4JPVH

Crystal structure of broadly and potently neutralizing antibody 3bnc117 in complex with hiv-1 gp120
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
223
structure length
216
Chain Sequence
QVQLLQSGAAVTKPGASVRVSCEASGYNIRDYFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRHASWDFDTYSFYMDLKALRSDDTAVYFCARQRSDYWDFDVWGSGTQVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A STRAIN 93TH057 GP120 WITH LOOP d AND LOOPD V5
publication title Somatic Mutations of the Immunoglobulin Framework Are Generally Required for Broad and Potent HIV-1 Neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 34
structure length 216
sequence length 223
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpvH01
3PNWB 1JWMA 2BVUA 4FP8H 3TV3L 3VRLE 4JO3L 4W4OC 1QSEA 3L5XL 2Z31A 1S5IL 5IG7B 5C07E 5LQBL 1ZT7B 1RUAL 3LDBC 3RIFK 3QQ4B 2I9LA 4YFEA 4GRWB 3FO1A 3L3DB 3BW9B 1H3PL 3MRRB 4M6NH 4PRAA 1ZGLB 4GRLC 2R0LH 4XH2B 2IBGA 3LH2H 3I6KA 3MA7A 3VGFA 3V52L 1HXMB 43C9B 2JELL 3SKOB 1UM6L 4PG2A 4X5XB 4KWUA 3J8F7 1AGCB 1EJ6A 2XWTA 2A6KA 4NDMB 5B38B 4AH2A 1SEBA 1JHLL 3QA3A 4UT7H 1I3GL 3IDGA 5I1IL 3HI6L 3AU1A 2EDHA 4RNRA 5AUMA 4M1DH 3DARA 1S78D 2YD8A 3OKDB 5JNYB 3QEQA 4FXKA 3QPQC 1BX2A 3BPOB 2VKWA 3NIFE 4WFHE 3VWJC 3GBNL 1LILA 2JK5B 4GMSH 4GUPB 4OIBA 5KSUA 4EBQL 4Y4FD 5ITFB 4NRXA 4OCSL 5ACZB 1UZ8A 4GKZA 3EO0B 1TPXB 1YN6A 5DC4B 5HGBB 4JKPL 1QYGL 1XGRA 1IGTB 2DMKA 5DMGC 3X17A 1BQSA 4HJGA 4OZHE 5E1AA 2RHEA 1EMTH 4QRUB 4KZEL 1RUML 4QCIB 1V3MA 1K5NA 5GGSB 1T0MB 1M7IA 4K7PY 5CS7A 4Z7OF 4P9HC 1GGIL 2EE3A 5HD8D 4WTZA 3D0VA 4YO0B 4HIIA 5DHXB 4KU1A 1EJOH 2X4OB 1FNHA 2YMXL 1T89C 4RWYH 3KWWB 3O4OC 5I6XB 4OZHB 3VXUE 1IM3B 2BCKB 3LQAL 3U83A 3UTSD 3O6FB 4X5WB 2MOVA 4BM7A 3QCVH 1TJGL 2IEPA 4HWBA 4PJEE 4M1CD 3UDWC 5MEOA 1B0GB 5JW4R 3MRFB 5HVHC 4QY8A 1Y6NR 3M8OH 2E5EA 4F57L 2P7TA 5H94B 4N90D 1A3QA 1A7BA 2E3VA 3PV6B 2GTWB 2UY6A 4QXTB 4UV4H 5EO9B 5D7LE 4M03A 4P5MA 1IGYA 5DEFB 4M48H 4HBCH 2ICCA 3D3VA 4Z0XA 3CX5J 5J57B 2LVEA 5AWNH 1QPXA 2H6PA 4NO0A 2X7LB 2AEQH 1YEGL 3D85D 5CJOH 3WO3B 3O2DH 1FFQA 1I8KA 1NBVH 3MLTB 4OT1H 3JWDH 3O11B 3T1FA 5D7LB 3ZT5A 1AGFA 4ONOA 2NY0B 2B4CH 1YPZA 2Q3AA 4PJFE 3MGOA 4QRPD 5IB4A 1A6AA 1U8IB 1OWWA 5H35A 1D5IH 3DMMA 1N59B 2F5BL 2GUOB 1CQYA 5I1JH 12E8L 1TVDA 4IRSA 1BBJA 3BP5A 2FJFA 2VLKE 4XPTL 5J06A 3O8XC 1XMWA 1ZKAA 2O93L 5IOPA 4KK6C 2V9QA 5C09A 3NGBB 2HFFB 4OTXL 1JMXA 1OY3B 4XZUA 2P5WB 3LKNB 2V9TA 4Y5XB 1MJJA 2DTMH 4NN5C 3K8LA 3P4MB 2QTEA 5IHLB 2V7NB 3NIDE 4UDUA 3NZHH 1NFKA 1MI5B 5MP6H 3N1GC 1INDL 1JE6A 1EGJH 2CUIA 4PRHA 2NXZC 3ZDZF 5KSVA 3GEWB 3WIFB 4K3JL 5KN5A 3VXUA 3S37H 1XAUA 3GMPB 4G43A 3ZKMD 1I1RA 2CLZA 3V6OA 4X6EA 4PJEA 1MHPH 4YPJA 4YUEH 4W81A 3GSUB 2VDMH 2V9RA 4PRNA 3V8OA 3BKCL 5BV7B 2W07A 1YQVL 4YIQB 1CGUA 3SDAA 3QDGD 2ZCLL 1Q9WA 2OTWA 3BP7B 4JM2B 1RSFA 1OB1A 3HC4H 1K9TA 1A7RH 1S9WA 3OAZK 2NTSP 5K9KA 2FJHA 3OF6A 1RUPL 4BFBD 5JW4Q 1BZ9A 1GGBH 3QUMH 5D1ZA 2AJUH 5FCUL 3OGOE 1MLBA 2X4PB 3BDBA 3DURA 4KK5D 3ALXA 1UKQA 4M00A 5FYLL 5MERA 1HHKA 1IE5A 4Z7WE 5ISZA 1LDPH 2E7MA 4PJFA 3WDHA 1A6VH 2PF6A 2BMKB 4YGAB 3LKRA 3OKMB 2HJFB 3WUWA 4PJ5D 3MR9B 2APBA 1HQRA 1BF8A 3DYMA 1RMFL 5IHUH 4PJXA 5HYJD 4PRBB 4LMQE 2PETA 1FP5A 3BO8A 1EERB 4Z7WB 4D0DB 3GHEH 3JV4A 5D4QA 3QWQB 4JE4B 4MSWB 5HGAB 4X9IA 3C5SB 3D48R 1NFDE 2XY1A 3WEXB 5C0JA 4XVSL 1LWRA 1A7QH 1RJYA 4GXUM 3RUGA 2AKRA 1ZHBA 1TZHA 2ZOKB 5FB8A 2Y72A 5F1NA 2BY3A 3G08B 1ZA6A 2N56A 2PUQT 2X89A 3L95B 1NAKH 2IQ9H 4NC1C 2ED9A 3UBXI 3WE6A 4D9LH 3BUYB 1RUKL 2R1YA 1C5CL 3VFRA 3I84A 5TPWH 3BT2L 3K0WA 2EH7L 1HKLH 2HJLB 2I5YH 2LFGA 4L3CB 2P5EA 1NFDB 1N0XH 4UZGA 1FIGH 2COQA 3BPLC 2D0FA 1OAQH 2J6EL 1CT8A 2ZSWA 1Q9LA 4Y0GA 5FK9B 4DGVL 2DLGA 3RDTB 4OZGE 2XG4A 4ZXBA 4S2SA 3BIBX 3TA3D 3EYFB 3RWCB 4B7LA 1S78C 3OB0H 3OBAA 5F70A 5D6DC 5E8DH 4HXAH 3BYYA 4K7PX 3C2AL 3FRPA 3V6ZA 2GITB 4TTGA 5FV1L 1FGNL 3MJ7B 4MJ6B 1M71B 4U6YB 1JNJA 1U3HA 5CJQL 4R7NA 3ZL4L 4Y4FC 5I1EL 3CFJB 3GM8A 5DFVD 2E9WA 3DROB 2I60H 2Y36L 1CDIA 4J4PD 4EI6B 3U9UB 3WL9B 1HCVA 5EDXA 3NA9H 3LEVL 5FF6B 1CXFA 2YSSB 3LKSB 5ABDE 3D2UD 5BW7C 2QJDA 1G7PB 1UM5H 1T2XA 2Q86B 5I1GH 4P23B 3FFDA 5HHVL 5HD8C 1ZSDB 5F9JB 4WNQB 3BI9X 4JZOB 3H9HB 1OSZB 1R3JB 3IFPA 5IW3A 5ADPH 2YD6A 5C0IB 2ICWJ 1H8SA 4KKNA 1KCRH 2VXUH 1UM4H 1WEJL 5JLZB 1KULA 1IEBB 3MC0A 4JDVA 4XWGH 5ID0A 1T2QL 3U4AA 3W2DH 3BEVA 4HV8A 4M1CC 1D5MA 4J3XA 1DBBL 3GIZL 4L3EE 4XT1C 2AGJL 3TBVB 2XZZA 1BFVH 5DJXA 3DX6A 1RURL 2FGWH 3VFWB 1HWHB 2AAVA 1DLFH 4JY4B 1AD9A 2MKWA 2BNUA 4GJTB 3FONB 2NXYD 1MCOH 4TTDD 4Y19E 3DXAA 2L7JA 5HPOA 4IOFD 2MWCA 1IC5L 2NX5B 5C0DB 3WUZA 5K9JL 3NAAL 1HHIA 1ZEAL 2EECA 3OZ9H 4L3EB 5DSCB 4PFEA 4RGOH 4R7DA 1OWRM 3X12B 4MAYD 4YWGH 3L3HA 1D6VL 4JANA 3UCRA 3GNML 2G5RA 2DQJH 4MA1C 2B2XL 4MX7B 3VFVA 5EUOE 3MZGB 3G6AA 3SKNA 4NZDA 2IPUG 1I3RB 3CUPB 1DVFD 4QOKE 4JG1L 4URTB 4RMQA 4PLOB 3HRZB 4DZBB 1DBJH 1C1EL 5EC2B 1RIVH 2VDLL 2VLRE 2NMSA 2D31B 5EC1B 3ARSA 2JJTC 1SBSL 5L2KD 4FABH 3KS0J 1NGWA 2Y5TA 4LGRB 2KUTA 4J1UB 4XP9H 5BMFL 1AJ7H 25C8L 3RX8A 2ERJC 1TQBB 3HZVA 4LLWB 2XZCH 2DLFL 4QF1A 3OJDB 1I85C 4LKCB 5BZWA 2BY1A 4KK8C 4LFHD 1UEMA 4BSVA 3RZCD 2ENYA 2VLRB 3BKYL 4YDIH 4JPWH 4OGXL 4L4TD 2UZXB 3FO2B 4O2EA 5EU3B 4MQ7A 3O6LH 3QUYB 1UXWA 4OJFH 5TDOB 4JRXB 4C59B 3V4PH 4G7YL 5IFJB 3O45A 1IC4H 3H3BC 3MRGA 5FUOL 5JR1H 1I8MB 2BVTA 1XF3A 5EIIB 1KTRL 1I1YA 5DRNA 2WUCH 5MEQA 2DIBA 4CADA 5HTSA 1E27B 4Y8AA 3W9EB 5FECA 1OSPH 2JCCF 4F2MA 4MNGE 1EFXB 3TT3L 3QUXB 4MDJA 3HLAB 2IPUK 3GB7B 5FYLE 5IMMB 1J0IA 4HIJB 4RMSA 3B2VH 4Y19A 4PBVC 1U3ZA 2VDQH 3FB6A 5ANMB 4OD2A 2R56H 4PV8A 1RZKL 5IQ9B 4R0LB 3PWUA 2DF3A 1T7ZA 4TPRH 4HUVA 4WDIA 5KVEH 3BP6A 4M43L 2IALA 5HVGB 4BJLA 3PGCA 1CZ8L 1RZFL 5TF1L 1RD6A 1XGYH 1CD1B 5I1AA 3TN0D 3OQ3B 1RHHA 3MRDA 4M02A 2FYYA 4OGAD 3WS3A 1XF4B 2CDGB 4OLEA 3I6GA 1QTYT 4XNUH 2FRGP 5DURD 5SX5H 2RIKA 4NNPL 1FVDB 1BLNB 4NP4H 3MOAH 4U2YA 1H5BC 5IVOA 4K3EL 4C56D 1IAIM 1VACA 3F58L 1CLZH 5L7XL 1N6QH 3MV8B 1U8QA 4K2UL 1N5YL 1U8HA 2X5PA 3BUTA 4K55A 4XBGB 2AJSL 3PL6B 5GGRY 1FFPA 1RJZA 3LKQB 2VE6A 4X4XB 1QBAA 5ALCH 1Q72L 2P4AB 4UOW1 3L7EB 3LZFH 4N8CL 2VXTH 2OXGA 3ZDXF 4E0RB 1ZLUH 2G2RA 4IMKC 1R0AH 4CVZA 4U1JB 2RFXA 1N8ZA 3JVGA 4NGHH 5BOPA 5I1HH 3KXFE 5EZJA 5JW3L 5F7DA 4GLRI 3LQMA 4S11A 4PJ8A 1INEL 3INUH 4V1DB 4UAOC 1V7NL 5DQJB 5DQ9A 2R69L 1F3DH 4I3SH 4M7JH 5DMIH 2E9JA 5EBGA 5C6TL 2YR3A 1CFVL 3BJ91 3FFCD 3W81A 4O58H 4ELKA 3LRSB 5F9OL 2YBRB 3DRQB 3I9GH 2W0LA 1QACA 1PZ5A 1CGSL 5CEZH 1NEZA 1MJ7H 4MNGA 3HCVA 4MJ5B 1XCQA 1ZA3A 1DQQB 3CZJA 1UJ3B 4JZNB 5ADOL 3QDME 3S6CA 3OJMB 5CILL 2BVEA 3NA4A 1CG9A 5DFVC 2D7NA 4BSWA 1N64H 1H0DB 1MAMH 3ZE2F 4OF8A 1WZMA 4N1EA 1K2DA 3IDXL 3L5HA 5AZ2L 5KSAB 5DRZB 4HF5L 2B1AH 3VXME 1W8OA 3QDMB 3BWAA 4F9LA 3CFIC 3RI5K 3UP1A 4U7KA 3MLUL 5FM8A 2P8LA 2JCCB 1AY1L 2Z91A 2VDOL 4BKLB 1UKTA 1XF5B 4JY6B 4J23A 5DR5L 1FE8H 5J1AA 2V5YA 2YEZA 4DOHE 1F11B 3S35H 5LWYH 4LCIH 5FOJA 4P46B 5D70H 4JLRA 1K4CA 3F7QA 4CMHB 3VXMB 1KBGL 3N1QC 2FSEB 2ZUSA 4JB9H 5JXEA 1OAKH 4HPOL 3O41A 4W6XB 2JB6A 3EOTH 2J6EA 3I02B 5C9KA 1KJ2B 3RPIA 4DOHB 1S7UB 3JWOC 2NXYC 4TTDC 4XNXL 3TNMB 3WSQH 1VFMA 4XCEA 4XHQA 5CJ5A 3A6BL 5I1LA 1KGCE 1LD9A 4JFHD 5KVDH 2CIKB 4WW1B 5DK2B 2Z35A 3VW3L 1JUFA 1E0OB 4PJBF 4LRNL 1IGML 1GC1H 1I1FA 1FRGL 1QSZA 3CVHL 1HCFX 4HHAB 1F2QA 3BE1H 4LIQH 5FYJD 3SJVA 1PY4A 5C9JB 5T1KA 4MAYC 4WENB 1HHJA 4P48A 3L3GA 4JDZB 3EOAA 2EDXA 2F5AL 3LIZH 4DGYL 4GT7A 5E8PA 2LQRA 2FWOB 1NAML 1VFOA 4MB3A 4JQXC 1LEGB 3WFCL 1MFEH 4BFGA 1AQDA 1NLDL 2YHGA 3E6FA 1DVFC 3EJJX 3C5JA 3JV6B 1NEUA 3UO1H 3GSXA 1HILA 3F7RA 4EEEA 2X09A 4UIKH 4PLKD 3TBSB 4AMKH 2IH3A 4PD4K 5CSGA 4G7VL 2DQFA 3ARBB 4ZDHB 1KACB 1CTNA 1GXEA 1PW3A 1A6UH 1JYVA 2AJVH 2B20A 5D71L 5DA0B 3VFOB 4Z7NE 3QXVA 1V3KA 3HB3D 5FKAB 2Q76A 4H8WL 3I3BA 4ENED 1CDGA 1KLFA 3C60A 3AAZB 3QHTC 4FQ1H 4HIHA 3P0YL 3LRGA 4GKNB 4Y5VB 4R26L 3LN4B 4R2GC 2J8OA 4KJPD 1JF1B 4NKMA 4ZPVB 1UYWL 2G5BA 4HGKC 3MV7D 4Y4KA 4FQJH 4YXHH 1P7QB 5DD1H 1P4LB 4M5ZH 3EHBC 4U49A 4WV1B 1JYXA 1NUDA 5D2NC 2Q6WA 3TZVC 1TJHH 1KIPA 4MA8L 1DBAL 4PGCA 5C0FB 4FTVE 5DEGA 3UROR 1U6AL 2NY3D 4EDWL 4L8SC 1T03L 2XPGB 1JNHB 1OAUH 4GG6A 1B4RA 5F9AC 2WAHA 1HINH 3OX8A 4XBPB 4QNPF 3TPUB 5D7JA 4NM8L 2HVKA 4HIXL 4JHWL 5ICXB 1ACYH 5BS0B 4HS3B 1DLHB 2P1YA 2XKUA 4FTVB 4XI5D 2EEAA 2YD5A 2JB5L 5GGVL 1G7IB 3BXNB 1IGIH 3C09B 4N0UE 1JPST 4OGAC 3QRFM 4NWUL 1IGFH 5T1MA 1Z9LA 3SDDB 1RULH 3W9DA 3UZQA 4KJYA 4HIEB 1NMCB 2V2XB 2Y07L 1EXUA 1UWGH 1CYGA 4MJIB 2LVCA 3KJ4B 5GGUB 3NCYP 3MLPA 5L8KB 4Z7VF 2K3TA 2VISB 4JO4H 3U4EA 1F6AB 4X6CA 2X9WA 2EKSA 5JW5B 1IT9L 3T77B 5DGRA 4PJBB 3MO1A 2DBLL 2P24B 4H1LG 5GS2H 3KNBA 4Z0BH 2IPKB 4PG9A 4I0KA 5IB3A 3HE7B 3F7VA 1FL6A 3DVNB 5IIEA 3GMRB 4HZLB 4LEOA 4J8RB 1B4JH 2XWJB 4YPGB 3TO4C 5C6PB 3SHSA 5IHZB 1Q9OB 2IAMB 5LKNA 1CXLA 3GSRA 4CU7A 1BOYA 5EU7C 1KF9B 4P2YA 3WS6A 2QL1A 3MACH 1UWXH 5HHOB 1FL5A 3FQTA 1VFAA 1KJ3H 5D8JH 4HUWA 2JIXA 1OF2B 4U3XA 1FZMA 5E4EC 2WSKA 3QULB 2B7DT 1EO8L 1DQJA 4XVJH 3RI5F 3SDXE 2R8SH 4KROD 1N2RA 2OL3L 4P59L 5C0AB 1KB5H 4QRSA 1RZ7H 4HUUB 4Z6AT 3I50L 3DUSA 5J13C 1PSKH 3L5WA 4JN2B 5FDYA 4OLVL 4P9HL 2AV1A 5CEXB 4QTHA 5SWQA 2NY4D 1S7VB 3CSYB 3QO1B 2IFFH 3B9KB 2FO4B 3GSNA 3SDXB 4RIRB 2BRRL 4G6KL 2BC4B 4JG0L 3MLRL 2MPAH 3T0EB 2NY2B 3FRPG 4HGWB 1VEOA 5GHWL 4N0UA 1KTDB 4WEBL 4ODWB 5GS0D 1FNGA 4UQ3A 3W0WE 2V5TA 2I24N 4ZUUA 4UT6H 4KQ3L 1B6DA 3E1F1 3PQYD 3ZKNC 3VH8G 5EU6E 5BQ7A 5I75B 2P8PA 2A83B 5D2LF 4PS4H 3VXRE 1NC2B 3FL7A 3UZEA 4JHZA 3QNZA 1MIEL 5HSFA 4DAGL 4XVTL 4G6ML 4NO5A 5IW1A 1QLEL 2VB5A 1W72B 1J9CT 2X9XA 4NQED 4ZNCD 1MRCL 5TFSL 2CLVA 1HHGB 1LE9A 3FZUD 3QFJB 4OIIL 1NANI 4DVBB 2OZ4L 3GGWA 2DKSA 2ARJQ 2ZP0T 3FOLB 5FYJH 3HUJE 1X7QB 3VXRB 2EDFA 2VERN 2X4TB 4G80A 4JKLA 4P2OB 3L3JB 3DO7A 4WHYG 1LO2H 5I1CL 4G8IA 1I7UB 1ZMYA 2R29L 3O4LA 5HYFA 1D6EB 1QLRA 3KS0H 5FYKH 2N4IA 3MGTA 3HMWL 3MLXH 1XR9B 1R3HA 3MUGB 4TN9A 1TENA 2PYFA 3ULVF 5DJCA 3PDGA 4Z7VB 5C0BB 3H9SB 1M05B 3RVUC 3OB8A 4MXQD 4WI2A 3WDJA 1DL7H 2JJWA 1WQVT 1ED3B 3KDMB 3BKJL 3RWDA 2CJUH 1S3KL 2FLRT 2DKUA 3HKFA 4NHUB 4GAFB 4JFEB 3GRWL 3VFPB 5E9DB 5EN2A 3C5ZB 4YHPB 5ID1B 4DN3H 3TCLA 2GSGB 2OSLB 4HKBA 4QLRA 5TH2A 5DF0A 1F4XL 4PRPD 2W91A 1K85A 4M3KB 1GGCL 5GS1C 4PB9L 2E6QA 1J1XL 2CGRL 3MOQA 5A2LH 1QBML 5EUKA 2AJXH 3DBXA 4YHZH 3B3IA 4L4VE 4LHUD 3W0WA 3VG0L 1FSKB 4ZUTB 1Z0NA 1RZGA 4WVRA 4NQVA 4ENEC 3NABL 1JWMB 2Y7QA 4HWZB 1F90L 4QHKI 2DMBA 3G5XA 4WWKD 3T8XB 3TP4A 3BPCB 5EORL 1JPFA 4KJPC 5F3BB 1CGTA 1YMHA 3V4UL 1YPZF 3QQ3A 4K7PL 2I9LB 3V4VL 4AY0A 5HHMD 5I0DA 3FO1B 5LGHL 2VYRE 3QDJD 5MENA 4KI5E 4PRAB 3ZT7A 4X6DA 1CDCA 5IQ7L 3T08A 2GIYA 3VA2C 3CVHA 2IPTH 3MA7B 4JFOA 1LK3H 2R23A 2NY3C 3PF2A 1YECL 3HUJA 1CBVH 1KG0B 3P4LA 4KHTL 5J6GA 3PDOA 4HLZH 2XWTB 2A6KB 4AH2B 3QA3B 2E7HA 4X6FB 3AU1B 5D1XC 1MFDL 5AUMB 3H3PH 5D2LB 5EO0B 1Y18B 4OFYA 1WBYA 4XI5C 5D96C 1WITA 3GFUA 2ESVE 1IAOB 4IRJD 5TJWK 3QEQB 3SE4C 2ZCHL 4EKXA 3D39D 1BX2B 1N5AA 3OL2A 1AD0A 2DJ4A 4NJ9L 5I8KH 3TJHD 3RWEB 4OB5L 4Y2DD 4OI7A 1YN6B 3VFTA 4PJEF 4JFYB 4RGMB 5D6CB 1A0QH 2V6HA 5HGDA 2ESVB 2R2CA 3QCUH 2VXVL 1MF2H 4DW2H 1WFTA 3EYSH 4ZAKD 4JAMA 4F7TA 1HYSD 2BSRA 1OP9A 1FBIL 1C5BL 4P4RA 5I15H 4HAGA 4I0PC 4P5TA 3RKDD 3ARWA 2D2OA 5EOCJ 1G6RL 4Z95H 4YNYB 4XNZB 1MH5A 1CLOH 3EFFB 3TF7C 4L4VA 3RGVC 4WU5A 1FNSL 5I19H 1MAJA 4LQFH 2IG2H 2E7LA 1DANT 1A1MB 1VHPA 1NCWH 2DYPB 4AENA 1DE4A 4XP6H 4PY7B 2AXGB 4I13B 1MCWM 4YGVB 1JPSH 4JFXB 4QY8B 4YE4L 4XMLL 3HI1A 1QFHA 3RU8H 2XV6B 1NUFA 3BMWA 1WBXB 1NSNL 1ROWA 2PW2B 4HGMA 1BQLL 3MRKA 1QA9A 2PXYB 4PJXF 4UILH 2DL2A 4GMTL 4U1KB 1RV6X 4W4OA 5FA3B 5J9PA 4KROC 2OI9C 1A6ZA 2LAAA 4G42A 3D3VB 2RBLA 1VFBA 1XGPA 5GS0H 2ATPA 3SCMD 5ACLA 2H6PB 4NO0B 4L4JA 5E94A 1WZKA 5JDJA 5I8OH 4UTAH 3PWVA 4XNQA 3U2SA 4NQSA 4OUUB 4OSUH 4Q7DA 3RUGF 5HYSA 5JOFA 1FFOA 3T1FB 1NEZG 1AGFB 4GRLA 1YPZB 2DIJA 2IQAA 2OQJB 4LLUA 2NNAA 3QPXL 4RFEA 3MGOB 5J3HC 3HC3H 1A6AB 1TCMA 4X4YA 5H35B 4PRID 2G60L 2ICWI 3CFDA 3T0WA 1F4YL 3JUZA 4WCYH 1AE6L 3CH8A 4Z77B 4U6TA 4R97C 5JDSA 4HMEA 4NHCL 4TVPH 4XNYH 1XFPA 1EHXA 1BBJB 1CXEA 4WUUA 1KCLA 3QUKB 3IJHA 2FJFB 4DVRH 5TE6H 5IOPB 5C09B 1MSPA 1YEKL 4MCZB 4OD3H 3MLZL 4XZUB 3V5KB 5I1KH 2FD6L 4P57B 3QQNA 3EDKA 2HFTA 1CFSA 2BNRE 4HZAA 3N50A 4NJAH 3OAZH 4FFZH 3H3KA 1ZT1B 3VWJA 2QSCL 3FZUC 1TJIH 3DX7B 3FO0H 4B5EA 1G6VK 3HR5A 2FEDD 2BDNH 2F53A 2EC9U 2H26B 4LSVH 1RUQH 2EO9A 4LAQH 1UB6B 1KOAA 4K8RD 2HKFL 2CRMA 2BNRB 3WN5C 3Q1SL 4G43B 2CLZB 3RIAK 4KZDL 4KKBD 2WNGA 1JGLH 1HXYA 1YMME 3LN9A 2E9IA 4NUGH 4MGXA 2QQLL 2UZIH 2A6DA 5EZOH 4KDVA 2IC2A 5BJTA 5CD3B 2DWDB 5IBLD 5JMOC 2VN4A 4PRNB 2BVOB 1FPTL 4KDTC 1NBZA 4Z78B 1JP5A 2BSSB 3SDAB 1UZ6F 3LHPH 2OTWB 4NRZA 4MXQC 4N5UA 3WNKA 4OCWL 3MROA 4PJGE 1OB1B 5D7IE 1T89A 3BZDA 5IEKA 1S9WB 1G9MH 5K9KB 1MVUA 3QEUB 1RIUL 1ZAGA 3WXVL 2R0WH 2AABH 5E4IA 1CFBA 2ZSVA 1MLBB 2A1WL 1T0PB 2BVPA 4I18B 3UDWA 2Y06H 2HA1A 5L6YH 4P2RE 3T4AA 4PB0L 1WTGT 3STZB 3BYTA 3WCYA 2ZCKH 4F8QA 3TVMC 1V5JA 5DZOA 2AK4B 2BVQB 3MRNA 4H1LB 5E56A 3WFEL 5HVWA 1SVCP 2WMPA 2LV4A 3RY4A 3U7YL 5F7UA 2CMRH 4PJXB 4RGNE 2EC8A 1S9XA 5DO2D 2Q87A 2OZ4A 3BN9D 1EHAA 3PGFL 3QRGH 4WFFE 3UTZA 5IJVB 5FUCC 1HIMH 4NKIL 4F3FA 1XT5A 2OP4H 1WBZB 4U6HB 2EE9A 4AQOA 1E28B 5IFAH 4XCYA 4D9QD 1R5WA 3GI9H 3BN3B 3VGGA 5C0JB 3BZEA 1ONQA 1A8JH 1RJYB 3T2NL 3RUGB 4LSDA 4F7MA 5FB8B 2H32B 2PYEE 1FAIH 3VI3F 4JY5L 4PJIE 2X1OA 1MFBH 4GXVH 3O8XA 3MJ8A 4Y88A 4P2QD 1QKZH 4HQQL 2P5EB 2V5MA 4U7SA 5T3ZL 1X3DA 1HQ4B 2J12B 4M4RA 3GRWA 4YDLB 3WIHL 1CT8B 2ZSWB 1Q9LB 3ARUA 5DJ6B 2DI8A 2FIKA 4HCRA 3X3GH 1M6OA 4UIMA 2YZ1A 4XP1L 4YHOH 4ZXBB 5F44A 1EHLL 4R8WH 4G9FA 3VD7A 3U1SL 4IRJC 5CSZA 3WIIH 1VKXB 4HKXB 2BOBB 3V6ZB 4PJGA 5B3JE 4MNHA 3KHOA 5EOQH 4LSSH 3WKNA 1U3HB 3PGDA 5L9DL 2BY0A 4R7NB 3VU2A 1CICD 1LO0H 3HZKB 4LVOC 2NY5C 1QFOA 4HUNB 4HWEH 3VH8B 1JNNL 5FUZL 2Z31D 3TFKC 3BKML 4U3HA 4P2RA 4LGSB 4MJ4A 1S7QB 4ZAKC 1HYSC 2YPLE 4XXCC 3VGAB 2FJGA 2XTJD 4X9HA 1OQXA 1IARB 1OARH 3IETA 3GBML 3ARFB 3T2QA 1IAIH 4ODUA 1ZVSB 3K2MC 5C0RL 1BWWA 2J4WL 1Q0YL 4RMRA 4XX1G 1MNUH 3IFPB 5GZND 1MWAB 2XOTA 4KHXL 5C1MB 4CW1A 4RRPG 1U8PA 3QXWA 4JFDA 1II4E 3U4BH 1NGPH 3GMQA 2CK0L 5F6HI 1BIIB 4JDVB 5ID0B 1T1XA 3BEVB 1D5MB 3HZMA 4A2LA 3VXSD 3K2UH 4G9DB 5IJKC 5AEAA 2VXQL 5E2UH 2QSVA 1XF1A 2YKLH 1MCWW 4OQ1A 1AD9B 4R96A 1T66D 4P0DA 1AGDA 2J88L 2FCBA 3UTOA 3EYOB 3DXAB 4PJIA 5KS9E 3MLWH 5E5MA 1KIQB 4PJ9D 1TETH 1LP9E 3UZVB 1QOKA 4NRYA 3SKMA 4HG4K 4R7DB 1S5HA 3RWFA 1H15A 1J86A 3HPLB 5CLTA 4GAJL 1F3JB 2EDDA 4HMCA 1FIEA 1Z9SA 1OPGL 3MNVB 1N3NA 3VFVB 3G6AB 3SKNB 3J7HA 2MHAA 5DD3H 4DWHA 4NT6A 3GMNB 3NZ8A 3IXAB 1GAFH 4S1SL 4M62L 4EN3B 5B3NA 1G6RA 4Q6IC 1JWSB 4LDOB 3FQXB 3OWEA 4ZFZA 1T6WA 1XR8B 4FNLH 4UUJA 1NGWB 4YR6B 1AGEB 3RNKA 1I1AB 2J8HA 3MRCA 1IKFH 5C07D 4CMMA 3HFMH 3JWOL 2I26N 3HZVB 5J56B 4ZUSA 1BOGA 1YEJH 3LCYA 3STBA 1C12B 5F9WC 2J2ZA 1UADC 5F3HB 4U1GB 3U46B 1KIRA 1YYML 2M8XA 3C8KA 5ESVA 4HKZA 1KENL 4XPHL 2FEDC 5T5FH 3MGAA 5ESQA 3QXAB 3PWLA 4Y4FA 2CO6B 3TWCL 3ZKQD 1CLYL 2MQ0A 2CKBB 1NMBL 5E2VH 1BEYH 4BK4A 3MRGB 1NPUA 1C5DA 1T83C 1JK8B 3V9FA 2I27N 1U3YA 4KKBC 5FO9B 1ZHKA 2Q7YB 4I77H 1I1YB 4OM1H 4RFNB 5DRNB 3V0VB 3BP4A 4OLYH 2R0ZH 5IBLC 5BW7A 5ECJE 5MEQB 4JO1L 1LO3L 4CADB 5FECB 4NCDA 2YPVH 2VDPH 4XAKE 4ZUWA 4HC1H 2H8PB 3I3DA 4WFHD 3O2WH 1TZGH 4KDWA 3AS1A 5EBWB 4OD2B 5GRZA 2PN5A 3SKJL 1ORQA 4IRSD 3JZ7A 3UTSA 3PWUB 4M4PA 4HUVB 4RBPK 3BP6B 3SBWC 5GIRA 4JQVC 4LSRH 5GSVB 5IROA 2MSPA 3MRDB 2FYYB 3WS3B 2WK2A 3I6GB 3PJSA 3QFDA 3O6FD 3CLEL 5TQ0L 3MV01 4LNRA 1ZVYA 1AP2B 5DTFB 4BQCA 3MX0A 2WUBL 4ZTOH 2UVFA 1IM9B 1VACB 4IHOA 3QJFA 4X7SH 4YX2H 3HR6A 1T1ZA 4PGDA 4K9EC 4Q6YA 4ODSL 1U8HB 3WFBH 5IT2L 1PLGH 2CKNA 2D9QB 1EAPA 1NGYA 3VXUD 4GW5B 3BN9C 1FFPB 4IJ3C 3D85A 4YZFF 2VE6B 2WBJB 3ULSB 1F00I 4N0YH 1ES0A 5FKPA 2P48B 4WHTB 4I5BB 4YK4C 3RX5A 3TC9A 1I3UA 5T3ZE 4QRPA 5F7KC 3HI5H 2XN9B 1MELA 5I16A 5CLWA 3DX8B 4FQHB 3MRIA 3VFSB 5DHYA 5D7LD 5HYIA 5F6IC 1KN4H 4APQC 4F15B 3CFBA 4I2XA 5DQ9B 5CZVH 1AO7E 1BVZA 2EIZA 2IMNA 3MRBA 2NY6D 4JVUA 4BZ1L 3OR7A 2J3SA 5HHQB 1PVHA 2J8UF 1I85A 3ME0A 3PWPE 1KV3A 3THML 3NPZB 4B7IA 3QB7C 1NEZB 1R3KB 1MLCA 4ZNEE 3SDYL 1AO7B 3JUYA 5DD0L 2P5WD 3JSSA 4Q0XL 1E4XI 3QO0A 1XCQB 1ZA3B 1AGBB 4BYHA 4X9GA 5EPMB 1PKQE 3DGGA 4MDIA 1CICC 4WUKH 1CG9B 1W0YT 2DQHL 2VLKD 2WP3T 4ZYKA 5CFHA 3VRJA 4ZSOE 1O7VA 3IJSA 5SWSE 2FB4H 4JHAH 3H42L 4GG6F 1BZ7A 3QDGA 3X13B 4LEXL 4GQ9H 5DUBA 4M6ML 3GO1H 2NZ9D 3VFUA 5HYQA 2PO6B 3STLB 2P8LB 2X89D 5DDHA 2Z91B 1IQWH 4FQCL 5CIPB 4ZSOB 3ZO0A 1I7ZB 2FX8L 4MQSB 4NBZB 2C1PB 1BP3B 5MI0B 1IQDB 4JM2D 5EULV 1FORL 2YEZB 5TE4L 5GZNC 2QQNL 4DUVA 4KPHL 2AJ3A 4IM8A 3FT2B 3CDYA 3RVXD 5FV2A 3NCCB 4X8JA 2BRQA 4PJAE 2H9GB 1HSAA 5GRUH 1CTOA 1FG2B 1FNEB 3VE0B 4NUJA 3O41B 4XHJC 1ZHNB 4ZD3L 3K81A 1K3IA 3P11L 1H5BA 3RPIB 1BECA 1A7OL 3A6CL 1MEXL 2VIRB 4PJ5A 2CK2A 1D5BA 4HUKB 1OP5K 1MJ8H 4X6CF 5I1LB 3ULVH 4PJ9C 1KCSH 3R06A 2APFA 3CLFH 2Q8AH 1T5XA 3N1PC 2HT3D 2UUDH 2A74A 1UC6A 5F7EH 5TE7H 3BRGC 2W38A 3KPRE 4LCYA 4HS8L 4NQXB 5T1KB 1IBGH 2Y4SA 1WLHA 1A1OB 3HNVL 2D03H 3BSZL 3L3GB 4IMKA 5I1DA 2VLME 3DYPA 4BELD 3CSBA 2V17H 4WW2A 4ALAH 3UAJD 3HNSL 4ZNEA 3K8KA 1M7XA 2C4XA 2GW5A 1AQDB 5EZLB 3MBXL 2YD7A 3E6FB 3EJZD 5JMRA 4JFPA 3EGSA 1PKQA 3C5JB 4FFYH 4LF3A 3BGFB 2QADB 4F33A 4BUHA 4R4FH 4PTTA 3IS1X 3FHQA 4U05A 4UB0H 5JOPD 3NCJH 4DCQB 1JMZA 3GJEA 3E6HA 5IF0A 5T33L 4ETQA 2J8UB 4G8EA 2BOCA 3QIBB 2GJ6E 3UJTH 1KYOK 5D1QB 2Z4QA 3FAWA 4CNIA 4P3CL 4LSUH 4HIHB 3ZYOA 4N0CC 1TFHA 3K4ZA 3RVVC 2NW3A 5FGCE 3AM8C 3T0VA 4NKMB 1F97A 3DX9B 2G5BB 3S36X 3RWGB 3REVA 3P4NB 2EIBA 3U9PH 4J4PA 1B0RB 1QLFA 1YJDH 1UKSA 2J1KA 4PJAA 2GJ6B 1T6VN 3ZE1E 2LTQB 4LSQL 3MV11 4KTEH 1TPXC 4GG6B 3HZYA 4M7LL 3OTTA 4XB8A 1KFAH 4HDIA 3CFEB 5F1SA 5TGBB 3MNWA 3DSFL 4G5ZL 1T5WA 3UYOD 3OX8B 1KEGH 4KAQH 2VITA 4LCWE 3MBEB 4KJQC 5DHVB 5D7JB 3RA7H 1OTSD 2O5YL 2PTTA 1BIHA 1DQMH 1JZ8A 1GPOH 4OKVB 5T3XH 4UV7L 2WP3O 2P43B 5C08E 4P23D 5GGQL 2CD0A 5D2NE 3DVFA 2CDFB 3R0NA 1OD7A 3OAUL 1JTPA 4YBQC 4JFZL 4FFVD 3KPSE 4XPBH 3MLVL 1YY9C 2AJYH 1BD2E 5I6XC 3C9NB 3TO2A 5BVPL 4YHML 3O6FC 3TBYA 3EFDH 3R1GH 1ITCA 3W9DB 5IMLA 1S9VB 3F5WA 4KJYB 2F74A 2KPNA 4EJ1C 1JJUA 4S1QH 3F6IA 4U0QB 1EXUB 1CWVA 4OD1H 4MAUL 2DDQL 1BD2B 4X6CB 4J3TA 1FNAA 5GGRA 3PABA 1CIDA 3L7FA 5BVJA 5KTEL 3MO1B 4W70A 4MAYA 4XMPH 3F62A 3HHRB 1N6UA 2D0HA 1AXTH 2EYRB 5IVXE 1R3LA 4ZO7A 4O4YL 4PG9B 5T5NG 4HEPG 4DQOH 4L3ED 4OV6F 4JQXA 4LNVA 4ERSL 3F7VB 3BRFA 1DVFA 1VFUA 4XPGL 1FAKT 5IIEB 5GXBB 1MRDL 4P3DA 4MLIA 3U7WH 5JHDB 1IVLA 2O5XH 4NNXA 3ULUF 4Y19D 5F7LB 5CP3A 5HDLA 2B5IC 2UYLA 2NY0C 1MREH 5IVXB 1J0KA 5L2KA 3RQ3A 1DQLL 2X4QA 1DFBL 4O02H 3RY6A 2AXJA 1V7MH 2VR4A 4Y4HB 3QHFL 1FL5B 1KPUA 4TSAH 2EDQA 2OJEA 4HUWB 2JIXB 4C58B 2YRZA 4P4KB 1FZMB 1IILE 2CXGA 4EOWH 1DQJB 1JN6A 1IGCH 1R3IH 3GSVA 1KNOB 1YDPA 5B39A 2BNQB 4RA3A 1QRNE 3CFKB 3NGBC 4AIZB 4OCXL 1N2RB 4RMTA 1EPFA 1NBQA 6FABL 3LKPA 4QRSB 1E4KC 2EYTA 4Y5XC 3IDNA 4QOKD 4OIAA 5E00B 3MCLH 2DTSA 1U8OA 1I7RA 3L5WB 2VLRD 1OCWL 2H32H 4PJHE 4KMQA 5C08A 3TIEB 4RQQB 5D2NA 3LSOA 1SEQH 3GSNB 3IRZA 3OKKB 4X6DF 3TH4T 3VFNA 3EBAA 1QRNB 3ZKSD 3KPSA 3QUYD 4FP8L 2ADJA 3I2CH 1X5KA 4L8SA 3HUJF 1FNGB 4AEFA 4JDTH 4PREA 5HXMA 1L7IL 3GSQA 1MCEA 4ZUUB 4NN7B 4PP1D 2AQ1A 2NZ9C 1BFSA 2HVJA 4M6NL 4PJ8D 1TDQA 5BV7C 4UT9H 5CGMA 3GMMA 4PJCE 3IFOA 4JM2C 3B5GA 4IOIA 3W39B 2HWZH 5IW1B 2ZOLB 1BGXL 3ZE0F 2Z8RA 3IDIB 3N1MC 4M1GH 2FH6A 5HHPB 4Q2ZA 5HDQH 4L8CA 3MREA 4JJ5A 3GGWB 5CBAA 4NBYB 4PJCB 3UTQA 4DN4L 3TV3H 4C56A 1NCCH 3WV0A 4JO3H 1U93B 4G8IB 2DS4A 3BAEL 1QLRB 5LQBH 1QP1A 2NW2A 1RUAH 1K8IB 4D0CA 1DTUA 2PYFB 4RZCA 1T2JA 5DJCB 4GMSL 1S7TA 2JJSC 3MLYH 4U6VL 4XCCH 2GFBA 3QEGL 1TVBA 3V52H 4WHYH 4HKJB 3RWDB 4E41B 1A5FH 4NKDB 4WTWA 2RCSH 1RJCA 2JELH 2Q7NA 3S34H 1F4HA 4HH9A 3UAJC 1GSMA 3LB6D 4QXGH 4XAWH 1PEWA 1XZ0B 4LU5L 5EN2B 4ZOAA 1R6VA 3TO4A 1MY7A 1JHLH 2Y6SD 4G8GB 4O2CB 1FZOB 5DUML 1I3GH 5I1IH 3ZHKA 3P0GB 1YZZA 1FCCA 3TCLB 3HI6H 1F5WA 3MMEA 1PG7W 4I3GA 4NKOB 3FFCA 3DSNA 1KC5H 3DHJA 1UFUA 2L0DA 4ETYA 3UTPE 1VGKA 2DQEL 4GBXD 4KMTL 5AAWA 3DBXB 5K93A 2G9HB 3Q5OA 4NZRH 3S8WA 2ADFH 2V2TA 3GBNH 2IF7A 3B3IB 3VWKD 1G0DA 4JPIB 3QCVL 3ZDYE 3TT1L 1BM3H 4EBQH 4OCSH 2Y7QB 3IVKA 3BH9A 4TQEH 1HSBB 3KXFD 5KZCB 5CWSA 3OJ2C 3AREB 2OJZH 1ZTXL 5ILTH 3B6SB 1YMHB 5HY9A 2O61A 4ZS6D 4UV4L 1RUMH 1MQ8A 4KXZH 1BPVA 4R4BA 5MENB 1FFNB 3BEWB 4M48L 4X6DB 2ICWA 5AWNL 1GGIH 4U0RB 2R23B 1VA9A 3MJ6A 2PKDA 2AEQL 2YMXH 3IAPA 1JGUL 4X9FA 4NM4L 1BFTA 5K9OA 1G7JA 5J6GB 3PDOB 4QRTA 4QHUA 2AQ3A 2YWYA 2B4CL 3FCTB 1SHMA 3QDMD 1T22A 4FQQB 4U7MA 3K8MA 2VQTA 3AXLA 5KJRH 4NPYB 4MA7H 1WBYB 4P23C 4WTXA 1NCDH 1U95A 5I1JL 4ONHB 5I17A 4NQCE 3VG9B 4TSCH 5ETUB 3SGDH 4P46D 2X1XR 3LQAC 4ZPTA 3SPVA 1ZLVH 3MUHL 5IGXH 3VXMD 4LLVA 2F58H 2F54E 4XXDA 1QFUH 2NZIA 1DDHB 1YNKH 3WHE1 3TBTA 1YEGH 4PJDF 5MP6L 3IU4H 1X5JA 4NQCB 1HH9B 2YZ8A 4JAMB 1A6WH 1JIBA 3VXQA 2BSRB 3HS0A 1EGJL 4P4RB 4I48B 3W11D 2YN3A 4POUB 5ELIA 5L0QC 3S37L 1QO3B 4X4MA 3RY5A 5HDBF 4Q9QH 2YUWA 5DK0A 5IW6A 4R9HA 1MHPL 4KKLD 4YUEL 4I1NB 1CGWA 2VDML 4XPTH 3OB0K 1J05B 4AENB 4OTXH 1DE4B 2ITDB 3WBDA 3EOBA 1KGCD 1G7LA 1E4XL 5GQBA 1WIUA 1DEDA 4LVHC 5DZNA 2RAMA 5GS1A 3L9RB 3HC4L 3BJLA 3HC0B 1P6AB 1V05A 4Y1AE 4UTBH 3QUML 4MMZC 3T65B 1INDH 2AJUL 2R39A 3EKCA 4K23H 1SJHA 5GRXG 5T5NF 4CJ1A 2DJUA 1QA9B 1NDMA 4A6YA 3VFGL 3ZT6A 4LPTA 4K3JH 4PJ7E 2CIIA 2VZVA 1RAMA 4OLWL 1A6ZB 1TQBC 5DFTA 1LDPL 2PCPA 2XZAL 3RVTD 1WUNT 4Y1AB 1F6LL 3MV7A 2D7QA 5E94B 4K94H 4N5EC 4XNQB 3U2SB 4NSKB 5HGHA 1HEZA 3TJEH 5DRWA 3BKCH 1BZQK 4M6OL 5IHUL 3QUYC 2NNAB 4RFEB 1MPAL 1IAKA 4H25B 1P7QD 5DI8A 4BQ9A 3GHEL 3CFDB 3CSGA 1ADQL 2IH1A 1T0NA 1GVIA 3EZJB 4WUUB 4YXLH 5FCUH 3KG5A 2F54A 1A7QL 2XICA 3V5HA 5D1XA 5DJAB 3G6JF 3NIGF 4MQXC 4FZ8L 3QSKB 4ODBD 2OS7A 3QUXC 1GHFL 5EO1A 5FYLH 1OAZL 1CFNB 1NAKL 2IQ9L 1ORSB 4LCCC 1G7QA 4XPAL 3SE4A 4MD0B 4GXUN 4PJGF 3T0XA 3BZFB 5F1IA 2I5YL 2HT4D 4R0LC 1N0XL 4XGZA 4FTVD 3IF1B 3HR5B 1OAQL 4X98A 3HA0A 2F53B 1CFQB 1WFUA 1RMFH 3ILPA 3EOYG 1PFCA 5K33A 1LVEA 5IB1A 3D5OF 4YEEA 1DN0A 1FNFA 3QXUA 4XC1L 4CVXA 2R2EA 1T3FA 4NNYA 1HXYB 1VCAA 8CGTA 4PJDB 3T3ME 4DEPB 3GK8L 1JL8A 4XVSH 2D7OA 3BD3A 1NBZB 4MJID 2ARJA 1LE5B 5EIQA 5LAXB 4NRZB 3PL6C 2FGZA 1KB9K 4GG8B 3WNPA 4ODHL 1KXQE 1RUKH 1C5CH 1NJ9B 3BT2H 4PJ7A 3LB6C 3IXTA 4EXPX 3OXSA 2ZSVB 1X5HA 3ZHDA 2BVPB 4TUJB 2J6EH 3CC5A 4FRWA 2I07A 2VSDA 4DGVH 5IB5A 1P84K 4JCMA 1JGDB 4PD4J 4WJ5A 3T4AB 5B8CB 4LMQI 3VI4F 1S8DA 5KOVC 2AI0L 5J12B 3C6SB 4CUCA 1S7RA 5IR1A 5B21A 4GBXC 4PJIF 3C2AH 1NH6A 4CRPA 1Q9KA 2VXUL 3MRNB 4J3SA 1FGNH 1UM4L 1B90A 2XQYG 5EFIB 3QI9D 1GH7A 1OGAE 1YUHA 1TTUA 5CJQH 4PGJA 5I1EH 3LEXA 1WWAX 1S9XB 2ICEA 3BMVA 3SY0A 2X44D 5EH1A 3G9AB 1DLFL 3DVIA 3OXRB 3QJHB 2QR0B 3O6KL 1FV1B 3JBG7 1MCOL 5CKAA 3LEVH 4JZJC 1IKNC 5JW4M 2R4RL 5JORA 1UJ3C 2C3VA 4XCYB 1R5WB 1OGAB 1WC7A 4QKXB 5HI3D 4JFFB 3OZ9L 2X10A 3L6FB 2LABA 4JJHA 2QQKH 3B43A 3KPQB 2Y25A 2FR4A 3B9KD 5D72L 1XEDA 4U31A 1P2CB 2AERT 3PQYA 2VRAA 3QIUB 1FN4A 2DQJL 5SX5K 1FC2D 2H41A 2ARWA 3DV4B 4KTDL 1T2QH 4OCRH 2A0LD 1B88A 3G6JB 3GIZH 2FIKB 3VGBA 1L9MA 2KL6A 3SQBA 3CJJA 1LEIB 2BXYA 5KSBE 4NQEA 5JO5A 3ROLA 3MRPB 4LLDB 2AXFB 4U1NA 4MNHB 4P46C 4FABL 2EXWD 3KYMA 1P1ZB 4CMHC 3ESVF 4XP9L 3QG7L 5F93C 3NAAH 1DN2A 1MCFA 1C16A 3PGDB 1LNUA 1ZLUK 3WN5A 4Z7QF 5EU6D 3PP4H 1YEHL 3DWTA 4JPWL 3VXRD 4Z76B 1U91B 3E0GA 3D87B 2FJGB 3O6ML 1O0VA 1QEWB 4ORGB 1UVQB 3P73A 3W11C 5EBMA 1RJLA 3ZTNL 2A6JA 5JR1L 1C1EH 4KKLC 5TDPA 3IDMA 4DZ8B 3U0TB 2AEWA 3MV9E 3JTTA 1SBSH 4CW1B 7FABL 1MUJA 1U8PB 3D25A 4JFDB 1OSPL 4LPVA 3HE6B 4PRPA 1WGOA 2DQTL 3GMQB 5BMFH 25C8H 5ITBL 5I8CB 1RQ5A 4O51A 4WY7L 3B2VL 5EU4B 2DLFH 3KYNB 4YDKL 3D6GA 3TVMA 1RVFH 5CP7A 4KK9D 2UWEA 2CO7B 1QR4A 3BKYH 1N4XH 4OGXH 5KVEL 1NGXA 3R8BB 2X4UA 4LHUA 1KTLA 3RP1A 1QSFB 2R2BB 3BZ4A 5SWZE 4KVCH 5E5MB 5IVNA 3DTXA 3JV5A 4WWKA 4XNUL 4G7YH 2ITCA 5BRZB 4NRYB 2W9EL 1KCKA 3SKMB 1NMAL 3RVTC 3O0RL 4MNQE 3MOAL 3C8DA 1H15B 1OP3H 3CX5K 4IIQB 4MHHG 2BJML 4I0CC 4LFHG 1JGVH 1CLZL 1N6QL 1A7PL 4XNMB 5SWZB 4UQ2A 3KPOA 1IEAB 3TT3H 4P5TD 2MHAB 3EJYD 4R4NC 4P49A 2Y23A 4OAWA 3NZ8B 1QFWI 5ALCL 1Z6JT 4L4VD 3IKCA 3MZTA 1SQ2N 3LZFL 1RZKH 3B5HA 2WANA 2VXTL 2EDTA 2X70A 2XKNA 3HTLX 1H3TA 4MD4B 2BSED 2ZUTA 3HG1B 4ZFZB 1RZFH 5TF1H 5A40E 2CR6A 2A9NH 3RNKB 4CMMB 2OTUB 5EU5B 1ERNA 3INUL 4IRJA 1MRFL 3D39A 5HI4D 4K07A 3KLAB 3FQRA 4KI5D 4I3SL 4M7JL 1LO5A 4JR9L 4LSTL 4K3EH 3AGVA 3C8KB 2HT4C 3G5YA 3H0TA 5L7XH 3GSNH 5ESQB 4O58L 4QRRB 3KPPB 4Y2DA 3I9GL 3MV9A 1FJ1A 3C09C 3H8NA 5CEZL 2VZ1A 4X7TA 5DJ2A 1CE6A 1Q72H 2IANE 3BHBA 4ZAKA 3O3AA 3SDDC 1ZHKB 2VQ1A 4N8CH 1NMCC 1ZOXA 4OLUL 3MRMA 3G6DH 3G04B 1KLUB 3MTRA 3HAEA 3DIFB 2ESVD 3KJ4C 1KIUA 1QFPA 4YDJB 2PTVA 5JW3H 1N64L 1MAML 2HFEA 4ZUWB 1MHCB 1TVHA 1J8KA 4UMGA 1EX0A 3CVIL 2R69H 4X5LA 3JTSB 1FYTE 1G7HA 3BPNB 3UTSB 5C6TH 4NQDE 2HG5A 1INQB 2HT2C 1ADQA 3HE7C 1J8HE 2DN7A 4LKXA 4NC0B 1ZWIB 1AIFA 3DRTB 4MNQA 2AV7B 5F9OH 3QEHB 4LBEA 5IJKA 3ZYJA 3DVGB 1CGSH 3S3JA 4Z9KB 1WK0A 5CCKL 4U6XA 2PR4L 1DBMH 1I8IA 1FE8L 1TXKA 1PG7H 2IAMC 3S35L 4JPVH 4LCIL 3F7YA 5D70L 2EYSA 5E7BA 3L3IA 1MCQA 2VR5A 4FQ2L 5D5ME 5BCAA 3UPCA 3QJFB 1J8HB 3OGCA 4PGDB 5CILH 3GJFA 2R0KH 1SVZA 3L5IA 5DUPL 5CZXC 4QYOA 1OAKL 1NGYB 1FO0A 3MRJA 1G0XA 3D85B 2PXYD 3QH3A 2D4DA 1J1PH 3HMXL 5DXWA 4OZIE 4MA1B 4BH7A 4WW2F 3WSQL 3T0AA 4HF5H 2ADGA 4QRPB 5KVDL 4YC2B 3ORJA 2AP2A 3ULUH 3MLUH 3CU1A 3CGTA 4LLYA 5JA8B 5K9QG 2VDOH 4Q6IA 3B9KC 5IWLC 4Z7UA 4OV5B 1PDKA 1UACH 3CFBB 4TUKH 3VRIA 1GZQA 3T0EC 2EIZB 2NY2C 3MRBB 3OR7B 1A7NL 2V7HB 1NC4B 1MY5A 3IU3A 1KBGH 4JREB 3SEPA 2QHLA 1MFEL 2Y9RT 3FMGH 1YY8A 1U8KA 2RR3A 3O3EA 1P69B 5CJBA 1YNLH 5FHAH 3S7GA 4HPOH 8FABA 4YFLI 5I75C 4U1MB 1T20A 5DS8A 2AVGA 5IMKB 5FGSA 5GGVY 4M93B 2ADIA 4GRMB 1EBAA 4XNXH 4O2FB 5INDB 2EXWC 1D5ZA 3A6BH 1YN7A 3DGGB 4MDIB 2AJVL 2M26A 5CUSH 3QAZB 1FYTA 1IGMH 1IFHL 1FRGH 1QQDA 3CVHH 4NQDA 1P5VA 1MQKH 1T83A 2VDNH 4ZYKB 3FQWA 4I4WB 4RFOH 3D0LA 1P4IL 4QWWC 4P2OC 1SM3H 2F5AH 2BNRD 4N8VA 5AD0B 3WFCH 5DUBB 1NLDH 3LQZA 4FQJL 1JPTH 4OZFA 4YXHL 4O9HH 5DD1L 4M5ZL 5D5MA 1UWXK 4AEIL 3T1WA 3T2PA 4ELMA 3FO9A 3SBWA 1MCHA 1G0YR 3OJVC 4JQVA 4G7VH 4KK6D 2ZG1A 1VPOH 2AJ3B 1K6QH 2O5ZH 5I76A 3U6RA 2A73A 2QKIA 3O9WB 4OZIA 1YMMD 3S4SA 4HT1L 5D71H 1HINL 3FB7A 5A2IH 4QHNA 3RNQA 1U8JB 43CAA 2VLLA 2FATL 2XA8L 1ACYL 1H5BB 2C1OA 4H8WH 4KK9C 2P44B 4JFQA 1F8TL 3OKNB 3P0YH 5E8OA 4ZUVA 1D5BB 1EA9C 3CPLA 2NXZD 2DQGH 5HYJB 2W60A 3ARPA 4PGEA 3R06B 1IGIL 4NN6C 1JV5A 1OLZA 1T5XB 4EUPA 1S7XA 2FECI 1KJMA 3EYVB 1FSKC 2R4SH 3WJLA 1F45A 5JPNB 4LCYB 4MA8H 1DBAH 4MCYB 5CBEB 3IKKA 3O2VH 4NZTH 1UWGL 5BV7L 3F8UB 4EDWH 5I1DB 4ISVA 4ODVH 4GW4A 4WW2B 1UB5A 1E6JH 1KCVL 4JO4L 4OLZH 2Y1VA 4TNWK 1D5XB 1SJXA 4PBXA 1U58A 4HIXH 4JHWH 3NMEA 4P2QA 4JEGB 1A9BB 1I9JH 2NLJA 4Z0BL 1P4BH 4RGND 2QBWA 5DJ8A 2GSIB 3U0PB 3MYJB 4WFFD 4WHCA 3CH1A 2WIIA 4PG2C 3TA3B 3VD4A 4FQPA 5F88B 5CEZE 3VCLB 3P9LB 1ZHLB 1MHEA 5HI4C 4KI5C 3WDIA 3LS4H 5DYOB 2I9TA 4CNIB 5IMOA 4GRWE 2PYED 2Y07H 3P4OA 2NW3B 1CICA 1WSST 4JGJA 1KJ3L 1YEDA 3GZKA 5EOTA 3RHWF 3TYGL 1IT9H 4C54A 4UU9A 2R8SL 1I7TB 5DVLA 2DBLH 1I8LC 2YPKB 4K3HA 4HLZG 3ZSTA 1HH6A 1RZ7L 4P3WA 1LEKA 2ORBH 3D2UB 5F89B 1NLBL 4CDGC 3DHMA 5A16A 4OLXL 1PSKL 4RGMC 3W82A 4NWTL 4N0RA 3MJGX 2X4NB 3NN8A 3LV3B 4HDIB 3V5DA 4KV5F 4K7FA 3MNWB 1T5WB 4FMFA 2VITB 3UYPA 4R3SA 3P30L 3TBWA 5C3TA 2HRPL 4XNZC 5INCA 3GIVB 3RWHA 1PQZB 1C08A 4HPYL 1NDGA 3VXSA 3T2OA 4S1RH 4MXVE 2YPLD 1EO8H 3TO2B 2WBWB 4PS4L 2G75A 3V0AC 3F5WB 1EEQA 4P59H 2F74B 3DUUA 2A2QT 5GRVL 1WZ1L 5DWUH 3FRUA 4TNVF 3ISWA 1B2WH 3I50H 4PJ9A 2LU7A 3PHQB 4N68A 3QXDA 4OLVH 4P9HH 3RWJB 2Q20A 5GGRB 5BVJB 2PXYC 2GJJA 5CD5D 3PNWA 4G6KH 3L3KB 3MLRH 3RBSA 3RAJH 1LO2L 2FNBA 5DFWH 5GHWH 4WEBH 4Q9CA 1ZT7A 3PUCA 2H1PH 2MTPA 3MLXL 3QQ4A 3RKPA 5JIPA 3SGEI 2GAZB 3L3DA 4P3DB 2D7MA 3GKZA 3MRRA 2CDEB 1WVZA 3RL1B 1ZGLA 5L2KB 1L0YA 1DP0A 3VD3A 1MIEH 5F1OB 1A4KB 2CJUL 1HXMA 2P42B 4G6MH 43C9A 3QR2A 5C07A 1QLEH 3SKOA 1YJDC 3FQNA 1MHHB 1MRCH 4EN3D 1AGCA 5TFSH 4NDMA 3LD8B 4ZFOB 5F1KC 2CPCA 1JVKA 4ODTL 1CFTB 2KZ1B 2OZ4H 1SYSA 4DN3L 3MRQA 3RZCB 5KAQG 4FFWD 4WEUD 1I1AD 1UCBL 4UOW0 2AW2A 4L4TB 3OKDA 5JNYA 4U2ZA 1U8OB 5JIKA 1M1SA 3HMWH 2AJXL 2GJZB 4YHZL 4QRQB 1U42A 5FO8A 2VXSH 3GMLB 2JK5A 3VMOA 4GUPA 2E7CA 3SGKC 2YD3A 5ITFA 5ACZA 3CK0L 2ADJB 2DWEB 3EO0A 4L3AA 4Q58C 3R8QA 5HGBA 2XZQH 1DZBA 1IGTA 1S3KH 3ARGD 3V6OC 3HMXA 1NCUA 2P5WE 1CDJA 3GRWH 4PREB 3GSQB 3WFZA 4QRUA 3V0WL 1I4FA 4HCRH 4AL8H 5E6IB 4HXBH 4LVNB 1T0MA 1IRAY 4CU6A 1JZ4A 1MI5E 3GMMB 4TULH 1KPRB 2YD9A 3DECA 3SDAC 2DD8H 3IFOB 3FN9A 4IOIB 4YO0A 1U8NA 2X4OA 1GGCH 4PB9H 1NL0L 1XF2A 1J1XH 5IK3B 3TN0B 1R5IB 4OZHA 1QBMH 1IM3A 1IC1A 2BCKA 5GJSL 3O6FA 4X5WA 5DURB 2HAZA 4KK8D 3VG0H 4TNWF 3P77A 4ZOEA 4I18C 5LVEA 2ZKHL 3Q6GL 3VXTA 1PX4A 1XH3B 3NABH 3H3PL 3MRFA 4C56B 1F90H 2OYPA 4BFIA 4XAKD 2OK0H 4ACPA 3EO1A 5H94A 3V4UH 2NW2B 3PV6A 5EO9A 1QFWL 3OKEA 4K7PH 3SOBH 3V4VH 4LP4A 4Z7OE 4NFBA 1IM9D 5HPMB 4QHKJ 5LGHH 5DEFA 3RX7A 5I8KL 5E2TL 5IQ7H 4LHUG 2GFBB 2VAAA 3WYRA 3IJYA 1TVBB 5I30L 1FFRA 3UPAA 4I8DA 1A0QL 2X7LA 2WBJD 3QCUL 5DMKB 1YECH 2D0GA 3EYSL 1D9KB 3KHQA 1W0VB 2E6PA 3MLTA 4KHTH 3O11A 5D7LA 1RFDL 4WI8A 5HVFB 3E8UL 4G8FA 35C8L 5I15L 1U8IA 2XN9D 2VWEC 2A38A 1N59A 4HUXB 4RGNC 3FFCB 2GUOA 5I19L 1AQKL 1OLLA 4LQFL 3RRQA 1VGKB 2IG2L 2HMIC 2WLZA 4PUBH 1JCKA 1BQHG 3ARRA 5T3ZD 2P5WA 1E4KA 3LKNA 3S98A 5LXGL 2Q8BH 4YDLC 1AR2A 1JPSL 3IVKB 3P4MA 3DGCR 2V7NA 4ZXBC 1RY7B 4UNVA 1MI5A 4XRCB 1F02I 2OMBA 2VLKA 4GLRH 1AO7D 1BWMA 3GI8H 5DJDB 5JOPE 1FBIH 1U8MB 1CGXA 1KB5B 3KYOB 1G6RH 4PLNC 1I1CA 3GMPA 5ICYA 3PWPD 3D18A 1H3GA 2DQDL 1FNSH 4DK3A 3OR6A 4UTAL 3GSUA 4PTUB 1DR9A 4QHUB 3VGAC 5DMJB 5MEPB 4JM2A 4NFDA 3ARFC 5DD5L 4M9OA 3RTQD 3ES6B 4LLMB 4YE4H 5E2JA 4XMLH 4NQUA 3HAEG 1U95B 4WFGD 5SWSD 5I17B 1PKOA 5DJZB 3IDUA 3ZDZE 1SJEB 1BQLH 3OSKA 1SYVA 1OD9A 4ZPTB 4DTGL 5I1KL 4C57C 3NFPB 3DV6B 2PW1A 4RWHA 4XXDB 1WIPA 5FYKE 4TRPL 2BMKA 3TESA 3OKMA 1LGVA 2HJFA 1TJIL 1EVUA 2JJSA 2BDNL 1FDLH 4LL9A 5CD5C 3KR3L 3OKOB 3QPXH 4PRBA 4E5XB 4MQTB 4Z7WA 1BQUA 4D0DA 4OBRA 1PYWB 1AE6H 1JGLL 3AS0A 4YEFA 3C5SA 4WO4B 2VDRL 4ZQKB 3R0MA 4XPFL 2ZOKA 1YEKH 3MLZH 2FD6H 1RK0B 3G08A 2MJWA 3QP3A 1A9EB 4OF6A 3I85A 2NX5E 1S7SB 4L1DA 4XP4H 4EN3C 4OF0A 2QSCH 4L3CA 3KPRD 1NFDA 1SJHB 3WLBB 4OCYL 3N9GL 4GSDH 1NDMB 3FN0H 2VLMD 3KPNA 3WFHB 2Y06L 1AKJD 4A6YB 1KJ2L 1Q1JH 4FFWC 4ODXB 5FK9A 1NBYA 2DICA 2YC1B 1I1AC 2CIIB 4H0IA 3MXWH 3EYFA 2HKFH 3RWCA 1WAAF 3HNTL 3Q1SH 1YEFH 2PCPB 4KZDH 3QWOB 2A77H 3QT2A 2GITA 4G6JH 4L9LB 4DKFH 3X11B 3MJ7A 5CINH 3P40A 1M71A 4U6YA 1FPTH 4X99A 3H2WA 1KTKE 3CFJA 2CMRL 3DROA 4OZGA 1CVSC 1WCQA 2NY3B 4MXWL 4PY8J 5KAQF 5LGJB 5LGKA 1QVOB 3WMSA 1HIML 3ARGC 4EI6A 3U9UA 2IBZY 3FT3B 5FF6A 2GJ6D 2OP4L 2YSSA 4RFNC 2A1WH 1P7HL 1MJUH 4YAQA 1G7PA 4GKOA 3C08L 3WXWL 4H5SB 4P23A 2GK0B 1X44A 1IL1A 1ZSDA 5D7KE 1E6OH 4JZOA 4N8VG 3H9HA 1MFBL 2DLTA 3MBED 1FGVL 5C0IA 4ZS7H 4JRXE 2ZUVA 1EO7A 2GCYA 4HFUH 4HK3J 3WFEH 1RK1B 5JLZA 4QXUL 4XGZB 2FECL 1DSFL 4X98B 1JZ6A 5I2IB 3U36B 3MFFB 1CXIA 4YHOL 5IB1B 3PGFH 5J1TC 3VFWA 4R8WL 4LCWD 4CVXB 4R2GD 2R2EB 4JY4A 2CSPA 3FONA 4NNYB 1CL7H 1KPVA 2CXKA 3IDYB 1K8DA 3EHBD 5IEHB 1F4WL 5C08D 2NX5A 5ANME 4LSSL 2FL5B 3TZVD 3UPRA 1LO0L 4OKDA 3KPSD 4JRYE 4LLQB 4J2XA 1GJIA 3B8YA 4L3EA 3OAYH 5DSCA 1BD2D 3O3UN 4JY5H 2WBJC 1FZKA 3X12A 3MJ9L 5C0EA 3IFLH 4PR5A 5HGGS 3IXTB 4NZUH 4HQQH 5JTWA 3OXSB 1PZUB 3KPMB 4EI5D 2N1KA 4MX7A 4EUPG 1OARL 5T3ZH 4MYWB 1I3RA 2Q3ZA 1IAIL 2I07B 2ZPKL 1QHPA 4JRYB 5IB5B 4K94C 1T7VA 2IGFL 3JVGC 4WJ5B 3GKWH 4XP1H 4DZBA 1BVKA 2UWEF 3MV8E 5JHDD 1EHLH 3K74B 1MNUL 3GSOA 3U1SH 2D31A 4F15C 3ARTA 1Q9KB 4FQXB 1DUZA 3FN3A 5EUOA 3U4BL 4KROB 1NGPL 3IYLW 1YUHB 4LQ1A 5L9DH 1G9EA 1QNZL 2HLAB 3ZYIA 4QOKA 2ICEB 2KBGA 4P4KD 2QEJA 3BGMB 5FUZH 2VLRA 2BNQD 2YKLL 2NY4B 3BKMH 4E42B 4AG4H 4YJZL 3FO2A 3BQUB 4V1DE 1VDGA 4CGTA 5EWIH 3QUYA 2C3VB 3OKLB 1DQDH 4JRXA 5DVKA 1TETL 5E6ZA 5C0RH 4H26B 5IFJA 3DLQR 3Q6FB 2J4WH 1Q0YH 4TVPE 2BSTB 1MCPH 1RZIB 5K59F 3PQYB 1QRND 1CD9B 3FQUB 1FN4B 4KHXH 1A4JA 2WZPD 4XCFH 1AI1L 4MMXC 3TO4D 1E27A 2K7PA 5HHNB 3QUXA 1DUYA 2DBJA 3GB7A 5DD3L 3X3FH 4LCCA 3RTQC 1X4ZA 1PJ9A 2PO6C 4EDXB 5ANMA 2VXQH 4KUCD 1EEYB 4M7KH 1S9YB 1JYNA 2OR8A 2EDWA 5AZEH 4ZODA 2X05A 3QNXA 5MI0C 5CZKA 1OAYH 3MRHA 5AYUL 5F6HJ 4CU8A 4GKSA 4U1NB 3IFNL 4RISH 1CD1A 1IKFL 3HFML 3JV0A 4UOJA 1XF4A 2CDGA 5JXEC 5ENWA 3VGHA 1FVDA 1BLNA 2JCCE 3KVQA 5T5FL 1EFQA 1OPGH 4MD5A 3PL6A 4YHNB 2C26A 3MODH 5E2VL 3IAQA 1RJLB 3KPTA 4MZ2A 4X4XA 3V6FB 3L7EA 4M7LT 2H3NA 3ZKND 4I77L 3MNZA 3WLWD 4OLYL 2R0ZL 3VJ6A 1GGYA 5DRXA 4E41D 3D25B 4PRPB 2YPVL 4AEHH 2VDPL 3JWOH 4IDLA 2W9LA 3CDCA 2FX9H 2XWBB 4V1DA 3O2WL 1W72L 4GBXA 1NFIB 5CP7B 1XIWB 2UWEB 3BGFC 4WTZG 2QADC 3VWKA 1NGXB 3K1KC 2X4UB 1M7DB 4UDTA 1KTLB 4XC3H 4XPHH 4NO3B 3LRSA 3KYAA 2IBBA 1CLYH 2X4SA 3KXFA 2VMFA 2IBZX 3DTXB 4WWKB 3LS5L 4BH8A 5JPMA 2ITCB 1Q94B 3ZDXE 1OGTB 1REIA 5C0CE 1TQCC 4JN1H 4C83A 4JZJA 1IKNA 2ZNXA 3QIBC 5D1QC 4FQLL 1UJ3A 4ZTOL 5HHMB 4JZNA 2D7TH 3QDJB 4X7SL 4MA3A 5DT1H 4YX2L 3RVUD 3WD5L 5KZCD 2VLJE 5CP3H 3ARED 3WFBL 1LDSA 1CDBA 3KPOB 3HPJA 3UTPD 1PLGL 5E8NA 4EVNA 1KT2A 4Z7UF 4OAWB 1GZPA 5T1LB 1AC0A 5C0CB 5ALBL 2B1HH 1BQHB 2Y5EA 3UYRH 2X70B 1IC7H 2LTQC 1ND0A 3QDMA 3MFGB 5ICZB 2RQ8A 2VLJB 4IS6B 4GO6B 3MOBH 4YHYB 3CSPA 1T21B 4AT6B 4BKLA 1XF5A 3P9WB 4JY6A 3CLEH 4IRJB 5TQ0H 3MBEC 3D39B 5SX4H 1F11A 5C8JB 5L2JB 2XTLA 1H3XA 1TCRA 4P46A 4H20H 2WUBH 3ROOA 3G5YB 3VXMA 3TLRA 3H0TB 1J0JA 3RVWD 2UUDK 3S5LA 4LSPL 3ZE2E 1UG9A 5IT2H 4LVOB 1H8NA 1BJ1J 4Y2DB 3B9AA 4X80H 5I9QB 4PP2B 3I02A 2VAJA 4XP5L 3V8CA 1KJ2A 5DJ2B 2YRPA 4ZAKB 3RL2B 3O3AB 3ZTJG 1YEIH 4U33A 1U3JA 4WRLA 4OM0L 15C8L 1J5OH 1JPGA 4U1SB 2CIKA 4WW1A 1BAFL 5DK2A 5BS0E 1UEYA 4P5KA 4U1HA 4WUKL 4NQCD 2QHRL 4HHAA 3ALWA 5B22A 4ELMF 1TVHB 4X0KB 4L8BB 2FB4L 4JHAL 5C9JA 1UENA 1CD0A 4JDZA 3KJ6L 4BZ1H 3IAGC 2FWOA 4EI5C 2F54D 4M7ZB 4OZIF 4GQ9L 3NTCH 1LEGA 3NOIA 5D1XD 1EEZB 4AZ8A 5M7QA 3NFSL 1T1WB 4LBEB 1NCTA 4RMUA 3OV6A 1AHWB 1IQWL 4RCAA 3THMH 4MJIE 1IJ9A 3JV6A 2F8XC 4HULB 3TBSA 4F7CB 3SDYH 32C2B 4IMLB 3BVNA 5DD0H 4ZDHA 1DBKL 1T7YA 3ARDD 3L3IB 1QR1B 4PJBE 3ARYA 4I3RL 5FYJU 1U92A 3T0DA 3OGCB 1ZLWH 4Y4HC 1LK2B 1JFQL 2VNCA 5M95B 1FVEA 2DQHH 4QYOB 4X83A 5FYKU 3SCMB 5F7NC 4P4KC 3RPKA 1FO0B 5FKAA 3V2AR 3QH3B 3AAZA 4WGVB 3H42H 1ZVHA 4GKNA 2ADGB 4I0PD 3EO9L 1NCAH 4ZPVA 4Y1AD 1KCSL 1N26A 4PRIB 1P7QA 5DJ0B 2Q8AL 3WUWG 4LLYB 3PIQA 3RGVD 4LCUA 1EV2E 5HHOE 4Q6IB 2FX8H 4Z7UB 3RWIA 2XA3A 2P47B 3MUY1 4AK1A 4F9PC 2MQ3A 3B83A 5CMAB 1FORH 2MCPH 1GZQB 4P9ML 5TE4H 5C0FA 3V95A 2XPGA 1JNHA 1A02N 4N0FB 3K1DA 3MJ9A 2W0PA 2YXFA 4D8PB 5C0AE 3BIKA 1U8KB 3M1BB 4XBPA 3O3EB 4AEEA 5I66A 3TPUA 2EDRA 4OZ4B 3QYCA 8FABB 3VDCA 3LPWA 5DS8B 5BS0A 4FFYL 4HS3A 1OQOA 2NTFA 1CIUA 1DLHA 4MS8D 4FTVA 1MEXH 1ZGLM 2MCG1 4J3WA 3UTTB 4DKEL 1LO4H 2ADIB 1D5ZB 3E2HB 5HJ3A 3T0EE 1YN7B 4J12A 4YBHA 4PGBB 1A2YB 2APTA 3BXNA 4JPKL 1KJVB 3VXOA 2DL9A 2XY2A 3SDDA 5IM7A 5FDWB 5I0ZA 4HIEA 5ESAA 1CK0H 3UJTL 3NPSC 4MB4A 1RHFA 4HS8H 4LSUL 2N7AA 4YDVB 3HNVH 3CX2A 1HWGB 4MJIA 5T1DL 4RAHA 4N8VB 4QNPE 5J3HD 3HNSH 2VISA 1F6AA 2ZUQB 3ELAT 2MFNA 3LQZB 1ZANH 2APVA 5DD6B 3SGJC 1QBLL 1YJDL 4WU7B 2P24A 1KEMH 4M5YL 3QIWB 5C2UB 4ELMB 2C3WA 2B0SL 3FO9B 3QFJE 4KTEL 2IPKA 4Z5RA 3ZYZA 3WLWC 3FOMA 5I76B 1UQSA 3H7BB 3A67L 2QKIB 4J8RA 2EXYD 4RAVB 5C2BH 2XWJA 3P9MA 4KAQL 4YPGA 3IGAB 3RNQB 1HI6B 1Q9OA 3RA7L 1DQML 4KY1L 1YNTA 1R24B 3QCTH 5T3XL 3ULUC 4JFQB 3QI9A 5E8OB 4Z7VE 5C0BE 3H9SE 4Y5YB 3SO3B 3ECBA 1OF2A 2AJYL 4IJ3B 3NFNB 5I71B 2HKHH 1MCSA 3R1GL 4JM4H 4O5LH 4EUPB 1S7XB 4JFEE 1KJMB 5C0AA 3LOWA 5E9DE 5CJXC 1P5UA 5D9SB 4HUUA 3FB5B 3MXVL 4OD1L 2XI9A 4M7LH 5CEXA 3AREC 4X7FC 5AG8A 1S7VA 3CSYA 5IWLA 3B9KA 4TUOB 3SDXA 1N6VA 3VRLF 1U58B 1EEUA 1T80A 1OGAD 4P2QB 1WCBA 2LE9A 4JFFD 5MHSE 4HGWA 3UJIH 2NLJB 5GRJH 4ODWA 4UV7H 5GGQH 4PGZA 4U0RC 2CR3A 3OAUH 4BQ8A 4A6YH 4JFZH 3CH1B 2SEBB 3MLVH 4DFIA 2OMNA 1EUTA 3U7WL 1QSEE 3AS2A 1G9NH 2CRYA 2A83A 1X4YA 5BVPH 3BDYL 5JUEL 1D3CA 3IDJB 1NC2A 3TVMD 1MREL 1U0QA 1MHEB 2YXMA 2I9TB 5IMOB 1WJ3A 2YA0A 4O02L 1W72A 4MAUH 1V7ML 3RVWC 3P4OB 3QWRA 2A9MH 1FLRL 1YEDB 3AUVA 5EU6A 4DVBA 1QSEB 2Z31B 2NY7L 2VC2H 4UU9B 1R3IL 3Q48A 1IGCL 2OR7A 3GM0A 5D7SH 3SQOL 3VXRA 2X4TA 3WO4B 2RB8A 3L3JA 1NUNB 1HH6B 1I7UA 2XTJB 1LEKB 3SE9L 4LHJB 1D6EA 2XRAL 3NIFF 2GT9A 2WQRA 4G6FB 4JHBA 4X9BA 5A16B 3VA6A 4XPGH 2YUXA 4LRIC 2L4OA 5D2LE 1XR9A 3MUGA 3I6KB 4K71B 4Z7VA 2FH8A 4K7FB 1R5VA 1M05A 3GHBH 2J5LB 3QEQE 5GSRA 3I2CL 2WWMC 4LPUA 3O3BA 1ED3A 3KDMA 2WM0A 1SEBB 1NAMA 4OZHF 2ENSA 2APXA 1MCLA 3IDGB 3S88L 2DRUA 5INCB 4JDTL 3VFPA 1C08B 4RNRB 5IBTL 3N85L 3VXSB 4YHPA 7CGTA 5ID1A 3OMZA 4BQBA 1U8LA 2OSLA 1SJVA 4LPXA 3DYOA 1KN2H 3U30C 4FXKB 3HE6D 4OCXH 5LCVH 2DM4A 3S3SA 1T1YA 4XVUD 1EK3A 3ARDC 2HWZL 4YQXL 4POYA 2FDBP 3ULVE 5KSUB 1VB9A 4NRXB 1UZ8B 4GKZB 1OCWH 5EBLA 2VO5A 2QQQA 4I9WE 3MV9D 3UXFA 3UC0L 4Y16D 1XGRB 1J18A 1CR9H 4GAGH 3TFKD 4HJGB 4HWZA 1FCGA 1NCCL 5E1AB 5E99L 4LGPB 4P99A 1CS6A 3T8XA 1LQSR 3BPCA 3PG2A 5BRZD 1F2XK 1K5NB 3GBLA 5F3BA 1M7IB 1L7IH 1ZS8A 4UINH 2GI7A 2GQHA 3D0VB 5A2FA 4HIIB 1NUGA 3IRPX 5IESH 3MLYL 1E4JA 5SWZD 1UJTA 1MWAL 4XCCL 4NYLA 1ZLVK 1A5FL 3NVQA 2RCSL 5C07B 1P6FA 1BGXH 3S34L 4LARL 1KG0A 4WI3A 3FQNB 4QXGL 4XAWL 5C6WH 5MEOB 3D3VE 4MNQD 1GRWA 4PJFF 5C7XL 3EZ8A 2HTKD 3DJ9A 3QNYA 4X6FA 2F19H 3HG1D 1SYSB 2LU3A 3MRQB 4XCNA 2P7TB 4DN4H 5D2LA 5EO0A 1Y18A 4KI1A 1L6XA 4MS8C 5J4MA 2HH0L 2XXMB 2NY1B 3PP3H 1KC5L 5DQDH 1IAOA 1YPZE 3BAEH 4D0BA 2C3GA 4P5MB 1IGYB 3EYUL 1CGVA 4Z0XB 1OAXH 5F96H 4NZRL 4Y7MA 2ADFL 4ORZC 5FO8B 1I8LA 4CN4A 5F97E 5FOBA 3PE9A 1EVTC 2VL4A 1BM3L 4U6VH 4QRRD 3ZKXB 3RWEA 1I8KB 1E4WL 3NIDF 3QEGH 4TQEL 4X8XA 1A22B 4JFYA 5D6CA 5C09E 1F3DJ 2ESVA 2OJZL 4OBSA 5D93B 4HS6A 1JI2A 2Z93A 1C7TA 1L7TH 3UBXA 4KUZL 5ILTL 5IB4B 4LU5H 1JTTA 3DMMB 1I3VA 1I4FB 4JM2F 3T04D 5DUMH 4YHLL 4DEPC 4J3OC 3BWUC 4TYUA 4IRSB 5TQ2H 4YNYA 4IRZL 5T3XE 3BP5B 2NR6C 3EFFA 4HW6A 3CIQA 1U8NB 3QISA 4PRHE 1A3LL 1XF2B 2IAND 3MLSH 2DQEH 2EXYC 4KMTH 5IFHL 4QXWA 1MJJB 1A1MA 4JGMA 2DYPA 3V6OE 4PY7A 4YHIA 4UDUB 3OHXA 2AXGA 2H45A 3P77B 3TT1H 1V3JA 3VXTB 4YGVA 5KJRL 4JFXA 4MA7L 4BFIB 5B8CC 1NCDL 4PRHB 5KSVB 1TZIA 3EO1B 5J12C 1ZTXH 1WBXA 2H2SC 4TSCL 2PW2A 5KN5B 3VXUB 2CKBL 1FYTD 4XMKH 3OKEB 2PXYA 1JRHI 4NQDD 4X6EB 5IGXL 4U1KA 5HHXH 2OL3A 4FZEH 5FA3A 4PJEB 4PY8I 1J8HD 4Z7WF 4Z18A 3BGAA 2F58L 5KANG 2VAAB 1QFUL 3IJYB 4DK6A 4HFWA 1YNKL 3IU4L 1Q9WB 1SY6L 1JGUH 4KKCD 4NM4H 4OUUA 1KLGA 1Y6KR 1A6WL 1WF5A 1HNFA 2JJVA 1BJ1H 1K3ZA 5ISZE 2B5IB 1A3RH 4G8FB 3T4YA 2OQJA 2FJHB 3IS0X 4OGYH 2NY6B 4KRMB 1BZ9B 1H3WM 2AK4E 3VD5A 3C6LD 5D1ZB 4Q9QL 5DEZA 1G7MA 4ZTPL 3DURB 4Z77A 3B2UD 1NFDF 3NACL 3BH8A 3QUKA 4PJXE 3QIUC 5MERB 1HHKB 3JWDC 3REWA 5GISL 5ISZB 4MCZA 2B4CC 1NC4D 3V5KA 4PJFB 4P57A 4YLQT 4FOMA 5A43C 3LKRB 4X7DC 5EZIL 3NCFB 5GGTL 4KVNH 3WUWB 1HQRB 4UTBL 3RUGE 3FKUS 5JQ6H 1CE1L 1ZT1A 2VWEE 4K23L 3DX7A 2VLKB 3BO8B 1UCTA 3SGKA 5E1HB 2EDLA 2OTPA 3JV4B 2H26A 4OZGF 2C7UA 3PHSA 1UB6A 5FIEA 3SE8L 3D9AH 2BNRA 1FL3A 2P5EE 4WEMB 5ICYB 2DQIL 3D18B 3S5LG 2AKRB 1ZHBB 1TZHB 2GY7B 1DANU 3OR6B 4K94L 3NCYS 5F1NB 5CD3A 1ZA6B 1AFVL 1J1OH 2DWDA 2X41A 3LMJL 5C0ND 4Q9RL 3TJEL 3Q3GA 2BVOA 4J6RL 4Z78A 3WE6B 2BSSA 4RMWA 4APQD 2R1YB 3VFRB 4S1DD 1E4XH 1UXSA 3UEZA 1QFWM 3WNMA 1Q0XH 1IZKA 1J11A 4GFTB 1YMMA 3OPZH 2YA2A 3QEUA 5DVMA 2NY5H 4YXLL 3AB0C 4ONGH 4S2SB 5KVFH 1FLTX 4I18A 5FM5M 1SYVB 1FYHB 3RIFF 2XQBL 3P0VH 3SKUD 4KGJA 3VFGH 4JQIL 3HE6C 3O9WD 4OLWH 5D7IA 2PW1B 4XVUC 1IZJA 3STZA 4PBWD 2XZAH 4QHLA 2ZNWA 4M61A 3HAEH 2AK4A 2BVQA 4H1LA 5JXAL 4ZFGL 2F8VA 4U1LA 1UZ6E 2M2DA 4PYGA 4Y16C 1UH2A 3MRLA 4M6OH 4HX1A 1MPAH 3EUUA 1A47A 3ILQD 4BK5A 1CI5A 5IJVA 1MCNA 2DM2A 1ADQH 1YC8A 2ED8A 4WHDA 1WBZA 4U6HA 3FFDB 1E28A 4IIQC 1UA6L 3SE3C 3QUZD 4N8PA 4FZ8H 2H32A 1GHFH 2ZUXA 1OAZH 1T7XA 2EEDA 1YEEL 4HJJH 2F9BT 3V79C 2O26U 3DXAE 4XPAH 1WIOA 5E03A 2EZ0D 4HV8B 1FZJA 3GJFH 5EUOF 5HDOA 4LASH 4XHJD 3MCKA 4Q97A 1CF8H 5GRYA 2HTKC 5JHLL 1FO0H 1HQ4A 3DX6B 5DJXB 4F80A 3KPNB 5DJ6A 1NBYB 2PYEA 2BNUB 3QHZH 3QZWA 2VUYA 3SDCD 4F7EA 1N7MH 5BO1H 4G3YL 4XC1H 4L1HA 1AXIB 5E2WL 3S37X 4OCMC 1HHIB 1VKXA 2D3VA 2UVEA 2BOBA 4HKXA 1ZK9A 1IEHA 4IOSD 1MFCL 3GK8H 1I9IL 3VI3E 4X99B 5GRWA 3HZKA 4ONFH 3L3HB 1NGQH 2EH8H 4JANB 4OZGB 3VH8A 4FHBD 4Z8FH 5CEZD 4ODHH 2KDGA 3B5TA 1S7QA 1YYLL 2GTZA 1ZLSL 5H2BA 4JVWA 3L1OL 3VXPA 3ARFA 4YAQB 5LBSL 3CNKA 1ZVSA 4V2BA 2QQKL 1IL1B 5DVNA 4GS7B 2Z8SA 5JW4N 1BF2A 1URLA 2Y5TB 2AI0H 3CXHK 5FCSH 1MWAA 4YHKH 2ZJSH 2GCYB 2YPLA 4K8RH 5EB9A 5KW9L 3BPNC 3EDFA 4QF1B 5D6DA 2D9CA 5BZWB 1BIIA 4OCRL 1OP3K 4BSVB 1GCFA 1F3RB 5E95B 4G9DA 4N0CD 5IROC 5IBUG 3RVVD 3ARQA 4O2EB 2OR9L 4MQ7B 1X5GA 1UXWB 3O6KH 4F37K 1KPVB 1FH5L 2FX7H 4OQTL 4OZFH 3EYOA 1K8DB 2JF1A 2R4RH 1A14L 3O45B 2IADA 3O3DA 5FGRA 1XF3B 1KIQA 5FO7A 5L0QB 3UPRB 4FQIH 2WBKA 2MNUA 5DLML 4F58H 5ERWA 3PP4L 5FXCH 5D72H 1CLCA 4QTIL 2YWZA 4F2MB 1FZKB 1X5AA 5C0EB 4MDJB 4KKCC 4PR5B 3HPLA 1F3JA 4H88H 5CHNA 3AMKA 4Y19B 4KQ4L 3WKMH 4KJQD 5KS9A 3MNVA 3FB6B 4LVHB 1MIML 4PV8B 2XXCB 4KTDH 1LP9A 4YC2C 1Z9MA 3C6LC 3GMNA 4WDIB 4KGLA 3IXAA 2IALB 3PGCB 1BVKB 3CMOL 4K9EH 4YBQD 4EN3A 2AK1L 3B2UC 2DI9A 1YY9D 3GSOB 5I1AB 1JWSA 2HLFD