3SDCD

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
239
structure length
239
Chain Sequence
GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSGKGLRLIYYSYGAGSTEKGDLSEGYDASREKKSSFSLTVTSAQKNEMAVFLCASGSLLDVREVFFGKGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcD02
3EYUH 2W1NA 1IEHA 1YMHB 4V1DB 3ZYZA 4JFPB 5CEZE 3SDCA 3S6CA 3C87A 1AC0A 2R1XA 3TIEB 5F96H 3KYKL 4S1DC 2F74A 5F7DA 4X7DC 2HWZL 1YN7B 2XN9D 3ALPA 5T3XD 3ARPA 5CMAB 1CFTB 2DKSA 4PJFA 4EBQH 4GFTB 4IRSA 4HUVA 4Q6IA 1QSFA 2AEWA 4LNRB 4D9RD 4PLJD 4NBYB 3N06B 4P48A 4MAUH 1W72A 2VLJE 4PJIA 4O02H 5AG9A 2ZOKA 3L1OH 5CIPB 5FB8A 3G6DH 1FFOB 5HDQL 2XT1B 3KAAA 3CXHJ 4LIQE 5IHLB 3W39A 4AM0A 2YA2A 2YRPA 1FDLL 1EEYB 3WFCH 3IU4L 5FKPA 2FL5B 1DP0A 2Y07H 4MJIE 4J1UB 4GO6B 3O11A 5A2JH 4OZFB 5I1KH 3H7LA 1BZQK 4G6JL 1MCCA 4Y4KC 2ADJA 4ZO6A 1JRHL 1HQRB 3U36B 5BRZA 5GS0C 4PG9A 4U33A 4FA8A 5AYUH 5D6DC 4Z7WE 5TDOA 5E6ZA 4QHLA 3UEZA 3D39A 5B38G 1T83C 3N1GC 3QG7L 5EOCJ 3KGRA 3QUMH 3HG1E 1U8HB 4KWUA 5D7LA 3MRBB 4Y4KB 3RUGA 4Z7WF 3R4DA 2WBJA 3QCUH 3QUYA 4JJHA 4FZ8L 3OZ9H 3DUSB 3IDYC 2Z93B 2IAMA 3O8XA 5GRJH 3OR7A 4R97C 4X6DA 4YGAB 1EVTC 1P2CA 1TENA 3I6LD 2IQAA 3VD9A 1I7TB 1Q9LA 3PWUA 3BOVA 4LL9A 1A0QH 2P24B 3BRDA 3HCVB 3KJ6H 3HZMB 5GZNC 3O4LB 1L0XA 3B2UC 4JJ5A 4I13B 1A9EB 1HHGB 4L4TA 3U0TA 2VSDA 1F2XK 4RGOH 4KDVA 3MV9E 1XGUA 3RPKA 3B4NA 4H1LH 2NW3A 2F54B 3CFEA 2RCSH 5C9JA 3HN3A 1D9KC 4GXUN 5C0AD 4XBEH 2DIBA 3REWB 3IAPA 4KTEH 4KKCC 3V5HB 5F1KC 2AXJA 5EORL 4WHYH 3WHE0 1EDQA 2LFGA 2WANA 1S5IL 2ICWA 4XNUL 1T04A 4S2SA 2GSGA 3AXLB 3V4PH 4GW1A 1KLGB 4NBZB 4JFXA 4PYHA 3O3EA 2GTZB 4HBCH 1D9KB 1GGCL 1ZEAH 1NCUA 1T1XB 3FT4A 2I60L 2Y5EA 5TGBB 5FOBA 5D96C 5TQ2L 5D7JD 1OGTA 1WCQA 2FDBP 2OSLB 2PO6C 3BEWB 3G08A 2X4RB 3BRGC 4LQ1A 2OTUA 4NYLB 1PKOA 1FVDA 1U3HD 1GVIA 4FZEH 2DLEA 4TULH 2H41A 4N0UA 3L9RA 3MJ8B 4G9DA 3QPQC 4R2GD 4M6MH 2Q7NA 2GJZA 3GIZH 5F88A 4MX7B 4KK9D 2FB4L 1HHJA 3UJIH 2QTEA 1QNZH 2PO6B 3JZ7A 4DOHE 3GSNH 3V8CA 1WWBX 2FJFB 2W9EH 3OJMB 2QKIB 3ZE1E 4UDUB 3F12B 4Y4HD 2QQKH 4NQVB 4NQDD 3L3OB 1RHHA 5FYLL 3HE6C 2BOBB 1B0WA 2MHAA 3ZE1F 5ITBH 5AZ2L 3N0PB 1EFQA 5C07A 3OG6B 3PGFH 2EDHA 4B7IA 2OYPA 5EUKB 3O4OC 3CFJB 4RAVB 5DEZA 3WUZA 4BFEA 1EUTA 1RMFL 5T5FL 3TVMA 5C7XH 4HH9B 1RUQL 4R7DA 4I2XA 5FEBA 3HE6B 2WQ8A 4KRLB 4TSAH 3H3PL 1A3QA 1JI1A 5I1EH 1LD9B 2NY6D 4GQ9L 4MQXC 4XH2A 5CS7A 1U8OA 3BGMB 3O4OB 4FN0A 2VKXA 5ADPH 3MBEA 1DEDA 2DQFB 4PR5A 2JKXA 4KK5C 3RI5F 5IFHL 5KAQG 5ERWA 3P3YA 4QO1A 5FYKE 1F3JB 2IPKB 3L7FA 5E00B 3NACL 1NBZA 3S5LG 4S0SD 1OM3L 1XGPB 4N0FB 4WY7L 1QYGL 2QEJA 4K7PL 5CGYC 5MERA 3FO1B 4MCYB 4Z7VE 3B6SA 3WIHL 4P4KD 3MLVH 2Z8VC 3ZT6A 1RK1A 2HLFC 4JG0H 2Q87A 4GG6B 4Z7VF 4MDJA 3QIWA 5DUPL 2BNUA 4R0LC 3WDHA 2M1KA 4LSQL 1RU9L 4RFEA 5DHYA 4UOW1 3IDXH 4KV5E 2F5AL 4BH7A 1TETL 3QFDB 3O3DB 3PQYD 2VABB 4NN5C 5FHBL 5GGTH 4U6YA 4KV5F 4R0LB 3HI5L 5JHLL 1A4JA 3VXNB 3WHXA 4QXTA 2L4OA 4W6YB 1A7OH 1EPFA 4PGEA 3VRJB 5EN2A 2EDTA 1KIPA 4OT1L 4X6EA 4X6FA 3JWOC 2BVUA 3LN9A 1NGZB 2HT4C 4JANB 3QO0A 4P5MB 5DQDH 1HSBB 1XGRB 4KJQC 5FIEA 3KLHD 4JPWH 4IRJB 2FX8H 1CDIA 1UA6H 1FZMA 5CLTA 4MJIA 3LD8C 5IEKA 3BJLA 2HTLC 1PDKA 3MBXL 5I18H 1Q8MA 3I6KA 4ZMAT 3RNKA 4J23A 2HVKB 3ALWA 1MFDH 1AO7D 1BJMA 4Z7WA 4WCYH 2VLMD 1I3UA 2Q3ZA 1S3KL 5I66B 3BIBX 1BM3L 5DMIH 3EOTL 4XPBL 1HYSC 1Z2KA 3HG1A 1J18A 4M1GL 2V2TA 1A9BB 2O5XH 4QRPB 4NNPL 4ONFL 3SE8L 1P84K 2BY3A 4HZAA 3OAZH 5JHDE 2RR3A 1YC7A 4ZO8A 3HI1A 1BQHA 4P5TA 2EDYA 1T6VN 1GXEA 1E4XI 2HN7A 4P46A 3MYZA 4O9HL 8FABB 3T0WA 2X4PB 4D0BB 4F2MB 1SYVB 3KPQA 4DW2L 15C8L 3OB0K 2BVOB 1AH1A 1EHLH 1YYLH 4JFDD 4K8RL 4CN4A 4HMDA 3KPLA 1JP5A 2CUHA 4ZFFA 4I3SH 4I77H 4ODSH 2BDNH 4PG2C 2OI9C 2O61A 5DJXA 3LSOB 3N9GL 2FECL 4PRID 1NEZA 3T08A 1FBIH 3FQRA 3S34H 1AJ7H 1T1YA 1TPXC 4PYGA 1FZKB 3TNMA 1Q9WB 4N8VB 4EI5D 3T2NL 2PYFB 2FO4B 3FOLA 3KPRE 3O81A 4IHOA 5JQHC 2V7HA 1JV5A 1JZ8A 2NY3D 2OI9B 2NXYB 4WHDA 2KZ1B 4X99A 1WBYB 4JKLA 4WEMB 5L88H 4EQ3A 4YXLH 2ZG1A 1WIPA 4YDJA 3WIFA 3A6OA 5CP7A 3LEVL 2IJ0C 3ETBF 2AK4D 3D48R 3MRKA 1TPXB 4AT6A 1GGIH 1JMXA 1ZLUH 2PTVA 4XP6H 4HWBA 2Y06L 4WVRA 4YDIH 2HT3D 2MFNA 4XBGB 1IGIH 5MHSE 1ZVSB 5CGTA 4NQTA 3DGGB 1IKFL 5ISZE 2APFA 1ETZA 4JRYD 3EOYG 4X5XB 1X5XA 1KCKA 3MCG1 4MJ5A 4NDMB 4B0MM 5C6WH 4MQ7B 4OLXH 4XRCA 4Z0XA 1YY9C 4NQEB 3LH2H 3AMKA 3VFPB 3QA3B 5F89B 3Q6GL 3EYSH 1CXLA 2GY5A 5TDPB 1OT1A 4XXDA 3IFLH 2WUCH 3KPMB 5C0FA 4R26L 4XNYL 1MF2H 1A5FH 5GSRA 4WUKH 5ALBH 4K8RD 2ESVB 5B8CC 5KVGL 2KKQA 3X14A 1H9VA 4S1RH 1E6JH 5I8EA 5C0CE 5INDB 3UTTD 2HFFB 2D31B 1BFSA 1S7WA 4E9LA 3FB6B 1TZHA 2FCBA 5EO9B 4N8CL 2CD0A 3BN9C 3VXMB 5B8CB 4UV7H 5CZKA 3GM8A 3UTQB 1YPZE 2NLJB 3U83A 2J8OA 1MRDH 4R90H 4HWNA 1H3PL 2JB5H 4OFYA 3KYOB 4XVUD 1ND0A 1QLRB 3CFDB 3ARUA 3KXFE 1A6WH 1YPZF 2ZOLA 4HS6B 1ERNA 1MJ7H 1OTSC 1NDMB 3QXVA 3V8OA 1RZJL 4LPTA 4U1GB 2DD8H 4WU5B 4NKIH 4ZS7H 1TVBA 4KQ3H 3TF7C 1T5WA 1JYWA 2M26A 1T22A 5IJKA 3FMGH 4G6KH 1T6WA 1CFVL 4M6OL 2YBRB 3IGAB 4Z7VA 3RWHB 1KPRA 3UO1H 1MI5D 1J8HD 1NJ9A 1S9VB 2X10A 1C5CL 4KY1L 3P4MA 1XGTB 1FGVL 5D6CA 2DWDB 2I9TB 3EO9H 4NM4L 3QQ4B 4YHKL 1MUJA 4PJCB 1T89A 3QEHB 1VPOH 1GZPB 1HINL 4PUBL 5FA4A 5EOCH 3G5ZA 3L95B 2BOCB 4JRXD 4LLUA 3OKDA 3QIBC 5E8PA 3EO0B 1EFXB 3EYOA 1JZ2A 2P5WB 4HKXA 1NAMA 2FIKA 4XAKE 3WEXA 3NOIA 3NCJL 2KH2B 4OKVB 2UZIL 4OQTA 4LPYA 4PRAB 2GJJA 3K81A 3UXFA 5KSAD 1BBJA 4QXUL 2C1PB 3MLZL 2V9RA 4GBXC 4JFYA 2Z35A 1A8JH 3VXUB 1UWGH 2N7BA 3KHQA 4WW1A 5EC2B 3VJ6A 5D7KE 3OV6A 3MGOB 3T0EC 1A6VL 2V7NA 2FJGA 4RAHA 1T2XA 4OZIB 1S9XA 4Y8DC 3HS0B 2PTTA 3MV7E 4JY4A 1LQSR 2XY1A 3FB5A 4GBXB 1MCOL 5F6IC 5SV4A 1V8HA 1XF3A 3DURB 5BVJA 1I7ZA 2JELL 1I7UB 2NY4C 4A2MA 2ADIB 4YXHH 2I26N 4K3GA 5ESVA 3G9AB 3VMPA 2HMIC 1FFPA 3JBG7 1JHTA 3GMMB 4KJWC 3GSVB 4MNGB 3T0EB 3V6ZB 8CGTA 3G5VA 4NC1C 1A6UL 5ILTH 12E8L 2W0PA 1T66C 3QEQB 2DLHA 2ERJC 2IANE 4IDLA 1MCWW 4JFOB 5F6IB 3RZCA 5BW7C 5D7IA 5SWSA 2NY4B 4OSUH 4NRYA 4U0RC 1T0NA 1I1YB 2X1WL 4Z7UE 2AXFA 3I9GL 5DVLA 4H8WL 4R96B 4NWTH 2I9LA 4YEFA 2IGFH 4E5XA 4NZTL 2H32H 5MENE 1UGNA 4L1DA 3GI9L 2AXGA 4JKMA 1A1OA 2ERJB 4Z7UF 4M3JA 2Q6WA 3FOMB 2VDML 3EHBD 5IGXL 5DO2C 4NT6B 1YEIL 4LSVH 4U0RB 3IXAA 4XCFL 2XWJB 3MRHB 1C08A 2R69H 5F7FA 5FO9A 3VD5A 4FMFA 3JWNC 3D1MC 3VFNB 5ADOL 5KJRL 3GSUA 2G75B 1ZV5A 3PWVA 3KPRA 2IADA 1N0XL 2W60B 3LQZB 3T09A 3NCFB 1RIHL 1K3ZA 4ZQKB 5IHZB 1XR9B 1Q94B 4ZUSB 4DKEH 1X4YA 3QULB 2DQEL 2XKNA 4IRZH 5J6GB 1ADQA 4G6AC 3QXUA 3FO9A 5HI4C 5INCB 2NXZC 3UCRA 3Q0HA 1TJGL 1IFHH 5D1ZC 1HILA 5C09D 1YMMA 5GRVL 1B0RA 4OCLC 2LU3A 4XC3H 1S8DB 5E8NA 5L2KE 4UDTB 3VFRA 5J9PA 2AJUH 1WIUA 2YD9A 5I2IB 5ISZA 2ITDB 4BZYA 2QLVB 1I7RA 2PUQT 3CLFL 4ZD3L 5BS0D 5IB2B 4UB0H 5KSVB 2D0FA 1CXKA 2DBLL 1DQDH 3QDGD 4UT6L 3SDYH 4Q9CA 4M7LL 4GKSB 4OF5A 3EFFB 4CMMA 1K85A 2LTQC 1MLBB 5FO7A 4Y5YB 3RJQB 4N1EA 3QXWA 5FYLH 3P0VL 4NUGL 2GI7A 4MAYA 3VXQA 3BPCB 4BZ1H 3LS4L 1T2QH 5EZJA 1F5WA 3VXOA 4DUVA 4K23H 4PD4K 3GBNH 1LO5A 3F5WB 4MZ3A 1I9IL 4HKBB 3T77A 1EGJA 3KPOB 2NY2D 2LTQB 3T0DA 1Z3GL 2P8LA 4OUUA 3TYFB 3RPIB 1G7MA 1ACYH 3QNYA 5F9WB 4WEUD 4G8GE 4H1LG 5DT1H 1EHNA 2YRLA 4BSWA 4GQ9H 3TZVD 1MFBH 2BVYA 4LASH 2R1YB 1WFUA 3DUUB 4HUNB 4Y5VA 4WHYG 1JPSL 1ULVA 1YPZA 5IFHH 3OGCA 4OBRA 3SOBH 3QEGL 5HHMB 5F93C 3TV3H 3PV6B 2YPLE 5C2BH 1SEBA 2OP4H 1NMBL 4AMKL 1DQJB 5DFVC 3IETB 4F80A 3KXFA 4X98B 5CUSH 1OPGL 1A1MB 1MHCA 1QYGH 1CLCA 3GB7A 4IDJL 1MCRA 1WCBB 4XZUB 1BAFH 5T1LB 2CH8A 1EX0A 3QUXD 2DF3A 5CINL 1W8OA 2BSED 3U4BH 4XXCA 3WYRA 3RU8L 2ZUSA 4M6AA 4MNHB 1F58H 1FORL 1BIIB 3VXRD 3ALXA 5DUPH 4PJ9D 4WWKD 2QV2A 1F6AA 2EKSB 4Q7DA 3T8XB 5EO1A 2R8SL 2C1OA 4I18C 2KQNA 4XC1H 4OAWA 3IJYB 4NQXA 1S7SB 3EJYD 2YA0A 4PBWD 4IM8A 4UQ2A 1DUYB 4YWGH 1G7QA 1OD7A 4W4NA 4S1SH 1JK8B 3NBNA 3AUVA 3SDCC 2HFGH 3C5ZB 1VGEH 2QQNH 5JHLH 3IU3A 2I5YH 3LVEA 5F7WC 4I18B 4MXQD 4L3EE 5BZDB 4RMWA 4JFHD 2D4DA 3QDMA 4P5KA 2Z8SA 4U1HA 3LKRB 3U9UB 1A7QL 1N3NA 5EBWB 2X1PA 5F3BB 2A2QT 2ARJA 4LCYA 4U6XA 1CD8A 4OT1H 1AY1H 3OPZL 4IRSC 2BFVH 1N7MH 1GIGL 4Q6IC 3SDCB 4YHOH 2R1XB 3ZKMD 4PJ8D 4A6YH 1CG9A 2F74B 4JPKH 4XVTH 5F7DB 4NOFA 3P30L 3HMWH 1EO7A 3S4SA 2HJKA 3MBXH 2P44B 3KYMA 3ROLA 4PJFB 4LLDA 3K4DA 2W0LA 4IRSB 4HUVB 1P6AB 2D7PA 1QSFB 4Q6IB 4OZGA 5JUEL 3TJHC 4ONHA 1A22B 1MNUL 3AS3A 4Q9RL 1EAPA 1N64L 1QLFA 5DZLA 1P7KA 4PJIB 5F9OL 3BH9A 2ZOKB 5FB8B 1IM9D 1NCBL 1QG3A 4NZUH 1CGXA 1JTPA 3KDMA 3UX9B 2FHBA 3EDJA 2RGSA 2CDFA 5T3XE 1HYRC 3OL2A 3W39B 4XPHL 4AM0B 1BVLA 1KBGL 3GSWA 5FKPB 1HHHA 2C4FU 4M00A 3O11B 5C8JA 1ZT7A 4D9RE 4M03A 2IANA 1F4XH 1QVOB 2ADJB 2AGJH 2WBJC 4XBPA 4X7TA 1KGCD 3QUYC 5BRZB 4PG9B 1DQQA 1RULH 1FQ9C 2DQJL 3O8XC 3I3DA 4Z7UA 4ALAH 3I85A 4I0PD 5TDOB 1JYXA 4GQPH 1M7DA 4WTXA 3D39B 4D3CL 5E70A 2NCMA 3MJ7A 1OQXA 3IYLW 1PAMA 4LSRH 5D7LB 1QFWH 4ZFGL 2WBJB 1FCGA 3ZSSA 2OL3A 3QUYB 2O5ZL 3PHSA 25C8L 2IAMB 3O8XB 2F19L 4N8PA 4UILH 3OR7B 3S8WA 4X6DB 4TSBH 1FFRA 1Q0XH 1P2CB 1HSAA 3NA9L 2IQAB 3IVKA 3QIUD 5TFSH 1DBJL 1Q9LB 3PWUB 4NZRL 3ZL4H 2EE3A 3VFVA 5BMFH 2YEZA 5HHOD 3BAEH 3D3VA 4JJ5B 3U0TB 4L4TB 2GJ6E 2E6QA 2FGWL 3VFTA 1C5BH 5KTEH 4HQQL 1XGUB 5AG8A 3I6LE 1YEHL 2NW3B 5LGJA 1BOYA 1B9ZA 3CFEB 5CKAA 5C9JB 5ID0A 2VXVL 1PD6A 4JKKA 4P99A 4X7FC 4OLZL 1PY9A 1CF8L 5L2KA 1RUAH 4Q9BA 2VE6A 3MRJA 5DD3H 2BMKA 3HB3D 5FECA 2ICWB 1ZT1A 4FFZL 1T04B 4S2SB 2GSGB 4ODVL 4GW1B 4JFXB 3O3EB 2A83A 3DX6A 3UJTH 5EU6E 3VFGL 2YN5A 1DBKL 4L3AA 4L9LA 3CU7A 5FOBB 4X4MA 1C1EH 3AMLA 4ZNCD 3G08B 4RZCA 1WTGT 4H20H 2OTUB 1X5JA 1U6AH 1FVDB 5KVGH 4N0UB 2CLZA 5KSBE 3L9RB 1GPOL 2Y1VA 4G9DB 4UT9H 2GJZB 3BYTA 5F88B 3GSXA 1HHJB 3NZHL 5DMYA 3UPRA 4EUPH 5IFAH 5KSBF 2NY7H 5EBLA 3WFBH 4LVHC 1CZ8L 3AAZA 1EVUA 1KENH 1MHHA 3LN5B 2OS7A 3INUH 1CE1L 1EZVX 3EO1A 2Y5TA 3CSBA 3TVMC 1WGOA 2F58H 1DLFH 1H3PH 1S7UA 1IZKA 2NZIA 1RHHB 3DMMC 2MHAB 2O93L 4WO4D 4IBLT 5C07B 2DLGA 1RZ7H 4RX4D 4Y16D 3GNMH 3P2TA 4LVHB 3ARTA 5DVNA 1F4WH 1U8QA 4GSDL 3SKNA 4GKNA 3ZTNL 3TVMB 1KIUA 1INDH 4QOKA 1VKXA 4R7DB 5GS0L 2X9WA 4I2XB 1A3LL 6FABL 2EDOA 1HIMH 4NQDE 1PX4A 4XH2B 1C5CH 2VH5H 1U8OB 4Z0BL 4V1DD 1BVZA 1AGFA 3ZHLA 3GMLA 3MBEB 3S96B 4PR5B 2P7TA 2W0KA 5ERWB 1HINH 1SJHA 2ZCLL 3CXDH 2W65A 1NBZB 1ZA3A 4M61A 4N90D 4K9EH 5F7EL 1DQLL 2V9TA 1AIFA 3QIWC 4BELD 3IJHA 5DRXA 4LSSL 3B6SB 3OKYA 5IUSA 4S1DD 3E2HC 1DCLA 3JV0A 4LVOC 3SY0A 1RK1B 1KSRA 2C3GA 4L3EA 4X7SH 2C9AA 1D5MA 2YSSA 3ARDA 1M05A 3KVQA 3QIWB 4MDJB 3DO7A 4M7KH 5E1HB 1KULA 2BNUB 1YQVH 3RL2A 3HC3H 4FNLL 4XPTL 5ICZA 4RFEB 5DHYB 1MCIA 1ES0A 3FN0L 3E2HB 4LVOB 5I1IL 1RZGA 5IB3A 4BH7B 1EUUA 1WAAE 2Q7YA 4BK5A 3R8BB 3OJDA 1AR2A 1LO0L 4NFDA 1WAAF 2EEDA 1A4JB 1B3JA 3WHXB 4QXTB 1MCOH 2DKMA 2FHCA 4ODTL 4Y4KD 1PLGH 1NFDA 5I1HL 5EN2B 4OV5A 5GS0D 1KIPB 4EOWL 1JWUA 4X6EB 4X6FB 3T2PA 3PQYE 1A6UH 3QO0B 1CQYA 3WFZA 5IEKB 1FZMB 2WLYA 4MJIB 2R1WA 4U1IA 5D2LE 3BKCL 2FR4A 3RNKB 1G84A 1T5XA 3C8DA 1UYWH 4LOUC 5KBNC 3M1BA 3O4LD 3N85H 5D2LF 5AEAA 3WNPA 1Y6MR 2AEPL 2J6EH 4Z7WB 1FC2D 2EH8L 4UIKL 4MXWL 1FNSL 4P5TC 3RWCA 4P2YA 4HT1H 2F54D 2G60L 1FZJA 4P46C 3HG1B 2BX5A 3O2DL 1ZHBA 5I1JL 3B2UD 3STZA 3RKPA 3UYOD 3HI1B 1FVCA 1BQHB 4KK6C 4P5TB 3S37H 1AO7E 4I0KA 4X4YA 3JV4A 3MLYH 1JNLL 2HN7B 4P46B 2VLME 5I15L 4HV8A 3D87B 1D9KD 1MRFL 3IKKA 3KPQB 4KKCD 4OLYL 2KPNA 3MOQA 2EDLA 4ZFFB 2GJ6A 4F3FA 3LHPL 4AQ1B 4ZOEA 1UKQA 3A6CH 4WI7A 1VACA 3MV9B 5DJXB 1QSZA 1G9MH 2VB5A 5HGBB 1NEZB 3WXVL 3V7AG 2IALA 1P4BH 5KAQF 3FQRB 4QT5A 3ZLQC 1T1YB 5KVDH 3TNMB 3B2VL 3FOLB 4HJGA 4GKZA 4IHOB 2PO6D 2V7HB 5D2NA 4JFDE 1JV5B 4MHHG 4C4KT 4X99B 3B9VA 1P7HL 4CNIA 3WIFB 5CP7B 4PRIE 3QPQD 5EU6A 4AT6B 1UB5A 4EVNB 1BX2A 4RFNC 5HI5C 1FGNH 4OFVA 3AU1A 4M8QA 4LSPH 4LPXA 2EXYC 5I1DA 3O6MH 5IESH 4L3CA 2EDKA 1ETZB 1KN4H 2BNQD 3HE6D 5KSBA 1QRNA 2AK4E 5GRWA 4RFNB 4MJ5B 3QDJD 1KCVH 1Z0NA 3LQMA 4Z0XB 1MH5B 3MUJA 3O2WL 4PB0H 1JGLL 3ES6A 1UM4L 4IS6A 4TNVK 1HHIA 3CH1A 2R0WL 1JPSH 4XXDB 1E6OH 5C0FB 3JWOL 4WFHD 5J89A 3OJ2C 4JRYE 5GSRB 2EE2A 1H3XA 4MQXD 3RVTC 4HG4K 2XA8H 3X14B 5FGCE 5HD8C 3AS2A 5GRVK 1N5YH 3BEVA 2FD6H 4HIXL 4KK5D 5I8EB 1MCFA 3FONA 1S7WB 1K4DA 1YEKH 3ZE0E 2E9BA 1TZHB 1CVSC 1IEAA 2FWOA 5CILL 2OJZH 1G7PA 4XGZA 3ZE0F 5TQ0H 2Y6SC 5CGYD 5F44A 4OCYL 3CX5K 5E08L 1DL7L 1J87A 3OAYK 5IJKC 1FVEA 3L7EA 1V3LA 5ESQA 4QHKJ 5FV1L 3QG6A 3WXWL 1ND0B 2OJEA 1OL0A 2HLFD 2ZOLB 2XG4A 3UTTE 3MUY1 5CBAA 3G9VA 4PY8J 1EEQA 4LKCA 4Y0GA 1OY3B 1TVBB 3GKWL 3CFBA 1F45A 1T5WB 1T89C 1T22B 1U8KA 4ZAKA 1OGAD 3BKJL 1FPTL 2GFBA 4QRRA 5IW3A 3GHEH 5F9JA 1ZLWH 4Z7VB 3V2AR 1KPRB 3BPNC 2COQA 1JHKL 1WLHA 4PJEE 4U1LA 5F9DC 5IK3A 4Z6AT 4YDKL 4BFGA 3QWQB 3UBXG 4BQ6A 1B4RA 3JV6A 1MIMH 1WICA 1MUJB 5B21A 1D6VL 4PJEF 3RL1A 2CLVA 1E4KA 4MA1B 4DK3A 2DTSA 4WFGD 4ELME 3HRZA 4NKDA 2OR9H 5FA4B 3WNOA 5JORA 3X3GH 3BPNB 3ZSTA 2WSKA 2RIKA 2QL1A 3G5ZB 5A2LH 4APQB 2R29H 4LLUB 1WAAA 2OLDA 3LY6A 3OKDB 5E8PB 4ELMF 5I30H 2NY0C 3OXRA 4OCRL 4JCLA 1MI5E 1HKFA 1J8HE 1GC1C 2HT4D 4W68A 1J0KA 1HZHL 2IBBA 2W92A 3EYOB 4KJQD 2DIAA 1Z5LA 4HKXB 1NAMB 2FIKB 3WEXB 1RUPH 1MCKA 2HTLD 3P73A 5IHUL 5E4IA 4KMTH 1NCBH 3JWDL 2A6JA 4U1JA 3VGAB 3C8HA 4JRXE 5IROC 2PXYC 3GSOA 5I1GH 3HZVA 1BBJB 5J06A 2FZ3A 2UUDK 1DE4A 1VENA 4IOIA 4FABH 1U8MA 2Z35B 1IC4L 3T0BA 3VJ6B 4LNVA 4GRWH 4XVJL 1HYSD 2DYPD 1A2YA 5D2LA 2V7NB 2FJGB 1S9XB 2M2DA 4HKJA 1B88A 4JY4B 3FB5B 1A4KA 4OIIH 3RZCC 5BVJB 1XF3B 1S7VB 1I7ZB 4ZXBA 1G0DA 1AFVH 5ESVB 3PXHA 2ADGB 1FFPB 5C0BA 1JHTB 3JTTA 1YUHA 5CZXC 1PEWA 3G5VB 2YD4A 4BFBD 5EBGA 3MZTA 2NY5C 4RA3A 3KYNA 4H5SB 3PGDA 3H3BC 4HLJA 4KU1A 4ODXB 2LV4A 3N1QC 3RZCB 5SWSB 3LEYH 1XGYL 1AO7A 4NRYB 2Q1EA 3DX8A 1T0NB 2D7MA 2GCYA 4M62L 2AXFB 1RIVL 3TO4B 2F53A 4RISH 4E5XB 2CR6A 2YHGA 5LGHH 1MQKL 2B1HL 2X42A 2AXGB 5TF0A 1A1OB 1J88A 3MLUH 2Q6WB 2NTSP 1LE9A 4KHXH 5I6XC 1BQLL 4XCYA 1MIEH 3GBML 1AQDA 1MJUH 3IXAB 3PJSB 4K55A 4HFUH 2VXVH 3BPLC 3S5LA 1C08B 2B0SL 2UV3A 5FO9B 4JQXA 4LEOA 4G7VL 2AW2A 3GSUB 4J3SA 4XP5H 3PWVB 3KPRB 3O6KH 4XMLL 5I6XB 2IADB 1I9JL 3DUHA 3QUZA 4JFDA 4K7FB 2XACC 4ZFOA 2H1PL 1P1ZA 3RJDA 5TPWH 3IDMA 5J7CC 2YZ8A 5AZEL 4W81A 1OAUH 2XKNB 3CDFA 1A6ZA 3FO9B 4JFQA 4JO1L 3LKNA 5F1NA 5GGQH 3FO0L 4NWUH 1YY9D 1HILB 2ESVD 1ORQA 1YMMB 2VLRD 3TT3H 4EI5A 1BGXH 1B0RB 4PS4L 5DEFA 4HIIB 5E8NB 3W0WA 4JHAH 4KQ4H 1EERB 3VFRB 5J9PB 1JTOA 4HBQA 1W0YT 5ISZB 4ZFZA 1I7RB 2AK4A 1ITCA 1AD9A 1XEDA 3VXMD 4HK3N 1YYMH 4OZFH 5C09E 1CFBA 2WW8A 4P57A 5DI8B 4CMMB 1CGTA 5FO7B 4CU7A 4MAYB 5LWYL 3IDJA 3VXQB 4HJJL 1M7IA 2ZUUA 2GTWA 3BN9D 4JGUA 4OFPA 5DURB 4UT7H 5EZJB 1G6RH 5J4MA 2BRRH 5BS0E 1LO5B 2CMRH 4GSDH 4LLYA 4R4FL 2MOVA 4Y5VC 32C2A 3O2VL 1P7QD 1CK0H 1CGWA 5CZVL 4JM4L 2P8LB 4OUUB 4U1NA 1G7MB 2ZCKL 3QNYB 5GPRA 3RWGA 2VDKH 2C3HA 6FABH 2X44D 1OTSD 1BEYL 2ZP0T 4WDIA 4QHUA 1M1SA 4BSWB 2GEEA 2E6JA 4KZEH 5BJTA 5DR5L 2WP3O 3CDGA 1LHZA 1YPZB 4XXCC 1YEEL 3OGCB 4G80A 1BFTA 2L7JA 5C70A 3VWKB 4U7MA 3G6JF 1SEBB 5BV7H 5CAYB 3GO1L 3KXFB 1EFXD 2P8PA 3NCBB 3SGEH 2FYYA 1MHCB 1F13A 3GB7B 4X9BA 5E4EC 2ARJQ 2P5WD 2XQBH 4M7JH 1CGVA 1W0VA 1JZ5A 1OAQH 1VEPA 4KRPB 5SWZA 4ISVA 3QIBD 1OP9A 1TZGH 4PJEA 1YJDH 2DAVA 1R3KA 3FL7A 1JIBA 4TNVF 3UC0H 5F7MC 2OQJA 3DVFA 3GRWA 5E4EB 1F6AB 5EO1B 2C1OB 1HEZA 4OAWB 2KBGA 4NQXB 3GK8L 4EUPG 2CK2A 4NHCL 3ZMRA 4AYFA 4UQ2B 3CD4A 1G7QB 4KGJA 4HGKC 4UBDD 3MJ6A 3BP6A 2WBWB 2WINA 1GGBH 3CSYB 5JA9A 2VDRL 4FQHA 5DLML 1MEXL 4KTDL 2K1MA 2JCCA 4YFEA 4GBXD 3IU3B 2X4NA 5F3HA 4YR6A 3BD4A 1JL8A 2OR7A 1T0MA 1FAIL 5DDHA 1UXSB 1U3JA 4P5KB 4U1HB 3QZWA 1JF5A 3T0ED 1AGCA 1N3NB 4NCC2 3THML 1LEKA 2ARJB 4LCYB 4U6XB 5T1KA 1WT5A 3WBDA 3BUYA 1A7PH 1H3GA 1QLEL 4K94H 4DVRL 3IB4A 2Z31A 1CG9B 3N1PC 4P9HL 1LK3L 2NY4D 5L9DH 3PP4H 3S4SB 2HJKB 2HMID 3KYMB 4KJWD 3EKCA 3ROLB 4JFHE 1HH6B 2Q86A 4LLDB 4RFOH 4UMGA 1R0AH 1I3VA 4P2QD 4JDVA 4WFFD 3GJEA 2VDLH 4N1HB 5MEOA 4CDHA 1X4XA 2AEPH 1EAPB 1QLFB 4Q2ZB 1HHKA 2EH8H 1P7KB 5E2TL 2A1WL 3T4YA 3ZT5A 3L3JA 4OTXL 1MCQA 3BH9B 1QBML 1DBAH 4JM2C 4WGWB 3KDMB 4EI6A 2R4SH 2CDFB 1RVFH 1GC1H 5DJ8A 4JQVA 3GSWB 1HHHB 4CN6A 4L8CA 5DJDA 3BT2H 4HSQA 1M71A 3DXAA 5ALCH 5C8JB 1ZT7B 2IANB 2YD5A 5DO2D 1UQSA 4G3YL 4Z76A 5E2UH 4QXWA 4XBPB 4X7TB 3DGCR 1DQQB 2VRAA 2VR5A 3IFNL 4Z7UB 5DJ0A 1H0DA 4FQJL 1NBYA 1M7DB 5KOVC 3MOAL 1I9EA 2HJLA 3N50A 4HIEA 3MRRA 4GS7C 3MJ7B 1P4IL 1KJVA 4NN7C 3V4UH 4OGXH 2OL3B 4OI9A 2FEEI 1MFCH 3TH3T 5H2BA 4G6AD 1GHFL 5EPMA 1ED3A 5HI4D 2NXZD 3MR9A 1HSAB 3EJZC 4YHZL 1JGVL 1K9TA 2BRQA 5D1ZD 1RQ5A 4OD2A 4GS7B 2XZZA 4O2EA 3BQUA 4NM8H 4NN7B 1YN6A 4YE4L 2NW2A 2YEZB 5DD5H 5CJXA 4GMSL 1OTTC 3BVNA 3I75A 1UWEL 3D3VB 5D8JL 1OP3H 3CMOL 2WLZA 2F8VA 1GOFA 1Y6KR 2B2XL 3VFTB 3B3IA 3WCYA 4XPGH 3CXHK 4KVNL 3SN6N 3U46A 2NNAA 5LGJB 4U7SA 5ID0B 5DYOA 5LCVH 3HNSH 2MTPA 2R39A 3PWNA 4Z5RA 2F5BL 1MRCH 2WQRA 4L9LC 1OAKL 4QLRA 4PRPA 5L2KB 3MREA 2OK0L 2VE6B 3AREA 3MRJB 2BMKB 3BYYA 2CKBH 3ME0A 5FECB 4M4RA 1ZT1B 4YUEL 2BJML 1YY8B 1L9NA 3EAKA 3P77A 4UQ3A 1FSKC 4YHIA 2A83B 2RB8A 2IFFH 3IDGA 2I07A 1CIDA 5D93C 5C09A 3R0MA 1QP1A 3GI8L 4L9LB 4AEEA 1KCSH 4GAFB 2Q8BL 2AEQH 4NNXB 1AD0A 4RZCB 1SMAA 2EYSA 5CSBA 1W72L 1J0HA 5SX5H 1QOKA 5MEPA 2CLZB 1AXSA 1NCCH 5D93B 3QT2A 4XP1L 5FYJL 3MMEA 5J1AA 2ARWA 4JHBA 3GSXB 1SY6L 1AGEA 1TFHA 5DFVD 4MHHI 3UPRB 5EBLB 4JFZH 5HYJA 1VB9A 3AAZB 5BVPH 5KS9A 1MHHB 2JE8A 3U82B 1JZ4A 4HX1B 3EO1B 4FFVC 2Y5TB 1DL7H 4PBXA 1S7UB 2VZ3A 4QRUA 5GRZA 3EUUA 3E3QC 1IAKA 3WIIL 3UP1A 4OCWH 2VR9A 4ZTOL 1I9RH 4PRHA 1U8QB 2X1OA 3SKNB 1VEMA 4GKNB 3WFHA 3RY6A 2VL5A 3OKOA 4QOKB 5FK9A 4JGMA 1VKXB 2XPGB 5IW6A 3LS5L 4I3RH 1V5JA 1PKQE 4GAGH 3UTSA 3C2AL 1EH9A 3D25A 4O2CA 3TT1L 4TYUA 1OSPH 3DV6A 1AGFB 2WWKO 4ZUTB 1FNAA 3GMLB 2CJUL 4DTGL 3BI9X 3SDCD 3SKJL 3ULUL 2P7TB 3PGCA 3QEUA 5GJTL 3RWJA 4LHUG 5F7YC 1SJHB 3K4AA 4M9OA 5GHWH 1IBGL 3A67H 2W65B 5DUML 3EDDA 1ZA3B 3NIGE 4M61B 5EU4A 4X8JB 4HPYH 4O5LH 4H25A 1AIFB 3ARDC 3TP4A 1CL7H 3IJHB 2HKHH 3KJ4C 4IRSD 1QQDA 1QSFD 3NIGF 5DRXB 4V1DE 5I73C 4HWUA 1UZ6E 3SY0B 4WWKA 2J88L 4KKLC 4L3EB 4U6HA 5FYJD 1F3DH 3W11C 3D0VA 3WO4B 4YHLH 1D5MB 2A73A 2YSSB 1EO8L 1DQML 1M05B 3JWDH 3QPXH 5FGBA 3DO7B 1AQKL 1UZ6F 2E7MA 4N90E 3KJ4B 4FXLA 3RL2B 3TJHD 1NPUA 3OB8A 2CK0L 5ICZB 2YD7A 3MOBH 5H8DA 5HYFA 5I73B 1ES0B 1RFDL 3MLWL 2V2WA 1RZGB 5F1SA 3ZHDA 5IB3B 2Q7YB 4QTIH 2QQLH 3NCYS 1LNUA 1YEFH 3N1MC 1PX3A 3DVNA 3QUMA 2FJHA 1YEJH 3OJDB 3LB6C 1F8TH 1UKTA 1CT8A 4P3DA 3D39D 1S9YB 4IOFC 4NQCE 2V5YA 1YECH 2Z92A 3MUZ1 1IGCL 5GJSH 5D7LD 1LP9E 2WBJD 3DVIA 3JTSA 4NNYB 4PLJC 4OV5B 3TH4T 3UBXI 4NQUA 1JWUB 4OFDA 1ZLSH 1CGYA 2DQIH 1LP9F 1DUZA 4JO2L 1ZK9A 3V52L 4CVZA 2R2BB 3I6GA 4MB3A 3PP3H 2R1WB 1GYAA 1RUKH 4E0RA 5L6YL 4U1IB 1SBBA 4WFED 2QADC 1L4IA 1CDUA 3KPPA 4OGAC 1T5XB 2GKIA 3M1BB 5FM5M 4H1LA 1A7BA 1L7IL 2AI0L 3UYPA 2D03L 3NAAH 4RGMC 4AH2A 3X11A 3X13A 3MTRA 4RA0C 3RWCB 1OW0A 1QFPA 5DFTA 1FZJB 3FHAA 1X5ZA 2QADB 4UZGA 1IKNA 5J12C 1ZHBB 4IMKA 4KXZH 1RJLA 5HVFB 1S9KC 3O4LE 3PL6A 1MREH 3STZB 1MPAH 2DI7A 1FVCB 5HHVL 4X4YB 1H3UA 5ENWA 5T3ZL 4HV8B 2HRPL 4ZUVA 3ARBC 1VGKA 4EN3A 1G9EA 2F54E 2EH7L 3V6FA 2P46B 4KPHL 2D2OA 3WLWC 2OM5A 4HIJA 2GJ6B 5D2NC 4F3FB 5HYIA 4X6BA 4WV1A 1VACB 3SQOH 2IALB 1KTLA 4PS4H 3GSNA 4QT5B 3SPVA 4HXBL 2FLBT 3WSQL 1MAKA 3FQNA 1FNEA 5J11B 5FCUH 3GUTB 1J12A 4HKZA 1KTKE 4GKZB 5D2NB 1TCRA 1HXYA 1E0OB 5DHVH 5CEZL 4F7TA 4LARL 1MFNA 4AEHL 5BO1H 2R2EA 4CNIB 2R23A 4MD5A 1URLA 3QH3A 4CBPA 5EU6B 1UB5B 4NN6C 3ULVC 4RGNC 3MNZA 3P0YH 4TVPH 5C07D 1BX2B 1D5BA 3TH2T 2VO5A 3AU1B 1QBBA 2AP2A 4M8QB 4Z9KB 2E9IA 4S1QH 1FP5A 2YD3A 3GJFH 5CEYA 2DN7A 1NCWH 4UNUA 2IG2L 3TVMD 4Z8FH 5I1DB 3QHZL 2IF7A 1OAYL 4L3CB 5TH2A 1U3YA 1UH2A 1ZGLM 3DMMD 1BIHA 5KSBB 4JM4H 1QRNB 3QI9A 1L6XA 3IRPX 3O9WA 3WN5C 3BDXA 4LIQL 4QYOA 2F8OA 3ES6B 3CDCA 5D7JB 3V9FA 4IS6B 1HHIB 2IMNA 2W9DH 5C6TL 2BNQE 4OFIA 3FT2A 4R2GB 1NLDL 3QNZA 3QDJE 4CVUA 2EDFA 4LGPB 3V0WH 5K9JH 3BEVB 1FH5H 1T80A 1RHFA 1IC7H 3FONB 1RUML 1K4DB 3RBGA 3HI6H 3H42L 1T03L 2K3TA 2DWEA 1QFWI 1IEAB 2FWOB 2GT9A 4DJMA 1PKQA 3P4OA 2O5YL 3B5GA 3H9SA 3QIWD 1NEZG 4WFHE 1G7PB 3HMXH 4WO4A 3DPBA 4ZAKC 4RX4A 1FVEB 3L7EB 2UZYB 4Y16A 3GIVA 5ESQB 3LKSA 5GGTA 4ETYA 3BKYH 1HOCA 3QG6B 5LXGH 4OCXL 3QCVL 2OJEB 3CZFA 3RAJH 4M5YL 2DIJA 2IQ9H 4NHCH 1S7RA 5CBAB 1FYHB 4LGRB 5ACZA 4LKCB 1XMWA 5GGVH 5IOPB 3CFBB 4KZDL 4AIZA 2FLRT 1U8KB 4ZAKB 2GFBB 4QRRB 4JPVL 5I1AA 2DQTH 1G7LA 5F9JB 1T1ZA 4YFLI 1KCRH 4U1LB 5IK3B 4QNPE 2IH3A 5EZLA 5A40E 3JV6B 4JZJC 1CVRA 3RL1B 2CLVB 1G7HA 3V7AE 4QNPF 1SVZA 2HH0L 3HRZB 4TRPL 4NKDB 4MJID 5JORB 1OGAE 4JZNA 1MSPA 1B4JL 3GSRA 4NP4H 3MLXH 3OXRB 3BX7C 4HWBL 1D7FA 1OAXL 4PY7A 1QKZL 3P4NA 4LDEB 4H0GA 2AJYH 3DV4A 3L3HA 5CHNB 2APWA 4ZOCA 3OHXA 1Z5LB 2FX9H 4NQCA 2R56L 2EC8A 2G5BA 4WFGE 2D7TL 1D5IL 1JCKA 1KPUA 3HG1D 4P59H 4M7LT 1LP9A 4LOUD 1TTUA 4GW5A 3GSOB 3HZVB 4FMKA 5JW3H 5DD1H 2FZ3B 1DE4B 4IOIB 1I3GL 1U8MB 2ORBH 3PQYB 4K3JL 1JWMA 4P5TD 2PW1A 2V17H 4LU5H 4I4WA 4ZXBC 2ZPKL 3A6BH 3JXAA 2OXGA 1A2YB 5D2LB 4CL7A 3H9HA 2Y23A 1B2WL 1ZA6A 4LKXA 3B9EA 5IG7A 2XY2A 5HTSA 4KK6D 4LSTL 4ZXBB 7FABH 5C0BB 3JTTB 5EOQL 1YUHB 3C6LA 2XXMB 3I50H 3KYNB 1IGYA 3SO5A 1U0QA 2D7NA 3PGDB 3BGFC 1SJXA 3EYFA 3O0RL 4FQ2H 1FNLA 4OD1L 1AO7B 4CRPA 3BJ91 2YUZA 3DX8B 3EDKA 3O3AA 2GCYB 1IGTA 5FYKL 2F53B 4X6CE 2WV3A 1RAMA 3SGJA 3REVA 3BRFA 1ZMYA 3T2OA 4JQXC 4UTBL 5C9KA 5E8DH 1BFVH 4UIMA 3MACL 3BGFB 4BFIA 1MHPH 1LE9B 4X6CF 5AWNL 3QUZC 1SBSL 4XCYB 3QCTL 1AQDB 4PJ7E 4EDWH 5DEGA 1INEL 3FAWA 3OTTA 3S5LB 4LEOB 3HNVH 4PJ7F 4OD3H 5HI5D 1P69B 4MA8H 1N6QH 2YUVA 5JTWA 3QUZB 4TPRL 4JFDB 4XPAL 4YHYC 5CWSA 3U79A 4ZFOB 4F9LA 2EXYD 1P1ZB 3RA7L 3IDMB 3E8UH 3ILQC 4PRIB 1A6ZB 5D4QA 2FBJL 2E7LA 2CDGA 2XKUA 5F1NB 4LVNC 2GW5A 1OAZL 1TDQA 4JR9H 5GIRA 2YR3A 1ORQB 1LO4L 4YHYB 4EI5B 1NAML 3FCTA 3QRGL 2UZXB 4KUZL 5DEFB 4J8RA 3W0WB 5EB9A 4OQTL 4EQ2A 2MQ0A 5FUOL 1MCLA 1DSFH 4WW2A 4ZFZB 1SY6H 4LVNB 3L3GA 3NGBC 1DBBL 1IGMH 2AK4B 1AD9B 3RVTD 5FCSH 4J3XA 3TO2A 4HD9A 1DLHA 1OOAA 2DLFH 5HD8D 4PGJA 2VDNH 4M5ZH 1BD2A 4MNQD 2VLRE 4P57B 4OFYD 3AC0A 4ERSH 3BFOA 1MWAH 5FYKD 5IWLA 1AE6H 3IDJB 3NGBB 4P2OA 1M7IB 2GTWB 3VGEA 2Y6SD 1DTUA 5JW4R 3QDJA 4LLYB 5FGCB 32C2B 3MLSL 2YK1L 4U1NB 1HWHB 3RWGB 5FA3A 5KSUA 4O58H 4QHUB 5IV2A 4O4YL 1IZJA 4ORGA 5BJTB 2ZCHH 3CDGB 3UPCA 4G80B 2OMBA 4Y5XA 2YPVH 4U7KA 2NY5L 1RURL 5ICYA 3VA2C 4L8SA 2P8PB 2GITA 4K2UL 2FYYB 2VDOL 1REIA 1LO2H 1IEBA 4OF7A 4I3GA 1UWXK 4PB9H 4PJCE 1W0VB 4NCDA 5I8OL 5BXFA 3WS6A 3RVXC 3S35X 5SWZB 4ACPA 4ISVB 3LZFH 4PJEB 2NY0D 4PJCF 4U1KA 1R3KB 3RWIA 2OQJB 1QSEA 4L5FL 2C26A 1NUGA 3BN3B 2C4XA 1P53A 3QQNA 1RFDH 2PCPA 3RGVA 1CLZL 1ADQL 1OGAA 3WUWG 5L7XL 3BP6B 2WINB 5DJYA 4KI1A 1AXTL 2PXYD 4FQHB 1ZS8A 4OKDA 4XT1C 2JCCB 2EEAA 2VZSA 2VDQH 2X4NB 5F3HB 4YR6B 2Z31C 1T0MB 2A77L 5DDHB 1A7NH 1ZVHA 2VR4A 3CX2A 3QZWB 1AGCB 2G5RA 3CMGA 1LEKB 5T1KB 2DM7A 5CSZA 2VAAA 4OZIE 2Z31B 3GFUA 5ETUA 3RZCD 2NY1C 1R3IL 3R8QA 5SWSD 2H32A 2DQDL 3RWFA 4NQSA 5JR1H 3SGKA 4OZIF 5CZXD 2Q86B 3V0AC 1TVDA 4MNGE 4WRLA 4JDVB 5IVZA 3DI3B 4JQVC 3I2CH 3GJEB 1I8KA 5MEOB 4H88L 2YRZA 3X3FH 1HHKB 3SE9L 3T4YB 3L3JB 4TUKH 1H5BA 5H37H 1ITBB 3SE3C 3CPLA 4OBSA 4EI6B 3WKML 1UENA 5DJ8B 2DYPA 3H6JA 1DBMH 3V4VL 5DJDB 4BQBA 4L8CB 4P2QE 4GT7A 1M71B 3DXAB 4WFFE 1QO3A 2H45A 1UQSB 4M7ZC 2AJVL 4KUCF 3U0WL 1RJZA 1K6QH 5A3IC 1BJ1J 1PSKL 5CJQH 3BZ4A 3K46A 5DJ0B 1H0DB 4ZTPH 3OMZA 4X6CA 1NBYB 4YFLF 1V05A 2QHRL 4HIEB 3MRRB 1YMMD 2AEIT 2DJ4A 1KJVB 3BQUC 3L5WA 3MCLL 3W81A 1PW3A 5CJXC 4PJ7A 3K2UL 3VDBA 3V5DA 4PJDE 4DCQA 4TOYH 4OIAA 4DKFL 4HXBH 5EPMB 5H2BB 1ED3B 3MR9B 5K93A 1AI1L 1TCMA 3H9ZA 4PJDF 5SWQA 5J1TC 4O2EB 3TBYB 3CK0L 1JNNL 2X89A 3BQUB 3MRPB 4UU9A 5JXEA 2NW2B 3MUHL 1JFQH 1X9QA 3D9AL 4LSUL 1KJMA 2SEBA 3BVNB 3I75B 4BZ2H 1SM3H 3O6LL 2H6PA 3UBXA 3AREC 4F58L 4F9PA 3B3IB 5DURD 4JVUA 4K3EL 1X5GA 1K8IA 3U46B 2NNAB 1CFQA 2VISA 1NGXB 5I76A 4FQPA 5DYOB 1HQ4A 2IG2H 3PWNB 4EEEA 4Z5RB 1WSST 1UM6H 1KN2H 3LIZH 4HCRH 4PRPB 3MREB 4HXAH 2LU7A 1FNFA 3C8KA 2NQCA 3AREB 3NH7L 3VD3A 4KKNA 2B4CH 1EEZA 1SYSA 3BZDA 3WLBA 4QY8A 3P77B 5EZOH 2QSQA 4UQ3B 4YHIB 5K9QG 1NGWA 1AR1D 3IDGB 3TN0A 2I07B 5C09B 5DRZA 3VI4E 2VLRA 4FQCH 3T65A 4AK1A 1FRGH 5GS2H 1AD0B 3VI4F 2EYSB 2YPKA 4PV9A 1BHGA 3JVGA 1O5DT 5MEPB 3EYVA 2DL2A 1AXSB 2WM0A 5FUZL 3S36X 3MMEB 5EU3B 5FKAA 5J1AB 2XNAA 3KLDA 3Q1SH 3B5HA 4R4NC 3MCKA 1LGVA 4ZNEA 1AGEB 1T2JA 2DOCA 2VZUA 5C0EA 4X80L 3ZKNC 2DJUA 5EC1A 5E99L 1A1NA 2MCPL 5KS9B 4XP9L 5DC0A 2FATL 3RY6C 5B3NA 2ZG2A 1MQ8A 2X1QA 1OD9A 4QRUB 1J11A 3PHOB 2MJWA 4Q9QL 3SGDI 1IAKB 4HPOH 3U7YH 3VW3H 2CGRL 4OCSH 1G9NH 3F58L 5I1CH 1P7QA 3UJJL 5J13C 2BHYA 4LLAA 1A3RL 1JGDA 1XGQB 2J4WH 3WFHB 2QJDA 2VL5B 3OKOB 5FK9B 2OL3L 3TZVB 4GAJL 4NJ9L 5IW6B 2DQGL 5F7KC 3D25B 3QDMD 4HWEH 1S7TA 4KVCH 3MFGB 5I8KH 1C5DA 4O2CB 4A6YA 5J13B 3DV6B 3SDXA 5LQBL 4N1CA 2EIZA 4Q58C 4G42A 1RZFL 3PGCB 3QEUB 3VG9B 3I02A 3RWJB 4OGZA 4N0YH 5EU4B 5IB1A 4GOSA 1QFHA 4H25B 5D7KD 1S7XA 1B4JH 1WTLA 5FGBC 4JN1L 4ZSOA 2WMPA 3EJYC 2DJSA 4DVBA 1QQDB 3GDBA 1KEML 4NJAL 4WWKB 3GZKA 4U6HB 4R8WL 1MVFA 3D0VB 2KL6A 3O45A 2Z8WC 2A73B 4PP1C 3VFWA 1C16A 1HKLL 4PJFE 3VDAA 1GAFH 1MAML 4J6RH 1QSFE 1E4WL 2V2WB 5T33H 3MA9L 4TSCH 1ZT4A 4PJFF 3FHQA 4JDZA 4YIQA 1LNUB 3SDDA 4JE4B 4JM2D 3QUMB 2FJHB 4KHTL 4GLRH 4JDTH 5IQ9A 1CT8B 4P3DB 5GGUA 2Z92B 1KTRL 4ETQA 1LO3H 1IGFH 3V6BR 1PG7W 1JN6A 1E4XL 3JTSB 4JO4H 3NCEB 3AVEA 4ENEC 4MD4A 2OCFD 1OWRM 2DDQH 4JY6A 1DUZB 4ODHH 1JI2A 1FO0H 4CVZB 3IKCA 4HEME 3I6GB 3D39E 4E0RB 4P2QA 2C3XA 3NFSL 3KPPB 5D72H 1JPTH 1AGDA 2DQHH 5D7LE 3RUGE 1F90L 4IMKC 4FXKA 4H1LB 3D3VD 5BW7A 2QSCH 3BPOC 1N2RA 3PL6C 1IJ9A 4AH2B 1PVHA 3X11B 3RUGF 3X13B 3MV11 4M1CC 3S88H 1KEGH 2VAJA 4M43H 5AWNH 4LEXL 5IMMA 3AS0A 4EN3C 1ZWIA 1Q9KA 1WZ1L 4WFEE 1OTTD 1YEGH 3BPOB 5HHXL 5L2KD 4LAQH 3TYGL 1RJLB 3TC9A 3PL6B 5JNYA 3U1SH 3NIDE 5IBTL 4P3WA 1RIUL 3MLTA 5ENWB 4WV1C 4TPRH 3DI2B 1QRKA 4EN3B 3HAEH 3NIDF 4H0IA 1JGUH 3V6FB 4I5BA 5EZIH 3VFUB 2XQYG 3AB0B 2YXMA 2ADFL 4HIJB 4RMQA 3MQIA 1OAZH 4X6BB 4UTAL 1IT9L 4WV1B 1TIUA 3QFJA 1KCUH 1KTLB 3MPCA 3GSNB 4EUPA 5D1ZA 3SPVB 4F57H 3FQNB 3U9PH 1FNEB 5FUOH 3TIDA 4FRWA 5DWUH 4HKZB 3KG5A 3NCCB 4GRMA 4XCNA 1TCRB 2OZ4H 2ZJSH 1HXYB 4LLWA 1Z9SA 3NVQA 1EMTH 4F7TB 4ZO7A 3ESVF 4XNXL 2R2EB 3HB3C 4F8QA 2BY1A 2R23B 3NTCH 3M8OH 4XCCH 4MD5B 3QH3B 4N0UE 3UTPD 4WI2A 3MNZB 3QI9C 4OM1L 5JLZA 3O9WC 2V2XB 1D5BB 4HAGA 3BWAA 4RMVA 3BISA 4HLZH 5IJVA 5CEYB 3RVWC 4FFVD 2VC2L 4QOKD 5TH2B 5D7SL 3MLSH 1KV3A 4KJPD 4TTGA 1IILE 5ICXA 3QI9B 3O9WB 4E41D 2BSRA 4QYOB 5C07E 3PUCA 4C83A 4DN3H 5D70L 3O41A 4YBQC 4F37F 2EDEA 5B3JE 4EDXA 4M93C 4K3DH 3H2WA 3FT2B 4AEIL 4RQQA 2DTMH 5B3JF 1MFEH 4NGHL 4NHUA 1N4XH 1QBAA 3VE0A 3ZO0A 4GRLC 1MCDA 1WQVT 3M17A 4Y16C 3Q48A 1KELL 2DWEB 2GT9B 1KB5H 1PKQB 5DUBA 4M93B 3P4OB 3QJFA 3E6HA 4M48H 4BUGA 3ARDD 2E3VA 3RZWA 4WO4B 2VXUL 5KVEH 2MPAH 4OM0H 1I1AC 4OLUL 4Y16B 4JAMA 3GIVB 3LKSB 3WE6A 1HOCB 2EDWA 1QA9A 3OJVC 1FL6B 3NPSC 3VFSA 3CZFB 4KKLD 3W11D 2VDPL 1F4YL 1S7RB 1DVFA 2A9ML 2P43B 5ACZB 2M8XA 1QFUH 4AIZB 5F7UA 5JXAL 3QXAA 5EUOE 4JGJA 4WNQA 3P11L 1U9KA 2E6PA 5I1AB 4OZ4A 1T1ZB 4HWZA 3NPSB 3C5SA 5DD0L 4FQIL 5EUOF 1BF2A 1E28A 2IH3B 1J86A 5C3TA 4YQXH 5EZLB 3OF6A 2R0LH 1MCPH 3LB6D 4NZJA 3WFEL 3GKZA 1QHPA 1BJ1H 2QQQA 1G7HB 4QEGA 4IOFD 4QHKI 4YO0A 1MLCA 3HC4L 3L3IB 4MA3A 2DM2A 1Q1JH 4JZNB 1XIWA 2J6EA 2ZKHL 4NPYA 4PY8I 2RAMA 3GSRB 1OP3K 2B1AL 1CIUA 3BGAA 4HHAA 2D9CA 3P4NB 1OCWL 3WFDH 3DV4B 3L3HB 1CR9L 5E2WL 3STBA 3OHXB 4FFYH 4UV4L 1KC5L 4NQCB 4AL8H 4OLWL 2G5BB 3BKMH 2QADD 3GMRA 1KPUB 4OGAD 3CDYA 3ULVL 1LP9B 3LQAL 1G7IA 4GW5B 4JN2B 2GYSA 1XFPA 4XWGL 1R5IA 1U36A 3MRQA 3QHFL 1JWMB 2PW1B 4ONGH 4I4WB 1UCBH 1EV2E 1TNNA 3C6LC 4MS8C 2PR4H 3H9HB 1FLTX 2DMCA 2BHUA 1ZA6B 5H35A 4LKXB 1IC5L 2GJ6D 5DGQA 5IG7B 3MJ9H 5SX5K 5GISH 2VXSL 2Q3AA 1TZIA 2N56A 3HPLA 3ARBD 3C6LB 3MLRH 3DSFH 3SGJC 1IGYB 3WLWD 2BVPA 5EWIH 4YAQA 5EU5B 2FIRT 4P3CL 3EYFB 3IDYB 2DQCH 4OF8A 4WEBL 5MP6L 5C0NC 4R97B 5TDNA 3U30C 3O3AB 1RZ8A 4M1DH 4FQLL 3VD4A 4A2LA 1IGTB 1AC6A 3RRQA 3RTQA 4XNZC 4AG4L 2CIIA 5EU6D 5KANG 1ZTXH 3IAGC 4UIMB 1LEGA 4BFIB 1YC8A 2MKLC 1OARH 4OF3A 3LN4A 1ZOXA 1CL7I 1BVKA 1WEJL 1ZLVH 5E24E 4LHUA 3U30B 4ZDHA 4F9LC 5DEGB 2HG5A 2BXYA 3EIFA 4F7EA 4LHJB 3TCXA 4J3UA 3ULVD 4RGND 1QRND 2E7LC 5FYJU 5T1DL 1OB1A 3UYRH 5KW9L 4LF3A 5CWSB 3VD7A 1NFIA 3FTGA 5GGSA 3QWOA 4Y8AA 3BH8A 1RZKH 4O2FA 4BSVA 2E27H 4WW2C 2AVGA 2CDGB 5C92A 1Q72L 4FQ1H 1CLOL 1PFCA 5GIRB 4RMSA 5JDSA 5D96B 1NCNA 3FCTB 4J8RB 5C86A 2Y36L 3WV0A 2HKFH 4DQOH 1FLRL 4WW2B 2G2RA 3L3GB 5IWLC 4P2OC 4BH8A 4X80H 2Z91A 2MQCA 4LK4A 5AYQA 3TO2B 1DLHB 1BMGA 2XG5A 4XP9H 1IAIL 1BD2B 5E9DE 3MODH 3CVHH 3S35L 4YC2C 1F6LL 5TF1L 4P2OB 2JJTA 4JB9L 4X9FA 2ATKA 2BNQB 3DMMA 1NUNB 3UJJH 3FAXA 2Q76A 3QDJB 4ZAKD 4YXKL 4QRRD 1F4AA 1OP5H 3R1GL 1MJ8H 4Y5XC 2P42B 4NJ9H 4MNQE 5FA3B 4FXGA 4YC2B 3NABH 5KSUB 4L8SC 4JVPA 5IV2B 1FE8H 5HHPA 4X0KA 5DRNA 3MRFA 2R4RH 5K9QI 3OX8A 4KXZI 3CCHA 4ORGB 3PP3K 2A9NL 2KUTA 2DI9A 4Y5XB 4LCIH 3WS6C 5B39A 5ICYB 4L8SB 1A02N 5I71C 4XMPL 2GITB 2RQ8A 2PETA 3U7WL 4JO3L 1IEBB 1M4KA 5EUOA 4U6VH 1VFMA 3I84A 4QXGL 4Y2DA 2AJZA 4K3HA 3RGVC 3BMWA 2UYLA 1CS6A 4U1KB 3PWLA 1WWAX 1OQOA 3CVIL 3RWIB 4XHQA 5JOEA 3VG0H 3R0NA 2XZCL 4ZFOL 1NUFA 5HVGB 1QBLL 1D6EA 2EO1A 5F7HA 3RGVB 4DGIL 1HI6A 1CICA 5D71H 1OGAB 3BXNA 2FRGP 4LDOB 2XICA 3CNKA 1J0YA 5DJYB 5HDLA 4HGMA 4KHTH 1UM5L 1ZS8B 3HFMH 4JG1H 3P9WB 5CJ5A 3L5HA 4NN5B 5IR1A 5GRUH 2AABL 1HXMA 2XRAH 3QAZC 4ZXBD 3SGKC 5C0BD 5I75C 4G6ML 1N5AA 1UZ8A 5CSZB 2VAAB 3MXWL 1NSNH 5EH1A 5ETUB 1YNKL 3W5NA 2H32B 1KFAH 2WUBH 4I0CC 1H5BC 2GIYA 3RWFB 4NQSB 1OHQA 3NFSH 5I75B 1R5WA 1W8NA 1PG7L 4QTHA 3LD8B 4TQEL 2F53D 2DLTA 2BCKA 5DS8A 4JKPL 1I8KB 2H2SC 1R3JA 2B5IC 1WJ3A 3T4AA 2Q8AH 1UEYA 1H5BB 4XP4L 4XAWL 1NCDH 5IMOA 5D7IE 5SWSE 3EJJX 3CPLB 2MQ3A 3KR3L 1WZ1H 4G5ZL 2GAZA 5CCKH 1TJHL 2UWEA 1NGQH 5B4MC 4P2CG 1YNLL 2DYPB 3ARFA 4LPUA 4NOBA 3DRTA 5D7IF 1JNJA 4R3SA 5FFLA 2B5IB 1QO3B 1YN7A 3QUZD 3V0VA 5CMAA 3C09C 1HCFX 1Q0YL 1Z9LA 1SJVA 3WNNA 5FHAL 1CLYL 1XZ0A 1RJZB 3KWWA 1QUNA 1QD0A 4EJ1C 4LQFL 4X6CB 3HTLX 3CFIC 4HC1H 3MRMA 1BOGA 4CVWA 5I0DA 2HFEA 3C09B 3L5WB 4ZOBA 5JXEC 3MXVH 4ONOA 4OLVL 3W0WD 4PJ7B 5CJOL 3V5DB 4DCQB 4MA7L 5L8KB 3ILQD 4J1UA 4OZFA 4KAQH 3FQUA 4EKXA 4F9PC 3W2DL 1PJ9A 5SWQB 3QZWG 4KK8C 4UU9B 3VRIA 4GXVH 4J4PD 3S36L 3HKFA 4NKQB 1QHOA 1TNMA 1YMME 4OGYL 5EIQA 3TCLA 3BSZL 1KJMB 2SEBB 2YKLL 3BDYH 1J0ZA 5FF6A 1G6RA 4RWYH 2H6PB 3UBXB 3GHBH 1V7NL 3X17A 1VCAA 1C7TA 1A6TA 4MZ2A 1KJ2H 1K8IB 3C08H 3WS3A 3QRFM 1J5OH 2XZQL 1CFQB 2VISB 1S9WA 5IKCA 1WZMA 5I76B 5KVFL 1HQ4B 2VUYA 4OZHE 3TN0C 1W0WA 2DM4A 3TWCH 1JPGB 3CFCH 5JIIA 5I19H 3C8KB 4D9LL 4DN4H 2P24A 4OZHF 1EEZB 1O0VA 4XCEB 1SYSB 3WLBB 4QY8B 5T3XH 3JVGC 4JPIA 3RX7A 2R0ZH 4OB5H 4FTVA 4YZFE 5F6HJ 1NGWB 3SKMA 4XMKL 3TN0B 5DRZB 2VLRB 4S10A 3T65B 5E9DA 3P4LA 4KI5C 4WJ5A 4YZFF 4M6NL 4G7YL 1CU4L 2YPKB 4PV9B 5BZWA 2CO6B 3HAEG 5JO5B 1PBYA 3EYVB 4NO3A 4ZPTA 5GRYA 1NGPH 5FKAB 2XNAB 1IE5A 3VGDA 4HS8H 2LVCA 2YMXH 3MCKB 1KJ3H 2A6DA 5SWZD 5GQBA 4JHWH 4MNQA 5C0EB 4X7CC 2AJXH 2X4QA 5EC1B 2FH6A 1A1NB 1TJIH 3RY5A 2Y4SA 3E0GA 3IAQA 2BC4A 2XQYK 5EA0H 4YGVA 2F8XC 4OLUH 2IWGA 2R0KH 5IMKB 3RVXD 5IVOA 4F33A 5GS1A 1P7QB 1UACH 3LKQA 1L7TH 2YUXA 1NL0L 1JGDB 2V9QA 3IDIA 1XF5A 3CGTA 5IF0A 2VITB 2ITCA 1V7ML 1IGJA 3P11H 1CXFA 4QRSA 5FGSA 5TJWK 4JCMA 4C4KO 1S7TB 5BOPA 4FQIH 1C5DB 4A6YB 4GMTL 2VXQL 4J12A 3KYKH 5DZOA 2X7LA 5T1KD 3SDXB 4B7LA 2EXWC 2EIZB 2HWZH 1BBDL 3IS0X 4G42B 4OUOA 5TE6L 1G0XA 2Z31D 3I02B 1MFAL 1CXEA 1EJOL 4LCUA 4YHML 5K59E 3DIFA 1L0QA 1L0YA 1AXIB 3BIKA 5IB1B 2AERT 3TJEL 3QDME 3FFCD 4ZSOB 4PJXA 5DMJB 4DVBB 4LRNL 5K59F 4Q0XL 4RMRA 5C0RL 3QIBB 2PYED 5HDQH 4QWWC 4UBDC 1K4CB 5I74C 2NY1D 3LPGA 3DARA 1JZ6A 4L4VE 1LD9A 1P5UA 1FDLH 3D85D 3IU4H 3O45B 4RMTA 3SDDC 4MQSB 2GUOA 3VFWB 3WD5L 4G6JH 1C16B 3DBXA 4UINL 3WDIA 5BQ7A 1JRHH 5E00A 2CDEA 3DXAD 4OZGE 5HHNA 5I74B 4L9DA 5IROA 1N8ZA 2PXYA 3BD3A 3QDAA 1ZT4B 2R2HA 35C8L 3GMPA 1J05A 1UXWA 3VXPA 2EDXA 2FX7L 4JDZB 4U2ZA 3T1FA 5DJZA 3QG7H 3SDDB 4OZGF 4YBHA 4CVXA 5IQ9B 5FYKU 5GGUB 4ETQB 4FZ8H 2DQUL 2MNUA 4U2YA 1JN6B 3V6OA 3TPKA 5A3ID 3MZGB 3IRZA 2O26U 43CAA 4MD4B 4OIBA 4UAOC 3WNLA 1TXKA 4JY6B 4RDQG 5IBLC 5CBEA 2H3NA 3TM6A 3IKCB 1A7RL 3O3UN 4P2QB 3BQUD 4JFED 4JM2F 1FG9C 1AGDB 2RJMA 1DN0A 4K71C 4FG6D 3MJGX 4FXKB 3W82A 2IPTL 4UAOB 5LBSL 1IQWL 3B9KA 3RX8A 4XWOC 4JY5L 3OAUL 4M9PA 1MJJB 3EYUL 1BZ7A 5EORH 5E5RB 3ZE2E 5IMMB 2CKBA 4CAGA 4K71B 1S5IH 5DMGC 1Q9KB 4XNUH 3QDHA 5F96L 4PRPD 4QCIA 5GGSY 2P8MA 4IRJA 5JIHA 4PJDB 3MROA 4KRMB 2BSSB 3ARED 4X4ZA 3ZE2F 2ED9A 3D3VE 5JNYB 1NMCC 1GGCH 2VL4A 4MMZC 2I60H 3MLTB 5TQ2H 4EBQL 5E8OA 1CDYA 3LOWA 2C5DC 4MAUL 5GXBB 4I5BB 4O02L 3LDBC 3L1OL 1NMCB 5J1SC 5F97E 4TVSa 3Q6FA 3ZDZE 2NXZB 3QFJB 1M7XA 2FB4H 2EE9A 5JW4Q 1NKOA 4HMEA 3WFCL 1I1RA 4EUPB 2Y07L 5D1ZB 5DQJA 4OZHA 3WUWA 3ZDZF 1X4ZA 4MQTB 5I1KL 4ZS6C 3U7AA 3TIDB 3RBSA 2EC9U 3LDBB 2Y7QA 4AENA 4XCNB 4LLWB 5DJ6A 1BF8A 4X4ME 5HYJD 3EGSA 5AYUL 5AZ2H 3PABA 5KANI 2X4OA 4HF5L 5HYSG 4PRDA 3QUML 4R4ND 5JLZB 1RMFH 5T5FH 3BWAB 3ZKND 5J0BA 3MNVA 4JFFA 1FNHA 3IF1A 3OZ9L 1RUQH 3VXSA 3IJSA 5IJVB 4PRHD 4PJGA 3RWDA 4HG4J 5A2KH 1N26A 3H3PH 5GRJL 4K9EC 1FZOA 3HR5A 4WIQA 1U41A 3UTSD 1CDJA 5ICXB 1A0QL 3UTPE 3K80A 3KJ6L 3VCLA 3WJLC 2BSRB 1XF1A 4P4RA 1U8IA 4C83B 2LQRA 3NACH 1OM3H 3O41B 4U3XA 4RWHA 4WY7H 3MRLA 5I0ZA 4EDXB 2ID5A 1IAII 4K7PH 4QOKE 1X7QA 5ABDE 2ZUTA 2RCSL 1N0LA 3E3QE 3WIHH 4RQQB 4XBEL 4E41E 1X44A 4KTEL 4NHUB 1TITA 4F7MA 1EXUA 1ORSA 3M17B 2V5RA 2PKDA 4QXGH 3P40A 3V4PL 3X12B 4LSQH 5DUBB 3RQ3A 1RU9H 3QJFB 4NBXB 3E6HB 1DVFC 3MFFA 4HBCL 4U0QB 1ZEAL 2F5AH 3TBTA 1TETH 2L7UA 7CGTA 5I16A 2GQHA 1X6NA 4JAMB 1I1CA 4TN9A 3WE6B 5FHBH 3AFLA 1QA9B 3VFSB 1HN1A 3HI5H 1RY7B 1NAKL 4FZEL 4TULL 3HPJA 5LVEA 4PP1D 3OKLA 5IFJA 2BK8A 5JIPA 4M6ML 3QXAB 4CDGC 2HFFA 3GIZL 4WNQB 3UJIL 1QNZL 1BFOA 1JGEA 4HWZB 4M4PA 3GSNL 2NZ9C 2W9EL 1XIWC 4L4VA 1E28B 3UTQA 1KOAA 4X5LA 2QQKL 4YO0B 5ITBL 1MLCB 3PGFL 3QJHA 4MCZA 4MA3B 2Z4QA 1XIWB 4NPYB 1W72B 4ENED 1NFDE 5C7XL 1S3KH 4HHAB 4LLVA 2XZAL 2MKWA 1BM3H 1YQ2A 3EOTH 4XPBH 4WI8A 2YBRA 1FV1A 4Y1AD 5C2UB 3RWHA 4TSAL 4M1GH 4HK0A 1NFDF 5I1EL 4NNPH 4D94A 4ONFH 3SE8H 2H2PC 3GMRB 4DZ8A 5E6IC 5ADPL 1G7IB 4D2NA 4AQOA 3KR3H 1G9MC 3RDTA 4O9HH 1R5IB 3MRQB 4JREC 3PL6D 4DKDC 5JDJA 4J3WA 4JM2A 5A2FA 4M1CD 4DW2H 15C8H 5T5NG 4HMCA 1QPXA 4K8RH 4QHLB 1IAMA 3OG4B 1Q0YH 4EN3D 5ESAA 4MB5A 2EC9T 3M45A 3RUGB 1X3DA 1NANI 5H35B 3MLVL 5M7QA 3N9GH 4JREB 2JB6A 1UCTA 1K2DA 5DK3A 5EIIA 1BQUA 4HZLA 1TZIB 3HPLB 3T2NH 4IEFB 1VFOA 5TE7L 4BYHA 4KGLA 5DHVA 3RTQC 2D9QB 3TESA 4R4BA 3RKDC 1JUFA 3IDXL 2BVPB 4M3KB 4YAQB 1RZIA 3LEVH 2DM3A 2AV7A 5GGTL 5TDNB 1RZ8B 2A38A 5CD3A 4HAFA 2Y06H 1D3CA 3RTQB 2CIIB 3LKPA 3GJFA 1FL3A 1YNTA 1LEGB 1KF9B 2Z8RA 1VADA 2WWMC 3LN4B 1IKFH 1BZ9A 5D2NE 4LHUB 4GW4A 4ZDHB 2HG5B 5DQDL 4CKVX 4F7EB 3UROR 2H8PA 4JPWL 2FX8L 2R2CA 4KKBC 1UA6L 1CGSL 3U48A 3QI9D 3Q6GH 4Z77A 3O9WD 3TNNA 5J57B 5I18L 1PQZA 3FT4B 1OB1B 4LF3B 3UTZA 1DDHA 4R26H 3RVWD 1NFIB 3T3PE 1OGTB 1MFDL 3FTGB 4XNYH 5GGSB 3QWOB 4WCYL 3BH8B 2X41A 4BSVB 4O2FB 1KB9J 3T3PF 5DMIL 3AM8C 4Z7OE 4G7YH 3ULVE 4RGNE 1QRNE 1FYTE 5JDSB 2O5XL 4GLRI 1GGTA 3VU2A 4N8CH 4YBQD 4Z7OF 3ULVF 3ZDYE 3L6FA 2J8UE 5GZOC 4MXVE 3HMXA 3NFPA 2D4FA 4LCWA 4CJ0A 5A2IH 1CGUA 2G2RB 2E9WA 5D9SA 2X9XA 2W60A 2JJTC 1U91A 3H9SD 3ZDYF 2Z91B 4W70A 5FV2A 2J8UF 4MXVF 5J3HC 3H7BA 3GEWB 1EHLL 1YYLL 4GRLD 3F7QA 1RZJH 3DNKA 4I3SL 4I77L 2DLIA 4ODSL 2BDNL 2WNGA 1CFVH 4M6OH 3DMMB 1FBIL 3S34L 1AJ7L 1NL0H 3W9EA 1I1AD 4D8PA 2RFXA 2Q76B 4E41A 2F15A 2ICCA 4KY1H 4X8XA 1WK0A 1FGVH 3K8KA 4NM4H 4FXGB 4YHKH 2EIBA 5L88L 4YXLL 4PP2A 5HHPB 2FEDD 4X0KB 5DRNB 3L7FB 4PUBH 3MRFB 1FFNA 4QKXB 3CCHB 1XT5A 3WDJA 4XP6L 5MERB 4Y2DC 4YDIL 4QRRE 4RBPH 1MHEA 2EYRA 3DHMA 5B39B 1IGIL 1U93A 4HUKB 3B83A 4WUUA 3KPOA 3ARZA 3NCJH 4MJ2A 2UZIH 5EUOB 3T0VA 3E6FA 4NQCD 4OLXL 4X7EC 2AJZB 3VRLE 3LH2L 1CICC 1DANT 4G8EA 4QXUH 3MLZH 5L8LB 2UYLB 3EYSL 1P4LA 3WHE1 3PWLB 4GRWB 2E5EA 3VRLF 4JKWA 2WUCL 1HH9A 4UINH 1A6VH 1MF2L 4U6YB 1A5FL 2MWCA 3MLPA 4WUKL 5ALBL 1D6EB 5D1XA 3ET9F 2X9YA 4X98A 1HI6B 3RY4A 3BXNB 5T1LA 4S1RL 2WIMA 2AK1L 1WZKA 4POZC 1DR9A 1E6JL 4XB8A 3S7GA 2JELH 4PGEB 4DK6A 1GGUA 4BM7A 4PJHE 5IR1B 1ROWA 1HXMB 3Q2CA 4UV7L 3VH8G 12E8H 1FAKT 4PTUA 2EICA 3C6LD 4MS8D 4PJHF 1MRDL 4R90L 2JB5L 1N5AB 2EKSA 1NKRA 3L3KA 4WU7A 4YJZL 2LU4A 3O6FA 3I6KB 1UZ8B 4ZUUA 3UMTA 1A6WL 4NUJA 3I9GH 1MJ7L 4H8WH 2HTKC 2UY7A 4NZTH 2DD8L 4NKIL 4ZS7L 3KPNA 4RRPG 4KQ3L 3HHRB 3GI9H 1R5WB 4QTHB 2Z9TA 3C5ZA 1UT9A 4G8IA 4ODUA 2FEEL 3FMGL 2VDMH 4G6KL 5C0BE 5IGXH 1J1PL 2IH1A 2BCKB 5DS8B 3GBLA 1YEIH 3ARFC 2P5ED 2V2TB 3FT3A 5E8EA 2E8ZA 3UO1L 2CUIA 1R3JB 4XCFH 3P9MA 3T4AB 5C0ND 4P2RD 4PPTA 5F3BA 3EO9L 5IMOB 5ADOH 5KJRH 4PFEA 1VPOL 5E5MA 1Y6NR 1DQTA 4PLKC 4MD0A 2GAZB 2UWEB 1N0XH 3ARFB 3BZFA 1NBQA 2VJXA 1MCJA 1RIHH 2F53E 3DRTB 5EOCL 1CCZA 4R3SB 2DQEH 3V0VB 1WUNT 3KPLB 1R3HA 3V5KA 1XZ0B 3KWWB 2O61B 1TJGH 1ZKAA 1P9MA 3G5YA 3ARBA 3MRMB 3PWPA 1BOGB 4X9IA 2HFEB 3GMQA 3V79C 2OBGA 1SY6A 4KC3B 2Y72A 3IDUA 2DMBA 3CLFH 4ZD3H 4NC0B 3ROOA 3BP4A 4NCC1 1UWGL 2DBLH 4UT6H 3OAYH 3FQUB 4FQXA 4YDJB 4M7LH 4NFBA 1ZVYA 3RHWK 1QVOA 3MRKB 1I1FA 1U2CA 4QHNA 4PBVC 3VRIB 5SV3A 1F11A 1MWAA 4W6XB 4OLEA 3P0VH 4L8DA 4NUGH 1BD2D 3TCLB 3BWUC 1T21A 1EAJA 4AZ8A 5FF6B 3LS4H 1G6RB 1H15A 3PDDA 4HF5H 3W0WE 2EDBA 1TLKA 4YXHL 4HUWA 1I9IH 2VLKA 4P2OD 1A6TB 2JK5A 4X9HA 3S3JA 2OTPA 3WS3B 1Z3GH 2XI9A 4R7NA 1AP2A 1FYTA 1S9WB 5IKCB 5BV7C 5ILTL 4J3VA 4XRCB 5ECJE 4C59B 2AJ3A 1W0WB 1MCSA 2QSVA 1IC1A 2J8UA 3ARGA 4OSUL 3JUYA 4JPIB 3QEGH 3CAFA 3GSQA 4NWTL 4FTVB 2IGFL 5BV7B 3WN5A 4AMKH 1NMBH 1UH4A 3SKMB 3QQ9C 1YJDC 5E9DB 4PTTA 5LGKA 1OPGH 2ED8A 4IDJH 4WJ5B 3QWRA 4LSVL 5HVWA 2CQVA 3ZKSD 5CINH 3QP3A 4MVBC 3HRPA 5BZWB 3RU8H 4URTB 2Y25A 2R69L 1NDGA 4LPWA 4YK4C 4JVWA 4NO3B 4ZPTB 2H9GA 1FORH 1T7VA 2UUDH 1J10A 2A6DB 5DRWA 4MNQB 1GZQA 1KNOA 3K3QA 2X4QB 5GS1C 2R8SH 1G1CA 4DKEL 1NMAL 4IRZL 5E03A 3SCMD 3P9LA 1GGYA 2BC4B 1QSED 4YK4B 4YGVB 5FM5O 1IFHL 1PY4A 2P47B 2VIRA 3RGVD 4K94C 1SMOA 4F33B 1MCNA 5CP3H 1NAKH 5GS1B 4XC3L 3LKQB 5SWZE 3IDIB 1LVEA 1KYOJ 1XF5B 3ZKQD 2LAGB 4FFWD 1NJ9B 2AJUL 5H94A 5IF0B 3P4MB 5KOMC 1A7QH 2ITCB 1IGJB 5D6CB 3B9AA 4QRSB 1U95A 3OPZH 4UB0L 5GRXG 1GIGH 1DQDL 3U4EA 3SDYL 2D7QA 3LN5A 3HUJE 2X7LB 5C1MB 2WK2A 3P30H 1OTUD 1AKJA 3C9NA 3HNTL 3HUJF 2JCCE 4BZ1L 2BZDA 2FH8A 3MRIA 4JZJA 4LCUB 4G9FA 5DC9B 1T2QL 3DIFB 2XXCB 3BIKB 5JUEH 1MNUH 4K23L 3GBNL 2JJSA 4Q9RH 1N64H 5ANME 2J8HA 1VHPA 2A6IA 2JCCF 4PJXB 5F9OH 2XZAH 2EZ0C 3HC0A 1QEWA 1ACYL 1AGBA 2FO1A 5DK0A 2NY0B 3B5TA 1ZLVK 2LVEA 5DT1L 1JMZA 4PJHA 4XPHH 1MFBL 1KBGH 3PV7A 3SDAA 4JFYB 4LASL 2X70A 2GUOB 4WW1B 3S96A 4WHTA 1RSFA 4KH2A 3DBXB 4WTZA 3SOBL 5BQ7B 3TV3L 3FFCE 5C2BL 2CDEB 2H2SD 2OP4L 5HHNB 1N8ZB 2NX5D 1FJ1A 2DQJH 2PXYB 1HWGB 2PTTB 3DX9A 2NMSA 2PYEE 2R2HB 3MV8D 3GMPB 5CUSL 1J05B 1RJCA 1UXWB 3V6OC 3T1FB 3VXPB 4M8VA 1BAFL 5DJZB 4D3CH 1ODAA 3U4BL 3J8F7 1IARB 3LMJL 5B4MD 4CVXB 4ZFGH 2O5ZH 1WWCA 3ISWA 3ARXA 3KYAA 25C8H 1F58L 5ELIA 2F19H 2ICES 3DXAE 1X5IA 4LMQI 3NA9H 5TE7H 1DBJH 1F3DJ 2VN4A 4NZRH 5D7IB 43CAB 4XC1L 3KLAA 3L5JA 3LRHA 5CBEB 3B9KC 2H3NB 4OV6F 4YWGL 2I9LB 4S1SL 2X89D 5FYLD 5JXED 3K7UA 2HFGL 1DN0B 1VGEL 5KZCB 2FGWH 3STLA 2QQNL 2XYCA 1R6VA 2I5YL 4HQQH 1BREA 3MC0A 1OWWA 1YEHH 4IRJC 3NFNA 1SEQL 3B9KB 2VLJA 4G43A 4OF6A 2XTLA 2XFXA 4OLZH 4HCRA 4KK8D 5JW4N 1BZ7B 1CF8H 4UNTA 2CKBB 1AY1L 2BFVL 1OP5K 1N7ML 2FBOJ 4JFEE 4FFZH 4YHOL 2K7PA 1HK6A 4ODVH 4QCIB 1B6DA 4A6YL 5IQ7L 2P8MB 4U3CA 4XVTL 4JPKL 3MROB 1CGSH 3HMWL 5SX4H 3BPLB 3VFGH 5L2JA 5F1IA 1DBKH 4NSKA 2W59A 4L8BA 2YS4A 2QHLA 5E8OB 4CADA 4ZO9A 3TN0D 4C55A 5EBMA 1I8IA 3B8SA 3F7PC 2J7LA 4U3HA 4PRPE 4NZUL 2AV1A 5CIPH 3DTXA 3Q6FB 1GPOH 2Z0BA 3C60A 3NZHH 1X5AA 2PTUA 5DQJB 4OZHB 3WUWB 5JPNA 1CZ8H 4J4PA 4KI5D 1F4XL 5GGVY 2Y7QB 1CE1H 4AENB 3OXSA 3R06A 2AGJL 4R6UA 5DJ6B 1RULL 3EGSB 3NZ8A 4ALAL 4UNVA 3PABB 4OI7A 2X4OB 5HXMA 3VXOB 4PRDB 2ZSWA 3UZEA 3T77B 4LSRL 1QFWL 1AR1C 2CRZA 2NXYC 5DFWH 3MV9A 3ZTNH 3MNVB 4JFFB 5HGBA 3IF1B 5DVOA 1NH6A 5GS0H 3VXSB 3B43A 1A3LH 3IJSB 4PJGB 1CDCA 4QRTA 3RWDB 3ABZA 1UJTA 5EG6C 4UILL 5HYJE 1FZOB 4TSBL 5KS9E 1Q0XL 1HNFA 3HR5B 5TFSL 4BSJA 4Z0BH 3ZL4L 4Y5VB 3RHWF 1OT2A 5BMFL 5KS9F 1NCAL 3VCLB 4P4RB 1U8IB 2ZCLH 3BAEL 4KROC 3JWDC 1NC2D 4PRHE 5F7EH 1DQLH 2X4UA 3EOAA 3MRLB 4Y19D 4EVNA 1C5BL 5KTEL 4WENB 1X7QB 4NRXA 4GUPA 1EO5A 3UTSE 2BP3A 4LSSH 1N6UA 1A21A 2EXWD 4F7MB 4KROB 1EXUB 1ORSB 4RDQF 1RUAL 5ACMA 5DD3L 3OAZK 3QNXA 1YEDA 1JF1A 1SJEA 3VXTA 1MH5A 2AQ3A 5HYQA 4FNLH 3F7VA 4XPTH 5IW1A 3MFFB 1UH3A 3UJTL 5M94B 3FN0H 5I1IH 3HUJA 3TBTB 2OR8A 5I16B 2JJWA 3Q5OA 4QWWD 1C1EL 4EXKA 3MRCA 1LO0H 2J2ZA 5K9OA 4H20L 1BECA 3DX7A 1U6AL 3HPJB 1TTGA 3SDDD 1AHWA 3OKLB 4ODTH 2AK1H 5IFJB 5ANMA 3QDMB 2EIEA 4UT9L 5F21B 4ORZC 5I1HH 1QR1A 2F9BT 4EOWH 1BFOB 4RAUA 1JGEB 3MUGA 4KTYA 5IFAL 3ZHKA 1IAIM 2NY7L 3WFBL 4KKAC 4U1GC 3IXTA 1KENL 4L4VB 3P0GB 1FO0A 3IDNA 3INUL 4ZYKA 2HVJA 4QRQA 2C3VA 4Y4FD