2L7QA

Solution nmr structure of conjugate transposon protein bvu_1572(27-141) from bacteroides vulgatus, northeast structural genomics consortium target bvr155
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MNELDIQQEYPFTVESMPVADEIAGDETVEIRLEIKPSGNFIGTVYTLRYFQPDGKGSLKMEDGTVLKPNDRYLLNEWKFRLYYTSQSDKEAQTIDLYFEDNWGNLQQLTYDFNGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein found in conjugate transposon
publication title Solution NMR structure of BT_0084, a conjugative transposon lipoprotein from Bacteroides thetaiotamicron.
pubmed doi rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7qA01
4LBAA 2L3BA 2L7QA
chains in the Genus database with same CATH superfamily
2Y36H 2VR6A 3VW3H 3TZVA 2CUMA 1P7QD 4ODBD 4O02H 4Y2OB 2UY6B 1F8TL 4W9FC 3ZY7A 4PRHA 4AKPA 4MS6A 3CBKB 3ULSB 1HEHC 1RUKL 2H9GA 1F1AA 4Q97A 3UTZB 5C0NC 1C7SA 2KERA 5CUSH 2GQHA 4C56B 2W9DH 5I5IA 5DD3L 3WFHA 3LNEA 2AERT 2EQDA 1L5GB 4FFVC 4AG4L 3B3BA 2XKSA 2FJHA 3TH3T 2WLMA 1J05B 3EH1A 1AZRA 4OIFA 1AQMA 4OCRL 2FBRA 2RFXB 4P57A 1S78C 3SDXE 3T2QA 4Q9BA 4Q2ZA 1G84A 2BOCB 1JIBA 4LHUD 5L9DL 4PG9A 4GLRI 3VDAA 3DHMA 5H4YA 2F19H 3IJHB 3GSWB 2GSIB 4KK6D 3HNSL 4YDVA 1ZV2A 5HGAA 4MXVE 3IKCA 3M17A 4HHAA 4YSUA 4XMTA 2XZAL 4FQJH 1FH5L 1MFDH 5B1KA 4DVBB 2Z93A 4ECNA 4F24A 3CVIL 4WI9A 3NQIA 2L4OA 2VISB 2CLVB 5D7LB 2VUKA 4PJ9C 5CLZA 4M3HA 1JNHA 1OY3B 2R39A 4ES8A 1J0ZA 2C8NA 1S6NA 2P42B 4CAGA 3D0LA 1RSYA 5BRZD 2J8HA 3WU1A 1KYAA 3OMIB 2HN7B 4IOSD 4TUKH 2R27A 5E8OB 2EYTB 2YGNA 1N3NA 5T3XD 1VF5C 3ZRSA 4M5ZH 4G6JH 1QA9B 1RVFL 2P28B 4X7FC 5KVEE 2HJFA 5DZNA 1H8SA 4JFEB 4X9BA 4L4VB 4HWEL 1JZFA 1S7QA 4ELME 3DXAA 3BKCL 1ADWA 2ZOTA 3AROA 1K3ZA 4PY8I 3OKMA 2GEEA 3KHQA 3K1DA 3UADA 4KJYA 3IBEA 2Z0UA 3C08H 3QZNA 4ZS7L 4I87A 4PJHA 3N1MC 1V7NL 4E42A 1IGYB 3IDMB 3AMKA 4XWGH 1ZLVK 3OB0H 2Y06L 3HNTH 4YGVB 3UTOA 2FEEL 1RK0B 3HKFA 3LZQA 3K2UH 3AXLB 3CFJB 3TESA 5LN4A 3FN0H 2F53D 1QX1A 5F3BA 1G1YA 25C8H 1A1OA 1A6VH 1OKEA 3O2DL 4YEFA 2P45B 4M1DL 3QIUA 2D03L 3LDBC 4J6RL 3NFPA 1I9EA 1MCCA 3Q6GL 3S4SA 5D7SH 5DGQA 2VUOA 3QORB 1QATA 2CJUL 4RBPH 4EVNB 5AW2B 2BVUA 5B1JA 2DL9A 1VFUA 1MAJA 4HFWB 4G1MB 4FAAB 5DLML 3S37X 2OZ4H 4ZSOA 5D1ZD 4XP1H 4IU2B 3QXDB 3OBAA 4JCLA 5DDHB 4FJZA 1CD1A 5FKPA 3PNWB 5JXAH 1AXTH 3CVCA 4JG0H 5FKAB 2WTOA 1HT6A 1X5KA 3MUZ1 4LCVA 4PW9A 1KCBA 1PF3A 2XBTA 2D73A 3R7RA 2QEJA 3U48A 2Q10A 2R4RH 3DWTA 3LQAH 1C16A 4FMKA 1NC4B 4ODSL 5D6CB 5EORH 5I16B 5CN2A 4FNLH 1LNUB 4G9DB 4OQTA 1E8WA 4FFYA 3L3GA 5KSVB 2FGWL 1IAOB 3KPMA 3STLB 3F62A 1U91B 4FNQA 4JG9A 2R29L 4L3CB 1NBYA 3IU4L 3IMWA 3DA0A 3FO0L 3N50A 4P07A 3RE0A 2DEWX 3FUEA 1KCUH 4N2GA 5IV2B 4M7LT 5IY5B 1JHKL 5DD6A 2G75B 3FDWA 1MFUA 3QQXA 1JZIA 1U93A 2CA3A 3LRHA 4K94L 4OH2A 5I0VA 1J0IA 1QRNE 3F5WB 1DO5A 4RSVA 5C0IB 3PWNB 3QH3A 4BH8B 4FL4C 2EVJA 5FYKH 3PF2A 4XPTH 1XXDC 5D1XD 4ERSH 4ZXBB 1REIA 1TZIA 4R2GD 2D3VA 4G8FB 1PYWA 4NLHA 4AC2A 3QUXD 3ZVVA 4XPAH 3UTTD 1UWGL 4CSSA 2FX9L 4G72B 4ZMAT 2B4CL 3RWGA 1AMYA 4JZOB 1A1MA 2I26N 1G6RH 4HCRH 3Q2VA 4HV8A 4N2IA 3RY6C 5I8KL 2AV1A 4XI5D 4NZUH 3FONB 2GITB 2KBGA 4NWTL 1FBIH 1WDAA 2NY6C 5IT2H 2XV0A 4PV1C 1WCBA 4UINL 4HSCX 3K91A 1P6WA 2GHWB 4J3UA 2VLJE 3U7AA 3ZOAA 5DHMC 4F2EA 4AE0A 5DJ0A 2YAMA 5T1KA 3VGEA 1AZBA 2R69H 4G6MH 4PRNB 3SCMB 3MCLL 5EO9B 1KEMH 1TETL 4X6CE 3B3IA 3US9A 1P4LA 1VGEH 3WDIA 2J55A 5CIPA 5E6IB 5FDYA 3T1FB 2JJTA 4OLEA 4WJ5A 4E9LA 4V2BA 4J7RA 2C3GA 5C0GA 1BF2A 1PAZA 2EC9T 1ID2A 5H8DA 3NZSA 3F6JA 2W80C 2F54A 4RCAA 1KT2B 3MBEC 1JP5A 1G5GA 4G6FB 1OWRM 4MAYD 3K4DA 3PWVB 2BSSA 3U30C 5KANI 3V0JA 4YDNA 3BDXA 2P8MB 2OMWB 4BSWA 3O81A 4BZ2L 2XVGA 1L3WA 5JUEH 2JI3A 1DBML 1HIML 4LIQE 3CE1A 4WQOA 4OZHA 3JZYA 1ZLSH 3V6OC 3E8VA 4H8WC 4EZLA 1BCIA 3OKOB 5DZ9A 4OZHF 1HZHL 4CL7A 2ZICA 3GEWB 1CFBA 1NBQA 1YEIH 3N42F 4B9JA 1UOLA 3CZKA 2H2SD 3ARWA 1T66D 1UENA 4Y2NA 5I30H 5CBAA 4WEBH 3AACA 3HI1B 1KGJA 5IQNA 3DX9B 1NBVH 4OKVA 4JKPH 3Q01A 2YD0A 2AAAA 1GA2A 4HEPG 1J88A 5EUKB 2V0AA 1BMWA 3EG9B 3ML8A 3ASWA 4HU8A 3S97C 4MNQE 3KJ6H 1HZLA 1C5DB 1T4WA 3WE6B 4DP2X 5DHXB 3V52L 2C4FT 5FV2A 5SX4H 4GSDL 1DQIA 3QDJD 3H7LA 4E9YA 5TH2A 1P5UA 2MCG1 4W9GC 3VD5A 1IM9A 3RB7A 4LCCB 4OQ1A 3VYOA 1E2ZA 2VXSH 4QF1A 5DURD 3MJ7B 4AQZA 3BLKA 2BNRE 3GJFB 2IH1A 3NN8B 4YC2B 4MAUL 5I76A 2BY3A 1BJ8A 1S7SA 4WUUD 1U8PA 4IOSA 1IC0A 2WXLA 4NENA 3VXRA 2I27N 4KXZH 3NJNA 2QPUA 5DJDA 4JGNA 3KPLB 3GBMH 4M43L 2EEDA 5FGRA 1MW1A 1NL0H 3QZWA 3GMMB 5D1QC 4ZQKB 1HZKA 1U8JB 4KRMB 1J8KA 2LW3A 1VLXA 4HWUA 4ELMB 5D9SB 1F8TH 3NSFA 2ZCZA 3N85L 4BFOA 5I17A 1ZLUH 1XCQA 3AG2B 1NANI 5C0FA 5AB2A 3T4AA 3NSDA 1W8OA 1B0RB 2BP8A 4LE8A 4PGBA 1DQJB 3D51A 5DD3H 5TDPA 1DQVA 3B2VL 1JXFA 3I6LE 3QJHA 3QUZB 4HUNB 8CGTA 5H94A 4AG4H 3X1BA 4RIRB 3A4EA 3V6ZB 3LS5L 3H1ZA 3QS3A 1YNLH 1G7HB 2F53A 4APQB 3HLAB 3BMWA 1HNGA 1T6WA 4G83A 2JNZA 2ORBL 1XF5B 4M5TA 4N0CC 1EXUB 2WIMA 4OCRH 1A0QL 1MRCL 4JO4L 4XWOC 2J6WA 4YAQB 3X17A 4A2HA 3QUYB 5L9DH 2AKRA 1WIOA 3CBJB 5DRNA 4LLWB 1A8ZA 2EIKB 4MQXD 4RETB 4KTDL 3HNSH 3L4ZA 1SHSA 2Z7WA 3HPJB 2XZAH 2XBZA 2KZWA 1FH5H 3TEWA 4DOHE 8PAZA 2AJSL 3LIUA 3CVIH 4XB7A 4HUXA 2DQIL 3D1MC 5CM1A 4OV5A 2QADC 4OD2B 2E7MA 3ATDA 3BH8B 4IBUA 2MQGA 5EEWA 1JGEA 5C9JB 4YMPA 3MZGB 3TGXA 1H5BA 4APXB 4F8OA 4I0PD 3L17A 3OJDA 2HFEA 3PNRB 4NQVA 1MCSA 2A6KB 1C08A 1SXAA 1X5YA 1BQRA 3VSVA 1RVFH 4JHWH 2Y69B 4MTMA 3K5RA 1FFQA 3RKDD 1CF8L 4Y16C 5E8NA 1IILE 2LHAA 1QRNB 4HWEH 3W5NA 1M1XA 4GUQA 1AGBB 1J86A 3BKCH 1RUPL 2OMTB 3Q8AA 5HDRA 3ME0B 1R24A 3GS4A 3K6OA 4LFHG 1YEHL 3GXNA 4C83A 2BCMA 4ZS7H 4XH2B 5FO7A 4HUKB 1V7NH 4YHNA 3QWRD 2XN9A 1B4LA 1I8LC 2VO5A 2XVBA 2Y06H 3I74A 3AAZB 4ZW7A 2ADFH 4GXVH 4CN4A 5I6NA 4LVHB 4P2OC 3NBNA 5CF3A 3VG9B 1C5CH 2EVIA 3B9KC 3O2DH 4R4BB 1MKFA 4M1DH 3TT1L 1YDPB 2FIRT 1UH3A 4KROC 2D03H 4J6RH 3JVFC 4WO4D 3SDCB 4M5YL 1UKSA 2XQYK 4G8EA 5GGRY 2MQ3A 3FB7B 1HU8A 3L45A 3FU7A 4MCYA 1SOKA 2CJUH 3G04B 1TJIL 3BUYB 5FUCC 5HPMB 5M94B 3ESPA 4QAWA 4YH6A 3O3EA 2VLJB 1Q9LB 1YPZA 3MFFA 4NZTL 5DLMH 4H8UA 1ZV5A 1UYWL 3UDWC 4HWBA 1A9BA 3QXAB 3B6SA 4G1EB 3DGCR 3OJMB 4X6CB 4PB9L 4JRXE 1GTNA 2FHBA 4QAMB 3SQOH 4JFDD 5GZOC 4IBVA 2XYBA 1E4HA 1EAPB 4RZKA 4UU9A 3TEXA 1CT8A 5IMKB 1M7UA 2XWJB 4ODSH 3UPRB 5IHZA 1XH0A 1NLDL 4P5TC 5DUJA 3ZZ1A 2V9UA 2XSKA 1SLWA 3FQYA 3P9LB 4P2CG 3BRDA 1GYCA 1YRKA 4MJ5A 5I15H 2Y5QA 1F02I 4GRMB 2HJLB 3G6JA 5LNEA 4W9LC 2R29H 1H3PH 3IU4H 1T1ZB 3FO0H 4GQRA 1KLFB 4LLUB 4IJ3C 2Y3AA 4KU1A 1G7MA 3QZPA 4NZFA 3G6JF 1ZLWH 1PL3A 5I8CA 2HRLA 1JHKH 4HOWA 5DJ2A 5E6YA 4NI3A 4HS3A 4K94H 4YHIA 5C3LD 1P4BL 3F7QA 1JZ6A 1OCOB 1J12A 2O72A 3BP5A 2FL5A 1UD8A 3GBML 4CMMA 4N6RA 2X5PA 4XNQA 2KQMA 1PZBA 3L9BA 1R3LB 2HFFB 3FH5A 3LEXA 4U1IB 4RFEB 5JW5A 4AWJC 1U8OA 1LO0L 4HZ1A 3QR1A 4KKLC 5FUZL 4O2EB 1UWGH 2B4CH 2ICEC 3ZTCC 1O7DE 2CU9A 5IB4B 3BWUF 1AO7E 3DDFA 3MJWA 1U3YA 1QHOA 3EAKA 4X0KB 5AVUB 2P46B 3RPIB 5BO0D 2PKDA 3QPQC 5I8KH 1FNHA 4F8NA 4IIQC 1NJ9A 4N2EA 4NN5B 4MNQB 3PREA 4NWTH 5J1SC 1CLVA 1J1PL 5AG8A 4A55A 4Y4FA 1NDGA 4UINH 2A2QT 1Q0XH 4WKZB 4FTVD 1TLMA 3FQWA 2QSCL 4EUPB 5FM8A 1U36A 4I3GA 4PGZA 4BIKA 3ROLB 3MCLH 4KMLB 4HPYL 3VFTB 4X8XA 3B9DA 1MAKA 2BNRB 2RB8A 4UTAA 1DTUA 2IALB 2FNWA 2GK2A 1OP3H 3WLWC 3CFKA 4U6HB 1JV2A 3UPAA 2BVEA 2C3XA 2QL1A 1CF1A 3JTSA 3VD9A 3KPOA 4RMUA 1TQSA 2BP3A 4ZT1A 4ZJ9A 2EXWC 1MVFA 1NC2B 2WVVA 3A21A 4X9YA 5E6UB 1QLEB 2MSPA 1S7UA 1FYTD 3QDAA 4BZ2H 4PAZA 3ARBC 2QZ5A 1DBMH 1HIMH 4J8RA 2DMCA 1CTNA 1E4KC 2FSDA 5GISL 3FL7A 2QHLA 1QSVA 3VFUB 4KK5D 2XZQL 2VLMD 3TN0B 2XG5A 1ZXKA 2FLMA 1HZHH 4D0BA 3MA7B 3ZE1F 5AB9A 4M3JA 4JEGB 4WTZG 4X6DA 5D6DC 5J6GA 5JZ7D 2LLLA 3BRFA 3IRZA 4N2HA 3RA7L 4CW1B 5BV7L 3BUBA 4YXKL 1LGVA 5KS9F 1XCTB 2QHRL 4JO3L 3F3HA 5JHLA 3JV4A 3HZVB 4PP1C 1KXVC 3RJQB 3IDNA 3PXHA 3NAAL 4GMTL 5TDOA 3ARGC 2J20A 3WEAA 2PYFB 4HJEA 2WNGA 5T1JA 2OMZB 3BUTA 4PY8J 5C08A 4DOHB 3V52H 4HZAA 3AREC 3I3EA 4CILA 4GSDH 3ZT5A 1NCWL 3W9EB 5J0BA 1S3KL 2PCPA 3UCQA 1QLRB 5CNHA 4NM8L 2BIIA 2QPEB 3QFJE 3W11D 4I0PA 3GXFA 1PAMA 1CBVL 1R3JB 4G9FA 4WRLA 1FFPA 4ALAC 1JZDC 1IE5A 3FOMB 1KYUA 4M43H 2IAMD 3CFCL 4P05A 2ZZUT 2ZKHL 1DEEB 3APFA 1QI3A 1QSFA 1ZS8B 4PP2B 2A99A 4WI4A 4N1HB 1IM3A 1DSYA 2IJ0C 3N85H 1CGYA 4GAFB 3QYNA 5ACZB 5L88L 4MD5A 1JD9A 4NNXA 2I7OA 4IOFC 1Z9OA 2ARJQ 1OV8A 1N9PA 4OQTL 4F8LA 1OW0A 4EQ3A 3H8NA 3AQYA 3B2VH 4PS3A 2YUWA 5IMLA 4QOKE 3L7FB 2YQGA 4NHUB 3LS5H 1M9WA 2GC7C 2YA0A 1HYSD 3B34A 4K3DL 3RIFK 1QFPA 1SXZA 3E80A 3MQIA 1IIIA 4R3SB 3VXMD 4AEIL 2ORBH 2F08A 4XBEL 1A0QH 2JJWA 4PU2A 2GAZB 3HN5A 4Y1AD 2ADIA 2Z1PA 3D52A 3WCYA 2VXTH 4DKTA 1NEZG 3MRCA 4ODUB 3RNKA 1XGZA 4AX3A 4HWNA 1U92B 1H8OA 1ZHKA 1ILUA 4XP9L 2F5BL 5IFJB 4Y9GA 5DYOB 4JRXB 2AJSH 3W38A 4G7YL 4GBXB 2VDOB 3L2LA 1JJUA 2KHAA 1O7SA 3EW3B 4YPGB 1ND0A 3SYPA 3Q2WA 4YGAB 1BVZA 2J2ZB 2QT6A 1OP4A 2N01B 2QSTA 4R26L 2VE6B 1WTLA 2E3VA 1DJSA 2H0PA 3CUPB 5I8OL 2DICA 3BISA 4FYTA 2Z92A 4XC1L 3DLQR 5CP7B 1BSIA 4YVUA 1OP5K 1MCPL 5F7HA 1M2OA 1ZT4A 2NQ3A 2Z31C 4X0NA 3BZEB 1U8HB 1QI5A 3QJZA 1NAKL 3FTSA 1RUPH 4BFKA 3ZN6A 2ZUXA 1IBZA 4X4ME 2BO0A 3R18A 5CJXA 4LKCB 1QW8A 1YEHH 3JUYA 3X3FL 3RVUD 4A37A 1WBXB 3FB5A 3D34A 3ECBA 1HHJB 9PCYA 3IGFA 2YFOA 1UWEL 3Q2CA 3U6XS 1DJZA 1TG8A 1Z5LA 3PV7A 5DGRA 1UTDA 4PJBA 4TTGA 5CSZA 2BXZA 1AO7B 1DJIA 2WUCL 1GY2A 2EVGA 4PJBF 3HG2A 3TT1H 1J9CT 1KFAH 3HE7B 4I1RA 3CHXA 5E4OA 1TJHL 3KHOA 3UTQA 4M5YH 2X4TB 4Y5XC 5BZXA 3VMNA 4CADB 1OSZB 1QLEL 1OHQA 3IGAA 1QVOB 3TVMB 1TJIH 2D7QA 4KKCD 4WIQA 2H3KA 4R0LC 1SHWA 1TQBB 3DVNB 1UYWH 2EE9A 4LAJH 2PPFA 1I7RB 4QHLB 1D5MA 2JIXD 4NLAA 4OZ4A 1TENA 4PB9H 4YSDA 3MA9L 2R9HD 4XVTH 4DUXA 3ATBA 3RX7A 5AKTA 4LQFL 1SJHA 2X4UB 3BPNB 2PPAA 4K7PH 3DBSA 1NLDH 3AS3A 4KDWA 5D7IA 4M1CC 2YOAA 2A9NL 4KFMA 2H32A 5D7IF 1U41A 3DBXB 3ZE2F 4JJ5A 4RA3A 3MLUH 5GGVH 3PAZA 4PM1A 4DNLA 2JF1A 4F57L 2IGLA 3N43F 4P2AA 5DQ9A 3FFCA 1FYTA 3O11A 4NIKB 4XN9A 4LP5A 1UXWB 1L3NA 3V4PA 2NYYC 5DQJA 3OLIA 5B39B 4A7QA 5CEXA 4I3SH 1P4BH 4P46C 4QXVA 1YEGL 1MSPA 3QEQE 3TBSB 2YLKA 5CMAB 3HFML 3RGVB 4JPWL 4U7MA 4UQ3A 1CFSA 1QO3A 4ZD3L 4DKDC 1LO0H 5FUZH 1A4JA 3JZ7A 2OJEB 3M7FB 4FG2A 1DJHA 1VJSA 1ZTXE 5KSUA 1KTDA 5FLUA 5HHQB 2HTLC 2P48B 4MCZA 4OI8A 1BIIB 2VR3A 4FQXD 1T7XA 3C9NB 2MNWA 5KVEH 4JVUA 4AYSA 5TF1H 1RPUA 1UXSB 2C1PB 3WS6C 5JPMC 2P1YA 3SPIA 4PREB 1M3JA 5BUPA 1J1PH 4JM2D 1L7TL 3TNMB 2IADB 5DSCA 2YD6A 3BZ5A 1W72B 2QSCH 4TQEL 2PUQT 4Z23A 4X9FA 3C5ZA 5E1GA 5GRVL 5T3ZE 2W1NA 2Y7NA 2MKLC 5DJ8B 4CMHB 1PG7L 5LWYL 3COOA 4HPYH 1INDL 1PBYA 1HCFX 5B1BB 1SNRA 4I88A 1NM9A 2TAAA 3N40P 1ESOA 4B9YA 3ECWA 3T4YB 2YZ8A 3QFJB 3U2JA 5E7BA 1MCFA 2BC4B 4L4TA 3IMSA 1G9NL 4PBVC 2Y23A 5AYUL 3WEMA 2Q20A 1G7QB 2A73B 4K5OA 1NCNA 3D0AA 3MRPB 2EDQA 1YNTB 1AIFB 4E41D 4QXGL 3TJHD 1HILA 3K8LA 3MLXL 1HHGA 3AT0A 2YD5A 5HGDA 5CJQL 4XGZB 1S78D 1JPFA 1D5ZA 2ZONA 3AXHA 4H8QA 3HEIB 2J5LB 5GISH 3D39D 4PVBA 1FO0B 1FE8L 2XZQH 4ZW8A 2X70B 3AGWA 3TIDB 1KGCE 1I8KB 2Z0BA 3PS6A 2ZD0A 1EUUA 1YUHB 1ORSA 2D0HA 4NUPA 1AD0B 3IDXL 3FPYA 2DWEB 3GSVB 3IJ9A 3VXMA 3RA7H 3F04A 3V9EA 5BV7H 1O9VA 4YXKH 4RSYA 2QGCA 5FCUL 5E9AA 3AY4C 4HIEB 4JO3H 5IQ9B 1TQCC 4AM0B 3PUCA 4HPOL 3DUUA 2DYPB 2YRLA 3NAAH 4GMTH 4EN2A 1EV2E 3M45A 4WDIB 5ESAA 5GS1C 3IDUA 1NUFA 2VW7A 5JDSB 2EDJA 5E00B 3WSQH 3FK3A 3U83A 4DO6A 4K8RC 4V2CB 3IMTA 4X6EB 3ZXAC 1P5VA 1NCWH 2HX9A 2OCJA 3FCTA 4LSRL 3ULVE 4OR1A 4QXWA 2WLJA 3ML9A 3G6DL 3S88L 1S3KH 5EC2A 4YQXL 5KSAD 5I5MA 2XFXA 4GRWE 4MJ2A 1CBVH 5B22A 2EDDA 6PCYA 3OWEA 3IN2A 1FORL 3P0YL 5AOZA 3VWKA 1KJ3L 3LKNB 3ZZSA 3CFCH 3TLRA 2UX7A 2ZKHH 4WW2B 4ODTL 2NXYB 5DLLA 1IQWL 2OSXA 1DQTA 5HP5A 1L0XA 4YSPA 2W94A 4U6XA 3IGKA 1PGRB 4JREC 5L88H 2X89D 3TM6A 5HDLA 4WI0B 2P24A 4LVNB 4XPHL 5EEXA 2IV8A 2DB8A 5F70A 4AEHL 5KYXA 3BEWA 3PHSA 2G4EA 4JDVA 2WWNA 4O2CA 1LDPL 4AL8L 3VCLA 3QI9B 1JG9A 4F37K 1ZEAL 3ZJAA 1E8XA 4U3SB 4AEIH 3WMQA 4OB5L 4EI6B 1UACL 4ANVA 1G7PB 4XBEH 1Z9LA 3RTLA 5JR1H 2XTJD 4OZIE 3WV0A 5MENE 3SDDC 2P8LA 2BVYA 3U7YL 2JKRM 3THML 3Q43A 4JRWA 5SWSA 4XN8A 1AHWC 1PU0A 4NO5A 3DX3A 4XMXA 2WLNA 1BBDL 4S2SB 2J1WA 5LHDA 2VDLB 3FT1A 2F5BH 3CV5A 2UWEF 3DMMB 4P23A 1FCGA 4BFGA 2GTQA 3SDAC 3GSQB 4AYID 4HEMA 3NEXA 4G7YH 4OF3A 4AZUA 5FXCH 3TO4A 3G5XB 1Q9KB 1UB5A 1ZMYA 2IPKB 5CZRA 1SYSA 5IB1B 5E8EB 3BVUA 3H3KA 1WRFA 4MXQD 1PTZA 3B7YA 3EFOA 1P1ZB 4R26H 3HPLB 5K69A 1JVOA 1VACB 5I8OH 1KIPB 1X5LA 4NPKA 4PTTB 3UROR 4XC1H 1KULA 1ZE3H 1TEFA 4QY8A 3KDPB 1MCPH 1ZHNB 3AW5A 3GXUB 2XXCB 4LF3A 1O6TA 3BVWA 4UTAL 4NQTA 5BS0E 5GS0L 3CLFL 3IXTB 1QWUA 2W07B 2P5WD 1NAKH 1HHHB 2M1KA 3R8BB 4B0MM 5GGSY 4EUPH 3QEQB 5E4AA 4BE6A 4JFZL 3MJ9L 1RLWA 2NY6D 2WCSA 3X3FH 1XAUA 5BJTA 5GZND 2NY0C 2V5YA 3R06B 1HOCB 3GXMA 1R3IL 2EE6A 4Q56A 1T7VA 2ARWA 3S9DB 3Q13A 4MMXA 1IEBA 4HKZA 1KYOK 4U1HB 4OFYA 1AG6A 1X5AA 4C4KT 2WUCH 3ARUA 2CCWA 3UCRA 1IEAB 3CDGA 1AAJA 1T20A 4ZO9A 2VR8A 3FB6A 4DT2A 3D09A 2WTRA 1QLEH 2LABA 5ISZE 1FLTX 2P44B 4M7ZC 4Z76A 3QC6X 5IEHB 3X1FA 1S7VA 1T1YB 3QIWD 3MBED 5AKSA 5DHVB 4PJDE 4AIZA 5EEUA 4KDTC 1D7FA 4ZFOB 2AXHA 3L8QA 4JUSA 5IBLC 3U7WL 3MNZA 4H1LB 3UMTA 1DQQA 5LO7A 4Q9RL 3ZPDA 2ESVE 1S9WA 3OLEA 1EQWA 3MA9H 2BNUB 2C9SA 5JHLL 2HRHA 3GJFK 2FZ3A 3CCHB 1EFXD 3S3PA 4LQFH 5LXGL 3WI9A 1MVYA 4EDXA 5DJ6A 3VFSA 3PG2A 2ZWLT 3CFIC 1FZOA 1ZDQA 1ED3B 3GMQA 4PD4J 1PZSA 2A9NH 2PCFB 3WLBB 1LE9A 4TVUA 5ESVB 4AH2A 5JIQA 3HE6B 3P1VA 2XPGA 4E41A 5CJ5A 3N0PB 4LEOA 2ZOUA 1PKQB 3KXFD 4F57H 1O6VA 2XTSA 1VSCA 5I1LB 3BJ91 1ET8A 1W6LA 3BGFC 4LLQB 1UG9A 1CFMA 4UDTA 4I4WA 4H40A 1Y6KR 5JLZA 5CCHE 3PP4L 5D72L 3M1OA 2F7PA 1CLZL 2NY3B 4S1DC 3D50A 2XKUA 1T1XA 3MNMA 4I18C 7TAAA 2B39A 4CUCA 4AYBA 3HFMH 2APBA 3QQDB 4ABVA 4JHZA 4WU5B 4ZD3H 1CXLA 2AV7B 4WWKB 1U3HB 5DS8A 4JRYE 5EF2A 2A6DB 1H8NA 3U25A 2H3NB 5E08L 1GJUA 4LCUA 3T2NL 4GUPB 4PR5A 2DMHA 4PJ9A 2C9XA 4HD9A 5AW9B 2ADGA 3MSPA 4NQDE 1NH6A 1LE5A 3IDJA 2PYEE 4R7DB 4H8PA 4PJAA 3BP7B 3D9AL 1WC7A 2V3DA 4PJAF 1QAWA 3ESVF 5D7JC 1L7TH 3MREA 3B7UX 1O5PA 1W0WB 1A4BA 2IOOA 1DUYB 4HT1L 2IOMA 4TQEH 1FVCA 2OKMA 4RMBA 2EJ1A 2ENJA 4XZUB 4R7XA 3ZDZF 1H9VA 2KPNA 5LWYH 2G2RA 3TBWA 3CFQA 1UZ6E 2Q3XA 3H7BB 4F33B 4Y89A 5K9QI 2XNAA 2VLRE 4GRWB 5E94A 2NY2C 5J3HC 1WWCA 3MLZL 1G9NH 3NJLA 1JMZA 1QOKA 5E9NA 1VRSA 4HGKC 3QULB 5AYUH 2DQHL 3L5XL 5HHOA 4ACTA 1CC3A 2EIDA 3MUGB 2ZKYA 1CD0A 3TFKC 4QXGH 2PW2A 5FO9A 4OLZL 1MY7A 4ZUTB 3LY6A 4LU5L 3MLXH 4BK8A 2XUWA 2XETA 2OK0L 4N0CD 4R7NB 1FFTB 5IBUG 3DV4A 5CJQH 3MRKB 2VDLL 2C3WA 1TZ8A 4ORGB 2IFFL 1KPUA 5EULV 1EA9C 5EC1B 5FM5M 1ZLEA 3W81A 4HDIB 3S35L 1FE8H 1GAFL 1M7DB 5DJCA 5BUAA 1BLIA 3SZKC 1RZIB 1J11A 3ZUCA 2DQCH 2KZ1B 1QUNA 3IDXH 1F45A 2CJSA 3RWFB 4W9EC 3VNYA 4IRSD 3IJYA 2OYLA 2HG5A 2HSIA 2NXZC 4A04A 1ACZA 4OZFB 1CYXA 4XPGL 4OZIB 2X2JA 3PABB 5MENB 4Y2DB 2X4OB 2EDMA 4EI5B 3WGUB 3X14A 3LD8C 4HPOH 1IMHC 2CR6A 1UWYA 3FU9A 4YDJB 3DX8B 3G9AB 4AVHA 5ABAA 2GEQA 1G7IB 4NS0A 4FULA 1JVLA 3MNWB 2IGFL 2V9QA 3OVUB 2DWSA 1PNCA 4X5WA 5JNYA 4G8GD 1NAMA 3BH9A 4DEPB 4ZZKA 1L9PA 4LSRH 1MIEL 2OTUB 5A16A 2NW2B 2Z1KA 3S88H 3U2SA 1F4YL 4YQXH 5EZPA 5J06A 1I1YA 1ZT1A 3IXAB 3EOTL 1FZMB 5ID1B 1WFUA 4F8PA 2VQUA 1AYRA 3D0VB 3IFLL 1AE6L 1CB4A 3HN3A 1FORH 1AR1C 3P0YH 1KJ3H 2CAKA 2Q7NA 1FNEB 4Z5RA 4P2OD 1MCKA 4ODTH 1NCAH 4MWFB 2NUTA 5HDWA 1IQWH 1Y6NR 3RY6A 3UG4A 1FL3B 3MV9D 1YZZA 4RDQF 2P5WA 2JKLA 1E27A 5FO2A 5T3ZL 3JWOL 1FI8C 1QLFB 3WO4C 5IB5A 4B9ZA 2WXGA 4XPHH 3O2VL 1R4XA 2DYSB 1A64A 1U8NA 2G30A 2OTWB 4AEHH 4EUPG 5DTFB 4AVJA 3TS8A 2CQVA 3R19A 3U9WA 3H0TA 1LO3L 4AL8H 2GIYA 3VXPB 3SO3C 4D9RD 5J13B 5GZOD 1XVSA 4OB5H 1UA3A 2WBJD 1KJ2B 1JPSL 1BXUA 5ISZB 3DRQA 2FGZA 3U7YH 4IBZA 1QEXA 3THMH 4P5TD 3FJTA 4KNTA 4JG5A 1BBDH 1UQSB 2ZIDA 4YHYC 4K7PY 4P3CL 1E6JL 1AQDB 3ABGA 4PJDB 2IPUK 5EG6C 5DI8B 2CBQA 3RVVD 2MOGA 5BPPA 3IJSA 5ICYA 5K9KA 4L8CB 5EU7C 1U6AL 2UXGA 3VFVB 4XMLL 4POZC 4DERA 2XIDA 2FBJL 2ESVB 1ZRUA 3PLYA 3QO0A 4F9LC 3CJJA 5FA4B 5GGVY 4NQSA 1EEQA 3OXRB 1KGWA 2G0KA 1NGZB 4BKSC 4DP6X 4ZX3A 2YBRA 3V6OA 2PO6C 3IMUA 3DC0A 5HVWA 1GW0A 2BWIA 4IJTA 3OAZK 4N2AA 3DHUA 3O6ML 1HSBB 5HGBA 2CDEB 1KGIA 4KKLD 3T65B 1CYGA 2Z6FA 4L8DB 5HYEA 3ZGHA 1TNNA 1RI8A 2CKBL 1UUSA 5DHYB 4KTGA 2SEBA 2DM7A 1BF8A 1CFTA 4PWFA 3KBHE 2ITDA 2ZYIA 5LNDA 2VR9A 5GS0H 4DZ8A 3AM8C 3H9HA 1YJDC 4UQ2B 4JFUA 4LSQL 4PRIE 3PDDA 4OGYL 3S6CA 3LVEA 4G2AA 3CZJA 3LSOA 1Q94B 3HMXA 2AXJA 3MJ9H 4JFZH 3WNNA 5MP6L 2WYZA 1P4UA 3CFDA 4KO9A 1CGXA 2IDSA 1O9ZA 2ZSWA 3G7TA 4JRYB 3RUGA 5AB1A 4BUGA 4YSAA 5I24A 4M9PA 1DN2A 5KVFL 4TYUA 5F1OB 5JXEA 2O5YL 4P59L 3RUGF 5JW4N 3UZQB 4IQHA 4NQDB 4N28A 4M29A 1S7RB 2PYEB 2Y6SD 2I69A 3BIKB 3ESMA 4JFHE 2PWFA 4XCFL 3VFNA 3WLWD 1N19A 2VMDA 5HSFA 4CN1A 5C8JA 1YG9A 1JZEA 1MCQA 2RD0A 4GW1B 1TZHB 5FK9A 2EXWD 1KCLA 5D1QA 2K8MA 2VDKB 3U7WH 5LVEA 2DAVA 2AQ1A 2XWBA 1MW3A 3WFEL 4Q9RH 3O8XB 4HKBB 2FQGA 2P5PA 1R5VA 4EAEA 1R5IB 2VLRB 3KYMB 4PRPB 2P4AB 1A3RL 2HLEB 3KEDA 5LXGH 4NC2B 2WXOA 2XWXA 5CWSA 4K7PX 4KGLA 1PQZB 3NIGE 2WW8A 1BPVA 2QVKA 2PXYB 3HB3C 4EJ1C 4KQ3L 5I82A 4NQXA 2W0LA 2WINA 2ROYA 4RNRB 3K81A 3M46A 3L9EA 4LASL 3ZT7A 1UGKA 2Y1ZA 3VFRA 1UGNA 5JTWA 2FHFA 4PYGA 5KYNA 3CH1A 2EC9U 3L3KA 1HYRC 1XB6A 3PP4H 5D72H 2GB2A 1UVQA 4PP1D 2NNAA 1I3UA 2BY0A 3WNKA 2XXMB 3AUVA 5DK2A 5BO1L 3AWFA 4PJ5D 3OR7A 1JWSA 1BZDA 1UADC 3ARGD 4L9LC 4KVPA 1UM5L 1E2VA 4FJ6A 5ETUB 4FLHA 5ENWA 1B88A 5LBSA 3ARED 1RIVL 3F8UB 4CA4A 5E08H 1Z0NA 3TH4T 4GSXA 5LNGA 2Q76B 3T2NH 4OLUL 1BVKA 4AW4A 4HUUA 3BN3B 3NIFE 2WZ5A 3WEXB 1NFKA 1ZAGA 3WN5B 3D9AH 1FL6B 4MJIB 4O9HL 4GKSB 3QCVL 4PJHE 1UKTA 2EH7L 2YHGA 4X7CC 4YUEL 4AUUA 1SFDA 2MH4A 1G43A 2H1LM 1ACXA 4RISL 1KLUB 5HHNB 1H6EA 1ZJAA 5EB9A 2ATPB 4XHJD 4AV0A 1BHGA 2ZXGA 4XE5B 1A6ZA 3NCYP 2EO7A 5H37H 4Y16A 3VTMA 1XF2B 5JHDB 5DMIL 2D8KA 4BQCA 1AKJA 4JO1H 5BOJA 3VI3A 5SX5H 1BPLB 1Z3GL 2P49B 4JFOB 2CIKA 3WELA 4JN1L 3LKSB 2F1AA 5DJAB 5IR1B 4IOFD 4Q6IC 1CD9B 3K6DA 2XPZA 3RZCC 3TP4A 5E1QA 1T6BX 4HWZB 4MD0B 4JPIA 5CEZD 4LLDA 2DQHH 3ZQWA 1I8LA 2X4RB 3L5XH 3CZFB 1KJ2L 3KPTA 4XODA 3T0DA 4Z7NF 5LDUA 1BEYL 2Y07L 3EBAA 3O41B 3TEZA 3FB8B 3NFNA 3ARDC 4OLZH 4WFHE 4LU5H 2GHZA 4UQBA 1WAAA 3B9KA 2OK0H 1JWUA 2WQXA 3U36B 2VDLH 3DPBA 3NOIA 3WO3B 5C9KA 2IFFH 2OI9C 1UXLA 3A6BL 3KYOA 4XNYL 2V7NA 5EZLA 4CSTA 2WD0A 4BFIB 5DK0B 4GAYA 3RDTC 3S35H 1GAFH 2G5RA 5E8DL 3SGEH 3UDWA 1IC5L 1RZJL 5D7LD 3CLEL 2ITCA 2QQKL 2HUHA 2RQEA 3C2SA 4JFSA 5IWLC 1QNZL 3C60B 1SBSL 2ZAIA 5GZOA 1HJCA 5CGYD 3ESUF 4H5SA 4PBXA 4XPGH 3DK2A 2MQ0A 3F7KA 2F68X 2ITEA 1EGJA 3HR6A 1URIA 4C4KO 4P5TA 2VN4A 3LRKA 1I8MA 3G5VA 3D3VE 5E2UL 2B8OT 3MRQA 5IFHH 4KZ0A 2BNQD 4YSRA 4L9DA 4FXGC 3K72B 3LKOA 2H7WA 4KUCD 1BXXA 3MBXH 1XGQB 1I1FB 3ILQD 2VAAB 3LQAC 2XVLA 3BZ4A 4AIOA 1JF5A 3N44B 1GGUA 2WV3A 3SGJC 3HS0A 1MIEH 2QLYA 5G55A 4GS7B 3EDJA 2X53A 1WA1X 3EDEA 2JELL 2NX5A 4RGND 4WTXA 1QSEE 5DRWB 1FFNA 2EDKA 3IFLH 1AE6H 2EDRA 4KKAC 1NMAH 2R2EA 4U6YB 1AZZC 2ICEA 5KN5B 1M6OB 3AS1A 5HYJE 4JZJC 1FA4A 2YD8A 3KYNA 3POCA 3N5AA 1RJZB 1C1EL 4WHTB 4PRIB 1LQSR 3M86A 5DHVH 5T3ZH 3JWOH 4XCCH 1R5WB 4YFEA 3GNML 2VDKL 1UT1A 2XWTB 2I07B 3DVGA 4H1LH 4HS8L 7FABL 3O2VH 3EH2A 3U2IA 4N2DA 1RZ7L 1DEDA 2ZKWA 4Y8DC 4CC0A 2F54E 3D48R 2ZX6A 3FCGA 3HZKA 4U2YA 1FNFA 1K4DA 1S9YB 4PTUB 3U1PA 5TE7L 1LO3H 3B83A 1S5HA 4RQQB 4XBGA 3VB9A 2H8PA 2NLJA 1FN4A 3P40A 1WS7A 1X9RA 3CHRA 2UY7A 1CE6B 2ZOLA 4QRTB 4N68A 4NO0D 1CICC 4BK5C 4Q14A 1S7WA 1NCTA 4WI8A 2FECL 1JPSH 3CC5A 5ERWB 4PD4K 3GKZA 3HW7A 4R7LA 1P7KB 1A6WL 4Y0GA 3NSYA 4M1CD 4DZBA 1C8QA 3PGCA 1WEJH 4PUBL 2E27L 3OKDA 4L2YA 4CBZA 1QHPA 1XCXA 3BPOB 5DC4B 4P5MA 2FJHB 4P3CH 4PJXF 1E6JH 3LX9A 2DTML 1E7UA 2BIPA 5A3IC 1U6AH 4XMLH 4FYRA 1N0LA 3TBTA 2FBJH 3E1ZA 3HUJE 4J27A 4AITA 5KBMA 2HVJB 3MBWB 4MNGA 4P57B 5ICXA 5IQOA 2YOCA 1GZPA 3ARBA 3EUUA 4TSCL 2WTPA 2V2XA 3GJEA 4IKKA 4L37A 1E4KA 5PCYA 1GGIL 4P46D 3LZNA 4OZGE 1ZGLB 1U9KA 3NIGB 1IBDA 1RY7B 3L6FA 5HGAB 3IKCB 2ZG2A 4HHAB 1XXFC 3O6MH 5C7ZA 1XZ0A 4QRQB 3WIHH 1XBRA 3HAEB 3H55A 4BGDA 2BHFA 2WYHA 4OKDA 4AMWA 2CKBH 3FQ1A 1WAPA 4QIRA 1DFBL 5J11C 5E03A 1VZIA 5K39B 3GLEA 1N5YH 1ES0B 1KXVA 5FF6A 4LSQH 2GUYA 2EDXA 4OGYH 1D9KC 4PJ5A 4AQ1C 5BRZE 5IQ7L 4QI3A 4D8OA 5I1DA 4PJ8C 3F64A 3EOBA 3DX6A 5T3XE 5MP6H 3FQRA 2I25N 4FQIL 5HI5C 4AE1A 4JHUA 3JWDC 4DGUA 3PHQA 1E90A 4GRWH 4P49A 2MHAA 5KVFH 1ZK5A 2O5YH 4P59H 3QDGD 1TZGL 4LEBA 2D2OA 1Q9OB 4JFWA 1MHPL 1S7QB 4D9QD 2XN0A 5E2TL 3NIFB 2WMPB 3P4MA 3O45B 4XCFH 1DVSA 3HBPA 1NFDA 1I75A 1O5DT 4PJHB 5SV3A 2NY4B 2WNXA 3ZSSA 3CSYA 3MJ8B 3DUSB 1H3GA 5EOTA 2O93L 4OJCA 4PG2C 3NT0A 1BFOA 3VYNA 4O58L 5F3BB 3P30L 4YBLB 1KB5A 2F53E 4LDOB 1INQB 4PLOB 3KR3L 2BCKB 3EGDA 3FSVA 4R83A 4PY7A 5DEJA 3WFEH 3UZEC 4GT7A 3S4SB 4JE0A 1RMFL 1Y07A 3EKCA 1HESA 1A3RH 1DJXA 1DVYA 3L1OL 2MCMA 5H37G 3VI4A 2PABA 2Q2EB 3V5HA 5F7LB 1OGSA 4OJYA 3FKUS 4IGBC 4OZFH 1GPOL 3VI4F 4KQ3H 3GGWA 5FKPB 3X2QB 1SJXA 4ZX6A 2A7BA 4Z77A 2GT9A 2H2PC 4LASH 4Z95L 5JHBA 3D6GA 3FF8A 3GLZA 1FG2A 1Q0EA 2WLYA 4U05A 5T5NF 3RI5K 3ZYZA 1G94A 4F15C 1C16B 4E36A 1JGIA 4X8JA 1EZSA 1X4XA 5KJ4A 2GTZA 2WM0A 5BO1H 3F2LA 3U6RA 1KN2H 1XR8A 2Y6TE 2ZAGA 1ACYL 3MC0A 1UM5H 3EYOA 1LO4L 4R97B 5F93C 4NUQA 2ZWKA 4UI2A 2AK1L 2VB5A 4TVPL 4F7PA 3RFZB 3D18A 2BOBA 3K6NA 2PWHA 4PFEA 3QWQB 4IHOA 3SGDH 1BZQK 1U93B 4JS7A 4OLUH 2H41A 1XAKA 3QH3B 1RURL 3ILPB 5IOKA 4BQ8A 1KIQA 4TNWF 5AWNH 1NFIA 4TUUA 1SHXA 5D1XE 1J5IA 4MA3A 1NCOA 4O9HH 1PYWB 1SDDB 2GCYA 3FQUA 2EH7H 2CLZA 3QCVH 4YUEH 2FAUA 2XQ0A 4MZRA 1D6EA 3PWPA 3UTTE 3MLVL 4RISH 4IRJB 1M7XA 2CNZA 2YR3A 5E99L 2Z31A 2YPKA 4ZO6A 3N06B 1BJ1J 1N6UA 3L13A 5DMIH 3BQUC 4XNUL 5EF0A 4LESA 1IL1B 1Z3GH 3A4FA 4GRLC 4JN1H 2OZNA 4XCNB 1DVQA 4XHQA 4AY0A 1WCBB 4L05A 3RWCB 3QDMA 3SEPA 2K9FB 4UIKL 2AEQH 1YPZE 2E7HA 3O6FD 5DJ0B 2JB6A 5T1KB 4I5BA 3W9DB 1KJ2H 1AXIB 1BEYH 2VLKD 2Y07H 5F7DA 5HYJB 1MIML 4JX0A 2NSQA 2AXGA 1ITBB 3QPKA 4LEEA 2PCYA 1XEUA 1ET5A 3DIFA 4WJ5B 2AQNA 5DS2A 2DQMA 3QG6A 4E68A 3H54A 3SDDD 1MJJA 4AK1A 4AYFB 1BFTA 3A6BH 4XNYH 4A68A 3TT3L 3NTCL 2CXGA 3WEOA 2F54B 4U1MB 1TZOA 3Q6FB 4KFZC 5SWQA 5E8DH 2BSED 3D8MA 4OD1L 4MGXA 1MCEA 1IC5H 1RQ5A 4G70B 3RYMA 4H1LG 2QQKH 4N0RA 2AJ3B 4AOFA 2CALA 2I9LB 3GKWH 2XQBL 1QNZH 4Y5YB 1SBSH 3FOLA 5C09D 3KGUA 2H6PB 3P77A 5CGTA 5F89B 4M4RA 3EOYG 3I2CL 3M7OA 1L9MA 5EFIB 2VITA 1LWJA 3L3OC 4YR6A 3QXUA 4XO9A 1S7XB 3VU2A 1X4ZA 3AU1A 5E2UH 5AW3B 3ARTA 1ZY9A 5DVOA 3FO1B 4PW3A 3SYAA 3F7RA 3W2DL 4E9WA 3OL2A 3BLBA 1OCRB 2ID5A 2E7CA 4N3TA 4UT9H 3V6BR 4N8UA 5AB0A 5CBAB 5I1IH 4AT6A 3HUJB 3KL5A 2YEVB 4NQEA 1G7LA 4OKVB 2Q87A 5D70L 4NAQA 2ZCLL 3HZMB 1KTJA 5C6WH 1MFAL 3VXOB 4AK2A 2BSCA 5DQDL 4JHBA 1PPIA 1UOWA 2GK0B 1MVUB 4P46A 2QTEA 4OZGB 1RH8A 4BZYA 1V54B 2ODHA 1QYGL 4UAOB 5EHFA 1DJYA 1UB6A 3VH8B 1OEZW 1YY8A 2Q5BA 3RVWC 4QCIA 5DFTA 2X4QA 4RMSA 4K94C 3QDJE 5TH2B 4U7KA 2CGRL 3QEUA 5I1AA 1EEYB 3T08A 1CL7I 1DR9A 4QF1B 5E5UB 3K5SA 2IH1B 3APCA 3NEEA 4GXUN 4LSUL 5BRZB 1S7SB 1HH9B 4FNTA 4WUUE 4P5KA 3GNMH 2VDKH 7FABH 3RDJA 4W9ZA 5B8CB 4B97A 1CTOA 5ICZA 2EECA 2B4CC 2WQUA 5DJDB 1RZ7H 4BDVB 5AYQA 3L4TA 3TASA 1ZGLM 1A2YA 2CDFA 5INDA 2YSSB 3UTPD 2MRYA 3ZU8A 4F2MA 4ANUA 3UTSA 1BYOA 2D31A 3LB6D 4BHUI 4H4NA 3A22A 2FO1A 1XFPA 3QWOA 3DOSB 4GY4A 2FQFA 5EO1B 2MCAA 2E56A 2BP8B 4LB8A 1FIEA 1A6WH 5TDPB 1MAML 5T1LD 3A67L 2K7QA 1CURA 3EDKA 3UP6A 1F1GA 4PUBH 2BFGA 2DLFH 2E27H 4URTB 1V3KA 3I3BA 4X6DE 2DTMH 4UIMA 4B41A 2F53B 2OL3B 1D7DA 2BPBA 3RFRA 4PJIA 1OQXA 3OR6A 4X7SH 4N8VB 2JMRA 3RKPA 5AD0A 4PJIF 4TSCH 2GC4C 2VZVA 4S1DD 5DRNB 1GGIH 2J1ZA 2WP3T 3EO0A 4XRCA 1A6UL 4JL1A 2VSMB 4N8PA 2FYYA 1OL0A 4TNEA 2A1WL 5GQBA 2FHCA 1YMMD 5LGJA 4OJAA 4PMEA 4OZFG 4Z3HA 4HJJL 2X2UA 4HKJA 3DOIA 1DFBH 4NO2A 1HL5A 3NIDE 4LKXA 1UFUA 3AY4A 4PRDA 2HTKC 2V9RA 1C7TA 1H5BB 1YC8A 5IQ7H 4LLMB 4JFFA 2GJ6D 3S2AA 1JMXA 1T22A 3OJDB 1OD7A 5GS1A 1FCCA 1WWWX 2YUZA 4FQIH 3HS9A 4GUCA 4HUMB 1KEGL 2Z35A 1Y18A 1JD7A 5GRXG 1TZGH 2WQWA 1E50A 2R0LL 3QJRB 3FQTA 2E59A 3MRHA 1JN6B 1ETB1 5E2TH 1CGSL 3A24A 5DJXA 4WV1C 2YKKA 3MRIB 5D1XB 2NY2D 3RIAF 3W56A 3GC3A 5IP4A 5FO7B 5MHSD 5J3HD 4R2GB 4NUGH 2C9AA 2ZKMX 4AYGA 4YHNB 3GQFA 3T8VA 4AKOA 5E9DD 1ZPLA 3UTTB 1E9QB 1PVHA 3ASOB 5FGSA 4O58H 4QLRA 3P30H 3TFKD 4WNSA 3KR3H 2Q0ZX 5GSRB 1RK1B 3FXIC 2CLRA 2EXYC 4ZX5A 1RMFH 2OMVB 1O75A 2VN6A 1FC1A 2LOEA 3OKNB 4G8EB 3CZGA 3FSOA 2X7LB 3N91A 5J7CC 4UNUA 4XNMB 3Q05A 2B0SL 5FOBA 5GGTL 5I1GL 3L1OH 2IQAA 4KKNA 4W68A 4NNPL 1ULVA 5DRXA 3O3EB 3SE4C 1N5AA 3ZL4L 1YPZB 5DD5L 5HDQL 4I9WD 1N6QL 4HUWA 4FERA 1GPOH 4OF5A 1A9BB 1B2YA 1OF2A 3B6SB 1TVBB 2RACA 3GD1C 3PWLA 4OUUB 4AQAB 1I1AD 4KJPC 3IETA 3BZFA 1LP9E 4KX8A 1SM3L 2NXZD 2XX0A 2HX8A 3M88A 3QT2A 4JFDE 4Z95H 2VDMB 3BVNA 1M7IB 3FUMA 4PCKA 2EE0A 3RQ3A 1Q38A 2WN2A 4UU9B 4CU7A 3E6HA 2WKOA 4JKLA 3S5ZA 4EIUA 5I23A 4JHVA 4MMZA 3GB7B 4N25A 4F3FA 4XNZB 1AHWA 4LCYA 5D4JA 4QYAA 4QHNA 1ACYH 1IGML 4RMRA 3G6JB 2BSEA 4Q4IA 4Y1SA 1LO4H 4R96B 4X4YA 3SD2A 1XR9B 4MAYB 4QHMB 5DVLA 2AK1H 3TIEA 5IMOB 1G7MB 4TVPH 4IOIB 3ZMEA 5I8CB 4E0RB 3JTTB 1VGKB 3C8KB 3SDAA 4P4KC 1J9RA 5DFAA 2FWOA 3QCTL 1W2KT 4OIIH 4AYMC 1C9SA 2F8XC 5AAPA 2YXWA 3KCWA 2BFVL 3RJOA 1G1OA 2FO4A 5IB2B 1KCWA 3B2UC 2FL5B 4CMMB 1NGXA 4N6RB 1SHMA 3L5WA 1BVLA 3QZMA 1KDJA 1N8ZA 1F4XL 3L2MA 3MOAL 1VZHA 2ARJA 2PTVA 2YPLA 4HIIA 4KK9C 43C9A 1DYZA 2LAGB 5JW5B 2OQJB 4ZXBC 4DP9X 1BG1A 4LOVA 4XTRD 2AXFA 1P7HL 4ZRGA 3MV01 5E99H 4UNTA 3IB4A 1QFHA 4JN2B 1LEIA 2AVFA 4JANA 3ZHFA 2VDRL 2Y25A 3ZE0E 1A4KA 4XNUH 5CGMA 4JW3A 4KI5C 1NJ9B 3S5LA 1OP9A 5E1HB 3BFWA 1FZJB 4IK7A 5J6HB 5B38A 1ECYA 4MA1C 2EAEA 4UIKH 3ARVA 4L3EA 5FLVA 4FTVE 5I74C 1I3GL 3QDJB 1J0HA 1AGCA 3DROA 3FUDA 2R1YB 2YLHA 1JF1B 3VMPA 3U0PA 3BVDB 1ZPUA 1T0MA 1Z2KA 3SCMC 5DURB 4E9TA 5IHBA 2O5ZL 2BZ7A 2DLTA 3H3PL 5E6IC 2OL3L 3VA6A 1MI5D 5IEKA 1CDBA 1W9XA 1U8KA 2Q2LA 4Y19A 3TT3H 2NW3B 3KPOB 1H15B 2CKNA 1HHIA 2IDCA 3NTCH 4KO7A 1KY7A 2YBGA 4LBEA 2WXFA 4A6YL 1JZ4A 3QYCA 1ACCA 4DETA 4KDTA 3DHPA 1IJNA 4X5XA 3CHSA 4POZD 5JW4M 4D3CL 2XQBH 4HGWA 3GIVA 3QR0A 5ALCL 2CO1A 3N9GL 2HWZL 3HAEH 5EBLB 4UOW0 1DSFL 3I2CH 1CU4L 5T1LA 3V0EA 1AANA 4M56A 3TBYA 1XTLA 4F58L 3AS0A 1T21A 2XG5B 2VLME 1BG9A 3Q9QA 2QQLL 3OZ9L 4YVNA 2EC8A 4FZEL 4D0BB 1PW3A 1K6QL 3EFFB 3FO2A 3GUFA 3NZUA 4X6DB 3U4EA 5GHWL 3W2DH 4ZTOL 5HHXL 4HOMA 1NCHA 4I13B 4B3EA 2BSBA 2LFGA 3BEVA 3P73A 1HEZA 5D70H 2EIZB 2ZCLH 2ZXWB 4MQSB 4NUMA 5BZDB 3IE9A 5JA8B 1MFAH 5DQDH 3S8FB 5K1VA 4Q74A 3T04D 4I18A 4TM9A 5FYLD 2FT6A 3ZR5A 1IBYA 1HDMA 1II4E 3FTVA 1QBML 4KXAA 4TSAL 1S5IL 2OMYB 3MYJB 1AGFB 2CA4A 2E74C 3SE8L 4P2QD 1KB5L 3H4FA 5TE4L 1YMMA 2KLRA 2CGRH 3OG6B 4KNSA 3CU7A 1PZ2A 3NIDB 3U82B 1YECL 4DK5A 3T9WA 4LCCC 4KZCA 3K6SB 2A4ZA 5I73C 5E1IA 5EIIB 1U8LA 4I0PB 5E6SB 3X1EA 5KVDL 2AI0L 2GJ6A 3TZVC 2EUZA 4BCZA 3GXTA 5D7JA 1J5OL 1HI6A 1UKQA 2QKIB 1FNGA 1NUNB 2HT2C 4YO0A 3VD4A 4UB0L 3CZEA 4NXKA 3WHXB 4WI6A 3B8YA 2CM5A 4RLDA 1XIWA 2YC1A 2YIHA 1E8ZA 1BVNP 1MHEA 2X2YA 2GFBA 4ZTPL 1JRHI 1TQVA 2JVUA 2OTPA 3MI6A 1EAOA 4DVRL 1JUFA 5C07A 3CVBA 1ODUA 3O3DA 3A67H 1WFMA 5E9DA 4DKEL 3PV6B 3PHAA 3HB3D 1ZSHA 4MVBC 1VFAA 4Z7QE 4WGKA 2N1TE 4Y4KA 1F97A 5C86A 1QR1B 4A7GF 4LLVB 1L6XA 3VXME 1AR2A 4U1NB 1JK8A 2EDEA 4WO4B 5IVXF 3SBWC 2DQDL 2VXVL 2DM4A 2ZXQA 4K73A 5GRZA 4YJZL 4FNRA 4OLYL 4L18A 2W9EL 2ADIB 4J3TA 4Y1AE 3V5DB 5GS2H 3ETTA 1KBVA 5LN8A 2JCCE 2Y2WA 3MRCB 3MRJB 3RNKB 1CMOA 3ZL1A 2X6VA 4NDMA 1VENA 4NKDB 5LQBH 3TOPA 3MCG1 2L3BA 1IGTA 2CHWA 2VSDA 1MCLA 1LP9B 43CAA 2A1WH 2VSKB 3KVPA 4JFDB 4WWID 3FF7A 4HJJH 2ZWSA 3V4LA 3ALPA 5IM7A 5I28A 2B15A 1CLOH 1KZQA 5EOCJ 3NZ8A 5F96L 3LYRA 2B14A 4KOCA 4MYPA 4KO5A 5HYSG 5EMYA 2C26A 4E9SA 3STZB 5BV7C 3M6DA 3UYPA 2K45A 3MRNA 1NMCB 1KEGH 5HGHA 3WFBL 3QZOA 4NRYB 5DHDA 4TLTA 3KJ4B 4FFZL 3IWUA 2R0LH 1S8DA 4HLZH 1PY9A 3RBSA 4J12A 4LPUA 1CLYL 1CGSH 1NDMA 2XN2A 1FFOA 5AVWB 3RZCD 2FTAA 3NCMA 4OV6F 5BVJA 1HXMA 4AGOA 3Q3GB 5E70A 1AOZA 1CL7L 5F97E 4NN7C 5K9OA 1F6FB 4ILDA 1KELL 4JLRA 5CSZB 5TK4A 1S9VA 1VZGA 2HT4D 3NDYE 5HDOA 5BZWA 2F8OA 5F7BA 3ZE0B 2GBUA 1ETZB 3QAZC 1BZ7A 3UFIA 1U95A 2G60L 3IVKB 3OX8A 1EAJA 3IGAB 4J1UA 2B0SH 1D6VL 5GGTH 5I1GH 4S1RL 3W57A 1IAII 3V7AE 4NNPH 1P1VA 2E86A 4UV4L 1GOFA 3BYTA 5DD5H 4FTVB 2H6OA 3RWDB 1N6QH 3F7PC 1EDQA 2V2TB 5FO8B 2XA8L 2YQBA 4WFGD 2GW5A 3LN4A 1D5MB 4HKXA 5KOMC 3VRJA 3QUGA 2FR4A 3NQKA 4OCSL 2B59A 1SJEA 2BJML 3WHE1 1OGTB 1SM3H 3MDJA 4YWGL 3BN9C 4BM7A 4L4JA 4M93B 3ZMNA 4ZNEA 5G5DB 4N0YH 4JM2F 3A23A 4AMKL 3TJEL 5GPRA 1A21A 1HQRA 4P2RA 2WZPA 1I9RL 1Q72L 4OJDH 3AJ7A 3F83A 5GGRA 5BW7C 2NY1C 1IGMH 5L8LB 5FYJD 4UANA 3MRGA 1G0XA 4NB7A 2QVIA 4S11A 3TONA 4OD3L 1FYTB 3O11B 3QCTH 4NUJA 5JOFA 2G5BA 1N67A 3GTVA 1MHHB 5DQJB 1NIBA 2BFVH 3ENEA 3FT4B 2VZOA 3LXAA 5CEXB 4KKBC 4EN3C 1DBJL 1OE3A 2PO6A 3VD7A 5KBNC 2H45A 3OQRA 1J1XL 4XCEB 2HLAA 2WJ7A 3FT0A 3MRLB 5ILTH 2ZUWA 3MOAH 3FN9A 5ECGA 4KKAD 1U8MA 2DTSA 5AVQB 1F42A 3JV5A 4Y7OC 4IRZA 5KSUB 1UD4A 4K7FA 1KTBA 4NM4L 1ADQH 3AS2A 4LLAA 3GM8A 3OLDA 1B0WA 3OQ3B 1T7ZA 2QGDA 3S3BB 3MLWL 3H2PA 2VDRH 3T6WA 4NZRL 5FGCE 5CCKL 4HJGA 1PCXA 3BUPA 3MMEA 2JKJA 2H1XA 4AV4A 4IKJA 5HTSA 4NN5C 1R75A 5DSCB 1J8HD 1Z1WA 2FH8A 3QI9D 1QNIA 4FLOA 4I48A 3DRTA 1ASOA 1I3GH 2W38A 2WP3O 2D2CC 2V5TA 2BMKA 1AY1L 3F05A 4AEFA 5DMYA 1M53A 2CUHA 2ZF8A 1CICD 2IAND 3H3PH 1EIBA 2J72A 2OL3H 1L6PA 1M9SA 2WLLA 5AOMA 4MB4A 5C0BA 5CINL 2MOQA 3FT2A 4TUJA 3K7UA 2IAMB 4XO5A 4A6YH 1XSKA 4NQCD 5C92A 3OKEA 2O6DA 1HQ4A 4E41E 3T5WA 1ZIAA 2AEPL 3PL6A 5FOJA 4QTHB 4J3OF 1HHGB 4D3CH 4C55A 4LAQL 3S37L 1AD9B 2IXQB 1D5ZB 5ALCH 3N9GH 2HWZH 1F90L 1DSFH 3J07A 1CU4H 3FQXB 4JO2L 2FYVA 1RIHL 3D39E 4NO3A 2CR0A 2ATKA 4F58H 2KH2B 2QQLH 3OZ9H 4L1TA 4FZEH 1RUAL 1USZA 4O02A 5DEFB 3RX5A 5L4FA 1WBYB 4F91B 4G7QB 4LDCA 1F58L 4ZTOH 4TN9A 5C3IA 5HHXH 3CMOH 3VXMB 1RULL 3SY6A 3WAJA 4PJFA 2G9KA 4NZDA 4MCMA 5GRUL 2VN5A 4KGJA 1ILSA 5AW0B 1Y1UA 3PIQA 4Y1AB 2VC2B 4E2OA 2JCCB 5KTEL 1D9KD 4W93A 1MFBL 3D25A 4PJ8D 4TSAH 4F7CB 1QBMH 1S5IH 2EUXA 5HI5D 1THAA 1A6TA 2N7SA 3PAYA 4BEIA 1P2CA 4FKEA 4HH9B 4YDIL 3SE8H 8FABA 5DVKA 5LCVL 1RAMA 3QXVA 1EERB 3Q44A 1KB5H 1RZKL 2JI2A 1E30A 4FXKB 3LKRA 4KKQA 5GS3A 5TE4H 4NYLA 4DAGL 4FQQA 1CGUA 3TFBA 4DCQB 5J4MA 4RGOL 1CPUA 3LH2H 2E8ZA 2XFXB 4NP9A 2R59A 4OAWA 5F1NB 1X9LA 4JDZA 5KVDH 4IKLA 2AI0H 2GUOA 1FNAA 4N8CL 3GSNB 5E6ZA 2WLIB 3IS1X 1J5OH 5HI3C 1NWOA 4UB0H 2Z91B 4WI3A 4DPRA 3LIZL 3P0VL 2IWKA 4NRXA 3T4AC 1T5XA 2EKSA 4ODVL 4JQVA 3AQXA 1U4FA 4O2FB 4U6XB 2LV4A 3SZ6A 4Z0BH 4YXLL 1NKRA 1W6WA 4ZTPH 2QFRA 2NUPA 5CN1A 3S36X 3EO9L 3DGGB 4Q6IA 3RZCA 5CD5C 1AQ8A 2W60A 4HLZG 5KYXB 1HXYA 4HC1L 4DKEH 3BEWB 4N2CA 4QNPE 4X50A 3QQ9C 3F7VA 1NKOA 3IJEB 2XIIA 3VCLB 4TUOA 2H2PD 5DXWA 4M8VA 3ARDA 5C0CA 4LARL 2VM4A 2IBGA 2QLVB 2WWMC 2ED8A 2WXNA 5A6IA 2B1OA 1VIWA 1VKXA 1G9NC 5D2LA 1WF5A 2DQDH 2VXVH 2P8LB 2XTJE 4XXDA 4N2BA 2KS0A 4OLYH 4XAWL 5K59F 5D2LF 4ENEC 3K8MA 4NO5B 2X28A 1A7PL 2VUYA 3ELAT 4OGXL 5HHPB 3RDTA 4WGVB 5KYYA 1V3MA 2EYRA 1WITA 3ES6A 2JIXB 4J39A 5IWLA 1B2WH 1BQHG 5MEQA 4X6FA 4HJ0D 3BFOA 1SOQA 5L7XH 4UNIA 4GBXC 1SYSB 3QQ3A 1ZT7B 3TCLB 2FSEA 3RHWF 2OZ4A 3NZHL 1MRDL 4RESB 5F96H 1OAKL 4GOSA 2NOYA 3GXIA 4LO9A 2CRZA 1XBDA 2TSAA 4AENA 4GQ9L 1BGXL 5FWRA 5I6OA 1E40A 3PWUA 4FXGA 4HIJA 3DJRA 4LT7A 3WTTA 1YY9C 2DLEA 4ZO8A 3WFBH 4H25A 4MHHI 1UC6A 3RRQA 5SWZE 4FFZH 4AXWA 3SGJA 4YIQA 4LHUG 3BQUD 4G42A 3IF1B 2EDLA 5DJYA 4A7SA 4F7MA 5MEOB 2P5WE 4Y2LA 5KYUA 5GIRB 1CLYH 4ZMYA 4Y5VB 3C6LC 3VH8G 1BYPA 2E6JA 1NSNL 3WJMA 2R1XA 1CL7H 4MMXB 3C09B 4MD4A 1IEBB 2AABL 4MNHA 4W9CC 4WENB 3G08A 2L0DA 1EO7A 3GHBL 4ZMVA 1NOLA 1ZKAA 1KELH 2N7BA 4JZJA 1TZAA 4YLBA 3ULUF 5FEBA 4FQXB 1T20B 5FGCB 2J43A 3OKLA 4XN2A 3MV7A 1QTPA 2G0LA 3FB6B 2G60H 4WF7A 1EWHA 4KRPC 1DJGA 3QARA 4A7UA 3MKGA 5E5MA 3MLTA 1IVLA 1D6VH 3H9SD 4S1RH 3QG7H 2UXVA 4MDJA 2NTSP 4HCRA 1DBBH 1G6RA 3VXUA 4EDWL 4BFJA 3MTXA 2AMGA 1OTTD 3QIBC 1KBWA 1J1OL 1WGOA 2XA8H 1JGUL 3SKNA 1F3JA 4A39A 4OCSH 1E4XL 2BJMH 1S9WB 4YWGH 3HG1D 2Q8BH 1I3RA 1RD6A 1CICA 5KJ7E 5IJKC 4N24A 2HUEA 2PPCA 4GXUM 4AMKH 3TJEH 5CBEB 3MHZA 3X13A 4EDXB 1LO2L 1T5WA 3SPGA 1XMWA 2R69A 4P48A 1FZOB 1T04A 4M62L 4UDUA 1Q72H 3GMQB 2AJVL 1KN4L 4Z7WE 3D85D 4AL8C 1XF3A 5L2JA 4AH2B 3VXQA 4GG8B 1QG3A 4WK0B 4KV5F 4Q8BA 2XPGB 3DO3A 4E41B 1KXHA 4JG1H 2L7JA 4OGQC 4JJOA 3KXFE 4OD3H 3NUKA 2DH3A 2E6PA 3GZOA 4G5ZL 4PCTA 3WNMA 3RPKA 1KBKA 3BSZH 5E1AA 5EN2A 5C0AD 2QV2A 1JYWA 2DQ6A 2P80A 4P06A 2LR4A 2VGLM 5M7QA 1CGWA 1DBJH 3NPSB 1XD1A 3EDDA 1B6UA 3BWUC 3FCSA 3ULUE 5CKGA 1QTYT 4N4YB 4AGNA 3RVWD 1L9RA 5DS8B 3GZQA 3F01A 5KBPA 2ED7A 5LJYH 4PJGA 3O3AA 4TL4A 1YEKL 5GRVK 3IS0X 4OW6A 3CX2A 2XV2A 4ZBJA 5DYFA 4WKXA 4PJGF 5DVPA 1J8SA 4HW6A 1E5BA 1K72A 2ADGB 2QR0A 2X6MA 5FWQA 4F80A 1UEYA 4NZRH 3TBVB 5CS7A 1WC7B 2A74A 4UUJA 5C0JB 5EZIH 3OGCB 4H88L 4UOJA 1PNDA 5HJ3B 4AIEA 4MDRA 3LJ3A 3KS0H 1BDYA 3FPXA 3MREB 3L08A 4RAVA 3CFBB 2W0FB 5GS0C 4QO1A 1KPVB 1MCRA 3SJVD 3M07A 2G2RB 2K6YA 1Q9WA 4G3YL 3SODB 5DK3A 3MRBA 5D5MA 2ZXCA 1ZSDB 3ZHKA 4CMHC 1N6VA 2CO6B 4D2NA 3M1BA 1PS3A 2NT1A 3N3EA 4E9QA 5E94B 5EU6D 5A2IH 3I50L 5AW7B 5CINH 5HHOB 3LVTA 3FU6A 5JPNC 4JY6A 1F11B 3UAJC 4PG2A 2MOVA 1J48A 5FO9B 2AEPH 3LV3B 1KACB 2VL4A 3D2UD 1TU2A 2COQA 3EHBD 3KVQA 4LAQH 3DV4B 3LDBB 3S37H 4DIXA 3PHOB 3APMA 1F13A 3R8QA 3C5JB 3B9EA 4ANWA 4R7VA 1LD9B 1B0GB 1F90H 5T5NG 3RTQA 5I2IA 1XGYL 4JO2H 4GMSL 4Z7UF 1RIHH 5EU3A 1DFXA 5MI0C 2BSDA 5DJCB 4IGBA 1SOSA 4JKKA 4FQHA 1BD2A 1RUAH 4R90L 2AGJL 1N59A 1F58H 5JO5B 3KNBA 1OXYA 1CFNB 2BSTB 3RG1C 4WTZA 4DO4A 1RULH 4PBDA 5I71B 1AGEA 3SKOA 4PLNC 3OAYK 2XTJB 5GRUH 3EGSA 2HTKD 1T6VN 1RJYB 3X14B 2ETWA 1OSYA 1IFGA 1CBJA 3WTUA 5KTEH 2EO1A 3CH8A 4QT5B 1MFBH 2VLLA 1TIUA 4YN3A 4QRRD 1KTKE 2KYIA 2YSTA 4ETQB 2JQZA 4YDIH 2J8UE 5LCVH 1RZKH 4A38A 2YWZA 1NAMB 4ES9A 4G8GE 4DAGH 4KVNL 4YNYB 2ICCA 2F7RA 5A16B 2W81C 1X5XA 2WLZA 4FL4B 4RGOH 1XMEB 5F7AA 1BWMA 4K3HA 5JIHA 2BP5M 3QW9A 3AITA 4OFIA 1FVDA 2EICA 3MGOA 3VFWA 1KMGA 1JFQL 4KUZL 4RMVA 5E23A 3P4LA 4N8CH 1IQDB 4N5EC 4HXBL 4WW1B 5EUOE 1M42A 5KBLA 3BAEL 3O8XD 1IGIL 5B7EA 1X7QA 3OTTA 4Z5RB 2I85A 4PRPD 2NUTB 1GZHC 3LIZH 3P0VH 2AK4D 3WIFB 5E4EB 1WAAE 3EO1B 5L4MA 4WW2C 2EXYD 3BQUA 3MV9E 5JQHC 1OW0C 2P5WB 1E27B 4QRUA 1OSEA 1EBAA 4YXLH 4KKRA 3S5YA 2XBDA 4GRLA 2PXYD 3EO9H 4V11A 2NY6B 1M6UA 1GJWA 2Q86A 1UWXK 1FAIL 4HC1H 3UABA 5TTRA 4NT6B 4OF6A 4KJPD 4MA7L 5J12C 5IOPA 2UVFA 3ABZA 4UTBL 3ULAB 4D9RE 4LARH 2TRHA 1A7OL 4DN4L 4R5TA 2VKWA 4NQQA 3RX9A 3SOTA 4ADJA 4RZCB 1G4RA 2C5DC 2CK0L 2KDYA 2OM5A 5EZJA 3U4AA 1NCJA 1Z9SA 1A7PH 5KBDA 3FS9A 3BUQA 4OGXH 5JW4R 1Y1DA 3FU3A 3MBEB 3PAVA 3QIWB 4Y9FA 3WNLA 4Z7VF 5ICYB 5K9KB 3O2DA 3WE1A 1NEZA 1AP2B 5D93C 2WNKA 4ZMQA 3U30B 4GPVA 1NGPL 2A9AA 3TXAA 4IRZL 4P4KD 2XWEA 1DVFD 3QO0B 3WNIA 3EJZC 4DTGH 1JF6A 4NQSB 2NNXA 3UJJL 4B5EA 4MJID 1EFXB 1TLKA 2FEDC 3BI9X 1GGBL 3GS7A 2FJFB 3B2UD 3L3OA 4Z7WB 3NZHH 1MRDH 4IYKA 4M03A 3IJ7A 5ELIA 2OMBA 1KTLA 1OAKH 1I7UA 1OPOA 1R3HA 2HVKB 2VMEA 4N0UA 4JMNA 4JM4L 4AJWA 4QJ4B 4GQ9H 1BGXH 3ZO9A 5JHDD 1OO2A 3DX2A 3KXFB 4KZEL 3NRFA 2CR3A 2DIBA 4TRPL 3N1QC 4DZ8B 1BFVL 3H9HB 2YXFA 1O6SB 3O4OC 1R33A 2GPZA 2YK1H 4KQ4L 32C2A 4KI5D 2R29A 1UZ8B 3BWAB 2BVQA 1JTPA 1BBJA 2FO8A 3VE0B 4ZUVB 2EKJA 1NSNH 2HMIC 1DUZA 4YL9A 1Q90A 2W8CA 3MN8A 2AABH 3OC8A 1HN1A 3GHBH 5I6MA 2CDGB 2CO4A 3BGMA 3Q8CA 1ZA3A 4LVOC 4OCXH 5I1EL 1YEEL 2HH0L 5EBWB 3WDJA 5I8EB 5EU5A 3V0AC 4X99A 1N7ML 1PEWA 2A6IA 2VDQL 5EIIG 2Y36L 1BZ9B 3VD2A 3VW3L 3VRLE 4RFNC 5ALBL 2EEAA 1AS7A 4O02L 5B4MC 3NESA 5GGSA 2F8VA 5DU7A 4B7IA 3W82A 1J1OH 1JGUH 3GSUB 3JWOC 1E4XH 5JHAA 1G5AA 2W9DL 1B4TA 1R5VB 2ENSA 4MNGE 3C5SA 4B9CA 2UY6A 3VDBA 2LAAA 3ZT6A 1A65A 5AL8A 5EU6A 3QXWA 5AVSB 4X42A 4C56A 4M62H 2AJVH 1KN4H 4UQIM 3GSOA 1AZCA 4DPBX 2NQCA 4W4OC 5PAZA 1Q8MA 2EH8L 2VN7A 4OF7A 1XB8A 4XMZA 3RP1A 5CFAA 2BH0A 1GR7A 3M1CA 1OCZB 2HLFD 5HHVL 1DQML 3VFRB 1JI1A 1IT9L 2N3JA 1Z6JT 4PRBB 5I26A 4KMQA 3L3KB 2RFXA 2WWKO 5DK2B 4N90D 2GTWB 1ECZA 4Q58C 4PJ5E 2BOCA 3NJGA 4UZGA 1WICA 4G82A 4DH2A 3V79C 3OKYA 2VR7A 4YZFE 5FV1L 2PPDA 3IJHA 3GSWA 2GSIA 4BSVA 4BZ2A 5ADOH 1QFOA 4IRSB 4N2NA 2EINB 1YEKH 3QGVA 3VX0A 1U3HC 4G7VL 1BVKB 3VWJD 2XJKA 4YDLC 1G9ML 1R6VA 5ANME 2CLVA 3BVTA 1UUNA 4JO5A 4MZ3A 4JNXA 2VRKA 3HBZA 3OF6D 1QI4A 2AQTA 2YD7A 1NFDE 1A7RH 2VQ4A 3BZDA 5DCCA 3TZVD 1A66A 3PRZA 3CK0L 2RIKA 3FTYA 4L8SC 2HN7A 5E8OA 1E28A 3MRMB 2DJSA 3GXDA 4WJG3 1TSRA 4HBQA 2J8UB 2HT2D 4PRHD 1L9QA 1Z0MA 3CIAA 4G8GB 1QA9A 3ARRA 4Y16B 3C08L 3BD4A 2KPWA 1CGVA 4G3YH 2PMZA 1IKNA 4JFEA 4L4VA 3VI3B 2F58H 1ROWA 4XWGL 1ZCRA 2OBGA 3ZKND 1G1CA 4G7RB 1L9OA 3I50H 3I6KB 4TULH 2G5UA 5F9JA 4JPIB 4Z7NB 1A6VL 1MWOA 2WXKA 5CEZE 2R7EA 4XPBL 5EUOB 4MVBD 1ZTMA 3O6KL 2G3MA 1LILA 4X7TB 4YGVA 2WXHA 4P2OB 1RK0A 3AXLA 3MACL 1I53A 3OPZL 2BWQA 4LCWD 3MV9B 4GXFA 1JWUB 1WT5C 4P8QA 1QUPA 3TJPA 3ZKXC 3J7HA 4AUJA 1YO4A 4JGMA 3FQNA 1XGYH 3KWWB 3SE4A 2V5MA 3QORA 1TVHB 4PS8A 2K9UA 5JXAL 1JI2A 1WIPA 4GAAA 2IIJA 3CAFA 4HFWA 4G1MA 4R90H 1ZLVH 2ZUSA 2AF2A 2AGJH 5D7LE 1QZNA 3TBBA 5IVOA 5A2KH 3GBDA 4K5MA 3WXVL 4IU2A 3QXDA 2AQPA 3GXPA 1RZFL 3SE3A 4H5SB 3B2MA 1FG9C 3MNDA 4AC4A 1LL1A 1CZ8L 3ALXA 5FKAA 2IEPA 4C58B 1KJVA 1ZA6B 4BKLA 2YGOA 4RAUB 2CPCA 2WYTA 4PS4L 1UM6L 2WO4A 2QQNL 2P9RA 4P5TB 4Y2DC 1I8MB 1KF9B 1NC4A 5I16A 3OC5A 4G9DA 2W9LA 3QNYA 2BNQE 1JWMB 1VB9A 1IAOA 3DTXB 4IJ3B 4F7TB 1H3WM 3DXAD 4NI6A 4ZOEA 4L3CA 3ULUL 3NYKA 3MCKB 4X5RA 3BZ4B 1N4XL 1IGJA 4OU3A 2E7BA 4KVNH 4JAMB 2G75A 1TEYA 4FJYA 3OXSB 3REWB 2C3VB 3HR5B 2P52A 3F5WA 3HC3H 2NX5B 3VWKC 3PWNA 3CWGA 5C0IA 4RGNE 1OAZL 1JFQH 2E76C 4KUZH 5IROA 2EDOA 1OAXL 4ZXBA 3S98A 4HXBH 1CCZA 4RX4A 4GSQA 1J18A 3BLPX 3FNKA 5DMGC 1XT5A 2Y7QB 1IGIH 3BAEH 3GSRB 3QIUD 1L4IA 1KYDA 4F93B 1GVIA 3KYNB 4J2QA 4JZOA 2BZCA 5IT2L 2B20A 3AT8A 3I75B 4IIQB 1J5HA 3SYQA 2UV3A 2YGQA 1GMIA 3EGXB 4JY4B 3HN8A 2R69L 4JDEB 5JPMB 2GITA 1I4FB 1CQKA 4LVEA 1FAIH 2C1OB 2D9QB 3JWNG 3FUIA 4F9PC 2ICWI 1EHKB 3LXCA 4CBPA 5A1AA 4JKNA 1U8IA 3BT2H 3CFEA 4MA7H 3QFGA 4XBGB 1JZ5A 2H8PB 2NLJB 4NKOA 5F7NC 3SCMA 4UTBH 4Z7AA 3BN9D 2ZOLB 4GG6E 4B9FA 1A7OH 1MUJA 1S7WB 5E6IA 5EZOL 4DN4H 1BLNB 4L1LA 5KVMC 2ZOKB 4POYA 2CK0H 1AVAA 4NERA 4LOUD 3LRGA 3HHMA 4P5MB 2NY1D 1OAUL 3MYZA 3TH2T 3H4HA 2CE6A 3DX7B 3S3JA 4YE0A 3QNZB 4GB9A 1KT2A 1BOGA 1NGPH 2A9BA 1N0LB 1N64L 1OTSC 2IH8A 4IMLB 4MNGB 4U1LB 1OGAD 2P8MA 2OMWA 3UJJH 2GY5A 2V2XB 3GJEB 1RKRA 4KKBD 4L37B 2FQEA 4XBPB 3RWIB 2E9WA 1GGBH 3QJFB 4TL5A 5TDNB 3VRIB 4EN3D 5LAXA 1RZJC 2QZQA 5LGKA 1CFQA 2C9PA 5I6PA 3QE5A 2D9CA 5F7MC 3OKOA 1XZ0B 2BHUA 2PN5A 4JM4H 4JKWA 2VRAA 2R2HB 2ZX8A 1MXGA 4KZEH 2ZYHA 4H8VA 4JFQB 3IRCA 4TRPH 1NINA 4EKXA 3N1PC 3SPVB 2VZSA 2P8PB 3KJ6L 1BFVH 2HJKA 5FF6B 3DX9A 1ONQA 5DS1A 3SDXA 2BX5A 4PJ5B 3ARGB 1BV8A 4LPVA 1URZA 5EUKA 3EG9A 3SDXF 3DX6B 1LLAA 3FQRB 1D5XA 4PRAB 3QAQA 3SQBB 1OWWA 5A43C 4J3OH 3PHQB 3AREB 1AC0A 2HP4A 5K1NA 4DUWA 1K5WA 4HAKA 3UEZA 3B43A 1X9UA 3HTLX 3QDGE 4PJEA 4JO8A 2DEXX 2VXQH 1TOXA 4XBMA 4ZPTB 3QQ4A 4NKIL 2HB0A 1YEEH 5CP3H 5ANMB 2HH0H 4D9QE 5CGBA 3NP4A 4LCCA 1JV5A 4Q89A 3OF6A 1N7MH 2NZIA 2VDQH 3MJ7A 1DE4B 1NFDB 2OYPA 2DDQL 1NL0L 3EBGA 5ALBH 3LRLA 3SHSA 5AW6B 1B6DA 3QRFM 4EZJA 2B16A 2CCLA 2YRBA 1T2XA 4Y4HC 5F7UA 2HCZX 3S8WA 3KPLA 2BVPB 1OT4A 3GMMA 1GS8A 3JYCA 3OJVC 4ZQKA 4YXHL 1MFCL 4ELMA 2AQ2A 5D9SA 1KGUA 1PEZA 3TYGL 2XPYA 1OD9A 2ZYSA 3O6LL 4G7SB 4CVZA 4ELMF 1YNLL 5E5LA 1KTCA 1AS6A 1B0RA 3S0PA 4OFQA 2E46A 1R0AL 3GGWB 5F0MB 3V10A 4HK0B 5HD8C 2EH8H 2FJGB 4IMKC 4RIRA 3SGKA 2FD6H 4PWIA 3V6ZA 3LRMA 3PFUA 5HHVH 4BFBD 2FVNA 2IMNA 1DQMH 4LCWA 1G7HA 2ZYRA 5IKCB 5I66A 1IT9H 4IS6B 2AS5M 3HLAA 3SBWA 2AJZA 3ZIYA 1EXUA 5FYJU 3KDMB 2V33A 5KAQF 3V7AG 3JT2A 4TSBL 3EYQC 2H26A 3QUYA 2OXGA 2ICES 3F7YA 4LLWA 1IM9D 1MQKL 1PLGL 1NEUA 2QELA 4HHGA 1MPAL 2GVYA 3D18B 3ALWA 1BWWA 2YEZB 3FBKA 3QS2A 4NC1E 4WNQA 3HPJA 4MYWB 3UBFA 1PFCA 1MRFL 2E5EA 4G7VH 4HYTB 4XNDA 4JRFA 2VERN 4YHPB 1MHCB 1G9MH 1A6AA 1S7TB 2P7TB 2XY1A 1X7TA 3FN3A 4I85A 3VXRD 4OD2A 2ZJSL 1IARB 3BH8A 1KNOA 3HCVB 1MF2L 2XZCL 4PI2A 1JYNA 4AZ8B 1A8JH 3DPDA 4JHWL 1BF5A 5CO1A 3FQUB 5C9JA 2GCYB 2ODIA 2CLZB 2JJVA 3CK0H 2BNQB 2QDWA 3P9MB 3BT0A 5HI3D 2ZUYA 5I5RA 4ZFGL 3VTTA 3GM0A 3WN6A 5D2NE 4MRBA 5DF0A 1EHLL 2BOLA 5IHWA 4PV9A 5A2AA 1MEXH 2EZ0C 3V2AR 1QRNA 1AGBA 1FV1B 3QHZH 2OMTA 3P4OB 4RGNB 3EBHA 5LUMA 5CD5D 3ME0A 5I6XC 1U58B 2ADFL 3MOQA 3N40F 4GXVL 5HJGA 4BUQA 5K5YA 3LNFA 1WTGT 1C5CL 4I5BB 4XPBH 1PZAA 4NPYB 1GHFH 1QFWI 3O6KH 3QQ9D 2YQ3A 3T0AA 1WFJA 2VLKE 1EEUA 2UZIL 3MACH 4ZODA 2AAVA 2WWMD 3CFTA 3OPZH 4BRJA 3HC0A 3QUMB 5EU4B 1V5JA 1EHNA 2HA1A 4R4BA 4Y5XB 1MJJB 1YDPA 2W65B 3ZTJH 1GC1L 3WBDA 3V4VL 3SDCA 4ENED 1VCBC 1XL4A 3FB7A 2VJ0A 4R0LB 3G04A 5JW4Q 3SQOL 1MDTA 3UOAB 1QP1A 4ZZFA 2MNUA 2VLJA 1Q9LA 4KH9A 4H8WH 5HVGB 3QXAA 2ICWB 1X5ZA 3TX4A 3WXVH 4ZPVB 4DEWA 4GG6B 3PP3K 1RZFH 4X6CA 1R17A 2JKSA 4NO0B 1CZ8H 5C09E 3P77B 3C60C 4RVBA 4M4RB 4BCXA 2CHNA 5I15L 4Y9EA 4X6CF 4BZ1L 5I6LA 2O6CA 1PCSA 4XCYB 4PS4H 1H3PL 1UM6H 5E4IA 2QQNH 4TLSA 5IMKA 1XGPB 2LFEA 3DUHA 2VJXA 3QJQB 4D0DA 5BW7A 3P9LA 4Z3JA 5JIKA 1CR9L 1M4KA 3IAGC 1U8QA 3R0NA 3WTXA 1YY9D 4AT6B 3I85A 1RSFA 4NPJA 4OFDA 4B50A 3ULUH 1E42A 1IGCL 1T1ZA 1CIDA 1KLFA 4LLUA 1N4XH 1U2CA 4BWTA 3U46B 1OGAA 5DFWH 2O61B 5ABDE 5J9PB 3MUUA 4EN3A 4P46B 4JFYB 4NCC2 4XVSL 2XN9D 1ZHBA 4R84A 4GS7C 3OV6A 3C6LD 2J7LA 1OAZH 2JKXA 2OS7A 3MO1B 4OFKA 4OI7A 1A7QL 1C5BL 4J5VA 2V37A 1OAXH 2UZXB 2ZCHL 2X4QB 1R3LA 2HFFA 4M9OA 4XC3H 4RFEA 3QEUB 4FQ2L 4TMPA 4W6WB 3FHEA 4O2EA 3ZK0A 4Z6AT 4NOBA 4Z7IA 4YHML 5L8JB 2EVHA