4NN6C

Cytokine receptor complex - crystal form 1b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
182
structure length
163
Chain Sequence
TVVCHDLETVEVTWLSLEFRYGTGALQPCPRYFLSGTSGCILPAARAGLLELALMVFKARQRASAWLKPRPPWQVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPVRCYDFRVRASPRAAHYGLEAQPSEWTAVTRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymic stromal lymphopoietin
publication title Structural basis of the proinflammatory signaling complex mediated by TSLP.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine/cytokine receptor
total genus 25
structure length 163
sequence length 182
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn6C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nn6C01
5DHVH 4LF3B 3TVMB 2EC9T 4PJ9B 4R3SA 2Z91A 4PG9B 1CG9A 4XCNB 1T89C 3QNXB 1WIPA 4YR6B 2HVKB 1Q9KB 3CK0H 2JKXA 5DEFB 5DTFA 3BXNA 4PTUB 5IVXF 4YXLH 1PG7L 1CE6B 1GSMA 2BHUA 3GIVA 4H88L 1JYXA 3DIFB 1DQLH 2E9IA 3UZVB 4DUWA 3QFJD 1RURH 2O5YL 3JXAA 4AEIH 3SDXE 3IJSB 4HIEB 1JBJA 5ESAB 5ICXB 4PBVC 2AXJA 2HKFL 2ADFL 1XR9A 5DRWA 1Y18B 4U1IB 2BCKA 4RGMB 2G75A 1UM4H 3O4OC 4QHUA 3CNKA 1MFCL 1MF2H 2DQEH 5BZDA 5DVLA 4EUPA 3HMWH 4JG0L 1YEFH 5IBLC 4YO0B 2P44B 2NQCA 3KNBB 2QADD 2YUWA 4Z7OF 1R3LB 5GS0H 5IEKA 3NA9H 4IDJL 3QAZC 5HDQL 4LAQH 3B4NA 4M7LL 5I15L 3WIHH 3BD5A 5CEZE 2E7LC 3QPXL 1A3LL 3IGAA 1XCQB 5IEHB 1NDMB 1ERNA 4ERSH 2D7OA 2IAMA 5LG1A 2AEPL 3QDMD 4MNHA 4I0PA 3UO1H 4HJGB 2PTTB 5I76A 2PYFA 1WVZA 1QFUH 1OAQH 3MRJA 1NFDE 5IHZA 2AS5M 1EEYA 3LN4A 4ONFL 4X7SL 3C60C 5JZ7C 3ZE0E 1DEEA 3T0VA 4JPVL 4WHYH 1ZTXL 2YUXA 1FGNL 1MEXH 2DLFH 4PBWD 4AIZA 1BQUA 5E8DL 1ITBB 3MREB 3FRUA 4OKVB 3WSQH 3B9DA 4HC1H 4U6HB 3JWOH 4RAHA 5ACMA 4F33B 1RK1B 3ZHDA 4PJHA 1ROWA 2J5LC 2RBLA 1CS6A 5E03A 4HZLA 3VE0B 1FBIL 2C1OA 3C6LC 5BO1L 4E41B 3VGBA 1HH9A 5I6XB 2H45A 3U79A 4I8DA 4AQ1B 1JGEA 5FM8A 2XFXB 4G9FA 1ZOXA 3HC3H 1F6AA 5EWIL 1JF1A 1BFVL 4KXZI 2MFNA 3QIUA 5FA4A 1NCWL 4KK6C 4HGKC 5JHLL 2Y1VA 2V5TA 2ZOKB 4HWBL 5ESQB 4U2YA 1B4RA 1NSNH 1YYMH 3FRPA 1WWAX 4NNXB 5HD8C 5CMAB 5CEZH 3T0DA 1XAUA 3BWAA 3M17A 2GCYB 3PDOB 1DQQB 5C0AA 1JHKH 2W0FA 1U58A 1IAOB 4JDTH 3I2CH 4MA7L 4DZ8B 5EBLB 3PIQA 4LCWB 4WWKD 5EZOH 4BQ8A 2OR7A 2VXSH 2DQFA 1RK0A 4P2RD 4DVBB 2VKWA 3SKNB 1G9MC 2LU7A 2JB6B 4GG6B 3G6DH 1LNUA 1A2YA 4LNRA 5FK9B 5EOQH 3ARED 4G5ZH 3PNWB 1WFNA 1F45A 5B38A 4K94L 4MMZC 2IGFL 1JGUH 4PJBA 1I1AB 3N1PC 1JNHB 2GQHA 2Y6SD 4OKDA 1MFAH 3U0PB 3X3FL 1B6DA 1BVLB 1HXMA 1KIRA 5E99L 5GZOC 2PTVA 2D31A 3NA4A 4JN2B 1BVZA 3MA9L 4L3ED 4P5TB 1AQDB 3DPBA 3BPLB 1F11B 2HJFB 2I60L 1G1YA 2ATPA 1D9KD 5IIEA 1DQML 3MOBL 5F1SA 1WZ1L 3NVQA 1B4JH 1U0QA 4YX2H 2XRAH 1BQHB 1Y0LB 4QHMB 3BW9A 4OF5A 4KMQA 4HFUH 3DYMA 5B22A 4BZ1H 5GIRB 3VGAC 2X4RB 3SDCA 4LPXA 1LE5A 1G9NL 1ED3A 4O9HL 1N8ZB 5B3JF 4I0CC 1AE6H 1HHHA 4OD1H 3UYOD 4QOKD 3MO1B 2C7UB 2ADJA 4FZ8L 5TDNA 3L9RA 5KVDH 3L1OH 1QSFE 4F15B 3D85A 3IJYA 2A77L 4IRZH 4K7PY 2EH8L 2V17H 4G8FB 4BK5A 4CAGA 1W72L 2DMKA 4Q6IC 3TEUA 1Z5LB 3WKML 3ZSSA 1U8KA 3WFHB 4DVRL 4TN9A 2VUOA 3OR6A 1X44A 3RTQD 5FUOH 1T80A 3HAEA 1BM3H 1GVIA 1VFAB 3U4EA 2OJEA 2ORBL 2VE6A 4UZGA 4S2SA 4ZO8A 3I02A 3JTTA 2H2SD 1OL0A 3GMMB 2NY2B 4K23L 2DD8L 2P5ED 1UYWL 2K7PA 4NQUA 4UV7L 4Y4HC 2Q8AL 4AQOA 4NNYB 2O61B 1SY6H 4PJ7E 4K7PL 1WEJH 1YEEH 3GB7A 5L7XL 1NAMH 5D7KD 3JV6A 4LHUB 3DURB 3MBEA 5HGAA 5J8OA 3A6BH 4HHAB 2WWMD 1D5IL 1JVKA 2VABA 3O3DB 5F93C 3T3ME 2VDPH 3E1F1 4GLRH 1WBZB 3WN5A 4CRPA 3EYVB 1FVEB 2OZ4H 4Y5XC 5CJ5A 4WHYG 5DHYA 3PWPA 5J6HB 1HOCA 1S7RB 4OM1L 4EI6A 4WY7L 2XWBB 4XCCL 2X4SB 4MQSB 2B2XL 3GKWL 3QQ4A 1FVDB 3C8KB 4NKQB 3IXAA 4LASL 1S9XB 3TJHD 5KS9F 5E8EA 3MJ8B 4C4KT 2VO5A 4LLUB 3I6LE 1IGTA 1LILA 2NY5H 3MR9A 1QYGL 4X4XB 4GAYB 4C59B 1DBJL 2NCMA 3AY4A 3O45B 4WHCA 1T7YA 4ZS7H 3MJ9H 1A6PA 4YE4H 5J89A 2YWZA 3KYOA 4OLUL 2VDKL 2NY1C 2XG4A 2I5YL 3VXPA 1R3KA 2DTMH 1KTLA 3OKOA 1NLDL 2WP3T 2R0ZH 2WLZA 2Y07H 4JHWL 4UT6L 1RJYA 2VR5A 4KUZH 3GSRA 3ARUA 2VSDA 1C5CL 2E27H 2JCCB 2P47B 2UY6A 5DK0A 2WBWB 5I30L 3PJSA 4ALAH 3VRJA 1A6WL 3MV9B 4Y4KA 3QPQD 3MRRA 4KHXH 1MH5B 4C54A 3ROLB 1N59A 2HLFC 4XVJH 5M95B 3GNML 4NZUH 3OJMB 1KJMA 4FQIL 3O6KL 4N9GA 1UZ6F 3P0GB 4YFEA 1GGBL 2EKJA 4MX7B 1OTSC 5JXED 3QULA 1P7KA 3GMRB 2XA8H 1JZ2A 2J4WH 2FCBA 5IMLB 2DQHL 4YDKL 3QG7H 3CH1A 4FXKA 1RMFL 2YKLH 4OUUA 1S78D 2YD8A 2R0WH 3H9SE 5J06A 2AKRB 3MGTB 5GGUB 3V6ZB 3BSZL 4JJ5A 1DBAL 5DQDH 2CDFA 5FCSH 5I8CA 4WHTA 3RJDA 3QHZL 4MNQB 2YA2A 5C2BL 3ARDC 1P5VA 4L1DA 3K1KC 5CINL 2J6EA 1EXUB 4ZXBD 2BHZA 4B7LA 2YR3A 3GGWA 3OJDB 4P9HC 4XBGA 5EUOE 1HHKA 2FO1A 1J18A 1PEZA 3E6FB 3WS6A 2F54D 1ACYL 4WI8A 1FZKB 4YAQB 5D2LB 1XCTB 5FF6B 4KK9C 4QXGH 4EN3C 3QEQA 5GGQH 4HCRA 4YDJB 3T0EC 4DQOL 2VDNL 1CXHA 4Z7VE 5CSZB 3S8WA 3AFLA 1KNOB 1NL0L 4NZTH 5C92A 5DJYA 4UT9L 1CIDA 2ZOLA 2EDWA 5D71H 1S7QB 4LSSH 3HZYB 3QUXC 1CN4A 2EDNA 3NCMA 3WS3B 2NY0B 2ESVB 1ZHBB 3FB6B 4KJPC 5KSAA 4TUKL 4M4RA 3FQRA 1B90A 4NN7B 5JO5B 4NHUA 1QPXA 4URTB 2CIIB 2XTJC 1IM3A 1I7UB 5FO7B 3FO9A 2H9GB 2V2XB 1MPAL 1RIVL 4JG1H 4NO0D 3MRDA 3STBA 2F8OA 3FZUC 1BZ7A 4NCDA 4KV5E 1PQZB 3PWJA 5CJQH 4MD0B 5CZVH 4CU6A 1FFPB 5DJAA 4MD4B 3IFLL 4PJDB 5AYQA 4M5ZH 3MACL 1MY7A 4I2XE 3O81A 3VMOA 4BFEA 3GSWA 1NMBL 3S3JA 4F7PA 1OSZB 1RPQA 4PJ8B 4TSBL 5D9SB 4PV8B 4NNPL 2X4NB 2EYTA 1DUYA 4UNVA 4J23A 1SEQL 5E8OA 3QCVL 5F7MC 2UWEF 4G7VL 5H35A 5EULV 1NLBH 1M7IB 5AUMA 1X5GA 1N64L 4J7RA 3PL6B 2Y72A 4PRPA 2X10A 1HCFX 5L2KA 4WO4A 3CX2A 1KC5L 3VH8B 4P2OB 1G9EA 1UCBL 5D93B 1JWSB 4ZDHB 3FT4B 2NYYD 3F7VB 3HNVH 1WZLA 4YEEA 4HPYH 4PJ5B 5SX4H 1FGVH 4OGYL 4GW1B 4F37F 4MA8H 2DQJL 3G5XA 1MWAL 3HZKA 1UJ3A 3EOYG 2ATKB 3C08H 5FKPA 1TFHA 5E6IB 1OCWL 1A8JH 5CP3A 3RWIB 1JPGB 2A74B 3TBWB 3H9YA 4K3JL 5I73B 4MLIA 4UILL 5J13C 1UM6L 3O6FA 4QHNB 2A9NL 4MQ7B 4R4NC 4U1SB 4PGDB 1CGTA 2Z8SA 1KPVA 3WJJC 4Q9CA 4D8PB 3C5ZB 2HN7B 5F89B 1BOGA 2CXKA 3RIFK 1HILA 3ARRA 1LO5B 3SE3C 5E2UL 2VLLB 4NCC2 4GXVL 3DUHA 2HFGH 5EC2A 1TDQA 2IMMA 3VFUB 5E2WH 2NZIA 3DMMD 3GSUB 1F5WA 1QBAA 2A6IB 3W82A 3UTQB 1VACA 1N4XL 3LH2H 3HLAA 1IGJA 5TDOB 3SGKA 3KJ4C 4QHKI 1J12A 1ORSB 1GOHA 3MRFB 5MEPA 5DJ0B 4HS8H 1J1XL 4AMKL 5IFJA 3MJ7A 2I07B 1A1NA 4V2BA 1JWUB 2YXMA 1MLCA 4HKXB 1ZLWK 4OZIB 1UGNA 5D1XD 5BVPL 4HUKB 4P46A 5F3BB 1I9RH 4J3TA 4K8RH 4GH7B 1LHZA 1J8KA 2WW8A 1YJDH 5ANMB 1MQ8A 1C08B 2B0SL 3BDYH 1H0DB 4MQXD 4PJIA 4QXWA 4NFCA 3W9EB 1E28B 1ZVSA 2WV3A 2PTUA 4OCWH 3MV01 5HVGB 1L6XA 3ZDYF 2VLJD 3RNKB 3AM8A 4CJ1A 5SWZD 4Y8DC 1GYAA 5BOZG 3HE6D 1NCCL 1KLFA 3I3EA 2GY5A 1U91A 4HH9A 3GBMH 1D6VL 3QWRA 2BK8A 2D7QA 1F4WH 3MRLB 4TUOB 1F3DJ 4IJ3B 3UTZA 5L6YH 5JHDD 2F8XC 4RZCB 2BSSA 3QP3A 1CCZA 4PGBB 1XIWC 1BFTA 1FRGH 2Y7QA 5F1KC 3Q3GA 5IVOA 4KFZC 1MHCB 2EEBA 4PGZA 1YDPA 3NIGF 5KN5B 3KPQA 4X9HA 2OTWA 1BQSA 2EO1A 3BPNC 4XZUA 4JO1L 1JWMB 4LSVL 3VI3F 2FHBA 3HS0B 5I9QB 3LN5B 1I8IA 4NQCA 1OAKH 3CLFL 4OLZL 2D4DA 1KF9B 3ET9F 1UB6B 1EA9C 4HXBL 1JZ7A 3MGAA 5HGDB 4U33A 4J3SA 5E4IA 4XNQA 1GZPB 3KG5A 1T89A 2Q20A 3EYUL 4JDVB 1INQA 2BRRH 1FVCB 3BQUC 3FO0H 4KHTL 2V2WA 1XGRA 1B3JA 2F19L 4ETQA 4XNXL 4OD3H 1JNNH 4G8GA 4AH2A 3HR5A 5IB3A 3LV3B 4OFPA 3NCJL 4GJTB 2EDLA 1UM5L 5FA3A 5AWNL 5INDA 4BM7A 4XP5H 4M43H 3EFDH 1OM3L 4XXCA 4MDJB 4WI6A 1NMAH 5DJCB 3KPMA 3IAGC 2JCCF 5F7UA 2AEWA 5J11C 3ULUC 4E41E 3U48A 2NY7H 4L4TA 4ZS6C 4N0YL 1MAKA 3S88L 4L8CA 5E2TL 1RZJC 3KLAB 5LWYH 4L3AA 5C08A 4PJEA 4WUKH 1VEOA 3MLVL 1CIUA 1HWGB 4GBXD 5TE4H 2CQVA 3GSVA 1FO0A 2DS4A 3B8YA 3NH7L 4WU5A 2RFXA 4FXGB 3BT2H 2PNDA 4TOYH 4QNPE 1JNLL 3O9WC 1UWGH 4PLJC 2HT4C 3MLTB 3MLWL 1JZ8A 3DHJA 3QQ9C 4NN5C 4YXKH 5JORA 2EC8A 4GQ9H 3VXME 4JQIL 3MV8B 1H5BC 4LCWE 2H6PA 4KXZH 4X7TB 2VLRD 3P30H 3DI3B 5E08L 1P7QA 3CSPA 5C0IB 2GTWB 5IK3B 3QUZB 3VFPB 4HX1A 3WXWL 5JDJA 5KJRH 3A0OA 1QP1A 4OQTA 1MAMH 1FNGB 1U8IA 1U95A 5ALBH 4NZDA 3P9MA 3EO0B 5L8KB 3DETC 2VWEE 3CMOH 4P2QE 2CKBA 5DFWH 4R90L 2IPKB 3T2QA 3QXAA 4HIHB 5C0JA 3PUCA 4NKMB 5IP4A 2AXFB 5EU3A 3S6CA 1LEGA 3I6KA 5C0RH 1RIHL 3C6LA 1T0MA 1BF8A 1M7DB 5BRZD 3RUGF 4R2GD 4OV5B 4U7MA 4YHPB 1A14H 3U0TB 5C0NC 2BY1A 2QSTA 4I0KA 5TDPA 5F7LB 4F9LC 3TJEL 1DL7L 2HP4A 3T3PE 3ARTA 4GRMB 1GC1L 3VFSB 1K8DB 4FFZH 5L2JA 1J1OL 4R6UA 5DJ2B 5I66A 3H7LA 4S1DD 2C9AA 3OR7B 3TT3H 4PUBL 3VXNB 2ITCA 4QHKJ 4U4BA 2N7BA 4N0CD 2FB4L 3IJHB 3AMLA 2C3GA 3PGDA 5JDSB 1QVOB 2MCPH 5C8JB 4L8DB 2X1XR 3WXVL 1XGTB 4U6TA 2BOBB 5HGGS 5IBUG 5CP7A 1SM3L 2Q7YA 1P4BH 3HUJB 5CGMA 5ISZD 4Z7WF 1IKNC 5F96L 1NGXA 4EDWL 1YPZB 5L88H 1KG0B 2F53E 4PJDF 4WW2C 1ORQB 3BDXA 1HINL 2WBJC 2V7HA 3RZCD 2W65A 3HPLB 3O2DH 4LRIC 2BSTB 3FFCD 2CO7B 2DQDH 4ZO6A 3DXAB 5D7IB 5C0CD 3TBVB 1DSFH 1YC8A 2AJSH 3O3BB 4ZPVA 2AJVH 3UJJL 1HYRC 1TENA 5C0BE 1RZFL 4CJ0A 1QTYT 3RU8H 1B9ZA 4JY4A 3S96A 5IB1B 1EEUA 3HNSL 1F90L 1R5IB 5IQ7L 3BIKB 2Y06H 4R3SB 5T1MB 1S5IH 4GMTH 4ZYKA 5ID1B 3FOLB 3D3VB 2AXHA 5DD3L 1PG7H 5DTFB 4Y2DD 3BXNB 5F8RC 2NXYC 3B83A 4LIQL 4OFYA 5GRZA 2D7PA 3NFSL 4CVXA 4NSKA 3R1GH 4Z78A 4M6NH 2YSSA 4WW1A 2HKFH 3BZFB 2PETA 3W81A 1LO2L 4LHQB 3RPIA 4O4YH 1MHPH 1FL3A 2P8MB 1AGDA 1KN2H 4PLNC 1A6UH 2D3VA 1D5ZA 4JG0H 5BZDB 2OI9C 4EUPB 5CHNA 3GRWL 4HMDA 2DWEA 4FQHA 1JUFB 3SDXF 4ODWA 3DSFL 3HE7D 4IDJH 3PWUA 5CIPH 1TVBA 1MFDL 3FHQA 4MA3B 4OCNC 3G5VA 4BH7B 1DDHA 4G6KL 4M7LH 4MVBC 4WTZG 3RL1A 5I15H 4Q6IA 1LEIA 4HUXA 1YQVH 3SE8H 3B6SA 3IGAB 1BREA 2FX7L 5F7EH 4CMMA 5EU4B 1UH3A 2P8LA 3HRPA 4LCYA 3I6GB 4OZGA 3UBXG 3K0WA 4PRIB 1EIBA 3MV9E 4WI7A 4X7SH 4X6CA 1NBVL 3LN4B 1QRKA 1I1FA 4QTIL 4QRQB 1DEEB 1H15B 1AI1L 1MCEA 1ZTXH 1FGNH 5D1QA 4LOUC 4Y4HA 2BFVL 4DKFL 2RQ8A 2CLRA 5E8DH 4JO4L 4AIZB 2FNBA 1JTPA 3LQAL 1KLUA 4ODBD 3GMLA 4KRPC 4KC3B 3R06A 4Y5XA 3KPNB 1D5XA 1MCPL 4AEHL 5JMRA 4WRLA 4R8WL 3SO3B 2DM7A 5F3HB 4N8PA 1RJZA 2OX5A 4HZLB 5BO1H 2EEDA 2L0DA 2C1OB 3HMXA 2Y6SC 2E6QA 3PXHA 4NPYB 1HH9B 2DMCA 4MNQE 5D96C 1BFVH 3RVUD 3VRLE 5TQ2H 1F6AB 5GS2H 1REIA 1JF1B 5J56B 1S8DB 3O0RH 3SQOH 1KB5B 3DBXA 3JBG7 4P3DA 5C07B 3MLXL 1VFBA 2MNUA 4RRPA 5I18L 1HHGA 3LD8B 5D2LE 5GXBB 1CDIA 4KVNL 2AJUL 3OXSA 4G6JL 4PJ8D 3D0VA 1J8HD 5C0AB 2W0FB 4I4WB 3QDGD 5JA9A 3ULSA 4ODXA 3PIQB 4BKLA 5LXGH 1JK8A 1NCAL 2DQFB 1RK0B 5EO9A 1U8PA 4Q74A 4UUJB 1LNUB 5IFAL 3VMNA 4DN4L 3L5JA 3THMH 4K94H 2FEEL 2FX8H 5HYJB 5F7YC 3ZSTA 4OLVH 5HHNB 4PJBB 5MEOA 3KPLA 1I3RB 2VDQL 3A67L 3KPPA 4PV9B 3ILQD 1HXMB 2ED7A 5T3ZL 1QD0A 4ZTOL 3SDDB 3W11C 4PP1C 5F9OH 2CDEA 2JELH 3ZDXF 1KJ3L 5DR5L 1A7RL 3QUMA 3Q6GH 1I9IL 2I60H 2VZ1A 3X14B 3OKEA 1DQMH 5IVZB 3MOBH 1GXEA 4UQ2A 1WZ1H 2BOCA 4GRWF 4HJ0D 1N0XL 3ARDA 3EJJX 5KVFL 1SVCP 2XWTA 5FM5O 1AHWA 2ARJA 3JTSA 5FUCC 5D6DC 4UNUA 3G6AA 2J6EL 4JFZL 3GK8L 3S98A 1INDL 3SDCB 4O9HH 4EN3A 1E27B 3OX8A 2YK1L 5E9DE 5K59F 3T0EA 4HUWB 4NGHL 3NBNA 2BVTA 3ZKQD 3IFNL 5LBSH 3VD9A 4JFOA 1J0HA 1HHHB 1KUMA 4RNRB 5T1LD 3LDBB 1T21A 2VISA 3TWCH 1F2QA 5TE7L 5DJ8A 1INEL 2ADJB 2J1KA 5TDNB 4LRNL 2FBJH 2OP4H 3QUXA 4ZFZB 5DJZA 4P3CL 2EH8H 3I85A 3BVNA 5GISH 3RWHB 3VFGL 3U36B 3WKMH 3S37H 3VXOB 3U46A 3EFFA 2EDEA 1GZQA 4MJ2A 4ZOEA 3MQIA 1P1ZA 3OR6B 4XVUC 3HAEB 2FR4B 3H9HA 3U4EB 5ICYB 4IRSB 3PDGA 1AIFB 3E8UH 2VE6B 4K23H 2DD8H 1T66D 2Q8AH 4JANB 1M4KA 5HHPA 4P4RB 2I9LB 1YEHH 1UVQA 4K7PH 5IKCA 1PX4A 4XWGH 3N1GC 4I18A 5FXCH 1EO8L 3GB7B 3SO5A 3QPQC 3VFVA 3JV6B 5HYQB 3D1MC 5HGAB 2VABB 4M8QB 3TESA 2J2ZA 3NIDE 5E1HB 5DHYB 3PWPB 2UZXB 3MMEB 3GFUA 3LRSA 1F3RB 3SE9L 5I1AA 4EI6B 2B2XH 3GKWH 5JXEC 1JYNA 4KQ3H 4PJ7F 3JWNC 1LQSR 3BISA 5J1TC 4OZIE 5K9QG 2EZ0D 4FQ2L 1MIML 3HUJF 3ZTNL 4OIIL 3PQYE 1EVUA 1S78C 1EZVX 3KS0H 3WFBH 8FABA 4X6FB 5ANME 1DBJH 3RWEA 2L7UA 1TVDA 5ETUA 4JGJA 4A6YL 1PZUB 2X4QB 1KCUH 3CJJA 4BQCA 1U3ZA 1DFBH 1CWVA 5HHOA 3VXPB 1R3KB 1WICA 1KTLB 1WAAA 4JHWH 4QRPD 4HAFA 1FLRL 4KJWD 4WV1C 1L7IL 2R0LL 1C5CH 1XGPA 3RX7A 4ODTL 5I30H 3VXSE 3HI6H 1MVUB 3CFBA 5DK0B 1B2WL 3WJJA 2MOVA 4C83B 1MQKL 4Y4KB 3K8MA 1CGSH 2ZSVB 3MRRB 4W6XB 3SE3A 3P73B 1G0YR 5GRVK 3B3IB 3L7FB 4Z7UB 3LOWA 4FQIH 1HKLH 1P84J 1IGFL 1JPSL 1BEYL 1KJMB 1GGBH 1WLHA 3QEUA 4WNQA 5CLWA 3B8SA 2W9DL 1G6RL 3VMPA 2X5PA 2EXWD 1UT9A 3QULB 5I17B 2DQHH 4YDKH 1P7KB 5FCUL 1YMHA 1N5YL 3ZMRA 3CFJB 2D0GA 4RGNC 3BSZH 2FLBT 4P59H 1PY9A 2YMXL 1DBAH 2IPUG 4JJ5B 4W70A 3BWUC 4XPAL 3ARFD 1CTNA 5J7CC 5GGVY 1UADC 4QWWD 5I8CB 4WHTB 5EBWB 3CFDB 3MV7E 3L7EB 1BP3B 5ABDE 2J12B 2NY6D 4ONHA 2FIRT 1X6LA 4YHOL 3B9KD 4LEOB 2UYLB 3GGWB 4XBGB 1ACYH 1CF8L 1HHKB 1W8NA 1KIPB 2OBGA 4F7EA 4QEGA 4D3CH 5MHSE 1ZWIB 2ZCKH 3VDCA 2VDNH 3BIBX 1OAXH 1JL8A 2LTQB 2DBLH 4ZODA 1OP5K 4YNYA 3QJFA 3SEPA 5E4EB 1NL0H 3U30B 1L7TL 4XX1G 3V7AG 4AG4H 1TIUA 4JHAH 4PJFA 2ZOLB 5ICZA 4GKNB 4IRJD 4XNMA 1UWXK 2Z31B 3D87B 4E0RB 2NX5E 1XIWA 3N85H 3TC9A 4I3SL 5KSAB 4XMKL 3FQRB 3VDAA 2I9TA 1DQTA 1YNTB 4MJ5A 4NHUB 3AB0B 2EYRA 2NYYC 4Z7VF 4KDWA 3KPRA 4HBCL 2X41A 1NGZA 1S7XA 5DRZA 3TVMC 4XRCA 5A16A 4BSWB 3HG1E 1F97A 2FD6H 3FO9B 2NTFA 5GGRA 3LKQA 1XGYH 1VADB 4D9QE 5GSVA 2FJGA 3V9FA 1FL6B 2DM4A 4MD5A 3U0WH 1WITA 3MRDB 4PRBA 25C8L 4U3XA 4Q9QH 2CIKA 2VUYA 5BXFB 1UFUA 4KH2A 3PDDA 4I13B 3O41A 4MXVF 3N9GL 2LU4A 2IQ9H 3PWJB 3UTTA 3IFLH 1MJJA 2W0KA 4JVPA 32C2B 4G8IB 3IRZA 3BQUA 3ZZ1A 3LEXA 3QDJA 4EZMA 1FIEA 4RGMC 2D9CA 4YDIH 3VA6A 1LO4H 4NQED 1KGCE 3U9PL 4ZNCD 1QFPA 3TH2T 1DUYB 5KANG 3RVXD 4ZNEE 1MVFA 5E8OB 1E4XI 5I16A 1NUDA 1H3PL 5LGKA 1N64H 2I25N 5AUMB 1CU4L 4RAUA 1BGXH 1KC5H 4PRPB 3BESR 2WZPD 4YZFE 3MLRL 1G0XA 2FECI 4ODUA 1NAKH 4MJ6B 4OGYH 3GIZH 1MRFL 3IKCB 1MWAH 1DTUA 3ZL4H 2BX5A 4GKOA 1V7NL 3D3VD 3ZYZA 3G5XB 3HZKB 1CD8A 1XZ0A 1UJ3B 2XZAL 1KEGH 2QQQA 5FKPB 4RFNC 4M6OL 4UILH 1UM6H 2A9NH 3QA3A 4JRWA 3I50L 5GGTA 4MB3A 4APQB 4C56D 4QKXB 3HZMB 3QFDA 1RUPL 2UUDK 1K2DA 1OP5H 3QI9D 4YUEL 3L6FB 4JFDB 3P4OA 1XF1A 1CR9L 5E2UH 2PO6D 3QIBD 3BRGC 1H5BA 1HILB 5FKAA 4GXVH 1ZHKA 3OTTA 2VDML 3V4UL 3AS3A 1G7PA 2WSKA 2A6DA 4GT7A 2FH6A 3UXFA 4HKBA 5F1IB 1IKFL 4M1GL 5EC2B 5TFSL 1YYLH 3T0BA 5JA8B 3IDGB 3QEGL 4HWZA 1VACB 4U6XA 5T1DH 5D7IE 4QGTA 1GPOL 1V05A 1IGJB 4NJAH 4OAWA 4RMTA 2DYPA 2GJ6D 1NGPL 1IFHH 5J12B 4DZBB 4OQTL 5IHLB 3H9SD 5IFJB 1FYTB 3MJ7B 1A1NB 1MLCB 4GS7C 5BVPH 1MNUH 4N8CL 1TNMA 4YWGL 2MPAL 1AP2A 3CC5A 4DCQA 1BAFH 5E24E 3QHFH 2ZPKH 4F9LA 5KVEL 3E2HB 4PJIB 1ZVSB 1W2KT 4ZAKB 3UEZA 1BX2A 3GBLA 1X5XA 4L3CA 2OL3L 4J6RL 4U1LA 3IS1X 1J05B 4OGZA 3O6LL 3OKKA 3LEVL 3F8UB 4HJJH 4IMLA 4QGYA 3QB7C 3TO2A 1TTUA 1D6VH 5CSBA 1QLEH 1H8OA 4HH9B 4E42A 5EA0L 4DEPB 3NCEB 3BKYH 5IW1B 4M1CC 2FX9H 2D03H 1P84K 3U2SA 3TPUA 2AEQH 2QQKH 4Z7NE 1P9MC 5T33L 1EK3A 1SMAA 3BJ91 5D2NB 1U2CA 3B9VA 1IKNA 1I1AC 4Q58C 2PKDA 2J7LA 3BH8B 3L3DA 3MZGB 1CI5A 1YDPB 4WW2A 1P4LA 2WUBL 5C86A 2WBJA 3KPQB 4LRIA 3B2VL 5E5UB 2VXQL 4LSVH 1P5UA 2W91A 4GBXC 4GKZA 2AQ3A 2LV4A 4OLZH 12E8L 3DO3A 1A9EA 4JPWH 4P5TC 2ZUVA 1I8IB 1RU9L 4NQCB 5ADPL 4KKAD 2NY3D 1ZVHA 4HXBH 1FH5H 3FOMA 3V95A 2OLDA 1CL7L 1EHLL 1IZJA 1EGJL 4ODHH 1R5WA 2HT3D 4XNQB 1MI5D 5D1ZD 3VI4F 3QDMA 3PV6A 2X89D 2V2WB 3JWDH 4ETQB 3NCJH 4J8RB 2DQGL 4AH2B 5CKAA 4M3KB 1I3GL 1ZT7B 4WFGD 5FA3B 3MNWA 5EFIB 5MENB 3F5WB 4WDIA 3RWGA 4PJHE 2OMBA 1XF5B 1W72B 5C0EA 4PB0L 2K9UA 4F15C 4K8RD 5E2VL 4OFKA 4JJHA 5F8QC 4N0YH 3NIFE 4QY8A 3O4OB 2FEDC 4L4TB 3D69B 5JIPA 3KLHC 4G6FD 4LLDA 3SDDD 4N1CA 3MLVH 1F4XL 4X9GA 1ZHLA 5DI8B 4EUPH 5C08B 3BEVA 3NCYP 3FL7A 5GHWL 4L8BB 43C9B 1HIMH 3GSVB 3NH7H 1T1WA 2GITB 4WU5B 3FB8B 5CBEA 4YBQC 1JNLH 2RFXB 3T2PA 3HI1A 4X5LA 3Q5TA 4LSDA 3VFOA 1P7HL 1Z9SA 3QQ3A 4LLVA 4JQIH 5ERWB 4HWNA 5C0AE 4L9LB 2FGWL 4ZFOL 5FYKE 1CGXA 1YMMA 2H6PB 4N0CC 1P7QB 1PBYA 3NAAH 1I7RB 3WXWH 4ZUWA 5DDHA 4HX1B 1EDQA 3NPSC 3U4AA 4G43B 4OF6A 2MKWA 3OKNA 4WWKA 3MXWL 3SCMD 3VRIA 1U95B 3TN0B 4PJBE 3MC0A 3P9MB 1P4IH 2JIXA 4HD9A 4PJCA 3P11H 1U8QA 3QXAB 5C0JB 3MYJB 5F7KC 3CUPA 3ESUF 5EU3B 3S4SB 4DOHE 4PGJA 4AENA 1LEGB 1CBVL 3H0TA 5IVXA 3TZVD 2WANA 1T0MB 3GSNL 3EDFA 2BJML 2FJHA 1DL7H 2HA1A 2VIRA 5DQ9B 3LZFH 3NCCB 5TDPB 1GC1H 2GK0A 3EDDA 4JB9L 4JM2F 2VAAA 4M9OA 3W0WA 3IDXH 4KDTC 3UROR 4L3EA 3VFMA 5FB8A 1MCLA 4HDIB 1QR1A 3MCLL 1NJ9A 4PUBH 4Y2DC 3FN3A 3W9DA 5I66B 3SDAD 2UZYB 1B6UA 1ETZA 5CILH 5F21B 2ITCB 2WM0A 5CEXB 3ETBF 3WXVH 2Z8VC 4OF7A 1MRDH 4O2FA 2Q3ZA 4NBZB 1F6FB 3T3PF 1YUHB 1NGWA 1IGCL 3BRDA 2IBBA 3EYSL 4EDWH 2DF3A 5FYKH 2HFTA 3RDTD 3NN8A 1KCKA 1XF4A 1MRCL 4H25A 3WUWG 4QOKA 4JZNA 2V7HB 2W65B 3DX7A 2BVEA 3ZKND 2IG2L 3GUTA 4ZFGH 1QLRA 3UJJH 4LARH 3S35X 1D6EA 3I84A 1JN6B 4U31A 1VSCA 4OBRA 3HNSH 3BP4A 5FUZL 4JY4B 2HFFB 3VGGA 5DK2B 1C5DA 4NJ9H 3BDBA 3VFTA 1GOGA 5GRUL 5HBBA 5DD3H 4ZYKB 4G3YH 5C0FB 3GJEA 1EPFA 3HPJB 4NSKB 4Z78B 2P5EA 5E8NA 2ILLA 2YSSB 1LO2H 4TNWK 4W4OC 4WW1B 3PWPE 5D6DA 2BHYA 3Q5OA 4KPHH 2DLGA 4MLSA 3T2OA 4EI5D 3RPIB 1A7QL 5IOPA 3FQNA 4P9HL 1TJIH 4JM4L 1DLFL 3WLWD 3HC0A 1AGDB 3CX5J 3BPOC 4NN7C 1ZA3A 3S36H 5FYJL 1WBXA 3KVQA 1D5ZB 2AABL 1UB5B 2C5DC 4PRHD 2WINA 4YGAB 3DSFH 1BIIB 2DWEB 4OGAC 3ARBB 4ODWB 2EDYA 1Q9LA 4G80A 4QT5B 1TVBB 1JTTA 1TLKA 1R3IL 4KZEL 1A9BA 1DDHB 1FC1A 5DFVD 5F9JB 3RL1B 3L3JB 4JY6A 3UTPD 2LVCA 4OLYL 3RVUC 4Q6IB 1FYHB 1LEIB 4R96A 3EGSA 1SQ2N 4HUXB 2MWCA 3T08A 4CMMB 3RX8A 4UIKH 5JPMA 4OLEA 1NEZA 5GS1C 4OZGB 1T1YB 3QO1A 3DV4A 3HAEH 1RJLA 2VSCA 3LKNA 5AAMA 4X6CB 1IAIM 4QTIH 2C3XA 3MLUH 4PJ8C 2HMID 5D1QB 3IYLW 3T09A 4Y4HB 1QG3A 4F2MA 2CLRB 1T5WA 2VLKB 4LQ1A 4WI9A 3L3GA 2YN3A 2YEZA 2FDBP 2NPLX 5F7DA 1EH9A 1F4YL 2WWKT 1H3UA 5CWSB 3G5YA 3PL6C 2Q6WA 1GGIL 1KLUB 3GMLB 4JM2D 4AEHH 1J86A 3DLQR 5H2BB 3V8OA 1D5XB 4HQQH 4FQXD 3LKRA 2AK4D 3BPCA 5JXEA 3LS4H 4CN1A 3TIEA 3ILQC 4IOSD 5JOFB 5IQ9A 5E6IC 3BP6B 1A4JB 1RZ8A 5I73C 2XY2A 1FV1B 3MLXH 3DBXB 4R4FL 5I18H 3C5SB 4YGVB 3VWKB 1MFBH 2NY1B 4X6BB 1RFDL 1XR8A 4DAGL 5EU6B 1HHGB 4JQXC 1KPRB 1IBGL 4HJ0C 5BV7H 1EV2E 3MBXL 4WV1A 4ZXBA 1KIUA 3OXSB 4H8WH 4LCCC 1G6VK 3RWJA 3VRLF 3VGDA 4ISVA 3D0VB 5E7FA 1OPGL 2CUHA 4HK3J 2V9QA 2F54A 3RGHA 3CVHB 3QRGH 1NCAH 1A7NL 1HYSD 3ULSB 4ODXB 5SWSB 1T20A 4BKLB 1SMOA 3KWWA 1U8PB 2F53D 3SE4C 5IFAH 1QFOA 3F7RA 1XEDA 5FFLA 4NQSB 2HWZL 2P42B 4NO5A 1YEDA 2OMNA 5ESVB 4KK5C 2DAVA 4FZEL 5I1KH 4X80L 3MROB 1J0IA 5FYKU 2VDQH 5IHBA 5CZXD 3ZYIA 5DZNA 3KPLB 3WKNA 5T3ZH 1MCFA 2APVA 4ZTOH 1AGFA 5C0BD 4Q6YA 1AKJB 5DMKA 3ULVE 1BD2B 1FG2B 3LVEA 5K9JL 5ITFA 1X5JA 1IL1B 1A7RH 2CDEB 4Z76A 4NQDD 4GAJL 4NO0A 2ZCLL 4JFDD 3OKEB 4XT1C 5KVGH 4JE4B 3IFOA 2V5YA 2XN9B 1DBBL 5HGBB 1N0XH 5DUPL 2PXYB 3BAEL 1AO7B 2W60B 5CD3A 1S9YA 1PDKA 2GAZA 2C3HA 1AHWB 2ARJB 1IQWL 4FABL 2DDQH 2J6EH 2WQRA 3GK8H 4ELMB 4LLYA 5KS9A 5DT1L 2YK1H 2QSCL 5F1OB 1IM9D 4HKJA 4PG2A 4EN3B 3B5TA 2FH8A 5D6CB 3T0EB 2UV3A 4PRPE 5I74B 5IWLA 5ECJE 5L2KE 5GS2D 4OM0L 2YD5A 5GGRY 2B4CC 5B39A 2VISB 1FYTD 4JZOB 4DFHA 4LRNH 2I27N 2Q86A 3BGMA 1WC7A 1X7QB 5DJ8B 4P3CH 3VFGH 3QUXB 1L6ZA 3OB0H 5I9QC 5AG9A 4KTEL 1JHTB 4O51A 4WUUA 1MUJB 3CXHJ 4K7FB 5DGRA 2VQTA 5AZ2H 1J0KA 3EFFB 1AXSA 1F3JA 3N06B 4CU8A 1GZQB 3UTSD 4LF3A 1P1ZB 5C6TH 3HI5H 3X3GL 3AS2A 4ZAKD 5B4MD 4XCNA 3QNXA 1EFXD 2FWOA 4YBLB 4YR6A 2HVKA 1Q9KA 5DEFA 4QXUL 3WFDL 2Y25A 4UIMB 3CK0L 1IEBA 3ULVH 5KSVB 4YXLL 1CICD 4FQPA 2F9BT 5HHPB 3MLSL 1EBPA 3QYCA 2JK5B 1I4FB 2G5BA 4HIEA 4I18B 4TVSa 2LU3A 5ICXA 1RURL 4AEIL 4FMFA 3ZLQC 5AAWA 1Y18A 4U1IA 4WFFE 3CX5K 4KMLB 4DK3A 3F6LA 4OJFL 1IC7H 1K85A 2YPLD 5FGCB 2CO6B 3DMMA 1UM4L 2DQEL 3ZE2E 2EXWC 5AD0B 1UZ8A 2J8HA 4H5SB 1YEFL 2D7TL 1MIMH 3ZTNH 4OIIH 1R3LA 4WI2A 1LP9B 2XICA 1G7IA 1YEIL 5GS0L 4AEFA 3RWEB 2ZG2A 4HWUA 4UOW0 3EDEA 3NIDF 4PJIE 4LAQL 3KYAA 5ETUB 1WJ3A 3WIHL 2EKSA 1RZKC 4OZFA 3F62A 1XCQA 1X5YA 3QXDB 4FTVD 5D1XA 2IAND 3GSXB 4LSUL 5HHOB 2D9QB 4J1UA 4ERSL 1L7IH 4HJGA 2PTTA 2EDRA 1ZV5A 4ODTH 4P4KD 3UO1L 4BELD 1XGPB 1QFUL 5CP3H 3F7QA 5J13B 5I75C 1B2WH 1S9VB 2I26N 3WV0A 3CFBB 4YHIA 2YUVA 2VLJA 1MQKH 5MEND 2ZJSH 5SWZA 5IG7A 1CDYA 5CD5D 3MREA 1QBBA 1MEXL 4D9RD 2DLFL 4BSVA 4W6WB 3WSQL 4Y19D 1IGFH 4KZDH 4F33A 2HH0H 1TMCB 1RK1A 2W9DH 4WNQB 4ZOAA 5JHDA 3QISA 3GMQB 4WTWA 1N5YH 1BWWA 1RV6X 1YMHB 4NQCE 1S7VA 2J8UB 3ARZA 5IJVB 2YMXH 4ZO9A 3REWB 3MUHL 4YHZH 1KJVA 2ARWA 1MSPA 3HC3L 2M26A 5D5MF 1A6TB 3D0LB 4HZAA 3S9DB 4KKBD 2ZOKA 3VD3A 1LVEA 4JPKL 2H2PC 3RGVD 2YHGA 2NZ9D 1FNEA 4KAQH 3WO4B 4G8GE 5CMAA 2UWEA 2QV2A 1YYML 2EIDA 2GCYA 5CEZL 1DQQA 1NUGA 1KJ2L 3QNZA 3WNKA 1JHKL 2BZDA 4WEMB 4JDTL 5E9DD 4DVBA 4F7MB 1S9KC 5EZOL 2W0LA 2VXSL 1N26A 2JB6A 5GGVH 3QJFB 5HYSA 1CFNB 4GG6A 5E94B 5FK9A 3EZ8A 4L4TE 3G6DL 1JI2A 1P9MA 4IMKC 4PJFB 1EUTA 1JGVL 3R0MA 5C08E 4I3SH 4PJEE 3D48R 4XMKH 2ZCHH 4XNMB 1I1AA 1XIWB 4HV8A 1JGUL 3QWOB 2I9TB 1BVLA 4N8VG 2GTZA 4MS8D 4HBCH 2BNRD 2EYRB 3DOSA 3RI5F 2A6JB 3BPNB 3KPRB 1NGZB 3KXFD 3TYFA 4NC0B 4GBXA 5A16B 5BS0B 1VGKA 3LKQB 1QSEB 4WENB 5GSVB 3F12A 2FJGB 1F11A 2HJFA 1P2CA 4POUB 1OY3B 3MNZA 4XXDB 4UT7H 5HXMA 3UTTB 4RFOH 1FZOB 3QI9C 1MJJB 1BQHA 4NQXA 1DLHA 1B4JL 4QHMA 4YX2L 2PO6C 4KJYB 2DL2A 4HK0A 2X4RA 3BQUB 3CGTA 4HFUL 3H7BB 4BZ1L 3WHE0 5GSRA 3F7PC 3ZYOA 3AUVA 4PGCA 3PP3K 3OAZH 1N8ZA 3NZ8A 5HHVH 4ESKA 4GFTB 2ZSWA 1AE6L 3QG6A 4K7PX 4OD1L 4RAUB 2LVEA 5KVDL 4Z18A 3CXHK 3V52L 1PFCA 1Z5LA 4IRZL 2V17L 1MRFH 4ODUB 3RY4A 3WFHA 2XNAB 5I1IH 4G9DB 2V9RA 5D7SH 1CZ8H 3BGAA 4O58H 1KTDB 1VFAA 5FUOL 1BM3L 1FO0H 3P4NB 4R7NB 4QRRD 4K3HA 4HLZG 2DWDA 4GG8B 1A3RL 4L29B 5D4QA 5MI0B 3GMMA 1HNFA 3QA3B 4JKLA 1EO5A 5D7JB 1CGWA 4DUXA 4HFWB 2AV1A 1QFWL 5TE6H 3P4OB 3V4UH 4KRNA 2VDMH 1FDLH 1SY6L 3C09B 1ZHKB 2H32H 1QRND 1IKFH 4M1GH 2A6DB 5TFSH 1XFPA 3O3DA 3RWFB 1HHJB 1WBZA 3QEGH 3FAXA 3EYVA 1FVEA 4Z7QE 4I77H 4KY1L 1S7RA 3SO3C 2XWBA 5ISZA 1GPOH 2X4SA 4U6XB 3ARBD 1FVDA 1QA9B 3GHEL 1S9XA 4OQTH 3LSOB 2YD4A 4LLUA 2VITA 5FDWB 1FFRA 2CKBH 3FFCA 5GZNC 2V6HA 4JRXD 3TIDB 3O45A 4LU5H 4YWGH 5C0CA 3QEHA 2MPAH 4L4VD 1OAZH 1RD6A 1OARH 1OQOA 3MJ9L 4RMWA 3CC5B 4YE4L 3MV7D 1MJ7H 4KI5F 4X98B 4DCQB 2NY3C 3DUSB 3WE6A 4YHYB 2EDJA 2DTML 1WK0A 2QHLA 2R0ZL 2Y07L 2OXGA 3ZTJH 1UKQA 3HRZA 4KDTA 1BX2B 2JCCA 2N1KA 4L3CB 2D0FA 1HSBA 3O6LH 4Y2DA 3LEVH 2V5RA 4PR5A 3V5KA 3OKKB 4ALAL 1MH5A 1H8NA 4Q9RH 4KHXL 4J3VA 2NR6D 4UB0H 2HG5A 3QFJB 4UDUB 4Y5VA 2HRPH 4XVJL 3TPUB 1GJIA 3IDIB 4MX7A 1IVLA 1KIQA 4YEFA 4QRTA 3GMRA 4LCUA 2H41A 5DMIH 1G9MH 3AAZA 4K9EC 3B2VH 4LVHB 3SDDC 4LKCA 3KPSD 3QG7L 4HUVB 2YKLL 2AKRA 5GGUA 1F58H 1NGQL 3HG1D 12E8H 4OT1L 3SGDI 2QADB 2R0WL 4GKZB 4YFLI 3HE7A 1R0AL 5DRXB 4ORGB 3VWKD 4OZGE 4OZHB 3V8CA 4LSQH 3SDYH 1CL7H 1EGJH 2BY2A 1DBMH 4MXWL 4X6CE 3GSOB 2CMRL 1LP9F 1AXTH 1ODAA 1JP5A 1EHXA 3RWCB 2ED9A 5DRNB 3QDMB 4YAQA 1FZKA 4GSDH 2DQGH 4P5KA 3OKDB 4G6AC 4N8VB 1FAKT 3NACH 1I3GH 4QXGL 1IGMH 3MODH 3RAJL 1KGCD 2PCPA 3ARGD 3K4DA 3MNWB 4W4OA 3LDBC 4XPTL 4WDIB 3RUGA 3RWGB 4PB0H 3INUL 3SCMC 1S7QA 4PJXF 2ESVA 2MCG1 3FB6A 2K3TA 4ONGL 3ALXA 4QY8B 4HT1L 4Y16D 1JPTH 3VGHA 3PHQB 4LLDB 4I9WE 5DWUL 1BD2D 4XNYL 4I5BB 1U8OA 1I7UA 5FO7A 5E2JA 3TZVC 3D39D 1YQ2A 4WU7A 4PREB 3DJ9A 3QZWG 3RVTD 1T1WB 4IRSC 2VL5A 2EDXA 2RJMA 1KELH 1IGIL 4JG1L 3HI1B 2EXYD 5ENWA 3NIFF 3K2UL 3VFOB 1PQZA 1ONQB 1AO7D 4M7KH 3W5MA 5DVKA 1JZ6A 3Q6FA 1FFPA 4MD4A 5CJQL 1JHLH 3TNNB 5CZVL 3GBNL 5GS1A 1DVFB 1Q0XH 4PJDA 3D9AH 1KN4H 4A2MA 1C8PA 5BVJA 4PJ8A 1V5JA 4FG6C 4PV8A 4WGWB 1J8HA 3RRQA 5DDHB 4NBXB 1R3HB 1VENA 3V0AC 4WWKB 4KI5D 3CPLA 4P2RB 1M7IA 3VRIB 5SWQB 5IFHL 1QACA 5LAXB 1F00I 2X4UB 3PL6A 4A6YB 4PJCB 5ILTH 1U8HB 4F3FB 1H3XA 1U8QB 3AREB 4KMTH 1CBVH 3CUPB 1JWSA 2V7NB 4Z95H 2P8PB 4ZDHA 4AENB 2XZCL 5HDBE 1ND0B 4PJ5A 3UAJC 1CXFA 3H0TB 4JPIA 4GW1A 3P77B 1U6AL 2NW3A 4HPYL 1FGVL 2FJHB 4MA8L 3TYGL 1JRHI 3HMXH 5C70A 3C08L 2VIRB 4MHHG 2ZUUA 1JPGA 1PKQA 3TBWA 1OP9A 5IJKC 2D7NA 4QHNA 2VDLH 3OJVC 4U1SA 4B0MM 1KCRL 5CCKL 1CD9B 4YHMH 1NJ9B 3W9DB 4R0LB 4D8PA 4HC1A 4JQXA 1D9KB 1ETZB 4Y4KC 5F89A 5EH1A 5IVNA 5EBMB 3DVGA 4XPGH 2VLLA 2XA3A 3MCG1 1UEYA 4MAUH 5HTSA 3T0EE 1FQ9C 5I8OH 4X9BA 1RZ7H 4LCCA 4H1LG 4O2FB 1IGCH 3VFUA 3DX9B 2P46B 4TRPL 3QJHB 4WFEE 2A6IA 4OV6F 5E2WL 3UTQA 4LL9A 3KPOA 1OW0C 2GHWB 3NN8B 5IBTL 4JR9H 1D5BB 3RKDC 4JFHE 1UCTA 3NCYS 4KTDL 3LH2L 3SE4A 5C9JA 4H25B 5C6PB 1XF2A 1FFNB 5DJ0A 4QOKB 4JZNB 2IG2H 1U3YA 2I07A 1JWUA 4HS8L 2XTJE 4HKXA 1QLRB 2XZZA 3X13A 4ODSH 2IAMD 5DFVC 4I0PD 4HGMA 3CAFA 5JIHA 1E4WH 1FNFA 4KUCF 1OTUD 3BP4B 2AI0H 5DEGA 3GO1H 1BFSA 5GRUH 3WEXB 2FRGP 4PLKD 1YJDL 5I71C 1MY5A 3ZDZE 3BDYL 4E5XA 4FA8A 5J4MA 3RTQB 3LS5H 5I1HH 4M03A 1TVHA 4TVPE 3EHBC 3OGCA 4Q0XH 3WHXB 4L4JA 3GJEB 4OCWL 2BVPB 5FDYA 5KBNC 3QUMH 3BX7C 2LTQC 1KXTB 1KTRL 3WNLA 1U3HD 2HMIC 5IW6A 5E4EC 2P5EB 4XGZA 3U30C 4HIIB 4MB5A 3MRLA 3GBML 4JVUA 1TETH 5FGCE 1IT9L 3TNMA 5EO1A 4P9HH 4JM4H 5KSBF 1DLFH 4O2CB 5IOPB 3FQNB 4RZCA 3UMTA 4U0QB 3MOQA 2Z31C 3CIQA 4QHLB 2AGJL 3HC0B 1QNZH 5I1EH 2E7CA 1MHCA 4JM2C 2VL4A 1WBXB 3L95B 4H26A 4PLOB 4G9FD 1IQDA 1Y6MR 4FQXC 2WINB 2ZKHH 4JFFB 2HJLA 3QIUD 4WI5A 1R3IH 3W2DL 4HW6A 4PGEB 4OLYH 4OTXH 4PS4L 5HHOE 4JY6B 5TJWK 2Q76A 4U0RB 1WAAE 4R96B 4TPRH 1PAMA 5HGDA 3C6SA 1GRWA 35C8L 5JPMB 4Y8AA 4JDVA 5H37H 3QO1B 3SGJC 4QRPA 3FO0L 5A3ID 3FHAA 3LV3A 4XC1H 2KZWA 2Z92B 4OD3L 1JNNL 2NY4D 5F71A 3MRBA 4F2MB 4JFEB 4TVPH 3QZWB 1HYSC 2EDFA 3HNTH 1J87A 5H94A 5FO9B 5DD6B 3O3EA 4XMPH 3G5YB 1KFAH 3ABZA 3VXRD 4AJ0A 2Q6WB 5FECB 4YHNA 3O3AA 4EJ1C 4LVEA 1QBMH 1X6NA 4XVTH 5C3LD 2NY7L 3KLAA 1ZLVH 3LKRB 1BZ9A 5CZXC 5LWYL 3LAFA 4WUKL 3G5ZB 4CMHB 1OB1A 2LAAA 2DIBA 5EZJB 5IQ9B 4FXGA 4NRZB 5E70A 5DC0A 4KQ4L 3MRKB 3BT2L 3PGFH 4TOYL 5LCVL 4APQC 3ARFA 1UWGL 1Q9OB 3G04B 4K2UH 1CD0A 3I75A 1NAMA 5FYLE 2P5WD 4OI8A 3VGEA 1XR8B 4GQ9L 3MBXH 3MV8A 4G8EB 3E0GA 4DN3H 4F8QA 5JW4N 2GT9B 4X7TA 1CLCA 1BOYA 4WV1B 2QKIB 2OZ4A 4ZXBB 5FGRA 1OPGH 5IK3A 3RWJB 2NNAB 3VFPA 5DK3A 2CSPA 3HN3A 4OFDA 2DICA 2APWA 2MKLC 2F54B 5E5RB 4XI5D 1N6QH 1Z9OA 4PJFE 1T20B 5KJRL 3V5HB 1FNGA 1XT5A 3D85D 4YDLC 3KWWB 1MAML 1TJHH 4MCZA 4P48A 4OGXH 2IPKA 5ALBL 3N1QC 3QXTA 4NKMA 4NO5B 4UU9A 1B0WA 3MTRA 2AXFA 3KPRE 3GSQB 4IRJA 4GW4B 2FO4A 3KLDA 5C0RL 4YHPA 4OV5A 1HH6A 3U0TA 5DMKB 4H1LB 2OL3B 5ITFB 5DO2D 4GRMA 3QCTH 4ZAKC 3VFSA 1ZSDB 4GAJH 5D7JD 3NPZB 5B4MC 4Z76B 3UTTE 5KOMC 1I1CA 4NO0B 4NO3A 3GKZA 5DMGD 1ZAGA 3BHBA 3OR7A 3BGFC 3CZJA 3MBED 1CICC 3QDJE 5CD3B 2GFBA 1S9YB 3TT3L 1B0RB 1IQWH 1CLOL 4DEPC 4S0SD 2GAZB 1TCMA 5JDSA 2PF6A 3AGVA 1XGTA 3GEWB 4FP8L 5D7LD 4NM8H 2MCPL 2QSCH 1LK3L 5DD5L 4LLYB 5KS9B 3MRQB 2B1AH 3HUJA 4JGUA 2VLMD 4JAMB 5D2NC 1P4BL 4UDTB 1YPZA 4PJAB 4Y4FD 1P6AB 1KG0A 4NQEA 3ULUE 4ZG1A 1ORQA 3HPLA 2M8XA 2BSTA 4IMKA 2VB5A 3DXAA 3O2DL 3SN6N 4KTEH 2DQDL 2YC1A 3CCHA 4L5FL 3O3BA 4O51B 1DSFL 1AY1L 1A1OA 3WDIA 4MAYD 1AXSB 4KROD 1Q72H 3X3GH 1R5IA 3RU8L 3BIKA 3T2NH 3G6JF 4ZUTA 5T1MA 5GGSB 1IAII 3FOLA 5ID1A 3B5HA 1G9NC 2Y06L 3D3VA 1KPUA 4QXUH 4OIBA 4WVRA 3WFDH 1S5IL 4GMTL 2FWOB 6CGTA 1V3JA 1OSPL 4P4KC 1CD1A 1IEBB 3MLSH 4BYHA 4C56A 1MHHB 2JTDA 4XP9H 3QI9A 3OAYK 3R1GL 3SQBA 2G5BB 4M6NL 4NWTL 4ELKA 3BZFA 1M7XA 4XXCC 2ITDA 5CD5C 1NFIB 1KOAA 2PO6A 4Y7MA 5H37G 3QIBA 5C09D 5T3ZD 1LWRA 1WUNT 1BLNB 1GL4B 4OJFH 2P8MA 4O4YL 1MHPL 4LSPL 4WCYH 3IDJB 1KN2L 5EIQA 2BRQA 3DMMB 2Q8BL 2WNGA 1A6UL 1HWHB 5DMJB 4TSCL 2D7TH 2Y36H 2EIEA 1UZ8B 1JUFA 1L0XA 1HK6A 1YEIH 5EORL 2GJ6A 1I75A 1UWEH 5E5MA 3ARSA 4MA3A 1G7IB 4XAKD 4BH7A 3QDAA 4QF1B 3ULUH 4LMQE 4LDEB 4ZFOB 4LPVA 3O2WL 2EKSB 1RZJH 2D2OA 3HB3D 4LSUH 4OZFB 5E1AA 4UTAH 4XTRD 5HVHC 5EU4A 1YQVL 4U1MA 5D1XB 3SE8L 3SJVD 4ZSOB 3CZFB 4L9LC 3ZT5A 3I6GA 1E4JA 5F7EL 4J1UB 3U1SL 4PRIA 5JUEH 4NC1C 4UTBL 2OR8A 4RFNB 3DGCR 4NRYA 3QEQD 3TO4D 4NN6B 3DYPA 2AJYH 3MLZH 4QRQA 1H15A 5CGYC 1ZEAH 3TM6A 1C7TA 4YHIB 5GGTH 3TH3T 2VLJB 1K8IB 4LP4A 5SWZB 5IG7B 3VWJD 3HE6B 2K7QA 3RIAF 3TN0C 4BSVB 4X9IA 4UBDD 2MQ3A 4KK8D 3KPNA 1CK0H 3GSNB 5EZIL 1WF5A 5JHDB 5F3HA 2DKSA 2DQIH 2DQTH 3CFKA 1S7WA 4XBEH 1CXLA 1PLGH 4NPYA 4TQEL 3VXTA 1S7VB 3ULVD 4XB7A 1H3GA 3R8BB 4CDHA 1S8DA 1KJVB 4GS7B 5TQ2L 1KB5A 5KG9A 3QSKB 1FP5A 3HC4H 3O0RL 5C07A 3SQOL 3P9LB 5D70H 3QDME 4JPKH 3RVWD 1DVFD 2MTPA 2BY0A 1FNEB 2UWEB 4XVSL 1MCRA 2VOTA 3DX6B 1MI5A 2R8SL 4CNIA 1KJ2H 5JQHC 5E6ZA 4I4WA 3OSKA 3STLB 4FFWC 3QNZB 4ZUSB 1WFOA 2YUZA 4JN1H 5LXGL 5HYSB 5GJTL 5BW7A 4UUJA 1PZ5A 3WFEH 4LLWA 4WO4D 5C0DA 1JGVH 1VFUA 5HYJA 4UOJA 5HHNA 3THML 4X5XA 2FX8L 1P53A 4OLVL 1RUAH 1I3RA 4OI9A 4HV8B 4PV9A 1NC4D 1FZJA 2NMSA 2GTZB 4YK4B 3SDDA 2FYYB 5EO0A 4AEEA 3SY0A 1R5VB 3TYFB 3SBWC 4GBXB 4XWOD 3O6FD 1VGKB 5F9OL 1MCDA 2JELL 3T77B 3F12B 3X14A 1WSST 4EDXA 1DR9A 5JR1L 5IVZA 3Q6GL 3VFRA 1P2CB 1DE4A 1QKZL 3L5WB 3MNZB 1YMME 5I1CH 1AD0A 4D9LL 3LEYH 1YNKH 1TQBB 1BWMA 1KBGH 4XCEB 4NQXB 1DLHB 2Q3AA 4H0GA 3AU1A 5HI5D 1MFEH 3C8DA 4HK0B 3ZO0A 3VFWA 2VLRB 4X4MA 3WL9A 4DWHA 4IOFD 1E27A 1EMTL 2GJZB 3MYZA 5GSRB 1AXIB 2JJVA 4PGCB 2XT1B 4HUWA 2E9WA 4M00A 4PJCE 3MRGB 5AEAA 3NZ8B 2EYSA 4RNRA 5LBSL 2ZSWB 3QG6B 2RIKA 3KJ6H 3SCMA 3ARBC 3TV3L 3PGCA 3TWCL 3NFNB 4ZFZA 5IVXE 3V52H 2DL9A 4P46D 3RWHA 2FBJL 2OP4L 3U36A 5GISL 1ZA6B 3VXOA 3B2UC 4TYUA 3S37L 5JIIA 1J0ZA 3BE1H 2AV7B 3RVVC 1CXKA 1CXIA 3TZVA 5HI3C 3W0WE 2FR4A 5BRZB 4R2GB 5M94B 4L3EE 1IC4L 1AFVH 4IRSA 3DARA 4G42B 1IGYB 5ICYA 4OBSA 1A3RH 1AIFA 1U2HA 2DWDB 4KKLD 2HJKA 5JOPE 1X5LA 3E8UL 5TGBA 5FGBC 4M4PA 3UJIL 4JANA 1R24B 1QFWH 4P4RA 5F6HI 2RHEA 2I9LA 5D1QC 2P4AB 2AV1B 2BMKA 5EBGA 4Z7OE 2PR4H 4RIRA 1YEHL 4W4NA 3DX8B 3LY6A 2AXGA 4M02A 4XWGL 5MP6H 5L0QB 1W8OA 3T65A 4WTZA 5HYQA 5EOCJ 3U7YL 3L3KB 5F1NB 1OP3K 4BA8A 4M8QA 4KY1H 3OKMA 3NPSB 4QOKE 3MMEA 2N4IA 4Q97A 3BMVA 2EECA 1NFKA 3IVKA 5ISZB 4JFFD 2X2YA 3GHEH 3UBXA 2VXUH 1ZVYA 2YZ8A 4KQ3L 3MA7A 2G9HA 3IETA 4PYGA 3IDNA 3V0WH 3C9NA 2VITB 2P7TB 3RZCB 1YY8A 3T8XB 3VW3L 4X6FA 3FFCB 4PJAF 5D8JH 4ZTPL 4YXHL 3WFBL 3DRQA 4AY0A 2X4QA 5C0CB 3TFKC 3QEHB 4PY8I 5HY9A 3LKOA 4RQQB 3P4MB 3VWKC 1KCUL 1HE7A 4HBQA 2XWJA 3U4BH 2DTSA 1DFBL 3WE6B 5DUMH 2D0HA 4Y89A 4CUCA 3O2VL 3QO0A 5HHMD 4G8GD 5IJKA 2P5EE 3LMJL 3HRZB 1OF2B 1MVUA 3F65A 3K8KA 2DIAA 5FUCE 3NTCH 4JFED 1HSBB 2R1XB 3HI6L 1YN6A 4Y2DB 4C83A 4PR5B 3V5KB 5D7KE 2ZSVA 2CRMA 1J11A 3P73A 4ZPTB 5FO8B 5JOEA 1RIUL 1CGSL 3B3IA 3L7FA 4Z7UA 4NRXB 2HG5B 4U1NB 3RBSA 3EIFA 4Y5VB 1FFOA 3EOBB 4X4YA 5IM7A 1HKLL 5EU5B 4TNVF 3IKKA 43CAA 5K9KB 1KIQB 5I17A 1OW0A 3HFMH 4QRTB 1ZLSH 4LCUB 1KYOJ 1UXWB 3F58H 4V1DD 3CFJA 3AAZB 1T6WA 5IF0B 1UA6H 4LKCB 1NGQH 4PRHA 4OT1H 5DUBA 1R0AH 4P59L 3O4LD 3HE7B 1HQRB 2OXHA 2HVJA 1BJ1J 3BKML 3SGEI 5EBWA 1MJUH 3CFDA 4MXWH 3L7EA 2CMRH 1A7OH 4X7CC 2PXYC 2EH7H 3NABH 4PB9H 4JREC 3C60D 1AHWC 4LEOA 2UYLA 1FL5B 3EYFB 5F6IB 5DLML 2A38A 1KIPA 2DJ4A 3TBTA 2BC4A 1T83C 1F8TL 1ZWIA 4P5KB 2APFA 3RAJH 4OCMC 4D3CL 1HNGA 2ZCKL 3DRTA 5I74C 2PCPB 5I0DA 1N3NA 1OAXL 2DBLL 4XPTH 2Z4QA 4N0UA 3INUH 2WP3O 5DJDA 3LQZB 2ZUQB 3RUGB 2PYED 4AG4L 4GKNA 5IMMA 4JHAL 3KAAA 1OAUH 4E0RA 2Z31A 4ONGH 4M7JH 5I19H 3BPOB 3ECBA 3QXWA 4HT1H 2DOCA 1RAMA 5DWUH 3N85L 4JM2A 1YNTA 5DHVB 4XNYH 4JDZB 2YD2A 3QUYB 4AM0A 4CGTA 4FQXA 2AK4A 4BFIB 4N68A 1U8OB 3IAPA 4OLXH 3SPVB 4BSWA 5GJSH 1MELA 4WU7B 1VADA 2FD6L 1IGIH 4YBLC 1FL6A 3CXDH 1M6OA 2VL5B 2H26A 5DD0H 1XGYL 3K2UH 1X5HA 5BXFA 3U0WL 5ENWB 2EE9A 3CH8A 4Q9QL 1UJTA 3VXQA 5EIVA 2B8OT 2MQ0A 3L5IA 3Q6FB 1FJ1A 1KENH 2IQ9L 3GBNH 2R56H 4Z7WB 4I18C 32C2A 5GS1B 5GRVL 2F54E 4G8IA 1W0YT 3SGJA 1MAJA 4ENED 2X6MA 5L8LB 4MJID 4ZFFB 1PJ9A 1OOAA 5BVJB 1UACH 4Y0GA 4BFGA 1J8HB 2DLIA 4YDIL 3BUTA 4HULB 1LO4L 3QDGB 5J57B 5JQ6H 5EN2A 5IFHH 3CPLB 3AVEA 1WBYB 3ZKSD 1OGTB 1L9MA 2IWGA 3ZE1E 4F9PC 1BGXL 1CGYA 4OCSL 4EXKA 4RGNE 2XZCH 4KJQD 4MJ6A 1NKRA 4U7SA 7CGTA 1U6AH 1NAKL 3IKCA 4NWUH 4R26L 4JPIB 4MNGA 3GIZL 3IT8D 4EVNB 3TYGH 2NW3B 3VFNB 4AT6B 1T0NB 3ZL4L 3ROOB 1KEGL 4RDQF 3OF6D 1PKQB 1U8NA 4K3DH 3GMOA 5HHXL 4FQLH 4APQA 4HWEH 1KCRH 5CCKH 3HZMA 4NQDA 2KL6A 3L6FA 4HKZA 3LHPH 4JFDA 5HDBF 4XNUL 3IDUA 4MQTB 3PHSA 4J4PD 5KS9E 2WK2A 4PY7A 1TTGA 1MCQA 4K3EL 3DVGB 4PRNA 2Z9TA 4QRSB 4LCCB 5F1IA 4TRPH 3SDXB 1DUZB 4LVOC 4JZJB 2VZSA 3IDGA 1GAFL 1YYLL 3HA0A 4HSQA 4EOWH 5IBTH 1IM9A 3KPOB 5MEQB 4KTDH 1JGLH 1U92B 5T1DL 5C9JB 1O7VA 4QRUB 1LO3H 1UKTA 4NJAL 4WUUE 4U7KA 4DZBA 3GMNA 1XF2B 5EPMA 1IFHL 5T1LB 1FYTA 3MFGB 5C0GB 1BBDH 5HYIA 3S7GA 2CUMA 4Z0XA 4HGWB 4HWBA 3X13B 1JZ4A 1MNUL 1VHPA 5HGHA 2X1PA 2OSLA 3MRHB 5EIIA 1BAFL 2IH3B 5DEGB 3UTSA 1E6JL 3WO4C 3BN9C 3QXVA 3QHFL 2ZPKL 4E5XB 4ZAKA 1KEML 1UZ6E 5IR1A 1TVHB 1AGCA 3OGCB 1S3KH 3WFZA 1KSRA 3K74B 1EFXA 1Z0NA 1J05A 2VMFA 5GS3A 5HVFB 1CICA 4HJJL 4JRYD 2NY4C 5IW6B 5IW1A 1OT2A 5JIKA 4XGZB 1QLEL 1IT9H 4ORZC 3BKYL 5T3XE 5EG6C 1IE5A 2FX9L 2D03L 2FIKB 3TNMB 5EO1B 3T0WA 2DM2A 4FFVC 4MJ4A 4F7CA 4M48L 2AEQL 2AGJH 3BP7A 2QQKL 5D2NA 5DC9B 3FN9A 4TUJB 3OKLA 1KYOK 3UZQA 3BH8A 4FHBD 2YPLA 4H26B 4I9WD 2VQUA 1IQDB 2HJLB 2R2CA 3W2DH 4Z8FL 1DQDL 1QQDA 4PS4H 4OLWL 2Y5EA 4P57A 5IMOB 2VNCA 3MUZ1 3IU3B 4JPWL 1NANI 2Q76B 2VZVA 5K9OB 1ITCA 3FQWA 1FH5L 3LB6D 35C8H 3C6SB 4FTVA 4ACPA 5JW4Q 5EOCH 2IANA 4GMSH 3LQMA 4ODHL 2FSEA 2VLJE 2A0LC 4AK1A 5SWZE 1OGAD 3WMSA 4QRPB 3VD7A 3A6OA 4P4KA 1T0PB 1CLZH 4J8RA 5LJYH 3JWDL 1NKOA 3VGFA 1YN7A 1ZT7A 4TULH 3MRBB 3RPKA 3BKCL 5EFIA 3VXUD 5HSFA 5MENA 3KHOA 3F5WA 2R1YB 1W0VB 5JHDE 4DKEH 4JEGB 1XF5A 1OTSD 1W72A 2J88H 5H94B 2YBRA 4YJZL 2YZ1A 3O3EB 2BP3A 4Y19A 1ZLWH 2O5ZH 2KDGA 4OD2B 3VD4A 4YHNB 3D69A 1G1CA 3O3AB 3QR2A 5CEYA 1SJEB 1IAKA 5DI8A 5T3XH 1BZ9B 1RHHA 1ZLUK 5F9WC 3V6BR 4L8BA 43C9A 4GRWB 5E6YA 1K6QH 1HIML 2GITA 3FB8A 5MERA 1OB1B 4KQ4H 4F37K 5LCVH 1X5IA 3MRMB 4M1DL 1T22B 5MI0C 2O93L 5DO2C 2B20A 2XQYG 5D7JC 3ARFB 2UWEE 3O6MH 3I75B 5ERWA 3WIFA 1NAMB 3LQAC 1EAJA 1AD9A 4L9LA 5LGJA 5FYJD 4I3GA 1ZKAA 4KK9D 3C09C 2NY6B 2M1KA 1O0VA 2DJSA 3B9KB 1T6VN 1I7RA 4GG6E 4OB5L 5I75B 1CDBA 2IBZY 3NAAL 1P6FA 2PW1A 4G43A 4M5YH 5KTEL 4DUVA 3TN0A 4RA3A 2Z8WC 4JFHD 4Y4FC 4HUMB 3BZDA 4MCZB 5ID0A 1BJ1H 1P4IL 3MYJA 1A6ZB 1T4KA 2WUCH 3P11L 4UU9B 2VZTA 3E6HB 3D18A 3S4SA 2Z35A 4V2CB 3S5LG 1RUMH 1H3VA 2P43B 4IRJB 4NZJA 4HAGA 3STZB 2FO4B 4FS0A 1MCIA 1JFQH 2W9EH 2X9XA 2A1WL 2NTSP 4X0KB 3OAUL 4PJGF 1HH6B 1WIUA 4YHYC 3ALWA 2BNRA 5DQ9A 5FGSA 3KXFA 4AZ8A 1SYSB 5B8CC 2VAJA 3LZFL 4LGPB 1P69B 4D0CA 5TF1L 1OTTD 2XQBH 4HDIA 4DTGH 3IDXL 4NO3B 3RY5A 4Z5RB 3T4AB 4S1QH 3BHBB 3MUY1 1CLOH 1FCGA 4WJ5A 1C16A 5CEXA 1A7PH 2AAVA 2GFBB 2BNUB 5CILL 4FP8H 4ODVH 1LK3H 5DD5H 4PJ7B 1MRDL 1YUHA 3GJFA 4X6DF 3F7YB 4XMLH 4Q7DA 5ADOH 5FYKL 4NQEB 4RISH 1I8KA 4LVHC 2OJZL 3QT2A 1MCJA 2GJJA 3TCXA 4ZOCA 3TPKA 4HLJA 4UQ3B 2HKHH 3ZDYE 2O26U 1UH4A 2QADC 4L5FH 5BJTB 4U1KB 4X7FC 2YC1B 3CCHB 1AY1H 4ZOBA 4ZFGL 3Q1SL 2BVYA 1JN6A 1OLZA 1K4CA 4JKMA 4LARL 1G7MB 1A1OB 1N7MH 2HFFA 5DK2A 4Z6AT 4J12A 3SBWA 3RHWF 4K9EL 4R4BA 4LBEA 1A1MB 4ZUTB 4NJ9L 5HHQA 4R4ND 2YOCA 1N2RA 5C0FA 1KPUB 2GUOA 3FO2A 5DURD 4G3YL 1OSPH 1YZZA 3SOBH 5I1DB 2X1OA 2EIBA 4QRRA 3TO4C 2DQUL 5DJ6A 1CFTA 1CD1B 3NIGE 3HPJA 1T2XA 4C56B 4NWTH 3QI9B 4ELKB 2ITDB 3VI3E 3VWJC 2PO6B 5C1MB 3QIBB 1V7MH 3V6FA 2HAZA 3S34L 5ISZE 1MCWM 4KPHL 4CKVX 4RMQA 1QRNA 1KXVC 3DROA 4LSPH 1TJIL 4JO3L 2Q8BH 2F5BH 4KK8C 3FQTB 1UB5A 4TSCH 2MHAA 5D5MA 3S36L 3MSPA 5TH2A 3FFCE 1BIIA 3GM8A 5EORH 3ARBA 2X7LB 5C0CE 1IMHC 4NZRL 2GJ6B 4QT5A 5E5MB 2IBGA 2CK0L 3UDWC 3WD5H 4PP2B 2QSVA 5F9JA 3L3JA 4Y5YC 1G7LB 3H9SB 4XC3H 3O2WH 1WWWX 4U6YA 5FOBB 1AJ7L 4JRXA 3CFEB 4L4VA 5E1AB 3TBSB 1A4KB 3H3PL 4U1MB 4HUUB 3U1SH 1EEZA 2JCCE 3KPTA 4UTBH 1T1YA 5TPWH 1DVFC 5FEBA 4UIKL 4NRYB 5FGBA 1TCRB 4AIXA 3QCUL 4JVWA 3MV11 2KPNA 1YC7A 3MLUL 4U1HA 5FOJA 5E56A 3ZT7A 2VLKA 4MGXA 4WWKC 1FORH 4NHCH 3WIIH 1BF2A 1ZANL 4Y1AD 5CWSA 1HQ4A 4Z7VB 3MFFA 3DVIA 1NFDF 5EZIH 3AREC 5I1JL 5H2BA 3T1FA 3ZE0F 1MWAA 3QUYD 1CGVA 1JMZA 3FN0H 4FQJL 3CFKB 4HQQL 1VFOA 1S7WB 4TQEH 2WMPA 4UMGA 4D0BB 3MJ6A 4BFBD 3LS4L 2HYMA 5JOFA 3VXTB 3KDMB 3KPSA 4QCIA 3BP6A 1RJCA 2EEAA 1A4JA 1PKOA 2APTA 4WW2F 2PW2B 4TSAH 1FV1A 4PBXA 3WNMA 5KG9B 5J6GA 3C5SA 1C5BH 4YGVA 3VWKA 4X6BA 1YY9D 4MA1C 4R0LC 5DD1L 5EU6A 1D9KC 2NY3B 1KPRA 1MFBL 1F3DH 1SBSH 3QDJD 4XVSH 4OZ4A 5BV7L 3SGEH 2R8SH 2BNQD 3S5LB 1MI5B 5D1ZB 3ARWA 4CNIB 3O11B 1FZMB 4H8WL 5HI5C 1FHGA 2BSED 3CVHA 5SWSA 3RUGE 2EIZA 5GS0D 3QRGL 1Q94B 5GJTH 1WTLA 2ICEB 2ESVE 3ULUD 3P0YL 1PZ5B 3ARGA 3EO1B 4LLWB 5C0DB 4LPWA 4ZS6D 4NQSA 4JO2H 4F57L 5ESVA 4XPHL 1XGUB 3MROA 4X5XB 4L8SC 3T4YB 5I1KL 1U93A 1DP0A 4GXUN 1YNLH 3QWQB 4Y16A 1FZJB 1AKJA 4G6FB 3ZHLA 1BD2A 1FG2A 5EO0B 3O9WD 3SY0B 1IL1A 4PLJD 3QQ9D 5IBUB 2EE2A 3D39A 3RTQC 1I1YA 3KHQA 5JR1H 3TCLA 5DHXB 1QKZH 4EDXB 4OQ1A 2XN9A 3VFRB 5HGBA 1DE4B 4PJDE 4D9LH 5KVGL 2H2SC 2PXYA 1C1EL 1DN2A 1AO7A 2W60A 3WUWA 1AD0B 3BN3B 2X4TA 3ZKXC 1Z3GL 3GM0A 3ARXA 1J8HE 2UZIH 4ELMA 3AU1B 1VEMA 4HIXL 2DDQL 1EMTH 1T83A 5I1LA 3BZEA 1GGYA 3VFWB 3WL9B 3FCTB 2AEIT 5FAAA 5D6CA 4LNVA 2DYPD 2WWMC 1X4ZA 3DETD 4BZ2L 4JQVC 1Z0MA 2VERN 1CDHA 2VDRH 2EYSB 4X8JB 4HCRL 3TV3H 4J3XA 4JZOA 1HEZA 2ZNXA 4L1HA 4N5UA 4JKPH 3SCMB 1X7QA 4YFDB 3PGCB 5FYJU 3LRHA 4GAFB 4PJ5E 4ZUVA 3FMGH 3TJHC 3IRPX 1JHTA 4O5LH 3K4ZA 4QYOB 1MUJA 1WCQA 4MCYA 4K7FA 3MCKA 1AH1A 1E4XL 5C0ND 4U0RC 3TGXA 5CEZD 5AZ2L 2A9ML 1PKQE 5DVNA 3OPZH 3TZVB 1IC4H 1F42A 1NCNA 5C6TL 3HI5L 4GUPA 3C87A 2BDNH 5JW3H 2FECL 4UIMA 3UJIH 3E3QE 1HHIB 2HJKB 4NP4H 5TGBB 5KSVA 2FATL 4LQFH 3ULVL 4U05A 2Z93B 4ONOA 2JK5A 1I4FA 2BMKB 4EIGB 1FNHA 4QTHA 4RIRB 1HXYA 3SDAB 1ZHNB 2AXGB 4OCXH 3U7YH 3T65B 2YRZA 3D2UD 4XP4H 1G7HB 1LD9A 3DV6B 2GKIA 3V4VH 1BJ8A 4EXPX 1R6VA 3OKMB 4ZO7A 2WBJD 1IC7L 1RVFH 1DANU 4GXUM 1MREL 1HI6A 2GY7B 2R15A 3IVKB 4JHBA 5AD0A 1S7UB 1AGBB 4H5SA 3UBXB 3CSYA 3EOAB 3RDTB 2QL1A 1IAMA 3MA7B 5I1GL 2G9HB 3IETB 1LP9A 1RUKL 2FZ3B 3VW3H 4HXAL 3BJLA 4F9PA 4LHUG 4CMHC 5F70A 3IDNB 3C9NB 4ZTPH 4YXHH 1YY8B 3T3MF 1DN0B 1CFVL 2X1QA 4AL8L 3DRQB 1QBLH 5HY9B 3W5NA 3QXDA 3LKOB 3NCFB 4OCLC 3GSXA 5LGHL 2XWJB 4W6YB 1Q0YH 3O2VH 5AYUL 4IHOA 2NXYD 3QO0B 4KGLA 3LMJH 4ZXBC 1X9QA 4WIQA 3WNNA 1S9VA 4PJXA 4LLQA 1CLYH 1YN6B 4GRLD 4MSWA 5E95B 1RIUH 2ZJSL 3CFIC 2CRYA 3PABA 1EAPB 1U3HA 5A2FA 4P5MB 5AZEH 3UBXI 4KZDL 1FFOB 4X4YB 5IM7B 2HH0L 3X17A 4EI5B 3ARQA 5I8EA 1AC0A 2F5AH 43CAB 3GMQA 2OM5A 3BOVA 1U9KA 2EDTA 1HN1A 1CFQB 3DHMA 4OF3A 1WGOA 4NO2B 4MVBD 5CBAA 2J8UA 1A64A 3B5GA 5IJVA 4PRHB 5DUBB 3REWA 2H1PH 1OVZA 4PRDB 5GRYA 3BKMH 5F7FA 3AMKA 2ADGB 2WIIA 2HVJB 4YHZL 1A6TA 5EU7C 3D0LA 2P45B 2W0PA 1YMMD 4QRPE 3IDMA 1RQ5A 5KAQG 1G7JB 5I71B 2IQAA 2R0KH 5DLMH 5KZCD 4KAQL 3VXMB 1NANH 4LOUD 1G7QB 3C2AH 1T7XA 1F8TH 3EBAA 1FSKB 3FB5A 3TBTB 2BC4B 5TQ0H 4ENEC 4I48B 1CVRA 4PG2C 5KSUB 4G6ML 5CSGA 4F7MA 1NQBA 4KKNA 2JIXD 4CU7A 1CFNA 3DRTB 5E94A 5IWLC 1N3NB 3FTGB 2Z4QB 4KRPD 5GGVL 4JFXB 4N0FA 4N0UB 3OG4B 3ZDXE 5DJDB 1MCNA 3DTXB 5EUOF 5IMMB 1QSFD 3VXRA 4YHLH 4P2QB 2AQ1A 3BD3A 3ECBB 4FQ1L 4GRWE 3RJQB 2WQ8A 3TF7C 2ZCHL 3QWOA 4X5WA 4JM2B 5GRJL 1T7VA 4B5EA 4XPFH 4YQXH 4KJQC 4AM0B 2HTLD 4FQXB 2MQCA 2A6JA 2AK4B 4U2ZA 5BS0A 2B4CH 3VDBA 3W0WD 4BH8B 3OG6B 1NGYA 3QBTB 1QSEA 1U8LA 5K59E 4RWHA 1M6OB 1T03L 2H26B 2FJFB 3MV8E 5JOPD 2VC2H 4WEBH 2IADA 2BSRA 4XXDA 1FN4B 2E9JA 1ULVA 2SEBA 3VXQB 4UT7L 1FZOA 1MFNA 1FJ1B 1WZKA 4M6MH 1GIGH 2P5WA 4RFOL 4J4PC 1F4AA 4KJYA 1EJOH 5A2KH 4HF5H 1UG9A 3UX9B 4CN6A 3H7BA 1TPXB 4KDVA 3GRWA 4DGIH 1J0JA 4JY5L 5BCAA 5LQBL 1LDSA 1F02I 5H8DA 4KV5F 3JZ7A 5FV1L 3DMMC 1DCLA 2GYSA 2NXZD 4D94A 4KKCD 5HHVL 5EN2B 5CIPB 2OQJA 1ADQA 2EO9A 2F53B 5IB5A 3C5JB 4OCSH 3DO7B 3I6LD 5BQ7B 5HVWA 4Z0BH 3W11D 2ICWA 2XNAA 3JV0A 3H42H 4R26H 4PP1D 1NUFA 1VKXB 4G9DA 2LFGA 4GKSB 2XXMB 4MNGB 5D1XC 1PG7W 2CJUL 5I1IL 1KTDA 5D7SL 3DUUB 1CZ8L 5C0BB 3CFCH 1ZT1A 4GRWH 4O58L 2E7MA 2YA0A 4KU1A 1T2QH 3P4NA 4R7NA 4MQXC 4GG8A 1HCVA 3ZE1F 4NN6C 1FO0L 2PUQT 4L29A 5HHXH 1U8NB 3V0VB 3GMOB 3VH8G 5D7JA 5KSBA 4EQ3A 5IT2H 4HFWA 4LSTH 4XNUH 4NQDB 4HKZB 1RZKH 4K3EH 3KYNB 4QO1A 5TE6L 3PWLB 3HUJE 4PY7B 3HE6C 2ERJC 4PRNB 2J8OA 1FDLL 3A6CH 1UC6A 1YPZE 4RBPK 5F9DC 3ES6B 3RWFA 4GQPH 1HHJA 4NQEE 1GAFH 1UWXH 1VCAA 3BD4A 4F58L 5D7LA 3V6OC 1L9NA 3WLBA 3SKOB 3PE9A 1JGDA 3DGGA 4NM4H 4I77L 3QIWD 4U6VH 1IM9B 3DXAE 4B7IA 3MJGX 1QA9A 4YDLB 2DIJA 1KTKE 2Q1EA 4Y4FA 3V79C 3LSOA 3GMNB 5EPMB 5FDWA 2E7HA 1FLTX 1F13A 3TIDA 2QJDA 2CKBL 3MUGB 5CJOL 4Z0XB 1YEKL 3GDBA 4XVUD 3D25A 1BQLH 4LU5L 2VZ3A 4RA0C 5J9PB 2E3VA 4U1GB 3D3VE 5HGHB 1OAZL 4X98A 1OARL 2OSLB 3DUSA 1E6JH 5EIIB 1MJ7L 4MAYA 1KCVH 5B3NA 3UTSB 1KEMH 1R3JA 5B8CA 1N6UA 3LB6C 3TBYB 4C56E 5K9QI 5IR1B 3RIFF 1AGCB 2ZZUT 4IIQC 1EFXB 5IMKB 4LVNC 3TA3B 3BGFB 5E00A 1JPST 1RZIA 1CICB 3VG0L 4F8TA 3EOTH 1L0QA 3QFJA 4UDUA 4Q9RL 3UPRB 4UB0L 4M48H 2GSGA 1TXKA 2HRPL 3IDIA 5C09A 4F7CB 4O02H 3BP7B 1NCDH 5EZLA 3O8XD 1A6AA 3OKLB 3IF1A 4WEUD 2GJ6E 1TQCB 3UPCA 3EYOB 2YPLB 4YK4C 5DMIL 4NIKB 1G9ML 4Z8FH 4HUVA 5KVMC 1DQDH 4OLWH 5IGXL 5T1KD 4CADB 1F58L 1QQDB 5DFTA 3W39B 5DRXA 4P57B 3PWVA 4ORGA 5E0QA 2XQYK 4OZHA 1I8MA 2UUDH 5CUSH 4PRIE 2DM3A 1A6VL 1CYGA 3GSOA 4H20H 2R69H 3FQWB 3P40A 4LSQL 1SJXA 5EOTA 3SDYL 1DBML 2X4OB 1TQBC 3RWCA 1AXTL 4FTVB 1LE9A 3U6RA 2IANB 3SJVA 2AJ3A 4FQQA 5DRNA 4RBPH 2FSEB 1QLFB 2RR3A 4XBPB 2A73B 1V3KA 3FQUB 3RA7L 3OKDA 3TO4A 4N8VA 4P4KB 4GSDL 3IAQA 3BKCH 1YA5A 3NACL 1YN7B 1IGML 3MODL 4YIQB 5J0BA 2NW2A 5DZOA 1BVKB 2C4XA 5TF0A 3PP4L 4HS6B 2AJZB 3VWJA 2A83B 1AGEB 4KRLB 1WZMA 2R4RL 2YBRB 1ZMYA 3UTOA 4NC2B 4Y19B 4MXVE 5ITBH 2LQRA 5CEYB 4RGND 3PHQA 3EO9L 2EE3A 1IAKB 1JPTL 4KVCL 3KYMA 4I5BA 1KXQE 3KLSA 1RHHB 1CFSA 3KR3L 4PREA 2VR4A 4R2GC 4BQ6A 5C07E 3UDWA 5MERB 4M1DH 4Y5YA 1KELL 1ONQA 1KT2B 1G0DA 3MRCB 2JB5H 5FHAH 4HK3N 4NYLA 5LKNA 4M7KL 1D5MA 5HVHB 1MCHA 1OTTC 1MI5E 3WIFB 1F4HA 3TNNA 1AD9B 5LGJB 4S1DC 1I7ZA 1DVFA 2VH5L 1JHLL 5L0QC 3V5DA 4DGVL 3RGVB 1Q0XL 4S1RL 2X09A 3D9AL 4OB5H 1KN4L 1KV3A 4QNPF 2R2BA 4WFGE 3REVA 5IB4B 1R3HA 1MHEB 5KTEH 2PW1B 3HCVB 5ALCH 1GHFL 5HYJE 5IB2A 4M93B 4P2RA 5E9DB 5SWQA 1U8MB 5LAXA 2X4UA 5SV3A