4JPVH

Crystal structure of broadly and potently neutralizing antibody 3bnc117 in complex with hiv-1 gp120
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
223
structure length
216
Chain Sequence
QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A STRAIN 93TH057 GP120 WITH LOOP d AND LOOPD V5
publication title Somatic Mutations of the Immunoglobulin Framework Are Generally Required for Broad and Potent HIV-1 Neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 34
structure length 216
sequence length 223
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpvH01
1P2CA 3GIZL 3NZHH 4O2FB 2FSEB 4HKBA 4G6AC 3QUZA 3KPSD 1LO0H 2GK2A 1J5OH 4A6YH 2X41A 1P4IH 2AXGB 2BMKA 1T03L 4DOHE 3CLEL 2LTQB 1KTLB 4JPIA 3I6KA 3ZE2F 5IW3A 1OT1A 4F33A 1M71A 1KN2L 1CXEA 1A4KA 4BUHA 3KG5A 3WXWL 2DQTL 1F02I 4OV6F 3RZWA 4K3JH 4O00A 5C08D 3OKYA 5DK2B 4IEFB 4LPWA 5B38G 2R9HC 3A0OA 1RIHL 3FT4B 4U1IA 5D7IF 3U7WH 5CJXA 2VERN 5FYKD 2YPLD 4WFFD 3BKML 3ARFD 1CLYH 5DEGA 1TQCB 3I02A 5FDYA 1IM3A 5FYJL 2R0WL 1T1YB 3HI6L 4ZFZB 1BIIB 3K46A 4HUXA 2VL4A 1JHLL 5EU7C 1KJ2B 1CR9L 5D2NB 3O8XA 3UTTD 1X5AA 4KK6D 4OB5H 2P5WE 2XTLA 1JGEB 2XV6B 2WBJD 5D1ZD 5JPMA 2DKMA 1VPOL 4QHNA 5E8DH 3HZKB 1FV1B 2XWTB 2P8MB 3D0LA 4LFHD 4HIHB 4NBZB 3DX7B 1U58B 4M8QB 3ES6B 1K4CA 4GRWE 4J1UB 1AP2B 4QRQB 3QJHA 4XGZA 4POYA 5TE7H 4JFEE 2J8UA 4TSCL 3PXJA 1GHFH 4Z77A 4U1GB 4KZEL 2EDRA 5DURB 5C8JA 3DX9A 2ICES 2YKLL 1CGSL 1ERNA 4CL7A 4DUXA 5KBNC 4N0FA 4XP6H 5DHXB 1QSFB 1UC6A 3VH8A 3WKMH 1KJ2H 3KYNB 1IE5A 3EOTL 2HLAA 1QOKA 4LQFH 4YHIA 4U3CA 4OFYD 5F88B 1KCKA 3GDBA 2YD3A 2VDMH 1FBIH 2O26U 1JF1B 4MAUL 4EI5B 4PJCF 5F9JA 2NY0B 4OZHB 1LP9B 2EH7L 3EYVA 3O6LL 4NM4L 1R24A 2P49B 4Y19B 3UJIL 1YPZB 4CUCA 1OCWL 4G6FD 3LKSA 2QADB 3B2UC 2UYLB 3OAYK 3O4LA 3QWRD 2R8SL 4FFWC 1Y6KR 4LGRB 2WBJC 1DQDL 3IDNA 5AAMA 2IFFH 3V7MA 4TVSa 2EIBA 1MH5B 3WLBA 2ITCB 4FQIH 4PGDA 4JKWA 1NFIA 2XWBA 3DTXA 5I17A 4PJ7A 3KLAB 4LSPH 3UPCA 2I9LB 3MV8B 1H3UA 2GSIA 1MI5D 4U1MA 4PRHB 3QQ9C 4HUWB 5BRZE 2Q3ZA 3RHWK 3PXHA 4DKEL 3TBWB 1X5HA 5DJ8A 1UM6L 2XZCL 3BPCB 2JJVA 4MVBC 4MNQB 2A38A 5DGRA 4R2GC 1BVKA 4GW4A 1FE8L 5EUOA 3L7EB 4RX4D 2W91A 2FLRT 1PGRB 3QEUB 3SDXE 4GRLC 1HH6B 1DUZA 3W9DB 3VFWA 5JW5B 4FQHA 4S1SH 4U0RB 5CD3A 1K2DA 1FHGA 4MNGE 3RVTC 4O2EB 2IG2H 1A4JB 1OTUD 4XHJC 4M7ZC 4O5LH 1T2QH 5CKGA 5CGTA 3NA4A 3LS4H 3NIGF 3G6AB 3MOBH 4EDWH 4Z95L 4MXVE 1WZLA 1K8IB 1G6VK 2OI9C 1EUTA 5EIIB 4JKPL 3HCVB 5IF0B 1KIPB 1QLFA 3BH9B 4OGYH 4HC1A 4IMKA 3GSXB 5KS9B 1J7VR 4H1LB 3HS0A 1JGVL 1VEPA 2Z91B 3P4NB 4KTYA 2BNUA 1ZHLA 1WBYA 5JQHC 4HMDA 4KROB 3LRSA 2WIIB 1BOGA 3T0VA 3BP5B 3T77A 2VJXA 2V17L 4KKAD 3VXUA 1ZVSB 4X5WA 5FDWA 4UT7H 4MAYD 3ULVL 1KXQE 3KPTA 1WZ1L 4P9HH 5L2JB 4Q9RL 2YSSB 3U82B 3KVQA 5JOFA 3EO0B 4NQCB 2W65B 5TDPB 1F3JB 1U8OA 3QDMB 4P5KA 4NJ9H 1MIML 3B9DA 1NAML 5E1HB 4OLZL 1AGBB 1FJ1B 4N8CL 4OZGF 2H45A 4ZFGH 3ZKNC 4U6HB 1CE1H 3C6SA 3VXRE 5TQ2L 4U6TA 1H3PL 1Q0YH 1XIWB 2NMSA 4PYHA 4K9EC 5L2KB 3X3GH 5FGCE 5I1KH 1T7YA 1D6EA 4OCRH 3U0TA 1NKRA 5K9QG 3H42H 1K8DB 5B4MD 3W39A 4PBXA 3GIZH 3IDXH 4NHCL 1IEAB 4FQ1L 3Q0HA 4X6FA 3BP6A 3EIFA 4BUGA 1NCWL 5IMLA 3VD5A 5E5UB 3TO2A 2FB4L 4PJ9C 1NGQL 5F3HA 4OD1L 1T03H 3KPPB 3CLEH 3PP4H 5T3ZL 4JFZL 3BHBA 2H3NA 5C0CD 3NN8A 4W81A 3U36A 3N1MC 4X5XA 4M93C 3UC0L 4DVRH 5HYEA 4DN4L 3JTTA 5TDNA 1CD9B 4P9ML 2DQTH 3I3BA 5M95B 3MRLB 4EZMA 3LHPH 4IOIB 2BVQB 1QD0A 4E0RA 1C16B 1MSPA 1DN0A 1TJGL 3SN6N 3REWB 3BKMH 1EAPA 2B20A 1ZS8B 2GJZB 1G7LB 5KSAD 5C07B 3RVXC 1CZ8H 4RDQG 5DR5L 4J3TA 1S78D 5FYJH 1OP5K 2V5TA 2GKIA 3HI6H 2N56A 2FO4B 2D0GA 1A7PL 3D3VD 2VTFA 1AGDA 1QSED 1QBLH 4EUPG 1ITBB 2X7LB 2OL3A 4FQLH 5DVNA 3RL1A 2BSED 1WC7B 2HKFL 2I07B 3MXVH 5JXAL 2D7MA 4P2OB 1HDMA 3RHWF 1DBML 3HMWL 3TIDB 3BD5A 1JFQH 3CVIL 3BKJH 1IKNA 5MHSD 3HFML 3S5LG 2X4QB 3QXVA 4LLVB 4JM2B 3TESA 4QTIL 3TT1H 4G6KL 3MLSL 4NNPH 4OF0A 3PE9A 4TSCH 5EOQL 1J18A 1PJ9A 3PV6A 5M94B 4EOWL 5CWSB 3VXQB 3ARBB 4KC3B 2X9WA 3EJZD 4I0PA 1OGAB 2DMBA 4X6BB 5EBWA 4LCWE 1NFDA 2DTSA 2IQ9H 2XKSA 3QJFA 4XI5C 3VI3E 1EHLL 3IDIB 4JQVC 4L3AA 3ZYJA 5GRYA 1PD6A 2FJFA 1W8OA 3D0VA 3RX5A 2YXFA 3K2UL 5AZEL 3P77A 1NC2A 4P46B 1HZHH 1ZT4B 4MD4B 4OFPA 4JO3L 4MAUH 5IHUL 1KC5L 2O5ZL 4LOUC 4F7EB 2OTWA 1FZMA 2EH7H 1CN4A 1KTRL 4QRTA 3HAEB 3HE7A 4Y16D 1DBKH 4D0DB 1A1NA 1H15A 4H5SB 2Z8SA 3C60C 1P6FA 5IIEB 2K9UA 3GRWA 4LU5H 3SKUD 4M00A 3ZKQD 3OZ9H 1DQDH 5EU7E 5LGHL 4A2LA 4H25B 2PYEB 4FTVA 4YBQD 1FYTD 1A6VH 1P7QD 1YYLH 1NCNA 2RBLA 5ISZA 1X5KA 2MWCA 5DYOA 4K7PH 1WV7T 1YEKL 5T1LB 2GTZA 3QHZH 3PP3K 1R5IB 5E2WH 4KJYA 4KHTL 2NTFA 4PJFB 3MOAH 4F57H 3QSKB 1FFOB 3SJVD 4IMLA 3HAEH 1TVHB 5KANI 1UM6H 2XZCH 3WMSA 5AWNL 3BH8B 4YDVB 5C0IA 2VDLH 3UBXG 2C3VB 3QFDA 3ULUC 3ZKMD 3HNSL 4G6MH 4HEPG 4PY7B 5D7SH 1FE8H 3MA9L 5IBLC 1TJHL 3MLYH 2DQEH 5BS0E 1S7SB 1HNFA 5ESQA 4NP4H 4F7MA 4KI5E 1GH7A 2EZ0D 5GS1C 3QG7H 4JGJA 3GSRB 2CUMA 1IAIL 4S1RL 3KDMA 4FQQB 1U8NB 3QQ3B 1IGFL 1QA9A 2X4SA 3F12A 1HN1A 1KIUA 1T66D 1XCQA 3IFPA 4WWKA 4WUUB 2JJTC 4OZ4B 8FABB 1AJ7L 3MXWL 3X11B 4FNLL 1TJIL 5FK9A 4EVNB 5GGSA 5MERB 3W0WD 2RIKA 4JKPH 2X4RA 1PG7L 4FQCL 3VGAC 5I1AB 1F6AA 1MPAH 2CIKA 3OG6B 1NDGB 4GG6A 4HIJB 2VLJA 3D85B 4S2SA 5DS8A 3IU3A 1JGVH 1LO2L 3QH3A 3VD3A 1NEZA 4IS6B 4Z76A 5DI8B 4QXTB 4LLAA 2XFXB 1OM3L 3CFJA 2GT9A 3UO1L 4XCFL 3W2DH 4ELKB 3DV6A 3IGAB 3ZDYF 4TSBH 1YEHL 3ARUA 3HLAA 1JZ2A 5CJ8A 3ULVH 4UQ2A 1D9KD 1JZ8A 4Q9RH 3IRPX 4ZS6D 4P5TA 4RIRB 1RD6A 2AEQL 4Y5VA 3O3AA 2RAMA 2V2TA 4NKIH 4PIRF 1CE6B 2ZOLA 1M05B 2ATKB 4OLZH 1D5XA 1FNEA 4Z7UB 1OTSD 4N8CH 5IK3A 5EU6D 1DCLA 5GGRA 3VA6A 4ZNEA 2YWZA 4IHOA 5TQ2H 4O2CB 1H3PH 3MRQA 2AK4E 1U8KB 4ZUUB 4I2XA 4JREC 5BJTA 3TEUA 3EYQC 3TO4B 3SDCC 2AV7B 1K85A 4XVJL 4K23H 4CRPA 3MUGB 3C5JA 5GS0H 2HT2D 1NCWH 2E6JA 3TIEB 1OARL 2FB4H 1NGQH 3P0GB 2DLTA 4M62H 4OD1H 4ONHA 3FO0H 2BRRL 1ES0B 3MRNB 1PKQE 1SY6A 2ZSVB 5F7FA 3SKNB 3MV9E 2C4FT 5TF1L 3ZL4L 4LEOB 2W1NA 3S34L 4DN4H 1RJLB 2QQLH 1MWAL 1UQSB 1FVCA 2VC2H 5DJXA 3MBEA 5ICZA 1HXYB 2IPTH 1D9KC 4WO4C 5EN2A 4WEUD 3VMNA 1CD8A 1UT9A 2X4PB 1TJGH 3D18B 2HT4C 2VQUA 2J1KA 2IAMB 4LCIL 5CD5D 5K59E 5DR5H 2JKXA 4OFVA 4OLUH 4O51A 3L7FB 5IMOB 1AQDB 2O5YL 2GITA 4FG6C 2P48B 3MUZ1 2CR6A 3KYMA 3VDCA 2G9HA 5MP6L 1MOEA 1WTGT 3FQWB 5E8NA 1Q9KB 1FPTH 1UWEH 4JHWH 4XVTH 1BD2D 5GRJH 3RVUC 4BSJA 1DBMH 3HMWH 4X7SH 4RZCA 1ZA6A 2CLZA 2DJ4A 2OTUB 3ARZA 3RAJH 3RWCB 2DDQL 4GBXD 4MMZC 1B4JL 3CFKA 3MLSH 4POUB 5D71H 4X9GA 5D4QA 4LEXL 3IDYC 2FCBA 5C0EB 2LU4A 1ORQB 1D5IH 2DI8A 2QV2A 5D8JL 1KLUA 3S97C 4PP1D 5EA0H 4TPRH 4WW2F 3FQUA 5IR1A 3PGCB 4RFEA 3MLXL 4PV8A 1YDPB 3GMQB 3G5XA 4LSUL 4HS8H 1J8KA 3T09A 5AZEH 1EFXB 1UWXH 4JO3H 1FN4B 4U0QB 1KC5H 2BOCB 1CG9B 2O5ZH 4V1DD 4G9FB 1N2RA 5LXGL 4URTB 3T0EA 5JDJA 1DL7H 1N0XL 1CFNA 5IM7A 4UQ3A 2OCFD 1LE5A 1IILE 2VDNL 4JZNB 3DURA 3RPKA 5AAWA 2EDTA 1JUFB 4QRRD 5F1NA 5KW9H 3DRQB 1QRNA 1SMOA 1S3KH 3V6OA 3GEWB 5HDBE 5TH2B 3VWKB 3RUGE 4LVNC 5F9OL 4Z7NF 5FA3A 3VXSA 3RGVB 1F4XL 2W9DH 1G6RL 2DI9A 2MQCA 3FB8B 5JLZA 4ODSL 2BNRB 3LN9A 1IM9D 5D2NE 1JGLH 2G5BA 3EOAB 1ZLUH 3DETC 5HGAA 3INUH 5HHQA 4KUZH 4PP1C 1MFAL 2YMXL 4AEHH 1GZPA 3JVGC 4PJ8C 5C0FB 2WLYA 5AWNH 5EORL 3FFCB 3BZEB 4P59H 5GGSY 4R4BA 1QVOA 4Y5XA 5H37G 1Q94B 5EU3B 3HNSH 4NQUA 4PJHE 1TJHH 1MJJB 2BVUA 2D03L 2K7PA 3O6MH 1H5BB 4ZXBD 3UYRL 1MRDH 1KACB 4D9LL 2WUBL 2Q3AA 3IJSB 4APQA 3VXMA 2VLRE 4HG4K 5DJ0B 4LSSL 4LPVA 3TYGH 3EW3B 3PWVB 2VR9A 3QEQE 4JQIH 4BQ8A 1JHTA 1ACYL 5A16B 4YEFA 2YWYA 4Y4FD 1FFPA 3LH2L 3K3QA 3VWJB 2P8LB 1IL1A 1YY8B 3PWPB 2B0SL 4MDJB 4MJ5A 4HK0B 4M7KL 4X0KA 1PG7H 3MODL 5FGBA 4FQCH 1QQDB 4KKCD 1UYWL 4OLXL 4ZSOE 1BMGA 5CMAB 5CGMA 1B0WA 4YJZL 4Y19E 4X4MA 4PGEB 5F7MC 4IRJC 5EH1A 4G80B 3QIUA 5GGRY 3QISA 1A7NH 1A6WH 1R6VA 3QDGD 4UILH 4ISVA 2VLLA 3I2CH 2NPLX 1CDIA 3CFEA 1G7QB 4JAMB 1H3WM 4PJ5D 3U9UB 1HOCA 1OM3H 2YEZB 3EYFB 4XCFH 4PJAB 5HI5D 3VA2C 4WGVB 5ID1B 3H7BB 1I1AB 4CMHB 1FSKB 1JBJA 4HAFA 1F90H 4JZOA 4XNXH 1MJ7H 4HKZB 1F00I 2VLKB 4KV5E 4EN3C 1TVDA 4PTTB 3B43A 5CHNB 2DQDL 3S8WA 3QHFL 3ULUE 4PRHE 1HYSD 2FNBA 3MR9B 4K8RL 4Q7DA 1F45A 4ZXBC 5ITFB 3RWDA 1MUJB 4XNQB 4NSKB 3SQOH 3AXLA 5GZNC 3T3PF 1UCBL 3V0WL 4MB4A 4KK5D 4YXHH 4HT1L 1BQLL 1I7RA 5D7IA 3CDCA 1EDQA 3DMMA 5F72S 4NQVB 5EBLB 2EC9T 3CDYA 1MHHA 4XVJH 5EOTB 3MBXL 4MCZA 1YZZA 2FIRT 4LLWA 4E42A 4HZLB 4HIIA 4AMKL 5KN5B 3RL2B 3KPLA 3LRHA 1E4XH 4DW2H 2XZQH 3N1FC 1OARH 2APWA 1HSAB 3F7YA 3I6GB 1ED3A 4RGMB 4M61A 3L5HA 3D9AL 3GIVA 2NY7L 2BCKB 5D93C 5ESAB 2ICWI 5D1QD 5IGXL 3S35L 4UV4L 5EU5B 3TJHD 3S34H 1P4LB 1TDQA 2Z8WC 1MCEA 4IDJL 6FABL 2YUWA 4GW5B 4KKBC 4J23A 1BQHG 1Q72L 4LVHC 4P3DA 1RIUL 5JW4Q 2MTPA 1KBGL 1U3JA 3AY4A 5EPMB 4IJ3C 3ZYOA 2AGJL 1KTDA 4KWUA 4MJIB 2J5LC 2ZNWA 3L3DB 1X4YA 2Q86B 5IBTH 1YQ2A 3THMH 5DD6B 2VZOA 4ZDHA 4HWEL 5D7LA 4K3HA 4JY5H 3MO1B 2XQBH 3O6FC 2VOTA 1AO7E 2O5YH 4L9LB 1AC6A 2NXYB 1CXKA 1X5IA 4DKFL 4R96B 5C09A 1SBSH 4ZTPH 4C56E 3VD9A 3DHMA 4ENED 4F3FB 1WZMA 3DGCR 3RTQD 4XCNA 4PJCA 4NQCE 4U6VL 4WI3A 1LE9A 4MWFA 4Y2DB 4FQXA 2EH8L 3K74B 4D8PB 2NLJA 5D7JB 5CIPA 3G5ZB 2D7PA 4OLVL 4WUKL 4G8IA 3MA7B 2ZNXA 1HSBB 2DDQH 4XRCB 1B4JH 3BW9A 4OCYH 5DDHB 4C57C 4TQEL 4KXZI 4J3OC 4WV1B 1FNLA 3T0BA 3B6SA 4PJGB 4R4ND 4C4KT 5E9DE 2Z4QA 1M7IB 3MACL 2HFEB 5D8JH 4AQ1B 1R3LA 4KQ4L 5EOCL 3PNWB 5LBSH 3C9NA 3W9EB 3MLXH 3QBTB 5I16B 4DZBB 5IMKB 1GGYA 1UWGH 4QXGL 2IANB 1AI1H 4NOBA 3BD4A 1CICD 4LBEA 1NCBH 4Y5YC 4EUPA 5I6XB 4CADB 1FNAA 5D6DA 1VFAA 4QF1A 5CBEB 4NGHL 1CI5A 2E7LA 4LP5A 5GJSH 4FP8L 1IVLA 5EZJA 1DANU 1RSFA 1A3LL 5C0BA 3ESUF 1N0XH 3HC0B 3VE0B 2VDNH 1JK8B 3MLZH 3ZTJG 3GHBL 4JG0L 4JRYD 3R1GH 5EZOL 1T1WB 1EBPA 4FXGA 1E27B 3VFSA 3TNMB 4I18A 9CGTA 1C7SA 4QRPA 3FT3B 2YZ8A 3TPUA 2NX5E 5IW6B 4G42A 1ZHNB 1OW0A 2OMBA 4G3YH 1C12B 4YZFF 5J13B 3HG1B 1F4XH 5HHPB 1N5AA 4LPCA 3A6BL 4NO0B 4Y1AD 2QSCL 1H3TA 2FZ3B 2XWJB 1HILA 5F21B 5EU4B 1OQXA 2X9XA 3QPQD 4KKNA 3S96A 2X05A 1LWRA 5HHMD 1T04A 3RY5A 2PO6B 4JRXA 4QO1A 2NY4B 2APXA 4KKLC 5DQJB 3U6RA 3MRJA 1JIBA 3KYOB 4Z18A 5JPNB 2XN9E 3HI1A 3NA9L 3UYRH 1MCLA 4ZUVB 1Q8MA 4XP5L 3W82A 2WUBH 4M02A 4ZYKB 4M6NL 5HY9A 3RVVD 3WO4C 4LSSH 5E7FA 1BJMA 4J7RA 4UIMA 4AT6A 3DUUA 1T4KB 5GQBA 3RX7A 3BQUC 3CD4A 4YHMH 1ACYH 1INDH 3MSPA 1QUNA 5K93A 2QL1A 5I15H 4FFZL 3VFNA 2Y7QA 3SDAB 4M7KH 1CGYA 4OZGA 1J10A 5HDQH 4XB7A 3MODH 3BE1L 4OLXH 1UYWH 3IXTB 1FC1A 3OGCA 1GGIH 2A6DA 1I75A 5FYJU 1UXWB 4H88H 4WRLA 2OS7A 2YD5A 2CDEA 2CLVA 4L4VE 3VJ6A 2X4OA 1XGRA 4Q2ZB 4HLZH 3UZVB 3VI4E 1HWGB 3P30H 5DVOA 3RWJB 4X83A 2UWEB 5CEYB 5HHNB 2P4AB 2CUHA 4HKXB 1ZLWK 2CDFA 4LCUA 1ZEAH 3BN3B 2WWKT 4P4KB 4QXUL 1LNUB 2F5BL 2HFFB 3MLVH 2FECI 4D9QE 5GGUA 3HE6D 1NH6A 4EXPX 2VLME 3D25B 4YHKH 1KB9K 2DQDH 4K8RH 2IGFL 2ATPB 4ZFFA 2CJUL 2J88L 1U8PA 3O9WD 1HINL 1S7QA 1MJUH 2V7HB 3ARDC 4LKCB 3DXAA 5GJTL 3CIQA 3V0WH 4DUVA 5ID0A 5IB2B 4ZUTA 3TN0D 1TQBC 1MHPL 1LEKA 4ZOAA 4HPOL 5JMRA 5B39B 4LSRH 4NQXB 3FQNA 2DD8L 5E2UH 3MMEB 5DMIH 4DKDC 4NCC1 2HT3D 2VWEC 4AMKH 1MCHA 2EE6A 2B2XL 4WU5B 5MEOB 5I8OL 3HRZA 2FGZA 1LO4L 3JTSB 3QRGH 4NJAL 1AHWC 3OWEA 4HC1L 2EDNA 1FORH 4G8GD 2ICEB 2J8OA 4LRNL 4XBGB 2MCPL 3T4AB 1JYXA 2CXKA 3D9AH 4QHMB 1NGPH 3F65A 3ULVE 4XPTH 3D2UD 4UV4H 1E6OL 2NZIA 2H26B 3K8KA 4WUUE 2I60H 3IAQA 4B7LA 2R56L 3K0WA 5DJAB 4MA3A 5DRZB 5HYJA 3PABB 4IDJH 6FABH 2YUZA 4RISL 4EJ1C 2O61B 2AJXL 3ZKXB 1QFUH 1RIUH 2W0PA 4PRPB 2EKSB 5CP3A 4LSDA 3X12B 1BHGA 2AGJH 4KDWA 5KZCD 4JJ5B 1MNUL 1NSNH 4XPBL 4XP9H 1ZE3C 5M7QA 1CCZA 2GTWA 4X6CF 1FL6B 3LV3B 4NN7B 5F3BB 1RURH 1GPOH 2H2PD 3MRFB 3BKYL 4K3DH 1RFDH 5INDB 1IGYA 5DHVB 5CP7A 3OXSA 1YEGH 4RMUA 1T1XA 3QUKB 1CXLA 1YJDC 2NY3B 4HGKC 3QDJD 5JUEL 3EYUH 2NNAA 3Q2CA 4ETQA 2A77L 3GSNA 5A2IH 3PL6C 3NIFE 1X6LA 5ACLA 1U93B 2GJ6E 3OKEB 5E6IA 3EDKA 3SGJA 5T3ZE 3OAYH 3FT2A 4U6VH 4BK4A 4PGCA 3L5XL 1OSZA 3V52L 1XFPA 3IFOB 1KF9B 1NUFA 1JTOA 1MLBA 2F8VA 1L9NA 3CFCH 4OLVH 4WUKH 3S9DB 1A47A 3GM8A 1Z5LB 2F15A 3B8YA 3DHJA 4PJBB 1TCRB 4RGNC 1BBJB 3QZWA 1JNHB 3SE8L 4F9LC 1AGEB 5DRXB 4F80A 3VXTB 1B6UA 4NOFA 2ADGA 3PWUA 2R29L 5DHVH 2CMRL 5DJ6A 3RZCD 4DQOH 1NDMA 3WUZA 1F2QA 5J57B 4QXGH 2YA1A 3VFTB 3PDOB 1G7IB 3RY4A 2RFXB 4W68A 4DZ8A 3G5VB 4X6DB 1NGZA 2JF1A 3KWWA 4LCCC 4L3ED 4RNRA 4PP2A 2H2PC 43C9A 1I1FA 4S0SD 4P23D 4P57A 3LKOB 3O3EA 4BZ1L 1A3LH 4IRSA 1YMHA 1LILA 2A9MH 1S7VB 4ONFL 4AJ0A 2OL3L 3GMOB 5DEFB 4TUKH 5L6YL 1U8MB 2JK5B 3VFRA 4HUUA 2EO9A 1AXIB 2LU7A 2RQ8A 3JWNC 3HNVH 2XNAB 4U7SA 4O9HH 4BSWB 3WN5B 2MHAB 4C83A 5IROA 1RUKL 3IXAB 5F89A 4ZPVB 2EDHA 1JNJA 4XPFH 1OAYL 4J3UA 3AS2A 1Y0LB 3SPVA 1UFUA 3QFJA 5B8CC 5JW4R 1FFQA 4Z78A 2PW2A 1NL0H 3OJDB 4E41D 2FX7L 3LAFA 2AQ2A 4HS6A 1AXTL 2G2RA 1RI8A 4ZTOH 3RZCC 1NJ9A 1OAUH 1EO8L 2Q6WA 5CEZE 5ELIA 1ZAGA 4POZC 3FFDA 4LL9A 4U49A 4WU7B 1DVFC 3AREB 4NQDA 2BNQE 3B9VA 1CLOL 1MRFL 4JZJC 3TJEL 3NMEA 2FX9L 3IAPA 1JPST 1SEQL 3VXPB 4U2ZA 5I1JL 4WTZA 2VL5B 5JORA 3UROR 3EAKA 3NA9H 3ARSA 3C09C 4I3SH 4OZFG 4TULH 5KG9B 3V4UL 1MCQA 4X8JB 2NXZB 3SKOA 1IGJA 4AIOA 2BVEA 5FA4A 1MHCA 2E8YA 4BSVA 2FATL 2V2XB 4Y4HD 3E6FB 4XTRD 2PW1A 5D1XD 1S7XB 5ANMB 5SWZE 3DV4B 4N0YL 5AD0A 1QLEH 1FO0A 4DTGL 5J9PA 3UTZA 1JPGB 3BE1H 4M1CD 4NKMB 2E8ZA 3FMGL 3IS0X 3O45B 5HYSB 4L4TA 1BZ7B 3FRPG 3SE9H 2JJWA 4RQQB 3OPZH 4YGVB 1AKJA 3NFPA 1U2HA 3BAEL 3SGKA 2A1WL 3C5ZC 3D39A 4UZGA 4QXUH 3TZVB 3MJ7A 2Q1EA 5BV7L 3LSOB 1J8HE 3PHOB 2DMCA 1EK3A 1RZJH 4XC1H 2RJMA 4I48A 1F3RB 2BNRE 1VFUA 2BVPB 4HHAB 4HKJB 3RWEA 2CJUH 3VFMA 3PQYA 1A5FH 2VISB 3TWCH 1HINH 4P2QB 4RAUB 4PJIF 4JDVA 1MHPH 4HPOH 4HIEA 1A6TB 4XTRC 3OF6D 4PR5A 4UT6L 3A6CH 5K9OB 5HVHB 4ZODA 2BVYA 5BMFH 1WVZA 4NUJB 2HH0L 2FHBA 3LN4A 1HHIA 1JI2A 1LO4H 4QOKB 4GRWF 1VDGA 3AAZB 1EO5A 3AS1A 1C5DA 4HGWB 2G75A 4NNXA 1XR8A 3MJGX 3RJDA 4Y4KC 5ALBL 3V5KB 3ROOB 3HNTL 3O3BA 2ARJQ 1E6OH 3U4AA 2W0FA 4F2MB 1CD1B 2ARJB 5ESVB 5C0AB 1I8KB 1F8TL 1LO5B 5EO0A 3VW3L 3IDMA 4G5ZH 3VDBA 3LKRB 3PWPE 3OKKB 4WY7L 4RISH 5DVMA 5DURD 2AJXH 4YHLH 1I7TB 5IMLB 5I19H 3ZMRA 4P2RA 5IV2A 3I50L 3LB6C 3TVMB 4C59B 4Z7VF 1QSFD 1BAFH 1M7XA 4JN1L 5MENB 3KPSA 1MNUH 4YBLB 3TV3L 1TZGH 3SKMB 4WW2A 2WUCL 1DQTA 2OP4H 4Z5RB 1ZWIA 3QUZC 3HPJB 5F1OB 3FO9B 1T6WA 3I6LE 4EI5D 2NY0D 4NCC2 4HG4J 4TVPH 1TNNA 2IH3B 3B9KB 1NBYA 3H9YA 5JUEH 1R0AL 3H3PL 4K3EH 5HHOE 5DD3H 3QULA 1AXSA 3MRGA 3WEXB 1S9VB 4ZO6A 5C08A 5DUBA 2W60A 4NPYA 4LARL 2GAZB 4JG1L 1T80A 2GHWB 2AK1L 5DRNA 3TBTB 5HXMA 2YPLA 2VWEE 3AB0B 5D7KD 4WHDA 5TQ0L 3ARFA 4AYFA 5I18L 12E8L 4FXKA 5CJXC 1XF5B 5BZWA 1PVHA 1SY6L 2IBBA 4R7DB 3MV8D 3WLWD 5FECB 4KJQD 1H8NA 5A3ID 4HZAA 1A6UH 1CXHA 3WIIL 2C7UA 4B41A 1G84A 3L3KB 3UTTA 2I5YH 5F7EL 3V2AR 4JFQA 1RZ7L 4OI8A 1E4KA 2V9QA 1EZVY 1G9ML 1YEDB 2D9QB 2VKXA 2WBJA 5D1ZA 3O8XC 3WSQL 3PF2A 2QSTA 5CSZA 1BX2B 3NACL 2M1KA 3H9SB 1ITCA 3QG6A 4J3VA 4MNQD 3SDXF 4D3CH 3ARVA 4XBPB 1NGXA 1UZ6E 5LVEA 5IJVA 1IMHC 3LN5A 3MRMA 3P9WB 4MLIA 3OMZA 3TCLB 1I8MA 5DZLA 5D2LF 4BZ1H 4EI5C 1I1YA 1V3LA 1IT9H 5J6GB 1YUHB 5FFLA 3C8KA 2FJGB 2AXFB 2RCSH 4PJEE 1NPUA 3C6LB 1K5NA 4MXVF 4XXCA 3I84A 1F3DJ 4EDXA 1MAML 4HDIB 3CU1A 3LEXA 3ZE0F 2WSKA 1JRHL 1Z2KA 2F54E 5KAQG 3BZFA 4OFYA 2FJHA 2C4XA 3BFOA 3IF1A 2B4CH 1OAYH 1VADA 1ZSDA 3KJ6L 1DQQB 3KPRB 5GRVL 2Z31B 3CK0L 5KSVA 3ARGB 2JJSA 2EEBA 1CFVL 1BM3H 3E6HA 1QO3A 2FX7H 5IWLA 3DVIA 4PRIE 4RGNE 1P53A 4KROD 3STZA 3QWRA 5IT2L 1BVLA 2NY2B 4PY8I 3TJEH 1NCCL 2Y07L 1A7QH 3S3PA 1ONQB 3UTQB 1S5HB 1A9EA 4NYLB 5J4MA 5E94B 4LPXA 4N1CA 3B5HA 5I1JH 1OSPL 5BXFB 1EEYB 5JTWA 2FHCA 2YD7A 4NZTH 1MI5A 3V4UH 4UTAL 3QDMD 2B7DT 1VERA 5DQ9B 3FZUC 2DBLL 4K07A 5GRUH 3L3OA 4Z0XB 5BV7B 2FEDC 1IAII 1A1MB 2KBGA 4JKLA 4XT1C 1XIWD 5JHDB 1FAIL 3QUMA 5L2KD 3CFDB 4CMMA 2H6PB 3SCMA 1R5VB 4RX4A 2ILLA 4JGMA 5FCUH 3FMGH 4NCDA 3ROLA 4ELMB 2IH1A 5FYJD 1YEJL 4JFDE 3O3UN 4S1QH 3V0AC 2I9TB 3BEWA 1OB1B 2A74A 1UB6B 1ZGLB 1JNNH 3SGDH 2A1WH 4XCCL 4N0UE 1B2WH 4KHXL 3DBXA 1FL3A 2MSPA 2ARWA 5BV7H 5C6PB 2XRAL 1PSKH 3MRPB 4XCYA 3HUJB 2P45B 4I0CC 5KSBE 4MS8D 1A3QA 3MLRH 3KNBA 1V7NL 2PXYB 2MKWA 1TTGA 4OJFH 1ADQA 4UUJA 3PDDA 5DTFA 3JV6B 1KNOB 1G7HB 3QA3A 5C07D 4IMKC 2N7AA 3L3GB 4OFKA 4N90E 4E5XA 1VEOA 4LPTA 5T3XL 4N9OB 1TZIB 1I9EA 4PJDB 4W6WB 1QHOA 1AIFA 4GG8A 2AQ1A 2ZSWA 1R3HB 4OLYL 4MAYA 5GXBB 1GSMA 3E2HB 1JWUA 1U91A 1SJEA 2HFGL 2AJVL 4P2OD 3L5IA 3V6FA 5FYLL 2VN4A 2I27N 4PLJD 5EZLA 1MEXL 2JB5H 3L9RA 4X99A 2KDGA 5DC9B 1U8LA 5IW1B 5BW7A 3BISA 4DEPC 5HGHB 4Z7WE 4NBYB 4JM2D 3RKDD 1IQWL 4XPGH 3ZT6A 1G7MA 1FNFA 3GSWA 1F8TH 3CUPB 4CVZB 4WI4A 4WY7H 5KANG 2OZ4L 4N9GA 1FVEA 5MEPB 4MX7B 1EVUA 2I26N 3ARBD 5IEHA 1YEFL 1G9NH 1OGAD 3FQRB 1R3JA 3I50H 2LU3A 1B88A 4MNHB 4I0KA 1QFWL 2VO5A 4HV8B 3V5HA 4JANA 4L3CB 4DFHA 2UWEE 3Q6FA 3MNVA 4J4PD 4XP4H 3S98A 1CT8B 2UY6A 4P46D 2IPKB 3BP7B 4HCRL 5C0CA 5C0GB 1CDJA 2ADJB 2DRUA 5I1HH 1YMMB 3QXDB 1OHQA 2QKIB 4HXBL 2H1PL 2NYYC 1R0AH 4Z0BL 3H3PH 3OKLA 3MV11 3QUYB 1JZ5A 1VGEL 4AIZA 3ISWA 3U0PA 3UPAA 4YFEA 1LGVA 1LHZA 3EZJB 1ZHKB 5I1LB 3U7AA 3EYSH 1U92A 4KUCD 2PYED 4PLJC 1PQZA 4M48H 1ZT1B 5TQ0H 12E8H 1ORSA 3QXWA 5KSAA 1JWSA 4M43L 5GGVY 2FIKB 2LFGA 3IDGA 2DTML 1T0MA 3IJYB 4WFHD 5DJDB 3IVKB 1P1ZA 2ESVE 3CXDL 5T1LD 3D3VA 1QSEA 2F58L 3S6CA 1TVBA 2IQAB 4BH8A 2HJFB 3U0WH 5F7EH 2R15A 1G9MH 2ZPKL 1RK1B 4D9RE 4DGVH 4ESKA 3NACH 4KI5F 3S4SA 3ZDXF 1KB9J 3V0VA 1YN7B 1BZ9A 4NQEE 5B38B 4ZS7L 4J4PC 1TENA 1IKNC 4P46C 1GIGH 3H0TA 2DWEA 5J56B 1F5WA 3A67L 4O4YH 3S3SA 1KLGA 3BDBA 3U46B 1U8IA 3RKPA 1FNSH 1N6VA 4AM0A 3V6ZA 4U6YA 4PFEA 5J06A 2BSRA 5T33L 5E8OB 1MAMH 4P4RB 3BGMB 3CVHA 2KL6A 3H9HB 4I0PC 1JRHH 4L8CB 4J6RH 2EDJA 1RQ5A 3ZHLA 4NRXB 4WJ5A 3DGGB 1FZJB 3SE4A 4JPKL 4ZQKB 3ILPA 1SJHB 2J12B 4Y16A 1DQLL 1WF5A 5J6HA 3D85D 4CVXA 1RUQH 2CKBB 3VGDA 3H3KA 3HE7C 3IDJA 5J0BA 1J1PL 3JV4B 4UOJA 4OCWL 4I13B 5IT2H 2A2QT 3FOLB 4KK8C 2CLRB 5GS0D 2DQUH 2Z9TA 5IEKB 1NCCH 5ILTH 1FYTA 3C8DA 5K9KA 3ZSSA 4KTDL 1P7QA 3VFUB 1CFTB 3N50A 1FDLL 2PF6A 2DIBA 3F8UB 4XAKE 3GBMH 5I8EB 2A73B 2IPUK 1INQB 1XGYL 4UTAH 1QPPA 1EO7A 3DOSA 2DBLH 2E27H 3QAZB 4Q6IA 3UAJD 3Q3GB 2XPGA 3HA0A 3SJVA 2EYRA 4WI5A 1QFOA 3TYFA 3DVNB 3U4EA 3Q5TA 4QHLA 2CKBH 3MTRA 1FAIH 1L7TL 4X6DE 2J8UE 3TO4D 4L8DB 3QEGL 5DGQA 3S3JA 4GS7C 3IKCB 2V9RA 1N6QL 5I8CA 1F58L 1RZGB 5E5MB 2PNDA 3RDTB 3GGWB 4JO2L 3SKJH 3GMPB 3V8CA 3GUTB 1FFNB 3VD4A 2HWZH 1JV5B 2GUOA 3N06B 1R5WA 3CXHK 4MSWA 1AQKL 6CGTA 2M8XA 4EBQH 1S8DA 1F4YL 4TUJB 1B0GA 2EIZA 2YA0A 2W9LA 5IMMB 3VFPB 4Z6AT 2BY1A 3G6JB 1T7XA 2VZTA 4XNMA 3O2WL 3GBNL 2Y36H 4WWKC 3BPLB 3VFVA 1T21B 3W0WA 1KIQA 2G5RA 5I8KL 3CX2A 1S9WB 4U1JA 1LK3H 1V7NH 5T1KB 5IFAL 1JN6B 4X80L 2OMNA 3O4LE 3EYOB 3MLTA 4LK4A 4NNYB 2L7JA 5EO1A 1I3RA 2IAMD 5HDLA 1GOHA 3NOIA 1KENL 4WI9A 4Z8FL 2K1MA 1TZHA 4Z7OE 2R69L 2R1WA 1HH9B 3FCTA 4PJ7E 4MLSA 4X98B 5CKAA 1E0OB 1W72A 4OLYH 3CZFB 4JEGB 3WIHL 1QFHA 3CSYB 4X6CA 5L88H 1V05A 1D9KA 4HX1B 1CQYA 2HFGH 5DZOA 1QHPA 3DO7A 4YO0B 1TITA 4G8FB 4FQPA 3BKCL 4JPVL 5J11B 1F42A 1MEXH 4P5TC 1CGUA 1DP0A 4JVWA 3DX6B 3QNZB 4Y5VC 3MFFB 2R2HA 3MRBB 3QI9B 1K6QL 3CH8A 2A6KB 3BP4B 4YE4H 2GCYA 3MGOA 1JPFB 4NZUL 5EU6A 2NY5C 4Y8AA 5EUOE 5FO9A 3C87A 3GK8L 4OKVA 4NIKB 5SWSB 5CINH 5ICYB 5ANME 1MCWM 2OZ4H 1BF2A 3HMXA 3BDYH 3P40A 3CMOH 1F4AA 2QSQA 3EO9H 5DA4A 1BJ8A 4UDUB 2XTJB 1FLRH 1X4XA 5GISH 2MFNA 5DLML 1EFXD 4CDHA 4HCRH 5FHBL 4XCEA 4QRUB 4Y88A 5D6CA 5SV3A 1WIPA 3EGSA 4YIQB 4G9FD 4QTHB 3WFBL 4MD0A 3CAFA 4N8VA 2JCCB 5EBMB 4HXBH 1VACB 1U3HB 5IFHL 1WBXB 2B5IB 2FDBP 1A9BB 1VGEH 1MQKL 3SO3C 1MREL 2UY7A 5TJWK 1RK0B 3U1SH 5JQ6H 5H94A 3MBEC 4ZDHB 2BSSB 2DL9A 3WXVH 4PJXB 2VQTA 3VWKD 1CFQB 1NC4B 3VXUE 5J12C 2P8PB 5HGBB 1M7DB 4RAVA 3RGVD 1T0NB 2DTMH 4CJ1A 2F53A 43CAA 1KJ3L 3DSFL 3EHBD 5EUKB 1VA9A 4OAWA 1DBJL 1TLKA 3WL9B 5CSGA 1Z0NA 3BIAX 3T0ED 3X3FL 1WSST 4JFOB 2ZPKH 4QOKE 5JHLL 1BD2A 3FFCD 3T0DA 2BXYA 3C2AL 1BQUA 1RUPL 3ET9F 1CVSC 3JZ7A 2GJJA 3FQTA 1XGUA 4ZUSA 4ZS7H 3T1FB 4GBXA 5H35A 4TNVK 1YYML 5FO8B 3L95B 3VXSD 4F37K 1I7ZA 1D5MB 1SYVA 3GKWH 2YD9A 3A67H 5CZXD 3WJJA 4ODBD 5E24E 4ZG1A 3JVGA 3GSNL 4G8EA 4YXLL 4QCIB 3OR7B 5MENE 1DBBL 1FG2A 3HC4L 1QR1B 4OZHF 1QBMH 3GMLB 1LP9F 3FN3A 3VWJD 4R3SB 1NLDL 4NHUB 4QHKI 2WIMA 4WFGD 3LIZH 3TH4T 3VFGL 3EFFA 3QNYB 3PWPD 3VCLA 1DQJB 1YPZF 3LMJL 3JWDH 5BZDB 1U36A 1MVUA 3BN9D 2XA8L 4V1DA 3HPLA 1D5BB 3OXRB 5C0NC 3S5LB 5GZOC 4LSTH 1P7KA 5JDSA 4X7TB 5FM4A 2OQJA 3QP3A 1HCFX 1UM4H 4PB0L 4IIQB 4OCWH 4L9DA 3X14A 3T0EC 1S7WB 4ODTL 4OGAC 4KV5F 4QRRA 5ADOL 4PV9B 3RPIB 2BHUA 1J1OL 3MQIA 4MHHI 4MQ7B 4BQCA 1SBBA 2HTKD 2UZXB 1I1AD 1GGCH 2X4TB 5IESL 4ODHL 2DWDB 2CDGA 2NQCA 2VLKD 2ZZUT 1FDLH 4JFPB 3V6OC 5IVXB 3MGTB 4LLMA 2BC4A 1AD9B 4NO3A 4MDIA 1UA6L 1XGYH 1A14H 5DRWB 1IM9A 2VABB 3U30B 3WFCH 1QZ1A 2DYPB 3T1WA 4N0RA 4UU9A 4U1LA 5H2BA 4DVBB 5DJZA 1IGMH 1OPGL 3FONB 3H9SE 1AY1L 5D72L 4DOHB 4K94L 2VZ1A 3TBVA 4JKMA 3X13A 1TMCB 5J3HC 3HZMB 1UKTA 2CD0A 1D5ZA 2X1WL 2Y25A 4BM7A 3MJ6A 4PJIA 1JPSL 4Y5XC 3DUSB 1IQDB 4M5YH 1T5XB 5JNYB 1FNHA 1NFDE 5E8PA 1DQML 3LZFL 3N85L 1EVTC 3MJ9H 2VDPH 4NZRL 4ZPTA 1U2CA 4APQC 3RNQB 4Y4FA 1PFCA 5HJ3A 2YBRB 3GBNH 4KK9C 4QWWD 5LJYH 5KS9F 3P4MA 1T83A 4ZD3H 4F7PA 3SDDB 4MXWL 3UBXB 2UVFA 3MRRA 3QB7C 5LKNA 4PGZA 4MJID 4L8SA 1AFVH 4JO1H 2P5WB 5FGBC 2CRZA 4ZAKB 5C0JB 1MLCA 3WUWA 3QDGA 4FTVE 4PYGA 1KENH 4L8BB 5DMKB 5CBAB 4Z7VA 2X4UA 3QIUC 1CTOA 2VB5A 3QEHB 2VR4A 5ISZE 5TE6L 1BLNA 1DFBH 2NXYD 5I2IB 4X9HA 3WIHH 5EZIL 1Q9OB 3FB6B 2UVEA 4JFEB 3QCUL 5IVZB 4HH8A 4WTWA 4X4YA 1PY4A 2RGSA 1FO0L 4OD3L 1FIGL 4LMQE 3ALXA 5JIKA 5JW3H 4Y2DD 5F71A 4M7JL 2E9JA 4MQSB 1ZA3B 2DQGH 1S9YB 2HVJA 4XMPH 5D7JD 4YHZL 1UXSA 2FD6L 4ZO9A 1K6QH 1MFEL 3CH1A 4OD2A 1E4WL 2J7LA 2EYTB 5J1AA 1GC1C 2Z93A 3W11C 2ENYA 1EAJA 2X40A 2AV1B 4JE4B 3GK8H 1MCIA 2VUYA 5JHDE 3HZYB 2M26A 2DLFH 3QCTL 4YUEL 5LGJA 5DSCB 3UTSB 4F37F 3C5SB 1LQSR 5BQ7A 1C08B 3DMMC 3L3HA 3MLUL 2B1AH 3O2VL 1RZFH 4MB3A 2IAND 5GGTL 1HEZB 4TNWK 3RWIB 2J3SA 2F8OA 2HA1A 3WYRA 2GW5A 1A22B 4R0LA 4N5EC 1DN2A 5D1QA 3WFBH 5DFVD 1RHFA 5FKPB 3ME0A 2R2EA 3VH8G 3PJSA 3ARPA 3EDDA 3SDXA 5CJQL 3RNKA 1WZKA 3MJ8B 4GG6E 1KCRH 2VLJE 1MQKH 5HPMB 1NBQA 1MREH 4V2CB 4MNGA 4ORGB 4XPHL 4GKSA 1KB5B 5D2LA 5MI0B 5BRZB 3EOBB 2X4NB 2F74A 2PUQT 4F9PA 3OHXA 3AY4C 5FV1L 3MV7B 3ZE1E 4PS4L 1XH3A 4TOYH 2HLFC 2Y23A 4PJDE 3HG1D 2A83B 4UINL 1UB5A 5IB4A 4NO0D 3GMMA 2Q7YA 1CFSB 1KJ3H 4LF3B 5TPWH 3DSFH 1QG3A 5IFJA 3B3IA 4PREB 4M9PA 3PWNB 3DIFB 3UPRA 5F7DB 5C0BD 4UTBH 3X3FH 3BUTA 3RTQA 1PZ5A 4JM2F 1UJ3A 4PGBB 1OTTC 4BFIA 4AEIL 2HTLC 4NM8L 3DVGB 1SM3L 3F5WB 1KV3A 2NY4D 1KB5H 4I2XE 4HFWA 4GW1B 3MUY1 4FQXC 2Z8RA 5B3JF 2CSPA 1UZ8A 3L5WB 1LVEA 3REVA 1U8HB 1DLHB 4JCLA 5HYFA 4QNPE 2C1OB 3V5DB 1KN4L 2OR7A 4X4XA 4PTUA 3U7YH 3BO8B 1DUYB 2NY1C 3QUXB 3F58L 2CO6B 4HXAH 5DVLA 4J3XA 1DBBH 2R0LL 3HC4H 1FZOB 2COQA 1TPXB 3TA3B 1CICA 2R23B 3FKUS 4LSVL 4K8RD 3SDAD 1N26A 3CPLA 3R0NA 1EGJL 2J4WH 4OTXL 2V2WB 3ALPA 1GVIA 2W07A 1F2XK 2XA8H 3CCHB 2WBWB 4KJPD 1RMFH 2NW3A 3FL7A 1RHHB 5D6DC 4KVNL 4LPUA 3OAZH 5A2LH 3AM8A 4FZ8L 4KUCF 4JN2B 2OSLB 5DMGC 1SJXA 4HS3A 2E7LC 3OR6A 3JXAA 3K4AA 4PB0H 5DVKA 3GBLA 1J0HA 5E2TH 2LABA 1A2YB 3DRTB 4JRYA 3D48R 4JPWL 4P4KD 2CXGA 4QXWA 3VXRB 1KIRB 3IETB 1NBZA 1Q9WA 5JZ7D 3KGRA 4ODXB 4G43A 4I18C 4HUVA 3BUYB 4MGXA 1UWXK 3RA7L 5E4EB 5FGCB 2YPKA 4Y1AA 4XAWL 1OW0C 4PBVC 2AJYL 4MD5B 1L0QA 2Z8VC 5GGVL 3ORJA 3QO1B 5L0QC 5E1AA 5ALCL 4FMFA 2XICA 5IKCA 1XF2A 2R1YA 4LCYB 2YS4A 1AY1H 32C2B 2G60L 3PG2A 3RIFK 1LK2B 1I7UB 5IB1A 2CK2A 1XF1A 1RJYA 2Y72A 5HI3D 2YA2A 2ICWJ 2J2ZA 1SYSB 3ULVF 1PX3A 3HB3D 1QYGH 1T1ZB 2WLZA 3PHSA 4P5MB 1IGCL 2C4FU 3HR5A 3IRZA 2ED8A 1RZIB 5F9WC 5HHVL 1I9RL 2O5XH 3ZO0A 4TNWF 1N8ZA 1DQMH 3LZFH 4CW1B 1ZLUK 4D0BB 1L7IL 5E8EA 1FVDA 4NZRH 1HQRA 2GSGA 2YOCA 3T0XA 3ARWA 1FL5A 4K71C 2HJLB 2KQMA 3U4BL 1IKFH 2V7NA 5IJKA 3GSOB 4JGUA 4P4KC 2D31B 1VKXB 3FQXB 3S88H 2W92A 4PRPD 4WDIA 5ACZB 3UEZA 3FO2B 3QXAA 3RU8L 1QSZA 2EXYC 4QT5A 2VQ1B 4KRLB 5JMOC 3MLWL 2FWOB 5JR1H 1QRNE 2XOTA 3V6OE 1KPVA 3QIWB 4U3XA 4E9LA 2Q8AL 5DFTA 3T0AA 1BECA 2ADIA 4R6UA 5EZIH 3S37L 3VXOA 2NY3D 3LKQB 3PIQA 3QUML 1C7TA 1MELA 1AE6L 2AJ3A 4Z7UF 2LV4A 3HE6A 4RFOH 2E9WA 4YFDB 1XZ0B 3W5NA 1WK0A 4FFYH 2HKHL 3L1OH 4LCWB 7FABL 2ZWLT 4YHZH 3O9WA 4FZEL 5JOEA 4JY6A 5H37H 5TGBB 5T1MA 4OBRA 4IRZL 1I8IA 1WWAX 3FAWA 3TN0A 3QCTH 5EFIA 3MRDB 3QWOA 3BOVA 3FB7A 3P11L 3TC9A 3ESVF 3VXME 5DXWA 5F1IA 3HAEG 2WBKA 5GGTH 2VE6B 3NH7L 5T3XE 1ZHBA 5SWQA 5IB3A 1UH4A 4J3SA 2AABH 1ZTXL 4I5BB 3BDXA 4G8GA 4U1HA 3FB5B 3O2DA 4MQXD 1CL7L 1PG7X 1A6AB 4CU6A 2BHYA 4NO2A 4OZIA 3D2UA 1DSFL 4MJ6A 1CK0H 5FKAA 1ZT7B 5FYLE 1J9CT 3IJHB 3GMNA 4RGOL 3G5YA 3OKMB 5BO1L 5DHYA 1KJMA 2HJKB 1U6AL 5AZ2L 4JO4L 3WHXA 2VKWA 4BQ6A 1JYVA 1HWHB 3ZHDA 1K4DA 3WFEH 4JB9H 4R9HA 1MCPH 2XQYK 5FF6B 2A0LC 4I3RH 5KVDL 2A6JA 4XWOC 2P24A 3RVWD 4GSDL 3P9MA 3CXHJ 5E4IA 1I3UA 4UBDD 3ZE2E 1G7JB 3QO0B 2XACC 4XB8A 1BWMA 1UEYA 5BS0B 1YNKL 1KCSH 3QDJA 4HK3J 2VRAA 3BEVA 1IAOA 2DQHL 4F15C 2R0KH 1RUAH 4NM8H 2BY0A 3SEPA 1BQHB 3ARED 2BSTB 1X44A 4ODUB 1SM3H 5E6IC 1AD0A 3SGJC 1Q1JL 3RIFF 4ZFOB 3TCXA 3PWLA 3LPWA 1IGTB 5JO5A 4G6JL 4JM4H 3UJJH 1TXKA 1BP3B 4LNVA 1NFKA 5DD1L 4D0CB 5EB9A 5EBGA 2EICA 5C70A 4NRZA 2WBJB 2NXZD 4WHTB 2XKUA 3ZSTA 4I4WA 3F58H 4M7LH 4HWBH 4JLRB 1NEUA 1NGWB 2ZKHL 2ZCKL 1R3KA 1YNLH 2QHRL 2AP2A 4C55A 4G7VL 1NGYA 1IEBB 1I8MB 1FYHB 2C3XA 2OYPA 2UZIL 5JOPE 5K9JH 3EJYC 3R06A 1EGJH 3RWGB 2Z92B 4W4OA 1NUGA 4L3EA 2CIIA 1TNMA 1JRHI 3WHE1 1NLBL 3KR3H 3DI2B 4P23A 4QGYA 3P9LB 4M3KB 2HMIC 1B0RA 5JXED 5KVGL 5TE4L 2FO1A 2DIAA 4R2GB 5D96C 4IRSC 2DKSA 1CDHA 1ZK9A 4XH2B 4H20H 4DCQB 4PJXE 3BWAB 3TZVD 2CUIA 4GRLB 4OSUH 5D7LE 1BJ1H 4GRMB 1XCTB 5DJ2A 1DEEB 4M1DL 1RVFL 5IB5B 4K94C 4OV5B 2KH2B 1NEZG 2AK4B 5C09E 1Z3GH 4H8WL 5IROC 3P73A 2H9GA 3CDGB 3BIKA 2VIRA 3BXNB 4OKDA 2IALA 4KY1L 4PJCE 4M7ZB 1UG9A 4R4FL 5AYUL 1SVCP 3AROA 1HNGA 3QQ4A 4WW1A 2RR3A 4P2QD 2NXZC 3QNXB 2EC9U 1CGWA 1F4WL 3CC5B 4L4TD 1QLRB 4E41A 1RJZA 4DN3L 2OI9B 5FB8A 2G60H 1WBZA 3UX9B 2A9NL 3WFZA 1VEMA 1PKQB 2H41A 4BH7A 2FR4B 1NAKL 4JDZA 4B7IA 3MV9B 4YHOL 2ENSA 2ICWA 2GK0B 4X7EC 4ZUWA 4A6YA 5INCA 3OKOA 1AGCB 3DX8B 2H2SC 5ENWB 1UACH 4XVUD 1A6PA 1AGFA 1I3GL 3D69A 5HHVH 4YHNB 1S9XB 4TVPD 5GS2H 2C1PB 1RU9H 1ZGLM 1IC7H 5DC4B 3LKPB 1G0YR 1WEJH 4FABH 1FGVH 2DQJL 4Y4HA 5C0AD 4GKNA 3VXNA 1Z9SA 2OR9L 5EC1A 2WK2A 1KELL 1IAKA 5D1XA 1MF2H 5IHZB 2Z35A 1U3YA 1N6UA 4NT6A 4YPGB 1DDHB 3OKNB 2ZUUA 4O2FA 2EEDA 4GT7A 2FSEA 4BKLB 4PJAF 3MLWH 3BI9X 4GAJL 2ORBL 5F1KC 1MY7A 2VAAB 2AXGA 1XR9B 2D7QA 3V7AG 1UVQB 1KTLA 4YPJA 3DPBA 3B9KD 3NIGE 3S37H 5IQ9B 3SGKC 5C2BL 1LD9B 4GAGL 4PJ9B 1P9MA 4TUOB 5AG8A 3IFNL 5T5NF 2VXSH 5DK2A 3FT4A 7FABH 3MREB 4CNIB 3BPOC 4YDIH 4M93B 4F7CB 1JL8A 1ZVHA 1C8PA 3U9PH 1V7ML 2VDRH 3GJFB 4IRZH 1XGQB 5KSUB 1T1YA 4ZFZA 1BIIA 3KJ4C 3OF6A 1IFHH 1PYWB 4K9EH 1A6ZB 1KJ2A 4YLQT 5D2NA 1HIMH 4RWYL 4X7CC 2EYSB 2BJMH 4RMTA 1JGEA 4HF5H 1UZ6F 1HQ4B 3NH7H 4K2UH 2VITB 1U8QB 1OAQH 3H9SD 4HJGB 3HI5H 3HZKA 4YBLC 1FV1A 2XWTA 2P8MA 1V3MA 4HIHA 4XNYL 3N9GH 4XMLL 3DX7A 1U58A 2R4RH 1DSFH 4M8QA 3ES6A 4J1UA 4QRQA 4OZGE 1AP2A 1FQ9C 1CBVH 4L5FL 2IADB 1MJ8H 3RUGB 4K7FB 1OAXL 1CF8L 4UOW1 2J6EH 4RGOH 4X9BA 1EJOL 4FFVC 1W72L 5ICXB 4YC2C 5BO1H 1HXMB 2YK1L 3GJFH 4KI1A 3KPQB 3C6LD 1IBGH 4JO4H 4FQ2H 1RZKC 3NTCH 4LLDB 5E03A 5HHXL 1QSFA 1MCOL 2KZWA 3KYNA 3P0YL 3PGDB 5T5FH 1KPRB 5DO2D 3SDYL 2K3TA 5F88A 3GMRB 4KXZH 3CX5K 2WINB 3LKNB 5DT1H 4AZ8A 2YRZA 1JF1A 3ZLQC 4WW2C 4GXVH 4EI5A 2HN7B 3JV0A 2OR8A 4OZHA 3KPRD 4PJHB 1LP9A 5I9QC 1MIEL 2DB8A 2Z31D 3QRFM 3ARGD 3GB7B 4Y19A 2PKDA 1W0WB 1YPZA 3HMXL 3OX8B 1Z9LA 5ETUB 3WFDL 2UYLA 3DXAE 4N0CD 5I71C 4PG9B 5DUPH 2VLRB 2NY2D 1RPQA 4PJGF 1ZXQA 3QEQB 3GO1L 1MH5A 5IHBA 3AU1B 3C60B 2ITCA 1JWMB 3MRHB 3KLAA 4KRPB 3FRUB 4LDEB 2I9LA 3MV8A 3ARFC 3CLFL 3UTSE 3NCJL 5D70H 4ODWB 4OQTL 4PRHA 3SOBH 4HUWA 4ZSOB 4J8RB 3BZ4B 1S7UB 5HDOA 5K9QI 4YAQB 1U95B 1X5JA 3B83A 3S35X 1HK6A 4R97C 1MFNA 2ZCKH 3TBWA 2QHRH 3BPCA 3O81A 4KK6C 3SBWA 4MNQA 1E4KC 1JMXA 5D1ZC 5FHAL 1ND0B 3F7RA 5HYJE 2DQFB 3MRIB 1QFPA 5IG7B 3L7EA 5C0RL 1KSRA 4Z7QE 3MUJA 1EJ6A 1NLBH 3QEUA 3BT2H 1HH6A 3W9DA 2AEWA 5JW5A 4ERSH 5KVGH 1DLFH 3ARGC 2E7BA 5DWUL 5DJYB 1L6ZA 5TE4H 4O2EA 3WIFB 1A4JA 2FGWH 1LO3H 5JIIA 4U1NB 5CJOH 1VGKB 1MFDL 4N0CC 3G6AA 4NDMB 1N59B 3MV7E 4PG2A 4XXCC 5GSVB 1C1EL 5GS1B 2XZAL 1K8IA 3B5GA 5EIIA 3LPFA 3HCVA 3VRJB 5IF0A 2ZCHH 1KIPA 5DJCB 5TDOB 2PXYD 3BH9A 3SCMD 4KY1H 2R1XB 4R4FH 2WZPD 1E28B 4TTDD 2X5PA 2W0KA 3GSXA 5KS9A 4LLYB 1N4XL 4H1LA 1X7QB 4I9WE 1LEGB 1OAKL 3KPOB 2Z91A 3P4NA 3M07A 2O93L 2JJSC 4YX2H 2WIIA 4HH9B 3BP5A 4JDTL 5IWLC 3FTGB 3KPNB 4TN9A 3VGAB 3ULUH 1ZVSA 3SO5A 2WV3A 2IEPA 1ZLSH 1X5ZA 1GAFH 1J05B 5I1CH 2VSCA 5L2JA 4G9DB 2YSSA 5GS3A 2Q76B 3EO0A 1IC4H 3OTTA 4NQCA 3Q1SL 2W65A 5TDPA 1F3JA 3QDMA 3PV7A 5FUZL 4HPYL 1OLZA 1AGBA 3BWUC 1FJ1A 4XXDB 4LIQL 1O7VA 3JUYA 1NMBL 4U6HA 2DQJH 5F7YC 2YD2A 2OR9H 4OF6A 1WIOA 1XIWA 3I75B 1KELH 4KVCH 3ZTNH 4QY8B 5L2KA 5HGDB 1S7TB 1UH3A 2GUOB 4WCYH 1AO7B 5FUOH 1K8DA 1XF3B 1NBVH 2UWEF 2Y5TB 1IEAA 3ECBB 3LD8C 3C08H 4QKXB 4C56B 2AJUL 3OAUL 5C0DB 3SCMC 4XNUH 4GAJH 2ORBH 4JREB 1UM5L 3KLDA 3KPPA 4OZFB 4YNYB 3SDCB 2ITDB 3MPCA 5I1IH 5I66B 1BFVL 4TSAH 5E7BA 1YMMD 2A6IB 1MY5A 4W6XB 1OTUC 1KT2B 3QFJE 4DAGH 2BOBB 4GAFB 3QUYD 4H1LH 4DFIA 2W9EH 4FMKA 3IYLW 5E9DB 5I1EH 3MRLA 1A7OL 2F19L 4GAYB 3T3MF 4IOIA 2BVQA 4HBCL 2DM2A 3F7VB 1C16A 4KPHL 4QRSB 5F7NC 2F5AL 5C92A 1CDCA 3REWA 4NQDE 3X17A 1ZS8A 2OXHA 2GJZA 1G7LA 1XF4B 5C07A 3O3DB 3E8UL 2FO4A 3UBXI 4WO4B 4OZFH 2DIJA 5FOBB 3WD5L 3LQZB 4M9OA 5EWIL 2X7LA 3DROB 2OJZL 4RWYH 1KN2H 5MEQB 1WC7A 1YN6B 4KKAC 5FO7B 4JFYB 2I07A 3WXWH 4MAYC 4P2OA 4PLKD 3TIDA 5EU6B 1WT5A 3GI8L 3KPMB 3GFUA 1RIHH 2PTTB 2FBOJ 4XMLH 2X4QA 4LLVA 4JM2A 1T5WB 5BW7C 2P5EB 1OAXH 1W0YT 5GIRB 2NX5B 1CF8H 3NZ8B 4LLQB 5DZNA 1M6OB 2R0WH 1CXIA 1P7HL 5I74C 5A2JH 3M1BB 5CWSA 1JHLH 3VXQA 3ARBA 1OGAA 4X6BA 1CR9H 1F11B 1QEWB 5CGYD 5HHXH 3KLHD 2QR0B 1MCOH 4YDJB 4M5ZL 4PB9L 3G08B 3IDIA 1U8JB 5B4MC 5FOJA 3D39E 1VPOH 3IDYB 4U33A 4J4PA 4NUGL 5DK0B 1E6JL 2BY3A 4P46A 1XGPB 1ZT4A 4IOSD 4MD4A 2FLBT 4JFFB 4F7EA 1Z9OA 3HAEA 1MIEH 4D0DA 4PY8J 5F9AC 5F1SA 4HMCA 4H5SA 4AH2B 1INEL 2WP3T 5IIEA 2XN9B 4NQSB 4HLZG 3PQYE 1MFBL 4KZEH 4PJBF 3WNKA 3CSGA 4JFHD 2YKLH 5GHWL 1CGSH 1OD9A 2J8HA 4H25A 5IVNA 2PYEA 1U9KA 3GO1H 2ZUQC 4AENB 4KDTA 3EOTH 5IP4A 4U6XA 5CLTA 2YHGA 3HZVB 2MMXA 1J88A 2BK8A 5KSAC 5CEZL 5T1LA 5EIQA 4OQTH 1R5IA 4OF8A 4WFEE 1S78C 5KVEL 3O6LH 3BGAA 4NN6C 4PJFA 4NM4H 4X6DF 5B21A 4WIQA 3UJIH 1FFOA 4L4VB 1TVHA 4LVNB 1OCWH 1DBAL 2AJZB 4CAGA 2FEEL 1BBDL 2PCPB 3BH8A 4YDVA 3TGXA 3KLHC 1KG0B 1Z0MA 2R8SH 2C3VA 5FHAH 1HI6B 2BRQA 4JVUA 4PY7A 3L6FB 1YEIL 4NO5B 1NANH 5E2VL 1S7SA 3M17B 1KFAL 3RDTD 4P2RE 4PJ8B 4H8WC 3GSVB 2YRPA 3GSRA 3KPSE 3IAGC 2W59A 5DWUH 4FQQA 1U8NA 2R2BB 3QQ3A 5I75C 1EXUB 4HJJL 2JE8A 4DKEH 1MFDH 5E95B 1DJSA 3D5OF 4WUUA 5HVFB 3EJZC 2JIXB 5CUSL 3L3IB 4OZ4A 2GFBB 4YEEA 2D4FA 5ERWB 4LLUB 8FABA 4FA8A 3X11A 4QYOB 2NZ9D 4EVNA 5MERA 3V4PL 1WAAE 1GCFA 2K7QA 5T1KD 4AK1A 5I1AA 2ZUTA 1NDGA 4HWUA 5C08E 4LNRB 1S7RB 4HIJA 3D85A 3SE4C 4CVUA 1HHKB 1OAKH 5FYKE 4YR6B 4IS6A 5IOPB 2B1HL 2YPLE 4Y16C 5DI8A 1JZ4A 4WFFE 4QXTA 2XFXA 2MPAL 4ELKA 3G6DL 3IGAA 3ZDZF 5DA0B 3WS3B 2YC1B 4EQ2A 4IRJB 2X1XR 4Z95H 2AEPL 5KVFL 3UTTE 4RIRA 2B8OT 4YBQC 2AVGA 4NRYB 3MC0A 4R7NB 1NAMB 1CE6A 1M05A 2ATKA 2NCMA 5EUOF 1WCQA 1MHEB 4LKXB 1CDBA 2YD1A 3QI9D 1FC2D 4Z7UA 5E00B 4LAQL 1ZOXA 1NMBH 4BQ9A 1GJIA 1OF2B 4NN5C 4Q6IC 4CN1A 1ZKAA 4HWZB 4EN3B 1DE4B 3RBSA 4O2CA 1SEBB 4JRWA 3QXTA 4K55A 1JGDB 5SWSD 1U8KA 4ZUUA 2HG5B 4PRDB 3TO4A 2V17H 2AV7A 4OCXL 4ZXBB 4GQPH 3MUGA 3ZKMC 1WZ1H 3G9AB 3MRKB 1U41A 3TIEA 5I1DB 2GJ6B 2XTJD 3LDBC 2X1PA 1NCAL 3V79C 1ES0A 3MRNA 1CGTA 1MIMH 1KYOK 2EZ0C 1NAMH 3WNMA 4WGWB 2EKJA 25C8L 2ZSVA 3SKNA 4J12A 2ZCLL 1U3HD 3LPGA 4LEOA 1RJLA 1T66C 1UQSA 2P42B 1HXYA 3T8XB 1A7OH 4TYUA 2BVOB 3ZT5A 5D93B 1W8NA 4NHCH 4PJ5B 4FQ1H 3VMOA 2X4PA 2F5AH 2YPVL 3D18A 1NC4D 2IAMA 5I30L 2QHLA 3RWHB 5FV2A 1EHXA 3L7FA 5IMOA 3E8UH 5T3ZH 4JFZH 5HD8D 3BPNC 1AQDA 2NW2B 3WD5H 4IJ3B 3TBYB 5IBUB 5EWIH 1MI5E 3RX8A 2OJZH 3RY6A 2J5LB 4LVEA 3UC0H 4GFTB 2XKNB 2HRPL 3FQWA 1Q9KA 4P9MH 4K7PY 3O11B 2OLDA 4RMRA 1JYWA 3QZWG 4ZS6C 3WV0A 2R39A 3QIBB 3O6FB 3SGEH 1KJVB 3LQAL 2OTUA 3RWCA 4RMQA 1HHHB 4CU8A 4Q97A 1JI1A 35C8L 1OTSC 3FHQA 4XZUB 5C0EA 1EHNA 1ORQA 2F53D 1A7PH 3PGCA 3VG9C 4X7DC 1BGXL 4M6OL 1YDPA 3GMQA 4Q0XL 5CEXB 2HKFH 5JXAH 4GKOA 4YGAB 5CZVL 3MCKB 1CIDA 2HT2C 4BA8A 3CVIH 4NUGH 2R4SL 4KGLA 3HFMH 1EFXA 4NKDB 3QPXL 3V8OA 1FN4A 2BNQB 1J1XL 2BOCA 1BFOB 1CG9A 4G9FA 4QTIH 4G6KH 1YJDL 2H32B 5EOQH 1ACZA 4UDTB 2MQ0A 4DGYL 1OT2A 4MXQD 4HFUL 5AG9A 4CDGC 4Y5YB 1LEIB 4JZNA 4EOWH 1A7RL 1JUFA 5GHWH 4I3GA 3DRQA 3T4YB 4F7TB 4KMLB 1J0KA 2KZ1B 5TH2A 3VWKA 4HLJA 1EHLH 4AIXA 2H8PB 3JBG7 3SY0B 4RMWA 4FHBD 4O02L 3RGVA 5E5RB 3KXFB 3K2UH 2VDOL 3OKDB 3FB8A 4ODVL 1YQVL 15C8L 5SWZB 1S5IL 5CD5C 5CEZH 5IHUH 2BNRA 4HK3N 5BVPL 2PR4L 1D7FA 3EOAA 2DYPD 3QT2A 4ALAL 3LEYL 2ZP0T 4P3CL 2VDQL 1J12A 5C0FA 5IUSA 2H32H 2ADFL 4WHCA 1OGTB 1BBDH 4WTZG 3FFCA 3BZEA 3WO3B 2YN3A 4RWHA 4U31A 1WITA 1GXEA 1Q94A 5EU3A 3O6KL 5LGHH 1YEIH 1G0XA 4OM1L 1MJJA 3MZGB 1KFAH 2AJSL 1J8HB 1I9IL 1H5BA 1NMAL 1CLZL 4GBXC 1JHKL 5BVJB 1DEDA 4S1DD 1I4FB 1YEKH 3IJSA 4I77L 5DJ0A 3WJJC 4KHTH 5GRWA 4NKOB 3GNML 3PWVA 4U05A 5A16A 5C0CE 1JF5A 4PRBB 2DF3A 3WFHB 1ZMYA 3GSUB 1GOFA 5E6ZA 3VWJA 3TBSB 2D7TL 2P8LA 1YY8A 3PWPA 1FZKB 4MDJA 4HK0A 2JB6B 1FRGL 3SDDD 3PHQB 2V5MA 3WO4B 2Q87A 3STBA 1QQDA 3MA9H 5D5MB 3GJEB 5CMAA 4OCSL 2CO7B 3BQUB 4PGEA 2P5WD 4ZAKD 4G80A 1EUUA 2BX5A 4OM0L 2B1HH 1IAIH 3K8MA 1NUNB 4S1RH 3U9UA 1G7QA 4JAMA 2P7TB 5C9JB 1F4HA 1HHGB 1IGFH 2YEZA 3EYFA 4PJAA 3G6DH 4DJMA 3VGHA 5ID1A 3H7BA 4LVOC 3FO1B 1I1AA 3D3VE 4JFED 1QSEE 3ARYA 1AJ7H 3MXWH 2AEPH 2VLKA 4HKZA 5KVFH 4UB0L 4FNLH 1TJIH 4YZFE 4EI6B 4PTTA 5CHNA 3CX5J 1WFUA 1NCTA 3MR9A 5ITFA 3U2SB 2HVKB 3EFDL 1MUJA 4XNQA 4NSKA 1T20B 1GZQB 4LAQH 4WNQB 3KS0J 5I76B 1LO2H 2ERJC 2ZJSL 4GUPB 2XXMB 3KLSA 4ELMF 4LSQL 4NQVA 4IOFD 5EBLA 3UO1H 1QKZL 3MRCB 2ZOKB 3BVNB 5EOTA 4XVSL 1YEHH 5HYQB 4M1GL 2P43B 4XP1L 4HZLA 5DD0L 3ARDB 4ZO7A 5KN5A 3CZJA 3RL2A 1A1OB 5HHOB 1JYNA 2AEQH 1OLLA 4X6EB 1HSAA 1TQBB 3I6GA 1KLFA 5CCKL 2BCKA 3HUJF 5ESAA 25C8H 2VH5L 1WWCA 4M03A 1MWAB 2DLGA 5ADPL 5EU5A 1Q9LB 4WDIB 1AHWB 1P4LA 2AKRB 3BGFC 3NZHL 4GW5A 4XX1G 3NGBC 4Y4FC 1VFBB 3CFBB 3P2TA 2X44D 1LO0L 1J5OL 2OJEB 4LHUB 3O4OC 4A6YL 5EPMA 1P4IL 5BOPA 4PJDF 1T83C 5BRZD 2MCG1 4MJIA 2FYYB 3L3DA 2YPVH 5F6IC 4CBPA 2Q86A 4KKCC 5TFSL 1H0DB 5I30H 5DD6A 2WP3O 3NFNB 3C8HA 4L8SC 2D9CA 1FYTE 3PIQB 4MYWB 1H8OA 2BRRH 3QXUA 2X09A 3CGTA 2AJ3B 1CDYA 3MO1A 3O0RL 4L9LA 4K3JL 4MJ4A 2X70B 5TF1H 3ZL4H 4R96A 5HI5C 2HRPH 2FH8A 4NQTA 4F3FA 3U7WL 1MWAH 4XNZC 3MROB 4JY6B 3SJVE 3LY6A 1CLYL 4Y2DA 4PJEB 2APVA 1W0VB 1BOYA 3MX0A 1ETZB 4D8PA 4QNPF 2P1YA 5D7JA 1N3NB 3R8BB 3G5ZA 5LAXB 3RBGA 1G7PB 1KXTB 2C5DC 3MA7A 4XRCA 1HSBA 1HYSC 5JA8B 3N0PB 2DM3A 2R2CA 5DDHA 2F54B 3PL6B 4LCIH 5GSRB 35C8H 4WV1A 3MNWB 4OUUB 4PJGA 3P4OB 1CL7I 1RZ8B 1M7IA 4QHKJ 2HFEA 4OGZA 4IBLT 4KK5C 4F8QA 1S9KC 3PNWA 1XGTB 2EE9A 4QHUB 5EO9B 3W9EA 3QUXD 4LFHG 5IMKA 2ZUSA 5E8DL 4DZBA 5I16A 4M6OH 3BRGC 5MP6H 4Q0XH 2IANA 4PRIB 4RGNB 1KPUB 2QEJA 1T22B 5TE7L 2R4SH 1Q0XL 4LAJH 3QPXH 4LHJB 4CADA 1GHFL 2D2OA 1J1XH 5CBEA 3W0WE 4YDLC 4KZDL 2FBJL 2ED7A 4R0LC 5HPOA 2WWMD 5D1QC 1T3FB 4LEXH 3WKML 3HC0A 4HFUH 2ZUVA 3VE0A 4RFNC 3TJHC 1JK8A 3G04B 4LQFL 4X8XA 5TF0A 4LCCB 2P24B 1T1WA 1FBIL 4IM8A 1E27A 3TNMA 3VXRD 3FT3A 2OK0L 4LSUH 1G6RB 5IW6A 4F9PC 1ZHNA 1C12A 3RWFB 3HG1A 4KJWD 5HHPA 4ODVH 1YQVH 15C8H 1S5IH 4NO0A 4PRAB 3CJJA 5BVPH 2FZ3A 2XWJA 5LXGH 1JCKA 1CIUA 5EU4A 4P3CH 2IFFL 3FOMB 4JFDB 5EU6E 3ULSB 4FQIL 3MNZB 4ENEC 3IKKA 2PO6A 3QHTC 3RTQC 4HJ0D 5B8CB 1UJ3C 3EOYG 4MCYB 4N0UB 5DQJA 5CLWA 1Y18B 2P5EE 3A6OA 3KYOA 4OM1H 1ROWA 5F9OH 3VFOB 3WS6A 1FNGB 4GKZB 5FGSA 5JPNA 3RZCB 4ZUVA 1G6RH 1JHKH 5KSBB 3VRIB 3AC0A 4ODSH 4ZYKA 5HYIA 1DVFB 1UH2A 4JZJB 4R4NC 1A8JH 1T4KA 2EXWD 3SE3A 1MFAH 2YMXH 2WQRA 3C09B 5EORH 3STLB 1G1YA 3SDAA 4UIKL 1CICC 4JFFE 1I3VA 3IXTA 1P5VA 4H26B 1UXWA 2D03H 4O5LL 1T2QL 4Q2ZA 1ZLVH 1P4BL 4OM0H 3LS4L 1VESA 4D9LH 3QIWD 3RWJA 3UTPE 5D9SB 3MOBL 2UWEA 5CZKA 5CEYA 5HHNA 1HHJB 3AM8C 4EDWL 4HKXA 1KULA 1MCWW 1EEZB 1UGNA 4Z7WB 4U1KB 2XA3A 3Q5OA 4P4KA 4G6AD 1EV2E 1GRWA 1LNUA 2HFFA 1B6DA 4OGYL 3LH2H 5DD5L 2WANA 2SEBB 2B0SH 3BESR 4L29B 3D25A 4JY4B 1BD2E 2ATPA 4LCWD 3EFDH 4ZNCD 3KYKL 3C5ZB 2FECL 5EC2B 2V7HA 4LKCA 4ONOA 4DGIL 3O41B 2FL5B 2BHZA 4UT7L 5IB2A 1B9ZA 4LSQH 3QPQC 3UXFA 5INCB 5B39A 1QKZH 2UV3A 2R9HD 5FAAA 4XVSH 4WFED 3MMEA 4ZO8A 4PRNB 4L1DA 4WU5A 5MEOA 4RCAA 4BYHA 3EO1B 2F8XC 3JTSA 3K7UA 4BQBA 1U3ZA 2ICEA 3QHFH 3G6JF 4XBGA 3T4AA 4Q9CA 2P46B 5CAYB 3L3JB 2PYFB 5CCKH 3JWOC 4QHMA 1Q0YL 3DO3A 1YNTB 4RBPH 2VH5H 2H26A 4RAHA 3RVVC 2CGRL 5FM5O 3X3GL 1UCBH 3F62A 5I1KL 3MYJB 4OCRL 4HT1H 4V1DE 4O58L 2YXMA 4JFXB 1BQLH 5DJAA 5DRZA 4U1SB 3IDXL 2FRGP 3PABA 3F7QA 1ZANL 1JE6A 3WDIA 2O61A 3K4ZA 2DQIL 2ESVB 4HD9A 3MBXH 3WE6B 4PRPA 4Y4KB 2EKSA 4LIQE 3X12A 5IJKC 5I73C 3PWJB 3TNNB 3PP4L 4QRRE 4JJ5A 2EECA 5TFSH 2GIYA 1FL6A 3LV3A 5F3BA 4DVRL 3MRFA 3LQAC 1UJTA 2NY7H 4CU7A 1M1SA 5INDA 5DHVA 4GMSL 4M8VA 3O0RH 5IGXH 3S35H 4NQEB 3H9ZA 3QUKA 5BS0D 5AUMB 1JTPA 3LHPL 3KS0H 4KI5D 3UCRA 1P2CB 1Y6NR 3MV01 1HE7A 1U93A 4HKBB 3OKEA 3QUZB 1Q72H 2EDYA 3DYPA 3JSSA 1KBGH 3IFOA 1CZ8L 1MRCL 3HE6C 3BSZL 2BMKB 2BVTA 1PX4A 3NPSC 2QQNL 4JPIB 3I9GL 3I6KB 1Z5LA 1QBLL 3EBAA 4PJBA 1TCRA 3B2UD 3BZDA 5FIEA 5DMYA 1BBJA 3O9WC 4FQLL 4PJIE 4F33B 1M71B 4HWEH 1T7VA 1JNHA 1AGEA 5DRXA 4FFWD 1A4KB 3MXVL 2EDBA 3S4SG 3VXTA 2VYRE 1YECL 3TN0C 2YUVA 1JFQL 4DKFH 3BKJL 1V8HA 4U1IB 5SX4I 3BRDA 1JF6A 4WVRA 3VFTA 3PDOA 5EULV 1G7IA 4OFDA 2HT3C 2JCCF 2NTSP 2RFXA 3TT1L 5DEGB 4NNPL 2DLHA 3G5VA 3NFSL 3I02B 2EH8H 4X6DA 1Q0XH 5F7HA 1IM3B 3QQ9D 1PKOA 5AEAA 3RQ3A 4HUXB 1NMCC 4KZDH 2FBJH 4YK4C 4PGJA 4TQEH 3LKOA 4LGPB 2PN5A 3O8XB 1WICA 2IQ9L 4PJXF 4MVBD 1S7VA 4LRIA 3MACH 3GMOA 4KI5C 5DEFA 2DKUA 4KQ4H 4R2GD 5EOCH 5JPMB 1X5GA 2E7HA 3QDGE 1U8MA 2JK5A 4QHNB 2XNAA 4PJ5E 4Z7VE 4BSWA 1HZHL 3KYAA 3D0LB 3WN5A 2MHAA 4GRLD 4P99A 2XY1A 2OK0H 5LQBL 1K4CB 3IXAA 4XGZB 3QJHB 2NY6D 4ZPVA 1DBKL 2AK4D 1EH9A 3RVTD 5GS2D 2J8UB 4LU5L 1MQ8A 1Y0LA 4XHJD 1FG9C 4Z77B 1KYOJ 1KGCE 4NGHH 5C8JB 3DX9B 3OZ9L 3I85A 2V5RA 3OJDA 4FP8H 4N0FB 1F97A 1CD0A 4UAOC 3VH8B 2I25N 2HLAB 1A6VL 4GXUN 5KJRL 1YYLL 4WU7A 4YHIB 3AREA 3GHBH 4JG0H 4UOW0 4U4BA 5EZOH 4RDQF 3MV9D 1II4E 4K7PL 3NAAL 4JVPA 3QHZL 3IDUA 3VXPA 5F9JB 5E2WL 3EYVB 2VL5A 1G9EA 3MOAL 4F57L 1R24B 5KG9A 4X5LA 1OP3H 3A6BH 4X8JA 3LKSB 1NANI 1T89A 2Q7NA 3B9EA 2QSCH 5SX5H 3O4LB 1XAUA 1AR1D 2VDLL 3IDNB 2V2XA 4G6ML 3E6FA 5D7SL 3UZQA 3IB4A 3MLYL 2DQEL 1FFRA 3WLBB 1PEZA 4NP4L 4KGJA 4PGDB 1S7XA 1NFIB 2XWBB 3DTXB 5ANMA 5I17B 2PTVA 4PJ7B 4UIKH 3DV4A 3QG7L 4KRNA 4YHYB 1JPGA 2NY6C 4Q58C 4NKMA 2GSIB 4U1MB 3ZKND 5HBBA 3O45A 4W4OC 5HYSA 5D2LE 5JXEA 1BZ7A 1P4BH 4UI2A 4XP5H 4P23C 4RQQA 4M6NH 2I24N 5DJ8B 5E2JA 4YGVA 4J3WA 5IVXF 3GRWL 2CK0L 1BVKB 3TZVA 3ZE0E 3LSOA 3QQNA 4GW4B 5DD5H 1MPAL 3PHOA 5EUOB 4PJ9D 3KXFE 4FFZH 4XPAL 1KEML 1DUZB 3VFWB 4FQHB 5CD3B 1K2DB 2BVPA 4HHAA 4HKJA 3KYKH 5CS7A 2VISA 3OAZK 4P2QA 3W2DL 1JVKA 4DGIH 4TSBL 4RAUA 1AR1C 2DN7A 4NWUL 1A6TA 5K9OA 4NKIL 4NUJA 4OI7A 1QLFB 2F5BH 5E08L 3RVXD 1YA5A 4QOKA 3AAZA 4HGWA 3HS0B 4WEBL 2IGFH 2BNUB 1ZHLB 1WBYB 2VXUL 3V5KA 2J88H 3DWTA 3LRSB 1BOGB 3ROOA 2GY5A 4P2YA 4DK6A 3S36L 3T77B 3UJTL 5GJTH 2CGRH 2VSDA 4K23L 3VXUB 4F2MA 3NCYS 1CD1A 2ARJA 1WFOA 4X5WB 5ESVA 5C0AA 1I8KA 5FDWB 1CGVA 4O58H 1I1RA 1LO5A 5GS0L 1WGOA 1ZANH 3LKRA 4GJTB 3OKKA 1VENA 4CVWA 3ZYZA 4Y4HC 2DQIH 1I7TA 2DD8H 5JOFB 4DEPB 5D5ME 5D1XC 3OJVC 4M62L 3TVMA 3FO0L 1U8OB 4P5KB 2W38A 4N8VG 5MENA 2B2XH 5I8OH 1J86A 4JRYE 4NJAH 4M1CC 4W70A 4HC1H 3SKMA 4Z5RA 2CR3A 2MCPH 3C6SB 4LRNH 3HPJA 3FO9A 5EIVA 2QQLL 2XT1B 2VC2L 4GMSH 4GH7B 2IH3A 3B9KA 2IPTL 2LTQC 4Y1AE 4XI5D 1D6EB 2R56H 3U0TB 3W39B 4RRPA 4X6FB 3BP6B 2LE9A 3WEXA 1S9VA 5JW4N 3TO2B 2APFA 2GAZA 2VLRD 5HHME 1MRCH 1P9MC 2AW2A 4LOUD 2NR6D 5F3HB 1QP1A 3BSZH 3TBTA 4OLUL 3QEQD 2QQNH 1EZVX 4RMVA 3I9GH 3C60D 5DC0A 3BHBB 2H3NB 3NN8B 4XPBH 4AL8L 3U36B 3WBDA 1XF5A 4X5XB 2NY5L 4R7DA 4KRPD 4N1EA 1XT5A 3SGEI 5FECA 3JTTB 3BKYH 5TDNB 1TQCC 2E6QA 5F6HI 1FPTL 1UWEL 4JHWL 4XVTL 5GRJL 4X7SL 2IBGA 1YECH 3L3KA 3TP4A 4Y19D 3K8LA 4UMGA 3BYTA 2A77H 4E0RB 5D2NC 2QADD 1YEDA 3V4VL 3RAJL 1DN0B 1OOAA 1BX2A 4Z7QF 4W6YB 3H9SA 1EAPB 3L5XH 3V52H 3NFSH 5D71L 4XBPA 1DR9A 3AVEA 2E7CA 1D5IL 3TCLA 1AGDB 5EA0L 4TPRL 2EDXA 3BIBX 5GRXG 2OL3B 3R0MA 3RL1B 5J6GA 2Y6SD 3SE8H 1YUHA 2V9TA 3HR6A 2FJGA 2AXFA 3ULUD 4PRHD 1HDMB 2QQKL 3C6LA 4ACPA 1IGIL 8CGTA 4HS8L 5JA9A 3AUVA 2R29H 4U1GC 5IBLD 2CMRH 4HDIA 3K1DA 2XG5A 1TTFA 2NR6C 3D6GA 5LQBH 3N1PC 2BFVL 2HFTA 5C7XL 4Y8DC 3UTOA 3PV6B 5F8QC 1DQQA 5KTEL 1DL7L 1Z9MA 4KRPC 3KPRA 4RA3A 4CN4A 3L5JA 2Z31A 3ARGA 4OBSA 4I0PB 5EBWB 2NY0C 5KW9L 3QWQB 4BFGA 1NFDB 1S3KL 4ONFH 3QJFB 1DZBA 2OL3H 3LVEA 5KJRH 5L6YH 2FJFB 3D0VB 4U6XB 3W81A 2QADC 2W9DL 3B4NA 3VDAA 3P77B 4TRPL 5DFWH 1NC2B 1ONQA 3UTQA 3NAAH 2FEEI 1S5HA 1CVRA 4NYLA 5E94A 2OTWB 1FZMB 1RUKH 4QRTB 1JGLL 2MNUA 4X9IA 3HE7B 4Q6YA 5BXFA 1A1NB 3AS3A 1H15B 3INUL 1EEYA 4KUZL 4AEHL 1V3KA 4B5EA