4NN6C

Cytokine receptor complex - crystal form 1b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
182
structure length
163
Chain Sequence
TVVCHDLETVEVTWLSLEFRYGTGALQPCPRYFLSGTSGCILPAARAGLLELALMVFKARQRASAWLKPRPPWQVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPVRCYDFRVRASPRAAHYGLEAQPSEWTAVTRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Thymic stromal lymphopoietin
publication title Structural basis of the proinflammatory signaling complex mediated by TSLP.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 163
sequence length 182
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn6C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn6C01
1J88A 5I8CB 3E3QE 2DQJH 5EO1B 3OAZH 3B2UC 3NFSL 3EOTH 4NYLB 1JZ5A 5DVLA 4OUUA 1E4JA 1FL5A 4NRZA 2O5ZL 3WXVH 4CRPA 1FVCA 2XN9A 3MV01 3QRGH 4MQXD 4NC1C 4WI6A 5FYLE 4L3EE 2PXYB 1A7NL 4YWGH 5E8NA 4R96B 1R0AL 2X70A 2AKRA 3EDEA 1XEDA 4PP2B 3VG9C 4E42A 2KKQA 2GJJA 4WIQA 3LKQA 3P9LB 1FAKT 5I8OL 2YSSB 2ICWJ 5EG6C 5KSAC 3FO9B 5ITBL 1MCBA 2NY6C 2NW2B 1D7FA 1GIGH 2G75B 4YHOL 3W5MA 3CFDB 1FGVH 2NW3B 1EEQA 4OCSH 1IAIL 3V6OA 3NCJL 3SDDA 2A6DB 4DGIH 4BUGA 3ULVH 1UM4H 3P0VH 3V95A 4OCYL 3DVNB 3GIVB 1AKJA 2DYPA 2BXYA 4BZ1L 1JV5B 3MJ8B 2J8UB 2M8XA 4Q9CA 3LAFA 3GMQB 1P4IH 3AAZB 5DJZA 5H8DA 5C9JB 3D9AL 4RMUA 4QXTB 5EZOH 4JJ5A 3UO1L 1DQQB 3OQ3B 1MEXH 3ARBC 5F93C 2DF3A 1S7RA 2BHYA 4P23B 3F58L 2JJSA 1KTLB 2D31B 3G6AA 4K23L 3VGDA 3EYFB 4KHXH 2Z92A 2X1OA 4OM1H 1BM3H 3ARUA 3HLAA 4OJFH 3TJEH 1TQCB 5F8RC 2W0PA 4ZPVA 2EDBA 4JPVL 4U1NB 4U2YA 3J8F7 2FR4B 1A3QA 4UOW0 1A2YA 2XWJB 1UJTA 5DJ6B 2EIEA 4GLRH 3BPNB 1YEEL 1S9WB 4Y0GA 3U7YH 3WFCL 5HVGB 4LPYA 3T04D 4X6DA 1XGPA 2EE9A 1JL8A 3MLZH 4G6JL 3AM8A 4QOKE 5I1GL 3IKCB 2MCPL 3NMEA 1F8TL 1JZ3A 2G9HB 4LGSB 3IS0X 4XBPB 3FQRB 3W2DL 1I3UA 4XMPH 5KW9L 2W65B 1M71B 4FMFA 4HJGB 3SE3A 4L8SC 2O5XL 2V5RA 4X7EC 1DDHA 4HQQH 4HXAH 2VXTL 4YZFE 3DURA 4Z77B 4JZJC 4JG0H 4OF3A 4HBCH 1T3FB 2BSSA 2QSCH 4WUUD 1OP3K 3CFKB 4X83A 4CU7A 4W6WB 3RKDC 5D5ME 3H0TB 3WEXA 2L0DA 5C6TL 4ZXBC 1R24B 2IMNA 3CC5B 4JFXA 2V17L 2WNGA 1AGDB 2EDYA 1U3HA 2Y36H 4G7VH 5EOTB 4LQFL 5J4MA 4U6XA 4XWOD 4NJAH 1N6VA 4KROD 1S5IH 4XXCA 4QYOB 3DX7B 4RWYL 3BXNB 1FJ1A 5EU4A 1G6RL 1M6OB 3D2UD 5I74B 1MJ8H 1QVOB 2X4OA 3VXSA 2R1YB 2H32A 3BQUD 3CSPA 4NKIL 4U1SB 3UDWC 4K2UL 4KZDL 3ALWA 1NL0L 3SHSA 2R23B 3KPOA 1ZLVK 5IG7B 4F9PC 3RGVB 3LEXA 4OZHF 1BPVA 1XF3B 5EUKA 1MRCL 2OTWB 3TYFA 4NQDD 1BIIB 1NANH 1HI6A 2EKSB 4ZUUA 1I3RB 5EOCJ 2YD9A 3G5VB 2D7TL 1QQDA 2C3GA 1IARB 3LRHA 4PD4J 3A6CL 3P4MB 4EXKA 1RFDH 4F2MA 5CGMA 1QRND 3CJJA 4CU6A 5FYKU 3QWRD 1R3KA 4KK5C 5EUOF 1U3YA 1LP9F 3QIWB 1YN6A 3S36H 3O9WC 3HC4H 4M62H 4XCEB 3EDFA 4WEBL 3H42L 3EOBA 3GSVA 3MOAL 1FH5L 3G6DL 5GRWA 4OCNC 2R15A 3IVKA 2JB5H 1K4DA 5T5NG 3QFJB 4R3SB 3FMGL 4KPHL 2XT1B 3OKLA 4M7ZB 3EJZD 3KWWA 2HAZA 5JQ6L 5ANMB 4GRLD 5BMFL 1J8HB 2BRRH 5FK9B 2IANE 4PJEE 1VKXA 1HK6A 4N0CD 4XNQB 2YA2A 5J6GB 4YO0A 3MXVH 4WUUB 4G9FE 5EORH 5B3NA 1J5OH 4KI5C 5CILL 1HH9A 4P2OC 1GZQB 1Q8MA 5GGTA 2YS4A 1LD9A 3VGFA 4EN3B 3RU8H 3RNQA 2BNUB 3RAJL 5EIIB 3LKSB 2BY1A 1XH3A 2UV3A 3CSYA 4TSCH 3VMNA 2L7UA 3QUZA 2SEBB 1PZ5B 3QCTL 5JOFA 3VXUE 2H2PD 3BPLC 1QBBA 4JJHA 3D2UB 1AGFB 1QACA 4OZFB 4AENB 1U58B 4XT1C 1P7KB 2PYEA 3GMPB 4H25A 2RBLA 4LBEB 3SQOH 3GSXB 4MAUL 3QEHA 1GOGA 5T3XD 4KKBD 5EZJB 4Q6YA 4Q58C 3LKRA 4G7YL 5B8CC 3QUYB 1BLNB 3CFBA 2QHLA 4QTIL 4LF3A 5L7XL 3T3PE 4D0DA 2D4FA 1RPQA 4GRWB 4S1QH 1KJ2H 15C8H 5FEBA 1T2JA 1ORQA 3O3UN 1NC2B 2A83B 4NQDB 4JFEA 3WNLA 3MNWB 4WTXA 3OXSA 3NVQA 4HLZG 4K3JH 1XIWC 4P5TC 4R2GC 4XPAH 1H3PH 3B9KB 4I2XB 4L9DA 5DJAB 1A1NA 2H3NA 3TFKC 5JW4N 3M45A 1QRNB 2IGFL 5D7LE 4RFNC 1NBVH 4DQOL 1DE4A 3L3JA 5C0RL 1P7QB 3T0EA 5MEQA 4OQTL 1MNUL 2QBWA 2FWOA 4JY6A 5DR5H 4HH9B 4PRBA 4PG9A 1SJEA 4XP5L 2IALA 3A6OA 5A3ID 1Q9WB 4K07A 5IWLA 4AJ0A 4PJ5E 4LCWA 3BUYB 2ADFH 5EU6A 2DIJA 2JKXA 2VDQH 3P73B 4X5XB 5E6IA 2P8PB 4BFEA 3B5HA 5DMKB 1JPFA 5CIPB 1L0YA 1PAMA 1KCSH 1CVRA 3BH8A 1NPUA 1AQKL 1G7HA 1N3NA 4IOIB 4HS8L 3MGAA 1J1XH 2APWA 1LDPH 2VXVH 1G6VK 3DETD 2JELL 4WUKH 4RMTA 3VXQB 1F4YH 2ITCB 3BP4A 4ODUB 5F6IB 3SGKC 4N5ED 5IB4A 1YEJL 2N7BA 4JY4B 2RAMA 3OAZK 5HHME 1I9IL 3SDXE 1NBZB 1KYOJ 1DFBH 3O6MH 4NQTA 3T1FB 2DQFB 4RAVA 5DJCB 4GUPA 2B1AL 4ZNEE 2MHAA 1GYAA 1RZ7H 2YKLH 3ABZA 3D25A 2OJEB 1NFIB 2ZCKL 4UNUA 1F13A 4PJ8C 3WJJA 4N8CL 1IT9L 3FQWA 2X2YA 3RHWF 1YYLL 3BJ91 4L4TA 1CDGA 1J1PH 3RIAK 1EAJA 4RAUA 1KN4H 1C1EL 4HJ0C 2ZSVA 4O51B 3RX8A 1UADC 1KGCE 2XKNB 3H9YA 3QQ4A 3MJ6A 5TH2A 3BE1H 3QG6A 2X1WL 1LE9A 3RX5A 2C3VA 2VLJD 4L8DA 1NKOA 4JREC 5GGTH 2VAJA 1RHHB 3FB8B 3O6FC 1DBBH 3QJFB 1BD2D 4TPRL 5HDLA 3BZ4B 3GBMH 5DJYB 5FCUH 1N0LA 4OB5H 4Z7QE 2X4RB 1QKZL 3U48A 3NCBB 2ZG3A 3P4OB 5JMOC 1OAYL 3AY4A 3RA7H 3UTPD 3HNSL 3BD5A 1DJSA 4G8FB 5EC1A 1U95A 3L7EA 2FX9H 5IHLB 1ZTXL 4XX1E 1JPGB 2CSPA 2VABA 3TM6A 1MY7A 3NTCL 3V52H 4JEGB 1GGIH 3WUWA 1SEBA 5EU5A 1U8HA 3OV6A 4PRIA 3MRPA 2ARJA 4WTZA 4G80B 4OGZA 2AK4A 4P2QB 5DK0A 4MA3A 2DKMA 3VFGH 1C16B 4IRJD 2DMBA 4MHHG 1ZA3B 4MAYB 5CJXC 3OAUH 4IOSD 1IC7H 1INDH 2ZUQB 3DX8A 5B38B 3NA9H 4KJWC 3OKEB 1E6OL 2FBOJ 3S3PA 4ZPTB 1JPTH 2J12B 1B4JH 1CZ8L 1FIGL 3QEQE 3UX9B 4NP4L 1BVLB 2BCKB 1WWCA 2EDEA 1RJYA 1NUFA 1DVFD 4IIQC 2YUVA 4TUOB 5FB8B 2EE2A 4D8PB 2VLME 2VXUH 1F4WH 4NQCD 4TTDD 2XTJE 1TLKA 4F33B 2A9ML 3IFOA 3MV8A 4HKBA 2HLFD 5DS8A 5HHNB 4D9LL 1H3XA 3NZ8A 1TZGL 4X8JA 1MCJA 5IB3A 5F88B 4J3TA 1DBJL 1EJOH 3CVIH 5ISZB 4F7TB 2E9BA 1JUFA 3T0WA 2XWTB 4PJHE 3MLUL 1RK1A 1KLUA 2CKBL 4D9QD 1FORL 1JYNA 4LHUG 5EU7E 4HWBH 2V9RA 2H9GA 3MBXH 4RFEB 2Y72A 3DYMA 3MLTB 1V3KA 2VZOA 4C83A 2RQ8A 4PRPB 4ZG1A 2IBZX 4FFYH 4PJ7A 3TIEA 5F7FA 3QPXL 3L3GA 5BZWB 1EAPA 3WJLA 4RGOL 3LN9A 1FLTX 2JIXB 1A4KA 3PDDA 5ERWA 4YXKL 2DQUL 1JGLL 1EHAA 4KMQA 1P69B 2IJ0C 4WW2B 4OGAC 1DN2A 5MEPB 3HG1B 4CMHB 3KPRD 2Z93A 4LNRA 2QR0B 4LCCA 2MFNA 1VGEH 3V5KB 2H8PA 4B5EA 3F5WB 3R1GL 3SOBL 1KTKE 3DRQB 4HGWB 1YNLH 1N2RB 1LO4H 1U91A 4HFUH 4JGUA 3C2AH 3TNNB 1CGTA 3OKKA 4CNIB 1JTTA 3BRDA 4RBPH 3V9FA 4KQ4L 1T4KB 3CXDL 3MRNA 1UEYA 4D9RE 3BSZL 4ZFOB 3RUGB 2FB4L 3CFCL 4OT1H 3H9SE 4XHJD 4KJQC 5ACZA 2FIKA 3HRZB 2HH0L 4IRJB 2UY6A 3ARDD 4P23C 4X9BA 2YBRB 4XH2A 1CU4L 4DKFL 1I8MB 2A77L 4ORGB 1HHGB 1IE5A 5LGHL 3OX8B 4BQBA 5HDQH 3OGCA 5BJTA 1TQCC 4Q74A 4LMQI 3O6LH 3EAKA 2BNRE 5E2WL 3NIGE 5E1HB 2Q8BH 1VCAA 1RU9L 2P7TA 3BPNC 1QP1A 3IDJB 3MBED 1H3VA 2R56L 2R1WB 3G6JA 1L4IA 3MRDB 3H8NA 3D3VD 3GK8L 5IMLA 3CMOH 5BVPH 4IMKA 5DEGB 2DLGA 3O81A 4XNMA 2CJUL 4LGPB 3GBNL 4Y4HA 5C0ND 1EEUA 4OZIE 4FTVD 2FD6H 4I13B 1RY7B 4KMTL 3IETB 3NH7H 3THML 3EOYG 1HE7A 2O5YH 4PUBH 2HJLA 5D72L 5HI3D 2ATKB 3PHSA 4U1KB 1OD7A 3MRIA 3RIFK 3BESR 3NPZB 3WBDA 1IGFL 3L3IA 4X4ME 4QRQA 2VL4A 4XC3H 1F97A 4L29B 5DA4A 5E7BA 1OGAD 4K3HA 1QR4A 3FQUA 4NZUL 5F1SA 1E4KC 4CADA 3FO0L 4MDIB 4PJDE 5JHDD 2XACC 3Q6GH 1PYWA 3C8KB 4X7TB 4DK6A 3TJHC 2P5WE 4ACPA 3GMNA 4CVXA 1HWHB 1Z2KA 2ZUXA 1BAFH 3NFNB 3JBG7 4OLWL 3RNKB 5I74C 4LSVH 3QQ3B 4LLUA 1DBKH 3PHQA 4XVJL 3JV6A 2HKFH 4KKLD 4MA8H 1IEBB 1OM3H 4ALAL 3QYCA 3IDMA 4LNVA 2Q6WB 1HHKA 3ZDZE 1QSEE 3DSFH 4M7KH 5D6DC 2IWGA 3LZFL 3E1F1 4JFPB 4JCMA 3FRUB 3RGVC 2IAMB 2Z91B 4ODVL 3ARDB 4U3HA 4NQEA 4C54A 1KJ3L 4LKXA 1JNLL 2RCSH 4LSDA 3UJJH 3BT2L 1A6VH 3GB7B 2G5BB 3KG5A 1JMXA 3ZZ1A 3LH2L 3BAEH 1B6UA 2FL5B 3MRCA 1LO3L 3GJFB 4U2ZA 3DTXB 3I84A 3QDMD 3D0LA 3QIWC 1B2WH 1TZHB 2CDGA 3VFNB 43CAA 3HE6D 4AEHL 4KGJA 4KUZH 1ND0B 1RVFH 5GS2H 2JTDA 3MCKA 4Y2DB 2YA0A 1P5VA 1UM6L 3WLWC 1O7SA 4JFFA 2DI8A 3IKKA 4M6ML 1WQVT 1RZ8A 2AEQH 3DECA 4WJ5A 4I0KA 4X6BA 3CIQA 3PWVB 4RDQG 1JMZA 4JO2L 1JNNH 1CDJA 4QRSB 5DT1L 4Y19D 2E9JA 4G8GD 3WFBL 3VFPB 4KUCD 4WHYH 1JWMB 1J0ZA 3GHBH 3KLAA 3U4AA 1IL1B 1ZHKA 3GSUA 5KAQG 3EZ8A 5I1DB 4G6KH 3U4EB 2FX7H 1RJLA 3IJHB 2XFXA 1CFTB 32C2A 3O3DA 2DLHA 3WIIL 4FXGB 3SO3C 7FABL 2EDKA 4ONFL 3GZKA 4WU5A 3LEYL 4BH8B 4EN3C 3IFPB 4LIQE 5ID1A 4I4WB 4OIBA 1DQJA 3DXAB 3TBVB 3T8XA 4F7CB 5GGSB 5H35A 3QQ9D 4HLJA 3CVHA 1I3GH 4QCIA 4ODSL 1TJHH 3EO9L 4GG8B 2Q87A 2BJMH 3Q5TA 3VG0H 3VFSA 3UTTD 1FFRA 3V6OE 5D1XD 1AI1H 1RUKL 1EIBA 1JHKH 4H1LA 1UACH 3RVXD 1NAKH 4XMKL 5AD0B 4JPKL 5JTWA 5DMIH 4DGVH 3QCVH 1K8DA 3BQUC 3LHPH 4X7CC 4JM2B 5KJRH 3HI1B 4JFHD 1LEIB 2C1OB 1Z3GL 2Y1VA 5IQ7L 1UM5L 4MA7H 4JDZB 5AUMA 3X3GH 4M93B 3NIFE 2QSVA 4HWZB 2GSGA 1F6LL 3EO1A 3FHAA 3I50L 2VISB 4YNYB 1PY4A 5DLMH 3OKOA 3LN4A 2R0LL 3C60B 1B3JA 2VITA 3FQXA 3B9AA 3SCMD 3VFWB 4XPHL 5FDWB 1G9EA 4D0CA 2R2HA 1DEDA 1S9YA 3V79C 4EEEA 1KFAL 4JKMA 3HHRB 1F3DJ 4X6DE 3X3FL 3OJDA 3CUPB 3SDAA 3EOAA 1UWGH 4KHTH 1DBMH 1RZGB 4ODTH 3GIZL 4OZFG 2BVPA 4CW1B 1MFBH 2JF1A 1J12A 4LPUA 1HDMB 4PGZA 4OF7A 3V4UL 4LCYA 4V1DB 5IBUG 2DTMH 4YHMH 4F7EB 3LKNB 1A6ZB 1VACB 1QTYT 5LGJB 3EJZC 3O8XD 4G8GB 3OF6A 1A0QH 4GRLC 4QY8B 2XI9A 5KS9A 3VRJA 5IFJB 4JG1H 4JR9L 4LCIL 4N0CC 4PGCA 4RQQB 4NKMB 4WW1A 5EBMB 4XP1H 4ERSL 4A6YA 4PJXB 2NR6D 4MNQA 3RL1A 4DZ8A 4QGYA 1BJ8A 3VDCA 2FBJH 4YJZL 3Q5YA 4Y16A 1VENA 1KJMA 3O6KL 2P8MB 4X98B 5A16B 2EEAA 1FZOB 4APQB 1BFVH 2ITDA 2YC1B 4WVRA 3T4YB 1XR9A 2IH1B 3FTGB 4U0QB 4ZO7A 4KDWA 1ZLUK 5A2FA 5CD3B 1T6VN 1QFWH 3IJSB 3B6SA 2H2PC 4PRDB 3WS3B 3LOWA 4Z7OF 3KPQA 5E8PA 2PCPB 4K9EH 3H9HA 3VXSE 2BNQA 3BW9B 3UC0H 5CWSA 3U2SA 1T22A 4BSWA 5K59F 2HMIC 1VFOA 2NXZD 3EYVA 4N0UA 1DL7H 4I0PD 1RURH 2XNAB 1N59A 2VLRB 4KU1A 4IDJL 5T5FL 1I1AD 4NKDA 1GGUA 1D5ZA 5BS0D 1M7XA 2KUTA 3TPKA 3CPLB 5GGRB 3CFJA 4OZHB 5J9PB 2CLZB 1IGML 3QXWA 3VWKD 3AC0A 4WI5A 4HBQA 5E03A 4Y4FA 1H15A 4KRPD 2OBGA 2E7LA 2A1WH 5IB1B 3CVHH 3HE7D 1PKQA 3QJHA 4WWID 5TDOA 3V6ZA 3KPTA 1Z6JT 3KPSA 4GKNB 3HS0B 3QXDB 4BZ2H 4O2EA 4XNZB 5D7KD 5GGQL 4NQSB 4H0GA 4OSUH 4GRMB 2W0LA 5D70L 5A3IC 2IQAA 4HF5L 2GYSA 3NACL 5GS0D 3VXNB 1RUML 4HMEA 5HBBA 4MXVF 1BQUA 5F7UA 1NCCH 3AB0C 5JDSA 2AVGA 3R06A 3L5XH 4TSAL 3VCLB 1BZ7B 5HDBE 4FZEH 4NZTH 2AV7A 1OD9A 2FLBT 1G7QA 2C4FU 3L1OH 5JXEA 4HDIA 2BSRA 4OGXH 3VH8B 4OLEA 3N9GH 4OLVL 4PTTA 3DROA 4AEIH 2EH7H 5IIEB 5D1ZA 4YXLH 2OTUB 4Q9QH 3DETC 3BGFB 5BQ7A 4ZSOA 2Q7YA 4PJBA 3MRMA 4X5WB 2KZ1B 1TDQA 1TETH 2QQNL 5C0AA 1D9KA 5CS7A 4N5EC 1QLEL 3BKCH 4FQ1H 4HV8A 3U83A 5AZEL 1F5WA 4KDTC 2IEPA 3D69A 4R4FL 2AEPL 4ZD3H 2P5EA 2BX5A 5D1QB 3QT2A 3H7BB 4Q9RH 1YMMD 2HLAA 3MV7B 4M5YL 4J3UA 1QBLL 2L4OA 3A6BH 2X4NB 2PYEE 2NTFB 5DJDB 3PWPA 4NT6B 4JANA 1IZJA 2AXGB 2NY5L 4IHOA 4PRHE 4MLSA 1T20B 3RY6C 5ESVA 2GK0A 4POZC 2NY0B 2I9TB 3NCMA 2EKJA 4J6RH 4TVSa 3JSSA 2VN7A 3VI3E 5IJVB 1KLGB 5D7JD 2YXMA 2K7QA 3IFLH 3L95A 2AXHA 4N8VG 1TQBB 2GEEA 1AC0A 4JFEE 4PJ9B 2DJSA 2FEEL 4X80H 4F58H 4R7DB 4U1IB 3IXTA 2PW2A 1GHFH 4UDTB 4LSQL 4TQEH 5C09A 4DN3L 3VXRB 4FQHA 1MWAB 2VNCA 2VH5L 43C9A 4CMHC 2VMFA 4X7DC 3CSGA 5FA4B 2OL3B 5T1KB 1SYSA 3CXHJ 2DLTA 4ODHH 3T0EE 5GGUB 2DAVA 3UBXG 3QCUH 5E8OB 2KQNA 4Y4KD 4KKNA 1HN1A 1UB5A 4JO1L 4R90L 4K55A 25C8H 5MEND 4ZS7L 1MLBB 5FYKD 4U1HA 3VU2A 1U8MB 4KTYA 3SE4C 2ESVA 4J8RA 3P11H 2R29L 4PJFF 5MERA 2ZJSH 2F54A 4YDIH 2OQJB 1G6RA 1WCBB 5DA0B 5CJBA 4IRJC 4KXZI 5DMGD 4H20H 4XHQA 1MCQA 3TO2A 1P4LB 3HR5A 1QPPA 3ARGD 2DJ4A 4X7SL 1MVFA 1OW0A 2Y7QB 4WI2A 3MRGB 4M43L 3MLVH 5E2VL 5CJOL 3AMLA 2G5RA 1A3RL 1B9ZA 2O5ZH 4FZ8L 1HIML 1D6EA 2NX5B 4E41A 3GSNB 3P0YL 1A7NH 2ZUUA 4XBEL 5FYJU 1Z5LA 5DF0A 1Q9LA 4JZOB 4L4VD 4NM8L 2GKIA 4PV8A 5DK2A 3VMPA 4TTDC 3OXRB 1VGKA 1IM3A 4G42A 5IROC 5INDB 5BV7H 2Z31D 3QNXB 1OT2A 5K9QG 5I8OH 3N1MC 2HLFC 4MD0A 1II4E 2AEWA 2DKSA 3FAWA 4YHOH 1E6JH 3OPZL 2DWEB 1MHEB 5CZKA 1RJZA 1SMOA 1KEGL 2X4PA 1IAIH 1U92B 1I4FB 1MFNA 1MUJB 4LVOB 1X5ZA 2B2XL 1I7UA 2B39A 1QBMH 2VQ1B 1ZE3C 1WBZB 2CIKB 4L4TE 1V7NH 4OZGB 5F9WB 1YJDC 2GTZB 2V5MA 1A02N 3ORJA 5I66B 4LVEA 3R8QA 4XGZA 4BZ1H 5GRZA 4JQVC 3SJVA 3WN5C 4DAGL 5KSAA 1UJ3B 1T2XA 4NJ9L 3D9AH 1EGJL 3HI6H 1QBAA 3G08A 5SWSD 3TVMD 2HJFB 3ET9F 4GW1A 1EFXD 1A4JB 3QDGB 5T1DH 4F9LC 3HB3C 2MKWA 2WUBH 4HKXB 3GEWB 4F8TA 1VFMA 5F1OB 4LQ1A 1NLDL 1MQ8A 2X9XA 3N1GC 1N8ZB 5EBLB 2UWEB 4OFPA 4UQ3A 3GUTB 5C0BD 4K94L 5FAAA 2DDQH 1K4CA 3L7FB 3OB8A 5GPRA 3ARBA 4QRPD 4QHMA 2Z8SA 4I3GA 5CEYB 4H0HB 1ZAGA 2P47B 4MVBD 4PRIE 3BWUC 3CDYA 5CP7A 4G6JH 4FOMA 4NN6B 4WO4D 1DLFL 2AK4E 3W0WA 4HT1L 5AWNL 5I1GH 1UXWA 2DM7A 1KIUA 4XRCA 2I5YL 1U8QA 1TVHB 1L6XA 1ZOXA 3BDYH 4OF5A 3ARDC 1HSAB 4OBRA 5JLZB 4EI5B 3E6FA 2GK2A 2DL9A 2UZXB 4Z7VB 1CXFA 1FNEA 5DURD 1IGYB 1KPUB 5C8JB 3RIAF 1MCPH 5FUCE 3EUUA 2LU3A 2WAHA 1TENA 2B8OT 3Q6FB 4WV1B 4LCUA 2BVQA 1BIHA 2CDEA 4P3CL 5GSVB 3MR9A 5IV2B 2V5TA 3MBEC 2A6JB 4L4VB 1MPAH 3ULVF 1BQHA 3LDBB 2FNBA 4X6EA 3PV7A 4M7LT 2PTTA 4MJ6B 4PJAA 1MQKL 5E2TH 3MV8E 1IC5L 4GW5A 4Y2DC 2ZOLA 4L5FH 1R5WA 2D0HA 1P9MC 5DUPH 5L2KD 4P2CG 3KR3L 4JZJA 1JFQH 1AXSA 4OQTA 3QUMB 1NAMB 1VFAA 4L1HA 3B3IA 1KIRB 5HPMA 5GJSL 1WFOA 1NFDF 4W4OA 4WU7B 2K3TA 4RWYH 4NUJB 5HI3C 3RPIA 1AGBA 5FO8A 4EBQL 1G6RH 3WFZA 4JQIH 2R0KL 4JLRB 5D7IF 2YPKA 4RRPG 4ODWA 5FYLD 3CK0H 4L3ED 5J0BA 4G6AC 4NKIH 1FO0B 1I1FA 3OJ2C 3S34L 4PJ7E 1B90A 1NL0H 2W38A 1IILE 1N5AB 2DQDL 2GI7A 3ZHDA 3HMXH 3MNZB 4GXUM 5T1MA 5IHUH 3RTQB 4MJIA 1SVZA 5FO9A 3B4NA 1HXYB 1AIFB 3QXTA 3TVMB 4ZFOL 4PR5B 3TIDB 2DI9A 3NCCB 1X4XA 1MRCH 3PIQA 4ETQB 3ULSB 4NKOA 4GAJL 1QSFB 4K7PY 3OB0H 1TJIL 2D7TH 1A8JH 1ADQL 1CF8H 5JIIA 1D5MA 1QPXA 2DB8A 1N64L 4QHUB 4KKLC 2OSLB 3MLWL 3ULUL 5C70A 3RWDA 4DGYL 3T0VA 2CIIB 4JM2C 4YEFA 4NO5B 4LVNB 4P2RB 3CLEL 3UTOA 3CZJA 4QRUB 1AO7A 3L3OB 2ZP0T 2NCMA 4ZFFA 3G6DH 4UT6L 3FMGH 2YPLE 2LVEA 1UA6L 3BYYA 3QO0B 2VAAB 5I2IA 2V5YA 4JE4B 3HPJB 3DLQR 4OCWL 2VDLL 3BRFA 2FGWL 5I19L 1IRAY 5MP6L 3IXAA 1WC7B 3IRZA 1YJDL 4OLZL 1YECH 3G6JE 2NXYB 2W59A 1OSZB 2WINB 3NAAL 4Y88A 3V6BR 4NNXB 4HUUA 3FONB 2BMKA 2WIIA 5BZDB 3I02A 5GGVY 3RAJH 4QOKD 5ADOL 3EGSB 1XCTA 3ARED 2OI9B 3ARRA 4FQIL 1UZ8B 3TNMA 4YHIB 3V5HB 5FHAH 7CGTA 2W91A 3RDTD 2EECA 1I85A 3L3HA 4P2OA 3BPCA 4NRXA 3D5OF 3INUL 1UENA 4TUJA 3EHBD 4TOYH 2R2BA 4NNPH 2A73A 4EIZC 2G60L 5F1KC 1CDUA 1Q38A 1TTFA 2J88L 4L3EB 1HQRB 1YEHL 3S5LB 1W0VB 1DLHB 4ORZC 3ZYJA 2FZ3A 3OHXB 1FL6A 4MAUH 3LN5B 4P46A 3C6SB 4O58H 4G7YH 3WHXA 5GQBA 1AP2B 2F9BT 5L7XH 3T08A 1QA9B 1KTRL 4APQC 1I7RA 2AABL 1Z9MA 3QQ9C 4NHUB 3U46A 4LPXA 4MXQD 5BRZA 4EJ1C 5DTFA 4HCRL 2ZCLL 3IDXL 5GGVL 1D6VH 2BXZA 4ZAKD 5FF6B 1NGXB 5D1XC 5DQDL 4DKEH 1YY8B 12E8H 3P40A 2IGFH 4DQOH 5B8CA 5E2JA 5DRNB 4IJ3B 3ARFA 3BIBX 5IVZA 5GGSY 5HGDB 2DQIL 1QR1B 1T0PB 2YOCA 1Y6NR 5F21B 3GKZA 5HHQB 5ICXA 1CLZH 1FYTE 2ATPB 1XIWA 3H7LA 1ACYL 3CFEA 5DHYB 3SKMB 3DVGA 1XF1A 1MCCA 5GS1A 4NQEE 5AG8A 4LFHG 4FXLA 2CKBA 3WFHA 4BFIB 2H26A 1AD9B 4B7IA 3RIFF 5C9KA 2X41A 1WTLA 2ZOKA 2CD0A 4X6CE 4GAYA 3ILPA 5L8KB 4OD1H 1LNUB 1ACZA 1MOEA 4OGYL 3MMEB 4OKVB 4JN2A 4KVCL 4P2YA 3LD8B 4IRSD 1GAFL 1MVUB 1VERA 3BD3A 4XNZC 2JELH 4LMQE 2HFGH 5D7SH 1YEJH 3AREB 4JFFE 1FBIH 3DPBA 3MGOA 1T04B 4HG4J 1KC5H 4UINH 5C08D 3S6CA 2IF7A 5HGBB 1ZGLM 4G6ML 4RSVA 4G8IB 2VSDA 3QIBA 3NIDE 1MRFL 1CYGA 1QFHA 4P5MA 1C5DB 4PJCA 2X4SA 3O3BB 1ETZA 5BVJB 2ZCKH 3WO3B 3SGKA 3ZE0E 2W9LA 5BOZG 5HHPA 4JFZL 2NR6C 2BSED 2QEJA 5CZXC 1EVUA 3VFOB 3EYSL 4Z5RB 2X09A 2HVJB 5D5MB 2N1KA 4UIKH 3SPVA 1C1EH 4ETYA 3HI5L 5HHOB 1ZXQA 4P9ML 2C1PB 3BMVA 1SM3L 4TULL 5CHNB 1EEYB 5EFIB 1KJVA 4JRXA 1RHFA 2ZPKH 5I8EB 5HYQB 1T1WA 1LEKA 3LS4H 3I75A 4FQLL 1GH7A 2I60L 4GG6A 1VEPA 4PGBA 4FMKA 2GY7B 1V3LA 4M6AA 1BWMA 5CEZE 4ZUVB 5EC2A 1GXEA 5EN2B 5MHSD 3JZ7A 2JCCA 3QDJD 3CX5J 4PJGE 2OXHA 4EUPH 4PLJD 1RZKC 1WZKA 2LTQB 1YN7A 2NXZC 4I0PC 1I9RL 1I1RA 4LKCB 4U6YA 2Y23A 1U93B 2OR9L 3NTCH 1D5BB 4HLZH 3KVQA 4G3YH 1Q1JL 1YNKL 5K9OB 1I1AC 5JDJA 4UNVA 1U0QA 4M1CC 1TQBC 1U36A 1FYHB 4PJ9C 5DI8A 1XGUB 5CJQL 4JQXC 2X4UA 4R8WH 1A6TA 3SDCB 5K9KA 4Y89A 1NDGA 4C56A 5K9JL 4PY8I 2WLZA 4PGDA 3TP4A 1LO0L 2XZQH 5JPNB 2AAVA 3OSKA 1S7QB 3S4SG 4HS3B 5TF1L 3MLYL 4G9DA 3VXOA 1CICA 3MJ7B 5GRUH 4R26L 5FA3B 1XF5A 1CZ8H 1FIGH 1Y6KR 4P4KD 4JY5L 5I30L 1TCRB 1JCKA 1A7RL 1E27B 5CJXA 1QNZL 5GGRY 3K1DA 1MCKA 3T09A 4M6OL 4LHUA 1A3LL 4Z9KB 4BFGA 4PB0L 5E9DD 5C0CA 2XQYG 1TZGH 2LAGB 4OIIL 3VE0A 2H1PH 3O0RH 3WNPA 5KS9E 3F7YB 5IQ9A 4Z7WE 1JPSL 1R3LA 2IANB 4PJEB 5SV4A 1FNSL 3BKYL 4IIQA 3NOIA 3IU4L 4WGVB 1L0QA 4YEEA 1HZHH 5CBEA 3C09B 1U6AL 3NPSB 4R7NA 4MNQE 3BGMB 1OSPL 4G9FB 4RGNB 3TCLB 1FC2D 1V7ML 3O2DL 1QEWB 3O4LB 2ERJB 3DMMB 2DQCL 4X8XA 1LEGA 2DQHL 1CR9L 2IG2H 3K80A 3ME0A 3LIZL 1CT8A 1FE8L 3T4AA 3PXJA 1MAJA 5HHMD 4KGLA 4NOFA 5I8CA 5EO1A 1RUQH 4Z7NE 4NYLA 3AVEA 5IGXH 1TVBB 2YZ1A 2A9NL 3C5ZD 4JB9L 1WLHA 4I3RL 1CL7H 3QIUB 3VXUB 5IF0B 4XVTH 2PXYA 3VJ6B 1CI5A 4OTXH 1D5IH 4R96A 2VL5B 2W9EH 4LVOC 2BNQE 3X17A 5BW7C 5E2UL 4PP2A 3V7AE 5I8KH 4QRRD 3SOBH 3HAEB 1CN4A 3BDXA 4N0UE 2PR4H 1JHTB 3VXMD 4ELKB 5LBSH 4XCFH 2AJXL 4AEEA 5CLTA 3FO9A 1UJ3C 2MQ3A 1KGCD 2VDNL 4KQ4H 2G75A 3OB0K 3CXDH 4L1DA 3CFDA 2YR3A 4J23A 1WCQA 2NW3A 4HD9A 2D3VA 2DQTL 1GC1L 4KI5F 3N06B 3SBWA 3SKJL 1P5UA 2FB4H 3CFCH 4RIRB 5JHLH 4ONGL 5FOBB 1L6ZA 2HH0H 3ROOB 1I7TB 4I77L 1T7WA 3CD4A 2A6DA 4QKXB 1UXSB 4DKFH 4TVPD 3DVNA 3GIVA 2LE9A 3U6RB 5D7LB 5D8JH 3ZE1F 4F7MB 3MJ8A 3D18B 2RFXA 1REIA 3GMQA 5E2WH 3AAZA 2I07B 3KPSE 1OP5K 5C9JA 3QAZC 5GHWH 3JWDC 3KPMB 4QXTA 4F57L 1DQQA 5D9SB 5HI4D 2R56H 4PJ5B 2FDBP 5I1IL 4JM4L 4BSJA 3I6GB 5IKCB 2D31A 4X4ZA 3EYFA 3QUXA 6FABH 4NN6C 2HFFB 1F58H 5KSBE 1AD0B 1S8DB 5IB5B 5JNYB 3GBNH 3CNKA 4U1NA 2VIRB 3DX6B 2FR4A 1NC4D 4EI5C 1IGTB 2XWJA 4W68A 5DJ6A 1S9WA 3CDCA 4UIMA 4QRTA 2GUOB 1NSNL 1XGYH 2DMCA 5D72H 2EYTB 5C0JB 2CQVA 3HFML 3T0BA 4WV1C 3QEQD 5TFSH 4KRLB 4ZSOE 4PJBE 4DUVA 2V7HA 3WHE1 3IKCA 5C0AE 1KCRH 2G9HA 2VLMD 4XBPA 3FQRA 3FFCA 1M71A 3ARZA 2XTJD 4GS7B 4JFQB 4HJGA 2C7UB 3SDXB 2FATL 2F15A 2P5EE 3O2VH 4GKSB 3U30B 3U0WL 3K0WA 3B5TA 4O02L 4PGEB 4OFYA 4Z77A 4HMDA 1KPVB 3W11C 2BY3A 4I3SH 4M3KB 4L3CB 4HAGA 1J0KA 1MWAL 3CFKA 1WZ1L 4OLWH 5JMRA 3MCLH 1OQXA 3PWPE 5I76B 2E9WA 3H0TA 4P4RB 1X5KA 2OL3L 4P9HL 3KYKH 4GKZB 1R24A 4ALAH 3CC5A 5DGQA 1RZKH 1AGDA 4KQ3L 1IMHC 3LZFH 4ZS6D 4XPGL 2NY1D 1ZLSL 4OF6A 2GW5A 1QG3A 1A6UL 1O7VA 3TVMC 1RSFA 4QYOA 1A9BB 1KELL 1OCWL 2NQCA 3BXNA 3DX7A 3K8LA 1M6OA 4YHNB 5AYQA 2AW2A 1QVOA 1KN2L 1BBJB 3PNWB 2R1YA 4U1SA 5C0FB 5DUBB 4KTDH 5JW5B 5JORA 3S35L 4LSPL 1AGCB 2R23A 1A7QL 3HPLB 1L0XA 3QI9D 4NQUA 4GO6B 5IG7A 1A5FH 1J0HA 3RGVA 1AH1A 3IFNL 4HZLB 1XF3A 2UVEA 3GSNL 4KI1A 4E9LA 2OTWA 3MJ9H 1M7DB 4LVNC 1GGTA 2ESVE 4GG6F 4AEHH 1IFHL 1JF1B 1I1CA 1I3RA 2F54E 4HIXL 4WO4C 3FT2B 3G5VA 2YHGA 5DHVB 5DVMA 5GS0H 3KYNB 3H9SD 2PO6B 3P4MA 2HA1A 3MO1B 4KC3B 4M6MH 3GM8A 3MLSL 1FZKB 1N7ML 2JCCF 3EFDL 3GSRA 2DM3A 4D0BB 2FEEI 2HRPH 2EE3A 5FGBC 4JO2H 4Q0XH 3VXPA 2VZVA 1MREH 1I8IB 5C0GB 3UCRA 1I8KB 1GZPB 3QIWA 3C5JB 3WLBB 1KULA 2EICA 3G5XB 1MHHB 2BNRD 4P5KB 2GAZB 4Z7UF 4XCEA 4C55A 3UZEA 4PREB 5HVHB 4DFHA 1QOKA 4Z18A 3HNVL 2B5IC 4NO3B 2CXGA 4LLYB 1WEJL 1A7BA 2OZ4H 4H8WH 2UVFA 3BFOA 1FPTL 3QFJA 3WIIH 4CVZB 4R3SA 5M94B 1BD2E 2N7AA 4NC0B 5T33L 3VWJB 2KQMA 5FM5M 3RWCB 4JRYD 3UTSB 3WS6C 3S88H 5ANMA 5IESL 2OI9C 3TA3B 1K6QL 1J8HA 1T1YB 4X4YB 5FK9A 3UTPE 4XNQA 5AEAA 3UAJD 1W0YT 3EO9H 3VD7A 1JNHB 4LHQB 2B0SH 5MI0B 5J6GA 1QO3A 2HWZL 2R0WH 3E3QC 2XA3A 5DJ2B 4PJHB 2IFFL 1RUKH 1GZQA 4XMKH 3MRBB 4EN3A 5TE6L 1FFOB 2W0KA 2BNUA 4HJJH 2R4SH 4YFDB 4PLNC 5EIIA 3JWDL 3LKSA 2YUZA 3SJVE 2DICA 1NDMB 2VOTA 4M8QB 1UM5H 5DC0A 1IC4L 2SEBA 1PZ5A 5HYJB 2BHUA 2EH8L 1Q94B 1S7WB 4RX4D 5F7EL 3TZVD 3U36B 1CFVL 5I1EH 1AGFA 3C8HA 2IBGA 4OZFA 4AENA 1E28B 1U58A 4H88L 1P7KA 3MRKB 5DD1L 2ZNXA 2R0LH 3GMPA 2P5WD 1I7ZA 1H5BC 4LBEA 2QTEA 3ES6B 1BOGB 1A1OB 3DBXB 1W8OA 3GSXA 2R9HD 5EZJA 1WIOA 3QUYA 2X89D 1BLNA 1R3HB 5DEFB 4IJ3C 1X4YA 1KFAH 4YBQD 1RZIB 4HIJB 3F7RA 5I73B 4KVNH 3X3FH 2LU7A 1NC2A 2A83A 2HTLD 4JN1L 5FYKH 2EXYD 3MUZ1 4KJPD 3W0WE 1EVTC 5JW4R 1JZ7A 3B9KA 1FSKB 4I2XA 4LLWB 4M7LL 3V4UH 5DJAA 1YUHB 1IAOB 3W9DB 2BFVH 5CUSH 4AK1A 2DLFL 4LLQB 4WFFE 1HILB 3UTQB 1NCBH 3MC0A 4LRNH 1P7QA 3QUML 5A43C 1NAML 1CVSC 4HH9A 2BNRB 4HPOH 3U4BH 4LCIH 4JR9H 4MD5A 1V5JA 5EA0H 2NLJB 1G9MC 1CS6A 3GJEB 2P45B 1G9NC 5IBLD 3PWJB 3V7MA 1CD9B 3BUYA 3LD8C 5FXCH 1FO0L 5F7YC 4X5XA 3E8UL 2BC4B 4PJAE 2P8PA 4M4PA 5FYJD 2MSPA 1CK0H 3AREC 5JPMB 4NCC1 5CIPA 3ETBF 2J8UF 3EYOA 2Q3ZA 4S11A 1PY9A 4IOIA 5L9DL 2CRIA 3RDTC 3WNKA 2Z4QB 1URLA 1Z0NA 3H2WA 3EHBC 1KCVL 2ITCA 2XN9D 4OD2B 3VXQA 4UTAL 4JKKA 4ODUA 1NFDB 4L8BB 5KN5B 2OP4L 3PQYA 1Y0LB 3U7AA 1BP3B 2P43B 4RMWA 5D7IB 5DD0H 2IADB 3ZKXB 2L7JA 2WWMD 1K2DB 4MJIE 3MSPA 4Q2ZB 2PF6A 2DQFA 2EEBA 3TZVB 5DJCA 5F9OH 2XPGB 2OJEA 3ILQC 1U3JA 2P5WB 1FN4B 2NZIA 1HSBB 1IGMH 3QISA 3TBYB 2BSTB 3ARYA 3WUZA 3SDDD 3HRPA 1T6WA 1VPOH 3O3AB 3MZGB 4O51A 1AKJD 1P4BL 1SEQH 2DYPD 5SX5K 2XKNA 2OJZL 1QSEB 1UYWH 4P59L 5GGQH 2LTQC 2XZCL 3QHTC 1AO7E 3IF1A 5KVFH 2VDRL 1MAMH 3TO4B 1JRHI 3NACH 1RHHA 3ZDYF 3QJFA 4UV4H 3BZ4A 4NCDA 2X4RA 4B41A 3FN9A 5IVXF 3P4OA 4TSAH 4HUMB 1X3DA 1BX2B 4G8FA 2VZ1A 3LQAL 2EDOA 2KH2B 3MPCA 5FFLA 3OZ9H 2C26A 1FL3B 1JPGA 3VD9A 1EGJA 4OZFH 4LLVA 4YE4L 3RVVD 1OT1A 1ZMYA 4N1EA 1BFOB 1QFWM 4G80A 4P2QA 4NSKB 3HZKB 4UI2A 4QTHB 1C16A 2QQNH 2VUOA 1ZA3A 1A6WL 2HRLA 4MAYA 5K33A 5B38A 1EO8H 3DSNA 2O61B 1QLEH 2VLKB 5E95B 3EBAA 4HGKC 3OKEA 3U9UB 2GCYB 3CCHB 1NMAH 2WBJB 3WCYA 2HG5A 4LLDB 1G1YA 4ZPTA 5IB2A 2JJTA 5ADPH 2YEZB 2YN5A 3MLXH 4N8VA 4M5YH 5ESAB 1BVLA 2BCKA 1QBLH 4KZEH 4OI7A 4CGTA 3O3EB 4NRZB 2LQRA 1FVCB 4QT5B 2YMXL 4TUOA 1AFVL 4D8PA 5ACLA 1GCFA 3C09C 3NPSC 3SE8H 2NY5H 4F33A 2Y25A 4E42B 1JTOA 4KDTA 1KENH 4MXWH 5L0QB 1JJUA 1YMHB 3VW3L 2XXCB 3DMMC 3GSOB 3MFFB 4HC1L 4NO0B 5HHNA 3FQTB 4FNLL 3EO0B 5ESQB 5F88A 4MLIA 3KLHD 4Y5XB 3PL6B 1U3HD 5ISZA 5E70A 4F7TA 1DR9A 2VWEE 1RIUH 2XTLA 5I75B 4FXKB 2XWTA 4Y5YA 1XCQB 2F19L 5BRZE 4LSQH 3HZYA 4DN3H 2XQBL 4N0YH 1ZT7B 4KK9D 2NYYD 1KIQB 1G1CA 5HHVL 1ZHNA 4RFEA 1GGYA 3MLTA 3VXSD 4ZO8A 2DQGL 4PRPA 3STZB 2C3XA 4HIEB 5BZWA 2F74B 1RJCA 4MNGB 4YPGB 4WNQB 4GBXA 4AIZA 2JIXA 3MUGB 5EIVA 4Y5VB 4CN6A 2X9YA 4MZ2A 5ALBL 4Y19E 4O9HL 1I8LA 2HTKD 3W5NA 1RIVH 2FEDD 4WFHD 2BVOB 4WW2A 4BFBD 1G7IB 1NJ9B 1LGVA 2R29H 2UY7A 3BYTA 3HG1A 3GKWL 3RWHB 5MEPA 4QWWD 1CDBA 2AI0H 1FVEB 4EDWL 1KBGL 3F5WA 3EJJX 4HGWA 3DRQA 3U79A 1N2RA 3TNNA 3VG9B 4FP8L 4CNIA 4YK4C 5EDXA 1NKRA 4UV7L 5CGTA 3SE4A 5I1JL 1T4KA 5CJOH 1S7UB 4KAQH 1T21B 4TSBL 1FYTD 4ZFOA 1G9NH 2IBZY 3RUGA 2NY6B 5TQ2H 3EJYD 2ZZUT 1OTSD 3HRZA 4RMVA 2YD3A 3FOLB 4JO3H 4NM8H 1QYGH 3ZDXF 2GJ6B 2YBRA 3W9EA 1YY9D 2VDPL 1I8MA 4ORGA 5JZ7C 1P84K 1HHGA 3GGWB 4PS4L 5M7QA 1ADQA 5IM7B 3TN0B 5IR1B 3OX8A 1FV1B 1JGUL 5TQ0H 1BJ1J 1UH4A 4HEPG 3M8OH 3B9VA 1ZGLB 2DQEH 2GJZB 1KEGH 4CVUA 1FVDB 4PJCE 3IDJA 5HYSG 3F62A 1KJ2B 3MRDA 1JI1A 1IKNC 2ILLA 2FECI 3VFUB 4K3EH 4LAQL 5GRVL 5DEGA 4IRZL 3B9EA 3WEXB 4XP6L 1I1YB 1YYMH 1CTNA 2CRZA 3O45B 4JRXE 1U3HB 3IETA 1X9QA 5FECB 1HHIB 3QUZD 1YEIL 3JWOH 4I18C 3U30C 1CLOL 2ATKA 4U1KA 3C5ZC 2H6PA 4N1CA 3VA2C 1DSFL 3PDGA 4U4BA 5EO9B 4I1NB 1EEZB 1HEZA 4NBYB 4HKJB 3BZEB 2PYED 1MFDH 1TTGA 3D1MC 1YEFL 5F72S 1T7XA 4L29A 2QHRL 1D5XB 4PY7B 3FB7B 3DRTB 5HHXL 4YDJB 3TWCH 4YC2B 2X05A 4K71B 1RUAL 3GFUA 4LEXH 4K3DL 4MDIA 4F9LA 4L8SB 3C8KA 4X7TA 4C57C 4PIRF 1DLFH 4JFED 3HC3L 4K7PX 3ARVA 2YPVH 5L88L 1HI6B 1OTUD 3PDOB 1SY6H 3NFNA 4YFLF 3TPUB 1U8JB 1NGQH 1MIEH 4C56E 4I8DA 4RNRB 3MV9B 1IEBA 4UBDD 3SKOB 5ILTH 1BFSA 4YDLB 2Q6WA 4GXUN 3SGDH 4ZXBB 5I1KL 4YBLB 3T0ED 5AAWA 1AGEB 1SHMA 4P3CH 2ADGA 2ZUTA 1VADB 2APBA 2IAMA 4S1SL 2Z91A 1N4XL 3EOBB 4G43B 3GSVB 1IAIM 1N5YL 4HCRA 4RRPA 1ZEAL 4LCWD 2QLVB 2DD8H 4Y1AB 1FGNL 5HI5D 1AJ7L 5EU6D 1K4DB 2EDLA 3GB7A 1IC5H 2G5BA 5DD6B 2MPAH 5C0CE 2PO6C 4AIXA 4GW4B 5JR1L 5B3JE 4UUJB 3KR3H 1KB9K 2QQLL 2FL5A 1ZVYA 1F45A 3GJFA 1YPZE 3DTXA 4U33A 2DJUA 2XOTA 1TZHA 5DFVC 3VFNA 5FGSA 4HS6B 3F6IA 4ZTOL 5GRJH 5FGRA 1PG7W 1ND0A 1LD9B 4Y2DA 1P9MA 1CFQA 3IRPX 4KKCC 5GZOD 1ZWIB 4UZGA 4KH2A 2ADIB 2XTJC 3PWVA 3VWJC 3A67H 1RZFL 4QRSA 3GDBA 4NC2B 3WE6B 3K81A 3VFPA 3TA3C 2D7NA 1IBGH 1JWMA 1CFSB 1RZJL 1IL1A 3O9WB 4AQOA 1TNNA 5I1DA 3U4EA 4M48L 1Q0XL 3IJHA 3TBWB 1CFTA 1A7OL 1ZKAA 4FXGA 1IM9B 2ICES 4L4TD 4PRHB 4BH8A 3IFPA 5CZVL 3DXAA 3TBVA 3QEHB 3MOBH 5EU7C 4KTEH 2FH8A 4F7CA 3CDFA 4DGYH 2AJUH 5GGSA 2NY3B 1J0IA 3FN3A 2A6IA 3FRPG 3B83A 3ZMRA 4D0DB 1RQ5A 3CLEH 4XWGL 3I9GH 4KRNA 1PLGL 2A2QT 2EYRB 5DJ0A 1OAZL 3RPKA 5AD0A 4UT6H 2ED9A 3T2NL 2H3NB 3HTLX 5F7DB 2VZSA 1F6AB 4JPWL 4JM2A 3LEVH 3HI1A 1LEIA 1ED3A 2C1OA 3VRLE 5MEQB 2R8SL 3QI9C 4JDZA 1WWAX 1U42A 1KIPB 5MP6H 5F1NA 4Z78B 3PGCB 5CEXB 2C4XA 4HWZA 1B0GB 2F53B 1BGXH 4N8PA 1MCDA 3LCYA 4JZNB 4XNYL 4YNYA 4NOBA 3DV6A 3HUJF 4PRID 1AXTH 1IQWL 1CLYH 2ADJB 1UCBL 2AK4D 3C60A 4NWUL 1XGTB 5ADOH 5F7LB 3V6FB 1FSKC 4KK6D 5DVOA 4XNUL 1JN6A 3VFWA 5FDWA 4X9HA 3ZKND 4FQPA 2J8OA 1T66D 3E0GA 1CGXA 1BBDL 5I18L 4X9GA 3INUH 3CUPA 3V0WL 5J57B 1LK3L 3UEZA 1BEYL 5A40E 1RZGA 3N50A 4CW1A 1MJ7H 5T1LB 2J88H 1ZGLP 3MLPA 3IGAB 1YEHH 3BP4B 1HDMA 4K8RD 4V1DA 4P5TB 4R2GB 3NFPB 3QPQD 3FFCE 1DZBA 4F7EA 3LKNA 1A6ZA 5C6PB 1VACA 2XG4A 4XCNA 2EDTA 5LGJA 5DMJB 4LOUC 3MV8D 4G8GA 3ULVC 4UT7L 1RIHH 5J3HD 5IFJA 4HUNB 4S1RL 4QXGL 4RQQA 3HCVB 4NKMA 1FG9C 5EBMA 5F7KC 2WM0A 4D2NA 1JWUB 2ZCLH 4PJXA 4JO4L 3I2CH 3MROB 3RUGF 1YQVH 3BO8B 2G2RB 4EVNB 4UQ2B 3FZUD 4L4TB 1JK8B 1MFCL 4U1JB 4OLUH 2P8MA 2DS4A 3WFEL 4TNWK 5A16A 5GISH 2OK0H 1Q9OB 4RAUB 5FHBL 1FZOA 3ARTA 4APQA 4LP5A 4QHKJ 2DIAA 2YC1A 3FFDB 1KG0B 3ZKXC 3GJFH 2DQIH 3T4YA 5GIRB 5IMKA 2IH1A 3V7AG 3FTGA 4BSVB 3GI9L 4JDTH 5EIQA 1OAQL 1U8OB 1ACYH 5CD3A 1WGOA 2BP3A 3IJSA 1J05B 4NM4L 1PG7H 3TZVC 4PRDA 3UROR 5INCA 2PCPA 3WNMA 2MOVA 3RVTC 2EZ0D 3BW9A 1FNGB 4JHZA 5H2BB 2BK8A 3ARPA 3O2DA 4TVPH 1L7IL 1GOFA 5FM8A 5GS2D 2F8VA 2LU4A 5EZIH 3L7EB 2XNAA 4X0KB 2VLRA 1DANU 1UG9A 4OFIA 4YBQC 5C2BH 1CE6A 2QADD 5GRYA 3PWNB 2WANA 2HN7B 4MGXA 2HTLC 1S7SB 5DGRA 5GGRA 3TF7C 4OZHA 5J9PA 4FG6D 2AK4B 4YX2L 2CLZA 1J1OH 1WF5A 4PJ8B 1GGCL 5D71H 3T1WA 5DRXB 35C8H 3VDBA 1XGRB 3JV4B 1U9KA 2AJVL 4XP9H 4G6MH 1C5BL 4GKNA 3S96A 3HS0A 3QXDA 4JHAH 4EI6B 4BUHA 4ZFGL 1E4WH 4PLKC 2XWBB 1H0DB 4GRMA 4ODBD 3WDIA 1Z9LA 4U6VH 3E2HC 5KG9B 5E8EB 4NQXB 5SWSE 3VXNA 4OCXH 5DQJB 2XXMB 3O6FB 5HVFB 3KYMB 4TUKH 1PZUB 3HI5H 3VCLA 1BZ7A 2AGJL 1A6AA 3MV8B 5ANME 2DBLL 1SM3H 5T3ZL 1BF8A 3P30H 4HFWB 4Y4HD 1HNFA 3D85B 1FNFA 5IB3B 3VH8A 5JXAL 2BDNH 1HCFX 2GSIB 3QUKB 5C0BE 4F37K 2VDOL 4QRPE 5IIEA 3FB5B 2OTUA 1Y6MR 4GQ9H 1T7ZA 2NY2D 1DTUA 3F7QA 1GGBH 4XAWH 4X5WA 5BOPA 5D2LF 1TNMA 4ODXB 4X99B 4ZOAA 2X4TB 4KRMB 1OAXH 4HK3N 2XIDA 5I1CH 2GITB 5DUML 1K3ZA 3KNBA 2D03H 1I9RH 5D1QA 4QF1B 1FLRH 1JE6A 2C5DC 2DQJL 3EYQC 5ERWB 4F8QA 3H7BA 1Q1JH 3EOTL 3G04A 3MV7A 3PL6C 4B0MM 4LU5H 1NGYB 3WXVL 4BQ9A 3QRGL 2X4NA 3GMRB 4YWGL 2NTFA 2WSKA 5DJDA 5CJ8A 2Z93B 5IFHH 5J13B 4NT6A 2UUDK 4LCCB 5GRVK 5KBNC 1LO0H 3V6OC 4M61A 3SDDC 3WXWH 3KPPB 5TF1H 2I9TA 4N5UA 5KVEL 5IJVA 3IDYB 1F3JB 3OKKB 4JFDB 1KLGA 3Q5OA 3R8BB 1F6FB 2CRYA 2JE8A 4GRWE 5DDHB 2ZUYA 3OGOE 4LRIA 5L2KE 3UJTH 3BZFB 4JY5H 4PJ9A 1GIGL 2Z8RA 4R7DA 5KANI 1FGVL 2VQUA 4F15B 3J7HA 4OCSL 4UDTA 3H3PH 1A7RH 2E8YA 1QNZH 2E6QA 3TV3H 1OWWA 2N4IA 2GT9B 5FKPB 3VXRA 3NGBB 2Y07L 4FQXD 1A3LH 1MWAA 4NQED 2JJSC 4DVBB 3ULVL 2D4DA 1EO7A 4PB0H 5FA4A 3ZTNH 1WICA 2YPLB 2OL3A 4FABH 5T1KA 3GSQA 5GGUA 2HVKB 4S10A 5E8OA 5EPMB 4XI5D 2R2CA 4R9HA 1HCVA 1I9JL 5DC9B 4C59B 4M02A 1WAAF 1FNSH 1MLBA 1MHPH 5EZOL 2QSTA 1U8MA 2ZCHH 5A2KH 5KTEH 2JLLA 2IH3B 2OQJA 1WCBA 1V7MH 1CQKA 1FIEA 3O2DH 2DQCH 4OM1L 1BM3L 3CSBA 1CR9H 4OJFL 3UXFA 3LIZH 1XR8B 2YD1A 1NGZB 4JFFD 2EDDA 1FCCA 3RL2A 4JM2F 1VB9A 1CTOA 3TN0C 5IOPB 5DFTA 2Y7QA 3MRGA 5F7HA 4YHLH 3SE3C 2A6KB 3U7YL 4JB9H 1JGDA 2JB6B 4I3RH 4WWKD 2YD4A 1DUZB 2NX5A 3LSOA 3GSNA 3B2VH 5HYIA 4PP1D 3AROA 4JZOA 3PQYE 4V2CB 3MFGB 4M6NL 1TZIB 1YEGL 1XMWA 4G6FB 4QRQB 3OXRA 3WYRA 1F2XK 4XMPL 3QNXA 4Y2OA 4EDXA 3S35X 3O4OC 4PD4K 3FQUB 2EDRA 1L7TL 3VI4E 2DWEA 1MHEA 3UYRH 1U3HC 2DQTH 1GC1H 4JG0L 1U92A 1GVIA 1G7JB 1MUJA 1H3GA 4PGJA 2WBWB 4URTB 3GMNB 2QSCL 4XXCC 1QLFA 1WBZA 1MELA 2CIKA 4M5ZH 4OZGA 5F6HI 2GTZA 1CXLA 2ORBL 4PJIE 4Z0XB 5I66A 1BREA 2NYYC 4JFYA 5CEZD 4LLUB 4FHBD 3C5SB 4EIGB 3BD4A 3I3EA 3X14B 4U1GB 1UJ3A 3P9MB 5EO0B 2VDKL 5E8DL 5KOVC 4ELMF 2K1MA 4NJAL 3KGRA 1KTDB 1A4JA 3MXWH 4U6HB 4YC2C 4K71C 4C4KT 4QEGA 1FYTB 3QDGA 5TDNA 1S5IL 5IMMB 1MCEA 2HTKC 4HKXA 2FEDC 4FQXB 3VGHA 1E4XI 1GSMA 1S9VB 4PJXF 1MJ8L 3LV3B 3FL7A 4PFEA 4LKXB 3MACL 1CD0A 1CGWA 2ARWA 2OCFD 5ABDE 1GPOH 3GUTA 3G5ZB 4GMTH 3IJYA 1FDLH 5AYUH 1KB5H 4X6CB 3L7FA 5IVXB 3O11B 4YDLC 4Q9BA 3AGVA 5CEYA 4OZ4B 5J56B 4YBLC 3C8DA 3D0LB 2AJZA 3IB4A 3SDAD 3N85H 3C2SA 3EJYC 1DP0A 1TVHA 4NWTH 4XVUC 1HSAA 4B50A 2EXWC 3GHEL 5DZOA 1RFDL 1YY9C 4EI5A 2QKIB 4Z7VA 1IGYA 1KPUA 1NEZB 2D9QB 5FYJH 1BQHG 5E99H 2FATH 4K7FB 3U0WH 3Q6FA 3OF6D 4WV1A 2OR8A 4WWKB 3S36L 5CCKH 5GSVA 3HC4L 1C5CH 3FOMA 4KMLB 2HT4D 4ZYKB 3ZT5A 2A6JA 1MWAH 2UZIL 1WZ1H 3C9NB 3SE9L 3I6KB 4MNQD 2JB5L 32C2B 4P9HH 4MJ6A 1UB6B 4H5SB 2CK0H 5KZCD 4PB9H 4Y16D 1G84A 3S37X 4FFZH 4DZBB 3T8XB 1X6LA 3KDMB 4F7PA 4Z76B 3S98A 3BP7B 5CD5D 5ISZE 4XPGH 5H35B 2BRRL 4LIQH 3QUMA 1CGUA 3K8MA 1NAMA 3TT1H 1OGTB 3QH3B 1KIRA 4JFOB 2W60B 4WU7A 3STBA 5EU3B 1PSKH 4NUJA 2EDQA 3MXVL 5EORL 1J5OL 4YFEA 4LDEB 4JLRA 1NUGA 1KN2H 4XPFH 3TH2T 2YD7A 4HSQA 2X6MA 1FO0A 2BNQD 3PWUB 4PRPE 1N5AA 4LSPH 1HXMB 4PJGB 1A14L 3MNZA 2CLVB 1Q72L 2LVCA 3C08L 4MJ2A 3RTQA 3DX9B 1SBSH 4TSCL 5C08E 1HXYA 1AIFA 3V4PL 2C9AA 2NY3C 2GSGB 2WZPD 3WL9B 4KFZC 1JZ6A 3ULSA 1QSFA 1OTUC 2YUWA 1N7MH 2Y9RT 3SQOL 2P1YA 5I1HH 4QHUA 3U9PH 4Y4FD 3SO3B 4RA3A 2IPUK 2CIIA 4NO5A 4RAHA 1S9YB 4P2RA 3T0EC 3KPSD 2ZG2A 4S1QL 1KJ2L 15C8L 4BH7B 4QRUA 3L3OA 1ZLWH 1KYOK 2XICA 4CN1A 2X40A 5ITFB 5EOQH 4FFWD 5IWLC 1FFPB 1H3PL 1FPTH 4KROB 4OD3H 4LCYB 5FGBA 1T83C 2K7PA 1NBVL 4UU9B 1EK3A 2VAAA 1NFKA 5MHSE 1WIPA 2VUYA 3QDJE 4RMQA 1P6AB 3E6HB 2VXQL 3BP6B 1CDCA 3BQUB 3HPJA 3FAXA 3ULUE 3FT4B 4Z7WB 5HYEA 1WC7A 5JXED 4LSUL 2KPNA 4ZO6A 4WW1B 1OSZA 2WINA 4EZMA 5JOPD 5D1ZD 8FABB 3RL1B 1ZSDB 4RMSA 2MJWA 3FONA 2VDQL 5BZDA 3KHQA 2BOBB 1NEUA 5C0AD 1D9KD 1UZ8A 2W92A 2VKXA 4HK0B 4CU8A 4YHIA 3V5HA 3I3BA 3SGJA 2RB8A 4M7JH 2VR9A 3P9WB 3P4NB 5E94B 1AHWB 1KCSL 1XR9B 3D87B 2XA8H 2P5ED 2X7LB 5F7EH 3F65A 1CFVH 1J1XL 4NQVB 1J8KA 1PVHA 3UJIH 2VXVL 1JF6A 3KPQB 5DD1H 5E8PB 3TEUA 3UPRB 5TPWH 1HQRA 4IOFC 3QNZA 1F4YL 5CSGA 3RWFB 1W0VA 3S5LA 4DW2H 1DLHA 5ID0B 1F11B 5E6YA 5JW4M 5CWSB 3WJJC 3OHXA 3CMGA 3PWPD 1S7XB 3LN5A 2AXFB 3C6SA 1F3DH 2H32H 4S1DD 1AP2A 5TE7H 1DFBL 5E9DE 3O6ML 5AG9A 1IGIL 2PUQT 3HMWH 2CMRH 1F3RB 1QFOA 2WP3T 4NKDB 1ZVSB 3FJTA 4GRLB 4JN1H 1P2CB 5E6ZA 1RZ7L 2YKLL 4M7LH 4GXVH 1NGXA 3BKMH 1S7TB 1YY8A 5C09D 2IFGA 5HDOA 3Q3GB 4DVRH 5ICZB 3GM0A 2DLFH 5DRNA 1J1PL 1BHGA 2IPTL 1KN4L 1R5IB 1CIDA 3QUMH 4XC1H 3BN3B 3V6ZB 4HC1A 4YAQB 5K93A 3ZE2E 2C3WA 3KPSB 1KOAA 2Z8VC 5BV7B 1DQMH 5HHQA 2ATPA 3OAYH 5F9JA 3U82B 5DHYA 3SKMA 4FQQB 2IQAB 4ZNCD 3QBTB 1DBBL 2ESVD 4BFIA 2B1HH 1AD9A 3E8UH 2HT2C 3GBML 5FCUL 4OB5L 2F54D 4OZGF 4YQXL 5KSBB 3BP5B 2GHWB 4KK6C 3RA7L 4QRRE 4RFOL 3AU1B 4OCRH 4R4BA 3KLSA 4UT9H 3P2TA 2APFA 1LNUA 3MMEA 1DUYB 4OLXH 4OKVA 3VXME 4NUGH 1T66C 4M9OA 1NMBL 1WUNT 3V52L 1MVUA 2XRAH 4FQJH 2NY4D 2YZ8A 4IM8A 4E41D 3Q1SH 4X4XB 2GFBB 3PWLB 3MRMB 4FQCH 3QHZH 3VFGL 3QDAA 5C0AB 1D9KB 4Z95H 3OAUL 4UDUB 1IC7L 5IEKB 3NA9L 3SGEI 5EBWB 2UWEF 4TVPE 5E1AB 3F12B 5HGBA 2OTPA 3T0AA 1MFEL 4G8IA 4L9LB 1JPTL 5J3HC 1L9NA 4ZUWB 1B4JL 1C5DA 4LPVA 3X12B 3O3BA 1XAUA 5SX4I 5DVKA 1QSZA 1A1MB 1OB1B 2RR3A 5BVJA 5I71B 1NCDH 2BY2A 3MYJA 2GIYA 2BY0A 3GMLB 3HN3A 1F4AA 4Z5RA 4HUVB 2HVJA 4DOHE 1CIUA 1K3IA 5D5MA 5HHOA 4Y8DC 5JW3L 2C1PA 4Z7VF 1H8OA 4LP4A 2OJZH 5CHNA 5EFIA 3AB0B 3SJVD 3KLDA 5KSAD 4HPYH 1X5LA 4P59H 5HYQA 4EXPX 4HHAB 3CVIL 2VDRH 3WJLC 3MRJB 3RWIB 2PW2B 1EERB 1FNHA 4WI4A 4ZUVA 2R69L 5EN2A 4LK4A 2EZ0C 4HWBL 4LSSL 5J13C 4LCCC 2VERN 4FFYL 5FOJA 2ICEB 2R2EB 1UB5B 4LKCA 2D0FA 1S3KL 1U93A 3IDYC 3ARBD 5K9OA 2Z8WC 3IAPA 4PTUB 4WI8A 4U3XA 3TBTB 3BEWB 2QADC 4A2MA 1RUPH 2ESVB 1PQZB 1XGUA 4QNPF 3SDCA 1OAKL 4F15C 3W0WD 2OM5A 3T0XA 1G6RB 4MMZC 1VGEL 4J3VA 3NGBC 2FYYA 5JPNA 3U0TB 3TO2B 1S7QA 3HUJB 2J3SA 4XNXL 3STLB 3JWNC 1LO4L 4EOWH 3C2AL 4GMSL 4WFFD 3MJ7A 5FA3A 4MQ7B 2F5AL 5H94B 1T03H 2F8XC 3VMOA 2FX8H 2NY4B 4N1HB 3VRIB 1TCRA 1E27A 1UZ6F 2VLJB 4UB0L 4KV5F 4V1DE 1N6UA 4XBGB 3VW3H 5B39G 1BD2B 5AZ2H 2A74A 4G42B 4NN5C 2E6JA 4FNLH 5HDQL 2X10A 4HZAA 3O6LL 1G7LA 2NNAA 3AFLA 4Y4HC 2Q8BL 2IANA 4PJEA 2VKWA 2F19H 5DRWB 1LO2L 3DIFA 2X4PB 2HFTA 5DSCB 5C07A 1JYVA 4G5ZL 3BGMA 4G9FA 1I7UB 2XQBH 1MF2L 4U7SA 1YC8A 1JVKA 2YRLA 3RKDD 5HHVH 3TCLA 1VEOA 4UOJA 1QEWA 3O4LA 3DMMA 1XF4B 5ENWB 2CK2A 4ZQKB 5E5MB 2P8LB 2P42B 4C58B 2VLLB 5LGKA 3T3MF 4Z8FL 4LASH 3N1FC 4MJID 3NH7L 1TVBA 1CGSL 3VFTA 4O9HH 3U0PB 2Q8AH 3H9ZA 3QIUA 3VXUA 5IF0A 1V3JA 3VJ6A 4JKPL 4DEPC 2VL5A 4OM0H 4EDWH 1NCWH 1KBGH 2EC9T 3HAEA 2WMPA 3WSQH 1DVFB 1Q0YH 4WCYH 4UNTA 1JHTA 2QQKL 4ELKA 4NQCB 4XC3L 3KYOB 2C3HA 4OCLC 2GTWB 5J1TC 4U1GC 4UV7H 2FSEB 4JRYE 5I1JH 4YPJA 1N0XH 3FCTB 4N9GB 5HYSA 3Q6GL 4BKLB 4AG4H 1AO7D 5FOBA 1I9EA 1ES0A 4OZHE 1I7TA 3C6LA 4UILH 3IT8D 1BAFL 5A2LH 2VDPH 4FQXC 2MMXA 2APTA 3U6RA 5D7LA 2DM2A 2HKFL 3O41B 4MA8L 1CG9B 4F7MA 4MQXC 5LXGH 5HGAA 5IJKA 1ZT1B 4AY0A 5C0EB 2I07A 4TNWF 1M7IB 4I5BB 4MB4A 4XI5C 3TYGH 4M7KL 3KPMA 3WN5B 3QNYB 2V2TB 5FKAB 4AL8L 2BVQB 1FG2B 2CDEB 5EUOE 1LP9E 4MJ5B 4PJ5A 5E00B 3I6GA 3G5YB 4WFGE 3RHWK 5A2IH 5C1MB 4YLQT 4WFEE 1G0YR 2HFFA 2RCSL 4XP6H 4XCYA 1AD0A 3UJJL 1KLFA 4LPWA 2PTTB 4L4JA 4K8RH 5D2NB 1A6PA 1S8DA 2YK1L 4PJAB 5IB5A 1AE6L 3KPRB 3DX6A 4K9EC 1IGTA 4S0SD 1L9MA 3RQ3A 2WLYA 5A2JH 1KSRA 5FDYA 2GUOA 3BAEL 5DYOB 1YEIH 2EYTA 1CLOH 1IKNA 5HPMB 4HH8A 1G7MA 5L8LB 1UVQB 4CMMB 2IQ9H 4AMKH 4P2OD 1B2WL 4WWKC 5FO8B 1AGBB 5GJTH 3DHJA 3V0VA 1KPRB 2E6PA 4OKDA 1YEFH 4JFQA 2AEQL 5F89B 3QO1B 1UWXH 2C7UA 4P46D 5D2LB 1XFPA 4GKSA 4J4PA 1JYWA 1RUAH 4PGEA 4TRPH 4O2FB 4O4YL 3MV7E 3SKUD 4P99A 1KPVA 3PV6B 1JGVL 3GHBL 3TCXA 4L3CA 5L88H 3HC3H 5BRZD 3ALPA 1JYXA 1YDPB 1RI8A 2F5BL 1DQLH 4P4RA 5C7XL 1UQSA 2XY1A 3MBEB 4IBLT 4GKZA 2V2WA 3R4DA 3D3VB 1CFBA 3BGAA 5LQBH 4LSTH 3ARFD 5FYJE 1EXUB 4MB5A 1X5XA 4NZRL 1I3GL 4NRYB 4S1SH 1TJHL 4FTVB 1HH6B 1OARL 2BJML 4C4KO 1A9BA 4YZFF 1XIWD 1B88A 1N5YH 4ZFFB 4YHNA 4F37F 1ZANH 3VXRE 3K7UA 5LVEA 1FGNH 3GMOA 1JHKL 3TFKD 1BBJA 3PNWA 3CAFA 5C0FA 1PW3A 3T65B 5DMIL 3ARXA 1MJUH 2XN9E 4P57B 5IVOA 5JW5A 5D5MF 3LHPL 1AGCA 5EH1A 3HPLA 2QQLH 3DGGB 4MA7L 1J0JA 3BVNB 4HZLA 4JVUA 3DGCR 3QG7L 2EIZB 1OGAB 3WIFB 2VR5A 1H8NA 3X13B 4OI9A 1JF1A 2M2DA 4Q6IB 5DLML 5DHVA 3KYNA 4LARL 4Q7DA 5FO7B 2PO6A 1MY5A 2BMKB 5IUSA 5JHDB 4IEFB 4XWOC 3LVEA 5F96L 1U41A 1XCTB 4GT7A 4KROC 5C86A 4PJFA 4LDLB 4D0BA 3BWAA 1T5XB 4PYGA 1SQ2N 2R1XB 5DD5H 5IHBA 2COQA 1DEEB 1I8IA 5C0GA 4EUPB 1KEML 1P1ZB 3FRPA 1BQLH 1GZPA 3C5JA 3P0GB 3G5XA 1MHHA 1OVZA 4P5KA 2GAZA 5CSZB 5IW6B 2O26U 4PREA 5CBAA 2DOCA 3QIBD 2NX5E 2VSCA 4NO3A 4LLYA 4ODTL 1BZ9B 1Q0XH 4B7LA 1A7OH 3GNMH 2B4CH 4CVZA 3VWJA 1R3JA 2FZ3B 2X4QB 3P3YA 2DTML 1ZV5A 2I9LB 5IEHB 1OP3H 4YHML 5TE4L 3RWCA 2ZKHH 3LY6A 4ONHB 3UTSA 3UZQA 3RFZC 4Y16C 3TA3A 3T77B 1T1YA 4X4YA 1A0QL 2YD5A 5ALCH 2CUHA 2EIDA 4JRXD 1JNHA 4XWGH 1AHWC 4JG1L 2P46B 1KCUL 4I0CC 5DJ2A 3HNTH 4HEME 4PJHA 4XP1L 5DTFB 4O5LH 3K2MC 3LPFA 1Z9SA 3MRBA 1MCFA 3QDMB 1FFOA 1TPXB 3T2NH 1H8SA 3HE6B 4GLRI 3F7PC 4HJ0D 3QXVA 3AS0A 5C92A 1NDMA 3ROLB 4M8QA 1ZS8A 4PRNB 5HYJA 3BOVA 3QEGH 5CP3A 3PUCA 5DWUH 4NPYA 1BFVL 3I6LE 1Q94A 1S7WA 3TH4T 1U8NB 3U36A 2PYFA 4PJEF 5JO5B 3SN6N 1N6QH 3OKYA 1W72B 1SJHA 3CFIC 4Y19B 4BK4A 1QFWL 4KKAD 1E28A 2FO4A 2H45A 1INQA 5GS1B 3MRKA 4ELMB 1IQWH 4PV9B 4K9EL 3WFHB 4NWUH 2OLDA 4D3CH 3ES6A 3MREB 1BOGA 3UC0L 1A1OA 2OXGA 3DBXA 4C56D 2YWZA 2ZOKB 1IEAA 3GI8H 4M1DH 5I1LB 4Y4FC 4G8EB 5DEFA 1RURL 4JAMB 2E7LC 2PW1B 5IK3A 1FNAA 1T0NB 1CICD 1BBDH 4HIJA 5I18H 5ICYB 2GQHA 3V0WH 5D96C 1UKQA 5BV7C 1PDKA 2LABA 1JBJA 4ZODA 4LLWA 3FN0H 4FFWC 2OMBA 1MIMH 1YUHA 1JPST 5KOMC 1IAOA 4AT6B 3UTTB 4KJWD 4LHUD 4PBXA 3W9DA 5I15H 4LLQA 1SMAA 1HILA 5D1XB 5C0CD 1GOHA 3RGHA 5I17B 4DN4L 4S1RH 4BZ2L 4QXGH 1LE5B 3EFFB 2NLJA 3GJEA 2KBGA 3T3PF 4OSUL 3MNVB 4YHKH 3PWJA 4KKBC 5CMAB 3K46A 4ZUSB 1XGQA 1NCAL 4IDLA 5D1ZC 3PE9A 4WFHE 2BC4A 1AY1H 2H2SD 1YEDA 3SPVB 3L5XL 5JPMA 1D9KC 4FZEL 3Q0HA 4NZTL 2VR4A 4JRXB 1NANI 3SCMB 4GAFB 4OBSA 4RBPK 3N9GL 2Z4QA 3LS5H 4L9LC 3CXHK 1Z0MA 5DHXB 4NM4H 2EH7L 5F70A 1HHJB 1T2QL 3BUTA 4YXLL 2DI7A 4M1GL 4WEMB 4NO2A 4J2XA 1U8KB 3BJLA 4OD2A 4Q9QL 2PXYD 5I71C 1NFDA 5EC2B 4L8BA 5KN5A 4ZFZB 4RGMB 2ZUWA 1TETL 1V05A 1Y0LA 3RZCA 2E27H 3BEVB 4X4MA 5D7IA 4H1LH 1L7IH 3MRLB 2IADA 3AUVA 2CRMA 4KY1H 4LPTA 3GBLA 4MD4B 5CEZH 1K2DA 1VEMA 1HOCB 2BRQA 3IDIB 5IT2H 1MH5B 3KS0J 1ZA6B 2XPGA 1ONQB 3O8XB 3ZYIA 3JTTA 4OGAD 1QSFE 3A6BL 2P5WA 5DI8B 1FN4A 1EMTL 1HSBA 2B20A 2R0ZH 3BPOB 3TBYA 2BSTA 3QULB 3WMSA 2K9UA 2AJYH 3O3AA 4K3GA 3UTZB 3L9RB 1X7QA 3R0MA 1TVDA 4J6RL 4GSDL 1U8IB 3SDXF 3DO7B 3TESA 1QSEA 1K9TA 3IFLL 3TO4A 4X80L 4KJQD 4XVSH 1S5HB 4HXBL 1KT2A 4TQEL 3VFVB 3DUSB 3QUXD 2FJGB 2EO9A 4XP4H 1JZ8A 2D7OA 2JJVA 1U8PA 5CP3H 2DBLH 5C0CB 1BX2A 5T3ZH 4ODHL 3VE0B 4HUWB 1CXKA 5B38G 5L6YH 25C8L 5D6CB 2NXZB 2VDOH 1OW0C 4I0PB 1ITCA 3B43A 1YPZB 4CN4A 3IDNB 1BFOA 1JHLH 4NSKA 1PX4A 1I1AB 3HZKA 2NY4C 3P11L 4QTHA 5BS0B 2ZJSL 4A6YH 5F7WC 3MLRH 4QHNB 2O61A 4FN0A 2VLKA 5JUEL 1K5NA 4RCAA 4Z7QF 3U9UA 2GCYA 3CCHA 4F3FA 5DUMH 3FFCD 2Q76B 2CO7B 3VWKB 2WBJA 1CD1B 4LLDA 5I16B 2YEZA 2IPKB 3ELAT 4KRPB 1LMKA 5TJWK 5ESAA 3MLVL 5BO1H 4OV6F 3HE7B 2P24B 4OFYD 1JI2A 2ZUSA 3O3EA 1BFTA 1T0MB 3WO4B 2AQ3A 4QT5A 1UWXK 4RISL 4LCWE 3DVIA 1YMHA 1EJ6A 3GSOA 5EU6E 5KVGH 5KVEH 3MFFA 4NO0A 3FQTA 5BV7L 4I48A 3EO0A 2HYMA 5ESQA 2Z9TA 1FAIH 3DWTA 2EDNA 4OF8A 3MGTB 4Y5XA 3PL6A 1S7VB 1E6JL 1HKLH 4FXKA 1XCQA 2RJMA 2XKUA 3PABB 3L5JA 2IMMA 3TJHD 1RULH 1F4HA 3JV0A 4X5LA 1ZT7A 1QBML 1UGNA 1IGCL 2Y07H 3NFSH 1KIQA 1V7NL 5I6XC 3C87A 1FZMB 1VFBB 1U8LB 3RWJB 4QXUL 3GO1L 3STZA 1IQDB 5FUOL 3PF2A 4HIEA 2XYCA 2ZNWA 2F74A 2ZSWB 1R0AH 4MNGA 1DVFC 4YPGA 2RFXB 4O2CA 4WNQA 3DJ9A 5T3XL 1I9JH 3MUGA 3KYAA 1Q9KA 3CU1A 3HI6L 3LQZB 4Y5VA 3RGVD 5CAYB 1X5HA 3S36X 2BVOA 5T1DL 1G7IA 3MTRA 1NJ9A 1EUTA 4PJHF 2VTFA 2WUBL 3RWHA 5ITBH 1YMMB 3QUXB 1FVEA 3SKNB 5C0IB 3S9DB 3NCJH 3WKNA 1NBYA 1EZVY 2DDQL 4OCYH 4UIMB 4QRTB 1S7UA 3QIWD 1T21A 1R6VA 1EHNA 1AQDA 4HIIB 5D7JB 1ORSB 2W0FB 3L6FA 5FGCE 3FOLA 1QFPA 3UO1H 2V7HB 4M6NH 2GJ6A 1WIUA 3WLWD 1YEGH 3BDYL 3GGWA 1J10A 3QFJD 3F58H 3TN0A 5IM7A 4EQ3A 5IR1A 3FFCB 1FV1A 3MQIA 4K23H 4QHLB 5D2NC 5SWQA 1MCPL 1ZGLA 1L7TH 4KK8D 4GJTB 1J8HD 1M4KA 2YA1A 2GJZA 4JPVH 1FVDA 2Y5TB 3FHQA 3QAZB 4Y4KB 1KJ2A 5TDPB 3CDGB 3B8SA 2EDWA 1YEEH 5MENB 4W4OC 1WFNA 3WFCH 3VFUA 1A22B 1MPAL 2VN4A 2ORBH 2BZDA 1I1YA 1QUNA 3TT3L 4EN3D 5HHOE 5E0QA 5E2TL 2QV2A 1ZVHA 2JJWA 1H9VA 1PKOA 4L5FL 1IVLA 5DUPL 4XHJC 2VDKH 3O45A 2MCPH 5E8DH 3M1BA 1F8TH 1WBXB 5FECA 1HHIA 1FZJA 4E0RB 3HZMA 1JFQL 3W2DH 5I1AB 5KW9H 3NIGF 2VXSL 3ARGB 3H6JA 2V2XB 4N90D 2MQ0A 2O5XH 3FB6B 3LKOB 5EO9A 4JQIL 5HGHA 1EEZA 2VXTH 1F02I 1NGWB 3MACH 3L5WB 4HKJA 3CK0L 3BZEA 3SY0B 1EV2E 5JORB 3VFRB 2FJFB 1D5XA 4PY7A 1BECA 2DMKA 3HMXL 3FB7A 3DRTA 5IHUL 4YDJA 3QUYD 4OZIF 5C6TH 1FFNB 3S97C 4L8SA 1TCMA 1TJGL 5KSVB 2Z31B 2V17H 5F3BB 3HA0A 1NC2D 5C3TA 5C0NC 4X9FA 4LQFH 3PDOA 3TPUA 1U8JA 4XZUB 3B9KD 4RNRA 3GHEH 2WQRA 1J0YA 1CF8L 3MV9A 2V6HA 3T2PA 2HJKB 3SKOA 3GSRB 3DUUB 4MWFB 4ZXBA 3VXPB 3QA3B 1P7QD 4LEOB 4KJYA 1JRHL 4K2UH 1AGEA 4KZDH 4NBZB 3EYUL 3QWQB 2KZWA 5DVNA 1VADA 4G43A 4PJDF 2UZIH 4YGAB 1AR2A 3HC0B 3SE9H 3QR2A 5EZLA 4Y1AA 5SWSB 1K85A 1EFXB 4J3OC 4HWNA 4AM0A 2X1XR 4Q6IC 5DD6A 3P77B 4GW4A 1MCSA 2AS5M 3UDWA 3REWB 4UUJA 3I85A 3U7WL 5I0ZA 3A6CH 2AJ3B 1WWWX 2CH8A 3ZDZF 4NFDA 4OV5B 1RMFL 5C0BB 5C07E 4F9PA 4M4RA 1QO3B 1F00I 2APXA 1I85C 1YECL 4QRPB 4HS6A 4RGNE 3NABL 3O4LE 4XPBL 4WEBH 3H42H 1B0RA 4WO4B 1ZWIA 3PQYD 3NBNA 3MOAH 3AXLB 1FH5H 3VGAB 1A14H 2ADIA 1Q72H 3C08H 1ROWA 3ARQA 3WE6A 4P46C 5FHAL 3V4PH 4KPHH 1Y18B 4UAOC 5DURB 5JQ6H 1CFSA 3V0AC 3SQBA 3MZTA 3O9WA 5BMFH 4TOYL 1UWEL 2VWEC 4MX7A 4NNPL 4XAKE 1LO5B 3TBWA 4YHZL 2B5IB 1I7ZB 5SWZA 4Z7OE 4K7PL 5IBUB 1IM9A 1HHHB 4PRHA 5CILH 4E5XB 2HMID 3WFDL 2EYSB 2YD8A 1TPXC 4NHCL 4O58L 3HE6C 3UPAA 4HW6A 4EUPG 3DV4B 5K59E 1LILA 3ARFC 3JVGC 5IW1A 2EDJA 5L2KB 4HG4K 5ACMA 2EYRA 3QCTH 4LVHC 4H26B 1RD6A 3PG2A 1D6VL 3OKMB 5IBTL 1CQYA 5GS1C 4DKEL 4NGHL 12E8L 1G0XA 5F7DA 1F6AA 3OJMB 3RJQB 3BIKB 5DJ8B 3FO1B 2VXQH 2WUCL 3KPLA 1J9CT 4RWHA 4ZTPL 1KIPA 4Z78A 5CEXA 3PGCA 4LSUH 1B0GA 4MD5B 2F53A 5CGYD 1CLZL 5IMOB 2DWDA 4QTIH 3OKNB 2WW8A 4WHTB 4KXZH 4JZNA 5CFHA 4MQSB 1M05B 2ADJA 1T83A 4P2QD 3ZKMD 1OP9A 1XGTA 3V6FA 2EC8A 1EX0A 4MAYD 2BOCB 1BWWA 4HWBA 4MXVE 1H5BB 2AK1L 3RBSA 3WKML 4OD1L 3EYOB 3RVXC 1O5DT 3CX5K 5CKGA 5JIKA 5F9AC 4FRWA 3N1PC 3PGDB 3ZT6A 4LLMB 5C0RH 3NIFF 3QIBC 4OQTH 1MNUH 5T1LA 1RAMA 3IGAA 4XP5H 2HFGL 1C8PA 4U31A 2VC2L 3MX0A 4GQPH 3OJVC 3PQYB 4P5TA 5D7SL 3NFPA 3ISWA 4MNHB 1FBIL 1MFAL 5FV1L 5DD3L 1KC5L 4UINL 4OAWB 5KSUB 4OUOA 1MI5A 5FUZL 1IGIH 3F8UB 3I3DA 3HCVA 5ISZD 4JVWA 2FECL 3SCMC 1RK0B 1JWUA 4X6DF 1NGPL 3MROA 5HD8D 1AQKH 3BO8A 4NN7C 4HS8H 2P4AB 2G2RA 3S8WA 4EVNA 2J4WL 4UQ2A 1JK8A 4U1JA 2WQ8A 1KCLA 4PJIB 4XB7A 1T1XB 4POZD 2IPTH 1Q9OA 2XZAL 4UIKL 4RGMC 3CZFA 4PRPD 2X9WA 4HWUA 2ICWB 4QOKB 3FFDA 1KG0A 2CLRB 5GIRA 4ZMAT 3GRWL 3MA9L 4BSVA 2ZPKL 4GBXD 1P53A 2JIXD 3LS4L 1U8OA 1I9IH 4WI7A 3IF1B 1J05A 4N0FB 3IAQA 1A7PL 3RDTB 3O8XC 3ECBA 4KKAC 4Y8AA 2B1AH 1FNGA 3OKD<