRLE 3NCYP 4EUPH 4OZIB 1AQMA 5J0BA 4YFLF 1RUMH 2W60B 2VXQA 1NL0L 2X1WL 1HHGB 1ZT4A 4PJ5D 1NKOA 3QJHA 4NZRL 1KCKA 2V9TA 3NIGE 2VR4A 1C8PA 3MZTA 4QRTB 1G43A 1NAKL 4HUVB 2HN7B 2O93L 1KEMH 5EUOF 1EXUA 3SJVA 4CL7A 4FFZL 3OKLB 1IMHC 2AK1L 3E6FB 2QQLH 4KDTC 3GSUA 3FUKA 1J0YA 3KYMB 2BSBA 4G43A 3LMJH 3OGCB 3KXFD 4JHBA 2YBGA 3LNGA 1A65A 2J4WH 3BP6B 4ETYA 4WFGD 2CJSA 1RURH 2BINA 1AD9A 4BFOA 3QUYD 4P3DB 4B50A 4WUUB 2EEAA 5HD8D 4R90H 5E2VH 3VSUA 3ABGA 5CGBA 1JNLL 3IXAB 1ORQB 4OFKA 1J48A 1MCBA 3JVFC 1EPFA 4RNRA 3OR6B 3T3PB 5TE6H 3HIZA 2A73A 4GS7C 3FT2A 5LB1A 1X4YA 2C4FT 2CGRH 1UC6A 5H2BA 5DUMH 4HJJH 3PAVA 4L8BB 1PSKH 3QEHB 1B3JA 4TMPA 5CP7A 3HLKA 1N5YH 1NCWH 1KCUL 4L1HA 1H8LA 4JG1L 1NBCA 1MCLA 1D7BA 1GIGH 5AB1A 1YMMD 2D3LA 2MQ0A 1HAWA 1KTDB 2WQAA 3CXDL 2ZPKH 3QFJB 4DHLA 2O5YH 4HEPA 1I1AA 5GRVK 5BOPA 2HSIA 4P23A 3HR6A 2FJGB 1XBRA 2FR4A 2J5WA 1R3IL 4QT5A 2D7PA 1CUOA 4XNZC 4P3CH 4LLQA 1GC1L 4B0MM 1E4KA 3L7EA 1NFKA 3G9AB 2R1WA 4FQQB 1EEYA 4ACTA 3KPMB 3QEGL 1KJ2H 1OTTD 4OVVA 2BC4A 5F7MC 1JCKA 4YR6A 4NZ8A 3TBYA 4IGBB 2EUWA 2BVPA 3MV7A 3UC0L 1EX0A 2X4OB 2B5IC 1T7XA 2OMZB 4YPGB 4IKKA 3LZLA 1ZA6B 4ZAKD 2BHUA 5C3TA 3VD5A 3RHWF 5HHVL 3FMGH 2G60L 2EIDA 1HXMA 3AUWB 2AABH 5IOKA 1NCCH 5HHNB 2OAAA 1RUML 3P69A 4MDJA 1S46A 1TVDA 3D69A 1DCLA 2VB5A 3MLXH 2OL3H 2Z4TA 1QI3A 4I0PC 3GXNA 3KBHE 1Y6KR 4N1CA 1NDMA 1DUZB 1LNUA 3O6FA 4XCNA 1UXLA 4L3CA 1MHCB 5I16B 2KLTA 5E4AA 1FVEB 1KEML 1BVNP 2J6EH 4OKVA 1CD8A 2G5RA 2BZ7A 3LKOB 4LDCA 4FFVD 1MH5A 4LCUA 4N8PA 2QQLL 5CEZD 3BVNB 3ZTJH 1QNZH 1ES0A 1KBGH 1L0XA 2XXFA 3F65A 2X05A 4E42B 3LMJL 2FJUB 3PGDA 3IJSB 2BHFA 4PJBB 3PDDA 2WZPD 3SDDA 1NBQA 4BXSV 4JY5L 3O2WL 2F61A 5IW3A 5CZXD 2V5SA 2CR3A 2NY6C 1FRGL 2VQ1A 4J7RA 3RGVB 4R90L 5D2NE 5E2VL 4KX8A 1B0GB 4JFSA 3ABKB 2Z0UA 3SDCC 3UP6A 4AI7A 5EU6B 1MWAB 3DBXA 4NDMB 1N7ML 3H9HA 3IU3B 2A74C 5DQDL 3TO4B 3RUGE 2CGRL 4JRLA 1JXGA 2P9RA 5DUML 2E3VA 2FAUA 4HJJL 3VXOA 4EKXA 1PSKL 1DLHB 3H9SB 3RWGA 3FRUA 5J6GA 4H8WC 4Y2DD 3SKJH 4XNXL 2QADB 2WM0A 3POCA 1NCWL 3TYGH 4A2LA 2VM3A 4UAHA 3F7KA 4DW2H 5CFHA 1GIGL 3VFPB 2DLTA 5D9SA 4AL8L 1AFVL 1KCBA 3MRLA 3UEZA 4E41A 5IVXB 1U91A 2ZPKL 4M93B 4R96A 1BXAA 1OB1A 4M6OH 1N3NA 4XCFH 3EYSH 1PKQE 2PABA 1MDAA 2NZ9D 3UMTA 1DUYA 1XGTA 5K39A 3UJJH 5GGVH 2W9DH 3TJEL 4PJEE 3JSSA 4CN1A 2Z4QA 1KZYA 2EXYC 3BYYA 3HG3A 3IMSA 2Y9RT 4ZPVB 2LFGA 4UILH 3F84A 1ZCRA 1TZOA 3CVIL 5G4MA 1T21A 3AITA 3KDPB 1KJ2L 3L1OH 4UIKL 2NR6C 3RB7A 5HBBA 5FEBA 4NSKA 2X12A 3ZTNL 4Z7NB 2F53B 1S7SA 3ZT6A 1OPOA 3BIBX 3QS3A 4XPBH 3FMGL 2HB0A 1ZWIB 2ITFA 3TV3H 1NCCL 4D9RD 4I5BB 1P7QD 4NUMA 3HAEB 3CZFA 4QTHB 4Z76A 1MHPL 1M1SA 1NCDL 3EGXB 5JMRA 1FVDB 3CZSA 4N8CH 1U8QB 2BVTA 1L9QA 1YNKH 5A2IH 4YS4A 1Z9MA 4X6CF 3WFZA 3HNVL 5A6LA 1RZKH 1OAZH 1OD7A 5I30H 2X40A 5IB3B 4I0KA 3D30A 2YD0A 1HYSC 1HH9B 1QNZL 2WPGA 3BISA 4Q7DA 5AOMA 1PD1A 3SKMA 1NC2D 1HL5A 3U1SH 3CTTA 2E9BA 1F4AA 1ASQA 4TTGA 4DERA 1YMME 3B3IB 3WKNA 3R18A 3TN0A 3SDXE 3U4EB 4HXBL 5HYQB 4MA3B 2PYEB 5IJVA 3L3DB 4KI5C 3QRFM 2ZAHA 2Y1VA 1RJLB 3CVHH 4GLRH 3S97C 1XZ0B 1SYSA 1ZA3A 5DHDA 4B9JA 4PVLA 2F8IA 5DA0B 3QHTC 1GPOH 2N3JA 2ZXGA 5DZNA 4GLRI 3SKJL 4OD1H 2VDNH 3TYGL 4Y4HB 4NJAL 4DW2L 4FZ8H 1I1YB 4PGDB 3LZPA 2G75B 1RMFH 3VG9B 3DX6A 3SPHA 1OT4A 2GBVA 4PCSA 1CFNB 3VI4A 2Y72A 4M6OL 4OCXL 4RX4D 4TVUA 4XCFL 3EYSL 3O11A 3N55A 5AVUB 3UJJL 2W9DL 3Q3GA 3QR0A 5E9DD 5ITBH 4HPYH 1Q0XL 5AKSA 5CWSA 2DQMA 3L3OA 4UILL 4GP5B 3BSZA 3NIFF 3II1A 4L4VE 1R33A 4OF7A 5ID0B 1ETZA 4M56A 4L4TB 3EGDB 4ODVL 4NHUA 1JV2A 3LRSB 3V0DA 2X4QB 4XNMB 5AAMC 3LJ3A 4ELKB 4HQQH 4XPBL 1Q1JH 5J6HA 3VB8A 1NIDA 4PRHB 4RH4A 5CEZE 3MLZH 3TV3L 1MPAH 4N3UA 5I1HL 5JOEA 4HVBA 5JORA 2CO3A 2AVGA 4KQ4H 4GFXA 4NZFA 4IMLB 2HFFB 2IEPA 5I1IL 3MRMA 2G3ZA 4N8CL 3FU9A 5I0VA 1YNKL 1CTMA 1HZHH 3B5HA 3O0RL 3ULUC 1GOHA 3N85L 1T83C 1SXZA 5CJQL 3QJXA 3QC5X 2GJ6E 1FNEB 5GGSB 5I30L 1T4KA 3FFOA 4NUGH 5H94A 1CFTA 2QHRH 3WNJA 5EO9A 2H3KA 4NZUH 2VDPB 2BFVH 3Q6GH 3MHZA 2VABB 4RISL 3U1SL 2UWEA 5FXCH 2XU9A 2FGWH 3MRGA 3K6NA 3Q0HA 3EJJX 4XE0A 3F85A 4G8FB 4Y16A 4NS0A 4K7PX 4N2GA 5IEKB 4L5FH 3V9FA 2YZ8A 3TJHC 1SBSL 3AJ7A 4GP8B 4WI0B 4LLMB 5DJAB 1S5HB 1DBAH 3OB0H 1HK6A 5IF0A 3VMPA 2AV7A 4ODHH 1DVFB 4IBSA 3FTYA 4JFEE 1GPOL 2P5EE 1AOZA 3IB4A 4IOFC 4OD1L 3BUBA 1R3JA 1NCHA 1U8IB 1UQSA 1KY7A 4JANA 3UZVA 3WLWC 4FZ8L 4QOKA 4XMVA 2EKJA 1GW0A 1JHTB 3AB0C 1RMFL 2Q87A 3FUIA 5DRWA 1WTLA 2DMGA 1A4BA 2LVCA 4OZHA 4EE2A 4Z7UE 2GTWA 3T4AC 5CHNB 4ELMF 3CZUB 1OF2A 1BJ1H 2K6ZA 2GY7B 1VKXA 1E5YA 4UDTB 4URTB 1QEXA 4R4BA 5C3LD 4HPYL 2XKNA 4UAOC 1U21A 3T5WA 4GIOA 1PNDA 4D9RE 2W0FA 5KS9F 4AEHH 1F5WA 4H88L 1XR8B 3ARRA 4PREB 4GIAA 1HKLL 3ARFB 4PIBA 5B21A 3BE1H 1OOAA 3P54A 3BIKB 3DI3B 4J3SA 4OCRL 3QH3A 1KCSL 4YSPA 3RVVD 4KZDL 3CUPA 4XP4H 1VEOA 1BX2A 4YXLH 5BRZA 4BZ2H 2VLKB 3RWDA 3WJLA 1RULH 3C8HA 5IJKC 4HQQL 4MD4B 3EGSB 4JO4H 4Y4FA 5C0DB 3ULSA 2OQJA 3A24A 3K71B 2ZWSA 4ZSOB 2IPKA 4OT1H 3QJTB 5EWIH 3FHQA 3UTZA 4F7EA 4KQ4L 3O41B 3OMIB 3JWNG 3TLRA 1LDPL 2NLJA 2A6DB 5PAZA 1PDKA 3NJNA 1TVBB 1OT1A 4FLHA 2ZUTA 2I27N 4L37B 1GHFH 4XX1G 3HE7A 2MFNA 3GK8H 3QULB 3QIBB 3LHPH 4FP8H 4H25A 3FB7A 4AM0A 1ZGLM 2RH0A 2ORBH 3IDNB 4BQ9A 4NUGL 3UGXA 5DQJB 2EE0A 3AAZA 4MNGA 3VH8A 5IMMB 1D9KB 3EH4B 3NACH 1A4KA 2NY4B 1PIFA 3EOYG 4G7YL 4N5ED 3W0WA 5HHQA 1SHWA 2BFVL 4JJ5A 3Q6GL 3TBTB 4W6YB 3SJVD 5AW5B 2FGWL 1BFTA 2FWUA 3FF8A 4MRBA 5AW0B 5D7SH 1MFDL 3LXBA 4XPGH 3G04B 2BRRH 1YZZA 4I1PA 4PJCF 3LRLA 1ED3B 4UM8B 2RR3A 5DD0L 1DBAL 3KLAA 1OARL 3RNQA 4L1BA 2UUDH 4ODHL 3QXWA 3PQYB 1T1WB 2ATPB 1GXEA 3L4XA 5DMKA 1LWRA 1FG9C 1R5IB 1WBZA 2DQFB 4UINH 5E7FA 2F68X 4OLYH 3QUXA 4XCCL 1NANI 4HWZA 1Y0LB 4EOWH 3AADB 1C8QA 1IVTA 3QIUC 1UT1A 3ZHDA 1KEGL 3CIAA 3D2UB 4FQPA 5D7IE 3UJIL 2W0PA 1IGJB 4ZD3L 3OGOE 1M3IA 3VU1A 5CZRA 3V4PB 4YO0A 1KIUB 4LLYA 1KC5H 2B4CL 5T1DH 4GKZB 5GS1A 3AFLA 1IAKB 4NQCA 3T3MB 5T5FL 4TQIA 4UV4L 5CUSH 3WU1A 5ALCH 3KPRE 4QWWD 1RJYB 1I1AD 1T1XB 3LEXA 4P23D 3S48A 2VZ3A 2ITDB 3UAJA 3ZTCC 3BE1L 3ZDWA 3X1BA 2CRIA 2XN9D 2H26A 3ZMNA 1OAKH 3F7VA 1D5BB 4MXVF 1RULL 3ULAB 4XTRD 2CBMA 4JO4L 1YEFH 1SLUA 2R29L 1BZDA 3DECA 4Y9CA 1E5ZA 4LLDA 2IANA 1M2OA 5J4MA 1TJMA 3IMVA 3CMGA 1J5CA 5JZ7D 2DLGA 4GKNA 3OAZK 3M6DA 4NAJA 4A7TA 1JYWA 2ADGA 3QXUA 1BZ9B 3TIEB 4ZMXA 3LNEA 2Y25A 3JTSA 4M5ZH 4P5TB 2E9JA 3DYMA 1OAQL 1BOGB 4L3ED 1SUJA 4K7FB 5GRJH 1KYFA 1XO8A 3E2HC 1MCEA 2R0ZH 1GHFL 2XZZA 4BZYA 2WXMA 4FP8L 3VI3A 1F8TL 3QB7C 2EDYA 1M53A 1XWVA 5AVWB 4AC4A 5EC1B 3WEXB 4AVHA 2Q10A 5TJWK 1TTUA 3NACL 3O6FD 3BGFC 3MRPA 5LN8A 3RAJH 4HLEA 1ND0B 3H7BB 2VN3A 3PWPB 3C60C 3WN5B 4JFTA 1G1OA 1T3FB 4JM2B 5LGHH 4AYFA 5F7YC 4GXVH 5D7SL 5BS0A 2JLLA 1UB6B 2XWCA 4KZEH 2WQWA 4JX0A 3PRZA 1AR1B 3I6KB 3SDDD 3RPIA 5FCSH 3MNWB 5E00A 2AZUA 2QVTA 4L3FA 4I4WB 4PJGA 1YJDC 4M8RA 5IG7B 5KSUA 4D8PB 1QP1A 4N0FB 1WG3A 4DKFH 2OTPA 3FONB 3V95A 1KTRL 3T04D 3O6KL 1KB5A 1SXSA 1XF1A 4OLYL 4FHBD 4R7VA 5H4YA 2IV8A 3C5ZC 2CG9X 4EOWL 5I5MA 1TITA 5FKAB 4RZKA 4NYLB 2ZOWA 5CZKA 5IFJB 2IMMA 2EUZA 1TZGH 1ET5A 4E5XB 1PVHA 1XT5A 2GQHA 4LE8A 4MMYA 4RGMC 1A3QA 2E76C 1IQDB 3OB8A 1KC5L 2MPVA 5T1DL 4ODWA 4E41D 3T1FB 5CUSL 3ARDD 2EDTA 4JFFA 5ALCL 4BFIA 4Z8FH 1E4JA 3FOMA 4P49A 4TQ8A 2CM5A 2DWEA 4FYRA 4JY6B 1I7ZB 1P5VB 4YE4L 4JFZH 1TTAA 2JKTM 2UZIH 1FWXA 3S9DB 1OAKL 4MNQB 2C9SA 3D33A 3IFNH 4ZZKA 4ADIA 5D7JA 3ES6A 3QUKA 4N8VG 4ZK8A 4WU7B 3NA9H 2CJTA 5A40E 2CAKA 4LSDA 2BOBB 5I1DB 4FNRA 1B0WA 1S7VB 3W9DA 5A7EA 5KSAD 1ZV2A 5IW6B 2DPKA 4KVCH 5B8CB 2R0ZL 1GKOA 3WUWG 5KVFE 2E4FA 5DMIH 4M7KL 1PD6A 4L1SA 5E99H 1TZHB 5GXBB 3U7WH 4P4RA 3DXAE 4IQHA 1CLYH 2CDGA 2X5PA 3QXVA 4JDTL 3QDGA 5I0DA 2XA8L 3U9PL 1KIPA 4X6FB 3RAJL 5F1NB 1NTDA 2BVQA 3HB3B 3MUJA 5LGHL 3LS5H 3GINA 4XBPA 4NEHB 1YUKB 4FI8A 4WW1B 4GXVL 4Z23A 1D2PA 5AVVB 3VFRB 1IC1A 1Q9KA 1VZIA 4H1LH 3RWHB 4FNLL 3DYPA 2O61B 3NSFA 4JO1H 2OP4H 4UQAA 3ILQD 3L95A 4L2LA 5DZJA 5AG9A 4ISVB 4P2RB 2CLZA 2EECA 4NGHH 5LGJB 3T9WA 4DF9A 3TN0D 1HH6B 1I7UA 2OX5B 1KPRB 1PKQB 2JK5B 3CH1B 5KVEH 3GRWA 2UZYA 5F9JB 4DEPC 4R8WL 4TNFA 3HS8A 3P11L 4GH7B 1PNCA 4PJEB 1AG6A 1E4WH 2ZT9C 5CGYC 5I1AB 3S8WA 1GTFA 2DH3A 2FEDC 2XN9E 2WO3B 4XAKE 5AUMA 4OH2A 3TBVA 3I9IA 5EOQL 3BGAA 1L7TH 4PJ5B 3MA7A 1JGVH 4PTTA 1Z9OA 4LRNH 3WELA 1GZPB 5E8EA 1M7XA 1P5UA 4Z8FL 3UO1L 4O2EB 2PTTB 2EIZA 4X5PA 1MFEH 3MLYH 1LK2A 2JQAA 4N86A 4JFZL 3PE9A 4L3EE 1L5GB 2UZIL 4MB3A 4ZJ9A 1KOAA 1UADC 3MROA 1LILA 3KXFB 4XRCB 1MCJA 5F6IC 3RHWK 4BFGA 3QW9A 1I8KA 3DV4A 3QQ4A 4GI8A 3ZKSD 2VR5A 3V5KB 3QUYB 4AGOA 2G3MA 3NA9L 2CIIA 4H1LG 5FW7A 3LN5A 1DVXA 1RIUH 2HVBA 1GOFA 1YEDA 2YAFA 4G6JH 4BSWA 4A37A 2EIMB 3TPUB 1CB4A 1DBML 3FT3A 3LQZB 3QAQA 2V37A 3H6JA 4UZUA 5JR1H 1Z66A 1SY6A 2AEQL 4AQAA 1U8PA 5A2CA 3IGUA 2VISA 4Q6IB 5DMIL 1KDIA 1HL8A 2GG1A 5E99L 3TO2A 4OZIF 1XSIA 1CLYL 2EDQA 4TQHA 5EU3B 2DQGH 5FYJD 1A8JH 1C1EH 3IE4A 4PP2A 3HUJE 3SDXB 1X7QA 1G87A 1EAPB 3CFCL 5E6SB 3KBPA 4HWBL 3REWB 3RRQA 4HIIB 5DEFA 1Z5LA 3LS5L 3MVSA 2O6DA 3MRKA 2VR7A 2JCCE 5K9KB 1K8IB 2SEBA 4IEFA 3NIDE 4S1DD 1A9BA 4AL8C 2WIIA 4Y9BA 1QNIA 1UFGA 3ARTA 1LLAA 3FBKA 1U41A 1T1ZA 4JO1L 2OP4L 1PX3A 5TTRA 4MXQD 3NAAH 2V9UA 1EJOH 5E1QA 5JQHC 1WIPA 3S37X 2V5MA 2YSSA 2C7UB 5LXGH 2XA3A 2WLKA 4Y16D 1ZPLA 4RLDA 3FJTA 3FSAA 3FSZA 1E7UA 3ZE1E 4IS6A 3HC3L 4ZAKB 3T3PF 4F8LA 2JJSC 2F7IA 3X12B 1G6RA 1EJ6A 1I8LC 1JGUL 4JAMA 1E4WL 5DLML 4J5VA 4DGIH 1JWSB 1AIFB 4F93B 1I1RA 5FUOH 4OCMC 5EUKA 3FU0A 2AKRA 4ABQA 4JQIA 1L7TL 4RAVB 5DO2D 1JGVL 2JB6B 4QOKD 4LRNL 4Z78B 3ZKMC 2GBUA 4XN1A 3QAZB 3HHMA 3IF1A 3MLVL 3SYAA 2E7LA 4ZUVB 4PVMA 5I1CH 4R83A 3IFPA 3L13A 5DQ9B 5EU5B 2P5PA 5I0ZA 3FU7B 3IMTA 2I07B 1FH5L 1S9VA 2IVFC 2Q3AA 4WWPA 4DIXA 1RK0A 3Q01A 2MCAA 2UXVA 3FQ4A 4TLKA 3MTRA 5M7QA 4NC0B 4K71B 4F37F 3ABMB 1RUKL 4NO5B 5MP6H 3OXSA 2EIBA 2VM9A 5DR5H 4OQTH 5GGRB 3VRJB 1LE5A 3AQXA 1RIUL 2A6IB 5JOFA 2JKIS 3IM1A 4CA4A 2J88L 2P28B 4I77L 5BRZD 3N5AA 2XICA 4GSDH 4P5MB 3S35L 4Y4FD 5INDB 2QMKA 5JIIA 5KVDE 1A47A 5F88B 4YHKL 4Y8AA 4JFOA 1MG3C 4UT6A 4Y2DB 1TPXC 2DLIA 5CBEA 3O8XC 1BWWA 3ILPB 3NQIA 1M2VA 2DF3A 1PZDA 2DQGL 3V5DB 4TPRH 1C1EL 1UT2A 3MNZB 2K9UA 1SXNA 3GTNA 2Y36H 4I3RH 3DGCR 4TOYH 1N8ZB 2D9QB 2FVNA 3HE7D 2BLFA 3HAEG 1ACYH 4BQBA 4G3YH 4HK0A 3ZL1A 3DVGB 3N1GC 3NH7L 3QHZH 3OKMA 4Y0GA 2VR8A 1FYTA 4R0LC 1J9SA 1DVYA 1NLDL 4XO9A 1R3KB 1EJOL 3MRNA 1QLFA 1RL1A 2APBA 2K0RA 3GTVA 4PJBF 1Y18B 3MRCA 2Z31C 1P1ZA 1FVCB 5KUKA 2WZ0A 5AOKA 2YMOA 2BIMA 1PZAA 3MOBH 1VZGA 2L0DA 3CHSA 3HFMH 3M1OA 3HZMB 2B16A 5BXFB 1SQ2N 1N9PA 5BJTB 1YO4A 1XH3A 4GO8A 4OZFH 2MNUA 5JDJA 1HEZB 1P7QB 4BKLB 2V2TB 4PQXA 3ZZLA 4AZ8A 2O5ZL 3RL2A 3DX1A 4LF3B 1JD7A 2VN6A 3MAWA 1FL5A 3FXIC 4UOW1 3LQAH 5F9WC 3DIVA 3QUXD 5F3HA 3BVWA 1FZJA 1BBJA 2HX8A 3C12A 4FXGB 4JFYB 5I1CL 3X3GL 1W72H 5C0CE 4R6UA 2H32A 2NUPB 3NQKA 5IVXF 1XD1A 1FJ1A 3SGEI 2P42B 2YGNA 1WFNA 1Z9SB 1P1VA 3GZPA 2BVUA 2VE6A 1QRNE 4LLVA 2FIRT 4QRPA 4X6DA 2A0LC 4KO6A 1NC2B 4NQCD 4PJDA 3NGBB 2N01B 5IB1B 4M00A 1T66C 5GS3A 2BHZA 2B14A 5TFSH 2CA4A 1KTJA 1GGBL 4UOJA 3OXRB 1K4CA 4ZOBA 5DR5L 4OQTL 2HZHA 4APQB 3KGTA 2BVYA 1AYOA 2CM6A 3BO8B 1IBDA 4GSDL 1BZ8A 3UTPD 1RXLA 1G7JB 2OXHB 2IAND 4HFWA 5EEUA 1NUDA 1S7RA 2ARJQ 1QI5A 1YEIH 3AREA 4MJ5A 2CK0H 4MMXB 2GHWB 3TEUA 4R97C 4TPRL 3G5ZA 2J44A 1VEPA 2CRMA 4UYPA 1T04A 2A9MH 2JTYA 2Y36L 3B7UX 3FO1A 4I3RL 4TOYL 4WKXA 5IB5B 1CGYA 1CDBA 4NOFA 1ACYL 4G3YL 5KTEH 2YK1H 5DFVD 5ETUB 5IP4A 2MHAB 5E9DB 5F3BB 4Z7WB 3FBQA 5EFIA 2KDYA 4HU2A 5CO1A 3X17A 4WUKL 3QHZL 1PLBA 3EO9L 1CS6A 3O3AB 4G6KH 4XXCC 3T0XA 1G7HA 1TYEB 4KITB 4N87A 1HS6A 3W39A 1HCVA 3GSXB 4XXWC 4HA1A 2GITA 2CHNA 1EDHA 5BS0D 2JXMB 1WRFA 3HFML 4IRJA 4IU3A 3DARA 2HT4C 1CICA 2DIAA 3Q6FA 4HIQA 2J73A 2WWOA 2D2OA 1R34A 1BFOA 1UASA 1WFMA 4N2DA 4YDLC 3S96B 4XNUH 4J27A 4G71B 4WHYG 1QACA 3F7QA 1S7UA 1J9RA 4ICXA 2J55A 1BLIA 3ETBF 3FCUB 3LQAL 4C56E 2R1YB 4LHUD 5HDQL 1BVKA 2BVOA 2G5BA 3HE6C 4AQEB 1I75A 4ZRGA 1ETJA 1Q0EA 4P2OA 4AMWA 2OKMA 4HPHA 5CZVL 3MNDA 3ZVVA 2E59A 3L7FB 1QHQA 1CDIA 3SGKC 1NBZB 2E6QA 1WZ1L 5DUJA 4OV5A 2V3DA 3F00A 3KLQA 2EZ0C 2WZ5A 1QSFE 1WZKA 4MX7B 4R9HA 3OZKA 2XWJB 2G2NA 1G9ML 1K2DA 2GFBB 3BUYA 1S7QB 3KPTA 3Q1EA 4JFFD 4A2EA 1BCIA 4WI7A 4ZUWB 4JZJB 5J8OA 2K70A 4B7IA 5JPMA 4MYPA 3GSRB 5J06A 4I7ZC 1O9VA 3X14A 4XCEA 1CGUA 1DJSA 4FRWA 2VRQA 4NRXA 5D7JD 1GKEA 1OAYH 2OMWB 2VZOA 4Q89A 3VTAA 1OP3H 1S9YA 2QVKA 2E56A 4MXWL 3QPXL 1TZIA 2BIIA 4KUZH 1YEIL 2VXUH 4O9HH 5IHZA 4OIIH 3I75B 3JWNC 2BP8A 4Q9QL 2MQCA 2YUXA 3EZJB 4XOEA 3WL9B 3MX0A 4EIZC 4QTIH 2YK1L 4JZNA 4L8CA 5JIKA 2AJ3B 2N1KA 3R4RA 1E67A 3QDGD 5F44A 5KBDA 1CZ8H 1P4UA 2AQ3A 4DGVH 4QKXB 4MDIB 2W07A 4B9GA 3JZYA 3EJYD 4HIHA 3W9EA 2B4CC 2AFNA 2D7MA 4RGNC 2GHZA 2XWBA 3L5XH 5E51A 1EMTH 4OI9A 5E94A 5IBTH 2ZWZA 3KMDA 1H3WM 2M1KA 4FEMA 4TRPH 2NDGA 4U1NA 5CP3H 4Z7OB 4KRPC 4TQEH 3UZQA 3SD5A 3TVMC 2BH0A 4OAWB 2ARWA 1GMIA 3LKQB 1QFUH 2BJML 4XNUL 3ARGD 4IK7A 4WEBH 2OS7A 4JDZB 4LLUB 4NKOA 1IO4C 1K8DA 2CQVA 4FKEA 5H37A 3SYPA 2KPWA 1HQ4B 5HVHC 4R4ND 4YGVA 3CG8A 2YPLD 4Q74A 4M7ZB 5E6UB 1EERB 2OLDA 4GB9A 1IC0A 5IQLA 4ZW6A 2APVA 4KTGA 2RBLA 1GGTA 1ZT4B 3C09C 4TQPA 1QWUA 3QJHB 1XSKA 3VFGH 3BAJA 1M4KA 1UZ6F 2IQ9L 4MMZA 2QHLA 2ROXA 4WV1C 3W37A 3WE6A 3PGFH 4WSKA 4EDWH 2W0KA 1UD8A 2FJHB 4ZO8A 3C5XA 3SJVB 4AE0A 5DZPA 3LKNA 4XP6H 2O5XL 1KIRB 3QRLA 3GSUB 3QQNA 2CUAA 4BKTC 1ZVHA 2L7EA 3LB6D 3C2SA 3GKZA 4G43B 4MBOA 5DEGA 1KJVA 4Z5RA 5DJ0A 2VSCA 2VW4A 2X10A 4L0ZA 1AD9B 3QNYA 2R56L 2YRPA 4NIYE 4RNRB 4N90E 1U6AL 2VXUL 3VXMA 4S11A 2FT7A 2A73B 2R9HD 2WOYA 2BXZA 3FT2B 1GOGA 4OIIL 4UANA 5H2BB 3GSQA 4NPKA 3SOTA 2ADIA 1T0PB 4L05A 3CLWA 5DMGD 2F1AA 2EUXA 2OXGA 3UTSE 1WGOA 2B39A 1E3ZA 4WCYL 1ZLUK 5CP7B 3FQTA 4QTIL 4JPQA 3FU6A 1LO4H 4IMKC 2OMUA 1ITCA 2R2BA 1KPVA 4K5PA 4PJGE 1DVSA 3K4ZA 3GJFK 1DL7L 1I1AB 3UPAA 1SLWA 2ZXDA 4P23B 2J8OA 4DGVL 4E9QA 1GCFA 2FR4B 1E8YA 5SX4I 4QT5B 3V6OE 2FATH 4LLQB 1VSCA 4LPXA 1L9NA 5IBTL 4LGSB 1QPXA 5FIEA 5ADOL 2IQAA 4IIQA 2YGVA 3L7EB 4ZMWA 2R1WB 1EEYB 4OCYH 4K73A 2EEFA 2R69H 4B9IA 4Y1SA 1QSEA 2BC4B 2C5DC 4YR6B 1FIEA 3TBYB 5IB4A 1FHNA 3CAFA 2BVPB 1KXVC 2V6HA 3MV7B 4GYBA 4UTAH 2DQEL 5C70A 2APXA 2EDJA 1NUFA 4P07A 5DJ6A 4N2KA 1V54B 1DHKA 3MRDA 1HXMB 1HDMA 3MOAH 5ISZA 1YAIA 1V10A 3GNML 4MDJB 4WI9A 4YBQC 2LABA 1QA9A 3N0AA 3D69B 1ZXKA 4R2GC 3U4BH 2YEQA 3ELQA 5L4IA 3VFGL 4BZ1A 4HJ1A 5TQ2L 4RAHA 1NDMB 1LNUB 1NMCC 3O6FB 4M5YL 3GLAA 4XCNB 4A1RA 4L3CB 4BV1A 3PNRB 1V3MA 3OZ9H 2VM4A 4PB0H 1U8JA 5DD6A 4G8GE 3T6VA 3T3MF 4EDWL 4PV1C 4OKVB 4E5XG 3H42H 1GH7A 1MH5B 4LCUB 5AAPA 5SWQA 3JWOL 4F7KA 4UTBA 1FL6A 1ES0B 4NWTH 4XVJH 2A9BA 3VRLF 3PGDB 2GSMB 3SDDB 5C9JA 3KYKH 4NENA 4LDEB 2Z92A 2XTLA 4CILA 4DSYA 4K5NA 3C9NA 3D08A 2A4ZA 1UJTA 1CIUA 4WWKA 5F1KC 2VQ1B 5DWPA 1WICA 1YNTA 3UTTA 5FYLE 2D0HA 2EC9T 1ECZA 3DBXB