4NN6C

Cytokine receptor complex - crystal form 1b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
182
structure length
163
Chain Sequence
TVVCHDLETVEVTWLSLEFRYGTGALQPCPRYFLSGTSGCILPAARAGLLELALMVFKARQRASAWLKPRPPWQVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPVRCYDFRVRASPRAAHYGLEAQPSEWTAVTRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymic stromal lymphopoietin
publication title Structural basis of the proinflammatory signaling complex mediated by TSLP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine/cytokine receptor
total genus 25
structure length 163
sequence length 182
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn6C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn6C01
2QSTA 1C5DA 3BW9B 3ET9F 4WDIB 5D7LA 3KPRD 1VESA 2PKDA 4MNQD 2OP4H 2YPVH 3THMH 3V6ZB 1KGCE 3GMNB 3HMXA 4C56B 4POZC 1CICB 3SDYH 4NO0A 5DJYB 4KVNL 4AL8L 2HTLC 4QRUA 4MWFA 4UT7L 4X5LA 4KKBC 5EU4B 4X6BB 3BHBB 3GMLB 2QKIA 4L8SB 3DX6B 1HEZA 4PJ7E 4LMQE 3PHOA 1JRHL 3L3JB 4MD4B 5DWUH 3A6CL 4JQIH 4LVEA 1EXUA 1T7XA 4BK5A 3ARYA 4ZFGH 3DTXB 3OB8A 4ODBD 3U0WH 3B8SA 1T1YA 4FFWC 4RFEA 1HQ4A 1NFIB 1K3ZA 4LVHB 3MRHA 1WT5C 5INCA 3RL1A 2GKIA 3CC5B 2YD1A 5C0AD 3OKNA 5DJDB 2E9WA 5HHOB 4MJ6B 3ZKXC 2A6DB 3WS3A 3QIWA 5GRJL 1J1PL 5C7XH 1MAMH 4WUKL 1R0AL 4NO2A 1B0RA 4B7LA 5I1HL 2Q8AH 5IEKB 1CL7H 4LDLB 4PRBB 3RGVA 1WCBB 2AJYH 4GRLB 1A5FL 1PKOA 3H3BC 2HVJA 1WBXA 4P59L 5KSBA 3MFGB 3O3AA 1CF8H 3CU1A 3C6LD 5J12B 1T7VA 1F6AB 4WI7A 5C70A 1UM6H 4IJ3C 3KPTA 1U8JA 3IFNH 2VXQL 3OKEB 3OKKB 3HAEA 3S4SB 3O3DB 3DRQB 4G8EB 1VFBB 1N4XL 1OGAD 4NRXA 2IPTL 3V79C 4LCUA 2OTUA 4JFQB 2VLJD 3OR6A 2IJ0C 3C5ZA 3MRKB 3OF6A 5KVEL 3ULVE 1YPZF 4ZS6D 4BZ1H 4BUGA 4ALAH 4EI6B 4X4YB 5KW9H 3ZL4L 2O5ZH 2P45B 2NY7H 4BZ2H 5I1KL 3QAZB 1JYXA 2OJZH 2VJXA 5C86A 4BKLB 4ODUA 4O2CA 1IM3A 3EHBC 4OLXL 4Z5RB 3HZMB 3JVGC 5F71A 5TGBA 3HUJB 1DN2A 3DBXB 4FQXA 5DT1L 2YC1B 4TRPL 3T0EA 3OKLA 4OZHA 1KTRL 3JWOH 1I3UA 1U8NA 5E1AB 1KLGB 4OGYH 1AKJB 3F7QA 1QD0A 5HVGB 1RJYA 1DZBA 3B2UC 5HI3D 4L4TD 3BPOC 4NBZB 2W9EH 1T7ZA 1P5UA 1NGZB 5I1JH 1N3NB 1KIRA 4XI5C 4DZ8A 4YHLL 3GSNB 2D03L 4L5FH 5EZIH 3D6GA 5D7KD 4KHXH 4G9FE 2P5WD 1OP3K 1D9KC 1IAIH 1YQVH 2HAZA 4BFIB 4Z7WB 5F9WC 4G6ML 5MEPA 1OM3H 5ERWA 4HQQH 4GG6B 1BVLB 3EIFA 4X6DB 3UJJL 5CILL 3RY4A 4Z7NF 4PYHA 3SGKA 4XZUB 3UBXA 1AHWC 1V3JA 4R8WL 3GJFA 3QUXC 3BH8B 3BP4B 3C2SA 3C60B 4GMSL 2G75B 5DVKA 1KPRA 3CFCL 5SWZB 5J11B 2IBZY 5JR1L 1JHKH 1T4KA 3AREC 1L9MA 1Q1JL 4FRWA 5MERB 3MRCA 1EUTA 3PP4L 5KVGL 3EO1B 3S3JA 1XR9A 2VE6A 4PRAA 2ITCB 3QNXA 4KV5F 3RA7H 1MFCH 1EVTC 5GRVL 2HKHL 4S1QH 5I1AB 1ZLVH 3UPRB 5CUSL 4P2OB 1MHHB 4QRPD 4JPVL 3ROOA 4JANA 3RDTD 3G6JE 4LP5A 2H32A 4MSWB 4HMDA 3TBTA 2XFXB 4DKFH 2I9TA 5IB2B 5I71C 1CGSH 2COQA 3BXNA 4BELD 1TLKA 1FRGH 4Z0BL 1RV6X 3JUZA 3L5XH 2EYSB 3PIQB 5IT2H 1H0DB 5F7WC 1OF2B 5DSCB 3VXRA 3EOTH 1G0DA 1NMBL 1FNEB 1XGUB 2X09A 2JCCA 2YPLE 3GSVB 1WSST 4QXGL 5GJTH 1BIIA 5HHQB 5ITFA 1T1WA 5IBTL 4K3DH 1JPTL 4D0CB 3MGOB 2R1XB 1QEWB 2HFGL 1XMWA 5T1KB 2BSTB 4AEHL 3IFOA 1YEEH 3TZVD 5HYIA 3VDBA 1EIBA 2DIJA 2YA1A 1MI5A 4EXPX 3K4AA 5AYQA 2X40A 2OI9C 4UIKH 3E6HA 4O51B 3TPKA 1L9NA 5SWSD 4P5MA 4Y2OA 5TQ2H 4XPFH 3JWDH 1Q9LB 5AZEL 2F58H 3I02A 5J3HC 3QIBD 4PJEB 2Y5TA 5GISL 1IC5H 3AVEA 2AJSL 5E2UL 1NSNH 3VFTA 3ARFC 1GYAA 4HPOL 3W9EB 5BJTB 4LLWB 2CO6B 2IF7A 1XGQB 1N26A 5J4MA 3DWTA 3ZKSD 3TBYB 3ES6B 4Q2ZB 3WIHH 1GAFL 3AS3A 5FO8A 3QWRD 4ZOBA 3NTCL 2NY5C 1AIFA 3ARPA 5KJRL 5I75C 1U3HB 4YBHA 2BY2A 2Y06H 43C9A 3DVGB 4L8CB 5FO9B 3D3VA 3VXUE 5B4MD 3B3IB 3OAZH 3BVNA 2AK1H 2IPUK 1JWMA 1X5LA 5CP7A 3ARZA 3L7EA 4XVSL 4XNMA 3P0YL 5A2JH 3AS2A 5FHBL 5JPNB 5EU6D 4JFFE 3HFML 1EUUA 2OSLA 3QUKB 4ZUWA 1LO0H 3PG2A 2VIRA 1K6QL 1YEJH 4FQJL 4PJCE 1PG7L 1MCIA 2AAVA 3SHSA 2XNAB 1BGXL 3W9DB 1RZKC 1CG9A 1AD0A 5BRZD 3FN0H 2RCSH 1I1AC 4UQ3B 3KPNB 4OZFG 4O58H 4XH2B 3PWUB 5F7EH 2VLRE 2JJWA 3EYFA 2HTKD 4HUXB 4NKQB 4I0PC 1RK1A 3BZ4B 1G6RH 3I2CL 5L0QB 1G0YR 1QFWI 5F7NC 3TF7C 2DN7A 4ZOAA 1IAKA 1EFXD 4NFCA 1XF2B 1DBML 1FFOA 5HHXL 3TBWA 4G43B 4R4NC 1PKQB 4KZDL 5INDA 1QR4A 4FHBD 4WGWB 4CMHB 1HXYA 3SDCB 3MUY1 5KSAD 3V4UL 4CVUA 5D7LB 3AXLA 3S3PA 3OZ9L 4RWHA 4H8WC 4MJ5A 3WN5A 3MLSL 3MBEC 4UV4L 1R3LB 3AM8C 3DSFH 1ZS8A 2GIYA 4GRWE 2P8PB 3EBAA 1KJVB 5H2BA 2Z31B 3V7AG 4KI5F 4RAHA 1FCCA 3OKOA 3RVWD 4OCSL 4PJ9D 1QSEB 2CKBA 4QRUB 4HS3A 5IHZB 1FZMA 5CJOL 5CMAA 3SE8L 1I8IA 4XP1L 1HEZB 2HT2D 4KJPC 3LEXA 3PHOB 4DQOL 3J8F7 3LV3A 1HHGA 5FYKE 1IGCH 1BFOB 4PS4H 5IIEA 2IGFL 3J7HA 2CH8A 3R06A 5B8CA 2DBLL 3BN9C 3V8OA 1T1YB 1U8PB 4RFEB 1LP9F 2R9HD 2ZG1A 5ALCH 3TO4A 2J4WL 1MJUH 3MRHB 1KJMA 2VDMH 4C55A 3S6CA 1FNFA 2C3XA 4Q9QL 4TVPH 5D8JL 2Z35B 3VFWA 2VABA 5IFAH 2ZKHL 2F8XC 3QJHA 3CH8A 1CWVA 5BVPH 3PGDA 1GPOH 2E8ZA 3WFBH 4GAGL 4NO2B 5K9KB 3ARBD 1RIUL 3MX0A 4M6MH 4TSAL 2JJSA 1WBXB 5KSBB 5GS2D 4MDIA 1V7NH 3HTLX 3O3AB 1AO7E 1NL0L 2VZOA 1IGTA 4P4KC 4QLRA 1INQB 4JO1H 3QXTA 3CVHA 1JHTB 1XEDA 4OAWB 5TQ0L 2VZSA 1U8JB 1BD2D 1YN7B 4NN5B 1DQQB 2XPGA 2VZUA 4WW2F 3TYGL 3KYMB 2SEBA 2OTUB 1DVFD 4UOW0 3MJ8A 4EOWH 3OR6B 3MUZ1 3MV8E 4RMWA 1S8DA 4HT1H 2FEDD 3BE1H 2XIDA 5ITBH 4PREB 5EDXA 2R4SH 3RNQA 4O2CB 1RZJL 1TZHB 5HYQB 4YPJA 3STLA 4PFEA 2OLDA 3OKLB 4OZHB 4I5BA 1F4XH 1DJSA 4Z78A 1U8NB 1ZTXH 1OWRM 1X4YA 5EA0L 3N9GL 2NY1D 3GFUA 1KV3A 1RJYB 1T0MA 5F44A 4FQIL 1EO5A 1MOEA 5IVZA 3KYNA 3MV01 5F7LB 2VQUA 1KIRB 4DZ8B 3FAXA 1W8NA 4KRPD 2OM5A 4J23A 3LPWA 2MQ3A 3LDBB 1XGTB 4HAGA 4JM2F 1BQHG 1IAOA 3QSKB 1MCPL 3QT2A 4NC2B 5BV7B 1CXLA 2IPKB 2UZIH 5CCKH 4WO4D 3UBXB 4JFHD 3OAUH 2WBWB 2YD5A 4NQUA 4JZOA 4TPRH 1DBAL 1I9RH 1P5VA 3Q3GA 1G6RB 1DSFH 3NIDE 3GSRA 1T2QH 4OM1H 3QBTB 4BK4A 2OBGA 3HLAA 4P2RE 4X9HA 1JNJA 3FONA 4LQ1A 4J3TA 2X4RA 3BGMA 2DQIL 4RAUA 1NJ9A 2BP3A 1JWUB 3ZT6A 4YX2H 4Y1AE 4LSUL 1CTNA 4YQXL 1QRKA 3JXAA 1FNSH 3H3PH 1IT9H 3TN0B 3M07A 3QNXB 4HLZG 1QLRB 1JK8A 1UH4A 4R4BA 3K4DA 3O6LL 4YIQA 2DQHH 1NGPL 2BNQD 4CL7A 3T0VA 4KKNA 4Q0XL 3TBTB 4KK5C 2I9TB 3PHQA 4GW5A 3BXNB 5E9DD 1PQZB 1SJVA 4G6AC 4FQHA 1FCGA 1U8MB 4HDIB 4YEEA 3BISA 3VXRB 4M8VA 4TSCL 1KJ2A 2EH7L 2AK4E 1PX3A 3IVKA 1BIIB 2DQFA 4HUWA 4PTUB 3U36A 3LN4A 4M5ZL 3QUYA 3WYRA 4PLJD 1EVUA 2CUMA 1F3JB 2XY1A 4KVCL 1YEFH 4UTBH 4WFFE 3C5SA 1MI5B 2EXYC 1JPST 3U82B 5GS0L 1R3IL 1MPAH 5C0NC 3MLTB 2XWBA 5BS0B 2V5RA 4P5MB 5DTFA 3ULVL 4I3RH 32C2A 3LMJH 1RHHA 1OB1A 3I02B 1CD9B 4XPTH 1OT2A 1L6ZA 1JJUA 4XPBH 4TYUA 2BCKA 4RRPA 4M93B 1G6VK 4S10A 2VLKA 1UXSA 5DQDH 2NY6B 1B0GA 3ZE1E 4AK1A 2Z8RA 5AAMA 1UWEL 5FYJH 3P9WB 4LCWD 5AG9A 3IU4L 3LSOA 3FHAA 1VENA 2FH6A 3O6FD 3WXVL 1JUFA 1TVHB 3WNMA 1JMZA 4OJFH 1WIUA 3BPNB 4OI7A 5EOCJ 5GRXG 3HR5B 1FVEB 3FB8B 3PQYD 5HHNB 3HE6D 4DKEL 4P46A 2CLRA 5J6GA 3K7UA 1QFUL 2VC2L 3U48A 1DE4B 5DD6A 2NY3D 2EC9U 3OGCB 1M6OA 3BVNB 1I8KA 3WL9A 1UXWB 1C1EL 3O9WD 1MREL 35C8H 1BQHA 3TVMA 4Z7UB 4HEME 3RTQD 3NFSH 5CP7B 1NGQL 3L7EB 4P0DA 3LKPB 3U0TA 1A0QH 4X9GA 3I75B 2X89D 3IRZA 3DX9A 4L4VB 1TITA 5KZCD 4LKCA 5JHDA 3U1SL 2IG2L 1ZA3A 2OSLB 4UQ2A 2ZUYA 5HJ3B 4MCZB 4ZUWB 3SE9H 1JPGA 2DWDB 1FJ1B 3QFJE 2VIRB 3QR2A 3P9MA 4WU7B 3RPIB 4NBYB 4Y5XA 3RIFF 1Z3GH 2GEEA 1BJ1H 3Q5OA 1CG9B 1AD0B 4MQXC 1ZANH 2DTMH 1UZ8A 3LPGA 4YO0A 2XZCL 1GIGL 1RK1B 2ATKB 4R2GC 5CIPA 2GK0B 3BDXA 4M61A 4JN1H 2DQUL 3B6SB 4IRSC 3TBWB 2A77L 3P11H 1SY6H 4U0RB 4P5KA 5INDB 3UYOD 1MNUL 3SKNA 5FO7A 1QSFA 3V2AR 4I3SL 1EEYB 3AXLB 5C6WH 1E4WL 1KEGL 1F97A 3MUJA 3C8HA 3WN5B 4KPHL 4YHKH 5D7IF 4IDJL 2EE3A 3EO9H 2ATPA 2J8UF 5HGAA 2OL3A 2YA0A 3QDME 1T7YA 2MPAL 3NFPB 4P2QB 3IDMA 3VFPB 4H20H 4M7JL 2NY0B 1NFDE 3CJJA 2ADIA 3MBXH 5KANI 5GS1C 1CDIA 1QSZA 4WW1B 4LQFL 2CKBB 4JFXB 5BQ7A 5HYEA 5E6IC 1P1ZA 3IDXL 5CMAB 3QI9D 1GSMA 1I8IB 3RKDC 2AS5M 5HPOA 3LV3B 3QIUC 5DFTA 1RVFH 4DWHA 4YNYA 1OAYH 4RMVA 1OSZB 5B8CB 1E4XI 2QQLL 4AENA 4EUPH 1ZT1B 2XICA 4FG6D 1KXVC 5GS0D 1ZWIA 4JO3H 1KJMB 3F58H 3DO7A 4JY5H 4OB5H 1R24A 5JW3L 4KDVA 3ULVD 5JIKA 1D6EA 3SDAC 4U0QB 5JW4Q 1A7QH 1MJJA 3WFEL 3A6BL 3VFWB 4U1KA 3V4PH 2W91A 2JK5B 1WZKA 4A2LA 3PGDB 2UUDH 2BVPB 3A67H 3O11A 1RSFA 2NQCA 1J8HD 1YEGH 2PR4H 4W6XB 4ZAKD 2NX5E 2VAJA 4WJ5A 3VGAB 4P9MH 1IGTB 2MKLC 1KN4L 2VERN 1GJIA 2WBJB 5JA8B 3NA9L 4PJGB 4PIRF 3FQUB 4JFDA 4WW2A 5JO5B 1FAIL 4WY7H 3WLBA 4ODXB 5IB1A 1T5XA 4HIHA 1II4E 4R90H 3DURA 4PLKC 4HC1L 5FUZH 3GIZH 2YRZA 4XP9H 1IC7H 2I5YH 1JN6A 3MJ8B 2DQTH 2LV4A 4HWZA 4LF3A 4WHTA 1S8DB 3IDJA 2JIXD 4JPKL 4JRYE 4U7KA 1EH9A 2MHAA 4QRQB 5I1GL 1A6AA 3IT8D 5FDWB 2C4FU 3QCVL 3RNQB 3L3GA 1QLEL 4PRPD 2OZ4L 3MV9A 2XZAL 1MCBA 3T2PA 1KG0A 2YHGA 3STLB 4HXAH 4F7PB 1UQSA 1AXSA 4ZSOE 3L1OL 1NBQA 4I5BB 4NSKA 4P23A 4Z78B 2J88L 4NZJA 3ZKND 1INDH 1G7JB 3W0WD 4OZFB 2J6EL 3GGWA 1DQJA 1T0MB 4NN7C 2R2CA 3ARXA 4FN0A 5IVZB 4GFTB 3BDYL 1I7UA 5CLWA 4PGBA 5I9QB 4UU9B 4WUUB 3FQTA 4DAGL 3DSNA 3QDAA 1OVZA 4LPYA 4GRMA 2FZ3A 3MR9B 3KR3L 3Q6GL 3IS0X 3MRPA 5E8OB 4H0IA 3EDFA 4NM4L 3ARGD 3MJGX 4AEIL 1IAOB 2FD6L 4NDMA 4DGYL 4G7YH 3RZCA 4QHLA 4HLZH 3X17A 4FQ2L 2Y07H 4WGVB 4IOFD 2MNUA 3V4VH 4YAQB 1HWHB 1CZ8L 1D5IL 1ADQL 4NCC2 3QWOB 3B5TA 1BVKB 4JFZH 3C08H 5IJVA 4KROB 1LVEA 2IAMA 2V5YA 4FXGA 2EICA 2IBGA 4JFYB 3TV3L 3FONB 2Q1EA 5FK9A 5FYKL 3BGMB 4RAUB 3VDCA 1CXEA 4OQTA 5DURB 3BD3A 1A9BA 3BYTA 4PUBH 1A7RL 1M7DA 4O9HH 2CUHA 4LEOA 5HI4C 3QHZL 4F58L 2ARWA 5CFHA 5DRNA 5ISZA 1BEYL 4HH8A 4R4BB 4X7CC 4XP5H 2W1NA 5BXFA 1NBVL 4YIQB 3WNPA 4RGNC 1MWAL 4X9BA 2XTJB 2VQTA 1F6FB 4HJ0C 1JZ3A 1Q9KB 5JXAH 3MRIA 4L3ED 2O93L 3I6KA 2DDQH 3U7YL 4U1NA 3ULUE 5C0RL 4BQCA 3FN3A 1UWXK 2EZ0D 5IV2B 4OFYD 2N7BA 4EIZC 1VADB 3KYKL 3OKDB 3ZZ1A 2UV3A 2W59A 3QIWC 4NJAL 4X80L 3IVKB 3E2HC 3JSSA 5LXGH 4YPGA 1FYTE 1CVRA 1JTPA 1ZGLP 2XQBH 4PY8I 1KB5L 3C5SB 1XF3A 4XCFL 2VLLB 4OCXH 4MA1B 5FEBA 3VXUD 1CVSC 1KEML 5EG6C 5IGXL 32C2B 5I0DA 4HJJH 1RHHB 1XZ0B 2PF6A 1OB1B 4QOKD 5EUOE 2BCKB 1OP5K 2ZSWA 4ZXBA 1A64A 4NHCH 1JIBA 4R0LA 5IW3A 1UXSB 4KMQA 2W60B 4NGHH 2B4CL 4JFFD 5D2LA 4Y19A 3PGFH 5D1QC 5F7MC 3F7PC 1KN2H 3PL6D 4LU5H 1WBYA 3MV7E 4FQXC 1UGNA 3O8XC 4HFUH 5TDOA 4WEUD 5CJQH 2APVA 3U4EA 4WFED 1WLHA 5JNYB 4ZUTB 4HBCL 4N0YL 5IW1A 3DYPA 1NCDL 4P46B 5DZNA 5F7UA 5J6GB 1KPUB 2VSDA 3UCRA 2HG5B 3MOBL 2ZUWA 2EH8L 2X70B 4K9EC 3AROA 1CDJA 4OCWL 1FO0L 1M6OB 3GIVA 1FLRL 4NQDE 3WL9B 4XXCC 3TH3T 3P4OA 4Z7UF 1BQHB 1GOGA 1QFWH 4RA0C 1QA9A 4OD2B 3U0TB 5C8JA 2PXYC 2HLFC 5KBNC 1ED3A 4JO4L 1J18A 4Y16A 5GGRY 1UM4L 3W39A 3TEUA 4WFGD 4LKCB 5JHDB 1TTUA 3CXDL 4D8PA 1EJOL 1ZA3B 4JQXA 2YD7A 4UQ2B 1WEJH 3EHBD 4X8JA 1J12A 1C5CL 1SJEB 1ZHNA 1FL3A 2KBGA 4QYOB 4Y5XB 1DQDH 2NY5L 4ZNCD 4JDZA 2DLEA 3FJTA 3NN8B 5EORL 3AFLA 3GRWH 1UZ8B 4PJDB 3X13A 3SKOB 2A38A 3IXTA 4GAFB 4NKMA 1A9EA 4GS7B 1MHPL 4LCCC 4U1SA 1S5IL 4PYGA 4XI5D 1IEAB 5J1AA 1U6AH 3EJYC 3T09A 4XMPL 2GAZA 4DZBB 1MCKA 1CK0H 3CPLA 1D9KD 3DGGA 4LRNH 4P5KB 4YE4H 4Z95H 5C07A 1YYLH 3DVNB 1U92B 3SKNB 2XWJA 1BM3L 4DGVL 4KUCD 5C08A 1RZ8A 2J8UA 3B8YA 3HI6H 1E28A 4JLRA 5H37G 5EUKA 3QUXD 3A6OA 1HXMA 5IB3B 5FM8A 5TPWH 1FPTH 4D3CL 5HGAB 2OL3B 4G42B 4U3HA 3MQIA 5CGMA 4OFKA 3WO3B 5KANG 1G0XA 2ADIB 1UJ3C 1BBJA 4RFOH 4QHMA 1A4KA 3LHPH 3QUMH 3VFOA 1NFKA 1AO7D 1P1ZB 3MXVH 3BZDA 1RZ7L 2Y6SC 1HHKB 4DVRL 4MMZC 3QWQB 2WINA 3U9PL 3F6IA 4PV8A 1AI1L 4XXDA 5EO9A 2X1XR 3RDTA 3QA3A 1U3ZA 4U3CA 1MEXH 2BNRB 3BFOA 4MJIE 4K23H 4AENB 4K07A 3V7MA 5GHWL 1NEZA 5F88A 4DK6A 3KPQB 4NUJB 2DLHA 1V3KA 1DEDA 1FZOB 2AKRA 4XMKH 2KQNA 5EO0B 2R56L 2B0SL 4FFYL 3O4LB 4FABH 2DB8A 3DV6B 1D5XB 1D5BA 2AJUL 4Y2DB 3RVTC 3WFDL 1FZKB 3RJDA 3HE7C 5T3ZD 5IG7A 1EGJH 3FOMB 1KCUL 5D72L 1HH9A 1K8IA 2ID5A 3SCMB 3HCVB 1YUHB 2E9BA 1EV2E 5TJWK 4OF0A 4NRZA 4I3GA 2R0LH 3ZTNL 1AXIB 2EIBA 5GIRB 3EFDL 1M7XA 4M48L 1I9EA 2EE2A 4X6CB 1T5XB 3PWLA 1X5IA 4HIHB 4Y4HD 4XRCB 3TNMA 3OKYA 1TQCB 3DURB 4OF7A 2VXUH 1S9VB 1JN6B 2CR6A 3WIHA 1U95B 1FFPA 3IDJB 4XCEA 3GI9H 3OJ2C 5EC2B 5HDLA 1Q0XL 4U6VH 4XB8A 4ZTPH 1N2RA 1NMAL 3V6OC 5IFHL 5CJXC 3IU3A 3Q1SH 1A6AB 2PW2B 4KHTL 1MFDH 3SGJA 3VGHA 3H6JA 3W5NA 4F15B 2OXGA 4OUOA 4UOJA 3H8NA 3EDKA 1KG0B 4HGWB 1KCVH 1OAZL 1WQVT 3BAEH 1GGIL 1AXSB 3MCG1 4E0RA 2H1PH 1X6LA 1XF5A 4P23B 4ODVL 4M1CD 4OCLC 1RUKL 1CLYL 4WU5A 1GHFH 2NR6C 2QR0A 4XVUC 3IF1A 4LSQH 5FGRA 2GITB 1I7UB 1S7RB 2KDGA 2XA8L 2DI9A 3RWGA 4WV1A 4Y1AD 3UTQB 3NH7L 5HPMB 5AZ2L 4DCQA 4XVJL 4E41E 1F5WA 2EDBA 1AQDA 4JHAL 1BMGA 2FZ3B 2WLYA 2AXFA 1A7PL 2VH5L 2AQ1A 2VOTA 1S78D 1XGYL 4QHLB 3RZCB 3MRJB 5F9JA 5IB5B 3HKFA 3F7YA 4F33A 1WTLA 4K7PY 5ID0A 5FYLE 3ZT7A 3P3YA 2BY3A 4Y4FA 5C0IA 4NYLA 1JGDA 3M8OL 1F90H 1MF2H 1T0PB 3R1GL 2NXZC 5CINH 2DJ4A 3PV6A 1NAMB 4LCIH 2V5SA 3V8CA 3SJVB 1A14L 1Z9LA 5C0CE 3GHEH 3KWWA 4J8RA 5BCAA 3IJYA 5KS9F 4B50A 4H0GA 5FCUH 1JNNH 3GMQB 4P5TA 3U6RA 3DRTA 3Q48A 1PSKH 1M7DB 1DUYA 3FRUA 4UINL 2DD8H 2VL4A 5DRWA 4KVNH 1QFPA 3B2VL 4R4ND 1AQKL 5L2KB 4UT7H 3S36X 3JV6B 1QFHA 4PJ5A 1MQKH 4GJTB 1OAQH 4MNQB 5JLZA 3DMMC 2XY2A 3DUUA 3MRIB 3RVUD 1S7UB 1A21A 4OV6F 1KCSL 4Z7QF 2XRAL 4FQQA 2BVYA 1LILA 4UILL 2X4QA 1RUML 1ODAA 1ZHLA 4X98B 2P7TA 5DK0B 2EDKA 2XWTA 3QDJD 1G7HB 2XN9A 1Z2KA 4PRHA 4PBVC 4DUVA 2WAHA 4WUKH 4EI5D 5DC0A 4U49A 4K3JH 1N5YL 2DQJL 2E7HA 2UVFA 1HINL 3O2VH 4X7FC 3O2DH 4Q6IC 1A5FH 3MLRL 3N1QC 1WWWX 4AIZA 1G7QB 2RBLA 4Z8FL 2CLZA 5EU5B 5C0AB 5C0BA 4AIOA 2ZSWB 4ZXBB 4CBPA 2Z4QB 1NAKL 2A74A 1QZ1A 5SX5H 4MQ7A 4F9PA 3TA3D 1N4XH 2IPTH 4Y19B 5D2LB 5ILTH 4UTAL 5HYFA 2YD8A 3FFDB 3QFJD 1PY4A 3NFNA 4JR9L 5FV2A 3BQUC 2A83B 2JCCE 3QQ3B 5D6DA 4KMLB 3C6LB 3ZL4H 4KK6D 2R0ZH 3SE4A 4MA8L 1X7QA 5I1KH 3U4EB 4M3KB 2B39A 1YEIH 1PFCA 3UTTA 5IW1B 2IPUG 3DXAE 3GK8H 4IRZH 1CD0A 1NBYB 4N8PA 4JO2H 3QO0A 4HUVA 2VLJB 2HJFB 3MLWL 3OAYK 2I25N 4UB0H 3RUGF 3P4OB 4L9LB 1Z9OA 3FQRA 5D93C 4OSUL 4LOUD 3MLXL 2RHEA 5FA3A 3UJIL 1NLDL 4DFIA 5C8JB 1W0WA 5E8DL 4G6FD 5FHAH 2C7UA 2VDQL 1KTDA 4D8PB 1V05A 5JHLH 3PDOB 2AJVL 1JZ2A 5FB8A 4NZTL 3STZB 4APQC 3GNMH 2PO6A 4V1DA 2WWMC 5D5ME 3WDIA 1FGNL 3FB7A 4JDZB 5HDQL 5H37H 3V52L 4L4TB 2YKLH 3BWAA 4R8WH 1O7VA 4AG4L 2NW2B 4JDTL 3QEHA 2PW1A 4M6AA 4QHUB 4NKMB 1A9EB 1RMFL 3GM0A 1JE6A 3KJ4B 4KTYA 2IANA 4ONGL 5MEOA 2OJEB 5ADPH 3D3VE 5J1AB 5J9PB 1Q1JH 1U8QA 2AP2A 3PP4H 4RFNB 1E27A 4DEPC 4GKSB 1F00I 3CPLB 3DGGB 4NQVA 4BJLA 5C07B 3ULUL 2XWJB 5E0QA 3LQMA 4FQCL 4OCRL 2FB4L 5DMIH 5GRUL 3V6OE 1E4XH 2V9TA 3CMOL 4BFBD 1C12A 5I76A 5I1DA 3TH2T 5IESH 4HFWA 5L9DH 4JPVH 4IS6B 5I74B 1NANI 4YXLH 1NC2A 2HT4D 4XAWL 2VXSL 3RWEB 3P30H 4DFHA 2X9YA 1RQ5A 4BFGA 1OTTD 3QUYC 5GGSY 2HA1A 4JG1H 4NKOA 1A4KB 3VFOB 1U58A 1CFNA 1U91A 1FHGA 4LL9A 1NMBH 3MRBA 1T66C 3F5WB 3QPXL 4LIQE 5DJCA 5HGGS 3UTSD 1MCNA 1FIEA 3HNSL 4JFPA 4QRPB 3EYQD 4PV8B 5EO9B 4XXDB 3RDTB 3U2SA 1EZVX 2BNQA 3QA3B 2ORBL 4FFZH 4KMTL 3VXME 4P9HC 4AEHH 4HS6B 4HWBL 1MCFA 1NEZB 4RSVA 1KSRA 1D5MA 1F8TL 1GZPA 1KTKE 1BAFL 3UDWC 4JRYD 5TF1H 1LQSR 4G8FB 1CDGA 4TULH 4NQSA 3H9ZA 1ZXQA 4EDXA 4UOW1 4G6AD 4PLOB 3D69A 5B39G 3UYPA 3LCYA 3T1FB 1TZGH 5AZEH 3PJSB 4GAJL 3VCLA 1I85A 2AQ2A 4LSRL 4X0KA 5GISH 3OV6A 5E2UH 4JQVA 4HKXA 1IEHA 1HH9B 2B1HL 4HPOH 1TTGA 4WENB 3H9SA 4YBQC 3UJTL 3DUSB 5GS2H 5SWSB 1Y0LA 3BWUC 2Q6WA 4NNPH 5CGTA 2J5LC 3WLWD 4RISL 1MHEA 3PWLB 1ZLVK 3V0VA 3TNMB 1YNLH 3WS6C 1UKQA 2R23B 1OP3H 3ARDA 1OGTA 1RUAH 2FJGA 2V17H 3TVMC 3WV0A 4XCEB 5C09A 2FATL 2X10A 3MYJA 1A3RL 3K0WA 3WKML 1QRNE 3MA9L 4LLQA 3IU3B 1DLHA 2NTFB 3BKJL 3VGGA 3VMPA 5I1CL 1QBLL 3VXNA 4NQCA 5IFJB 2AI0H 2X5PA 1QBML 5ESQA 3RHWK 3ZE2F 1ERNA 5D7JD 5F96H 4E0RB 2AEQL 4OLWL 5T1DH 5I1IL 5J13C 3HFMH 2BRRL 4F9LA 4NZDA 4CDHA 4CVZB 1INEL 5ECJE 1BQUA 4Z7VA 4EN3A 3IF1B 3GKWL 4JHBA 3RWGB 1AJ7L 4PGDA 4DCQB 1BGXH 2WNGA 4JB9H 3MRLB 1X5YA 4YFLI 1ONQA 4UUJA 4NO5B 5I15L 1AQDB 3UEZA 4A6YH 3BEWA 1LDSA 4K8RD 3OJMB 1YPZE 1ZT7A 5SV4A 1YQ2A 5EULV 1XCQB 1IL1A 5LWYL 1BECA 2NMSA 3F7YB 2R1WB 4GXUN 5ID0B 4LLVA 5HHXH 4G80B 5I1EH 4Y4FB 3MPCA 4MZ3A 5C0IB 1JGDB 5ESVB 3ULUD 1CICC 4JY6B 4U6YB 4OF5A 5I1LA 3OG6B 1ZK9A 5BRZB 1XGRB 4Y4KA 3LS4H 2Z91A 3L95B 4KI5C 1BFVL 4GUPA 3ZMRA 4LFHG 1AXTL 5SWZD 1TNMA 3EJZC 4MQXD 4PJ7A 3VRIB 5DD3L 3MLSH 4J3WA 5AYUL 4H25A 1H8SA 3DV4A 3RFZC 4EBQL 4BH8A 2XZQL 4JM4L 1S7SA 3VD3A 3FRUB 4KJQD 4RX4D 4BYHA 1IM9D 4F2MA 4YBLC 3QHFL 5DRWB 3UMTA 3G6AB 4RNRB 1WFTA 2AJ3B 4M02A 5KSAB 5CJOH 1QSVA 1QNZH 3QXAA 3KXFE 4XP1H 5CLTA 4Z7NE 3KAAA 3DUHA 3MLYL 3DUUB 2DQCL 4AIXA 3TFKC 4JN2A 4WNQA 2BSRA 3HMXL 5GGRA 5B39A 4FQQB 1T7WA 3ROLA 4UT9L 4K3EH 2X4QB 1UA6H 2CLVB 4WI4A 4L3AA 1ZAGA 1WFOA 4NBXB 1O7SA 3BZFA 3IDUA 4GRLC 3IKCB 2XWTB 3CSYB 2JJTC 4EUPA 4PJIB 3DVFA 2XN9B 2HYMA 4NN6C 2HWZH 4JFOA 1PD6A 2ZKHH 5T1KD 1RJLA 4UZGA 4OUUB 4OLVL 3T0AA 3MJ9A 4KV5E 2VZ1A 3V9FA 2R8SL 1CXHA 4ZQKB 5HYJA 4O5LH 4MD5B 3RP1A 2GY7B 2PTUA 4NC1C 4TSAH 3D39A 3TIDB 4N8CL 4N5UA 4PP1D 3HG1E 2CRZA 3MRRB 4N90E 1M05A 2MCPL 5ANMB 2CLZB 5FM4A 2CIIA 1P4BL 3QAZC 2BY0A 3W2DL 3VWKA 1QHPA 1RUQL 1BHGA 2ED8A 4RGMB 4QCIB 5KVMC 3CZJA 4H26B 3TYGH 1VGEH 1FG2A 1WUNT 2BVUA 5HHPA 1XH3B 5T5FL 1YJDL 2D7OA 3ARBB 4X9FA 3HZKA 5I2IA 3QEUA 3GHBL 1DEEA 1KBGL 4XTRC 1W2KT 2APWA 1NMCC 4N0CD 3VWJA 4NKDA 4GW1A 3SQOH 1NDGB 3MJ7B 5C0EA 3IGAA 3T2QA 5I8EA 4ZFZA 1ITCA 3CFKA 2DYPA 2FIRT 1ZLSH 3VW3L 1JNLL 3I3BA 1DVFB 4G9FA 4XWOD 3V5DB 2YEZA 5EA0H 3N9GH 3TYFA 4JM2C 4H0HB 1FE8L 4PLKD 2R1YB 1A7NH 4FQIH 4KKAC 5FYLL 5FA3B 1BLNB 1YECL 4OGXL 5E6ZA 5EZOH 1T3FB 3EYVA 1MFBL 1W0WB 4R3SA 1MIEL 3U46A 1I8MB 5EH1A 5FKPA 2ICCA 2VLKE 3MGAA 3O6KH 1KTDB 3C60C 2V5MA 3VFGL 5J11C 4D9LH 4MMXC 4V1DB 1C16B 4C57C 2QHRL 3NIDF 4QTHA 1WWBX 5ICYB 2IQAB 4HGKC 4HWUA 3BWAB 3RWHA 1J8KA 3WFHA 4CN6A 1LWRA 3MGTA 4IOSD 2ZCKL 4J3XA 1GC1C 5KVDL 4PB9L 5MEOB 1HHJB 4PGJA 4P2OC 4UDTA 2P5EA 4FTVD 3G6JA 1AE6L 4XP4L 3BZEA 2CMRH 4MXQD 1LO2H 1U8QB 4M7ZC 2DQIH 4MJID 4PGEB 2DBJA 4WO4B 3REWB 5BMFL 2R2EA 2IQ9H 4LARH 1K9TA 4XNYH 4YQXH 1UACL 5E99H 1FGVH 2OMBA 1HKFA 4ERSL 1G7IB 5C6TL 3N1MC 1C12B 5BO1L 2OQJB 2YPLA 4MA3B 1TJIH 3SKJL 5I76B 4I77H 5I1DB 1NGPH 1VEOA 3FOLA 1JPSH 4Q0XH 5ACLA 1QR1A 1G9NH 1TCRB 1GL4B 1Q38A 2YPKB 3P40A 4X99A 4EVNA 3QCUL 5AD0B 4P57B 2XTLA 2Z92B 2I60L 3IFPA 4NO0D 5L8KB 1FL5A 5KSVA 4X5WB 3MRBB 3WJJC 4HKZA 2F74A 1OT1A 3Q6FA 4MXWL 3NZ8A 4UT6L 5HI4D 3OHXA 2BMKB 2BNQB 1T83C 1NLBH 4I2XA 2JJUA 2E7BA 2CIKB 3FMGL 4HS8L 4MB3A 4LASL 4KVCH 3I6GA 1Q72H 4BSVA 4XNZB 3JTSA 4HPYL 1D5MB 1YY8A 3MLUH 4D94A 5GS0H 4LRIC 5CEXB 2R29H 2YUZA 3KGRA 4EDXB 2FBJL 2LU7A 3ULVH 4ZTOH 2FHFA 2XKNB 5AAWA 1ULVA 5EU3A 5A3ID 2C5DC 2HLAA 1HYSC 3F12A 2BNUB 4BA8A 4KI5E 2CK0L 3QIWD 3INUH 4R7DB 3SQBA 3UZEA 1A47A 4M8QB 3VRLE 1CR9L 4XPHL 4YHNA 3RGVD 1U3HC 3S96A 4L1DA 1VCAA 3WNKA 43CAA 3G5YA 1IBGL 1UWEH 3H9SB 3EZJB 3S35H 4YHOL 4L8BA 4JZNB 4HUNB 2K7PA 4KU1A 4Q97A 1OAUL 5KOVC 3WXVH 5IKCA 1IC1A 3F7RA 3BP7A 1XIWA 4Q7DA 4HK0B 2HN7A 5KTEH 3WHXB 1MHEB 3V0VB 1DQMH 5SWQB 1XCTB 1T5WB 2H9GA 5FGCB 5FYKU 1ZVHA 1YNKL 2DJUA 1EX0A 1LP9E 1WT5A 4KY1H 4HC1A 2X4SA 2D7TH 2FJGB 2FL5A 5EBWB 1Q9OA 4JFFA 5IMOA 5ETUA 1TTFA 3JWOC 1JYWA 2ICWA 4LP4A 5IHLB 5CBAA 3C5ZD 3OF6D 4LCWB 1MY7A 4LLQB 1DLHB 1I7TB 4Y16C 3O6FB 3GDBA 5C0GA 1TJGL 5D1ZC 25C8L 4PJCA 1DFBH 1MREH 2BOBA 5EIQA 2OZ4A 5I8CA 3T4AB 1IZKA 4M9PA 5D70L 2A9NH 2GK2A 2Z9TA 4NQCB 5E00B 3DIFA 4FQXD 3FRPA 5E94A 2YD4A 2VLRA 3GJEB 3T0ED 3WNNA 2YN5A 1EPFA 5ADOH 5L0QC 4Z7VB 3K1DA 3T2NH 1KB9J 2YSSA 5DLML 3K8MA 4EDWH 1NQBA 3QRGL 4L3CB 1DN0A 1RZGA 2FLRT 1LO3L 4JFDE 3ECBA 3LEYL 4NC1E 3MCLH 4UUJB 5ID1A 1AGDA 4IRJC 1G1YA 3RVVC 1J1XL 5KZCB 3SDCC 1ZSDA 2QHLA 4YK4B 3LIZL 4WEBH 5CZXC 1MVUA 2KQMA 5IROC 2PXYD 3JVGA 4ZNEE 4ZO8A 2RFXA 3HI5H 1VKXB 3FKUS 2PETA 1JGUH 2LU4A 3MV9E 1VGKB 3HB3C 4WWKC 1ADQA 4Y4KB 1K8DA 1MNUH 4GUPB 1ZVYA 3CSBA 3X3GH 4HCRA 4PJ7B 2XKUA 4KPHH 4L9DA 3DETC 4BH8B 4KTEL 2J12B 1NGWA 1LNUA 2FX9H 2MPAH 4ZPTA 4M7JH 1D9KA 1KLUB 4GOSA 4DW2L 1J0ZA 4F8TA 3RWIA 4X6DE 3NAAL 3LKSA 3KPSA 3QXAB 3HZVA 5DEFA 1MWAA 1MLBB 1AHWA 5DJ2B 2YXMA 3QUXA 3O4OC 4JN2B 3H9YA 5GGRB 3SBWC 1IQWH 3X11B 5B39B 2QQLH 5BVJA 1MRCH 1EK3A 3LOWA 2P48B 1BOYA 5JOPD 5LGJA 4TQEL 4ORGB 3T65A 3AREA 3BZFB 5JW3H 2FBOJ 4OCYH 4MDJB 4NJ9L 5CJ8A 3QI9B 5IHBA 2ICES 1SVZA 3JWDC 3LS5L 2DM2A 4I18B 2NLJB 1QLFA 4JFOB 1RJLB 4I1NB 4JJHA 4OZGF 2X2YA 4XGZB 4D2NA 5TE6H 3QNZA 5CEYA 5FECA 2AXGA 2XQYG 1KB5A 4JGUA 4MHHI 4XCNA 4ONFL 1K3IA 1X3DA 2B5IC 1MI5D 4AQOA 4HHAA 4QGYA 1OCWL 2WIIA 3VI4F 3MV8A 5T5NF 5ISZE 1HE7A 1U41A 2D2OA 4FFVC 1R3JA 1NCAH 5L7XH 1KN4H 4YDVA 4XBPA 1M05B 3WIFB 1RZFH 1E4JA 2CIIB 2IFFH 2LABA 1M1SA 2ZOLA 5FM5M 3HN3A 1A3LL 4KWUA 1A6UL 3B9KC 1B2WH 1GGCH 2NY6D 1J8HB 2AJZB 1D7FA 2L4OA 4YDJA 1A1OA 1DEEB 2VXTL 4PD4J 2OS7A 4E42A 3MLVH 1BWMA 1MH5B 4NKDB 3U4BL 4D9RD 3FO0L 4GW1B 3OGOE 3T77A 5IF0A 4N8VA 4KJYA 5C0EB 3QCVH 3L6FB 5GGSA 3CVHL 3JV0A 3V5HA 1CD1B 4R4FH 5T1LA 5HYSG 1N0XH 4NQEA 2W0PA 4XHJC 1SBSH 4GXVL 3RWDA 3L1OH 4G9FB 3LDBC 4UAOB 5L6YL 1FSKB 3GUTA 1AR1C 3D3VD 3I3EA 3U7WL 2JIXB 1JWSA 3UPCA 1N5AA 1EHLH 2CSPA 3G9VA 1H3UA 3ARFA 3BDYH 3HNVH 2NYYC 4D9QD 1A1MB 1FVCB 1DL7H 4HULB 5DMKA 5BZWB 4M7LH 2R39A 5E08H 4OLYL 2UUDK 3OKMA 1VHPA 4H1LG 5ENWA 4AEIH 4P2RA 2YUXA 5DI8A 4DGYH 5K9QG 5F6IB 3IB4A 1EMTL 3I6LD 4GRWH 5ESAB 2YD9A 2H8PB 3ZDYF 5JZ7D 3VD9A 1NANH 4C83A 4QRRE 3OPZL 3GBNL 3TN0C 1A6WH 4TN9A 5DVLA 4QTIH 5KN5B 5FOJA 4F7MA 5FA4A 4QY8A 1KENH 1RJZA 3QEGL 3ARGB 4H88H 3ZDXF 1S7XB 3G6JB 4NNXA 3TT3L 3GO1L 1TJHL 2R2EB 1SEBA 1A7RH 3NZHL 3QHZH 3G5VA 4L8DA 1EEQA 3BKCH 4FS0A 3D18A 2AK4A 2YPLB 5GSVA 4HD9A 4HZLB 4U3XA 3CU7A 4HWNA 2DLFH 1LEIA 2BDNL 1I1AA 3BI9X 4MD0B 2BVTA 2D4DA 3BH9B 4X99B 4I0PA 1EO7A 2NY0D 5E2VL 3IFPB 2X4OA 1OQXA 1FL5B 5CEZE 2VYRE 2XT1B 2GY5A 4HKZB 2F74B 3KYKH 5GGQL 4J4PC 2QSQA 3SDDC 3Q6FB 3NZ8B 3EYOB 4JRXA 4J2XA 1NKRA 4PJHF 1J7VR 5J1TC 5KG9B 2VITA 3SPVB 4L3EB 3JTSB 5GGUB 3QEQE 4O00A 2EDEA 5FKAA 2C3VA 3PE9A 2CQVA 1IFHH 3TO2B 1MRDH 4R26L 3TO4D 3ARWA 3MBEA 3WDHA 2X9XA 3AM8A 3H0TB 3S3SA 5D7IE 5C08E 1KJ2L 1EAPA 4F9PC 5IGXH 2RB8A 3A0OA 5EU3B 2BSSA 4EQ2A 4OF8A 2HLAB 4BQBA 2UYLA 3ALPA 1KCKA 5HD8C 1DQLH 4GKOA 3KPPA 5D6DC 1QSEE 2X41A 2B4CH 4E9LA 4HXBL 4YHNB 3MO1B 5T3ZH 3LPFA 43CAB 5I17A 3RX5A 2H2SC 4JG0H 3G5YB 5EBMA 1WVZA 1KCRL 1MFEL 3VXUB 4P9HL 2ESVE 5IKCB 3FHQA 5BZDB 5IP4A 3K8KA 4QOKB 3L3HB 3B43A 2HT3D 2H9GB 3O0RL 2J8HA 1KC5L 4G7VL 4HBCH 2PTTB 5HVFB 5HDOA 3WUWA 5L8LB 4JFFB 3WXWL 5IMOB 4AYFA 2ICWB 3OMZA 3MOBH 1J05A 1QKZL 3PL6B 4LPWA 4Q6YA 1KB9K 5C0GB 1FLRH 2H2PC 1F02I 4PJCB 4GKNA 1RU9L 5I8CB 2BFVL 2R0WL 2BVQB 5CSZB 4MAYC 4U7MA 2NXYD 4YGAB 4W81A 2NY2C 5E94B 4P4KA 5HY9B 2VLRB 4GBXC 2CRIA 4S1SL 3CXDH 5DZOA 4AMKH 1EJOH 4PJAF 4YUEL 4ETQB 4RAVB 2X1WL 4LSPL 4J3VA 2YSSB 3LRSA 1LK3L 4XC1L 5C0JA 1DN0B 5GZNC 2ZSVB 3ORJA 4X6EA 1SHMA 2YR3A 4TNVK 5EORH 5ID1B 3IDGA 1VFOA 4U7SA 1AGDB 4DKAA 3FO1A 3QPQD 1BREA 1HOCB 1X5GA 4QXUL 1CGXA 1C08B 3CDCA 2X4UB 4X83A 5TDNA 2F9BT 1ZSDB 2A1WL 4PJXF 1GXEA 4XNQA 2VDOL 4G6JL 2VN4A 4HIEA 4GRWB 1F4HA 1KUMA 4MQSB 1I1YA 3QDMA 5DJAB 4FZ8H 2D7QA 1K8DB 1NFDA 5CKGA 5I73C 1E6OL 4QF1A 3H42H 5EOQL 2EEAA 1WF5A 2VB5A 4KROD 3ARRA 3BPOB 1HZHL 3NCYP 4HF5L 4X6FB 3ESVF 1FDLH 4HJGA 3S36L 1R5IA 2ICEB 3UO1H 1D6VL 1OPGL 4ZPTB 2EC8A 4UBDC 1S9WB 5IWLC 1D9KB 1I3RB 5F9WB 1P84J 1PLGL 3RWIB 3D25B 5EOCH 5MEQA 1SYSB 1SMOA 1MWAB 5IW6A 1B6DA 1YEKL 2I9LB 4DVRH 1AHWB 1U8OA 4LLDB 1OP5H 3U9PH 1NGYA 4K2UL 3QUXB 2IH1A 3UBXI 3SY0A 4MVBC 1IKFH 2H3NB 3QQ9C 5BVJB 4OLZL 2Z93B 3CFDA 1OP9A 2JKXA 2Y36L 5CS7A 1ZGLA 3MROA 5EBGA 1H3GA 3T65B 3AREB 5C1MB 2CRYA 2NX5A 4XWGL 1I85C 1AO7B 3VGAC 1S7QB 1NCCL 1ZLWK 4XX1E 2VDNL 2P8LB 2WWKO 2WBJC 3QUYD 2R56H 5DD5H 3O3BA 1F58L 4KAQL 5FECB 1T66D 5CEYB 3I3DA 1W72H 1KB5B 4MHHG 2CDFA 1KCUH 5D72H 3QULA 4HHAB 2WIIB 4GMTL 2AEPL 5IB4A 3UTPE 4PD4K 4LSVL 5T33L 5F9DC 3ZTNH 4YDVB 2VQ1B 1N6QH 4PJ5E 2ZCHL 4M48H 3RU8L 3JWNC 2ZOLB 4ZYKA 3T3MF 2EECA 5J6HB 2VLKD 2BHYA 3MRQA 1XGPA 2F54A 4OFPA 3CX2A 4K7PX 2OCFD 4JKKA 4HK3N 1UB5B 4E42B 1Q0XH 2DIAA 1AGBA 1UYWH 4F7CA 5I18L 2YUVA 1NMAH 5IFHH 1WFUA 5IUSA 4N8VB 5D4QA 4KHTH 1IAMA 3O2WH 4H1LH 1X4XA 3CCHB 3JTTB 5GGSB 3UYRL 4W70A 4PRHE 2OI9B 2GT9A 2HFFB 2ZPKL 5I9QC 3O3UN 4Y4HB 3SDXF 5IMLB 4RZCB 1IGYB 4TVPE 4P46D 5BS0E 3UTZA 1PW3A 3FQXB 1JMXA 4ODVH 1JGVL 5MHSE 1FO0B 1YMME 1RUKH 1UB6B 1JWSB 1A7OL 1B90A 1YNTA 3O6MH 5FF6A 2X4TA 3TVMD 1OLLA 5D9SA 2GHWB 1UADC 5DQ9A 5C0BE 12E8L 3V5KA 1BBDH 2DLIA 5DMKB 5CD3B 4CVXA 5DZLA 4EKXA 3MNZA 4QWWC 1S3KL 5JHDD 4M7KL 1Z0MA 3R0NA 1XGYH 2VN7A 1N64L 3VH8A 4ZD3L 4A6YA 1KPVA 5I75B 3LKQB 3N06B 4Y1AB 1ETZA 5C92A 3M8OH 4C83B 3R1GH 3UTTE 3JUYA 1IQDB 2FO4A 3HC3H 4F7MB 1A14H 1TVBA 3NCJH 3PWVB 1RJZB 2NPLX 5AUMA 4RMUA 1P2CA 4N0UA 4Z7UE 5D6CB 5MP6L 3PABB 2O61A 5J06A 2XTJC 5GRYA 1AC0A 1YYML 2G2RA 3EAKA 2CJUL 2IH3B 1SEBB 4L4VE 2WP3O 3I50L 3S5LA 3FT2A 1KELL 4Y5VB 3G5VB 2FJHA 3L9RA 3AAZA 3G08B 2AK4B 1QSFD 4BH7B 1AQKH 2ZUTA 5GSVB 4Q9BA 3BMWA 5E2WH 4NOFA 3E0GA 1Y6KR 4KXZI 1JI2A 1FYTA 1I1AB 3K74B 4F57L 5IM7A 1F45A 2APTA 1CCZA 2MQ0A 3OXSB 3QG7H 4E5XB 3VD7A 1BF8A 4NT6A 2X4OB 4UILH 4U31A 2OP4L 2YPVL 3THML 4JPIB 4EIGB 4IRSA 3HNTH 4GW4A 4MA1C 4PP2B 3PDDA 4PJHA 5I66A 2YZ1A 2IANE 3PWNA 4N5EC 3X12B 5DEZA 1CE6A 5CHNB 3U4AA 1A4JA 2H45A 1NCNA 5E4IA 4KKCD 2VITB 3OJVC 1UKSA 4GLRI 3VGEA 2JLLA 2DI7A 1N5YH 4U1HA 3HPLA 4KK8D 4LAQH 3MBEB 2VZTA 3FTGB 4XAKE 4LNRA 5DWUL 4M9OA 4JQIL 4XMLH 3MV7A 4OV5B 2MSPA 1EAPB 3GSUA 3QDJB 4ZFGL 3VA2C 4CRPA 3E3QC 3U0WL 4XBGA 2UYLB 2AVGA 1W72B 5GS1A 5E6IA 2F19H 3VWJC 4EI5B 2YMXL 5I17B 2VDLL 3DHJA 4KTDL 5HYSB 2FECI 3QIUA 2CDEA 4JR9H 1KXQE 2LAAA 2X4NA 1MJ8H 4RDQF 5C7XL 4NQDA 1MAML 1PBYA 1EBPA 2B1AL 3PWPA 3GB7A 4JFDD 4MA8H 1TENA 5DYOA 3MREA 1CL7L 1JV5B 5IBLD 2AJYL 3OB0K 3LH2L 4S2SA 3SDAA 1CF8L 2GJ6A 3TA3B 5IOPA 4NO3A 4WHCA 4KUZL 1J05B 4KQ3H 1UM6L 3QFJB 4HGMA 4H1LB 1CFVH 3QO1B 4OSUH 4GKNB 3BIBX 2P49B 2RQ8A 3UJIH 4PJFF 3MV9D 1NLDH 1FLTX 1YEHH 3MXWH 4YDLC 3H9HB 5E8DH 2Q76A 4ELMF 4BZ1L 3FQNA 4ALAL 5KW9L 2VDQH 2O5ZL 3KLSA 2NY7L 4P23D 3FCTA 4BZ2L 3E8UL 4PJGE 2AJVH 1OTUC 2OJZL 4FMFA 5AWNL 5LAXB 3S37X 1MCLA 2AGJH 5DUBB 1T21A 3LRSB 4FXKA 4PR5A 5C0JB 2A6KB 3HAEG 3T04D 4LLUA 3LRHA 2X44D 3UP1A 3JWOL 5FYJE 5H94A 4PJXA 3KPMB 4OGYL 3FO1B 4G6FB 5F3HB 4L4JA 2VSCA 5TDNB 1DLFH 3GSNH 4JRWA 3VXQA 4K8RH 1W8OA 4X4ME 3RZCD 3W11D 2ZUVA 1S7WA 1AY1L 4HUUA 2H26A 4L5FL 5EZIL 4ZFOA 3QDMB 1GVIA 3DPBA 1NFDB 3ULUH 3WHE0 1IAIL 2X1QA 1P84K 4G8IA 5TF0A 5JXEC 5CEZL 3CLEH 1OM3L 5B3JF 4HQQL 1T20B 2IAMD 5F1NA 4ZG1A 2X4PA 1N7MH 1FZJA 4HJGB 3VGDA 1P53A 2AXJA 4YHYB 1R5IB 2VXSH 5CZVL 4QHNA 4HKBA 1SYVA 5AEAA 3QCTL 1BZ7B 3HC4H 5D1XC 1QTYT 1JHKL 3FO2B 2DOCA 5ISZD 5FUOH 5CP3H 5DF0A 3L5WA 3VRJA 1KNOA 3OTTA 3QPXH 1U8OB 2V5TA 4ESKA 3HNSH 3TBSB 1NGYB 3IDIA 3UTOA 3UBXG 1OHQA 1R3HB 3MV11 1CDUA 2E5EA 4GQ9L 2VKWA 4QT5A 1F13A 1SBBA 3RA7L 4FQ1L 5BW7C 3LKOA 2V7HB 1L7IL 3QG6B 4LLMA 4S1QL 1ZGLB 3V7AE 2IADA 2UWEB 1DDHB 1F8TH 2NX5B 4OI9A 1CDCA 5MI0C 5T1MB 2YD2A 3NOIA 3LQAH 4XCCH 3TPUA 4DKFL 5KS9E 1UH2A 4ZPVA 3UTSB 1I9JH 4G8GA 1FRGL 5IT2L 4GAJH 5ICXA 3EOTL 3IDNA 4WFHE 3RVXC 1D5ZA 2HJKA 5GJTL 1XIWC 3OAYH 2GUOA 1FV1A 2B1HH 3GI8H 1C7TA 1ZHKB 2XTJE 5IB4B 4JRYB 2V9RA 5C2UB 1U8IB 5TDPB 4CU8A 2R69H 3T0WA 4ETYA 1Z5LA 3FFCA 4AH2B 1HSAB 5GRVK 1IAIM 3IDYB 4Z7QE 4IM8A 4F15C 4ZYKB 4ZXBD 3PHSA 1XGPB 5F9OL 4U6XB 4ZSOB 5TQ2L 1F2QA 4Y19D 2VL5A 4XPFL 5E5MA 1AGEB 1AGBB 1FFNA 4F7CB 1IC5L 4S1RH 1NSNL 5DHXB 3BKJH 4JPWL 3GSXB 1A02N 3E6FA 1JFQH 2GT9B 4Q58C 5I1CH 4KQ4L 1E4KC 4QRRD 4XNXH 4E41A 3UTZB 2ZUUA 4PLNC 4UNTA 4YFLF 1HKLL 5GZOD 1FORH 3M45A 3Q2CA 5HYJE 5I1IH 3WIHL 1EJ6A 4KDTC 1INEH 2YRLA 3D39E 3F65A 3ZDZF 5IVXF 2OMNA 1MLCB 5C0DB 5LCVH 4PJBB 1OW0C 1U2HA 4ISVA 1AJ7H 4G3YH 3LB6D 3DX7A 5D1QA 5DQ9B 2Y06L 2Z8SA 2BSED 1UH3A 1X5ZA 3OQ3B 1T04B 2VR4A 2VZVA 3OJDA 4CVXB 4Y16D 5JMOC 2P43B 3O8XA 5D7JB 4XPAH 2AK1L 3TIEB 5C0CA 3S34L 3E3QE 3T8XA 1KIQA 1EA9C 5DFWH 2P47B 5GSRB 5LWYH 2VDKH 1WAAF 2BHZA 3VH8B 5A16B 1JTTA 2HVKA 4CUCA 1ETZB 2VNCA 3TGXA 5DK3A 1A22B 2FX8H 3VD4A 5CEZD 3B9AA 1LO0L 2XA3A 5GGVH 1FP5A 2O5XL 2JB6A 1BFVH 1TVBB 2DIBA 4XXCA 1YEJL 3RUGE 2DL2A 4WTZA 2PYEE 5F89B 1P4LB 4J12A 1AFVH 1ZVSB 3UAJD 5AYUH 2G2RB 2PXYA 3FN0L 2X9WA 3VG9C 1VEPA 4O58L 3ZYIA 4KKLC 5F7EL 1DBBH 2XZQH 4JM4H 2E7LC 2V7NA 5C07D 2QADD 1G6RL 1UZ6F 1K4CB 1CLOL 3VD5A 3L9RB 2A9ML 2FRGP 3O3EA 5C08D 2E9IA 3ZYZA 4MA7L 1ZHBA 4YH6A 2GCYA 3WFCH 2CD0A 4WWKD 1FYTB 3MLYH 1WK0A 5IM7B 2AEIT 4R7NB 3P4MB 3HMXH 4XBEH 4LSTL 4QXTA 5JOEA 4R2GB 3VMNA 2ZJSL 1CFBA 4NT6B 4UT9H 5DA4A 1IM9B 4LCCA 3VXSA 4N68A 4GW4B 1P7HL 3DSFL 4Z77A 2ESVD 5HDBF 4YGVA 3WEXB 3PWNB 1CE6B 2P5EE 1A4JB 5DDHA 5EIIA 1FVDB 5EUOB 3ULSA 5L88H 1ZLUK 2Q20A 3CH1A 1QHOA 3IJSA 4JY4A 1X5FA 1CFTA 5E56A 5F8RC 4G6KH 3HPLB 4K94H 3AS0A 1DTUA 3KLAB 1G9ML 1PZ5B 2ZG3A 3GMMB 1NUNB 3MV7B 2F53E 2M26A 5DS8B 3GSUB 4U2YA 4O2EB 3C6LC 4ZFFA 4C4KO 1QQDB 2OX5A 1CTOA 1UJ3A 5GS1B 1MJUL 4F7TA 5E6IB 1AP2B 3DXAA 2P24B 4TVPL 2FIKB 2FWOA 2X6MA 1YJDH 3ILPA 4NP4H 2VLME 1MCWW 1KULA 5IFAL 5I16A 2X4NB 5IMKA 3CK0H 5BVPL 1B4JH 1GPOL 2BNRE 3DJ9A 4UDUB 3WFBL 4OZIF 3QQ4B 2WBKA 3TT1H 3GB7B 4L9LC 5E4EC 3L3OA 4O4YL 2V2TB 3MREB 1SM3L 5ELIA 1LE5A 2QQNL 2BC4A 3CLFH 4I2XE 1JNHB 4S2SB 1S7VA 5ALBH 3SDAB 1FN4A 1RUPH 3HAEH 4JO1L 5KSUB 4PB0L 1JNLH 1T1XA 4JVUA 1HH6A 2C3WA 5M95B 1JF1A 3HR6A 1CFQB 3B9KD 3HE7A 5D5MA 4ENED 3MOAH 4ELMA 4DOHE 2ED7A 5HI3C 4EOWL 4YLQT 4HT1L 3FQNB 2R0KL 1VFAB 1ES0A 1SJHB 1OSPH 3BE1L 3BOVA 5EZJA 1EZVY 3FCTB 5ITBL 2VXVH 4AY0A 2G9HA 5E7BA 2R4SL 5TE4L 1T6VN 4HUKB 3PXJA 2QHRH 1J0YA 4MZ2A 3S88L 1W0VA 2A73B 3PUCA 5H94B 2NNAA 4BUHA 1ZTXL 2DKUA 1WBZB 3V6OA 2ZCKH 5DUMH 5CJXA 2NYYD 2BOCA 3K3QA 3VXQB 1G7PA 4YDKL 4IHOA 4QEGA 5TH2B 5KVDH 4PB9H 1A6ZA 3RWCA 4ZUUB 2MJWA 4HH9B 1X5XA 1S7WB 3P73B 5I74C 4HUUB 5MENA 2H26B 5BV7H 4Y4FD 1XAUA 3ZE2E 5BMFH 4ZUVB 1ZT4B 3QNYA 3P4NB 1UJTA 2ZZUT 4KJWC 4O02H 4LVOC 4NN7B 4ERSH 3BSZL 3AB0C 4AM0A 5F1NB 4XCYA 2UZIL 1P7QA 3D2UA 4LKXA 1JL8A 1U0QA 1JHLH 1FZJB 3QB7C 4FTVB 2AV1B 4U1IA 2AV7A 1C5BL 1AGCA 3VXMA 4QHNB 4MJIB 2ICWJ 4HKBB 1SYVB 4P5TD 4JKPH 1DSFL 3BRDA 1GZQA 2KH2B 3QCUH 4QRSB 1O5DT 4OM1L 2I60H 1BQSA 4PTTA 1K4DB 3UTPD 3L5WB 1IEBB 1TXKA 3BUYA 5J57B 1C5DB 4PJ5D 4UT6H 2QJDA 3IDIB 4DUXA 1FNSL 3H3PL 1IT9L 3SKMA 5F6HI 4QT5B 2H32H 1J9CT 2C3GA 3KHQA 3MCKA 2XZZA 3SJVE 4LLMB 5I8OH 4Y7MA 1F11A 3TZVC 2DQHL 5DJ6A 3QP3A 1RHFA 1P6AB 4NO0B 4CJ1A 3TPUB 3ZKMD 4MWFB 4MAUH 3VRLF 2FBJH 4U6HA 4ZPVB 3MFFA 5DK2A 2F5AH 2XN9D 2QKIB 5L2JA 4PRHD 1TFHA 2FHBA 4F7EA 3QIBC 1EXUB 1HDMA 2YWYA 4GO6B 3C2AL 2GUOB 5L2KE 1UKTA 1HQ4B 5MHSD 5J56B 3KPRE 1UWGH 4OD1L 3Q5YA 4MNQE 4P2CG 4TUKH 3DMMA 5LGKA 1QRNA 5INCB 1IGFH 1YN6A 1NUFA 3RL1B 3KPSE 2UZYB 1Z5LB 5EWIL 1YEFL 4UTBL 3CFEA 4X7TA 3OKNB 5C0BD 2EO1A 2LVCA 1YNKH 5IHUL 1MPAL 3WS3B 3QIWB 1B0RB 1AGFA 2FGWH 4I3RL 4Y88A 2VL5B 2WUCL 5E5MB 3RGVB 4XT1C 7CGTA 3RX7A 2HVJB 4YHMH 5GRZA 4IIQA 8CGTA 5F1OB 5B4MC 4CJ0A 5JOFA 3GKZA 5IR1A 1TJGH 25C8H 5DQDL 1MVFA 5HGDA 3SGEH 1S9XA 3E6FB 1C8PA 5K9OA 2R4RL 5JIHA 1T0NA 5D70H 3PP3K 4CADA 3UTTD 4GSDH 4E41B 4Q6IA 4U1LA 2FX7H 5FYJL 1JPFA 2HH0H 3HAEB 4URTB 1JYVA 1F4YH 4NRXB 4LCUB 1YPZA 4GG8A 2MMXA 4X5XA 3BGFC 1PEZA 3C5ZB 2DMBA 4Q9RH 4OLUH 3BIAX 2PYFA 3VI3F 4RRPG 4CN1A 4ISVB 4P3DA 5DD0L 4FNLL 4ODUB 1I4FA 1IM3B 2LAGB 3HUJF 5TGBB 3OJDB 2C9AA 4NKIH 3ZT5A 4FQXB 1L0XA 3RL2A 3BQUA 2CRMA 3T0EB 1J1XH 4MS8C 2HTKC 1KIQB 3AY4C 3CDYA 3NFSL 2VAAA 4NUGH 3LIZH 1S5HA 4MAYD 2PO6D 1V7ML 4V1DD 1KFAL 2NY2D 1A0QL 1OTSD 3GSOA 2XACC 1KLFA 4D0DA 1OGAE 4KXZH 1TPXB 1R5VA 4I48A 2FNBA 4XC3H 4F3FA 2VLJE 2ITDA 4JAMA 1VB9A 3SE9L 3K46A 2ZG2A 4NQEE 4OBSA 3ZLQC 4NPYA 1ZEAH 3VFRA 5CD5D 5KSAC 2IAND 1Z3GL 1MCWM 3KXFA 4Z7WF 1FNGA 3ARSA 4FQLH 2PXYB 5MEPB 4GG6F 4X6DF 5ERWB 4JFEA 4KTEH 1WIOA 2A2QT 3RNKA 3GJFB 3LKNA 2PCPA 4APQA 3O3EB 4GLRH 5K9JH 5GRWA 4PJ9C 3NAAH 1KPRB 1SY6L 2GCYB 1MCCA 4L4TE 1R6VA 1T4KB 6FABH 2HT2C 1NC2D 1PDKA 3MRCB 3KHOA 4BSWA 2K9UA 5B22A 5C9JA 4YXKL 2AJXH 3HRZA 5IQ9A 1XR9B 2E27L 3EOAA 1REIA 2VE6B 2P5WE 3RAJH 4PRAB 3F62A 3RWJA 2R9HC 4CU7A 2CKBH 1MCSA 3JV5A 4NJ9H 2W0KA 3HG1A 1IGML 1CIDA 5EBLA 5DDHB 4H20L 3ROOB 1LDPL 4JANB 3MRNA 1GGBL 2V2XA 3ABZA 2H32B 4DN3H 3WD5H 5C0FA 3CH1B 4F37K 4JY4B 3L5IA 3VXPA 3MNVA 4RGMC 1NBZA 1A7BA 1FIGH 1OCWH 3ARBC 1RVFL 5A2IH 1OAYL 2JCCB 4MLIA 1PZUB 5ITFB 1T1WB 2G60H 3NACL 1OQOA 5TFSH 2QSCH 2DQDH 3QDGE 2ZUQB 4JO3L 4M6NL 1X5HA 1IE5A 4JY5L 4OB5L 3IFOB 3DXAB 1WZ1H 3MJ9L 1A7QL 4TOYH 3ILPB 3KS0J 5DO2D 4QRPE 2ZNXA 3V4PL 1DVFC 3K81A 5I16B 3H9SD 3E6HB 1JRHI 1OY3B 3U4BH 3A67L 3KPLA 4WTWA 5EFIA 2FEDC 2Q7YA 1WIPA 4JRXE 1FG9C 5DRZA 1YEGL 5LGHH 1LE5B 3CVHH 2PR4L 4PJEF 5EN2A 2OR9L 3UDWA 2Y5TB 2P8MA 4P9ML 1FN4B 1HNGA 3MRGA 3O41A 3ARDD 4NZUH 3VFTB 1T1XB 2V2WA 2EYTA 5C09D 5ICZA 5L6YH 4WY7L 2VKXA 4JREB 3U7WH 1BJMA 4ZS7L 2NY1C 1P9MA 4R90L 3S35X 5FUZL 1H15A 15C8L 3JV4A 1YY9D 2I5YL 2WUBL 5I19L 2DQTL 2EXWC 5FO8B 4NQCD 4NC0B 1GOHA 5DFVD 1ES0B 1AIFB 5EZJB 4KRPC 5SWSE 3P0VL 43C9B 3D85D 4CAGA 3D3VB 2ERJC 3WS6A 3MMEA 1S9YA 4LSSL 4EN3D 4CNIA 2CGRH 4OZFH 2D3VA 2P4AB 4P3CH 4QKXB 4HXAL 3FT3A 1EMTH 1JGLH 1W0VB 1DANT 1JWMB 1INDL 5DJXA 4XNMB 3IXAA 2OK0H 3OX8A 3GBNH 5LJYH 1L7TL 3TBVA 5DR5L 2BOCB 2G5BA 1HSBA 3TT3H 1X44A 2DI8A 1KGCD 4WI8A 1TJHH 1LD9A 3EZ8A 4XP6L 3BIKA 3QNYB 3K8LA 1CS6A 4Y4KD 2APFA 2CXKA 4UNUA 4G7YL 4X4XA 3MNWA 4AM0B 1MCDA 2Y07L 3EYFB 2J2ZA 3D2UB 4LKXB 5JUEH 1HILA 3V4VL 4U1IB 3U9UA 2AV7B 1IAKB 1AGCB 1TETH 2GSGA 1FFOB 1MCOH 3BJLA 4WFHD 4JFZL 4PY7A 3ARQA 3C08L 1MFAH 2MCG1 1GZQB 4PJ8A 5EU6E 3EYSH 5TE7L 3BW9A 3TP4A 2C26A 2EDDA 3PWJA 5DMYA 5JDJA 3W5MA 2JTDA 3BUYB 1J0JA 1HXYB 3NGBC 5LBSL 2NXZB 1CICA 2FR4A 4MJ5B 4PUBL 4RMRA 1GGTA 1ZS8B 4PLJC 5BRZE 5F21B 4ODTH 5DHVA 5E2JA 5CBEA 2QQKH 4J3UA 5DJ6B 3ARVA 3MC0A 4OGAD 1I1FA 5H2BB 3VGBA 5EU4A 4M6OH 1FBIH 3OKOB 4U1GC 5HGBA 4HS3B 2Q7NA 1FZMB 2A0LD 1KJ2H 1KXTB 5JXAL 3SOBL 5E70A 5DK2B 1CXFA 4KRLB 2DDQL 3LEXB 3WMSA 4C59B 1HHGB 5IIEB 1LP9A 3R06B 1R5WA 3N85H 2GFBA 5HYJD 4HXBH 3WE6A 3TO4B 5LXGL 3D39D 1QRNB 1MFEH 4MNHA 5DJDA 5HHOA 2XQBL 5J89A 4K7PL 3D5OF 2A6DA 2AABH 1I7RA 3RHWF 3UC0H 1UCTA 3O6FC 3CFEB 4X7TB 2VABB 1N59A 3TCXA 3VWKD 3QJHB 3HRPA 3O0RH 4PRBA 1WCBA 4GRLA 2ZP0T 4OTXH 3HE6C 1AGFB 2JJTA 3GBLA 3WXWH 5KSBF 2DKSA 1H3PH 4X7EC 1QKZH 2FEEL 4MDIB 4Z7OF 3VWJD 2NY3C 1P6FA 4NHCL 4OZGE 3OKEA 3S4SA 2VZ3A 1EO8L 3O3DA 4NGHL 2FGZA 5HGDB 3O9WC 4G8EA 3CVHB 5K9OB 3PGFL 2LU3A 4KFZC 4Z9KB 4JFQA 3Q5TA 3RTQC 4CADB 1Z9MA 1KN2L 4LU5L 2DYPD 2XPGB 3R4DA 3VI4E 3MRKA 4CKVX 4IMKC 1NCBL 4HFUL 2SEBB 3MACL 3QFDA 1YPZB 4G9FD 1S9KC 4YUEH 5DRXA 5CJQL 3TJEH 2B7DT 5ANME 3U83A 4BKLA 4ZNEA 2PYFB 5DMGD 3DBXA 2YC1A 5DHYA 5T3XE 1A6TA 1I4FB 3W81A 1DBJL 3QDHA 3WUZA 8FABA 1OAKL 5E1AA 1KLGA 2NXYB 3RL2B 2XG5A 4QXUH 2F54E 2DQEH 4OZHF 1MIMH 1UM5H 2A1WH 1S5HB 2VDOH 4G6JH 3QZWA 1NGZA 1N3NA 1M71A 1BD2E 4LFHD 4ZOCA 4D0DB 5HVHB 3KYNB 5IEHA 5DMJB 1G1CA 3BUTA 4JZJC 5DJZA 2L7UA 4I48B 4F3FB 1WEJL 2ITDB 4JM2A 4BFIA 1KT2A 4JHWH 1B3JA 4Z7WA 5D2NC 1E6OH 5EOQH 3VFRB 1BVLA 4X6DA 1XF1A 3QXWA 1FNGB 2P5ED 5CIPH 3C8DA 1T89C 3O81A 2EDJA 3S36H 3I9GH 1G9NC 5DD1H 3C60A 1D6VH 1OPGH 2J3SA 3DLQR 2G75A 2HRPH 1CQYA 4JZOB 3KLHD 2F53D 3FB6A 3Q3GB 2YPLD 2LTQB 2WZPD 3GSRB 1YEKH 3HLAB 1CK0L 3QI9C 3T0BA 1TQBB 3L3DA 4YE4L 4HCRL 1RIHH 3ZDYE 4M7LT 1F4WL 2X4RB 1X5AA 3U30C 3D9AH 2ITCA 1NJ9B 2X1OA 4JJ5A 4OKVA 2YK1H 2OL3H 3HRZB 3LN9A 3W82A 5I1AA 2Y36H 3HI6L 4LGPB 3UPRA 1IILE 4P2OA 3BKMH 3NIGF 4FG6C 5GS0C 4DN4H 4QGTA 3ZDXE 5TPWL 4PBXA 4XWGH 1FPTL 3ELAT 1JK8B 4DEPB 3ULVC 3HG1B 1UCBH 3MSPA 5EBLB 4N0UE 4JFHE 1A6VL 1F58H 4KAQH 1YZZA 1H0DA 4RFOL 3PHQB 3QUML 3F7VA 1OF2A 4GW5B 4U1MA 1G9EA 4CDGC 1FNEA 1NBZB 4WCYL 1YDPA 4FQHB 1QFWM 5HHQA 1AR2A 4GMTH 2FH8A 2AEPH 3MGOA 1CU4H 1QEWA 2R1XA 4LLAA 4S0TD 3ZHLA 4ZAKC 1KJ2B 5LQBH 3DX8A 1MEXL 4POZD 5EB9A 2DQFB 4K23L 5EPMA 5D7SH 2BSTA 4HUWB 2MQCA 3U36B 3LN4B 2JELL 3QUYB 1VPOH 3RU8H 1CDYA 3WJJA 4M43H 2HTLD 3QQNA 2DMCA 4O51A 1ORSA 4KKBD 2E6JA 4XMKL 2DAVA 3VXTA 2VDRH 1T83A 3KJ6H 4FABL 1V3MA 1Q9LA 1FSKC 3FB5A 2XWBB 1BVZA 4QHKJ 4PJEA 2FCBA 3KPLB 5DTFB 4PJHE 5EFIB 1XIWD 2VTFA 2Q7YB 5E9DE 2XQYK 1Z9SA 4FFWD 3MRDA 5EN2B 1NEZG 4LRIA 4JVWA 4LLWA 3HHRB 1XGQA 4J6RH 3O41B 2R0LL 2VLKB 1OARH 2Y72A 3QXDA 4NWUH 1B0GB 3ES6A 3I85A 3ZKNC 4M1DH 3LSOB 3VG0L 5E95B 3TH4T 1JUFB 5JPMA 1H15B 4HWEH 3WBDA 2VXUL 1N6VA 2YRPA 3S37L 3CFJA 5F72S 1U3HA 4Y5YC 3WIIH 12E8H 4A2MA 4GKZA 3GI9L 2CPCA 4QRRA 4U6VL 5E8EA 1J5OH 1BP3B 2VLRD 2CLRB 3B3IA 3WHE1 2ZCLL 3ARGC 4ZO9A 3RI5K 5DD6B 3MMEB 1S9YB 3RBSA 5FGCE 4ZDHA 2E3VA 1U9KA 1I8KB 1KCVL 5GQBA 3TC9A 3BAEL 3PWPE 3TVMB 4IOFC 2H1PL 1IGIL 2FHCA 1X5JA 3IXAB 4OCMC 3C09B 3QUZC 4M62H 1GHFL 2M1KA 4LSQL 2GJ6E 3DX9B 3G5ZA 5D1ZA 4ZO7A 2QV2A 3UX9B 1KIUA 4YHZL 1HHHA 1JPGB 1CXIA 2XNAA 3W9DA 1NGXA 3P9MB 5D71H 3PQYE 1YYMH 4ORZC 5BOPA 2CJUH 3KPNA 4XH2A 3BIKB 1RAMA 3PWUA 2J1KA 3BX7C 1JZ4A 4HIXH 1MCJA 3BZ4A 3R8QA 1KELH 4PJAE 1ZLWH 4NQXA 1NAMH 1EEZA 5JQ6H 4YO0B 3CFBA 1CGTA 3B2UD 1XF2A 4W6YB 1H9VA 5CIPB 1HILB 4M61B 1PKQA 4DVBA 2GJZA 1MF2L 5CINL 5FCSH 3ZSTA 5FYKD 2GSGB 4IRJA 4PY7B 2KZWA 4ONHA 2I24N 2D0GA 3SDCA 4OQTH 1EBAA 3GHEL 1WJ3A 3QEQA 2HJLA 3PWJB 1M7IA 4PJXE 2EZ0C 5IROA 4OIAA 5FO7B 1QSFB 1R3LA 2Y23A 4KKLD 5D7IA 5KVFH 2W9DH 5FCUL 1JNNL 1KTLA 4HIJA 5J1SC 1CXKA 3KPSD 3NCYS 2P8PA 5E2TL 2FR4B 1BQLH 1PSKL 2C3HA 1KJVA 2K1MA 2Z8WC 3F6LA 4WWKA 5HGHA 2Z31A 1RZKL 2DD8L 4PV9A 3C9NA 2ATPB 3JZ7A 5DHVB 6CGTA 5CBEB 5IBUG 1QSEA 5IHZA 3IDMB 1I1FB 5HBBA 4XX1G 3RY6C 1MQKL 3BESR 4CVWA 5IQ7L 1OAQL 3ARED 3VFUA 3GMPA 2Q86A 1F2XK 5HGBB 5BQ7B 5E24E 1BFOA 2JB5H 4LMQI 1SMAA 4LPVA 1URLA 2ESVA 2K3TA 3LAFA 3RPKA 2F8VA 4YXHL 4YBLB 1U8PA 4YNYB 4Z76A 4MX7A 1LP9B 5D2NE 3MZTA 1R5WB 1FC1A 2GFBB 2Y9RT 2YMXH 2VDLH 2W9LA 3WE6B 1ZWIB 4KTDH 2Z35A 3DO7B 3V0WH 1H8OA 4H8WL 3MV8D 3VFNA 1R24B 4M1GH 1R3KA 4MNHB 3PGCA 2OTWA 3SO5A 3PL6C 1D6EB 3SBWA 1I3GH 1I7RB 1MJJB 2Y25A 2B1AH 4K3JL 4OFVA 1N59B 4U1KB 3KPOA 5K9KA 3AMKA 3O2VL 3O2DL 4B41A 1QPPA 3LH2H 3O11B 4JHZA 1INQA 4G5ZH 2VRAA 4NN6B 2KL6A 4KUZH 5JQHC 4WJ5B 1JHTA 4OAWA 4DTGH 2ENYA 1YN7A 1NH6A 3NPSC 1DQQA 4PJGF 3MUGA 3KYMA 4JFDB 4G8GE 1YMHA 4WW2B 4XVTL 5ILTL 3WLBB 1QG3A 3C8KA 5IB1B 5T1LD 4AZ8A 4NQED 1HNFA 2EDRA 3T0DA 1Q9WA 2XI9A 1RURH 1FAKT 3QFDB 5E5RB 2R0ZL 4RGNE 4OIIH 5DRXB 4HWZB 3E8UH 4LF3B 4WHTB 4PREA 4RWYH 5J3HD 5AWNH 1YEIL 1A6PA 5CZKA 4YC2B 1TZHA 4RCAA 2MHAB 3B9KA 3GK8L 3ARFD 4IRZL 5GGTH 3EOBA 3T3ME 5HYQA 5DHYB 3BP6A 3FFCE 1A6TB 3MZGB 3L3GB 4OBRA 1J8HE 4JO2L 1Q0YL 3MV9B 8FABB 4ODHL 5GJSL 5F1IA 1NMCB 3MODL 4UB0L 4W4OC 1RZIA 4WI9A 1UQSB 1IC4L 5A2KH 1HIML 3EYUL 4NSKB 2EDTA 3LN5A 3B4NA 4P2RD 1RJCA 3GGWB 3QZWB 1DQJB 3K2UH 4MXVF 1M71B 1LE9A 1KOAA 1AY1H 3K2MC 5FHAL 3SDXE 5IEHB 4PGBB 4KC3B 5DJZB 3G6DH 1PG7W 5JHLL 1XGTA 3FQTB 3NCMA 4JM2B 1KT2B 3GNML 5CEZH 1OD9A 4GRMB 2IPKA 3MRPB 1MY5A 2YKLL 2WQRA 3K1KC 4NDMB 4PRPE 1NCWH 3EW3B 2E7MA 3VJ6A 1CLZH 1CDBA 5CZVH 3ETBF 4I9WE 1YA5A 5DVMA 3ILQC 1T80A 5FGBC 1G6RA 3QCTH 4YDIH 5D96C 5ADPL 3W0WE 3CZFA 3FB6B 3ZO0A 2AK4D 5IJVB 1LHZA 2IAMB 4FXGB 2Y1VA 1JWUA 3L3DB 4NFBA 4KJWD 3QDGD 2FO1A 5FK9B 1I1AD 4GQ9H 3TN0A 5DMIL 4JJ5B 1N6UA 1E4XL 4OKVB 4FQ1H 1QLRA 2YWZA 1A9BB 4I0PD 1L7IH 4WWID 4WFFD 3U0PA 3QYCA 4LEOB 5IESL 2NY4C 5L9DL 5DRNB 4YXLL 5ISZB 4M7ZB 4MNGE 4AL8H 5BXFB 3P30L 4JRXD 3OB0H 1PQZA 1P7KA 1U8MA 4HDIA 4JG1L 1JRHH 3F7VB 4U1MB 3A6CH 2WMPA 4OKDA 5C2BL 2ZUSA 2VISA 2B4CC 3I6KB 1YDPB 4U1NB 4PTUA 3MBED 4FFZL 3DX8B 1F3JA 5EPMB 3ZYJA 5HVWA 4S11A 1P4IL 4YPGB 4TTDC 3RX8A 2BK8A 4IIQC 2ADFL 5TF1L 4J4PA 4XHQA 4Y4HC 4TULL 1J1PH 5GRJH 3SDDA 2VR5A 1ORSB 3MLTA 5BS0A 1LO4L 3VXTB 5F9OH 1R0AH 1XF3B 4KJPD 4IBLT 5B21A 5I1HH 1FNAA 1CE1L 5M7QA 3VXSE 1TZGL 5SV3A 3FB5B 2M8XA 1J0HA 1YMMA 2N4IA 3HZYA 4P59H 1DBKL 2D9QB 3BN9D 4JPWH 4BFEA 3SEPA 3UROR 4L3EE 5E1HB 3MRDB 5T3XL 4KQ4H 3PV7A 1Y6MR 2Z0BA 3H3KA 3SE3C 5FXCH 4R0LB 1OWWA 2VXQH 2W07A 3QXDB 4WI6A 2EO9A 1HKLH 4NOBA 1TVHA 5I6XB 5HHVL 4NNPL 4M1CC 1T2XA 1WBYB 5LG1A 3CVIL 1FVEA 3HR5A 1YNLL 1KACB 3FB8A 5KVEH 3JBG7 5JPMB 2QQQA 5HHNA 1HK6A 1CD8A 5TDOB 1RUAL 2V17L 3CFJB 4K71C 2Q3AA 4GKZB 4QRRB 2IMNA 4OLXH 5E8EB 1DE4A 2QTEA 4P4KD 2FEEI 3OGCA 5DT1H 4TRPH 3S34H 1UXWA 1KCLA 4QOKE 4Z7UA 5K59F 2GYSA 2XV6B 4HK3J 4ZDHB 3GIVB 1S78C 2AI0L 3LKPA 5F96L 4U4BA 3I75A 4PGZA 5I8KL 5T1DL 1QA9B 4L4VA 7FABL 1DQTA 3MA7A 5HJ3A 4MCZA 1H5BC 4Y5VC 1ED3B 2DWDA 2ICWI 4YHLH 4Y16B 1FJ1A 2O5XH 5F70A 3G5ZB 1JVKA 2D03H 5D1ZB 3W39B 4WU7A 3RPIA 4JDVA 2EYRA 2UY7A 1HHHB 4UIMA 4X8JB 2N56A 4JB9L 4WFEE 1ZHNB 1NGXB 5K33A 3KNBA 4G6MH 4MAYA 4PJFE 1FL3B 3DROA 1QACA 2P46B 4OF3A 3UJJH 3QDMD 4MS8D 4A6YL 4GBXA 5CILH 4ELME 2ATKA 3B5GA 1T2JA 1U8HA 2GK0A 1CLOH 4NQXB 1EEZB 4PJDF 2A9MH 3CFBB 3X13B 3O45A 3IXTB 3B6SA 5I1EL 5A2LH 4GMSH 4MA7H 1BFSA 4DVBB 2GJZB 3CFCH 5CSBA 1CN4A 5B3NA 5JR1H 4U1SB 4U6TA 3TWCL 4IRJB 3LS4L 5B38G 3CNKA 4ONHB 3RVUC 2GAZB 4LSTH 5KVGH 4WFGE 3QEQB 1EEYA 2HJLB 2ZJSH 2QADB 1M7IB 5FYJU 1NDMA 5D7IB 5C08B 2E6PA 1KTLB 4HIJB 4LDEB 3VXOA 2HKHH 1RZ8B 2J8UB 4JLRB 1E28B 3T3PF 5CUSH 5EUKB 1JCKA 3NFPA 4P2QA 3VFPA 4WWKB 5HGHB 2HMIC 1HXMB 3H7BA 2YOCA 2DRUA 1RIVL 2GTZA 3C9NB 4PV9B 5MENE 4WW1A 4JFXA 4OM0L 4K7FA 5B3JE 4EI5C 1QNZL 3BN3B 4Z0BH 3VFUB 3WJLC 2NX5D 1BBJB 1G9MH 3DYMA 3GMPB 2Q86B 4QHMB 5CJ5A 1LMKA 5FFLA 2ESVB 1OSZA 4QXGH 2WINB 5IWLA 5IBTH 1JPTH 4K3EL 1ZT1A 1UA6L 2HFGH 4Z76B 4MX7B 4M5YL 5F88B 3RJQB 3TA3C 1B88A 3NBNA 1WZMA 3PNWA 3VFNB 3O4OB 1VDGA 2HWZL 1R3KB 4KK5D 2JK5A 3PGCB 2OTWB 4PG2C 3RIAK 4P4RA 2AKRB 2BVPA 1K85A 4KK6C 3KPOB 5T3XD 4O4YH 1SM3H 4O5LL 1J88A 2QQNH 1Q8MA 1D5BB 1FH5L 1T03L 2AJSH 1P9MC 2F54D 3MRFA 5IG7B 4MJ2A 4PB0H 4LVNC 1K8IB 2WBJA