3SDCD

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
239
structure length
239
Chain Sequence
GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSGKGLRLIYYSYGAGSTEKGDLSEGYDASREKKSSFSLTVTSAQKNEMAVFLCASGSLLDVREVFFGKGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcD02
1FC2D 2EO9A 5F3HA 4POYA 4HX1A 3FONB 2XZQL 2NY6C 5SX4I 5HGDA 2AXJA 4G80A 3V4PL 3LKRA 3PWVB 2R2EA 3QI9D 3EYSL 1EVUA 1BBDL 3G5VB 1KJ2H 5HYJD 4QF1B 2DQFA 2OR7A 4ERSH 4JANA 2ED9A 2ITCA 3ES6B 4JLRB 3QFJB 1UH4A 4N90D 3JSSA 3O3DB 2AEQH 2X1OA 5DQJA 2X40A 2ERJB 3DLQR 4KJWD 4U3CA 4F2MA 3CFCH 1HINL 1YZZA 3C8KB 1GRWA 3HC4L 4M6AA 4Z7VA 1PLGL 5GJTL 1RQ5A 3QXUA 1DZBA 4KKAC 3KR3L 4LEOA 5CJBA 4D0CB 3GMRB 5E56A 1IM9D 1VESA 2OM5A 3OAYK 1BP3B 2X4TB 1UGNA 4JFZL 4V2BA 4DOHE 1IGYA 3B2UC 1GXEA 3H9SE 1YYML 1A6AB 2C3GA 3ARDA 5DJAA 2B39A 2F5AH 3K74B 1QQDA 4DGVL 2JELL 4X80L 5EC2B 2V5MA 2FX7L 2AABL 4ETQB 5HI3C 3F12B 5GZOD 1UM6H 4MNQA 4CNIB 5CJOH 1ACYL 4OQTL 3ARGB 3HLAB 2EEDA 4L29A 1M05B 4YR6A 2XG4A 4R0LB 4POUB 4BM7A 4KFZC 5E4EB 3C09C 3U30B 3HE7C 5HDLA 5KSBB 5CEYB 3V8CA 1JE6A 4C4KT 1JWSB 4ONHB 4YEEA 1T1WA 1XGRB 2H9GA 3FRUB 1UWEH 3VFPA 4N8VB 3HZMB 3MRKA 2DLTA 2LU3A 3UPCA 3DX7B 3MCLH 3BO8B 4QCIB 1GGUA 3MUHL 4L8SB 4TRPH 2EH7H 4Z95H 1NMBH 1X5GA 2NY3B 2HFEB 2LQRA 4I18C 3W82A 4S2SB 3V52H 3VFRB 3OAUH 5F1NB 5D2LB 5L7XH 1J86A 4OAWB 4FFYH 2QHRL 3SO3C 2FIKA 1E4WL 1PKQE 5AUMA 4WJ5A 1EZVY 3D69A 5F6IC 3T3PE 2EE9A 3MO1B 2UY7A 3IKCA 1PKOA 1JGDA 4Y4KD 5BQ7A 1GGCH 3GSUB 1C5DA 4ZFGL 4RWHA 1S9VB 43CAB 4M93C 1X5AA 3UTSA 2FWOB 4NM8L 3RVWD 3AU1B 5J9PA 3NFSL 3IFOA 4HWBA 1W0YT 1NCNA 3LKSA 5JW5B 4CN4A 4PJFA 4P2RB 3CH8A 3BP4A 4F58L 4P2QB 1TZIA 4HKXA 1RUKH 1CG9A 2G60H 4R6UA 2A9MH 2YUXA 1EFQA 4NN5B 2MQ0A 1BHGA 3CH1A 4K7FB 4JG0L 2R69H 4G8IA 4X9BA 4WUKH 1AC6A 4L4JA 2PYEA 4HULB 1HI6A 4OUUB 2FHCA 2AKRA 1ZGLP 3BEVB 5FYKE 5CGTA 5JIIA 2GJ6E 4M43L 4MA3B 5ID1B 4G6JL 2XA3A 3DOSA 1FQ9C 3TNNA 1AXTL 1JK8A 3BHBB 4DN3H 3L3IB 4J1UA 3AVEA 1A6ZB 2VZ3A 5J3HC 3VFGH 4PD4K 3VWKB 5CFHA 1TQBC 4QHUB 1GOHA 4CJ0A 2Z35B 2H32B 3LKPB 5EWIL 1QG3A 1IEBA 4DKEL 1CS6A 3LN5B 4WO4D 1ZSDA 3LY6A 1U91B 1YMMA 5FYJE 4X5WB 2XQBH 4ZNEA 5EPMA 2YEZB 4DOHB 3PWPE 3CXDH 1A7PL 3V5HB 3H9SB 2HRPH 5EO9B 3PGFH 1X44A 5L6YH 1LEIB 3O3AB 2R0WL 2NY4C 4PJAE 4Y5XC 5A2FA 3INUH 5TF1H 4HK3N 3P9MA 4QRUA 5JA9A 1NCDH 1H9VA 1CFQA 2JIXB 1YQ2A 1JL8A 3O45A 5JPNB 4X4YB 3ILQD 5T3XH 2WUCH 4PYHA 1I1AC 1TVHB 3RI5K 2AQ3A 2FZ3A 3KNBA 5BZDB 1C08B 3VDAA 4MQTB 4XZUA 1HDMB 2VR5A 1OGAD 4HMDA 4ZQKB 5GGVL 3RZCB 1CLCA 3RVTD 4AEFA 5F7YC 4PJ9D 3MXVL 4HUXA 2XY1A 1KB5H 5CIPA 1MY5A 2BOCB 1KTDB 4OZFA 4C83A 4AEIL 4MZ2A 4JKPL 2MCPL 1B90A 4XNUH 4XWOD 4NC0B 4OJFL 1G7QB 2J4WL 2VZTA 3LEYL 1EV2E 4U6HA 1X5JA 1TJHH 5C1MB 3C6SA 2VNCA 4U1HA 1PKQB 4RMRA 5F7WC 1S3KH 5EORH 3B6SB 1J0IA 2CRYA 5EIVA 1A4KB 3NCJL 5EZLA 1R5WA 1OQOA 5BJTA 4F7EB 1VFBB 4GMTL 1OAKH 3TYFB 1INDL 2X1PA 5EUOB 3ECBA 1UZ6E 5ILTL 4RFNB 3TA3B 2OL3L 3UC0H 2XZAH 1CR9L 6CGTA 4JPKH 3QIWC 4Y4FC 2X42A 3PG2A 4ZAKD 3QCVL 1GHFL 4OLYH 1ZLSL 4I0PA 4KI5C 3BKYH 2VABA 2YKLH 4JO2L 2HFFA 3IDMA 3K46A 2VAJA 3CAFA 4Z7WE 5IB4A 2VC2H 5JW4R 4JRWA 3QPQD 1YEJL 4G6KH 1GC1H 2XTJD 4IOIA 4M48H 4M7LL 2PXYC 4H88H 4KC3B 3ZE2E 2VUOA 2B4CL 5D7IE 1FPTH 1FCGA 4JFXB 3N85L 2H41A 5I1EH 4OZ4B 3MV9A 5EZOL 3MLXH 4I5BA 4PTTB 2WBWB 3MA9L 5KS9F 1UB6B 4QT5A 3UZVB 3W9DA 1XGPB 1AHWB 1KB9J 4PIRF 2BNQE 4YE4L 5GS1A 4QEGA 1JV5A 4MJ6A 5BCAA 3QDGA 4HEME 3WFDL 5HHOA 3LKNB 2IANE 1CTNA 2K3TA 3W81A 1P9MC 4LHUB 5DZNA 2VLLA 2WWMD 4GRLD 4Z7OF 3RQ3A 3JTSA 2M1KA 3PWPB 3QCTL 4NNXB 5JOEA 1OAXL 1U0QA 4NZUH 4TOYH 2G2RB 4KDTC 5GGSY 4RNRB 3QA3A 2VDNL 3MYJB 1YJDH 5F89A 3TPKA 4PJ5A 4ZFFB 5FIEA 1F5WA 1SM3L 1VGEL 3LQZB 1RZJH 3B5TA 4S1RH 3BPCB 3C5ZD 3QUYC 4GAJH 4MAYA 1LD9B 4K94H 2Q3AA 3QHZL 4BJLA 3BPNB 2IFFL 1FNGA 4BYHA 3VA2C 1B0RA 1PW3A 4NKDA 1MWAB 3MACL 4RSVA 1PZ5A 4BKLA 2NY1C 4M1DL 3EDJA 1WZ1L 2AI0L 2YC1A 4UV7L 4G7YL 2BDNL 2OYPA 4RWYL 3UBXG 3LDBC 3DUSB 3PABA 5DT1L 2IPUG 5C7XH 4Y2DC 1IM3B 3KPRD 4YGVA 4WHDA 3QCUL 4U7KA 1BM3H 2A74A 5DJYB 5EUKA 4OGXL 4ZO7A 1N26A 1OPGH 4UU9B 1Z0MA 3S98A 1N5YH 1A3LH 1Y6NR 3RPIA 3TZVC 3N0PB 2DMKA 4PBXA 4LGRB 1NEUA 2DBLH 4G6FB 1U8OA 4NQDA 3MTRA 4P4KA 1LO0H 3MPCA 4GRWB 3FO2B 3RJDA 3CC5B 1U58B 2EDHA 3NACL 5K33A 2R39A 1VFOA 4MNGE 2E27L 3OF6D 4JM4H 5KAQG 2BJMH 3IRPX 1VGKB 4KTEH 1TCRB 2WINA 2YD9A 5E1AA 3WFBH 1DDHA 1MIML 2P24A 1RJYB 2PO6D 2DTML 3LQAC 5J1AA 3T65A 3QEGH 3QIBA 4HIXL 3UYRL 4KZEL 1LK2B 3A6OA 3SKOB 43C9B 4YXLH 2VXQL 4Z7WB 5LJYH 5TE4H 3PWNA 4XP9H 1OARL 4A2LA 4WHYG 5HDQL 3BJ91 5CJ5A 3Q2CA 2YXFA 1A1NB 3DYOA 2EDFA 3RDTB 4APQD 2EDQA 5D5MB 5IROA 1UJTA 2ZSVA 5D2NE 5ID0B 2ZUTA 3RA7H 4DUXA 2NXZD 4Y2OA 3GBLA 3MA7B 2CDFB 2EYTA 3IS1X 2BNQB 1S9XB 3VGHA 5IEKB 2AK4A 1MIEH 2EO1A 4NRXB 4HLZG 4PJ8A 5HJ3B 3O9WD 3U83A 2AJUH 4PGBA 5DMIL 4HKZA 1QLEL 5LXGH 4RMQA 4NQED 4PP2B 1XGYL 3JV6B 3LZFL 4H26A 4EUPH 3GUTB 3ARDC 3MLPA 4F37F 4UILH 2B5IC 3BXNA 3S88H 4MJ4A 3V5DA 2OL3B 4F7MB 1NJ9A 1NMCC 4P5TB 2CRMA 2DWDA 5IT2H 3L6FB 4YHLL 4ACPA 2FH6A 2QSQA 1Q94A 3Q5YA 4FQCH 4OF3A 3S9DB 2X89D 3IDIB 5B4MD 4A6YA 1OTTC 2APBA 4W6XB 3UO1H 3OKKB 3D25A 4KV5E 2X1QA 4YHPA 2NYYC 1QSZA 5IBTL 2PYFB 1N7MH 1HHGB 1GGIL 4KMLB 2X4SB 4ONOA 1BIIA 1UA6L 1FFPB 4ZUSB 1HHJB 3VGAC 2IWGA 3I50H 4LDOB 5DUBA 4HXBH 4E9LA 3HC0A 3DV4B 1EX0A 5C07A 3QUXA 3RY5A 1B6DA 2LAGB 2NY7H 4YDVA 5AAWA 1OSPL 5C09A 5HPMB 3NIDE 1BGXL 5E00B 3CMGA 4HV8B 1U8IA 1IGTA 1REIA 1AXSB 2F53A 4EQ3A 2C3WA 1QO3B 2BRQA 5IMKB 1RIHH 4BH8B 1UG9A 4PJIF 5CSGA 3DXAD 5EFIA 1C16A 3VI3E 2WBKA 3SE3A 1RI8A 5L8KB 4WUUD 4OF7A 4WEUD 3WUZA 5MEND 4S0TD 3T77A 3KPNA 3MLWL 2JJWA 3U6RA 4ORZC 4M3JA 1YNTB 3I02A 4WFFD 4FZ8L 5LQBL 4N0FB 5D1QC 3I3DA 1UJ3A 4JREC 5GIRA 1EEQA 1EHLH 3D2UA 4Y19B 1F6AA 4MNGB 2OR9H 1G0YR 4OZIF 3GMNB 3RU8H 3ALXA 2QQLL 1G9EA 2FX9H 1G7HA 4V2CB 1T21A 1EEZA 3JUZA 3F8UB 3SDCC 5I76A 1AP2A 2G5BA 2X4RA 2IF7A 3FOMB 3VXUA 4WI5A 3IFNL 2W9DL 1KCSL 5DUML 4GAYB 4M4PA 3I6KA 2IH3B 3K8LA 2YD4A 4FN0A 1JTPA 4P4RB 3GSVB 4JFQB 3VD3A 3J7HA 2AEPL 2DQCL 3EYQC 1UWXH 1QA9B 5KN5A 1B0WA 1OM3H 2NNAB 1KELL 3PP4L 4Y5YA 2P5WD 1CVRA 4PUBL 2XWBB 3SGEH 4PG9B 1SYSB 5D2NB 5I1DB 5FECB 1EAJA 2CSPA 4IS6B 4OIIL 4IOFD 5IBLD 3MOBH 3ISWA 2VDQL 4WWID 4K2UL 1XCTA 5L2KA 2GJZB 5LAXB 1KEGL 3R8QA 2J5LC 1XIWB 3OTTA 3VFSA 2VB5A 1YECH 4Q7DA 4X7CC 4CW1A 1CICC 5HHQB 1NCTA 3U9PL 4JKLA 4MQXC 3QWOA 3VE0A 1Z3GL 4OI7A 3JWOH 2EH8L 2VE6A 2NMSA 4M61A 2RAMA 4HHAA 3MFGB 3J8F7 4Z7QE 4IHOA 2PR4H 1OAQH 4XCYB 5F8QC 3PP3K 4C56E 3IDUA 3OPZL 2YZ8A 3SGDI 3ROOB 5I71C 4MXWH 5IM7A 4AENA 1P4LA 2BCKA 3MREB 1RK0B 4P5KB 3CFBB 3SKNA 3CUPA 2Y6SC 3OKOB 2D9CA 5D7SH 1AO7B 4L1DA 2ORBL 4ZDHB 4KJYA 1XFPA 4XNZC 1QKZL 4I1NB 1I9EA 1ZMYA 4UT9L 1J0ZA 4PB9L 3S96B 4OZHF 1JPTL 3ZE1F 1CD1B 1M7IA 4GS7B 4UAOC 1UVQB 1S7UA 3LKOA 1ZHBB 4JFPA 1KIQA 3Q5OA 4YHIB 3UPRA 3HI1B 4U4BA 3SCMD 1R3IH 3BPLC 1F58H 2R4RH 4HQQL 1FL5B 4ZFZB 1J88A 1NGWB 4RIRB 1AD0A 5F9WB 2NZIA 1IVLA 3MZTA 4P46A 4EJ1C 4UDTB 1YPZB 3V6FA 2BRRH 1BX2A 1O7VA 1VADA 3QUMA 4R7NB 4QGYA 1MAJA 4XPHH 3CVHH 3LS5L 5CLWA 3VXPB 1DVFD 2FEDC 3IFLL 5EN2B 2BY1A 4FA8A 4TNVK 1RUML 1T20B 4JO4H 5DRWB 5EU4B 3KDMA 3M1BB 2CKBH 4OIBA 5GS2D 1ZK9A 1IT9H 2BK8A 2ZOLA 4R97C 4TSCL 5F88B 3OWEA 5IEHA 3EYOA 4P23C 3MJ9L 5JORB 3VFNA 4YHMH 1MFBH 5DD3H 1OAYL 4HEPG 1KJ2A 4I0PC 1F2QA 4JFEA 2YRLA 5JXAH 5D72L 2J12B 3RX7A 1Z2KA 3TN0B 1VACB 1HNGA 4PJ7E 4PR5A 1JF1A 3TIEA 5MEQB 5D7KD 5ESVB 3PWUA 4JZJC 2WM0A 2EZ0D 4KRPC 4YUEH 3RVUC 3SE8L 5EZJB 4ODHL 2R0ZL 3QFJD 5C0EB 1U3HB 1GAFL 2XNAB 1LDSA 3RTQB 2B2XH 3SPVB 2MJWA 4ZFOA 1IGCL 5DMKA 1NDMB 5F7MC 1JRHI 5GS1C 5GQBA 4WTZG 3RY4A 3LIZL 5KG9B 3MJ8B 2PW2A 1JGVL 4BQCA 5DSCA 1D5IL 3MBXL 3H7BA 1H8SA 3SDXE 4K8RC 4IMKA 4QOKE 4DVRH 4WV1A 5E2VH 3L5IA 1CK0H 1CDGA 4HF5H 4ENED 1BWMA 3PNWA 1FNHA 35C8L 4I2XE 2FR4A 3BVNA 4MDJB 1HXMA 5BMFH 1JGEB 1WBXA 1IGFL 1QPXA 1OAZH 3VFWA 4LLUA 5GSRB 4YIQB 3ARGD 1K6QL 3S36X 2FB4L 3VXQA 5E5MB 1U8MA 4GSDH 3CMOH 5FYKU 4NUJB 4J8RB 4MAYC 3C5JA 1FYTD 4XNMA 1ZVSB 1J8HB 1GIGH 4DQOH 2DQHL 1UH3A 3TJEL 2AJXH 4X6EB 4N9GA 2DKMA 3S6CA 4HS3A 2AQ2A 1BOGA 2KKQA 4LRIA 3BD3A 1TCMA 4PS4H 5HHMB 5I74B 3ZDXF 5CJQL 4QTIH 3UJTL 1R0AH 1HH9B 1HE7A 5KVDL 4AEHH 4PRHA 4U1LB 3GKWH 4PJGF 2ENYA 2J8OA 4FTVE 4K71B 1HOCA 5FYJU 4PPTA 2AXFB 4OLWH 3MNWA 1ZTXH 5HGBB 2ZCHH 1T80A 1JWUB 4UQ2A 1DR9A 2DQIL 1CF8L 1T66D 3NN8A 3DV6A 3Q3GB 4XHJD 2YUWA 5I15L 3H7LA 4MD4A 4L8BA 1QFPA 1HZHH 2QQNH 5F1IA 5KTEH 4XPFH 3BZFA 2A38A 3FTGA 3ULUD 3ARFA 4HPYH 5ABDE 3EOBA 4R8WH 3X12A 3BIAX 4P2RD 5HHPA 1IL1A 1AKJD 3CDCA 3KHOA 4L4VE 5HXMA 1SYVB 4P2QD 2JCCA 4UIMB 3BQUB 5CHNB 2O5ZH 2AGJL 4MWFB 4Z5RA 2F54A 1CL7I 3TBSA 1UYWL 4IRZH 5DJ2A 1U8LA 1GZQB 1N64L 1RJLA 5EIQA 3KS0H 5FCUH 2VLRB 3ULVC 3DO3A 3BH9B 2UVFA 3S35X 1AGFA 4DGYL 2BX5A 4O2CA 3I6LE 1A3RH 2HG5A 3B9DA 3GMMA 4FXGB 1A7RL 2LV4A 1Q0YH 4NRYA 1MCNA 3RWIA 5IFAH 4KVCL 3MJGX 1LQSR 4NUGL 1YA5A 3DVNA 3CDGA 1JTTA 3RJQB 5E6YA 2R0LH 5CS7A 5DQDL 2D7PA 4TUKH 5A3ID 2AJYL 3KPOA 2ARJA 3PXJA 3MV7B 4Z9KB 5F96H 3TBYA 3HTLX 4TSAH 5GRJH 1KCLA 2C3XA 3KYKH 1X9QA 2BP3A 2DL9A 3NH7H 1D3CA 3QULA 2FJHA 4XCFH 1RPQA 4JFYA 1UEMA 3SDXB 4QOKB 5M7QA 5H94A 3DGCR 4PJXF 1RZGA 4NYLB 3GJFK 3H9SD 1LO5B 3L3DA 4PGCA 3X11B 4Y4HB 1JGUL 1YNLH 3R0MA 5CEXA 1I9IH 3TT3H 3GJFB 1T5XB 2YA0A 2YPLB 3BP5B 1AGCB 1N0XH 1S7RA 1X6LA 5GRZA 4F33B 4M7KH 3VFMA 5I1LB 1QRKA 1YY9D 4P5MA 3TIDA 1BBJB 2X9WA 4ODTH 4HT1H 4RMUA 2AJ3B 4XPBL 1V05A 3CCHB 2AV1A 3FRPG 1G9NH 3A0OA 1CU4H 5A43C 2GSIB 3CD4A 2FX8H 2RIKA 2VDLH 3O3EA 4OLZL 5GS2H 1KB5A 3VFOA 3GI8H 3EHBC 4TSBL 3RFZC 2R56H 1AGBA 1TZGL 1KACB 2OZ4H 1DSFL 5F6HJ 3PV6B 4KUCD 2I9TB 5J0BA 4DWHA 1I9RH 3NMEA 5IUSA 4DFIA 4OB5L 5I17B 1I9JH 3QUXC 1UT9A 4LPCA 2NW2A 2VDRL 5GGQH 2O93L 1MH5B 3LDBB 3FFDA 4P3DB 4EI5A 5MEOA 3OJDB 5CEZL 2RFXA 4XNYH 1AD9A 3DETD 4LPXA 4IRSB 4XP5L 3E8UH 2DI7A 1SMAA 2HTKD 2KZWA 2O5YL 4QRRA 3E2HB 3F7PC 2Z4QA 3NCYP 4ZPVB 3IS0X 4W6YB 1BFVH 1S7WA 1J1XL 1NFIA 1XF4B 2XXMB 3HE6C 3BIKA 3UTSE 1NC2D 1ORSA 3TO4D 5E99L 4RDQF 2O61B 1IGIH 5J4MA 3MJ6A 2NR6C 4P99A 3U1SL 5LGJB 1BFOB 1UJ3C 4UINH 4LLQA 4NM4H 4PJFE 4EZMA 4HH8A 4XI5C 3TA3D 3S5LB 4FFVD 4X0KB 1QLRA 3QZWG 1D5MA 4L9LA 4L4VB 3IDYB 3WIHL 1KEML 1WTLA 2YMXH 4LCIH 1DUZB 4M7ZC 1NCUA 2A9NH 4HX1B 1CBVH 4M6ML 1P2CA 4OD3L 1M7XA 1HIML 3B83A 2VXUH 4XVSL 3LKRB 1RU9L 4HPOL 1XR8A 3HUJF 3DECA 2VKXA 4H20H 5FYKD 2D7TL 1U93B 4XC3H 2GJ6D 2APXA 5FOBA 3T2NH 4UOW1 3RP1A 5E8EA 2HKHH 4N1CA 4XBEL 2UUDH 4F8QA 5CEZE 2A0LC 2J8UA 5ICYA 5DQJB 4Y5YC 1DQJB 3QNZB 4F2MB 4YFLI 2RQ8A 3MGOA 1KXQE 3M17A 2BNRE 2Z31B 2DLFL 4OCYH 3GIVA 3PF2A 3CJJA 1S9WB 1SJHB 3ARBD 4FQPA 5EBMA 2OS7A 2L0DA 1XGQA 3WXVH 1AGDA 2V5RA 4HD9A 2EE6A 3CX5J 3W11D 5FYJD 1RIVH 1SQ2N 3QUZC 5FHAL 4GG8A 1NAMH 3DPBA 1MCWM 4ALAH 3C60D 3ARDB 2BFVH 3FB8B 1BJMA 2B5IB 1HHKA 1Q9KB 3L3GA 2WSKA 4YDKL 1OTSD 3EFFB 3MRNA 4ODUA 3PXHA 2ZNWA 1EPFA 1NGXB 1MCCA 2FBJL 1G7JB 2Z93B 4P3CL 2YD7A 4MGXA 2VDPL 5FGRA 2M26A 3THMH 4YR6B 2CRZA 2P8MB 4PRIA 3ULUF 4JQXA 3CNKA 3BGFC 1G7PB 2DD8L 5DHYB 4J3SA 5F9JA 5FCSH 1I3RA 4IIQA 3W2DL 4JY5L 3WSQH 3S34H 4GW4B 1T1WB 3O6KH 4JM2A 1JNLH 3GB7A 5HDOA 1T1XA 1F8TL 1YEEH 2V9RA 2ZSWA 4U49A 5INDA 1JHKL 3WNNA 1L7IL 3GRWH 1IQWH 2DYPA 4D0BA 2HN7A 2FBOJ 1P84K 3GI9H 4YX2H 3IJHA 3L7FB 5IVXA 2GKIA 2JB5H 2WAHA 5EC1B 4MCZA 4R4BB 2FIKB 4MQ7B 5FGCB 3QP3A 5AUMB 5FHBH 3D69B 1X4ZA 2MMXA 3FT2A 3H42H 3T4YA 3IKCB 2D9QB 4EN3D 2C3VA 5BQ7B 4XRCB 2Y5TA 2NXYC 3NCFB 3VWJA 3WHXA 3V6ZB 5HVHC 1CIUA 3B9KA 3C08H 3CSBA 2DIBA 4PJFB 3WFCH 2P4AB 1NANI 5EZIH 3VI4E 4DK3A 1BEYL 4UOJA 4R4FL 4G43A 5JZ7C 1Q72H 5DJCA 2NW3A 4XHQA 3CH1B 4K3HA 3VA6A 1NCAH 2ADIB 3EJYC 1HI6B 4Y1AA 4OI8A 3BW9A 5I75B 4KVNL 2XT1B 1F3JA 1A02N 4QHKJ 3DWTA 1XEDA 4NBYB 4X6CF 1N5AB 1RY7B 4PLKC 1VERA 3S36L 3TNNB 5F9OL 2RCSH 1JK8B 3ZE0E 4YQXH 3IU3A 2EKJA 5I1IH 3MV9E 3RDTD 4UTAH 1ADQA 3LEVL 3RWEB 3V0VA 1K3ZA 1OCWL 1NUDA 3S3PA 1C1EH 1KIPA 1RUAL 3TO2A 1F6FB 3EO9L 4EXKA 2BNRB 1IEBB 2BNQD 3QDGE 4KUCF 5HHOE 5C08A 3U46A 4WW2F 2IAND 2MNUA 4MDIA 5IMMB 4XP4L 2AXHA 3QRGH 2FHBA 3TCLA 4IMKC 5EPMB 1K3IA 4PRAB 4MX7B 3W0WB 5IOPA 4WV1C 2IALB 4UV4L 3X13B 3KLHD 4AG4L 2FO4B 4QXTB 5GGTL 2VQ1B 1JIBA 3KPTA 3SDDA 1T03L 4BZ2H 4NP4L 3NPZB 3P11H 1DBBL 4QRUB 1CFQB 2ZG1A 2FEEL 1A6WL 3F5WA 1JGLH 1UC6A 4KK9D 4DAGH 5KANI 3QEUA 4QRPA 4YNYA 4WIQA 1VFAB 3WCYA 4AL8H 1ZEAL 2CGRH 2CDEB 1CFSA 4OT1L 3GSOB 3ZKXC 1U95B 5HGAA 3LB6D 2YPKB 1KPUA 4IRJA 4R26L 1D5ZB 4LRIC 1BVLA 1C5BH 4HUXB 3I75A 1FIGL 2X44D 3IXAA 2CIIB 2W07A 5FV2A 4UAOB 4OZFB 1QRNB 5HHVL 5CP7A 1JHTA 1NLBL 5DFVC 3BZ4B 1MHCA 3RWGA 1KLFA 2ITDB 4PJIA 3DMMB 1TJIL 1F45A 3S35L 5HVFB 1Z5LB 4LAQL 5SWZD 1WICA 1F3DJ 5AD0A 2NY2C 3C6SB 3S5LG 5CZKA 3TC9A 1P5VA 1PYWB 3IDXL 3CK0H 5EZLB 3LS4L 1I8KB 2GCYA 4R96A 4NQDE 1R5WB 4PJDF 4JY4B 4I3RH 3S4SB 4N0YH 4E42A 3P9WB 1X4YA 3IDJB 4TVPE 4D9LH 4OZIA 2MWCA 4HMCA 4NQSA 3MZGB 3RIAK 4YHOH 5L2JA 1URLA 1NGYB 1S78D 1XZ0A 5JIHA 3FHQA 3AY4A 5FYJH 1C5CL 1MJ7L 4LLMA 2AK1H 4RISH 1AGEA 4TVSa 1MFCL 3UTZB 1OTUD 1ZS8A 2XIDA 1YEKH 1KN4H 3IDMB 4JG1L 2HFGH 1GH7A 2W9EH 4PJAF 1IGMH 4NO0D 3S97C 3ARVA 4IOIB 1EXUB 1CFTA 1KJMB 1UACL 4D0DA 1E6OL 1IEAB 5HTSA 5C0RL 5JUEH 1ZHKA 3RL2B 1KFAL 2APTA 2X1WL 1NGPH 3MLZL 1C7SA 2HP4A 5CCKH 2ATKA 1Y6KR 4GUPA 1MCQA 2LU7A 3L3KA 4QT5B 1UCBL 3MOAH 3WFHB 2AK4E 1JV5B 3CFJA 5KJRH 1G84A 4LQFH 5E8PA 5TQ2L 3S3JA 5IR1B 5IP4A 4FFZH 3KPMA 1FORL 2CXKA 2BZDA 3B2UD 4LNRB 4FG6C 3HG1A 5EU5A 3JTSB 3QNYB 2IPKB 3B3IA 1PBYA 1XGUB 3K1KC 3D39A 4HS6A 2CMRH 1S5IH 3I6GA 2Q7YA 3V0WL 5E2TL 5F7EH 2LABA 5HI3D 3SJVA 4BQ8A 1ITCA 3GSWB 5F89B 1ES0A 3EOAB 1A9EA 5FO9B 4U6XA 3LD8B 5E8OA 3K8KA 4WEBL 4C58B 4GKNB 1VPOH 3VFTA 3HAEH 3Q0HA 5CMAB 3H9HA 4MAYB 1MCDA 3HE7D 1MJ8H 4CVZB 1QPPA 4ODSH 3VXRE 3FO1A 4JDVA 4NKDB 1JNNH 4H1LB 2CDGB 3JWDL 5F7NC 1PZ5B 4S1SH 4BKLB 4X7EC 2J8HA 4U6YA 2YC1B 3OAZH 3QFDB 1M7DA 2D03L 3O3BA 1G9ML 3MLSH 3K4AA 4G6MH 4L8CA 3PABB 4EI5C 3MXWH 3RX8A 4Q58C 2F53E 3N9GH 4PJCA 3TPUA 5SX5K 1YEIL 3QXVA 3ZE2F 1YUHA 4NBZB 4XP1H 4QTHA 4Z0XA 1MI5A 3L7EB 5D7IF 4WTXA 4NNPL 3ULSB 4HG4J 4DN4H 2W92A 1LEKA 3RPIB 1MJJA 1YMHA 4RZCA 1YQVH 4LLDA 2IAMA 3T0VA 3AGVA 4IDJH 4X7TB 1H3UA 1U8OB 3LV3A 4P4KB 2D0HA 4YK4B 1WT5A 5BRZE 4CADA 1JI1A 3AS1A 3OR7B 4BQ9A 1RUPH 3IRZA 3DURA 4GXVL 3GK8H 1SEQL 2GYSA 1J1OH 1RZ7L 4ZTPL 4XMLH 1DANU 2FGWL 3BUYB 4L9LC 4HCRH 1DDHB 1QSFA 4S10A 3VFUB 1FFNA 3QO1A 2P24B 3VXUE 4V1DE 5C86A 5J1AB 3T65B 3KXFA 4M9PA 2YD3A 5K9QI 3QIBB 4OM1L 1AQKH 4OGYH 4L5FL 4JZOA 1MJUL 4J3VA 3QWRA 3SDAB 5BV7L 1ZHLA 4D9QD 2NY5L 2IGFL 5FYLE 1A1OB 1U3HD 1GZPA 3H3KA 1WIUA 5HI4C 5KOMC 1ORQA 3RTQD 5J3HD 1RFDH 1S7TA 4QXUH 1CE1L 4CBPA 3D3VE 2HT4C 2OSLB 5I8KL 3HZKA 4UQ3B 3M8OH 4XGZA 2YPVL 4K9EH 2EYTB 5EBLA 5I19L 9CGTA 5JO5A 4FMFA 2AK4B 5JDJA 3OBAA 1MQKL 4FZEH 4KMTH 5IWLA 4PJ8B 4PGBB 2BVQA 1CLZH 1B2WL 3DGGA 4HKZB 3P0GB 3EJZC 4K07A 1T2QL 1A7QL 4H26B 3WXWH 5GRYA 4UNVA 1RULH 2DQDL 5HVWA 4M7JH 1RZJC 3VXOB 2NY4D 3V5DB 3D18B 5DK2B 1NJ9B 3I9GL 3RGVC 2DWDB 1BZ9B 1B0GA 2C7UA 4PGDB 4MAUH 1JNHB 4BFIB 1FZOA 1Q94B 1I1AD 4A6YB 4NZRH 3FZUC 2D4FA 5AZ2H 4C56D 2YXMA 1I7ZB 3GSQB 4JQXC 3D87B 4MQSB 4YHPB 5FM5O 3VXRB 3OR6B 2P46B 2XYCA 4FXKA 4ERSL 4I4WA 2DB8A 5DI8A 1GPOH 4PJGA 5CD5C 3OQ3B 2AEQL 3IETA 5ANMA 4JM2C 5DUBB 3L9RA 5C9JA 5HGHB 1LP9A 2HVKB 4JHAL 2EYSA 3NCBB 2FEEI 3ZTJG 1TVBB 4JKKA 2NY0B 3N06B 3S4SG 3RBGA 3WS3A 1WQVT 3F62A 3NCCB 3AS0A 2F53B 3KJ4C 3HCVA 4FQHA 4X4XA 2MQ3A 1KLGA 2F74A 4HWZB 4WWKA 5CBAB 2HWZH 4KPHH 1G6RH 1XF3A 1A0QL 2F5AL 3AXLB 3KPNB 5KSAA 3U6RB 4LBEA 4HKJA 3VWJC 4UIKH 3QG6A 1CTOA 2MSPA 4PP1C 4Y5VA 4LLYA 1UM6L 5BRZB 5CJOL 3B9KC 3MV01 5JMOC 3NFNA 4HFUL 1JTOA 3RUGF 1IAOB 1F6AB 1WAAF 3GMOB 3VCLA 1H15A 3QIWD 4Y4FD 2X9XA 1G7HB 1EEZB 2JKXA 5I76B 1AP2B 4JFEE 4O2EB 4XNQA 2G5BB 4G6AC 4V1DB 2B8OT 5KOVC 5GS0D 1AXIB 4OBRA 3BRFA 3MV11 3I6KB 2VH5H 4MD5A 3BKCH 5F1KC 4GLRI 4Z18A 1T22A 2PXYD 3UTOA 1QUNA 3MCLL 3ZKNC 1A4JB 4MA8H 5KSUA 4TRPL 2EH7L 4Z95L 1GOGA 1NMBL 2WP3T 3FFCD 1EA9C 1IFHH 2XKNA 4KXZI 4HH9A 4X6BA 1GGYA 1LO3H 2F19H 2JJSA 4HC1H 5BXFB 5L7XL 4FFYL 5B3JF 3D3VB 4NSKA 3VXNA 4S11A 2GI7A 4OKDA 2HJFB 5IFJA 1GGCL 4XPAL 5J6HA 4XBPB 4KHXH 5T1KD 2EDEA 1UB5A 2X4QB 3RWDA 3VFSB 2ZUQC 2FSEB 3G5XB 3VGBA 1KTLA 2I60H 5AYUH 5I16A 3QWOB 3SDDC 3V5KB 2P45B 1D6VL 4H1LG 4HHAB 1ZT7A 2BVPA 3IXTB 4O5LL 5BO1H 1EBPA 1FDLH 4YAQA 2E9IA 2Q8AH 4GAGL 2R1XA 3G6JF 3LH2H 4KKLD 3QUYD 4HGWA 2OZ4A 3VXMD 3D85A 3HB3C 5HD8D 1QBML 2D3VA 1JYWA 3T0XA 4AENB 2BCKB 2EDLA 3VG9C 5BV7B 3O4LA 5I1JH 1FFOA 3CUPB 4BUGA 2A73B 1LWRA 4DN3L 2X4NA 1FFRA 5IVZB 2NY1D 5CUSH 4LSQH 3O2DH 1WVZA 4PRHE 5CAYB 3OKLB 1S7UB 2BNUA 4FTVD 1NEZG 4Y2DD 3VD5A 4YDJA 1PSKH 5DD1H 3OB0K 1K5NA 1U8NA 3SOBH 1AD0B 1J87A 2XN9A 2XQBL 4AQOA 2GEEA 1U6AH 4P46B 1K4CA 1RZIA 3T8XB 1BX2B 4BSJA 3QUMB 2HRPL 3GMQB 1OAUH 4X5XB 3TZVD 2NXYB 1S5HA 5FDWA 5DQ9B 5L6YL 1MF2H 1F4AA 3INUL 5EU7E 5TF1L 1NCDL 1HWHB 3QDJB 3T0EE 3HZYB 5F7LB 3NAAH 3SN6N 1FAKT 3AAZA 5IEHB 2VLKA 2XOTA 3EYOB 5DS8B 2JCCE 3AY4C 3VFNB 2F54E 1MCLA 2N56A 5CKAA 4LRNH 1H3PL 3HUJA 1D9KA 1I7UA 3TBVB 3U0WH 1LNUB 4PR5B 4O9HL 1JZ2A 4JRYB 3TIEB 3ZDZE 5TE6H 1KC5H 3I6LD 1MHEA 2WBJA 3O6FB 5FEBA 1CDIA 5C2BH 4Z7QF 1BD2A 4LNVA 2OJEA 4XNUL 5I1AB 2DICA 5DYOA 4JFDE 2V9QA 1M71A 1RJZA 4Q9CA 1TJHL 5LCVH 3HZVA 5FK9B 3NIFF 5DMKB 4QHLA 2OQJB 3WN5A 3WKMH 2DKUA 3F58H 1KPVB 3WLWC 3HHRB 4L3EB 3L1OL 3EZ8A 1JPFA 1OD9A 4Y88A 3A6CH 1OAKL 3MRPA 5CBEB 1X5YA 2X1XR 3O6LH 1T6WA 3ARDD 3KYNA 5KVEL 3KJ6H 4X99B 1QFWI 3BVNB 1T04B 4XX1E 3UC0L 5T3XE 2XZAL 4JPKL 1WBXB 1MELA 3STLA 3VFWB 4MNQD 4LLUB 4OLYL 3BKYL 2E9JA 2GTZB 1IGJA 2YKLL 3U0PA 1KCUH 1OTTD 2GUOB 4B7IA 5IW6A 2VC2L 3MLUH 4F3FA 4EOWH 2X7LB 4G6KL 1GC1L 1X5HA 2NYYD 5JW3H 5D7JB 4M48L 4H88L 5J11C 1KIRB 4GG6F 4N9GB 4Z78A 2A6IB 1FPTL 3E3QC 3Q6FB 3GRWA 1WBYB 4MNHA 5E94B 5I1EL 4U0RC 3EGSA 3IFPB 4KI5F 2R0KH 3EKCA 3IDGB 3PGCB 4JQIL 4PRHB 4EXPX 4PJ7F 3B5HA 1FO0A 4AYFA 4NKMB 2V7NA 1CGUA 5IESH 5DLMH 4NDMA 4PGEA 1T4KB 5DMGC 1JMXA 5EO0A 5JDSA 3MNWB 4CDGC 2BMKA 2D7QA 4UQ2B 1ZA6A 5T1MA 1AY1H 1WFTA 2VR4A 5DHVH 1QLFB 5C70A 1ETZB 5FM5M 3NN8B 3DV6B 4TOYL 1JPST 4MD4B 5FO7A 2IAMC 3UTSD 1HHIB 5F1IB 2CJUH 3FT3B 3BDYL 4AK1A 5K9OB 3BZFB 5I9QB 2V5TA 3ARFB 4YHNB 3GGWB 1FNEA 4TUJB 3T0EB 3X12B 3TVMA 4K7PH 4MA1C 5CD3A 3R06B 4K94L 3BWAB 3V7AG 4BA8A 1KT2A 5EDXA 5E8NA 2F54B 5D71H 4MJ5A 1KCVH 1A6PA 4I3GA 3TBSB 2VUYA 5DJ2B 3RIFF 1RJLB 2X9YA 5IBUB 2PYED 2BOBA 4N8CH 4QRTA 2EDJA 4LPUA 1DQQA 4XCNA 3C6LB 1OQXA 1CGWA 4NC2B 2HMIC 5GJSL 3GMMB 3RWIB 3SKJL 1CD0A 1NFDA 3NABH 4KRLB 1F4WH 5C7XL 2J8UE 4J4PA 1L9MA 3DIFA 3QJHA 1BM3L 3EO1B 5C0IB 4JFDB 5ESQA 1OPGL 4ORGA 3P4OA 1N5YL 3KPOB 1L7TL 4NHUA 1HQRA 3LRSA 5DVMA 4FQXA 1F4YH 4Z7OE 1YN7A 3G5ZB 4X9FA 3WS6C 1NCCH 4OZGF 4XPTH 3UTQA 1OLZA 2B1AH 2CLRB 1YMMD 2EXWC 3G9VA 4OF8A 5DK3A 2DBLL 1U8HA 1A14H 2FJHB 2VQUA 4JFYB 4NNYA 1LO0L 4JO3H 3L3HA 3OGCA 1R3HA 5ITFA 3GMLA 1MCFA 1LEGB 3L3DB 1FFQA 4IJ3B 1A22B 2BJML 1YN6B 3OHXA 3UXFA 4OF6A 4KTEL 4YJZL 1S7RB 2E3VA 4YXKL 4P5MB 3U2SA 3TIDB 3P3YA 3QEGL 3V4VH 3S8WA 1NMAH 5IQ9A 2V7HA 4LFHG 1IKNA 4PRIE 4YXLL 3W9EA 4XVJL 4XP9L 1P7KB 1V7NL 3O3EB 4NQXA 1KB5B 2BY0A 5EBWB 1ZXQA 3MSPA 3TV3H 4P59H 2Y6SD 2C1OA 3DI2B 1AGBB 4R3SA 1IZKA 5DD0H 4QLRA 2AAVA 3CFDB 2XZZA 4NQUA 3TBTA 4CU6A 3LQAH 3RA7L 25C8H 4U1NA 5H2BA 5HYJB 1MCWW 4ELMA 3FFDB 1G7MB 2APVA 1MIEL 1MHHA 1ZV5A 4UDUA 4MB3A 3RNQA 2AJUL 4X6DA 3LPGA 5J12B 5LXGL 4PY7B 1S7WB 1R5IA 4HAGA 4F7PA 1NFIB 4YO0B 1QNZH 2H8PA 4Y16A 5KSAC 4UILL 2EIZB 3ZYZA 1ORSB 4Z7VF 4WW1B 4JPVL 2AQ1A 4Y5VC 5IT2L 1EGJH 4K23H 4LLQB 1I8LC 4FQCL 1MRDH 1OP5H 5IW1A 2QSCH 3UO1L 3FQXB 1A7NH 1NBYB 2E6QA 4K3DH 1T7WA 3OG6B 3LQMA 4I0PD 3WNMA 2W91A 2OX5A 2X05A 4Y1AE 4HUWB 1XR8B 3LHPH 1R3LB 1UWGL 3VXSA 4HXBL 3MRIB 1MCIA 2OJZH 1NUNB 4FP8H 4Q9QH 4KRPD 1U92B 5IB1A 4Z76A 3MR9A 4WI7A 5E8EB 4NPYA 3BMVA 1QHPA 2CK0H 3MNZA 3UP1A 4X4ZA 4WI9A 1CD8A 3FO9A 5EOTB 3MV9D 3EJJX 2JJSC 5E5UB 1H5BC 1BZ7A 1G6VK 3MGOB 1WUNT 1RIHL 5I6XC 4NN7B 4MA7H 1V7ML 3QDGD 3BWUC 3WEXB 5C08E 3WIIH 1L0XA 5HHOD 1DLHA 1OWWA 2XQYG 1J05A 3VRJA 4K8RD 3X3FH 3DARA 3I3BA 2PTTA 3MROA 5ICXB 4OV6F 1CZ8H 1EHLL 3HS0A 2BSSA 3CSYA 3UTTA 1LK3H 4OBSA 4Y4KB 2VXTH 4YPGB 3RU8L 4PJ5D 1G9NC 1XF5A 2FX9L 1B88A 5AZEH 3OGOE 3SKMA 3TNMB 1JZ7A 4MAYD 5IVNA 1U8PB 3S3SA 5DF0A 2IQ9H 4PRIB 1JZ5A 2JK5B 1PFCA 1ZANH 5MI0B 1W72L 2J6EA 4J7RA 5F9JB 1I3RB 4IIQB 2AJZA 3CXHK 4LEXL 1OM3L 2DQEL 1ZWIB 1K4DB 4J2XA 5GZNC 1UXWA 1BF2A 4J12A 2ZSWB 4HWEH 5INDB 2Q6WB 5HY9A 3QSKB 5F1OB 5C0NC 4J3OC 1KPRA 5FAAA 3PJSB 4PJIE 2DYPB 4KKNA 3TJHD 3MOBL 4FABH 2HKFL 3IJHB 3KJ4B 4MJIA 1RD6A 1R5VB 5EOCH 1H0DB 4MCZB 4K3EH 4YFDB 3MGTA 4RGNE 2DQGL 4LP5A 4PB0H 2FDBP 3FT2B 1KGCE 2C3VB 5DK0A 2Y5TB 2HLAA 5TGBB 5I8EA 4LVOC 5GGVY 4NQDD 5C6TH 4P4KD 5ACZA 4OZIE 3U7AA 2D2OA 1A7OH 1QACA 2BHZA 2MKWA 4HCRA 4ODVH 4TVPD 3TLRA 3GFUA 1UKSA 4XBGB 2XY2A 5TDNA 3MRRA 1A9BA 2B1HL 3BZDA 2PR4L 1OAQL 1SJVA 2OTWB 2PCPB 4FMKA 3GZKA 1WZKA 1ZT4A 1JPSH 3BH8A 4G43B 4MXWL 3ULVD 1D9KC 4NO3A 4UT7H 4O02L 32C2A 3QIBD 2WZPD 5D7SL 2ATPA 5KAQF 2PW1A 3BW9B 4U2YA 4UNUA 2FGZA 4AH2B 3DO7B 1AE6H 2KQNA 5J06A 1T7YA 2HJLA 1Q1JL 1WGOA 1XCQB 2XA8H 4QGTA 1VDGA 2YS4A 3VD4A 5FA4B 4W4NA 1GGBH 1R3IL 4PY8J 2R4RL 4PJ9B 1N8ZA 4H8WL 3UX9B 2FHFA 1OB1B 4BSVA 4WHYH 3MFFA 3IDNA 1KIPB 3HC3L 4CU7A 1OP9A 3TO2B 1QOKA 2AK4D 4JGJA 3B8YA 3WN5C 4PRPA 4XPHL 3TP4A 1KN2H 3CVHL 4F37K 3FB6B 5C08B 4EUPB 4HDIA 4PJ8D 5IW3A 3PQYA 3WUWB 1GGTA 2ENSA 4MDIB 2C5DC 5CIPH 5IMOA 3HG1E 4JO4L 5IOPB 3NVQA 2CKBL 3CZFB 3D39E 2Y25A 1IT9L 4PBVC 2CLZA 3KYOA 3GHEH 1JN6A 3SJVE 3QG7L 4HLZH 4HG4K 4Z7NF 3BDBA 2P47B 3KVQA 5I8OH 3FOLA 4KH2A 3F5WB 1BMGA 1V3KA 4FQ1L 3QEUB 3A67L 4JVWA 1FBIH 1DL7H 1BBDH 3CPLA 3WYRA 1PEWA 4RA0C 4TNWF 1TVDA 1FH5L 2VL4A 3HFMH 1NAKH 3H3PL 4YUEL 2NLJB 2NX5A 3E3QE 3VG9B 3OV6A 2VAAB 3EHBD 4DZBB 1MFNA 1WBZA 3OXSB 4LPVA 4IRJB 1F11A 4RAUA 2Y72A 1DE4A 1FSKB 2B2XL 1SY6L 2DIJA 3GO1H 3ZT5A 3HC4H 4LMQE 5C07D 1KJVB 3QUXD 4YDLB 1WWAX 5B39G 4CUCA 2H6PB 2NZ9D 5C09D 2A1WL 4JJ5B 1MHCB 4DGIH 3RWGB 3AREA 4PJIB 1GCFA 4UUJB 1G6RA 4FQLH 2F53D 3DROA 3CZJA 4AT6A 5HHNA 2VJXA 4I0CC 1MI5E 1OOAA 4LASH 1I7TB 1IJ9A 4DVRL 4OFYA 5E2VL 4NO5A 3EO0A 1CK0L 4RGNB 1UM5H 3ZE0F 3TF7C 4HF5L 1U2HA 3T1FB 5DMJB 4GBXA 4C57C 2QR0B 5BMFL 4XXCA 1WAAA 1OAZL 2NR6D 4OZIB 2QQKH 4DJMA 1ACYH 1W8OA 1F13A 2IADB 4GRLB 4NQEE 1KV3A 5FGBA 3D0LB 3D2UD 4XI5D 4BZ1L 5I2IA 4GSDL 1XZ0B 5L8LB 4YFEA 3OKNB 1Q9WB 4WENB 1QSFE 5LBSH 4DQOL 1UWXK 4W81A 1IAIL 2AJXL 4MD0B 3LN9A 3VXUD 5F7FA 4HJ0C 1ZS8B 3FAXA 3KXFE 1N4XH 4G42B 1W72B 4YWGH 3RX5A 2OI9B 5LKNA 1Z9SA 5DRXA 3C5ZB 3WLBB 2I9LA 4PS4L 4JB9H 2W0FA 4HC1A 4QTIL 1R0AL 4N68A 1A1MB 2VN7A 1T7ZA 5FYLD 1ZHKB 3W5NA 4J4PC 2A0LD 5J8OA 2PTUA 2APWA 5C6WH 5HYSB 3EDKA 2ATKB 4OLWL 1E4WH 5IMLA 1SJEA 4LKXA 4OD1H 1VKXB 4XMPH 3Q6GL 1HSAA 1QBBA 2G9HA 3LEXA 5DR5H 5D7LA 3RY6A 3CFJB 5KSVB 5CP3H 1DQMH 5E8PB 2DM3A 1NCWL 2X70A 2ICEB 2WIIA 2QQNL 1HZHL 5L2KD 3KPMB 4JVPA 5FKAB 4XPFL 2ZJSL 3PDOA 1N3NA 5IHLB 4HPYL 3EDFA 3P0YL 5EU5B 3DXAE 1U3YA 3MRQA 2VDOL 1N6UA 4R8WL 2YSSA 3I6GB 3L5WB 4DCQA 2Q7YB 1NUFA 5FFLA 3QISA 4WDIB 1OHQA 2BY2A 4PREB 1ZGLM 1R3JB 3G6DH 1JZ8A 4JG0H 2ZCKH 4O2FA 1PD6A 2ADGB 4H25A 5E8OB 2DWEA 5FCUL 2V2TA 4OFPA 4M1GL 2XPGB 2EICA 5JIKA 3MCKB 3BP6A 3H9YA 4HZLB 1A3RL 3O2DA 1BLNB 1Q0YL 3ZDXE 4WHCA 4G8GA 4OZHB 3D48R 1OF2B 4PJGE 4U33A 4JRXA 3MNVA 2DQJL 5TDPA 5L0QC 2R0LL 1IE5A 2HTLC 2R2BA 1LP9E 1NBQA 4LQ1A 4U6YB 4MXVE 3VFVA 5B8CB 3ULVF 3ZDYF 4FFWC 2BC4A 4KQ3H 3ULVH 5ALCH 5D1ZA 1KLUB 5GRJL 1YEHH 2XI9A 2HVJA 1QFUL 3MRBB 5ICZA 3NH7L 3CVHB 4LU5H 5B21A 2R2HA 3E1F1 4XCFL 1YUHB 4QTHB 4APQB 4W68A 5SWQA 4P46D 2GT9A 3PWJB 2NXZB 3L5HA 4LCUA 1LEKB 2CKBB 3NFPA 2NXYD 4JHZA 1MJJB 1YNLL 1YMHB 4JGMA 4RZCB 4LLDB 4L4TA 4Y16C 3QUKB 1I9IL 3TT3L 5D6DC 2I26N 1N0XL 4GXUN 4G7VL 3OKDB 4M7KL 1IKFH 3C9NB 5TQ0H 3K1DA 3QXAA 4NQEB 3LSOB 1BOYA 3DURB 1JYXA 4QY8B 5I66B 3QO0A 1F4HA 3HNTL 3QI9C 4KUZL 2Z92A 4PG2C 3IB4A 1FFNB 3FQWA 3QO1B 2FX8L 2VDLL 4ZUUA 4JFED 2UYLB 3GI8L 2FLRT 3KXFB 2R56L 5BZWA 3MV8A 3TT1H 5GS3A 3GSXA 2VZUA 3QPXH 5C0JA 4KJWC 1E4KA 1RURL 4TTGA 4OKVA 3CFEA 4PLKD 1D7FA 1ZHLB 2MCPH 4EUPG 3REWA 5IQ7H 3MRFA 3ALPA 3WUWG 3PIQA 3GSNA 1GZPB 2ICWA 5E24E 4BSWA 2J4WH 1ORQB 1DQTA 4GKSA 3I85A 4XNXH 1N59B 2XRAL 1LMKA 3NCEB 2N1KA 3LRHA 2A83B 4OIAA 3KYMB 3SDYL 5EBLB 4D8PB 2C26A 4PJXE 2DOCA 3NCJH 2XV6B 4F57H 2V6HA 4MHHI 1BVKA 2BVQB 5TDOA 1IGIL 1EIBA 2F15A 5MP6L 1YY8A 2F8OA 3ARXA 4TQEH 3DXAB 4I9WE 4NM4L 4UINL 1PY4A 1ZA3B 4WUUB 4WU7A 5MENB 3QEQA 2MPAH 4N0UA 4LMQI 4G9DA 5INCB 3RWCB 1NUGA 3C2AL 2YD5A 4ELKA 3MRLA 1BREA 1GHFH 3V4UH 4QHMA 1BJ1J 2A9NL 1CBVL 3SEPA 4GG6A 2LVCA 3EW3B 5C3TA 4QHNA 5I1CH 1YEJH 1H3TA 2MHAA 4H20L 3I84A 4XC3L 1UQSA 4J3XA 4OI9A 2MKLC 4ZUWA 3BP7B 2VLJA 2YRZA 4Z7UA 3T2NL 3O4LE 3ZYOA 1NBVH 2HKHL 4I4WB 5DJDB 1V3LA 4PJGB 2EXYD 1ZHNA 3IETB 3IVKA 4AIXA 1KG0A 3SY0A 3L9RB 4OCRH 4X9HA 2ED7A 4LARH 4YE4H 4PRHD 4CVWA 1QVOA 3F7YA 4S1QH 3WFDH 1A6UH 1C12A 3L5XH 4M6NH 3TGXA 2XN9E 2B7DT 3G5YA 4X4XB 5DTFA 2NY2D 4KK8D 1TIUA 5IGXH 2RR3A 1NAML 3QCTH 5EA0H 2X10A 4WWKB 5T5FH 5FYLH 4ALAL 3L3JA 1XF3B 4LBEB 4NZDA 1MRFH 2VDNH 4RGOH 1A6TB 3ROLB 1P9MA 3QG6B 5IK3A 5DVLA 3ZHDA 2ZWLT 4G5ZH 3EYFA 3ARFD 4LLYB 5FA3A 3NFNB 1MLBA 1NDGA 1WWBX 1HYSC 4XP6L 3BPOC 4F7TB 4M03A 3THML 4QXGL 2VLKE 1EEYA 3U4EA 4DKFL 2IFFH 5I18L 1QYGL 5L9DH 2EDYA 2F54D 3ULUL 3HUJE 4KK5C 1HXYA 5E0QA 4PJEF 8CGTA 1T7VA 4XMKL 3WSQL 4M02A 3S34L 1CDBA 5LG1A 1CE6A 3O6KL 4LPWA 4RAVB 3HA0A 1WZ1H 1JNLL 4O58H 3OKMA 4G7YH 1FYTE 5CILH 4B7LA 1YEEL 1T22B 4ZUVB 1JJUA 4NO2A 4RWYH 4PRDA 3NA9L 1BD2E 5DT1H 2OXGA 5KSUB 3QIUA 3FN0L 4DUVA 4U6VL 2IFGA 4WO4C 3MMEB 3GI9L 4YX2L 1NFKA 5CZVH 1ED3B 4O51A 3GNMH 4JN2A 1WC7A 2H26A 4C4KO 2ADJB 4PLOB 5FHBL 5JHLH 5HYQA 3OXRA 3EUUA 3KPPB 4PJXB 5IFJB 4ZSOA 1CT8A 3MUZ1 4EDWL 5J6HB 3O8XA 4XH2A 3BZEB 4KTDH 3JBG7 4ODBD 3SCMB 1S7XB 1FL3A 1DUYB 5BS0A 4FG6D 5F7DA 3NACH 1KTLB 2EC9T 4AMKL 3WFCL 1VA9A 1P7QA 5IHZA 4HIIB 2YUVA 5T3XD 2UY6A 2DTMH 1ZT7B 2BVPB 1Q72L 1T6VN 3TBWB 1NCAL 2PTVA 4HIXH 3UYRH 3FB7A 3QQ3A 2ICWJ 5E08L 1B9ZA 1FGNL 1OARH 4JFHE 1CFNA 3FJTA 4I13B 5HDQH 1Q9LA 1P4BL 4U1SA 1EFXA 2AXGA 1I3VA 3FB5A 2A6DB 3O4LB 2JB6A 3RHWF 4YHYB 2RCSL 4XWOC 4YQXL 2X4NB 1L0YA 1AFVL 2H2PC 5DD5H 1MLCA 4UTAL 5K9JL 1WISA 2R1YA 5C0BA 1HEZB 1C1EL 2QKIB 3MRCA 1NBZB 3MRDA 4QO1A 5IV2B 2BNUB 4EI5D 1KYOK 3AREC 3T2PA 5J6GA 5DJXA 4QRRD 1QLEH 5J1TC 2E5EA 3ZSTA 5HGGS 1CQKA 1RZIB 1XH3B 2OTUA 4YZFF 4LOUC 1KULA 1EGJA 1KNOA 2Y4SA 4GBXC 4BZ2L 4XXCC 4ZS7H 3F6LA 4ZAKC 4M8QB 1YEFL 1RHHA 1WTGT 3FONA 5FGBC 1CIDA 4OV5B 4X8JB 1D6EB 2UV3A 1OW0A 3VXTA 3OZ9L 2VLKB 2WK2A 3MRJB 1JP5A 3G5VA 2CGRL 4MSWA 5AYQA 3DHMA 1T2XA 5L88H 4RGMB 3HUJB 1GGIH 4RMTA 4X6CE 2UUDK 3ES6A 4OCXH 4JLRA 4LSPL 2FD6H 5E2JA 3OX8B 1C5BL 3C87A 1OWRM 1TPXB 1CLYH 3WJLA 1FYTB 1E28B 2WBJB 4PJBF 1NFDE 2XICA 5IJVB 4N1HB 3ZKMC 2IJ0C 5HI4D 4D0CA 3F7QA 3GMRA 2L7JA 1SBSL 5KVMC 3MRHA 1M71B 4Q9RL 2X4TA 5FYKL 3W39A 2HT4D 2MOVA 4UB0H 1ERNA 2R1WA 4X7FC 4I3SL 1FZMB 1A6AA 3RY6C 4WCYL 3QYCA 1NAMB 3AUVA 1UXSB 3MLWH 4LK4A 5F1SA 3QB7C 1JZ4A 4FXLA 4ETQA 3T08A 5LQBH 4N0YL 2VXVL 3U0TB 3EJZD 4D9LL 5DUPH 3U7YL 2BVEA 1V3JA 2LU4A 4NC1E 1U8KA 5FYJL 5KSBA 5CEYA 2DKSA 2AK1L 4RISL 5DJZB 5TE7L 1FGVH 4FQJL 1HK6A 5D1QA 3R0NA 3BE1L 4ONHA 2W9DH 5DUMH 3UJIH 3DX6B 1XGRA 3FRUA 3U0PB 1KN4L 3ORJA 5IW6B 1AKJB 3FZUD 1IGML 4PRID 3HZMA 2AEPH 3DX7A 2AW2A 3BO8A 5ERWB 3SDCA 4QCIA 4L8SA 5GRVK 5JUEL 4BFEA 1KELH 3BEWB 1MVUB 4PYGA 4JAMA 4D9RE 5AWNH 5HYEA 5CD5D 1NGPL 4S2SA 2JCCF 1PX3A 4MNHB 4JM2D 4PUBH 5F1NA 5D2LA 3EGSB 4OAWA 4PGZA 5MERA 3SBWA 2EDDA 4XTRC 1MWAL 3MO1A 4ELME 4GKZA 1A3QA 1IAKA 2HLFC 2RHEA 5D1ZC 2R4SH 2DYPD 1ITBB 3K2UH 4LQFL 5ALBH 5AEAA 5KJRL 4K2UH 43CAA 3UBXA 4MMXC 3ZDZF 2AV7A 4PGEB 5E2WH 4NN6B 4X6DE 4DEPB 1KEGH 3AU1A 4LVNB 4M6OL 5BW7C 1EEUA 4PJDE 5JW5A 3OKYA 4OCSH 3DSFH 1ZA6B 4F15C 5T1MB 3LOWA 4NJ9H 2VISA 4I48B 2EH8H 3VWJD 5F7EL 4PP1D 4LHQB 2VXSH 5E03A 3B9KD 4P48A 2GY5A 3HR5B 4LVHC 3SE9H 1CICA 1VPOL 3MBEA 4PRNA 1T1ZB 3TVMB 5DGRA 3ARRA 3VH8G 4OUUA 2Q7NA 4ZXBA 4OD2B 2FL5A 1MJ8L 1F90H 4ODSL 4JN1H 5E8NB 5ID1A 4MJ5B 4G6AD 2J88L 5IG7A 1JNNL 1I1YA 4X6CB 3BHBA 4J6RL 3OKEB 1YNKH 4IEFB 1A6ZA 4QRTB 4Y1AD 1DQQB 1DQDH 4S1SL 4YHKL 2CUHA 3VWKA 4UT9H 3PHOB 3VXSE 4QHUA 4PB9H 1E4KC 3SKUD 2Z35A 2H32A 3LKPA 4ZG1A 4YHZH 3MLVL 3BESR 3DRTA 4YC2B 3MLSL 4G6ML 1MHPH 3LN5A 3MXWL 3WL9A 3DIFB 4X5WA 3N9GL 4XP1L 5IB3B 4HJGA 4WW2B 3LRSB 4LF3B 3V5HA 4FQXB 4TPRL 5DJ6A 1WWWX 5EO9A 1WIPA 2UZYB 5C08D 1YQVL 1LEIA 3D9AL 3O3AA 4LCCB 5ACLA 4IDJL 2IMMA 3CDFA 5IB5A 3QAZC 1RUMH 2JIXA 3AB0C 3L3HB 3STBA 4LPYA 5ITFB 5B38G 4X4YA 3G08A 4FQ2H 1RUPL 4QKXB 3A6BH 1TQCC 2EECA 3UTTE 4LSRL 1RZKC 3SDDD 2H3NA 1J1OL 4GRMB 4XMLL 4QRQA 1NCBH 5DWUH 1H8NA 5BZDA 3OHXB 1C08A 1NC2B 4HCRL 3HI5H 3TO4B 5KVGH 2VITB 3P30H 5E8DL 1UZ8A 1U42A 4YGAB 3RZCA 2V2XB 4QRPD 1MCJA 2V7HB 1AQKL 1LO4L 3HB3D 4P23A 2VYRE 2P8LB 2XG5A 5GXBB 2F5BL 2BOCA 1KTDA 2XWTB 4ODHH 3VDBA 2VWEE 4IRJD 1T1YA 4R3SB 1FLRL 2IBZX 4RMSA 1G7QA 1PY9A 1WFUA 2ED8A 5HI5C 3X14B 4QXUL 2R29H 4RDQG 3LRGA 1OD7A 4PBWD 3DX9B 1IGCH 4JZJA 2IEPA 1Z6JT 3M8OL 1PKQA 4X7SH 2GJ6B 4K9EL 4ELMB 3B6SA 4Q0XL 4BZYA 5LWYH 1DJSA 1A4KA 3MBXH 4K7PX 5AG9A 1JUFA 5D1XA 1DBJL 3PL6A 1CLZL 4GFTB 3VGFA 1VFBA 1WEJL 1I8MA 4U1KB 3WBDA 4PJDB 4RGND 3BT2H 5EUOA 2J8UF 2GFBB 1E27A 1R5IB 1KGCD 4OQTA 4F7PB 3WXWL 3ARBB 1QBLH 2E6JA 4OF5A 3RRQA 1TJGL 3JWNC 1II4E 2I27N 1Y6MR 3QNXB 1VHPA 1M6OB 5H37G 1RAMA 4NRZB 1X4XA 4MAUL 2AVGA 5IB2A 4YLQT 2HFTA 3C60B 5IW1B 1MVFA 4NZRL 3KAAA 5AZ2L 2DLGA 5HHXH 4PJAB 2A2QT 4LHJB 5J13C 5EOCJ 4R2GC 4ZOAA 5FO8A 3HPJB 2KBGA 3RNKA 4X83A 1BFTA 2ZG2A 2BHYA 3RVXC 1GPOL 4N8VG 4OZ4A 1RMFH 1F3DH 4YEFA 1UB6A 3UJTH 1AHWA 3FQNB 3MR9B 3F7VA 4JDZB 3QIUC 5IBLC 5E95B 4HK3J 3LKNA 2BVOB 5CP3A 3U9UB 4J3TA 4GT7A 4LHUA 4HKBA 4YBLC 2E9WA 3RKPA 1BZ7B 3DTXB 4XVTL 1ZKAA 3PWPA 5DVOA 4M9OA 3ETBF 4NNXA 3GKZA 2DQIH 1CF8H 4PRPE 5DRNB 4KPHL 4JM2F 1I7RA 3O2WL 4RFOL 4WI8A 3WLWD 3PQYE 1DLHB 2JJTC 3RL1B 3O8XC 1QR1B 3MYJA 4ZMAT 4EBQH 5SWZE 1BQUA 4EVNB 5DD6A 3HG1D 3LCYA 1SHMA 5F44A 3LQZA 3D39D 3HS0B 3CSYB 3NPSC 2R23A 5IIEA 5IVXF 5F72S 4EN3B 1LD9A 3HAEB 1BQLL 3SJVD 1PX4A 1H3XA 4UOW0 5D96B 4KRMB 4PD4J 4GQ9H 1X5LA 1N64H 3SKMB 3NGBC 2OK0H 2NTSP 3UDWA 3LKQB 2VH5L 3GBML 3OAZK 3BKCL 3AMKA 2FYYA 2NX5E 4KVCH 5T1DH 3DUSA 5JHDA 1EJOL 1IM3A 1PG7W 2AJZB 1JRHL 5DJYA 3KYAA 1WJ3A 1IFHL 3QH3B 2JLLA 3V2AR 5DQDH 4UU9A 1LO3L 2YN3A 2AJYH 2YA1A 1YEDB 1JWMB 2QADC 1T89C 1KPRB 5D7IB 3QXWA 4CJ1A 1DVFC 5DMGD 4KHXL 4I77H 4U1IB 1T3FB 1MI5D 3FO2A 4HIEB 3CC5A 1U58A 3MGTB 5A16B 3NZ8B 1JGUH 2SEBB 1L6XA 2I60L 1MCBA 2F58H 5AYUL 3EZJB 2EE3A 5DK0B 2QSTA 2CR3A 3RUGE 1ADQH 1E4JA 2IAMD 2HLAB 3VJ6B 2P44B 5I8EB 1WAAE 3V6OC 2R15A 2IANB 2X09A 1MPAL 1RJYA 5ACZB 5KBNC 1DBKL 1I4FB 5BO1L 5LGHH 5D6CA 1FDLL 2IH1A 4OGAC 4BUHA 1O0VA 4NHCL 4ZS6C 5TDNB 4XPBH 1VENA 1PDKA 1LK2A 5HDBF 1OW0C 4TUOB 5C8JA 43C9A 2FRGP 3N1QC 2P48B 6FABH 3FQRA 3RAJH 5MEPB 1QSFD 4AM0A 4R7DA 5EU3B 3ZO0A 2MFNA 3KXFD 5I1JL 1A1NA 2ATPB 2ERJC 1OP3H 3ZYJA 5D5MA 4LSQL 5ID0A 2HMID 4OB5H 3QWRD 3WJLC 5CINH 2VDRH 2CDFA 5B3JE 1S9XA 5IEKA 5DDHB 1N0LA 2VL5B 5IFHL 1FE8L 1PSKL 4NRXA 5DD1L 3ARWA 4JFOA 1RIUL 3PWLB 4LGPB 1N8ZB 2YUZA 4HIHB 1A21A 3SOBL 3MFFB 3IDNB 5HVGB 4PP2A 3JV6A 5D7LE 3BDXA 1G1CA 5ECJE 3B43A 1IBGL 3PGDA 1J1XH 1MUJB 3H3BC 4GXUM 4PRPB 1YDPB 5E99H 2EXWD 4WTZA 3WNOA 4HDIB 3PQYB 1MF2L 5F3BA 2OLDA 3DRQB 3WD5L 4F7MA 4P5TA 5SWZB 4DVBB 4Z8FL 3WO4B 1CL7L 4R0LC 1TETL 4OCLC 5E4EC 3U30C 3G6JE 3HE6A 4ONGH 3CU7A 3QXTA 3TCXA 2BSRB 3CDYA 3BN9C 1HHGA 5I73B 3QQ4B 1A6VH 3FOLB 2X4SA 1N6QH 4OD3H 2F8XC 4LDLB 1FFPA 4ZUSA 1IQDA 3HR6A 5T33L 4P9HC 4HPOH 4MMZC 4F8TA 3CPLB 3DV4A 1FV1B 4G8EA 1KC5L 4HZAA 4ODXA 1R3KB 4G8GE 3JV4A 5C2BL 3S7GA 4L8SC 2NY3C 2XFXA 3QDMA 4JRXE 2NY6B 4WNQB 1F11B 4G8FB 1AXSA 1WCBA 4RAUB 3V0AC 5GSVA 5IMKA 4NO0B 3SBWC 4BH8A 5LCVL 1WCQA 4D9QE 1M1SA 5HYIA 5J1SC 4ZUTB 3AREB 4LHUG 3F58L 4XHJC 4P3WA 1G6RB 1YNTA 4HUKB 5FHAH 3SE4C 2Z9TA 5HHNB 2V17L 5EU6A 4N0FA 4N5UA 1IZJA 3A6CL 4NO5B 4WWKD 3EO0B 3ZTJH 4BELD 4J23A 4GO6B 2C3HA 3O6LL 4QRSB 4Y19A 5E2UH 3RVVC 4L4TE 3KJ6L 5KSAD 3QHFH 3GMNA 4LSUH 3RUGB 4HSQA 1MAML 1WK0A 3QUZA 1TDQA 3B2VH 3HRZA 4NN5C 2FBJH 3FOMA 2MQCA 4P3CH 2P7TB 3BJLA 4GAYA 5I2IB 5I30L 3MBEC 2I25N 2IH3A 3BSZH 3MQIA 4PJEA 4P4RA 3E6HB 3GSVA 4JFQA 4XAWL 4EOWL 4ZXBC 1FJ1B 3SQOL 1K2DB 2DD8H 4IMLB 4JPIA 5JW3L 3DUUB 3UJJL 2NNAA 8FABB 4OCMC 1RHFA 1RUQH 3VWKC 1F8TH 3C09B 3HE7B 4WGVB 5D2NA 5I1DA 2R0KL 1JHKH 2W0FB 4EDXB 1EMTH 1L7IH 5D9SB 5DJ0B 5EIIB 1EVTC 5GS0L 4IS6A 4DW2L 5JOFB 3NIFE 4AIZB 2BSTA 3IF1B 5IESL 5DLML 5AG8A 1EERB 4XCCL 3DVGA 2GJZA 3BYTA 3WNPA 1XIWA 2Q76A 4WRLA 5IMLB 3V79C 5BVJA 4JFFA 3VMOA 1J0JA 1AY1L 5FKPB 1LO2H 2WIIB 4I18B 4XWGL 2CJUL 5JW4Q 1BQHB 5ETUB 2RB8A 1DBAL 3N50A 4NQVB 1PG7H 3SO3B 1YY9C 5JQHC 1IAIM 3MRQB 5F6IB 4I9WD 4JJHA 4PJCF 2YSSB 4K7PL 3QEHB 3QEQE 4N0UE 4DCQB 3BX7C 4M93B 3G6JB 1I1FB 4PV8B 3ROOA 2VDKH 4PV9B 1U3JA 4K55A 4C55A 5EO1B 1RK0A 1KCVL 1DP0A 4OM0H 4P5KA 3OKOA 3RZCC 4F7CA 1AO7A 4FQQA 4GG6E 2V2TB 1QFOA 4N8CL 3VW3L 1IAMA 2XXCB 5KW9H 1AR1D 1OSZB 3WE6A 3D85D 2GIYA 4KHTH 3BP6B 4X98B 3S96A 1CD1A 1KF9B 2VLJE 3FRPA 3MUGA 4Z7UE 4BFGA 2FJFA 1ZHBA 4KI5E 3S36H 3O4LD 3STZA 2D31B 3HI1A 1F4WL 5GZND 4P57A 4JRXB 3LEVH 4ZFZA 1NGWA 4RIRA 4FRWA 4UDTA 1YPZA 3VFVB 1T0MB 5C0ND 1MY7A 1I8IB 4R7NA 4QXWA 1NCCL 2HVJB 3VXPA 4X9IA 3FFCE 5EN2A 2FATL 4NGHH 5D1XC 2XN9D 4LLAA 3PL6C 1TQBB 5EU4A 4JO3L 3M1BA 2QSVA 3NCYS 4F15B 4LCUB 5GGTH 5F88A 4RFNC 2ICES 1AIFB 3NFPB 3L95B 4L4TB 5JORA 4U1JA 1CXHA 2FIRT 4ZO8A 1KCRH 5CWSB 4G3YL 1B6UA 1VACA 3BKMH 3K2MC 3TN0A 5JQ6L 3V4VL 3TH2T 4AIOA 4X4MA 1NMAL 1TNNA 3QO0B 5MEQA 2VLKD 5ESVA 4OT1H 4LFHD 2AJSH 2NY4B 3QZWA 4Y5XB 4U1GC 4JKMA 2R8SH 1D9KD 3DBXA 5C0EA 4PJBA 5DD0L 4M5ZL 2XNAA 4R26H 4ZNCD 1T2JA 2Q3ZA 3VXME 1I1AB 1CFBA 4Z0BH 4NT6B 1NGZA 4C56B 2WBJD 1AHWC 3OJVC 1NLBH 2C1PB 2W60B 1BD2D 5C92A 3CFKB 5KG9A 3MRFB 1HSBB 2DAVA 3MJ8A 3L3OB 4BSWB 4GKSB 5CZXC 3UEZA 4NWUL 4OZGE 3BFOA 5T5NG 1P6FA 2P49B 1MFEL 4ODWB 2GSGB 5T3ZE 1T7XA 4ZSOE 3HPLA 1JGEA 3KLAA 4WGWB 1LP9F 1D5XA 2ARWA 4RMVA 3X3GH 1FN4B 3QAZB 4MXVF 5BS0E 5GSRA 1EO8L 1NGQH 1F2XK 1NSNL 4NUJA 4J8RA 4M62H 1MRDL 2Y23A 4WU7B 3WMSA 3QEQB 1MJ7H 1ZVSA 1J8HA 3BPNC 4N0UB 2GTWA 1MFCH 4BH7B 4K3DL 4NQCA 4ELKB 3MRLB 4X6EA 1OL0A 1ND0A 4K3JH 5E9DA 4MLIA 3E6FB 5DHXB 5H35B 3C8HA 2NCMA 2VRAA 2X4PB 4GG6B 3UDWC 2E6PA 1SVCP 3LHPL 4JFHD 3QIWB 4Y4FB 4FP8L 1UQSB 4U1LA 2VLJB 4Z7UB 5CSZB 4KKCD 4WU5B 2CK0L 3H0TB 3B9EA 5F93C 5E4IA 1P6AB 2C4FT 4PJ7B 1ZHNB 1O5DT 3MGAA 1JPGB 5C0BE 1KG0B 3SY0B 4DTGL 1UCBH 5HGBA 1JWUA 2PXYB 3P4MA 3ILPA 5TQ2H 1W0WA 4WY7L 3F7YB 3Q3GA 4XC1H 4OFIA 5DHVB 3FFCB 5IKCA 3X3FL 1G1YA 1FORH 2EYRA 2W59A 4Z7VE 5DTFB 5SWSA 1EHXA 1CZ8L 1KOAA 1MCPH 2VXTL 2C4XA 5CHNA 3BQUA 1DBMH 4H5SB 4KI1A 5IK3B 5T1KB 1EBAA 2VSCA 5FA3B 3RIFK 2ICWI 5AZEL 2VLRA 1NDGB 4R9HA 3TVMD 2L4OA 3N1MC 3BH9A 4XCEB 3LMJL 3U4EB 4I2XB 2IQ9L 1NC4A 2VIRB 4FXGA 4LIQE 4LSDA 2DDQL 4HWBL 4MNQE 1ZANL 5IF0A 1HXYB 2R9HC 4HJ0D 2G75B 4TULL 2Q86B 3RDTC 2NTFB 1TLKA 4OLXH 3QUYB 1I1CA 3O11B 4E0RB 3OKMB 3VXMB 2DQTL 3MV7A 2D03H 4HWEL 4NO2B 1R24B 3B4NA 4PRDB 2IQAA 3T04D 2Z8SA 3V8OA 3QIUB 4RFEB 4J4PD 5GRUH 4FABL 4RAHA 4NKOB 2NY1B 4O51B 4OZGB 5C0DA 4QOKA 1WC7B 4K3EL 2H26B 1A7BA 3KLHC 4FQXD 2VLME 3OXRB 4Y4HA 4FTVB 4Y2DB 4NZJA 3ARYA 3GJFA 1EDQA 1T5XA 2YPLA 4ZSOB 1FL6B 1AGCA 3ZL4H 3MJ9A 3BRGC 5C6TL 2V2WA 5I1LA 4P5TC 1A7OL 5BS0B 1BBJA 5GHWL 3KPQB 4GXVH 1LE5A 1K8DA 15C8H 1RZ7H 4ZTPH 3CCHA 1KENL 3TZVB 5KSBE 1IC7H 2GSIA 1U8QB 3MODL 1P7HL 3EDDA 3GMPB 5BOPA 2ZCLH 5ELIA 2B4CC 4UT7L 4JY6B 2I9TA 3PV6A 1PGRB 4L5FH 1S8DA 5GGRB 1DN2A 1FRGL 5I17A 1CFNB 2WLZA 1AE6L 4U1SB 1MH5A 1EFXB 2AXGB 2IGFH 3ZYIA 3FB5B 5F3HB 3BKJL 3OJDA 2PYEE 3IGAA 4IRSA 2XA8L 5D4QA 4D9RD 5HGDB 5C0GA 1CE1H 3QHTC 1GGBL 4G80B 2BY3A 2HTLD 2R2EB 1CGVA 5CJ8A 5I8KH 2R1YB 2VKWA 3V7MA 2YPVH 1DCLA 5C0BB 2Y06H 4FFWD 2UZIH 4ZPVA 3K7UA 4FQIL 1MFDL 3MRDB 2X4UA 2DQFB 1AC0A 4F80A 1MQKH 3BGMA 4JANB 2ITCB 2QTEA 2O61A 3GBNL 3R1GH 1FCCA 4HLJA 5DJXB 5LGJA 1BFOA 4WHTA 4Z7VB 1OP5K 2FJGA 4HAFA 4LEOB 1KNOB 3S5LA 4X0KA 4Y16D 3GHEL 3WO3B 4L4VA 1YMME 4PLNC 2IPTH 3FN3A 5FUZL 3I9GH 4ZNEE 1DUZA 4FS0A 1RSFA 1VFMA 1RHHB 5I8OL 1IGYB 2FNBA 1OTUC 1RZ8A 3KPLA 1J1PH 1FBIL 3VXTB 3O81A 3R4DA 5DJAB 4GOSA 1DL7L 1QQDB 4Q6YA 3QWQB 1TNMA 3SO5A 1U93A 5I1KH 4MSWB 5BVPH 3HFML 3GSRA 1NMCB 1NAKL 2AJVH 4MNQB 3RGVA 1J5OH 5C0FA 4JHBA 4KZDH 4L29B 1X5FA 3GO1L 1DQJA 3QNZA 3VXSD 4JHAH 2Q8BH 2OTPA 5D2NC 2Z31A 1WLHA 4RQQA 1S9WA 1SJHA 2ZKHH 4DGIL 1YC7A 4ONFH 2H9GB 3MRHB 4FQLL 4KTYA 3VGAB 3HMWL 5E6IA 5DRZA 3W39B 4CVXA 1XIWC 3VFPB 4LASL 3BMWA 3MRKB 2R1WB 4UTBH 3VGDA 5FOJA 1UM5L 2I5YH 1A0QH 3FB8A 5AAMA 1KXVC 1Q9KA 3EFFA 3SGJA 1NGXA 4Z7NE 2Z93A 1G7JA 4HFUH 2QQKL 4P9MH 4XVUC 4WJ5B 1FO0H 1TXKA 3UTTD 1FVEA 2JJVA 1JGDB 2Q1EA 2P8MA 1U8KB 1C5DB 1HQ4A 1KB9K 4K8RL 5LBSL 3UTSB 1G7PA 1ZOXA 5DEFA 5DHYA 5J9PB 5D70H 3IFOB 5D1QB 3LKSB 1N4XL 4GW4A 4JREB 3T3MF 2LFGA 4KJQC 4Q2ZA 4YWGL 1WFOA 2B0SL 3BP4B 3SGKC 1TZIB 4GS7C 4HKXB 4JB9L 1JYNA 1CG9B 3SDCB 1BF8A 4UT6H 4G8IB 4JAMB 2PYEB 3DYMA 3L7FA 5IHUL 3K0WA 4NWTH 2EDTA 4P2OA 5EC1A 1CXKA 2G5RA 5F9WC 2AKRB 3Q1SH 4R4BA 5MERB 4MQ7A 4DFHA 1BAFH 4OD1L 4XMPL 5DR5L 3QQNA 4IBLT 2IPUK 2EIBA 4GKZB 4OLUL 1IAKB 3EIFA 5M94B 1WV7T 4XRCA 1DQML 4XPAH 5EBGA 4PRBA 4JPWH 4CN1A 3UBXB 4JHWL 4MJID 3V6ZA 4J1UB 2AV7B 3LPWA 1NFDF 3PDDA 5EUOE 4HUNB 3TH3T 2FCBA 4X7DC 2VISB 1ZSDB 1D6VH 1YMMB 4O5LH 3G6DL 1JHLH 2J5LB 3C8DA 2ZCKL 3OL2A 2ADIA 4DKAA 1HYSD 4GAGH 3TN0C 1CICB 3MBEB 4PRNB 4XPGH 4H0GA 1QBMH 1EO5A 1CGSH 4ZXBB 2FL5B 2Y36H 1MSPA 3MRMA 4KK5D 4PJ5E 4O00A 1N5AA 3P9MB 4TVPL 1S7SA 3B9AA 5IG7B 1I1YB 3O45B 1WWCA 1U3HC 3DUHA 4HWUA 3RTQC 3RWEA 2COQA 3U4BH 2CH8A 1FIEA 2FZ3B 3KNBB 5ITBH 3S37H 1CGXA 4FNLL 1T5WA 2H1PH 5I71B 1YEGH 2BNRA 4KQ3L 3ULVL 3DRTB 5ALCL 2ZP0T 1YEHL 3HNVL 4XZUB 3WL9B 1UEYA 5JA8B 5IMMA 4LU5L 4XNZB 4G9FA 3W0WA 4PRAA 4MX7A 4MS8D 3NTCH 2IALA 1F4XH 3X13A 4HJGB 4JCMA 5CIPB 1WZLA 4R4ND 3UYOD 2FO4A 4QXTA 4C83B 3O2VL 2VQ1A 5DJ6B 4PRPD 2JE8A 3PQYD 3K81A 5J7CC 3BPLB 3WIHA 5IB5B 2BVYA 4U6HB 1XMWA 5E6ZA 3K8MA 3ZTNL 1IKFL 4ELMF 5TQ0L 1FG2A 1U8JA 3KGRA 3G08B 3QT2A 4U1HB 2WIMA 3HI6L 1J11A 1VFAA 3P0VH 2E9BA 1BFSA 2OCFD 2H3NB 1HH6A 4M5YH 4X6DF 4QRQB 4ZTOL 4PJHF 2ZUSA 2CDEA 3CLEL 3GSOA 4TNWK 4NFDA 1U95A 1H3PH 4U3XA 5BJTB 1FP5A 4RX4A 2YPKA 1UZ8B 3UBXI 4O9HH 1NL0H 3MOQA 1D5ZA 3ECBB 3TT1L 4R97B 5EOQH 5K59F 3QPXL 2PF6A 2CIIA 4P23B 5I74C 1JFQL 1X6NA 2YBRA 1JMZA 1QRNA 1XR9A 5JMRA 2NX5D 5JHDE 3BZ4A 1RV6X 4K71C 4WFEE 2DTSA 5IQ7L 2ITDA 4I0PB 3ULVE 1HILA 3ZDYE 3DMMA 2VABB 1SEBA 1T1YB 2APFA 2NY6D 2HFFB 4A6YL 2H2PD 2WUBH 1Z5LA 3GJEA 4XNXL 1DFBH 5IB4B 3EYVA 1MFAL 4JZJB 1KXTB 4KRPB 3ARED 1PYWA 4ZO6A 1I8KA 4F57L 3L1OH 5GPRA 4JY4A 1JUFB 3BAEH 5D1XB 3S4SA 3MV9B 4GRWE 3PL6B 1SBBA 3IDJA 5JNYA 4HBCH 4I5BB 3DHJA 1CLOH 4OFYD 1I8MB 3I2CH 4U1MA 2GW5A 3W9DB 4LOUD 4KKAD 5KVEH 4TQEL 1NGYA 5GS1B 2KUTA 1E27B 4F9LA 4GBXD 4MJ6B 3QDGB 2MPAL 5HHOB 3BQUC 3HN3A 4N0CC 4JDTH 3UTZA 2VLLB 4NZTH 4OCWH 3V4UL 4S1DC 2VTFA 5GS0C 5D8JH 12E8H 1LE9A 4UZGA 5IB2B 5I1CL 3QA3B 1EXUA 1KJMA 1P84J 1B4JL 5C2UB 4U1GB 1IEAA 4PJ5B 1S7QA 2ZUUA 2YD2A 1K85A 5FO8B 1NBVL 3RL2A 3NBNA 2VQTA 3RNKB 5GGSA 4BQ6A 5D5ME 2QQQA 1FLTX 1FNSL 1MEXH 4OCRL 1FNGB 4JQIH 4LARL 3RZWA 3P73A 3FMGH 1B0RB 3WFHA 4L1HA 4ZOCA 3F7VB 3ZKMD 4Q9BA 5KANG 5IR1A 3OB8A 4S1QL 2ADFL 1A6UL 4JCLA 2N7BA 3K80A 1ZLVH 1Q0XL 3L5XL 4HKBB 4KAQH 4M6NL 1PEZA 4LNRA 5C07E 3K4ZA 3QNYA 2J6EH 4NBXB 2IPKA 4U3HA 5D7LD 5C09E 4D94A 5IGXL 1XGUA 4LCWA 5EA0L 3U7WH 5T5FL 5C0CA 5FYLL 2DM4A 4Y4HC 1I7RB 4YGVB 2D7MA 1E6JL 4PGJA 1MRFL 3BDYH 1RK1A 2A74B 4RGOL 3DYPA 5EUKB 3GSWA 4LSSL 3N1FC 5FM8A 3EOAA 4G5ZL 5DD6B 5FO9A 3FO0H 3TYGH 3NIGF 4GKNA 1EJ6A 5CMAA 2R23B 3EYUL 4JO1H 2XACC 4KKLC 5IIEB 4HW6A 3D0VA 3MRGA 3FL7A 1UM4L 5HD8C 4CVZA 5T1LA 5L9DL 1GJIA 2Y9RT 1J8KA 4NQDB 2LTQC 3M45A 4H1LA 2CDGA 1J12A 4LCYA 3LN4A 4OLVL 4KDVA 5DVNA 3EBAA 3B5GA 1E0OB 4NKIH 4O58L 2Y07H 3QFDA 5CILL 3WNKA 5GJSH 2WINB 5E1AB 3SKJH 2FYYB 4G8GD 5JHDB 3QDME 4IRSC 4JRXD 2LVEA 5CZVL 1IC1A 2E7HA 5TPWH 4O4YH 4XTRD 3PWNB 3E2HC 1L7TH 2IG2H 3GNML 3DI3B 3L7EA 4URTB 1CDHA 3ULSA 3ZT7A 5JHLL 2HLFD 1AI1L 3JUYA 5D1ZD 5DFTA 5GGTA 2P5EA 3K4DA 3DVFA 1NEZA 3EOTH 1HNFA 4X7TA 1J9CT 1QFWL 4KTDL 3O4OC 5EU6E 4OTXL 2ZSVB 1RZFH 3OR7A 1DEDA 5F8RC 2YRPA 4QNPF 2DLIA 4Y19E 3O6ML 1CDUA 2E7CA 4QWWC 4YXHH 3WS6A 2YZ1A 2WP3O 4L4TD 2UWEF 3BUYA 3IDYC 3I3EA 5L2KE 1LDPH 3VFUA 4YXKH 1A5FL 5TFSL 5D6CB 2IH1B 1T0PB 3QUML 1P4IL 5C3LD 4PJEE 1QFHA 1Z0NA 5C8JB 3FQRB 4XVJH 3BXNB 3SDAA 4AM0B 1V7NH 4R7DB 2X4OA 5F71A 1CGTA 2IBBA 5GRXG 2NQCA 1A1OA 2GJJA 4CMHC 3MV8D 5DD5L 3G04A 4OZFG 5CJXA 2OSLA 3CVIH 3D25B 4UQ3A 1MCOH 2Z31C 1KJ2L 3P4LA 3BOVA 3RPKA 3HNSH 2D7NA 1FVCA 1LHZA 1BIIB 4JFOB 5E6IC 4HUUA 4KDWA 1XF2A 2YHGA