4JPVH

Crystal structure of broadly and potently neutralizing antibody 3bnc117 in complex with hiv-1 gp120
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
223
structure length
216
Chain Sequence
QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A STRAIN 93TH057 GP120 WITH LOOP d AND LOOPD V5
publication title Somatic Mutations of the Immunoglobulin Framework Are Generally Required for Broad and Potent HIV-1 Neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 34
structure length 216
sequence length 223
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpvH01
3CCHA 4IMKC 3NBNA 5EOQL 4UT9H 1QA9A 2NY4C 3V4PL 4M3JA 4BH7B 4LSVL 3QI9B 4XVSL 1NGZB 5T1LA 4WHYH 4OIIL 1R3LB 2ED7A 3TCLA 5M95B 4HHAA 2AEWA 1H3VA 4XXDA 2XG4A 3OTTA 1PX4A 4U2YA 3PQYB 3WDJA 5FM5O 4WHCA 3T8XA 3I84A 2CKBA 5F72S 1F3JB 2NPLX 2DQCH 4O9HL 5DDHB 2ZUWA 4JDTH 2FEEI 4FQCL 2R0LH 1Y6MR 3CX5K 4KQ3H 4TTDC 3TT3L 1KCLA 4ODVH 2WWMC 2BVOA 3H42H 4OCYH 3TYGL 2VN4A 4LLYA 2VXSL 4ZAKB 3WNKA 2WQ8A 5IQ9A 4XWOC 3TIDA 5I19H 3GBNH 2IGFL 4P5TB 4JRYB 4N8CH 4YDLC 1FRGL 4I18C 1RZKC 1AXIB 1BJ1H 2F74B 5FCUL 5JHDB 1FG2B 1KEGL 1RUKL 2P5WE 4WDIB 1GGIL 1T20B 1HKLL 3QXAB 3HRZB 4M9PA 2EXWC 3HI6H 1WWWX 1NMAH 4S1RL 4EIGB 4RAUA 4F7TA 4MJIE 1NKRA 3MRGA 1CDCA 1JNJA 4I4WA 3MV9A 3LB6D 1LO4L 5L9DL 2GJ6B 5JXEC 3TIEB 3GHBH 3BP7B 3MLRH 5DJ0B 4N0YL 3SGKA 1WFNA 4PJ8B 5C71A 1W72H 5CBAA 3OKNB 4N0FA 3IDXH 25C8H 4RDQF 4YC2B 1X5AA 4NQSB 4UV7L 3INUH 3VWJB 2ZCKL 4JN1L 1U8OA 2EH8H 2GT9B 5BVJA 1WZMA 5H35B 5CJ8A 4XVJH 1FZMB 4R3SB 4NCC2 4TUKH 1WAAF 2Z91A 3UJJH 2CJUH 4XCNB 2IQAB 4WWKD 2DM3A 3VE0B 3ZE2E 2IADB 1EHNA 2HFEA 4WW2B 1JN6A 4AYFA 1BGXH 3WFBH 1DQQB 1V05A 5C0CD 2B2XL 4HIEA 5TPWL 3UBXG 3NZ8A 2BVEA 4WI5A 3BSZL 1G6VK 2NY0C 4X80L 3QHFH 3WEXA 3HZMA 5E8PB 1RHHA 3JV5A 3X3GL 4FA8A 2X4PB 2GI7A 3VFGH 3ROOB 1QSEB 1RZ8A 1BECA 1G9NC 1JWSA 2BNRA 2VDPL 2VMFA 3T1WA 4P2RB 1C5CH 4WV1A 4TNVK 1P6AB 3TN0B 1IGFL 3DETC 3NN8B 3V0AC 5E2TH 3LPFA 3HC4L 4L4VD 5EU5A 1U8JB 1WIPA 5I9QC 5SWSA 4K3DL 4PJFF 4XMPL 5ESAA 3IKCA 4QY8B 3THML 1RVFH 1RIVH 1AJ7H 4LRIA 4NQCE 1AQDB 2XTLA 4JY5L 4PTUB 4LHUD 4FQIH 4IEFB 5D1XA 1I3GL 4FG6C 5E4EC 3HPLA 2IC2A 2ITDA 2VLJB 5F7EH 3QPXL 4CMHB 1Q9LB 2ARJB 3X11B 4NT6B 5BQ7B 4JM2F 3RHWK 4BQ6A 1D5BA 1R5IA 2NW2B 4HG4J 5IJKC 4JO3L 5L0QC 2UV3A 3WIHL 3ULVC 4PRBA 1H0DA 3FQNB 2OTUA 2DN7A 2XICA 1U8HB 3HG1E 3HS0B 3F58H 3L5IA 4XNZB 4OQTA 1XGRB 1MCOL 1CG9A 1DLHB 3E8UH 5MENE 4POZC 4N9OB 1E6OL 1DL7H 3CFIC 2ICWJ 5EO1B 4MA8H 4IRSD 3WE6A 4EN3B 3PABA 1WCBA 3KDMA 2FSEB 4I9WE 4Y4HA 5I1LB 4KPHH 3TO4D 4LMQE 3BFOA 1KPRB 4OAWB 2HH0H 5HPMB 4DN4H 3W9DA 1JHTB 3RGHA 4LGSB 4XPGH 1F3DJ 4C56E 1PKQE 4GQPH 2VH5H 3PWLB 2OMBA 1T7WA 1AGFA 2XZZA 1EZVY 4D9QE 3OKEA 3TO2B 3WSQL 1LO5B 1MLBA 4Z7WB 2Q7NA 3PGDB 1KPUA 3U82B 4S0SD 2VXVL 4ZFOA 4NRYA 4S1SL 1FGNL 4QHMA 4HFWA 2MCPL 5DJ8B 3UPAA 4JR9H 4DK6A 4U33A 4M43H 1T6VN 5DA4A 2ZUYA 4C54A 3F5WB 5I2IA 5D7IB 5TDNB 1W0WB 1H5BA 1PW3A 3KPMB 3O4OC 3RNKA 1IKNC 2R29H 3CFBB 4QOKD 4G7YL 2W65A 3GSQA 4FFWC 3GSRB 1F4YL 2J88L 4MSWB 3TT1H 3D85D 3T1FB 4K55A 3VG9C 4L3EB 3BPNC 2P5EA 2R4RL 2YEZA 3W0WE 3MV7D 2ZUXA 3EYQD 2NY5H 3MREA 1TQBC 4GLRH 4RRPA 1D5XA 5IBLD 3E3QE 1IEAA 7FABL 4GG6E 2NY7H 3QB7C 2X4UA 4HJ0C 2WQRA 4JFQB 2RB8A 5CKAA 2WINA 3SQOL 1N7MH 1MFDL 1F45A 3V6OC 3I3DA 5EBWB 5D70H 4EBQH 3FOMA 1JHLH 3CVIL 3UTQA 1TZGH 1DVFD 1KLUB 3BPOC 3KS0H 3SDAC 5IVXE 3ZYIA 1CR9H 3FQUB 3FT2B 2JF1A 4JPVL 2IFGA 3ZDZF 3WUWG 3V4UL 2D31A 4KUZH 1DDHA 2JJUA 3VXSE 3FAWA 3K0WA 4KTYA 3ESUF 1IGJB 4JFEB 5ENWA 3HNSL 1OD7A 4PJGB 1KELL 4U6XB 2QHRH 4GW5B 5SWZD 5E8OB 1P7HL 1FBIL 4NO2B 5EG6C 2ZG3A 3A6BH 1F6AA 4B50A 4E5XA 1NJ9B 3OJVC 2VLMD 3QFJB 3D18A 4KY1H 5FXCH 3DVGA 3WO3B 2AJVH 4JVPA 1HQ4B 2XYCA 3CU1A 4X6EA 2W0FA 3B9KD 4P4RB 5E2VL 4MNQB 3U36A 4ZFGH 1NUGA 4LEOB 5C09D 1F2XK 3MACH 3WNMA 4OGYH 2FECI 5KVEH 3NCYS 1U8PA 3R8BB 1SJHA 4I77L 1KCUH 4Y4KB 3DXAA 3FRPG 5BMFH 2CLZB 2PXYC 1MCIA 2FL5B 3T3MF 1HYRC 1ZA3B 4NN6B 4OCRL 3B9VA 1IJ9A 4NO3B 5FK9A 5CP3A 4MQXD 4ODWB 3WIIH 1FYTD 3REVB 2QKIB 2GY7B 1A21A 5I0DA 4Z7OF 2CRYA 1J0IA 5D7SL 2I5YL 4M3KB 4N0CD 3NAAL 2WIIB 4WUUD 5CEZD 1OSZA 2P5EE 1BBJA 2YXFA 3ARFD 5FKPA 2OJZH 1ZLUH 3DTXB 4R90L 3G9AB 1J1PL 3H7LA 1CIDA 2G9HB 3TBWA 2DS4A 4YBLC 1S5HA 2C3HA 2DQEH 3MA7B 4LP4A 1BVLA 2AK4D 4UU9B 3DX9A 3VRIB 3QEQA 5TF1H 2KQMA 4JPWL 4IOFD 1ND0B 3MCKA 4UNTA 4PJXA 1QVOB 3HMXL 1OD9A 1NGYA 5GSVB 4NKQB 4OB5L 4F15B 3P11L 4KMTH 5TFSH 3S96B 3WJLC 3FFCE 3FO0L 4F2MA 5B3JF 3MLVH 2X9XA 3RVXC 1IZKA 2X1PA 1KTLA 4JN2A 2WBKA 3OJDB 1UB6B 1AP2A 1KNOA 3B8SA 4NQTA 3G5YA 2DKUA 5FF6A 4NQVA 4J3UA 1EO8L 5H94A 4NUJB 5I6XB 1JTOA 4HIHB 5HPOA 4D3CH 2FEDC 4ENEC 1CXEA 1EZVX 4NNXA 1CLOL 4ZSOB 3QUMB 4HD9A 3BZEA 1QSFB 3UAJD 3LOWA 1QR4A 4FQXA 5D7KD 3MLZL 2GIYA 1ZXQA 3OKOB 3MLYL 4EOWL 5T5NF 5DTFB 3ZYZA 5BZWA 2CLRA 5LJYH 5L2JA 2YS4A 2BOCA 4KVCL 5BS0A 5JLZB 1UWGH 2YD7A 3ZTJG 1K8DA 2JB5L 2I07A 3LS5H 3JWDL 1OAZH 5MI0C 3T2PA 5E95B 1BQSA 2OX5A 4XC1L 1A2YB 4ZUVA 4OM0L 3LEYH 3ZDYE 1DUYB 4XRCB 1CBVH 4F7PA 3U0WH 3DXAE 3MJ6A 2EKJA 5T3ZD 4XWGH 2Z35A 4DGVL 2AEQH 4D2NA 4Q9CA 4PRIB 4GXVL 3UTOA 4GLRI 1CFVH 4TSCL 1GCFA 1D3CA 1DQMH 3LKPB 4N90E 2H9GA 4DW2H 1JNNL 4BSVB 2DWDB 1FDLH 1A6AA 2ZUQB 2H6PB 4ZXBA 4KK8C 3LDBB 4UOW1 4ELKA 4DK3A 1M71B 5HD8D 3VGDA 2Y6SC 4MJ6B 4N1HB 3VFTB 2W9LA 1I1FA 1ZT1B 2NXZC 3R1GL 2HFTA 5IEKB 1F90L 5IHZA 3X13A 3QEQE 3SDCA 5HVHB 4CMMB 4OZHB 3ALPA 4X9FA 4IIQC 2Y25A 1LHZA 3WUWB 4ELME 1W0YT 1Q9OB 3TLRA 3IXTB 3RIAF 1H3TA 4HWZA 5FM8A 3P30L 3QXWA 1SEQL 2DBLL 2DQIL 3QDGE 4UB0H 4EI5B 4MS8D 4PJCF 5KN5A 4F9PA 1DE4B 3KPRB 1G0DA 2OL3A 3C08L 3NIFF 3IJHA 3ARGA 4OF7A 3BW9A 5JW4M 3C2AH 1YY8B 2A77H 3T77B 4XCFL 1KCRL 1NMBH 1AHWA 5E9DB 1B0WA 5T1LD 4LAQH 3FMGH 3FL7A 1HILB 3T0BA 2P8MA 4AT6B 4NQDB 4UQ2B 1IGTA 1IC7H 1PBYA 3QUYD 4ORGA 5BW7C 1BZ9A 5HVWA 3KYMB 3NFNB 1KG0A 3MRHA 4UINL 5ISZB 4YR6B 1JGUH 1MSPA 5C0DB 5B4MC 2ZNXA 2E27H 2FD6L 4Y19B 1GC1L 5HGHB 1AC0A 2EXYC 4Y4FB 1XR8A 4AM0B 3IGAA 1A7OH 3OKMB 1EV2E 2XQBH 4JPKH 2NY1D 5D5MB 2R2BA 4DKFH 2QBWA 2VSCA 4X7TA 3T04D 2D03H 3QUZB 5I15H 5ALCH 1VFAB 5IB1A 2DKMA 3GBML 5TQ0L 4H0GA 1DQDH 1MJJA 4RBPH 3JXAA 4LQFL 4XMKH 3GNML 1W0VB 3S98A 3WHXA 1BQHG 4OCSH 4QRUA 1YC7A 1EXUA 3MJGX 2Y23A 4EQ2A 1VKXA 4MZ2A 3WNNA 4BSWB 3QA3B 1KIQB 2K3TA 2H32B 3BUTA 4GW1B 1I8LA 1CK0H 2GK0A 5E8DL 2QQLH 2QSVA 3V52H 3MV9D 2W60B 3G5ZB 1YYML 3NCBB 1U91B 4OZIF 2B8OT 2Y7QB 3GHEL 5D6CA 3RIFK 1X6NA 3DX6A 5CMAA 3MRNA 5FECB 2GK2A 3HCVA 1Q72H 1N5AB 1S9YA 3KPNB 3L95A 5C08A 3QIUC 5TQ2H 1NAML 1VACA 1ZSDB 4FQ1H 4H26A 5ID1B 4POUB 4FMKA 3V7MA 4Y2DA 5LWYL 3GMRB 4ZYKB 1P4IL 2GTWA 3RPKA 2ZOLB 3BXNB 4X5WA 3NFPB 1HZHL 5DMJB 1TVHA 1X6LA 1PG7L 4YNYA 3PDDA 4Y8AA 1BBDL 3EYVA 1T1WA 3ZE1F 1T4KA 4MA1B 4P9MH 1U6AL 3VD7A 3EHBC 2Q3AA 1MHHB 2ZPKL 1FQ9C 4R7NB 3BD5A 2DTML 4RGNB 2Y06H 4X6BB 4YEEA 4YK4C 1KIRB 2BNRD 5DC4B 2XT1B 3U7WL 1R5WA 3FTGA 3P4NB 3L3HA 4OBRA 4HT1L 2V2TB 3BAEH 2QTEA 3H7BB 1V7NL 3SDYL 3MJ8B 5SWSD 1MQKH 1LD9B 3VXUB 4KKBD 3O0RL 3L7FA 1HI6B 3ZL4L 2PO6A 5J56B 4HDIB 1F4XH 3QXTA 5D1XD 3KLSA 3SOBL 4NFDA 2LTQC 4ONGL 4FZ8H 1OTTD 4PRHB 5EOCL 1CDBA 3B6SA 4L3CB 1TLKA 4P2CG 4Y89A 1RV6X 3LS4L 4JY4A 4ONFH 5HI5D 4PREA 4PS4L 5F9OH 1KJVA 2UZIL 5IMMB 3FCTB 3M8OH 4HFUL 4YGVA 4CDHA 4C4KO 1JHKH 3QCTL 4Z76B 4LCCC 1M6OB 5ID0A 4DJMA 4MCYA 4WJ5B 1H3PL 1TZIB 4Y4HD 3MFFB 4FQLL 4NQUA 3MOAL 1OGTB 2F19L 4M4RA 4BFBD 2VO5A 1T03L 4OJFL 5IFJB 2KDGA 4K7PH 2HLAA 3LQAL 1MI5B 1AY1H 4OF6A 5IVNA 5E6IC 2PTVA 4R96A 1Q9WA 2P43B 4XPBH 1YJDL 3QCUH 4I0CC 1T7ZA 1T7XA 4JFPA 3VI4F 5EU6A 4X6DB 5FFLA 2YPKB 4C59B 4PJEB 4GRWB 3UZEA 5FIEA 3RVWC 1D7FA 5SWQA 3E6FB 4ONOA 2ZCLL 4RFOL 4OZGB 2Z4QB 2D7PA 3BDYL 1NLDL 2MQ3A 3EYFA 4Q9QH 4HBQA 3OHXA 5CHNB 5GGQL 3DSFL 4MNHB 5FUZL 5B39A 4KRLB 3K1DA 4F57L 4LU5H 5IB5B 4QGYA 1A1OA 1FL5A 4GG8A 3O2DA 4WEBH 3BJ91 1TNNA 4LLQB 4WFGD 2ICCA 3KXFE 2P5ED 4H0IA 1X5JA 43C9B 1BQHB 1A6UL 5I1DA 3O6FB 3TPUA 4J3WA 1M4KA 2RIKA 2GSGB 2OBGA 4R8WH 5EBLA 2DQHH 1NC4A 4QT5A 3HTLX 4PGCA 2VDQH 3P4MB 1Q0YH 5T1DL 5HYJE 4HF5H 1CE6A 4MA3B 4U0RC 4Y5YC 2RCSH 1KLGB 4JAMB 1EEYA 3T2NH 2Z31B 1NFDA 2AJZB 1MJUH 4Y5XB 1FNGB 4IMLA 5IFAH 1U3HB 1YECL 1R0AH 1HEZB 5JIPA 1N5YH 4M5YH 4XBGA 3ZE2F 1EHLL 4GKOA 4U1KB 1B6DA 4LSQL 1A1NA 2FHCA 4OLVH 4R4BA 3FO1A 1TETL 2H8PB 3QNXA 3IF1A 2IMMA 1IGIH 1R5VA 4U2ZA 2EYRB 1KBGH 4EJ1C 5IMOB 5B38B 5A16A 2EYTB 1F8TH 3QQ3A 1HHJA 3QCVL 3OAYH 4ZG1A 2NXYD 4F37F 1FO0B 1G7MA 5FYJD 3RUGB 3AXLB 4S11A 1L0XA 3PIQB 2Z8WC 5F7MC 5J6HB 1WC7B 4O2FA 3EZ8A 5FUOH 1YEHL 2UYLA 1QPXA 1ERNA 4QNPE 4P4KA 4POYA 4K3HA 1MRDH 1P5VA 1E4KC 2A6DA 5B8CA 4B41A 3O4LE 3FN0L 3NA9L 3EOYG 1UACL 2CQVA 5F93C 3U0TB 1HHIA 1S7VB 4AIOA 3PWPA 4M7JL 3WUZA 5CZVH 4Z7NE 5KVDH 3MBEA 1ZT4B 4H0HB 5DZNA 4HJJH 3V4VH 3O3EB 1MWAB 3DXAD 1LE9A 5IKCA 2C9AA 2R0ZL 3RGVA 1T21A 3WFDL 1W8OA 4OFIA 1TPXC 1KJ2B 2E8YA 5HYSG 1MHPL 1MQ8A 1RZKL 1T5XB 3MRBB 5IG7B 2GAZA 5T3XH 4UUJB 5IGXH 2I9LA 4OLXL 3QFDB 4DVBA 4OI8A 1EA9C 4XHJD 1AGBB 4NZDA 1A1MA 4ZUTB 2ZSVA 1F02I 4L4TE 3QDMA 5I66A 1R3IH 5EC2A 1T83C 3MCG1 3VI3F 3TBSA 2PCPA 4PPTA 4J3OC 2BMKB 2BC4A 5DMYA 3QEQD 2XTJC 1SY6H 3D39A 2CK0H 1IGMH 4PYGA 1FVDA 3C2SA 4U1HB 4KZDL 4ZOBA 2ED8A 4YHNA 2YR3A 4HQQH 5KW9H 2GFBA 5T1KB 3VWKA 2NY3D 1OARH 4LSUH 1WWCA 4DAGL 1UCTA 3BQUA 4M1GH 4QRRA 5EUKB 1WT5A 5L7XH 4GAGH 1C5BH 5GIRB 2F5BL 4MQ7A 4PBXA 4W81A 2CLVB 4AK1A 5KAQG 3JUZA 1A6VH 4G6ML 3OF6A 4M6MH 1BX2B 1OF2A 1IEBB 2YHGA 4YPJA 3O11B 3WCYA 2I60H 3HC3L 1AO7A 1EHXA 4IRJA 4G7VL 1U92A 4FQXD 2DL9A 5KZCB 1YQVH 3GKZA 3D87B 3C5JA 4FQHA 4XTRD 4AEHL 3IRZA 4X4ZA 3TV3H 1W72A 1S7UA 2WBJA 3ULVE 4OCMC 5DJZB 3DO7A 1Q9KB 2MPAH 3VXTB 1K6QL 5GPRA 2AQ1A 1U3JA 4ISVB 1M05A 1G9NL 5BS0D 1NEZG 4J8RB 4S0TD 4ODHL 3KJ4B 1GJIA 4GG6F 1NMCC 4NRZB 1UADC 4GSDL 1HIMH 4M8QA 4KROB 1BF2A 3MXVH 3MODL 2LV4A 4LLVB 1ZV5A 1JZ7A 2KH2B 4UDTA 4OCWH 1EJ6A 3V79C 1WQVT 2AJXL 3NCEB 1J5OH 1S9VB 4TULH 2HP4A 3BPLB 2EDFA 5MEQB 2XZQH 2B5IB 5IVXF 5KOMC 2OJEA 3RWDA 2EIZB 1R3HA 5HHPA 1AD0A 2R8SL 4HK3N 3ULVL 5B3NA 4P23C 3UXFA 1YYLH 2DLTA 4ZXBD 1EVTC 1VADB 2OXHA 3BYTA 4MHHI 4ZTOL 5JORB 2X4TB 3UTTA 5CSZA 1BZ7A 1YN7B 3UTSA 3FT3A 1RIHH 3V5DA 4ODSL 3W81A 3MOBL 1ZTXL 1BAFL 1OGAB 2CDFA 3SGDH 3M45A 2ZG1A 1VB9A 3IDYB 4NN7B 1CDUA 2BVPB 3ARRA 4M8VA 5E1AA 5FYKH 3SDCD 4Q7DA 1GXEA 1J8HB 1P2CB 1EGJL 4GS7B 1M7DB 4QRPA 1OB1A 5F96H 4G8GB 2A9NL 2YUXA 4QRSA 5HDQH 4FZEL 2VDKH 1E28A 4OF5A 3MLTB 2DQUL 4Q74A 1DQLL 5IW6A 4X6CB 5DYOB 1CGVA 1UZ8B 3IT8D 5HVFB 4LSTH 2NNAA 5F21B 4JO4L 4PJDB 1FVCA 4I2XE 4LPXA 3DGGA 3ALXA 4PV8A 3A6CL 3GKWH 4XPTL 1MELA 3ARGD 1BHGA 4PJAA 3R06B 3SJVB 1QRNA 3V5KA 5EA0L 4I0KA 2CDEB 2K1MA 1BFOA 2LAGB 3LRSB 2A9MH 4XT1C 3U6RB 3RPIB 5E94B 3AAZB 2EYSB 5EOCJ 3GSUA 3HC0A 4K8RH 2D0FA 3WXVL 4ALAH 2QADC 1RZFL 5DI8B 4M4PA 1S7XB 4PJ7B 2P47B 5MP6L 4G9FB 4U1IA 3V5HB 3KPLA 2CRIA 3D1MC 5HYSB 3AGVA 2IBZY 3BKMH 3CSPA 2C4XA 4XBPB 5I1HL 2EZ0C 1MAJA 2NZ9C 4XP1L 4KFZC 1U42A 1YEDB 4CW1B 3FQRA 4BH8B 3PWNA 1C16B 4JZJA 5F71A 1ZWIA 4UZGA 1X5HA 4KJWD 5DJYA 2HT2D 3V95A 1MH5A 5L2KB 4WCYH 1K4DA 3C8HA 4QRQA 2LAAA 4R2GD 1HH9B 3O6LH 2B1AL 4F80A 2C3VB 4I0PC 3P0YL 4LOUD 4J6RL 4M61A 2J8UE 3EW3B 3GMNA 2JIXA 1YUHB 3TIDB 4NSKB 4J1UA 1ULVA 4PGBA 5FGBA 3H0TB 4UT6L 1BIIB 4MAYC 5EU3B 3UJIL 2MHAB 3UTSE 1L6XA 1WGOA 3ZT6A 1TZHB 3NH7H 1I75A 4WO4B 4HK0A 2UWEE 3TH4T 1FVEA 5CJQL 2CJUL 2J4WL 1NAKL 2FIKB 2YD6A 5IHBA 1JPST 2COQA 4MXVE 3DVNA 2A6KB 5ILTL 5C08D 2DM2A 5HYEA 4FMFA 1RJCA 1MCJA 4Z77A 4Y2DD 3QJFA 3NGBC 5FB8A 1OPGL 3WNLA 5D2LB 3O6ML 1NANI 3ZDYF 1KXVC 1LEKB 4JKPL 1CFSA 3LIZL 2G5BB 5F8QC 1I8KB 2VDRH 3ILPA 1NDGB 4LVHC 1BLNA 3FB8A 4M5ZL 4Z0XA 4JE4B 4U3CA 4FXKB 4YLQT 3HE7A 1NEZB 3CDCA 4E41A 4FQJL 2NX5A 1QD0A 5ACZA 4Q9RL 2BY3A 4HMDA 1XZ0B 4JRXE 1G0XA 4AG4L 2JCCA 4XPFH 4CADA 3HZKB 1EIBA 5CILH 2VDLH 1KEMH 2VABB 1F00I 1INDH 3EOBA 4EEEA 4XCEB 1C12B 1CD1A 1CU4H 3MMEA 1T2QH 3OKLA 2XXCB 1RY7B 3L3IA 4AIZA 3WS6A 3L3OA 5KS9B 3F7VB 5D7LA 3TM6A 4KAQH 3U0PA 1X5IA 2AK1H 3O81A 2JK5A 3RVUD 1S7TB 3WKML 1LQSR 1QLEL 4PJXF 2PO6D 1ACYH 2APBA 3DX7B 3BZDA 1AD9A 3LSOB 4D0DB 1DBJH 4ZUSA 4V1DA 3L5XL 2H2PD 2JJSC 2XN9A 5AZEH 1OVZA 4QXUL 2GKIA 3WN5B 2E5EA 5CAYB 5F1SA 3QUMH 1X5GA 2VDNH 5D93B 1U0QA 2DYPA 4MXWH 3KPQA 3GRWL 3QQ9C 5INCA 3SGDI 3BWAA 1KT2B 3T3PF 2YZ1A 1ZK9A 3CK0L 1H9VA 3GSNL 5DEFB 4XPGL 3ARQA 3HMWL 1I3RB 1MHEB 4HXAL 1TJIL 4ZFFB 1S9WA 4EXKA 3SCMB 3KLAB 5BXFA 4RZCA 3G5XA 1ZVSA 1IAKA 3P73B 5LGJB 4Q6YA 3ZKSD 1NGQL 5CUSL 4WTXA 1JFQL 2IFFH 3NVQA 5GS2H 2E7HA 1LO0L 3I6KB 1TNMA 3JVGC 4R26L 1XGUB 3L9RB 2PYEE 5ICZB 1G84A 1KC5H 1J7VR 5EU6D 1VCAA 5F1NB 1DEDA 4Z78A 3I6GA 4IOIA 4M7KL 5C0FA 3C5SB 5D1ZB 3QR2A 3NFSH 4APQB 4P5MB 2MJWA 1E4WL 3VXNA 1IRAY 4DUVA 4J23A 1MF2L 5DT1H 4E41E 3FN3A 3RVVC 1KPUB 3HLAB 4NFCA 5LVEA 4WW1B 5GRYA 5J3HD 2IBZX 3BKYL 5L6YH 3NMEA 3PGCA 1RMFL 2ZZUT 5IK3B 3PXJA 3MNVA 3UP1A 3LHPH 2AJ3A 3WHE0 1QFWH 2AGJH 5KVFH 1WTGT 2G75B 3BMVA 3MROA 1T0MB 4F7MA 3QIBB 1K8IB 5C92A 3R0MA 2D7TL 5ETUB 1NC4D 4GW4B 4PJIA 1G1CA 2OR7A 3RL2B 1MFAL 3LD8C 4OKVA 1YPZE 3N9GH 1MLCA 4I48A 4MD0B 3GSWA 4B7IA 3OR7B 4ZOEA 4V1DE 4LPUA 4LPYA 1XF3B 3K4DA 5EULV 3UBXI 4XPHH 2FHBA 1BEYL 5TE4L 1X5XA 3S34H 3L3DB 1RUQH 4L8SC 2CSPA 3D2UD 2VERN 1L9NA 1XCQA 3K3QA 2HA1A 4IOSD 4O2EB 1IEAB 2PTTA 3F7QA 2YKLH 4LCWB 2A2QT 1F58H 2XA8H 4JFDA 3K8KA 2VZTA 5GRJH 4UIKH 3UJTH 4U1LB 4YXKH 5T1MA 1QFWM 1UM4L 3QZWG 1KN4L 5HI4D 5E8NB 3K4AA 3PXHA 3SDXA 1NCWH 3QAZC 1KF9B 4XCCL 2ATKB 5DHVB 1XIWC 1AQKL 5GS0H 3LH2L 1FFPA 4F33A 5LAXB 5KVMC 5CCKL 4FFVC 3S5LG 3OG4B 1JNLL 4HKXB 5FKAB 2IPKA 4W4OA 1EAJA 2D4FA 2VXUH 2VLRA 4ODXB 5JUEL 3CSBA 3FRUB 1RAMA 2H32H 4R0LC 1MCWM 3PWPD 4OV5A 3L5WB 1S78C 3SKNA 3MBED 3IFLL 2AXFA 3MOQA 1AGCB 1HHGB 4O02H 3RGVD 4Y5VA 1HE7A 1ONQB 5KSVB 2W9DL 4FXGB 5C6WH 2NY2B 2IPTL 3G6AB 2VL5A 3MV8B 1XH3A 5FO7A 2HJLA 1DLFH 4MDJB 1T1ZA 2FIRT 1UT9A 5TF1L 4PJ5E 1EFQA 1CD9B 2UY7A 4Z7UA 1YEIH 2Y36H 3F6LA 3S88H 2MFNA 4BK4A 2ORBL 3DARA 3QDMD 1JRHL 3IDJA 4LVNC 4TQEH 5F9WB 4LARL 2H1PH 2DQTL 4AEFA 4RFEB 3D3VB 1BF8A 1T2XA 3EO1A 5TDPA 3V6ZA 4HXBL 3V6FB 3DMMC 4KJQC 2VLKB 5F9JA 4XZUA 3BI9X 2B4CC 1JCKA 2DJ4A 5FK9B 1UENA 3CH1B 4DKDC 4ZUUB 3T2QA 4YWGL 1HHKB 3D39D 4XNMA 4G9DB 3MRQB 4ZO9A 1S8DA 4R9HA 3ZO0A 4Z7VE 5JW4N 3ZTJH 3B9EA 2F58H 3VWKD 3TGXA 3N06B 1S7WA 3BQUD 2LQRA 4H25B 4QRRD 2BP3A 4UDUA 1I4FA 4NWTL 5HYQB 4CGTA 3DVFA 1XR9B 3LAFA 4HPYH 5HDBE 4TNWK 5CKGA 2EE3A 4X8JA 5CLTA 3LV3A 5IF0A 3OF6D 3EYUL 5DMKA 1PJ9A 1Z3GH 3IXAB 1CICA 5DVLA 1ZOXA 3GIZH 3RWFB 2VLLB 2IBGA 1AO7D 4IRJD 1KTLB 5BZDB 2A6JA 1BFVL 1D6EA 5BOPA 2G2RB 32C2A 5FA4B 1EMTL 1DQJA 5IB2B 3NZHL 1UWEH 4YX2H 5C9JB 2WBJD 3U0WL 1NCUA 3VXRA 5DJ2A 5JOPE 3C5ZC 2B0SL 1WBXA 5D2NA 2FJFA 4ONHB 4OCNC 5TE6L 3ULSA 4YFEA 4DVRH 4OCLC 1Y6KR 5ITBH 3VFRA 2EC8A 3UYRH 1EBAA 2E6QA 4IJ3B 4PUBH 4MB4A 2ESVE 2DMBA 1BJ8A 1QQDA 1OY3B 4JM2B 4TUOB 5C07A 1YEEH 4DZBB 1QFWI 1G7PB 2FZ3A 1A5FH 4WI7A 4HPOH 5E2WH 1MEXL 1DJSA 1J11A 2WWKT 3GJEA 4Z8FL 1IGCH 1A0QL 1WBYB 3BGFB 2P49B 5FO9A 4NYLB 2MCG1 5K9KA 3C6SA 5ITFB 1SYVA 2V2XA 2Y07L 4JREC 3UTTD 1I1YA 1M7IA 4Y0GA 2AABH 3GIVB 1MAMH 4NGHL 3UTSD 2GJZA 1AI1L 5KSBE 1JGDB 1NDMA 3WS3B 5F7NC 4GRWH 4NZJA 1LWRA 4FNLH 3O3BB 4BELD 1PAMA 4QNPF 3AS0A 3OXSA 3CIQA 3UTPE 2APFA 3VXMA 5AYUL 1HYSD 3M17A 2YBRB 4NKMB 4QRPD 1D5IH 1O0VA 5HHOA 4OV6F 3K2UL 4GMTL 3Q0HA 3P0VL 3QZWB 4UILH 3RZCA 1H15B 3DSNA 1XGPB 4LFHD 5GSRA 2ADGA 1XGQB 2VDMH 3ES6B 3P4OB 4YDJA 3U9UA 5HI3D 5SX5K 1TJGH 2AW2A 4UI2A 1UYWL 1OTUD 3BX7C 2DL2A 4JANA 1FLRH 5L88H 1QRND 1BD2E 4DQOH 5IT2H 4LHUG 2HWZL 1SBSH 1WBZB 5E5MA 15C8L 3RTQA 2ZSWB 5DJAB 5LBSL 4KMLB 4PGEA 4OGZA 3SE3A 1XF5A 5D71H 1U8NB 3W2DL 2Z8VC 1S7RB 5D2NE 4C57C 2R1WA 3IJYA 3MRIB 1XT5A 2YZ8A 1N2RA 1CQYA 3UC0H 2BNQB 1RUMH 4F9LC 1DBKH 1S3KL 1E4XL 4DCQA 4XGZA 5ANMB 3DRTA 1L7IL 3CJJA 2AI0L 3LB6C 3JTTA 2R0WH 4ZS6C 3QUXB 2FO4A 1MRFH 1FC1A 3T65A 3BUYA 1B0RA 1FO0H 3HE6B 3T0EB 2VXTH 1GZPA 5CGTA 1NCBL 1ZANL 1EERB 3VG0L 3O9WA 4O5LL 4P3CH 2VZUA 4G42B 1NCCH 1IQDB 1FAIH 1T7VA 1MJ8L 2JIXD 4HEPG 4ZD3H 5JXAL 3BEWB 2IF7A 3O41A 4I13B 3V0WH 5JW3L 3MLUL 4Q0XL 4XH2B 5DSCB 4K9EC 3L1OH 3WLBB 4HIIB 3T4YB 1B0GA 4YHPA 5MERB 3RU8L 1JF1B 4O51A 3VCLB 4WWKC 5E08L 2J5LC 2R1YB 3RX8A 5I30L 1MWAH 5C0IB 3RWGB 3K8MA 3ULVF 1NL0L 1A6WL 4DUWA 4BH7A 3QI9A 1NGZA 3RY6A 1KJ2H 3CVHB 1R3LA 1JMXA 1YEFH 4R4FH 5MEPB 2ZUSA 5LKNA 2YPLE 2Q3ZA 1IT9L 4U1GC 3MUGB 1FGVH 3DGCR 3LN5B 4BZ1L 3PQYA 4MD5B 1JGLH 5E7BA 1DBAH 3QQNA 4YDVB 1F3JA 4YPGA 3C8KB 1NBYB 4D9RD 4DGYH 2Z92B 3PL6B 5DDHA 3MLWL 1R6VA 2JLLA 1EO5A 4OZ4B 4KWUA 2X05A 1X4YA 3BZ4B 2XTJE 5J1AB 4NIKB 3CDFA 3HE7D 4PJ9B 4E41D 2NX5D 4NHCH 1UM5L 4ZAKA 1G7JB 4JKMA 5DWUL 2SEBB 1DBBH 5HHVH 4P5TA 3L6FB 4JRYA 5EO0B 1TVHB 4X4ME 4P2QE 2XWJB 1FNFA 3NPSC 2FLBT 2W59A 1T1WB 4MDIB 4Q6IC 1ADQL 4R4ND 3IFNH 2F74A 5JHDA 5IBTL 1FG2A 1D5ZB 5D7LD 1F13A 1DFBH 4WDIA 1T20A 4NM4L 3QXAA 3HRZA 3E6HA 2OR8A 3FONB 5CSBA 3HNVH 1U41A 4RCAA 5HGAB 4IRSC 1TQCC 3S4SG 2N4IA 2AS5M 5DD0H 1GAFH 4HWBH 4V1DD 3DI3B 1JPSL 4LSRL 2XN9D 5CJXC 3TO4C 1UWXK 3TYFB 2GJ6A 3WHE1 3TIEA 1FC2D 2K9UA 3BP7A 4U49A 2DYPD 4K7PY 1YNKH 5DJ0A 5DUBB 1I9EA 3CMGA 4PJ8A 4XP5L 1JP5A 3I50H 3OKNA 2VTFA 5DO2D 1ETZB 1JPFB 4NQSA 3VWJA 3QSKB 3I2CL 2GT9A 1J0JA 3QPQD 1FZMA 4R3SA 1ZHLB 4WU7B 4WIQA 3IS1X 4DKEH 2IQAA 3VE0A 2IADA 5GRXG 3O6FC 4JY4B 4WW2A 3VFNB 1V3MA 4WFFE 1SY6A 5J11B 2IAMB 1DQQA 2OQJB 1P4LB 4CVXA 3OR6A 3OXRB 4NCC1 5I1EL 3BIBX 2HJKB 1INEH 1MFCH 5A2KH 2BX5A 5C0BB 3CDYA 3QWOB 2X4PA 3RAJH 4QRTB 2YK1H 1QSEA 3ROOA 4ZMAT 3O6KL 3ARSA 3EOTH 4P2RA 4RFNB 1LNUB 3EYQC 3SE4C 1MREH 3TN0A 3NN8A 2X1WL 4RQQB 2ICWB 5IBLC 1U8JA 4WEUD 1YMHB 1NSNL 1X5KA 4KGJA 4JQVA 3GK8H 4X7SH 4BFGA 4QY8A 3EDJA 2A74B 1MFEL 5EO9B 1N6VA 1AQDA 4PTUA 2OI9C 1Q0YL 4JRYE 2VLJA 2YUZA 1ZLSH 4PG2C 2HFGH 2ARJA 3X11A 4NT6A 5BQ7A 4HIXH 4WEMB 1DVFC 2NW2A 4R97C 4DEPC 3NTCL 3TVMB 2BHYA 3RWCB 3AMKA 1R0AL 2UWEF 5FGCE 1JYWA 1IAIH 4LRNH 3FQNA 4QO1A 3IB4A 1U8HA 3HS0A 1RZJC 1XGRA 3KJ6L 1JWUB 4K7FB 1DLHA 4OLVL 5FGSA 1YEGH 5E03A 5EO1A 1EAPB 3TA3B 4B5EA 4PJCB 4EN3A 1UWXH 2FSEA 5I1LA 1I9JH 2YD2A 1MIMH 2FGWL 5FYLH 4M7ZC 4PGZA 1KPRA 5I1KH 4OAWA 2FLRT 5HPMA 1JHTA 2ZCHH 2DQDH 5DRZB 1E4XI 4PJAF 4PY8I 4Y1AB 3PWLA 3B9KC 2O5ZH 1WITA 3LEVH 2DDQL 5GISH 4RMWA 3VFPB 2D3VA 3H9YA 1Z0NA 3TO2A 1LO5A 4JFDD 5J1TC 4Z7WA 3PGDA 1KB5L 3GO1L 4F58H 4WUKL 4MAUH 3U1SH 2XKSA 5DJ8A 2QV2A 4A6YB 4LSSH 5DFVD 3L7EB 3MRPB 5I16B 1GL4B 2F9BT 1HWGB 1WLHA 1IAIM 1SEBB 1NEUA 4NJAL 1A1NB 2YMXH 3F5WA 2HKFL 3LKQB 4GAJL 1JGVL 5D7IA 5TDNA 3EUUA 1UCBL 1W0WA 4MQXC 1MFBL 5HY9B 3KPMA 1NUDA 1OM3L 2VITB 3AY4A 2VLRD 4N0CC 5IHUH 3CFBA 5J9PB 5F6IC 5DQDL 3Q6FB 3ARFC 2ZJSL 1UA6L 3GSRA 4HWUA 4MSWA 4D9LH 3OL2A 2DI9A 3T1FA 2Q8AH 5ADOL 4L3EA 4P4KB 2XACC 1EEZB 2C26A 3SPVA 5LGHH 5B8CB 5KSAB 4OD3H 4G3YH 5C7XH 1OP3H 3FHAA 4PP2B 4IOFC 1L7TH 3GJFB 1IFHL 4XNUL 2LU4A 2ADFH 2FX7L 2CO6B 3QRGL 3UEZA 1H3XA 1KPVB 4NBYB 4KVNL 3DUHA 3S4SB 1Z9MA 4BSJA 4OZIB 5IBUG 5DD1L 4MJ2A 4JFQA 5EWIL 4OFPA 4RAVB 4WRLA 4ZUWB 1CWVA 2V2WB 5EBWA 1EUUA 4RMQA 3I3BA 2Y1VA 1OW0C 3OKYA 4ZS7H 3S37L 3Q5OA 2XKUA 2NCMA 1KLUA 5DUPL 3WJJC 4K7PX 3QEUB 3EFDL 4EIZC 4PJBB 3VU2A 5E5RB 2VZ3A 1Y0LB 3FQUA 1UEMA 1UKTA 3FT2A 4TYUA 5D72L 1Z5LB 4NDMA 4QKXB 3STLB 2X44D 2P4AB 3O3DB 3UAJC 1I8MB 1ES0B 4KROC 1IGJA 4JFEA 4PJGA 4U6XA 4GW5A 4EI6B 1MAKA 5FYJU 5BV7C 5E8OA 4NO2A 2BRQA 3SE8H 3M1BB 2VE6B 3TC9A 2EEAA 2BC4B 3MLXL 1NJ9A 2JELH 3QFJA 2UUDK 4PY8J 4WI8A 1B3JA 3ULUH 3GEWB 1HQ4A 4FQ2H 1NBVH 1BREA 1QHOA 4CJ0A 3E1F1 4P4RA 3I02B 5AZ2H 2X9WA 3FO9B 3UBXA 4MNQA 3RX7A 1CICD 3GGWB 4LEOA 5ICYB 2JCCF 1P53A 4IHOB 2EIEA 3BDBA 1W2KT 3EIFA 4Y4KA 3UDWC 4L8DB 5ICXB 5FYKE 2NTFB 2CLZA 3VXRD 2FL5A 3U79A 4GAYB 1ZA3A 5I75B 4OCWL 2OK0H 4UAOB 2YOCA 1UEYA 1WZ1H 1NC2B 4NO3A 4ODWA 4OZFG 3U2SB 3REVA 2QKIA 2XOTA 3ARUA 3CLEH 5F6HI 1RURH 6FABL 1NGPH 1YPZF 5HD8C 5JW5B 4L9LB 2YPVH 4U6VH 4DN3L 2ZWLT 5C07D 2WIIA 3EOAB 1YMMB 1KJMB 3VFOA 2AV1B 5SV4A 3DTXA 3UPRB 5JHLH 4KRPB 3QHZH 1V7ML 2G9HA 5F70A 3MA7A 1RZGB 1B6UA 5D1QB 4UU9A 5C6PB 1C1EH 3VRIA 4HS8H 3RRQA 1ND0A 1QVOA 4Q9BA 3M07A 3ARBB 4P2OB 1MUJB 5FEBA 5KTEH 3HNTH 4Y88A 5GSVA 1XGYL 2P46B 3S96A 5AAWA 3VW3H 1J18A 1NBQA 1A3LH 4MS8C 1IC1A 3N1PC 4YHKL 4GKZB 4NN5B 4HUMB 3PNWB 4BUGA 5FAAA 3OJDA 1UB6A 5J57B 3VH8B 1JL8A 1SVCP 4OBSA 3VXMD 3KYNB 1AXSB 4NUJA 5HHOD 4HIHA 5GS1B 4HULB 4ZSOA 3QUMA 4O00A 1AIFB 4D8PB 1QSFA 4HKZB 3RZCD 1BQUA 2R1XB 2FX9H 3SKOB 3W11C 1JZ6A 3OKOA 4J3VA 5E2UH 1SM3L 1WEJL 2VJXA 5DTFA 4LLDB 2P5WB 2NY1C 5DMIH 4HUUB 3VMOA 2Z8RA 5JLZA 3BEVB 4OGAD 4MJIB 3J7HA 5JPMB 5I1GL 3G04B 3RTQD 1A2YA 1TTFA 2HT4D 1AH1A 3S7GA 2VC2H 4M1DL 1DUYA 4XRCA 4DGIL 2VYRE 1JTPA 3MCLL 2XWTB 5IOPB 1ZS8B 1B2WH 1OAXL 1U95B 1LO3L 4UIMB 4W68A 1QZ1A 3CX2A 1IKFH 3F12B 4GAFB 4LLMB 4PRIA 1YY9D 2C3WA 5DUMH 1JMZA 4YHLH 3WNOA 3LKPA 1IC4L 4GKNB 5JR1L 8CGTA 4XP4H 3MR9B 3PHSA 4BSVA 2DWDA 1FYHB 4CU6A 1D6VH 4PLNC 1M71A 4Z7VF 1P5UA 5IBUB 3QNYB 3RBGA 5FV1L 3FFDB 3HZYB 4MJ6A 3VFTA 3SGKC 1MPAH 1ZT1A 5IEKA 1RHFA 3NH7L 1OHQA 4LBEB 5DHVH 4MMZC 1GIGH 3O9WD 1UFUA 5I74B 4OZHA 4QF1B 4CMMA 4BQ9A 4IDJH 1TTUA 5HDBF 1A22B 3WO4B 3WUWA 5C2BH 5IW3A 1TDQA 1Q9OA 1QYGL 5J12B 3IXTA 1CE1H 3KR3H 3AB0C 3HFMH 4EI5A 2QLVB 4FFYH 4XBEH 1S5IH 2AJYH 3BZFB 1DE4A 2E9BA 2RFXB 3EO9H 3O2WL 3KPRA 2D7MA 4PJFE 1YY8A 4L29B 2HVJA 3FO2B 5E9DA 3ZKND 5FOBB 3QI9D 4NQCB 3VXOB 1HILA 1N4XH 4KGLA 4AT6A 1RUPH 1AGEB 5EPMB 2OP4H 4NQDA 4UQ2A 2FATH 4NKIH 4U31A 4AZ8A 3MJ7B 1IILE 3KYMA 5IFHL 3H6JA 3NFNA 1OSPH 5ISZA 3PQYD 4WV1C 4OSUH 4YR6A 3S35L 4DWHA 4S2SB 1G6RL 2BXYA 4Y19A 5HGHA 1AXTH 3FRPA 4Y4FA 4QLRA 2N56A 4AM0A 3HG1B 3PDGA 3TPKA 4HH8A 2WUBH 4KKBC 4MA7L 3OKMA 1Z9LA 2FGZA 5FHAH 5MENB 1LK3L 4NUGH 1K5NB 4LRIC 1KJ3H 5DRWB 3UPCA 1MJ7L 4ZAKD 4PTTB 4OZFB 5D1XC 3FAXA 4CVZB 3KLHD 1Y18B 3QUZA 1VFAA 4P5TD 4Z7UF 1JZ2A 1B4JL 1CXKA 1OTTC 4JRYD 3PWJB 3F62A 1A4JB 3GSXB 1I8IB 5C0RH 4OCXH 1W0VA 4ZOAA 5KJRL 4BFEA 5KSBF 4C4KT 3MZTA 4N8PA 1I85A 4LL9A 1U36A 5JHDD 1CGWA 3H3PH 5HI5C 4BSWA 3QA3A 4C56B 1PKQB 1MIEH 3X14B 1YNLH 4X7EC 1KIQA 1A14L 4G5ZL 3O3AB 4YAQB 1N64H 2AKRB 2H32A 5HHXH 4GW1A 3ZHDA 8FABB 3U9PL 5I17B 5BO1L 3EZJB 5IB3B 3QO1B 3JTSB 2B4CL 1O7VA 3PGFL 1F42A 2YSSB 3Q1SH 4Y4HC 1N6QL 4TUJB 2W60A 3G5ZA 3E0GA 4M93B 2GJ6D 1U91A 2ZUUA 1JWMB 2X42A 3D25B 2CRZA 2Y7QA 5E70A 2PR4L 4N0UB 4XP9L 4PJ8D 5AEAA 5FECA 2HRPH 3HI5H 5T3XD 1SQ2N 1WCQA 5CJOL 1N5AA 2IQ9L 3KPNA 3EYSL 5HHNB 4GMSH 1ZSDA 3KPSE 4NZUH 3VWJD 4WY7L 1HN1A 4YFLF 5ID1A 5LXGH 4BA8A 3FB7B 3T0VA 1QNZL 2G5RA 3H9SB 3GMOB 4LVOB 4M7LH 1CDGA 3GMRA 5HTSA 2AERT 4ZYKA 1YN6B 3G6DH 4EDWL 2ZOLA 3BXNA 3N1FC 3NFPA 2IALB 1X44A 4NBXB 4M48L 3W0WB 3TFKD 3U4BH 1BFTA 1DSFL 3ILQD 2XV6B 1G0YR 5GHWH 1C5DB 5ALBH 5C0AE 2J6EL 1CLYH 1OQOA 1H5BC 5E9DE 4GG6B 1C08B 1MHHA 5T5FH 3TWCL 4F3FB 3H8NA 5DD3L 2I26N 4R7NA 4LASL 4X0KB 4OUOA 1QSED 1HXYB 4X6BA 5ISZE 3IDUA 1OWRM 3V7AE 3P4NA 4KTEH 4P2RD 2FX8L 1JYVA 3TN0D 1J87A 4X7FC 2V2TA 4K2UL 3H7BA 3CLFH 5CP7B 3MJ8A 1LD9A 2KUTA 3VXUA 3SEPA 5D5ME 1VPOH 1HI6A 4QXGH 3VXSB 4U1SB 4HDIA 3S36L 5GJSL 2R2EB 2X2YA 4JB9H 2VLJD 1RULH 5EORH 1UH2A 2WLZA 3ELAT 4PRHA 2YA0A 4YDIL 4L3CA 4B0MM 3OPZH 4JDZB 7CGTA 5AUMB 3VXNB 4FQQB 1GRWA 2CO7B 4UT7L 2PKDA 1JPTL 3O8XB 3C6LB 5IMMA 4ZTPH 1WK0A 3FCTA 2XRAH 2RQ8A 4NP4H 4GRLB 1T89A 1LP9A 3ZKMD 2NXYC 3MGTB 4Z76A 4XPAH 5C86A 1M6OA 3DI2B 5GZND 4EN3D 4WJ5A 2V7HB 1TZIA 3QQ4B 3MFFA 5I1CL 1K4CB 4XNXH 1XFPA 4KZEL 2EDEA 2C7UB 4YXKL 1OGTA 2AJUH 2BCKB 2V17L 4X7CC 2FRGP 3KGRA 5EU7C 1EUTA 3CDGB 1EFXB 5IFJA 1PY9A 3IU4L 1OP9A 1MI5A 4M6NL 3BKJL 3EGSB 1PEWA 2VUYA 4RWYH 2DIJA 4RA0C 3SDDA 4NZTH 4UTBH 4X6DA 4Q97A 3OKDB 3GI9H 2YPKA 4JKWA 4PJEA 5KG9B 3MXWH 1NLBH 2QSQA 4Y16B 5DJXB 3E6FA 4MVBD 4PGDB 5IESL 1VEMA 4KHTL 5FYKD 3B43A 2EDOA 4OZGA 4OUUB 2Z4QA 5A2LH 1KSRA 1OCWL 5K59E 3QEHB 5DC0A 3ROLB 3K80A 4P46B 2AXJA 5CHNA 3C8DA 1DCLA 4MNHA 4L1DA 5DLML 4XHJC 3FFCB 3MNZB 5B3JE 4HCRH 2W92A 2IWGA 4RGNE 5IB5A 5JW4R 2B7DT 3K46A 4W6XB 1QBML 1PZUB 1J1XH 4ZDHB 3FB6B 3K81A 4LLQA 5D7JB 4L3ED 1FFPB 43C9A 1BQHA 1IC5H 4JO1H 1RK1B 3O6FA 4OM1L 3FQWB 5C0CE 5T33H 3CMOL 2GSGA 3MRMB 4RIRB 2HKHL 4HUWB 1QBLL 3TBYB 2Y4SA 5EUOE 2BSTB 3TJEL 4EVNB 3U30B 3P4MA 4K8RD 1NUNB 1F4HA 3MA9H 3CVHH 4MA3A 5K9JH 2BVYA 4KQ4L 2NY3C 1KLGA 4JAMA 2Z31A 2AJZA 4HG4K 1P6FA 2QHLA 1MNUH 3ZSSA 1FP5A 4Y5XA 3DYOA 1FNGA 3BWUC 1U3HA 1TCRB 1HEZA 3ARDB 3L3KB 1CQKA 4U1KA 2OZ4H 4K9EL 4ODBD 1KN2H 2BDNH 2H8PA 2BHUA 4ETQB 5C2UB 2DLFL 3QP3A 2EYRA 2F5AL 1PGRB 1T22B 4QXWA 4TOYL 1MCPH 5B38A 2EYTA 1IVLA 1CFQB 1G9MH 3IAPA 3L3JB 4TVPH 3NCJH 1CD8A 4Q2ZB 1CXLA 1FO0A 3NACL 4FQXC 4I3RL 4JFED 3X3FL 4NM8H 4PB0H 5EB9A 4XNYH 3AM8A 3RUGA 1OAKL 3AXLA 4XTRC 5DGQA 3V6ZB 3PIQA 5J6HA 1WC7A 2HTLC 1PSKL 4DTGH 3NCMA 3QFJD 5E2JA 4NNPL 4Q58C 1MCRA 1NCDL 5HXMA 5F3BB 1YEJH 4MNQD 1OAQL 3U0TA 4X6DE 2NMSA 3RIAK 2XZAH 4HC1L 4Y4KD 1ZT4A 3O3EA 3QG6B 1MWAA 1QFPA 2EE9A 4LDOB 4OZGE 5DRNB 1LO2L 3IDIB 1JYXA 3PJSB 2V5SA 2EH7H 5ERWB 4MHHG 1KJ2A 1T1XB 1CTOA 4YDKL 1C8PA 3CPLB 3B9AA 1FZKB 1T5XA 3MRBA 4XC3H 4QTIL 4ELMB 5IG7A 4YUEH 4KHXL 4UUJA 1UJ3B 4ZXBC 5IQ7H 3QFDA 1QEWB 5DF0A 2VISB 1KFAH 5I0ZA 3QDGB 1AGBA 1GOHA 4ZUTA 4YXHH 5JQ6L 5F88B 4UTAL 3B83A 1C7TA 1JGEA 2YRZA 3HPJB 2HLFD 4WTZG 3C09B 1TCMA 5EBMB 5E99L 2IMNA 1FORH 2R56L 3SDCC 5JDSB 2BMKA 3AUVA 4HLJA 3MLSL 4RISL 4QOKE 1RZ7H 4U1HA 3CFCH 3FB5B 3ZKXB 1IQWH 2H26B 4X5LA 2B20A 4G8IB 4F9PC 5T1KA 2GSIB 5DEZA 2QQNH 4YHML 3PUCA 1X3DA 3MV7E 1MCKA 2VR9A 5EUKA 1N59B 3ARGC 1GGBL 3A67H 1QP1A 3OAUL 3WKNA 3C9NB 5GIRA 1AHWC 4P9HC 3ZT7A 5BRZB 5D8JL 4JDVB 4JGUA 2CLVA 3FQTB 1GHFH 4HWBA 2AEPL 1BX2A 4ZPVB 1IEBA 5IT2L 2R4SL 3O11A 2FB4L 2YN5A 2QQKL 1QSFD 3U7YL 2VAAB 4K71C 5BVPH 1NAMB 1PLGL 4AENB 3HE6C 1JZ4A 2DI7A 3GUTB 1F3DH 1BQLL 3K2MC 5DJZA 1G7HB 1Q9KA 3VXTA 3RKPA 3X12B 5CEXB 3WJJA 1RUAH 4ISVA 3LMJH 2EDJA 3OX8B 1IZJA 1ZLVH 4J8RA 4LKXB 4S1QL 4CNIB 1QRKA 1IGYB 4OTXL 35C8H 4NRZA 3DV4B 5E56A 3SE9L 4EUPG 5GGVH 2LABA 3EJZC 4JHAH 2HT2C 1ZVYA 3QIWB 4LLVA 3JWOC 5GGTH 2P8LB 5F7DB 4R2GC 2M8XA 5GS2D 4LKCB 2F15A 2VLME 1YDPB 5CINH 1S9VA 4JG0L 4PRID 4LOUC 1I8LC 5MEQA 2X70B 3RKDD 2O26U 4OF3A 3B4NA 1MVUB 3WFHB 5C09E 2EIZA 2G60H 2D7OA 5TGBB 2VIRB 3I75B 1VADA 4FABL 2OMNA 1JZ8A 1RZJL 3V0WL 5JORA 4ODTL 2X4TA 1YN7A 3HI1B 3ZE0E 2BNUB 1RPQA 4H88H 4A6YH 2MKWA 1J0YA 3V9FA 2BVPA 2Z93B 1FYTE 2EDBA 1J8HA 1P2CA 3F6IA 1JTTA 3MYJB 1M7DA 3BPCB 1DBMH 1GGCH 1A47A 1KCSH 1XCTB 4G8GA 2J3SA 4Y2DC 1D9KB 4A2LA 1P7KB 4Z7WF 4P59H 1T1YB 1I9RL 2FO4B 3MLTA 3U7AA 3MRCB 3BHBB 4WUUE 4X6CA 5DYOA 1QOKA 1UZ8A 5CEZE 4EI5D 5IWLA 4PJDA 4CL7A 4U3HA 2E3VA 3KPRD 1AE6L 5CD3B 4JKLA 1Y6NR 3WD5L 2FR4B 2AK4E 3KYKH 4FTVB 3MJ9L 4GOSA 4G6KH 3R06A 3SJVA 1RFDL 5D7IF 5E9DD 1QLFB 1N0XL 2X10A 2CDEA 3GJFH 1CLZH 3LRSA 3VA6A 1OAUL 4NQDD 2DQGH 3HAEG 3RPIA 5E94A 3TZVB 3U6RA 3AAZA 1F11B 2EYSA 1B0GB 2EDKA 3W5NA 3C60B 5ISZD 2EIDA 5LQBH 1T2JA 5DI8A 1IMHC 2ICEB 4Y19D 1S7XA 4PJ7A 4X4XA 4LEXL 4Y4FD 5GXBB 4G9FA 1SHMA 5CEZL 3PP3K 5TE7H 4MNGE 3V5HA 5A3ID 3AROA 3RVUC 3CZFB 3N1GC 5HYSA 2MOVA 3FT4B 2PO6C 3NABH 5C6TH 4XBPA 4BQ8A 3QUZD 1X4ZA 3T4AB 1L0QA 4OLWH 2H2PC 1YEDA 4CW1A 3HNVL 4OI9A 4BH8A 5D7KE 1CFNB 1C16A 4NNYB 2CMRL 3QEGL 5GS0D 1IL1B 3TF7C 4YPGB 1YA5A 5EDXA 2EDTA 5L2KA 2QSCH 3CSYB 1Q1JH 3T2OA 4PB9L 4OD1L 2OS7A 4QHKJ 1YNTB 1HH9A 1T5WB 3P77B 1A7RL 1F4WH 4GRMB 3FHQA 1HQRB 2VDOH 2C3VA 4KH2A 4H8WC 4XB7A 4XP6L 5F7HA 4TSAL 1OQXA 5JTWA 3VI4E 1AGDB 3WFZA 1FPTH 1P84J 2P45B 4U6HB 1YUHA 1VSCA 4WFED 3D9AH 4NSKA 3O2VH 3H0TA 4TPRH 3QDJB 1BIIA 3BE1H 4GKSB 4YE4L 5EU3A 3D0VB 5T3ZE 5HHMB 5EOQH 2WIMA 2MHAA 5HBBA 2DJSA 1TZHA 3V4PH 1V3KA 4LSVH 1OL0A 4WO4A 5FOJA 5I8EB 4XVSH 1LEGA 2X6MA 4OIIH 1ITBB 5JIHA 1OGAE 2BVUA 3MGOA 3VGAB 2YUWA 2FHFA 2FIKA 3FKUS 3E6HB 1M1SA 1HXMB 4O4YL 1CL7L 4LIQE 1U8MB 2A6KA 3D0LB 5BV7L 5IMLB 2ICWI 4JFZL 4YHOL 2O5XL 5A40E 3I85A 1LEIB 4ZS6D 4O9HH 5D2LA 4FQCH 1I1AB 3KXFB 5DC9B 3MLPA 4YBHA 5DD5L 1LEKA 3TT3H 2E8ZA 3GI8L 2G5BA 3TYGH 1I8KA 5GJTL 4G8FB 2NY4B 3EOTL 4FRWA 1NDGA 5GRUL 3SJVE 4L1HA 5T3ZL 2IGFH 4FXKA 3BRDA 5J3HC 1NEZA 3RI5F 1FRGH 1XZ0A 5IW1B 2E9JA 1YQ2A 4RGND 5FYLE 4F37K 3HZKA 5FCUH 3ESVF 4EUPB 2VABA 1RSFA 4LIQL 1KEGH 2ZOKB 1RUKH 4XCEA 1C12A 3MBXL 5E4IA 1GGIH 1HKLH 4K3EL 3K8LA 3W9EB 4S1RH 4NKOB 4CVXB 3OR6B 5KS9A 3PP3H 3F7VA 5IROC 3VXUD 2HJFB 1LO4H 1S7TA 1VA9A 5L9DH 1B88A 2R69L 3DV6B 2D4DA 3DX7A 3LSOA 4I5BB 4D0DA 1FZJB 4YDLB 4N0YH 4I18B 3G6JB 4M6OL 4Z0BL 4PD4J 3WN5A 4PRHD 1HSBB 2WBWB 3PP4L 4WVRA 5CIPB 5AG8A 4KK5D 1RJZB 3QJHB 4J12A 4H20L 4UV7H 5KBNC 2ZCKH 1U2CA 4JN1H 1KT2A 3O4LB 5DEFA 1PVHA 3CH8A 1ODAA 4KV5F 2D9CA 1I3RA 1QSZA 3LEVL 3N1QC 5HI4C 1MHEA 5BCAA 1A3RL 4ZFFA 5FO8B 2XZCL 3SCMA 2XWBB 1CYGA 2HYMA 3KLAA 5C70A 2AP2A 4X6FB 2OXGA 4OIBA 4P4KC 2B2XH 3P73A 5TPWH 1S9XA 1MI5D 3BSZH 5B8CC 5LGJA 4X80H 4WI4A 3X3GH 2CKBL 5B21A 1FFOB 1RZIB 3I6KA 2VDPH 3Q6GL 3UO1L 1XGUA 3L9RA 1EJOL 3MV9E 5ICZA 1I7TB 5F9AC 4U6YB 1XF2A 1IGFH 4L4TB 1BWMA 3HAEB 3FQXB 1FNEB 3JSSA 3MBEC 4PBVC 2BY2A 3HR5B 3VI3E 5F1NA 1DUZB 5IHUL 3QULB 1QBAA 3RGVC 4K3DH 3C5SA 4XMPH 5D1ZA 3GM0A 4APQA 3THMH 4P5MA 3IDMB 4JY5H 4QYOB 1I3GH 2NY0B 2EDWA 3QPXH 3HLAA 4I3GA 4WW1A 5IIEB 4X99B 5E5UB 5IK3A 4JO3H 1REIA 3WIHH 1PDKA 4I3SL 1WICA 3OB0K 4EQ3A 1PEZA 2G75A 2CXKA 3O6FD 1U8KB 5I9QB 5J4MA 1DP0A 5L8LB 2BSSB 1RK0B 2AVGA 4KTDL 1E6OH 1T0MA 3DNKA 3QIBA 4Z95L 4L5FL 1K8IA 4JFOB 5ETUA 4GW4A 4JLRB 3RL2A 4RMSA 3V6BR 1A7QL 4MD0A 5E4EB 3OR7A 4BYHA 2BNRE 4G6JL 3VWKC 3OZ9L 4ZNEA 1XF3A 1CGYA 2Z31D 3BQUC 3EDEA 3LY6A 3EO0B 2NYYD 1WT5C 1JUFB 5L0QB 2DD8L 3MRFB 1U3HD 5E7FA 4N8VG 3L3DA 3SPVB 3A6OA 5SWSE 1KGCD 4MMXC 3WSQH 1G7QB 4O2EA 4WGVB 4X9BA 5I73B 2VXVH 3EDDA 3VMNA 2VL4A 4S1SH 3G08B 1FGNH 2RJMA 1FN4B 4LCWA 3S97C 1QLRB 4QHLB 4WHTB 4U1LA 4IRJC 2DICA 5AZ2L 3ZYOA 4OZFH 5E8NA 2EC9U 4K23L 1T66D 3MPCA 5HJ3B 2WBJC 2ATKA 4PRDB 5DHVA 5AD0B 1KXQE 4KRPC 1J86A 4O58L 5LAXA 4BQCA 2ITCB 5C0EB 4PBWD 5D1QC 4G7YH 4JQIL 4HKXA 5FKAA 4NDMB 5D5MF 2CDGB 1ZGLB 2M26A 1F4YH 3T0AA 2J88H 4ODXA 2XKNB 3FRUA 3OG6B 2R4RH 4XMLL 3B5TA 3L5WA 3ARZA 1QFUL 3LRHA 2E6PA 1AGCA 1HHGA 2WP3T 4LNVA 1ONQA 1BMGA 7FABH 5GGUB 12E8L 5KSVA 3OAZK 1A9BB 3B2VL 4FXGA 4HWEL 5CFHA 3E2HC 3G6AA 3BGMB 3MV8A 3O4OB 4HZLB 4XVTL 3UBXB 3SQOH 3HUJB 4MDJA 1MFDH 4P3DB 1UQSA 4OQTL 2HG5B 3CVIH 4JGMA 3QO0B 3VG9B 3BPNB 4I2XB 4JO2L 1A7PL 4XVUD 5I8KL 4RFEA 3D3VA 4PFEA 3V6FA 3VD5A 4C55A 4JPVH 1TQBB 4GQ9L 2VLKA 3V4UH 5F1IB 4JCLA 1JI1A 1IAMA 4JY6B 2FO1A 1HYSC 3CH1A 4ZUUA 3WDHA 1QPPA 2EEBA 2IG2L 3RA7L 1HHKA 4FS0A 3HNSH 1WTLA 1YEKL 4G9DA 1KELH 2BY1A 3UYPA 3MRQA 4JG1H 2AAVA 1FBIH 1EEUA 4ZNEE 4CBPA 1S9KC 1WAAA 4WFGE 2QR0B 4J2XA 5T1KD 3VFOB 5KVGL 2NTSP 2FYYB 4BZ2L 2WUCL 4HS3B 4C83B 5MEOB 4ZFOL 4H25A 5HI3C 2X4OB 3BPOB 1FL3B 3IAQA 5HYQA 5E2VH 3SDAB 3GDBA 1OTUC 1XR9A 1SMOA 5K59F 2HVKB 1SMAA 3MO1B 3RL1A 1T3FB 5LCVL 2C1OB 2FBOJ 4LCWE 4FOMA 4I77H 3JBG7 3MNWB 5TH2B 3IXAA 3GMLB 3RWFA 4OF8A 3WFCL 4UV4L 2VLLA 5DJCB 4YFDB 5BZDA 4OCRH 2G2RA 3GSOB 5FA4A 5KZCD 2R0KL 1GSMA 3QNZB 5IB2A 5C9JA 4YQXL 3DIFB 4BQBA 4FFZL 4ONHA 5D7SH 2GY5A 2CPCA 2I5YH 2J8UB 1IM9B 2AXGB 3NAAH 1UM6L 4OLUL 5EUOF 5FYJE 3JWNC 2XFXB 4JZJC 3TBVA 1XF1A 1KULA 4R90H 3AU1B 4KROD 4JM2A 1J0ZA 1BVKB 4RSVA 4TUOA 3VFSB 5EC1B 2PXYB 5EU7E 4DZBA 2UWEB 1G7PA 2OR9L 4JPWH 3MC0A 3VGFA 4U6TA 3HMXH 3OAZH 1ZHKB 1U9KA 4OB5H 1KENL 3K4ZA 3P11H 1WBYA 3FO0H 1KB9K 4NYLA 3AC0A 4K3JL 5FGBC 4LCIL 4RGOL 3Q5YA 5ITFA 1J1OL 3V8OA 2NY5C 3GB7B 5ELIA 3D3VE 3GIVA 5E8EB 5JO5B 1HINL 2O5YL 1JGDA 2YWYA 5F97E 5C0ND 2XG5A 3WS3A 5I8OL 4YBLB 2QL1A 4N8VB 5FYJL 1EO8H 1OGAD 2I27N 3O3BA 4JZNB 3K1KC 2F54B 3ZHLA 3SKUD 1CLOH 1J8HD 2YBRA 4NKMA 1J0HA 4JRXB 4G8GD 3MLZH 3MLYH 4EOWH 3DX8B 4X6DF 3GSNB 3QZWA 1CGSL 3U83A 4KVCH 4GRWF 1H15A 3S37X 1XGPA 3BRGC 1VESA 1XGQA 4JFFB 3P4OA 3ES6A 2JB5H 5EZOL 1OT1A 1WWBX 4OZGF 3JWDH 4LMQI 4YO0B 4XC1H 1FG9C 5DHYB 3SJVD 4PJXE 3HE7C 3FOLB 1HNFA 4OM0H 2AQ3A 1A7BA 4HIJB 1I7UB 1WBZA 3SKMB 1MRCL 2ZSWA 5FYLD 5I1IL 3RWEB 5GRWA 5DJAA 3UTZB 1FNSL 2PTUA 4DGVH 3IU3B 3QWRA 4GXVH 4R4NC 2B39A 1U8NA 4TSCH 3DO3A 1S7RA 3WS6C 3T3PE 2JKXA 3BKCL 2HVJB 4G9FD 4MX7B 4FP8L 4AMKL 1JNNH 4LCYB 3MRIA 4OT1L 2DJUA 3BOVA 2BNQA 5MI0B 2M2DA 2KKQA 1NCAL 5ANMA 1QFOA 2AXHA 3R1GH 1X5YA 3QUXA 1F90H 5DHXB 5L2KD 2H45A 5D96C 2Q6WB 3W11D 3IJSB 3HE6A 3T0EA 1IM3B 5BS0E 4LCUB 1NPUA 5DO2C 4RNRB 3QDAA 4G42A 1I3UA 4HCRA 3P30H 1IQDA 1SEQH 2DBLH 2DQIH 2PYEB 4JCMA 4GH7B 3BEWA 4JJ5B 4M62L 5IV2B 1CIUA 3I9GL 4XH2A 3QPQC 5DSCA 3DWTA 3C08H 2HN7B 2E9IA 2X4QB 3BDXA 3WLBA 4HIIA 3T4YA 1A7NL 5AWNL 5MERA 1DN0B 1JF1A 3VCLA 4XCFH 1KCRH 2NXZB 2N7BA 2EICA 4WO4D 1PQZB 3WFEL 2R1YA 3U48A 5C0IA 3VGGA 5H8DA 2EKSB 3RWGA 3S3PA 4IIQB 2DIAA 3IFOB 1BOGB 1J9CT 1P4BL 3L3GB 3CVHA 4UINH 1ZE3C 3BYYA 5MEPA 3R4DA 4AEIL 2FD6H 1GC1H 3MZGB 5J13C 3MUGA 3LN5A 4OLZL 3DROB 4MD5A 3NCFB 4X4YB 4YDVA 2OZ4A 4M02A 3C8KA 4HH9B 4TSBL 1NBYA 2Z92A 3PL6A 4OZ4A 3BZ4A 4KKNA 4JRWA 3GBMH 5J1AA 5TQ0H 1YPZB 3DVIA 4PJ9A 2Q7YB 2HTKD 4GRLC 4LQFH 3LQMA 3GNMH 1G7JA 1A6PA 1OAYL 2SEBA 1HCFX 3L6FA 4AEEA 2ZKHL 5EO0A 3RJDA 2X1QA 4C58B 2XWJA 9CGTA 4MDIA 3QG7L 1XEDA 4A2MA 1XF4B 5E8DH 3ZE0F 3ULUD 1D5ZA 1WSST 1TVBB 2W91A 4H5SB 4KK6D 4JVUA 3FONA 1YYMH 5FA3B 5HGAA 1QO3B 4PRNB 3GHEH 5I18L 3VFMB 3PG2A 4ESKA 1FH5L 4YGAB 4XPAL 3TYFA 5FCSH 4Y8DC 4EDXB 4DOHB 3T0EE 1NAMH 4P57B 5DUBA 2CR3A 3QBTB 4P46C 4TRPL 3BO8B 4MLIA 5LWYH 1VGKB 1P4IH 2OL3L 4ERSL 3L5JA 4HBCL 5CS7A 4KKCD 1ETZA 1JPFA 1Q0XL 1HZHH 1M7XA 1BWWA 3WL9B 4P9HL 1PG7H 4MJ5B 2X4NB 4RWYL 1BBDH 5JPNB 3SCMD 5DFVC 5I71C 1KIPB 1A64A 1ZHLA 4KKAD 2DBJA 3CD4A 1U6AH 4L4VA 4WU7A 3TESA 2X09A 3KHQA 1GOGA 5IEHB 2ZPKH 3VFNA 3SGEH 2IAMA 4W4OC 2DTMH 3QIUB 2OQJA 4NO5B 1P4LA 3BT2L 3OXRA 4XCYB 4X9GA 2HJKA 1LP9B 4F7EB 4PJ5B 5ESVB 3U7WH 2AJSL 3SKJL 5C0BA 1AFVL 3QWOA 1X5FA 4RMUA 4HT1H 3N85L 5HGBB 4QRTA 1V7NH 3SDYH 1RIUL 4LQ1A 4Y5VC 1WFTA 5CD5D 5D1ZD 1LNUA 3O0RH 4G6AC 4APQD 3CFDB 3IKKA 4YXLL 2NY6B 3ZL4H 4RQQA 2ICWA 4R7DB 1ZA6B 5C08E 1YMHA 3SOBH 2FNBA 1WZKA 1QKZL 3JWOL 4ONGH 5JQHC 5IVOA 2A74A 5EO9A 5EOCH 3SDDB 5DK2B 4Z7VB 1QR1B 4YK4B 1HSAB 3LS4H 4CU7A 2Q87A 2J12B 4YH6A 3RWJB 2DQJH 3SBWA 5JDJA 4GBXA 4PS4H 1V8HA 2BVTA 2UZIH 3VDCA 3TVMA 4HFUH 4P0DA 1CD0A 4KI5D 3RWCA 4JHWL 3QCTH 3QIBD 1T0NB 1H3PH 5DFWH 1JWUA 4K7FA 3RVTD 3LKSB 4FQLH 4Y7MA 1AKJB 1NBZB 1GGTA 3MOAH 2F19H 2HT3D 1EAPA 3TA3A 4OJFH 2VSDA 1T03H 4JFHD 4PJCA 3PHQB 5EN2B 5GGTA 5I1JL 5F1OB 3LQAH 5C8JB 4X6CF 2VZ1A 4EXPX 4XX1E 4MJ4A 4PJDF 3SO3C 3TP4A 1VHPA 5FDWB 5EU4B 4X9IA 4NQXB 1YJDH 5DMGD 2FBJL 2DRUA 3MRLB 5DRZA 5IROA 2VRAA 4Y1AA 4IRZL 2CR6A 1WVZA 4LCWD 3VFPA 1CICC 4ACPA 2ESVB 2WLYA 1HCVA 4LSPL 2MTPA 2ZCLH 1N3NB 4RFOH 1JF6A 3BDYH 1NLDH 4JQXA 3LZFL 3C09C 1GGUA 2ZUTA 1EPFA 4A6YA 2XY1A 3L7EA 3MRPA 2EDRA 5I16A 5D2NC 4KK9D 5GGQH 1SEBA 3DSFH 5HDOA 5FUZH 5E6IB 3LKQA 4QEGA 5FYKU 4F57H 1FSKB 5HY9A 2VITA 5GZOD 1CF8L 3ARWA 5SX4H 1A6UH 1BM3L 1ORQB 5J9PA 5IMKB 1GPOL 5KSBB 4KU1A 3Q6FA 2MMXA 3TBTB 4CUCA 1EEZA 1E6JL 4IM8A 2AV7B 5T1DH 5KSAA 4RGMB 3WXWL 2NY2D 4PP2A 3GJFA 1NGWB 4KXZH 3MV8D 4J7RA 3REWB 1KPVA 3QWQB 5EU6E 4HWNA 1DEEB 1GZQB 1YECH 4E42B 1CZ8L 3S4SA 3UZVB 4OZIA 1FZOB 2CUHA 4H8WL 4RAVA 1EHLH 4AQ1B 3CFCL 1T04B 4ZUWA 3S3SA 4LSQH 3D3VD 1TETH 2V2WA 3NIGE 4N1EA 2XPGB 5JIIA 2LVEA 4AIXA 2VLKD 1P9MA 1DZBA 1BD2B 1GH7A 3QEUA 3QCVH 4PJBA 1Y0LA 4P5KB 4OGXL 1KB9J 5ADPL 1WFOA 1Z5LA 2IANB 3STLA 4U0RB 1YEHH 3U46B 3CXDL 3O3DA 1I8MA 1ES0A 4HX1B 3RZCC 1JGEB 4BKLB 2VOTA 1DR9A 2W9EL 3KPPB 5DR5L 1FE8L 4EI6A 4EUPH 3M1BA 2VE6A 4M00A 3FN0H 3NA9H 1UACH 5GRZA 2NW3B 3PWVB 3SGEI 2FH6A 4U1JB 4U0QB 4OGAC 4XAWL 2CGRL 4M7JH 1HDMB 1VGEL 2EC9T 3RTQC 3I02A 3FO9A 2B1HL 2HT4C 5GGVY 2R0ZH 3GGWA 1NFDE 5ICYA 3SE3C 3WFDH 2Q8BL 2A83B 4IHOA 1MHPH 4L8DA 5ICXA 2PW1A 1RZKH 2NTFA 3O2DL 1N8ZB 3BN9D 1RU9L 1LDPL 4I1NB 4OIAA 4GAYA 1I9IL 1YY9C 4OLXH 5CIPH 4PR5A 1NC2A 1RQ5A 3N0PB 3U2SA 1FIGL 4PV9B 1NANH 5JW5A 3RY4A 4L9LA 4JM2D 4NQEB 5EZLB 1KTKE 2EDDA 3AS1A 3EOAA 1YMMA 1KJMA 2HTLD 2A73B 2AV1A 3KG5A 1TPXB 4ZODA 3UPRA 2L0DA 3O9WC 4KZDH 1TJHL 1JYNA 1RZGA 1UXWB 3KNBB 4P3WA 5D1QA 2Q86B 2DOCA 3CZJA 4HGWB 1S7SB 4AL8L 3ARBA 3PWPE 4P2OA 1MUJA 2YPLB 4DAGH 1NH6A 3LEXB 3J8F7 4GKZA 1Q94B 2F5BH 1YC8A 3HAEH 2R15A 3LN4B 3PNWA 2E7CA 3MX0A 4G6MH 1INQB 2PN5A 2V7NB 3VH8A 2XTJB 2BFVL 3ZKNC 2NLJB 3QI9C 4MWFB 3RY6C 2C1PA 3BESR 3HC3H 4OKDA 3KYNA 4OLYL 4U3XA 4G7VH 1AXSA 5DQJB 1MCWW 2OSLB 4KKLC 3WLWD 5GS1A 3QDME 4AEHH 3WIFB 1AIFA 4D8PA 4P2QB 5ABDE 2A1WL 3T0XA 4HKZA 1K6QH 5KANI 2R1XA 3HKFA 1G9NH 1A3QA 3SKOA 3O3UN 3NIDE 4KI1A 4NCDA 3V0VB 1Z9SA 3MUY1 4ODHH 1X7QB 4LLDA 2P5WA 4E0RB 4HUUA 3D39E 3LRGA 3IDGB 1QFHA 4GSDH 4UT9L 3BEVA 4ZAKC 1HH6B 3B8YA 3KLHC 5TE7L 3MODH 4MJIA 4UQ3B 3VXQB 5JPMA 4P5TC 3G04A 4UMGA 4DFHA 3OGCB 3BD3A 2AJXH 5SX4I 3EDFA 3ME0A 3QWRD 4QRRE 3B2UD 4HJGB 2XWTA 5IOPA 1ZS8A 1U95A 4UIMA 2R8SH 2DQCL 3ULVH 3F12A 2NQCA 4JDTL 4KI5F 4LLMA 2H2SD 2P1YA 2BNQD 3CFKB 2R0LL 1A9EB 5E0QA 4KQ3L 4KXZI 4ZTOH 5H37G 1NMCB 5E24E 4ODVL 3H42L 4OCYL 4GKNA 3F65A 4XXCA 1AO7E 3MR9A 4ODSH 1TIUA 3MOBH 1ZTXH 1BAFH 3QUXD 3GBNL 5I19L 3QNYA 4N8CL 3FFDA 3BP6B 3HE6D 4X4XB 3VFVB 3T0ED 3HZYA 1EGJH 1Q8MA 3P0GB 4HEME 4PJ8C 1ZT7B 2A9NH 4LBEA 5FUCC 4FZEH 4YC2C 3QXDB 2DQUH 4QF1A 1DQLH 4XAKD 3VRJB 3VWJC 4P23B 3PV6B 3QUYA 3WIHA 4JO4H 2Q1EA 3HI6L 1NMAL 4W6WB 1BJMA 3A6CH 3EJZD 4XPTH 5C0GB 4QTHB 3TFKC 1SBBA 3ILQC 2V9TA 4WW2C 3BZFA 3GHBL 5F3HB 2RFXA 5EA0H 5EOTB 3MLRL 4H1LG 1U8QA 1A4KB 4L29A 3FO2A 2FJHB 5FOBA 1W72L 4NQCA 4X98B 3VXOA 3WXVH 5JOFB 3IDXL 25C8L 2W0LA 2WW8A 1RZFH 1AGEA 5EPMA 2WMPA 4NO0B 4UOW0 3INUL 1F5WA 1KYOJ 2PF6A 3UTTE 3MJ7A 2EH8L 5J7CC 5MP6H 3U4EB 4XVJL 3TN0C 2R9HD 1LEGB 1KB5B 4S2SA 4TUKL 1UB5B 3UJJL 3MGOB 5FGCB 3SGJA 3PL6D 5I1HH 3BMWA 3HG1A 4PLJD 4XP1H 4JQVC 1BGXL 3WFBL 4CN4A 4QRPE 4JZOB 5MENA 2O61B 1K5NA 4TVPD 4M1CD 4G8EB 4PJ9D 5DRWA 1ZGLM 1MCFA 4PTTA 4OZFA 4CVZA 2MNUA 1Y18A 3QHFL 4CMHC 2QADB 3PWJA 2FECL 1A4JA 2B1AH 3VFGL 3GSXA 1I8IA 1KXTB 3VA2C 2OCFD 3P0YH 4J6RH 1C5CL 4PJAE 2IH3B 5E2TL 4C56A 3P9MB 1PKQA 1QRNE 4XNZC 3X14A 4D0CB 1SJXA 4UT6H 5H2BB 5A43C 3O3AA 4YAQA 2O93L 2AKRA 3PE9A 3ZKMC 3UJIH 4Z6AT 8FABA 2PYFB 4X8XA 5I17A 3LPWA 1RVFL 1RIVL 1AJ7L 3G5VB 3QO1A 5IVZB 4EN3C 5GZNC 5IB3A 4CVUA 2Z0BA 3JTSA 2YSSA 3ZDXE 4TUJA 3OKKB 4FQIL 5CJQH 4PLKD 2J4WH 1NAKH 5F7EL 1JWMA 1KTDB 3D25A 5ILTH 5K9QG 3HHRB 4N0UA 3BH8B 1WISA 4I0PB 3RDTB 3U4AA 4LLWA 1OPGH 3F58L 1S7QB 3O6MH 5HHNA 3E8UL 4JKPH 4GO6B 4QHUB 3LIZH 4MAYB 1DL7L 4FHBD 3FB7A 4MA8L 2APXA 3H9SA 1UH4A 3GMOA 2CKNA 1R3KB 4MVBC 1YN6A 4ODUB 4PJHB 4M5ZH 2IALA 2X4RB 4KPHL 3W0WA 2GITB 4CN6A 4RDQG 4E9LA 4URTB 2HH0L 2JJTA 4FQJH 4ZO6A 4DN4L 1C5DA 2IAMD 4Q9RH 4ZOCA 4AG4H 4GG6A 1C08A 3AY4C 2VH5L 4F3FA 2DLEA 4WWID 5C0BD 2FJGB 3NGBB 4LHJB 4X0KA 3DRQB 2XQYG 3PHOB 1FJ1B 2BVQB 1HXYA 1LILA 3V2AR 4WU5B 1S9XB 4JR9L 4LVHB 3WKMH 4GFTB 4Z7QE 4M43L 1QLEH 3MRRB 5CP7A 5IVXA 5DQ9B 1I7ZB 5I73C 1U8IB 1LE5B 2P42B 3L5XH 4K8RC 3TJHD 4QXUH 1MY5A 3VXSA 1XF2B 4U1SA 4J4PA 2R29L 4N68A 3I6LD 3UROR 2R2EA 3BVNB 3GRWH 4MGXA 5K33A 4D9RE 4GBXD 3TT1L 3CK0H 3GSNH 4JDZA 5AUMA 3TVMD 3HMWH 1RD6A 4FQQA 3UCRA 2NY5L 3FN9A 1LGVA 4HXAH 1TJIH 2NX5E 4W6YB 1G7LB 3O8XA 3C6LA 1JNHB 1OTSD 4GRLA 2JCCE 4WNQB 3OSKA 2P7TB 2NY7L 3MGTA 3TA3D 1FV1B 4NJ9H 2V7HA 3QQ4A 3DJ9A 2DKSA 1NGQH 1K4CA 5CUSH 1JFQH 2C7UA 3HMXA 2BCKA 4NWUH 4UBDD 1N7ML 1LO0H 3AREB 5EH1A 1BZQK 3CDGA 4N0UE 1EFXA 5D7LE 1EO7A 5D70L 4AJ0A 4R26H 4EBQL 3LPGA 3QYCA 1JHLL 1H3UA 2IPUK 1TZGL 4H1LB 3EGSA 4Y1AD 4JFXB 5EBGA 5EIVA 1HK6A 1CR9L 2RGSA 3RP1A 1A02N 4M7KH 1FHGA 3W82A 2XN9E 3VD9A 4KUZL 3H9SE 3CNKA 3HR6A 1F6LL 4Y4KC 1E4WH 3OKDA 2BK8A 4XHQA 5KG9A 1ZLUK 4Y16A 5DJXA 4PGDA 2QHRL 4NN6C 1MF2H 4BM7A 4OUUA 2YD9A 3QEHA 3KYAA 3STZB 3BKYH 3A6BL 3ROLA 5JA9A 2I24N 1RMFH 4P46A 1TTGA 2Z8SA 4KY1L 2AJVL 2VZOA 4JJHA 2H3NB 3FFCA 3MNZA 4ZFGL 4YIQB 2HLFC 3MACL 2BY0A 1ZKAA 4OGYL 4QXTB 4ZDHA 3FB6A 2CUIA 5D7JA 5KVEL 3LKRB 1KCUL 1U8LB 4M6AA 4P4KD 1CT8B 2D7TH 1RK1A 1MFAH 5BMFL 5IHLB 1L0YA 1JVKA 5KSAD 1K3IA 2AEIT 3FQWA 3MRMA 4RIRA 4HUWA 3CUPB 5E00B 3TBYA 4EVNA 2BSTA 4F15C 2QSTA 3WIIL 1BEYH 5TE4H 2HFFB 2JB6B 3MRJB 5EZJB 4JG1L 4L8CB 3WMSA 2IEPA 3SHSA 4YBQD 3ECBB 2XA3A 1KCVH 1TCRA 2KZWA 3ARDA 2OJZL 3L3KA 5DVNA 1II4E 4F7CB 2DQEL 4ETQA 3VFWB 1UM4H 1KN4H 3LD8B 5I6XC 3TNNB 1T22A 1UQSB 3JV4B 2KZ1B 4XCCH 1JV5B 1SVZA 1CFQA 3L3JA 4Q2ZA 1AQKH 3V7AG 3LH2H 5TFSL 4KMTL 3CC5B 3QHTC 5HVGB 4L8SB 5CCKH 3MLVL 4RX4A 1JNLH 3DUUB 2EO1A 1K9TA 4HK3J 1AR1D 1UKQA 1RJLB 5JUEH 4LNRB 4PJIE 2DM4A 3N1MC 5F3BA 1VERA 2LU3A 3IFLH 5CZXD 1P69B 4D3CL 5A2FA 3QAZB 5JMOC 3SO5A 4N5ED 1PZ5B 2DQFB 5DJ6B 2W9DH 4G6FB 1XIWB 2R23B 4GT7A 2IPTH 1J12A 3QG6A 1HOCB 5AAMA 1BJ1J 4CAGA 5DRNA 4K94H 3IDIA 4JPIB 3PJSA 2I25N 3DECA 3RL1B 5ERWA 1P7QB 3OBAA 1T1XA 3RKDC 1NC2D 2DLHA 3CPLA 3H9HB 3IETB 4WHDA 2ORBH 1FZKA 4JFDE 1G6RB 1JRHH 4ELMA 1UWGL 4LARH 2BZDA 4R0LB 2DQTH 5M94B 2ZUQC 3LS5L 1UJ3A 3LDBC 4HGMA 4NOFA 3SDXE 4HXBH 1OAZL 1QEWA 2VISA 3QDGA 2ATPB 5F88A 2XNAB 3HPJA 4KDWA 1YMMD 3LEYL 1CBVL 1A6TB 4YWGH 4PJFB 5EBMA 2W0KA 3BP5B 4KRPD 4WENB 1P1ZB 5HVHC 5JDSA 5D9SB 4XWGL 2GUOB 2WV3A 2AEQL 5D1QD 1ZHNB 3D69A 2VLRE 3OWEA 1CFVL 1Q38A 3TBVB 3ARBD 4P2OD 1DQML 4DW2L 4G80B 3VJ6B 5DURB 1VFUA 4LVNB 4EI5C 1I1CA 3FB5A 4KDTA 4NWTH 1FDLL 2H26A 4G8IA 2GSIA 2R2HB 3DMMB 1N59A