3SDCD

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
239
structure length
239
Chain Sequence
b'GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSGKGLRLIYYSYGAGSTEKGDLSEGYDASREKKSSFSLTVTSAQKNEMAVFLCASGSLLDVREVFFGKGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcD02
4OCXL 1QEWA 1Q9KB 4YHMH 1LEKB 2FX8L 2EXWC 2VKWA 2YPLA 5H8DA 4U49A 5JOPE 1RD6A 5HGBA 1P7QA 1QSED 2VR9A 3Q2CA 3TO4B 4IOSD 4WI4A 3RWGA 1E28A 5F6HI 4YHYC 1ROWA 3SCMA 2BVYA 5JDJA 2D31B 4RX4A 2MCPL 2RGSA 3C2AL 4R90H 2PYFA 1BM3H 2HP4A 4S2SA 2BVQA 1HHGB 4MZ3A 5CLWA 3GHEH 1D5BA 2YD3A 4CGTA 5KOMC 2Y36H 1NBQA 2GUOB 4G6KH 1H3UA 4I77L 3QIBB 5E94A 1T3FB 4HK0B 1DSFL 5C9JA 4L8CA 5L7XH 4M7ZC 3ARGA 1F6AA 1T1ZB 4K7FA 1P4IL 1S7UB 2V5TA 4P5KA 2E9BA 2EXYD 2QL1A 2ATPA 4KPHH 1S7RA 3IDYC 4ORZC 1Z5LA 3MRRB 1TPXB 2B1HH 3RZWA 1X5IA 1EZVY 5GGTL 3T3MF 4K94C 4KMQA 4QRRA 4ZFFA 3U0WH 2YC1B 1MREH 4WFHE 5AUMB 4QT5A 2DLEA 5IBLD 3P9LA 4Z76A 2PXYB 5HD8D 4DKEH 5EU5B 3LZFL 3OAUL 4JEGB 2Q8AH 2FH8A 5E5MB 3RPKA 4NQEE 3OXRB 2P5ED 2W0LA 4HBCH 5KOVC 2VLLB 3TJEH 5L8LB 5KSUA 3UTSB 1AO7A 5EZJA 4M5ZL 4KKBD 1BEYH 1S5HB 1OTTD 2EH8H 1HHHA 4ZAKC 5D2NC 3UPRA 1CDYA 4Q6IB 3EYSL 3QCVH 1NBYA 2WW8A 2H45A 1ZLSL 2F19L 4DKFL 1MQKL 2MKLC 5I1IL 1KBGH 2YBRB 2D7MA 1K5NA 1PZ5B 1FO0H 4K7PX 1R3KB 2KH2B 1Z3GH 4ZTOH 3ARUA 3HE7D 4JZNA 4L9DA 4UAOC 4OQTA 3O4LB 5CHNA 3CSPA 5ICXA 3T2OA 4ZQKA 2R0WH 4RGNE 3SE3A 1S8DA 4HKBA 1J05B 2YUXA 4NWUL 4BQ6A 5F8RC 3I6GA 1CZ8L 2VXTL 3RWFA 5ABDE 3QFJB 3HE6A 4MSWA 4FP8L 5TPWL 1HH6B 1VFOA 4NQXB 5DWUL 1X4XA 4I4WA 4MJ6B 2X4PA 1FIEA 2OLDA 4NDMB 3FN9A 1UH2A 3P0VL 2DF3A 3LKSA 4X6CA 3L7EA 5E2JA 4M1GL 1UWEH 3TH4T 1M71A 1YEJL 5C86A 1FV1A 3KPPB 4HW6A 4LSTH 4Y4KA 5D2LF 1JTTA 4NOFA 2I60H 3SDAC 3OR7B 4XCNA 5E08L 5EO9A 2I5YH 2BRRL 2AJXL 4JFXB 5GPRA 3RQ3A 5EZLB 1R3HB 4QWWD 3G08B 4U7KA 3HPLA 5IT2L 2ARWA 1JNNL 5F93C 2DJ4A 3PP3K 4RZCB 1H5BB 3HFMH 4UIKL 3IKCB 1HH9B 5CGMA 3E6HB 5BXFB 2IMNA 3PQYA 3E2HB 3V52H 3HUJE 5IVZA 2BSED 1IFHH 4ONGL 2DWEB 4QXUL 3CVHA 1EEYA 1SJEA 1QLEL 3C8KB 3QDGE 5I9QB 2FB4L 4PLKD 3WDHA 3JV4B 1RUML 2BNUA 3MUJA 5IHZB 2C7UB 2ZOLA 1CQKA 2DQDL 3QEQA 1ZGLA 3OB8A 4K07A 1AC0A 1X5AA 3STLA 5FUZH 1M6OA 4ORGA 3RI5K 1GSMA 4MCZA 4O58L 1FYTE 4I9WE 1IC1A 2AJYH 4ELMB 4LLVA 5L88H 2A77H 2O26U 5C0GB 3GM8A 2VXVL 4ELKA 4PGBA 1MVFA 2ICEB 2H6PB 2VDRL 4L3AA 2AJSL 1SEQH 3W9DB 5DQ9B 5I8CA 1FNHA 3C08H 3PABB 4JE4B 1VFMA 3QDJB 4PLOB 1MIML 2E6JA 4NN7B 1FQ9C 2NY1B 2WUBH 3RNKA 1CWVA 1G1CA 2J7LA 1TZHA 3MREA 1ZANL 1ZA3A 1J9CT 3HR5A 1ZK9A 4WTZA 2DD8L 5B8CB 1NFKA 4JFYA 2LTQB 2FEEL 4MJ5A 2YPLD 2DL9A 1B90A 5GS2D 2FHFA 4QXWA 1FHGA 3QDMA 5TDPA 1T2QL 3PV6B 5TH2A 4J6RL 4ZOCA 3RIAK 4F8QA 5J3HC 2JB6B 3SCMD 1A1OB 4WFEE 2AXFB 2NW3B 2QHLA 2VQ1A 3BI9X 3LMJH 4RX4D 3LKOB 3VG0L 4R26L 4OGZA 4A6YB 1KIUA 3R8BB 3KR3H 3BUTA 3KPTA 3FQRA 4XCFH 5HI4C 3GMQA 2WANA 3MRNA 4IMLB 4P2RA 1UVQA 3MMEA 5BVPH 4G6FD 1HE7A 2R69H 4PGDB 3GHBL 4S1QL 2V9RA 1JHKL 4JHWH 1GYAA 4CW1B 1UWGL 3ARGD 1G7LB 5T3ZE 3MRPA 3T3ME 4QY8A 1LP9F 2EDQA 1HCFX 1SJVA 4YEFA 1ORSB 3LPGA 4XP1L 3TPUA 1IC5H 1U91B 4QRRD 3K74B 3VFPB 3JSSA 1FL6A 1F6LL 4PRBB 4U1GC 4G9FA 2JKXA 5GZOC 2VR5A 5EFIA 3SO3B 4ZMAT 1RUQH 3G5VA 3DX6A 3ULVL 2JIXA 1KB5H 3GBNL 4L4VB 3F7YA 4OFYA 3JTTB 3D39A 1AO7D 1LO2H 4TUJB 1QQDB 3TN0C 3QIUC 3O41A 5FKAA 4PG2A 1AJ7L 2G5RA 1RZIA 4PJ9B 2Q3ZA 3MJ9H 1DN0A 2ZUYA 1GGYA 5CBAB 5IVXF 4GW5A 5IJKC 3O4OB 5JDSB 4L5FH 2V7NB 4OLYH 4KZDH 5CJQL 2BNQB 2YSSA 2DYPB 1QO3B 1AGBA 4ZDHB 3WUWB 1FRGL 2MMXA 2CLZA 1FGVH 1D5IL 2EE6A 1WWBX 3BX7C 3IB4A 5DUBA 5C0EA 1A6ZA 2IPTH 4JDZB 2QQLL 2F74A 4X6DA 5KJRL 4KDVA 3KPOA 3CX5J 3NIFF 5JHDE 3AAZA 1E6JL 1L9NA 2W0PA 3X17A 1T7ZA 5J8OA 4N90D 3EKCA 4LK4A 3RJDA 1A47A 3D3VA 3P4MA 3UTQA 2ZNXA 1DBMH 1WC7A 3PL6B 3V6BR 5GRJH 3PGFL 4F57L 4POYA 1X4YA 3OR6A 2P49B 5IW6B 4IOFC 1A3RH 3HE6D 3BT2L 3W11D 1ITCA 3HZVB 3PWJA 5F9JB 3CXDL 4M1CD 3TT3H 5DRNA 1MWAL 1ZT1B 5FM5M 1RJLB 4WHTB 3I9GL 4Y16A 3FQTA 5D2LE 4FA8A 3GSXB 2EZ0C 3E3QC 5GS2H 4OI8A 3QG6B 3SY0A 4LVOB 3LQMA 1BHGA 3ZTNL 2AJVH 2ZCHH 3QWOB 2YUZA 3OGCB 3DTXB 5D9SB 1LK3H 4Y4KD 2RFXB 4WY7H 1IGTA 4UQ2A 3UJIH 4ZYKB 5J13B 1J0IA 3MV8E 3HC3H 3PP4L 4IRJA 1JNJA 3NA9L 2IQAB 4JN2B 3BDYL 4UOW1 4IIQC 4J23A 2VLKB 1E4XL 2OP4H 4J3SA 1T2XA 2YHGA 1NLBH 4H8WC 3P30H 2AEPL 4GAYB 4HV8A 1A1NA 3MJ8A 3PQYD 4JFQA 5HYSG 1CFVH 3VFRA 4LGPB 3ULVF 3VGDA 3MJGX 4WUUB 4YFDB 4LLYB 4XWGL 2I07B 3V95A 4FXLA 3O2WH 5EOCH 3QEQD 4NO3A 2SEBA 3BH8A 3B83A 4HIEB 4NFCA 3RGVB 1HYSC 3DNKA 3IF1B 3UBXB 2Y06L 1T1WA 2PW2A 1GCFA 1AD9B 3IVKB 3WNNA 2BJML 3STZA 5E7FA 1BGXL 3CPLB 2VXSH 5FOBB 4TYUA 2AK4A 4N1EA 4YC2B 3BKYH 1TZGH 1ZSDA 4CU8A 3FOMA 1JN6A 4U6HA 3GUTB 5HXMA 4L3CB 3GHEL 4TTDC 4LHJB 3NCYS 5K33A 5SV4A 5F1NB 5CJBA 3RWJA 2NTSP 2CK0L 5D6DC 2PO6A 2YA0A 5FA3B 3ULVC 1J8HA 1DFBH 1FAIH 5DDHA 3QPQC 2ZUQC 4WO4B 5E70A 1KT2B 3FFCD 3QDMD 4KPHL 2FIKA 3L5WB 2A1WH 1JWMB 3MBEA 2B1HL 3F12B 1QPPA 5J1AA 1JGDB 3I50H 4BUHA 5J7CC 2R56H 2YK1H 3ARFA 5FV1L 1DVFC 3P4OA 4FNLH 1M1SA 3MLTB 4P2RD 5BJTA 1BJ1H 2Z93B 1LP9E 1YEGH 4JO2H 1GZQA 5I1EH 5ISZE 4F37K 2EH8L 2OZ4L 4R2GD 3UDWC 5KTEH 3DOSA 4PRIE 3NZHH 2ICWA 1PKQB 2R1WA 1AE6L 5HHQA 4HG4J 3B3IB 4HHAA 2NXYC 3G9VA 3HI1B 3NZ8A 2H26A 4I0KA 2FYYA 1TTGA 2PN5A 3PV7A 4KRPB 3K2UL 4HFWA 5FHBL 4BSWB 3S6CA 1MCSA 1K2DB 2R2HA 1N6QH 1UWXK 3MNWA 5DRZA 5HBBA 1MCKA 1J18A 4G9FD 1S9KC 3PGDB 5FK9A 4LSQL 4M61A 2JIXD 1GGBH 3SE4C 5C0BA 3CX2A 2RCSH 1ZMYA 2LU7A 3H2WA 4OFYD 2JE8A 5IVXE 2I9LB 3D39D 4AENA 4JREC 5DJ0A 1P7KA 4OLUL 4Z77A 3QCUH 4O51A 4LSVH 4QRPA 1JPSL 3N1MC 1B2WL 1N7MH 5DEZA 3HNTH 4YHKL 2NTFA 5EU6E 1A1MB 5GHWL 3CVHH 5CCKH 2R4SL 5I8OL 3LVEA 2X4RA 2VO5A 2VDPL 2FATH 3CC5B 4HS6A 1QR1A 3V79C 1AIFB 3M1BA 3NIFE 4R4FH 4ETYA 1ZS8B 2MKWA 4Z7VF 1W0YT 2CPCA 5F3BB 4GRWH 4TVSa 4GXUN 1HWGB 2A6JA 3RZCC 5J57B 4OCRH 2HFFB 1CVRA 1Q9KA 1LEKA 2XQYK 3U4BH 4AM0B 1INDH 5DD6B 3QUYB 5CZVH 3H3PH 3SGDH 3HB3D 3D3VD 4LARL 4HD9A 3TO4A 2R1YB 3DIFB 1UC6A 4JPVL 1AC6A 1ES0B 2HJKA 1OAKH 2A0LD 1VEMA 3MQIA 2D31A 3GK8L 2X4UB 3BWUC 5JA9A 3L1OH 1F4AA 3LN9A 5ALCL 5IG7B 1XCTB 1HHGA 3PUCA 4C58B 1BQLH 2BX5A 2GUOA 2VE6B 4Y16D 5HHMD 3QIBA 1EMTL 2X44D 1A7BA 1T3FA 2LU4A 4HK0A 5TFSL 3V52L 3UZQA 1BVLB 3KDMB 1T1ZA 3LS4H 4OLWH 4B0MM 2FR4A 1S7UA 3UJTH 1S78C 2G2RB 2G75B 4EKXA 2AJUH 2FX7H 4NNXB 1VKXB 4XNYL 2CDFB 5D7JC 3VCLB 2VL5A 3AS0A 3SQOL 4IRJD 4R4BB 2YC1A 5AUMA 2XTJE 3KPLB 2PXYA 4RMUA 4FQ1H 2R2BA 2CXGA 5EU5A 4YIQB 5F7MC 5C09E 2IADB 1J1OH 4ODSH 1KENL 2YUVA 5E5MA 5I1HL 1MHPL 3K2MC 1LK2B 3BDBA 3UTSA 3ULVE 5IHUH 1S5HA 4P4KB 1Z9OA 5C0RL 2DQEL 2APVA 3MLRH 3ECBB 2YMXL 5D6CB 4Q6IA 2D03L 4LEXH 1EHLH 1BFOB 4Z7WB 3ZE2F 3O11B 1UYWL 1ZLWH 2YBRA 1PZ5A 2DQJH 1KPRB 1R3KA 4LLQB 3R8QA 3DMMB 1JL8A 2WINA 4OF8A 4FQIL 1BX2B 4NQTA 2VZVA 1V8HA 4ZPVB 1E4WH 5E2TH 3HNSL 1EZVX 3TLRA 5I1KH 5HHOD 2XQYG 1QD0A 3O4LA 3VFMB 3KHQA 2G9HB 1UJ3B 5F6IB 2OI9B 4YBQD 3BP7B 4J3OC 1D3CA 3KVQA 5EOCJ 4AEIH 4HGKC 4S1SL 1IQDB 5LWYL 2PTUA 3ZKNC 3QFJA 2AK4D 4N5EC 2WLZA 1MCWM 3L9RA 5J11B 4NO0B 3OKLB 4M62H 1HH6A 4EUPA 4NQXA 3O6FA 4M6ML 3IJHB 3MUY1 4MJ6A 1VFAB 2NY7L 4X8XA 4NDMA 3RY6A 4Q9QL 2PO6D 1I9IL 4MXQC 1CXEA 2AP2A 3KPPA 1DBBH 5IUSA 2VXQH 5GRVL 5EO1B 3P0YH 3MBED 2ZOKB 4NZRH 1UH4A 3J7HA 4YHLL 4OZGA 1FP5A 4JFXA 4GXVH 5EZLA 3MLVH 5EIVA 2COQA 3DXAE 4NO2B 3ARFD 4LCIH 4RMTA 3EFDL 2VLME 4HUUA 2HRLA 2FD6H 1KG0B 4Z7UF 5CSBA 1A9EB 3EAKA 5C0IB 3OKYA 4RZCA 1H5BA 5I1DA 1JGEB 5HHXL 1HH9A 2N1KA 5DFWH 1L0YA 3E6HA 5BXFA 2BVTA 4KY1H 2ED8A 2HT4C 1MHEB 1K4CB 3G5YB 4QHNB 1JZ7A 2DWEA 2HH0H 5DHYB 3MUGB 1A5FL 3MX0A 3MA9L 3C8KA 4FQHB 1BJ1J 3JV4A 4N8CH 3WIIL 1NCCL 5F7KC 3SE9H 2FWOB 2C7UA 3MROB 1SM3L 1OVZA 3Q5OA 3L3IB 1KCKA 3O3EB 3ULSB 4KK8D 3P40A 5EUOB 1CGSH 4ELMA 2FJGB 4JPKH 4OQ1A 5DC4B 5C0GA 3U7WH 4PJIB 4R97B 4W4OC 2ICEA 2H6PA 3C2SA 1P4LA 4LIQL 3W9DA 5DQ9A 3ZKQD 2EXYC 2LVEA 2CKBL 4Z7VE 4HH9B 4KXZI 4NWTL 3PABA 5IQ9B 4GQPH 3MR9B 3OKOB 4PBVC 2D7PA 3EGSB 5AYUH 1EUTA 1GAFH 1MF2H 2EE2A 1NC2B 5C0AE 3NGBC 1BECA 2XWTA 1G9MH 1I8MA 4PREB 1G9NL 1WBZB 5ILTH 3GMPB 3ALPA 1AGEA 3MOQA 4EI5B 4JLRB 1DBKH 5FYLD 3OKEB 1A7QL 5B8CA 1LO5B 4F7TB 2Y6SD 1CS6A 5HYEA 3N06B 1HIMH 5DMGC 3RWDB 2ZCHL 3CCHB 4PGZA 1CGVA 3FZUD 4HJJL 3TO4D 4WTXA 2JB6A 1XF4B 1Y18B 2AXFA 5C0CB 2NW3A 3HC3L 5C07B 3RY5A 3JWOH 3LKOA 5I30L 5DJDB 2BY1A 5C0NC 2VIRB 4A6YA 5EU7E 2WLYA 4X6FB 1CVSC 4HG4K 3FO0H 4IMLA 4MQ7B 3HE7C 3IXTB 3ARTA 4NRYB 5DJ2B 3QIBD 5EA0L 1IGFH 1JJUA 2E9JA 1OD7A 4HQQL 4PTUB 2A6DA 1G7LA 5A43C 4LPYA 4YHIB 3TA3B 1YEDB 2DM3A 4HT1H 2DTML 4XNXH 1ORSA 2VDNL 4M7KH 4QOKB 5CBEB 3EOTL 1NCDL 2NY6B 3NFNB 1U91A 4M02A 1DZBA 3VFPA 2W9EH 3Q6GL 4CNIB 4UT9H 4PRBA 4NN6C 4K8RD 2PXYD 2IBGA 2VC2H 4L4VA 4GW1B 3EOYG 4I0PC 2IC2A 4QXTB 1MCEA 3FMGH 1OAYL 2B7DT 3JTTA 5BRZA 1JMXA 3UTSD 1QQDA 3AY4C 2HJFA 3SDXF 4P2YA 2YS4A 3SGEI 1FNGB 3WUWG 3JV6B 2FGWH 5JDSA 3WKML 5DEFA 4JVWA 3C6SB 5DA4A 5SX5K 2BNQA 3GJEB 3T65B 2DYPA 3QZWB 1N5YL 1QO3A 2B0SL 1TJHL 2FGZA 4MHHG 3U2SA 4OIIL 1DQLL 3T1FB 4OQTL 3WUWA 4QWWC 2AEIT 2QLVB 1MRFL 2KPNA 2PTTB 4Y4FA 1J11A 3FO2B 3VH8G 1V7NH 3O4LD 1G6RB 3W0WB 4FXGB 1S7XB 1KUMA 2BC4B 1A7OH 1QSEE 1NJ9B 4LKXB 2HTKC 3B9DA 3PL6A 1SYSB 3BPNC 2A6KB 4G7VL 3D0VB 5IW6A 3QFJD 5CLTA 1T7WA 5ADPL 1YPZB 3HZVA 1RVFH 2IFFH 5F9JA 3LDBC 4E41B 4XVTH 1XGRB 4ZS6D 4I5BB 1DANT 1CCZA 3GO1L 4P46B 4PLKC 4D3CL 5IFHL 2JELL 1XF3B 1ZT1A 1NBZB 4QHLB 3S9DB 3MRKA 4IBLT 4OZFA 5FYLH 3LRHA 4WHTA 1JNHB 4OB5H 5D1QB 6CGTA 1YEGL 4WGWB 4MMZC 3G6JB 1Z6JT 3JV0A 3IDNB 1Y6KR 4NQSB 3QG6A 4MXVF 4KMTL 4CVUA 2VSCA 2ARJQ 1N0XH 3QWOA 3S36L 3OGCA 2DBLH 3FN0H 4UINL 2RFXA 5CEYB 4YXKL 4ZYKA 5MEQB 5AZ2L 3ILQD 4Z7UE 1NCWL 2XG5A 12E8H 1W72H 3LRGA 4K23H 2OK0L 2IQAA 1OP9A 4JN2A 4XNMA 3SKNA 1NGQL 2VLKA 3JUYA 5D8JL 2JJTC 2P5EE 3GDBA 4GAYA 4PD4K 4MXWH 3IS0X 4HC1A 1G9NC 1N7ML 1QRNB 1RFDL 3HNTL 4XMKL 2XZZA 1BD2B 3VW3L 4HBQA 4HGMA 4WUUA 3KJ6L 1JYXA 4LLYA 2DQUL 2I07A 2PYEB 4PJHB 2FATL 1DE4B 5JZ7C 3AMKA 3UBXG 2KZWA 1JF1A 3SCMC 1I7TB 4LPXA 4WFFD 2JJUA 2WWKO 5I17A 2ZUVA 4P9HL 2IQ9L 4F15C 4NQDB 3UTPD 4HIEA 3MGAA 4GH7B 1CL7I 3RGVA 3UBXA 1NMAH 2OCFD 2GKIA 3QEHB 2D7TL 4K3EH 4P3WA 3RPIB 1AD9A 3VD3A 1UB5B 1IKFH 2B2XH 2AABL 3IVKA 5LGHH 2VL4A 3VE0A 1C5DB 2QQQA 4LBEB 3WL9B 3CPLA 1ACYH 5FOBA 1C5BH 3HZYB 4NIKB 4NC0B 4CKVX 2ADIB 2DQFB 1F5WA 5L2JB 3GNMH 2FJHB 2NY1D 3UYRH 3GUTA 4GMTH 4N8VB 4L3CA 1IC7H 4LU5L 5I2IB 3WS6C 2IG2H 1E4KA 1ZTXL 3PIQB 3VFTB 1A6PA 5F1NA 4URTB 5FA3A 4GG6B 3LEYH 3C6LC 3MLYH 4YWGL 5I75C 1KT2A 4OT1H 1FFNB 2EEAA 3MOBL 4N1HB 4P59H 2AJUL 3L5WA 1RK1B 4Y4HB 1JWMA 3L6FB 1L6XA 4X6CF 3KNBB 4GBXB 3F12A 2P8LB 4NQVB 2OL3L 4ALAH 4EUPH 4OLVL 3KGRA 5EG6C 2EE3A 3OHXB 3BRDA 4JN1L 4ODSL 4EOWL 2VDKH 1INEH 3MLTA 4LSPH 5EB9A 2Z93A 5JIIA 5BO1H 3OZ9H 1K8DB 3ZYJA 3GSVB 2W9DL 1DL7H 5TE4H 1U3HB 3D6GA 1KLGB 3ILPB 1EH9A 3O3UN 1CICB 3INUL 4K3DL 3B3IA 2ADFL 3T08A 5EUKB 3HI1A 3PWNB 4X9BA 4DGYH 4DTGL 1FNFA 3TC9A 4QEGA 4LNRB 1EVUA 3N1FC 5IR1A 1I8LA 4RFNB 3W11C 2X4TA 1T66C 5EIQA 5F89B 1F4XL 4M1CC 4XMLL 2CMRL 3TIDB 3SDXE 1OAQH 4Q9BA 1WZKA 4L4VD 4C59B 4MD5B 4JGJA 5BRZD 1X5YA 3HLAB 2Y23A 5KSVB 3GSNH 4YDIL 2GT9B 4MX7A 1PG7X 5IESH 5CGYC 1MAMH 2QHRL 3MLXH 2YKLH 1HXYA 1A1MA 4KUZH 4WU5B 3UTZB 4Z5RB 5ADOH 3KPSB 4I13B 1EDQA 1NL0H 2GY7B 4HUNB 2HG5B 3CC5A 5FCUL 4EBQL 4LIQE 2BNQD 3VA6A 4LLDB 2VLJB 2DYPD 2F53B 1AIFA 1WZ1H 2WV3A 1ZS8A 4I2XA 5ECJE 4Y4FD 2OXHA 4MNQB 5TE7H 2HFFA 5FM8A 4OGAD 3DRQB 1PEWA 5ESQB 3WN5B 4AM0A 5IEKB 5DD6A 4FRWA 4MGXA 4YHYB 3EDDA 5I66B 2YXMA 4Q9RL 2YPLE 4XHJD 2XKUA 1UQSB 4KI5D 3PL6D 4JY4B 1DBBL 3C09C 4H88H 2R1YA 3DIFA 4NZRL 1ES0A 5GRWA 5DJYB 1OP3H 2P7TB 4UU9B 5DQDL 3CFCH 4GXVL 4LEOB 5T1MB 1LO4H 3WFCL 2X4UA 4KVNH 2DI9A 4LCIL 3M17B 1XGYH 2EDWA 5IG7A 1XCTA 2VAJA 5ID1B 1FE8L 5KSBB 1NSNH 2J5LC 2V7HB 3DUHA 4MXVE 1FL5B 1J88A 2VE6A 3EHBD 1RK0B 1ZHKB 4R7NB 4NPYB 4P9HC 4M93C 4OCWL 3EYVB 1Q1JH 2XRAH 2R29H 2EKJA 4LSUH 1BVLA 3HZMB 3KDMA 3C5JA 2G2RA 4JHBA 3WHE0 2G75A 5GGRB 5ICYB 2NR6C 4NNXA 1VKXA 3VD5A 1IGIH 4O4YL 2CDFA 2LABA 4JHZA 3TVMB 2IANB 3VCLA 1MI5A 5L6YL 4N8CL 4QRRE 5B21A 4R4BA 3EDFA 1A2YB 1NH6A 3KPLA 3EDEA 4FTVB 4YLQT 2X6MA 4NHUB 1IM9A 3ZMRA 4YIQA 2IADA 4YAQB 2VLKD 4ZAKB 2PF6A 2VXUL 2P44B 4LLAA 1KACB 4TRPL 1LK2A 1R6VA 2XY1A 3T0EC 1CGSL 1AO7E 4FFYH 2VERN 4P4KA 4WCYL 1KTLB 3T3PF 5F9OL 3BAEH 3ZHDA 1E0OB 1MCJA 3ECBA 2QQNH 5D6CA 4NQCB 4WUUD 1CK0L 1F97A 4ETQB 1SBBA 3VXTB 3O11A 4NT6B 4TNWK 5DK0B 5FA4B 5F96L 5DRXB 1R5WB 4K55A 1KPRA 5HGHB 4LLQA 2KBGA 2MNUA 3DMMA 1G9ML 4IM8A 1BX2A 2X1WL 4ZPVA 5ILTL 3BZEB 1RZKL 5FDYA 1O5DT 4OUOA 3VFMA 4GMSH 1QBAA 2D7NA 1DBKL 2G9HA 3P9MB 4HJGB 1NMCC 1UJ3A 5EZOH 3HZKB 3RGVD 4LKCA 2UWEB 1HIML 4N90E 3BP7A 3KJ4C 3RWCB 4X6DF 1Q0XH 2VH5L 3QB7C 3ESVF 3SKOA 2EDFA 3P3YA 1IQDA 5GZNC 5EOTB 1CE6B 1SJHB 1YQVH 2A74B 2AQ3A 4UBDD 3C5ZC 4RGMC 3JWOL 2AKRA 4NO0A 3OKLA 2RB8A 4HXAL 5CP3A 2VZSA 2OXGA 3T4AB 2NZ9D 3O3AB 3V4UL 1N2RB 1VFAA 3WO3B 3LH2L 1NBVH 5GRUH 3MACH 4M7LH 1MJ7H 1IGFL 3KYKH 5GJTH 3RIAF 4X6CE 1IAOB 1C1EH 4MLIA 3W9EB 3SJVB 4U4BA 4PG2C 3P4LA 4M7KL 1CLOH 3VG9C 1XR8B 5EO1A 4RWYL 2ZOKA 4JZOB 3ARPA 4ODVH 2R23B 2NW2A 4NHCH 3FT3B 1MFCH 3ARQA 4NO2A 3TCXA 1VHPA 3LKRB 4OZFH 1KG0A 4MZ2A 4DKDC 1A9EA 4QHKJ 2ZNWA 3H3BC 1SQ2N 3QO0B 1ZGLM 4Q0XH 1JGEA 4MD4A 2MTPA 1S7WB 3BYYA 4QRSB 3B9EA 3G5YA 1MHEA 1K4CA 1OAZH 3BKMH 3BW9B 1SYVA 4GKNB 1OAXH 2QSCL 2R9HD 3BD3A 5DHYA 5CJOH 3QEGH 3MUGA 4KRPD 4FQHA 3OB0H 3RY4A 3T2NL 3QJFA 4OUUB 3Q48A 3QNXB 3MPCA 1H15A 4QNPF 4NKIL 5DK2A 4Z95L 5DD3H 1JYVA 2HA1A 2VDOH 3WJLC 3L3IA 3WIHH 1NANH 2BDNL 1BQSA 2HLFC 2BMKB 3ULSA 2XNAB 4WV1C 5EUOA 2FJGA 1NEZA 2VISB 2QADC 5E2UL 2HKHH 4PJIA 5HTSA 3SE8L 3L3KB 4CN4A 1DQJA 3VRIB 4DGVH 4O2FB 3CMOL 5DJZB 2OMNA 3NH7L 4HH9A 3L5IA 5IQ9A 3MR9A 3OKOA 5FV2A 4YJZL 4WWID 1JPTH 1R3JB 4WU7B 5KANI 1IVLA 1G7IB 4Y1AB 1PD6A 1U2CA 1NC2A 3F5WB 3QWQB 4IRJC 5E7BA 5F70A 1JRHH 1XGTB 1HSAB 4PREA 5D7SL 3T0EE 2N4IA 3GMPA 4EI5A 2HJLB 4JLRA 4JFZL 2E7LA 4MA8L 1EO8L 3OKEA 1LO5A 1FORL 4F7TA 5L9DL 3RWDA 3TBWB 1N0XL 3CCHA 1DLFL 3BISA 2AK1H 2CIKA 3FFCE 5L2KA 1QSZA 2J88H 3QDME 4XRCB 4HULB 1P4BH 3VGAC 1XF4A 1Y18A 2DLFL 1XEDA 3DETD 1NAMH 2E8YA 4TUKL 2C26A 1QFWH 5C0CA 4NJ9H 3G6AB 4JQVA 1DEDA 5DJDA 1CFTB 3QXTA 2VIRA 4X6FA 4KVCH 4G3YL 1WICA 2PNDA 5M7QA 3IDXH 1CFNA 4MQ7A 4P2RE 3NPZB 5DK3A 3IXTA 3Q6FB 3QHZH 4NRYA 5DJ2A 2EECA 3RKDD 4N1CA 5HHNB 1TXKA 4P48A 4GSDL 4YHIA 3TA3A 1YEDA 4YBQC 1Z9SA 4U1GB 1YN6A 4IHOB 4QOKA 5CBEA 1D6VH 2KL6A 4X7EC 5JIHA 1V3MA 3NFNA 4IRSB 4MQTB 3OAZK 4XP5H 4K8RL 1MFEL 3L5HA 2DDQL 1MI5D 1JCKA 3CH8A 4CNIA 5E2WL 1KLFA 2CRYA 3TN0B 4G9FE 1Q72H 1IM9D 3VWJC 4LDLB 3T3PE 3C5SB 3ZLQC 1CYGA 4GW1A 4QXTA 1QOKA 3GBML 5GS1C 3D39E 3NPSB 1JK8B 4P4KD 1JNLL 3QZWG 4MNGB 3KLSA 1FNGA 1NCBL 5TQ2L 4LQFL 3UCRA 3JV6A 1ACYL 1PG7H 4XXDB 1LO0H 2UVFA 3ARDA 3C6SA 3CH1B 3GJEA 3T65A 5FGBA 5FKPB 3QZWA 3GMRB 2EDEA 3MC0A 3VFGL 5A2KH 1BQUA 4NN5C 2R15A 2XFXB 3T1FA 3UYRL 5HPMB 4HK3N 1DBJH 3DMMD 2PTTA 3QYCA 3FO2A 1U8LB 3TO2A 2QV2A 4MAUH 2X1XR 4X6DE 1G6RA 4FXGA 5C6TH 3WLWD 4JZJB 2IPKA 4KKCD 4FMFA 4LRNL 1YMMB 1CLZL 3MJ6A 4DEPB 1S7XA 4Z0BH 2BC4A 3D3VE 4ODUB 4OT1L 1BF8A 1NJ9A 4P9MH 1SYSA 1UG9A 2A6KA 4LLUB 3D0VA 2VDLL 3HMXH 1H3XA 1FFRA 1YPZA 4E41A 1IEAB 1XGRA 3OV6A 4NO0D 4YX2H 4I5BA 1KJMA 4P46A 5I73C 1GGIL 1XF3A 3MYZA 1NBZA 3OJ2C 4BSJA 4QHLA 3RFZC 2B20A 2XKNB 4XP6L 4YDVB 1JNHA 5D1QA 4GFTB 5K9QI 2ZKHH 5HHME 2H41A 4ZS7H 4KDTA 3IDNA 4KK8C 4MYWB 5EPMA 3EFFB 5IB1A 3EYQC 3SO5A 4G8EB 5CEYA 2J6EL 4DGYL 5E1AB 2R8SL 1WLHA 2FEDC 1OL0A 2JJVA 4TQEH 5MEQA 5BW7C 3RVVD 1MNUL 2PUQT 2W59A 3OL2A 5IGXH 3N1PC 4CUCA 3V6OC 1A6VH 4OGYH 2BSRA 1OAQL 5F1IB 4MJIB 3BN9C 4M3KB 1LE5B 2RJMA 2VITB 3S7GA 2IMMA 1KELH 3EJYD 5IVOA 4XWOC 2EDOA 5IESL 3PG2A 3VXPB 4OD2B 4F9LA 1QRNA 3IDIB 3RA7L 2ADGA 3MLXL 5C0FA 1BD2A 2EE9A 5ADOL 4R0LC 3EO1B 3RWIB 5E2VL 4NC1C 1A4KB 3EO9L 4MA3B 2PYEA 1NDGA 4B50A 1DE4A 3BHBB 5IM7B 5EO0B 1I7TA 5SV3A 4E42B 4G5ZH 1X6NA 3WEXB 4NQDA 4BYHA 4CU7A 2AW2A 1DANU 5HHOE 2GJZB 1ORQB 1MIEH 1YQ2A 5E8NB 3RU8L 4ERSL 4ZD3H 5JW4N 3RPIA 1UB5A 1KYOJ 4CVXB 1C5DA 4LBEA 3WL9A 4UT6H 4GRLB 5IOPB 3MLWH 5AG9A 4U33A 3HZYA 4LNVA 3K4ZA 2AK4E 2EDXA 2ADIA 2UYLB 2DQFA 2XA8L 5L2JA 3VFOB 5DVNA 4KVNL 4W81A 4RDQF 3HG1B 2FJHA 2YPVH 1KEMH 5FECB 1NC2D 4N8VA 5CWSB 1WJ3A 4K8RC 5ID0B 5I2IA 2EDTA 2J3SA 3VFTA 2BRQA 4EI5D 5GRZA 2FECI 1J1XL 1RZ7H 4I3SL 2V5RA 3H7BB 2AGJH 1Q1JL 2ZSVB 5D70L 3V4PH 4GG6A 4K3JH 2ZCLL 3UO1L 2NX5B 4JRXB 2DLIA 1KV3A 5CUSL 4R4ND 1R5IA 4M7JL 1RK1A 1DVFB 1MCPH 1P2CB 3L6FA 4Q6IC 4Y4HA 3O9WB 3KNBA 4GBXA 2P8LA 3MRDA 4M9OA 5C0CD 4NQVA 4A6YL 3GI8L 5DYOB 4X4YB 4OF5A 1OARL 3OHXA 3VXOB 4L1HA 2HWZH 2OR8A 4KKAD 2DBJA 3B9KB 4YHPA 1VADB 3CFJB 2NLJB 4OZGF 2J4WL 4HS8L 2NNAB 2XXMB 4PRPB 1IQWH 2V6HA 3C9NB 2VYRE 2DQIH 4FFYL 1A3QA 1K8DA 3O2DL 3GSVA 4HGWB 1RUKH 3BAEL 4F58L 1U3HA 1KLGA 4HLZG 4LVEA 1CICA 1KJ3L 3TA3D 5EUKA 3SKMB 3PWNA 5I1JL 4MB4A 4QOKD 2NY6D 4NZUH 1E6OH 5D72L 4LNRA 2WIIB 1EGJL 3RVUD 4U0QB 1U58B 5F21B 3GSUA 3O45B 5DHXB 1DEEB 4JREB 1FZJB 1FBIH 4ZS6C 4L4JA 1JF5A 1T1YB 5DVMA 4MD5A 4NOBA 3VFUA 1MCOL 1I3GH 3HLAA 4XTRD 2ZPKH 5KSVA 2A9ML 1TMCB 2GT9A 3SDDC 2Z35A 5BV7C 2EDHA 5T5FH 1Q0XL 4KZEH 4WU5A 4Z5RA 3UTZA 3V6FB 4ELMF 1D5XA 1U8HB 2HG5A 2GFBB 4KTDL 5DGRA 2X40A 3RZCB 2YPKA 4LLDA 2VLJA 3BKCH 2F53A 3ILQC 3N50A 3IETB 1RIUL 3KPQB 1OTUD 4RA3A 1UM5H 4MNQA 4QGTA 2BCKB 1HQRB 3X3GH 4M7LT 1P1ZB 3DRQA 5IEKA 5GRUL 3W0WD 3GMOB 5I66A 1BAFH 2R0LH 2X89A 1H5BC 4XBGA 4ONOA 1YEEL 3OKKB 3B2VH 3FB6B 4JY4A 4OCSL 4QF1B 4DFHA 5H37H 5DJYA 3HC4H 2P7TA 4UU9A 1T21A 1FNLA 3NABL 3HKFA 4RNRB 4LEOA 4YO0B 5T1MA 3RL1A 3V4VL 4E41D 1BQHB 1OP3K 3ZTJG 3BGAA 1ED3B 3M17A 4JDTL 4P46D 3BIKB 4EN3B 4P2OC 5ID1A 5KSBA 4CL7A 2V7HA 4JM2B 3MV7A 1C08B 5D1QD 1B4JL 5MI0B 2WWMC 3JV5A 4HIXL 5H94B 2CIIB 1ZHKA 1I8IB 3EYVA 4FQLH 1ONQB 1BFTA 3VD4A 1MVUB 4C4KT 3IGAA 2R0KL 5BS0B 4Q6YA 1U3ZA 2D7OA 3QEGL 5GGRA 2YR3A 5ICYA 1U8QB 1G7PB 1N5AB 4OBRA 5JIPA 4FFZH 4NBZB 3ULUD 2IANA 3Q3GB 1XIWB 3AGVA 1TITA 4QRTA 5EDXA 3V7AG 1A2YA 5IMMA 5JNYA 4FTVA 2C3VB 4NHUA 3SGDI 4YAQA 2FHCA 4ZAKA 4U7SA 5D2NA 5IB5B 1S9XB 2V17H 4HC1L 2FLRT 3HI6H 3UTSE 1PJ9A 1DUZB 2NY5L 4JM4L 1KTLA 3PHSA 1OHQA 5I8KH 3T4YB 5IIEB 3EOAB 1QRND 1U93B 3DYPA 4PGCB 3WO4B 1BD2D 4NQCA 3SKJH 5DXWA 5AEAA 1YECH 4ETQA 5CEZL 3VXTA 2PYED 3FO9B 4NT6A 2HFGH 5DK0A 5FA4A 3BJLA 5IMLB 5ALBH 5DR5L 5DRXA 1R5WA 4JO1L 4UUJB 3A6CL 5EZIL 3NVQA 4P2QB 1OAUH 4XAKD 4OZIB 1QVOB 1JRHL 3PGCB 1XGUB 4NQDD 5LXGL 2GY5A 3B5TA 1A0QH 3WLBA 3BZEA 2FCBA 5I74B 2XQBL 3O4LE 3MRJA 4HJGA 3P9MA 4U1LB 4XPTH 5DUML 1RZJC 3V8CA 2UWEA 3DYMA 2QTEA 4G42B 3RWCA 4WI8A 2DQCL 2Y07H 2EIZB 4HEPG 3QIWB 2J88L 3S35L 3SGKA 1T83A 1P4BL 4G8FA 1CE6A 3R1GH 1QPXA 2A74A 3QFJE 2HYMA 2V5MA 4N0FA 4HH8A 4KI5F 6FABL 5BVJB 3CFDB 3NCJH 3U9UB 2H2PC 3T4AA 3O3AA 2O61A 1N2RA 1WFTA 3SO3C 1B0GB 4KQ4L 1JGUH 1FL3A 2OTUB 4D0BB 4YDLC 2YEZB 2B1AH 3H0TB 1IAOA 3VDBA 3W9EA 4YXHH 4BZ2L 5CZKA 2VZUA 3SJVA 2Y5EA 3GEWB 1T89A 4PJ8C 3MFGB 4PJ9C 2VQTA 4OM0H 1IE5A 1XR8A 4Y4HD 1HSBB 3B2UC 3FQWB 3H3KA 4JZOA 4GBXD 4XP5L 4KK9C 4OZGE 1F4YL 3KPRB 2ESVB 1P53A 1II4E 5I1GH 3B8YA 1ADQA 3LKRA 5JHDA 1NGXB 1IT9H 4JFHD 1M4KA 2EC9T 3QO0A 5LAXB 3MRGB 4Z7QF 2OJZH 4R8WL 4OGAC 1I7UB 4QRSA 1BVKB 4OM1L 1U3HD 2JJSC 1CICD 3BW9A 3WJJA 4JGMA 2ZJSH 1IGCL 4XHJC 2APTA 4PR5B 3MYJB 1LO0L 4X7SH 2Z31C 3CZJA 4CJ1A 4F7EB 3RDTB 3QNXA 4M43H 3GRWA 2VLRB 5GRYA 4WFFE 5IBTL 2DWDA 4HWZB 4WJ5B 2HT3C 4NUJA 3QDHA 1NFDB 3UTPE 2JF1A 5T3XL 3TIEB 2YZ8A 2BMKA 2XNAA 3VMOA 4ELME 3RVTD 1KTDB 5DD0H 3UAJD 3ORJA 4IDJL 4LVOC 4K7PL 3VRIA 1Q38A 3IKKA 1VACA 4O2FA 3TNNA 4LMQE 5C92A 4HKZA 4N8PA 1A8JH 1G7JB 4NP4H 3HI5H 2VLJD 5EOQL 4M1DL 2F53D 1R3JA 4YX2L 4PUBH 4WU7A 4Y1AA 1G7IA 4OF7A 3G5ZB 3F5WA 1N26A 4WEBH 4RSVA 4G6MH 1F3JB 1VFBA 1CR9H 4MNQD 3MRHB 3CVIH 2HJLA 4F9PC 3WFEH 1BJ8A 3TP4A 3X11B 3RWEA 3QPXH 3QHFH 1U8JB 4KQ3L 1KEGL 4JFEB 2X89D 1A14H 5KVFH 1T4KB 3TBWA 3MCKB 1JWSB 3R0MA 2CKNA 3L7FB 4GS7B 4RAUB 4XRCA 1IARB 2MQCA 5FM4A 3V7MA 4D9LH 2Z8SA 3WDJA 1F4HA 4RFOL 4KC3B 2AEQL 3EZJB 3RBGA 1TVHB 3G6AA 2VUYA 4HFUH 4NCDA 1CFTA 1FLRH 1IRAY 4JPWL 3GJFB 4JQIL 5HYFA 1MRCL 1TETH 2VMFA 1I9EA 4NJAH 3MV7D 3RWHB 3LY6A 1HKLH 2I27N 3Q6FA 2OTPA 2Y72A 2MCG1 2ATKB 3WSQH 3X14B 3RGVC 3BO8B 1LDPH 4BQ9A 4ODHH 4XCCL 1QTYT 1KCUH 1CTOA 4NN6B 3JTSB 4IHOA 1GPOH 4UTAH 4OGXL 4IRSA 5HVGB 2IAND 5B3JF 4I0PB 1NQBA 2AERT 2Q86B 4YC2C 1WWWX 3TN0A 1HDMB 3QIUA 4FTVD 1GGUA 1XH3A 4ZAKD 3C5SA 4XPHL 4S1RH 5DMKB 4L4VE 3RUGB 1Z9MA 5BRZE 5IJKA 3BJ91 4XVJH 5BOZG 3V5HA 1JK8A 4DQOH 1E4KC 3FQXB 1YNKL 4MNGA 5LGJB 1QYGH 4LPCA 4ZO8A 3NTCH 5TF1L 1BIIB 4OAWB 1IM3B 3PDDA 4NQCD 3ZSSA 4XXDA 4WO4C 3H7LA 1FPTH 2BNQE 5FKPA 3GMRA 4CBPA 4HAGA 1FIGL 5HPMA 2V9QA 2XFXA 4LF3B 5KSAB 1PFCA 1CBVL 1U8LA 3QUMH 4P99A 2CGRL 1YEIH 2YRZA 3BPNB 5E0QA 1YMMA 3ARBB 2IF7A 1IC4L 5EORL 2P46B 4RFEB 3DBXB 5JW5B 4KI5E 3AMLA 3SDYH 4LLUA 1C12B 1FNAA 2R9HC 1AQDB 3CFKB 1IEAA 3RIFK 4AIXA 1SVZA 4ZUTB 1Q94B 2M8XA 1FZMB 1MFDH 1I8LC 4Y2DB 2XKNA 3WHE1 3FN3A 1EFXB 4YDVA 3FJTA 1KXQE 1OD9A 2DKMA 1QBLH 4WNQB 2IBZY 5DFTA 4UIMB 3EFFA 1P84J 3SPVB 2Z91B 3SJVD 3UTTB 3QH3B 5AZEH 2FHBA 5CSGA 4G8EA 1MLBA 2P8PA 3ES6A 3RAJL 5E1AA 3LKNB 4IIQA 4LSDA 1E6OL 4DZBA 3ETBF 5GGSB 3TYGH 4Z7QE 5SWQB 4KWUA 1Z0NA 4NM8H 5JHDD 2VLKE 1EJ6A 1CFBA 3DROA 4MJIA 5F1IA 1UCBL 5HDQL 3L5XL 3UTOA 1TJGL 1LE5A 4HF5L 1KULA 2VITA 3TNMA 3RHWK 4K94H 3VXPA 1JV5B 3MRCB 4OD2A 3IDIA 2DI7A 3QUYC 2PR4H 5EN2B 3EO1A 5DJXB 3RWIA 3D0LB 4MA7H 1A4KA 4NZJA 4WUUE 4PTTB 3QSKB 4MA3A 5FAAA 4F15B 4JFOB 3BHBA 3H9SB 2HMID 3GI9L 2O5ZH 5CEZE 5IM7A 35C8H 2F5BL 5EO0A 3CDYA 3PJSB 1R3IH 2NY0B 5JXAH 4Z7WF 3WEXA 2MQ3A 5JOFB 3X3FL 4LHQB 1QFWM 2RHEA 2GJZA 2WQ8A 2UZXB 5E8NA 3IU4L 1SHMA 5DURB 3WV0A 1RURH 3KYNB 3NCEB 4OCYL 1FNSL 5CIPB 4GRLA 2QBWA 5IOPA 1CQYA 3HC4L 3LS5L 3O8XB 2RQ8A 1ZHLB 1UB6A 1C7SA 1NAKL 3I2CL 2X4QB 4Y8DC 3VFOA 4HWUA 4Y1AD 4QTIL 1ZWIB 4XB8A 1F00I 5D6DA 5FECA 4WW1B 3FO1A 5ID0A 3C6LB 5T3ZH 2C9AA 1K4DB 1FZKB 5I75B 3A6BH 3JZ7A 3WFZA 3H7BA 3VRJA 2I9TB 4HMEA 5E1HB 4KGJA 3PDOB 1UEMA 2NX5A 3DGGB 4JRXA 1OB1B 5ETUB 3VFVB 1UCTA 2Z92B 1DVFA 1P2CA 4PV9B 1FC1A 4DUVA 4MD0B 5HPOA 1UADC 4D8PB 5DYOA 2EH7L 3VXOA 5KVEH 3GM0A 1FZOB 2D0GA 1J5OL 4KJPC 2WUCH 3UDWA 1MCHA 4YQXH 3B9KA 1VADA 3CFJA 2NLJA 5C3LD 2NNAA 4KHTH 3DSNA 3DMMC 4AMKH 4IDLA 3C9NA 3HI6L 4MS8C 4HGWA 4NFDA 3WLWC 2ICES 4KKCC 5B3JE 1CU4H 4X6BB 1PKQE 2OI9C 3KLAB 3NOIA 4ZODA 3SKMA 5GZOD 4MLSA 5I8EB 1WV7T 4IRSD 3AS2A 3QWRA 3SE4A 2WIIA 3LEVH 5F44A 3GFUA 3MOAH 1CLYH 1U58A 3WFBL 2FLBT 3O45A 3DURB 5J11C 3TN0D 1RAMA 1DEEA 3QIUD 4XPBL 1FZJA 1KIPB 4G8IB 1T1YA 4QHKI 3BPLB 5FUCE 2L7UA 5T3XE 5AAMA 3PXHA 4G7YL 4IEFB 4NZDA 3B4NA 3QUXC 4YUEL 3TFKD 5EUOF 3V6FA 3R1GL 4JRYB 5DJ6B 1U8HA 2GFBA 4PJIF 3RZCA 4GKSB 4CRPA 1KJ2B 4N0UB 3AM8C 3IETA 5JXEC 3S37H 3KPQA 7FABL 4I2XE 1G6RL 4PJAB 4I77H 1HQRA 1Z2KA 3ZL4L 4P5TB 1P1ZA 3UP1A 1DSFH 3OPZH 4Q9CA 3GMOA 2CO6B 2AQ1A 3CFBB 3BKJL 3R06A 1YMMD 3CD4A 1P4IH 3HAEH 3ROOB 4X9HA 4F2MB 3GMNB 2GSIB 5IJVB 4P0DA 3OKKA 2WWKT 4K2UH 4WWKC 3FB6A 1UKTA 4DFIA 3JUZA 5GGTH 2A2QT 2G5BB 2OSLB 2W60B 2HFEB 2VDML 4RNRA 3J8F7 2Q76B 3FCTB 4YO0A 1BLNB 4NYLB 3LZFH 1BQHA 3OAUH 2R0ZH 1YNTB 5H2BB 3OG4B 1NLDL 4U1JA 2VTFA 3BIKA 2EZ0D 3QQNA 1N4XL 4LAQL 4JM2A 1IT9L 1C08A 4M5ZH 4NNPH 4X0KB 4WI2A 2E6PA 3TM6A 5H94A 2CIIA 4TUOB 1J0YA 1ONQA 3EYSH 5D7JA 1MVUA 1ZLSH 4B53A 2F19H 32C2B 1MQKH 1T1XB 4DKFH 5I1IH 4R97C 4U1IB 3ULUL 3L3JB 3W81A 1U8QA 1G7PA 1N5AA 4X7SL 1IAIH 4CDGC 1XIWA 2UUDH 3GB7B 1I3VA 3G9AB 1U8PB 2GTZA 2C3VA 3I6LD 4HKXB 5KVDL 3PE9A 4LMQI 1HILB 1ZE3C 1UACL 4MJID 5E95B 4OKVB 5IB5A 5IVNA 5MEPA 4NRXB 1S9XA 3V5KA 5CSZA 1T0NB 4NWUH 1DUZA 1CD9B 4EI5C 1HEZB 1VESA 2BNRA 3BE1L 3EOAA 3GKWL 4MCYB 2VDQH 1CZ8H 2VXTH 1U93A 4ODXB 1S7QB 2CUIA 5E6IC 2A6IB 1QLRB 4S0TD 1CD8A 1NFIB 2EKSB 4PYGA 4Z7WE 1TCMA 4FP8H 3THML 5IMLA 4NP4L 4R4NC 4W6WB 4PBWD 5M95B 4UUJA 2V2XB 4PUBL 3E6FB 5DWUH 1HYSD 2BY3A 4P2QA 4JDVB 1DQDL 4OZIA 3PGCA 1QHOA 1XGUA 5IFAL 2I25N 5E9DB 4J3TA 3CVIL 4LLWB 4M48L 1WFNA 4M1GH 4U1LA 5I19L 4H20L 3UROR 1YEJH 4Y5XC 5CINL 4G42A 2EIZA 3IJYB 4RGMB 3WNPA 3QIWA 1YEHL 1ZXQA 4GRLD 2BRRH 4L3EB 3FB7B 3QRGL 2EDKA 3ZE1F 1EEZB 4QRQB 1IJ9A 4XGZB 4TTDD 2EC8A 3QT2A 5IT2H 1JNNH 2IH1B 1FLRL 3CFDA 5BVJA 1F58L 1TJIL 4RRPA 1P84K 2DICA 4HUXB 1TETL 1HKLL 1YPZF 3QPQD 1B0GA 3U83A 4FQQB 2YEZA 5IB2B 4HUWB 1PSKL 1HZHL 3DUSB 3H0TA 4ONGH 4ODHL 2NX5D 2UY7A 4JRXD 5DMIH 4QXUH 3F8UB 1QLEH 3QHTC 3VU2A 1EAPA 3G6JF 4YH6A 1DVFD 1HSBA 2FB4H 3FQWA 1RUMH 1OSZA 2DQDH 5B38B 3DWTA 4X4ZA 2E27L 2ESVA 5FGBC 4C55A 3B9KD 1TENA 1NGXA 4S1RL 5FCSH 3ULUF 1OTUC 1R24B 2JLLA 4RWHA 5A3IC 1J8KA 2VXVH 1KCRL 3MRGA 5CP7B 2EYSA 4I3RL 5LAXA 3TV3L 5F8QC 1BVKA 2AJSH 3D18B 4F8TA 1BIHA 3RGHA 5IWLC 5K59F 1EA9C 4JANA 4V1DB 1QG3A 1FFQA 3GMMA 4Y89A 4PR5A 3MYJA 4PLNC 1MIMH 4H8WH 3LV3A 2BK8A 3QWRD 4TULL 2V2TB 1QKZH 4F7EA 3RDTA 4FZ8L 4K9EC 4WV1B 1W0VA 2VLRA 4JJHA 1GIGL 4HWZA 4WJ5A 2QADB 4PJHF 3MRMB 1NFDA 2DD8H 4W4OA 5C0JA 1BVZA 5DO2D 3TIEA 1P9MC 1QSFB 4Z9KB 5EUOE 4S1DC 2NZIA 3U6RB 1KTDA 3MBXL 4X7FC 1T2QH 4HWBA 4J6RH 4KDTC 4PJIE 3MV9B 3TESA 1XMWA 3VXSB 4FMKA 2EDJA 3VG0H 4R26H 1G7JA 5I16B 3RZCD 2IAMC 1I1RA 1EO5A 3ULUC 3G5ZA 5EULV 1F3JA 1D5ZB 3MRHA 4P57A 5GS0C 3GHBH 1PW3A 4S1QH 5MERA 5DD1L 1JVKA 1KXTB 1UWGH 2DTSA 4KJWD 1HN1A 3X11A 4LGSB 3VGAB 1U8JA 1CI5A 1CG9B 3MNVB 3MCKA 1JWSA 4M00A 4N0CC 3VJ6A 2H2SD 4RAUA 3K1DA 3IFPA 4NQUA 2V5YA 3KG5A 5TF0A 4E5XA 4XP1H 3VDAA 1HHKA 2X1OA 5HYSB 4GG6F 1NANI 5GJSH 1EV2E 5C0CE 5D1XC 1TVHA 1X5ZA 2YWZA 3KYMB 4BZ1L 1N6VA 4JHAH 3ULVH 3GBNH 1ZLUK 1J0ZA 2VRAA 5T5NF 3AREC 3GJFA 4JM2D 3RWHA 3UJJL 1CFSB 1FG9C 3QNZB 1S78D 1AJ7H 2ATKA 1IGML 5FYKD 3X14A 3BO8A 2R1XB 2PR4L 3BP4B 3EUUA 5D7JD 5I76B 1VCAA 5CJQH 3ZYZA 2B5IB 4FZEL 1JRHI 4TNVK 2EDRA 4QOKE 15C8L 5D7KD 3ROLB 4I0PA 1XIWD 3OAYK 1JFQH 3K4AA 5GS1B 1D5IH 1A6WL 2Q86A 1MCFA 1SY6A 3DSFL 1HDMA 5KJRH 2QQLH 3BP6B 3IDMB 4IOIA 1VSCA 1HHJB 5KN5A 1E6JH 3RUGA 2WIMA 2A83B 1KTRL 3FQXA 4JY5H 4LASL 4Z0XB 1QFWI 5LGJA 2BNRD 1BIIA 4OAWA 4F57H 3DX7B 3FRUB 1YN7A 3SHSA 2ORBH 1H8OA 4U0RB 3BT2H 1BREA 4GT7A 3CXDH 1M7DA 4NSKA 1KPUB 4PP2B 2J2ZA 1QRKA 4Y4HC 3IDJA 1MWAH 4NO5B 4GBXC 4H1LH 1MUJB 3BDXA 4P2QD 4JFPB 4LF3A 3I9GH 5KSAA 3VXUB 2W0FB 2ED7A 3N0PB 4BH7B 3T09A 1WWCA 3W0WE 3ZTNH 3ZKND 3ZE1E 3ARBA 3OKNB 4RFEA 2CLRB 3DBXA 5ACLA 3VGHA 3QIWD 3RX7A 1CICC 3MNZB 2FBJL 2E7CA 1QFOA 3PP4H 4GW4B 4L4TB 5T33L 5DVOA 1AQDA 3NA9H 4UILL 2Z8WC 3DRTB 3BDYH 1YPZE 3IAQA 4M5YL 5IW3A 4E41E 4ZUTA 1E4XH 1Q94A 4MWFB 1U2HA 3W5MA 2XI9A 4YQXL 3S8WA 2AEPH 4GKOA 4RFNC 4Y2DA 1ZVSA 1EFXA 5HDLA 4LDOB 1OLZA 4P49A 1DN2A 3G6JE 3BGFB 1HXMB 4WNQA 1PX3A 2C3WA 5KSBF 4UIMA 4W4NA 5FIEA 2BVEA 2CDEB 4H5SB 4RMQA 4Z7NF 4XWGH 3REWB 3UTTA 3QH3A 4XCEB 5F7FA 1HYRC 4YR6B 1MCIA 4YHZL 5JORB 2MWCA 3FB8B 3ULUE 1ADQL 1VA9A 3MOAL 4UV7H 2ESVD 5GGSA 3ZKXB 3CSGA 5SWQA 1XF5B 4OKDA 1G9EA 4ZPTB 2Y06H 2HT4D 4NC2B 3RVXC 2HRPL 1W2KT 1U8KB 1FG2B 5FYKH 4R0LB 1J86A 2UZYB 3DI2B 3I6KB 3IFLL 2WBJB 1S5IH 3WN5C 3MRCA 2BJMH 4G43B 1QRNE 1BGXH 5EN2A 2QEJA 1J1PL 1BD2E 3D0LA 2IBZX 3PDGA 2PYEE 1KFAL 4JFOA 5E8PB 1QLFB 3H9SA 3GRWL 2BHUA 1EJOL 3PJSA 3RDTD 1YYLL 3G5XA 2DAVA 2VLRD 4TN9A 3S37L 3O6LH 4XAKE 4XI5D 5JOFA 4NQDE 5GGUB 4POZD 3O81A 3WHXB 2CK0H 3OPZL 5DJ8B 1WBYB 1WEJL 3OKMB 2AI0L 5I18L 1FGNH 4YDKL 2FRGP 4K2UL 5HDBF 4LCYB 2OM5A 4LP5A 5KZCB 2UWEF 3O8XA 1ZHLA 3WS6A 4TVPD 2EEDA 2OJEB 2X4QA 4LVNB 2R0ZL 5INDA 3TVMC 2CRIA 4AEFA 4PJXB 4NNPL 5DMGD 3C6LA 1B9ZA 1G0YR 2OZ4H 3O3BA 1K4DA 1FZKA 2I9TA 2X4OB 1AE6H 4P3DB 3GSQA 1PQZA 4GG6E 4FG6C 3DGGA 3U30C 3ZDYF 4WEMB 3K2UH 5FHBH 5C0ND 4ZNCD 3WXWL 3B43A 2HTLD 2EO1A 2NY3C 4PV9A 3P4NB 4MD0A 1A9BA 1FJ1B 1IAIL 1RUPL 4LSQH 4UNVA 1FZOA 4P3CL 4OD3L 3QJHB 2CO7B 4OLUH 4JFHE 3NA4A 1GXEA 1JPSH 1B2WH 1U3JA 4YHKH 1TLKA 5D4QA 5EU3B 5HI3D 5M94B 4U6YB 5GHWH 2VDQL 2XA3A 2GAZB 2X41A 2R4SH 3W39B 4X6BA 5I8OH 2FJFA 3EYUH 3K80A 3KLAA 3PNWB 5DEGB 2QQKL 1CFQB 2VDPH 1BOGB 4DN4L 3ARRA 3GIZL 3SGKC 4UT7L 1T83C 4I0PD 4PJCB 3EYOB 5I0ZA 1LEGB 2VWEC 1NUGA 5FYJL 4FABH 3DURA 3SDDB 4EDXB 1WCBB 2X4NB 3K7UA 1KIPA 4G8IA 5BV7B 3P0GB 3LHPH 5C0AB 4EVNB 4LARH 3T8XB 2C3GA 1UENA 4TTGA 3U4AA 3HNVL 4JPVH 4Q2ZB 2APFA 3PHOA 5ANMA 4C54A 2CR6A 4JRYA 2XWJB 5DJ6A 4BELD 1U95B 3GK8H 1T89C 3FQUB 4GKSA 3V9FA 3ZYOA 5ALCH 2VLJE 2MPAH 5GIRB 2MOVA 4PS4H 2F53E 1AI1L 2D0HA 4HAFA 1MEXL 5FFLA 4HSQA 5KSAD 2NCMA 3S36X 4PJAA 4UV4L 1EMTH 4MNQE 3BSZL 3F7VA 4R7DB 3BFOA 5TFSH 2HTKD 3TWCL 3EJZD 3CFBA 4JFDB 4JCLA 2FX9L 3ROOA 4F2MA 2XPGB 5CAYB 3ARBD 3GMNA 2GSIA 5IJVA 5DMIL 5ITBH 4U7MA 4XNYH 1A6UL 1FVEB 1BBJA 3WJJC 4P2OB 3SQOH 2G5BA 3DI3B 2OSLA 2W60A 2HFEA 2Q76A 3FCTA 5EIIB 1BLNA 3VFSB 4WHYG 5EBGA 1YNTA 5H2BA 4JO4H 1KENH 4RIRB 2HMIC 4ACPA 1YEKL 5DHVH 5I1HH 1MHPH 3RJQB 5KSBE 5KW9L 3C87A 4Y2DD 4X0KA 3TJHD 1EFXD 3BZFA 3MV7E 3RVWC 4HZAA 4Z7NE 1J0JA 1IBGL 3QEUB 4G6AC 4ISVA 2DQEH 5C0RH 1FO0B 4TUOA 5IV2A 2V5SA 4KJQC 2YMXH 5K9JL 4HMCA 4XP4L 4XP9L 1JZ2A 2D03H 2PCPB 4GAJL 4EIGB 3UTTD 32C2A 4V2BA 1UYWH 1T1XA 2XYCA 4TOYL 3T0WA 4U1IA 2BFVL 1OSPL 1RJCA 5E56A 3L3JA 3WXVL 4H8WL 1N64L 2J1KA 1QKZL 1QBBA 3RKPA 2IANE 2DKSA 3DHJA 3GB7A 2Y4SA 4FQIH 3T0EA 1JWUB 3HNSH 1U8PA 2EYRB 4C83B 4AL8L 4FTVE 2P24B 4HKXA 5E8DL 1MAJA 4XNQB 1HILA 2AXHA 2ID5A 3NIGF 4OKVA 5D2NE 5KAQG 3FFCA 1HEZA 1UFUA 4MCYA 2DQHL 4ODXA 5GGVH 5JZ7D 4S1SH 5LWYH 1S7QA 1Q9WB 2AV1B 3U1SL 2A6IA 1QLRA 1Y0LB 4NQCE 1FCGA 2EEBA 5B3NA 5D96C 3O2VL 1NFIA 2AXJA 2D4FA 2EKSA 2KDGA 3MGTB 5DZNA 1QSEB 4X80L 2OL3A 3H9SD 3Q1SL 1GC1L 2V2XA 3E6FA 4M6MH 2ZG3A 2NY0D 5FO7B 4JDVA 2NY7H 4YBLB 4NZTL 5E9DA 1E27B 3OXSA 5T1LB 4LLWA 1ZLVH 4Q9QH 5HDBE 1MCBA 1LE9A 5DD5L 1N8ZB 1I9IH 4Z78B 1DLHB 4K71C 5DURD 2UWEE 3HAEG 1F13A 3C5ZA 5GSVB 3IJYA 4YHLH 3BN3B 4L3EA 3FB7A 4PJFB 1CDGA 4QRQA 3JWDL 1QZ1A 3O8XD 5GJSL 2P4AB 4XGZA 4WI9A 4AZ8A 3EFDH 4I8DA 5E8OB 4JHAL 4LSRL 2IH1A 1GHFL 4IRSC 4YDLB 5JMRA 5MP6H 5DLMH 2Q1EA 4JG1L 4HUXA 5F7NC 1RHFA 1UKQA 2F54A 2Z4QB 3C6LD 4KFZC 3ZDYE 5HHXH 4FQQA 5EC2B 1V05A 1L4IA 4PJ8B 3QQ4B 5IB2A 4HUWA 2ZSWB 4A2LA 1S3KL 5B38G 3DUSA 5KVGL 4W6YB 2OMBA 3NPSC 1WT5A 3SJVE 1A5FH 3D2UB 3CIQA 3MA9H 3NMEA 3CUPB 3BZDA 3TBYB 3TYFB 3TFKC 3WIIH 1NCCH 3HPJA 2J8UB 3FT4B 2IH3A 1ZT4A 1JFQL 1T5XB 1SM3H 1LDSA 2X9WA 4AEHL 3MJ7A 1G6VK 3CDCA 2X1QA 1RZGB 2GK0B 3KWWB 1R24A 4RMSA 5ICZB 3GSWB 5CP7A 4PBXA 2X09A 1U36A 5JPNB 4JY5L 3VH8B 4XMPL 2UVEA 3D18A 2YWYA 4JZJC 4LIQH 1F2QA 2Z31B 1KN2L 1C5CL 3VGFA 3KHOA 4DEPC 2ORBL 2CKBH 4V1DA 4NWTH 5TQ0L 2VNCA 1T66D 4Y5VB 1H3VA 4S11A 3WJLA 4H0HB 2V2TA 2EDDA 3T4YA 3X13B 2JCCB 4OBSA 4WV1A 1G9NH 5F88B 3MRMA 1OTSD 3HN3A 4GUPA 5CGYD 1A7QH 2YZ1A 4L8BA 1HQ4B 4X8JB 3AXLB 1QSFA 3U6RA 4KUCD 4IS6B 1I7RB 4HJJH 1L9MA 3FFDA 3TCLB 1GL4B 1OPGL 4XX1E 4LFHG 1A7NH 1T04B 3DVNB 2VAAA 4P4RB 2XKSA 3VXSA 5F7EL 4JRYD 5JW4R 2GW5A 3B9AA 4Q97A 5I1CH 5I30H 4ZUSB 5I16A 5MENB 3R4DA 4BQBA 4KAQL 1YY8B 5ERWA 3DGCR 4Y1AE 1UXWA 3MV01 1FCCA 4MDIB 4MVBC 3U9PL 1D5ZA 5EA0H 1IAIM 4H26B 3NACL 4OI7A 4HQQH 4O5LL 3K8MA 3I3BA 4JKLA 5CS7A 2B39A 2ITCB 1XGQB 3GSRB 1WFOA 2VSDA 2DTMH 1KB5B 2F8OA 2HVKB 2VDNH 3FHAA 3RTQC 3EOTH 5TE6H 1NCDH 1NGPL 4GO6B 3I02B 4O02L 2Y1VA 3Q6GH 5HYSA 1NKRA 2L4OA 3KYMA 1PYWB 1YNLL 5CILL 5DF0A 4UV7L 4CU6A 1TDQA 1BMGA 5HHOA 3S4SB 2V2WB 2EIDA 1OAYH 3H6JA 3BESR 1GC1C 3CSYB 1CFSA 4OSUL 5E03A 5FYKL 4HJ0C 4FQCH 1S5IL 2NR6D 4B7LA 2R1XA 3BP4A 5I76A 3WKMH 4FS0A 4NCC2 5DT1L 1F90L 4WENB 5C7XL 4AYFA 1N5YH 2B0SH 1TJHH 3VWJA 2A73B 4GRLC 2VKXA 4FQJH 4BKLA 4OIIH 4C4KO 1DQLH 2DN7A 2VZ1A 3NIGE 5CKAA 4OQTH 2RAMA 5GS1A 1MRFH 3T0ED 3IJSA 1AGDB 3O6LL 3IDMA 3UEZA 3JWDC 2VABB 3ZKMD 5FYJE 3CXHJ 3TH2T 1GRWA 1CF8L 5A2FA 3VD9A 1HHJA 1J0HA 3H9HB 4X99B 1AKJB 2X05A 3PWLB 4AG4L 2AEWA 3PWPA 5T1KB 2W1NA 4Z0XA 4GKZB 1FGNL 4MNGE 3MCLL 4NRZB 5DJAB 3QP3A 4RQQB 4G7VH 3CLFL 3DX7A 3FRUA 2KKQA 1KSRA 3AS1A 5ADPH 4LPVA 1KPUA 5HGBB 1P7QB 4PP2A 5C2UB 4WUKL 3GO1H 4MB3A 4D3CH 5IFHH 2JELH 5DQJB 3O9WC 4NO5A 1MUJA 4OI9A 4BJLA 2KQNA 5IMOB 3MRIB 8FABB 2XZQL 5E9DD 4BH7A 3B9KC 4KMTH 4NUGL 2P48B 5GZND 3S36H 1MCLA 1YMME 1NGZA 3W2DL 4UINH 3OKNA 3C5ZD 3QXDB 4Y0GA 4ZTPL 2ARJB 3CGTA 4YZFF 4YXKH 4NNYB 3G6DL 5AZ2H 5F7HA 1NCWH 4L3ED 4L8CB 3MNZA 2N7AA 4GW4A 4L4TA 3WFHA 1F6AB 4BH8B 2OK0H 3DRTA 1YEFL 1LEIB 1NGQH 4K7PY 5MEOA 2Y7QA 1OM3L 3ZT7A 5GISL 5D8JH 3E3QE 2ZUWA 4M8VA 2NY2B 1JPST 2F54D 1OP5K 1EEUA 1WZMA 4Z76B 1RFDH 4XMKH 3L3GB 2Z9TA 1HXMA 1U8MB 4L9LC 5DO2C 2H8PB 3VW3H 4JM2F 1UKSA 3KJ6H 4BK4A 1SMOA 2DQUH 2CDEA 4H5SA 5BW7A 3EYUL 3MRLB 5EZJB 3REWA 4XC1L 4WGVB 1RIHH 4FQPA 3V6OA 2DM2A 2HN7B 3M07A 2DRUA 5EBLB 1I3RB 3FB8A 4KU1A 4P9HH 2IQ9H 4XT1C 4FABL 1XF5A 3I6LE 4X4MA 4ZPTA 3OSKA 4MJIE 4CMHC 1FG2A 1IKNA 2D7TH 1I4FB 3IDGB 3LHPL 4R0LA 2AABH 2WBJA 3LD8C 4R3SB 1TNNA 5CHNB 4G43A 4KJWC 5ICXB 1MHCB 5CZXC 1RZFL 2E7HA 4KK5C 4V1DD 4G9DB 2ZZUT 1S8DB 4LPUA 2H2SC 4KRLB 1G7MB 2PW1B 2DQGH 5E8PA 3CSBA 1T5WB 1X3DA 2MPAL 4TSAL 4PS4L 2HLFD 5JR1L 3U7YH 4LU5H 4H1LG 1ZTXH 2QADD 2BXYA 4DJMA 4H25B 4MA1B 5GGUA 5DUPL 4EN3C 3WHXA 5E00B 4JM2C 2Q7NA 2GTWB 1QSFD 4HWBL 5DJ8A 1WBYA 1IAMA 4YWGH 5MI0C 3OKMA 4OZIF 3MOBH 2GJ6B 5HY9B 3QXVA 5E4IA 3MV9D 5ITBL 3A67L 3MRRA 4OFKA 3VXSD 4TVPL 2OL3H 2ZP0T 4OLVH 3EDKA 2OQJB 4HCRA 2C4FT 4Y4KB 4JN1H 2B4CL 2OJEA 4Q58C 2R2EB 1JTOA 4EOWH 4JO4L 2EDYA 2BXZA 3VXMB 5E24E 5JHLL 3OXRA 4LFHD 1XIWC 2VLLA 4PJXA 3ZT5A 1B6UA 4JVUA 5CD3B 2W9DH 1DQML 2YD2A 3INUH 4JRWA 4K3DH 2ADFH 1OWRM 2NX5E 1MCWW 4JRXE 1WTLA 4UDTB 4PRDB 3CK0L 3CX5K 5F7DB 1CN4A 1NMBL 3OJMB 4DTGH 3PQYB 3WO4C 4P5MB 3P4NA 5IVZB 3STBA 1FJ1A 1AHWC 1KC5L 4HUVB 2L0DA 1F4XH 4XMLH 2CMRH 2LFGA 3CVHB 1SJEB 1MOEA 4OFPA 3QJHA 4NKQB 4I18C 1PGRB 1LO3H 1UT9A 4YDIH 1J05A 1LNUB 1YYML 5HHVL 3S34L 3QEQB 4PRPE 3F62A 3QUZB 5BMFH 1ZGLB 2QHRH 5I74C 5JIKA 1S7SB 4HEME 4M4PA 4U6YA 3U4EB 5GGVL 1V7ML 3LIZH 1M6OB 4ORGB 2GAZA 4GRWB 3W39A 1KB9J 5DEGA 5CGTA 1CFQA 3QO1B 5FCUH 4EBQH 1BOGA 1IZJA 4ELKB 2H3NB 2F58H 3QIWC 3VWJD 3OWEA 1JBJA 1SY6L 4PJCA 1GOHA 3EYOA 1CXHA 1PBYA 5D93B 3FRPG 4OD1H 3QG7L 3SDDA 2AV7B 4BSVB 1WCBA 1G84A 4Q9RH 3QUXB 3PWPD 4EVNA 3RNKB 3C8HA 5IK3B 3FRPA 1A21A 2E8ZA 1NFDF 4LP4A 3OR7A 1H9VA 5A2LH 5DQDH 2J6EA 3WFCH 4MJ5B 1R3HA 2XWJA 1U95A 4QXGL 2AJ3B 1F02I 4ZFGL 2M1KA 3FQUA 3G08A 1I9RL 3C60C 3QDMB 2OTWB 4U6VL 5GIRA 3I75B 1FE8H 5MP6L 5DLML 5IBUG 4KTEL 3IKCA 2JJWA 4OCWH 1EBAA 4R7DA 3ZDXF 4WWKB 4DW2L 4JFDA 4HPOH 4BFBD 4P2RB 1WAAA 1LWRA 2XPGA 3MMEB 4LPWA 5HYIA 4O4YH 5B39G 3OMZA 4L4TD 4P2OA 5L6YH 1DDHB 2DIBA 3NCCB 3MRPB 5IHZA 5CJXC 5EIIA 1AY1L 5AYQA 4RIRA 2VXUH 4PYHA 4TRPH 3RDTC 1DTUA 2BSTB 2XY2A 3DYOA 1JZ3A 4WCYH 3RP1A 1JIBA 2OX5A 3EYQD 3E1F1 3QEUA 4XI5C 4XBEH 1IAKB 1MJUL 5F9OH 1FO0A 3NBNA 1CDCA 4POZC 2FEDD 5FYKE 4CVWA 2PCPA 1V3JA 1CK0H 1F4WL 1JGVL 4AT6B 3O6KL 5BS0E 5F96H 4POUB 3CXHK 3QDJA 3U79A 5DVKA 1PAMA 1DN0B 2NY4B 4Y88A 4ZNEA 3K46A 3QNYB 5HGAB 5D7KE 3BN9D 4GW5B 1CXLA 1JWUA 2EYRA 4C83A 1RZKH 2P24A 1CE1L 4XWOD 2YSSB 4XNQA 2B4CC 1Y6NR 3S3SA 4OF3A 5BCAA 3WD5H 5E6IB 1Z9LA 2R4RL 4XNUL 3ISWA 2WBJD 2VH5H 5C0EB 5JUEH 3LCYA 3PV6A 2BNRE 3M45A 3KPOB 5GS3A 2AV1A 1A7NL 3RUGF 1A1OA 1Y0LA 3AAZB 4N0YL 3AFLA 4GS7C 5I1CL 3P4MB 2CK2A 4HXAH 3RX5A 4DVRL 2HTLC 3SOBL 3V4UH 4V2CB 4P2QE 4KGLA 4Y5XB 3LH2H 4OZIE 3ARVA 1E27A 5T1LA 2EDBA 4PGDA 3VD7A 1ND0B 5KANG 4GAGL 1N8ZA 1TTFA 4CW1A 4MQXC 4Z78A 5JMOC 1DLHA 3O2DA 4ZG1A 1IAII 2IJ0C 4WDIB 5HI3C 2F8VA 5GSVA 5TE6L 4F3FB 4RWYH 2WBKA 4HXBL 2VR4A 3F65A 3OX8B 4PJFA 5KZCD 1FLTX 3L3OB 1YC8A 3W5NA 1OF2B 1EGJA 5ITFB 1X5FA 4K3GA 5E8OA 1EFQA 4KK6C 4UQ2B 4APQB 4LCCC 2GQHA 4FXKB 5I15L 2LQRA 4IJ3C 4TUJA 4I48B 3PWUB 4OIAA 3ZE2E 1WIPA 5EC2A 1S9WB 4PJ8A 4PJ9A 3QQ4A 4M6NH 2ZSWA 5CBAA 4FQCL 4C57C 2QSCH 3L3HB 2V7NA 3D2UA 4HX1B 3CUPA 2DB8A 1SBSL 3TBYA 3TYFA 3T2NH 4ZDHA 3BGMB 3VFRB 4FQJL 2J8UA 3FT4A 1AD0B 2EO9A 4NKIH 4Z95H 1VEPA 1T5XA 1NUFA 4KROC 2BY0A 2ESVE 3T0DA 4IMKC 4JDZA 2VZ3A 3SDCC 2BDNH 4ZOBA 2GK0A 5SWSB 2GYSA 4FFVD 2JJSA 3KWWA 5KSAC 5E2UH 5ICZA 3GSWA 4NO3B 5JPNA 3SE8H 3VH8A 5HYJB 3EJZC 3CMOH 2Z31A 3NH7H 3TBVB 3ARBC 3DV4B 2PW2B 4BFEA 5H35B 1WF5A 1TCRB 3K4DA 3BVNB 4Y5VA 2ZCKL 1F2XK 3QCTL 4JY6B 5AG8A 1L0XA 4L8SB 3X13A 2JCCA 1PVHA 1JHLL 1RJLA 1Z0MA 5F9DC 5D7SH 3D48R 3CZFB 2VLRE 3SDDD 2F5AL 4JFZH 2BOCB 4MA8H 1EO8H 4Y19B 3GSXA 4HIJB 1NFDE 1MFNA 3F7PC 1FORH 5B4MD 5L9DH 1HQ4A 4X8JA 4Y2DC 3AXLA 2E5EA 3TJHC 3E8UL 3QFDB 3DTXA 5D9SA 3P9WB 1DLFH 5FGCB 1NC4B 1I7RA 3N1GC 3ZDZF 3TCLA 2IAMB 2OR9H 2DLFH 3RWJB 1KOAA 1T04A 3DVNA 4TUKH 2PO6B 1F6FB 4P4RA 1J8HB 5GQBA 5DDHB 4GXUM 4ZUSA 1TIUA 5MENA 3TT1L 4TVPE 4X83A 4G3YH 3ZDXE 1YY8A 4F9PA 3MBEB 4IRZL 3MCG1 2DM4A 3MXVL 4MDIA 1XF1A 5T1DL 1UM4L 4PJ5B 4HIHB 4H26A 1Y6MR 4TSCH 4GSDH 4JFDD 1B4RA 1P5VA 4YE4L 2ITCA 1XGQA 1KB5A 2HVKA 5D1XB 5K9QG 3S4SG 3EDJA 4OF6A 2FDBP 1RIHL 1UM6L 4PB0L 3I02A 4K8RH 4JFFB 1H3GA 1MFEH 2DDQH 3AREB 4P2OD 5E2WH 4HHAB 3MJ9A 1RY7B 2HKFH 1PYWA 5KS9B 2FEEI 4JO3L 1UWXH 2WWMD 4PIRF 3S4SA 2V2WA 1TQBB 4P23C 3GBMH 2XOTA 3IF1A 2NY0C 5IKCB 3NCMA 1JNLH 3DX8B 3EJJX 2E7MA 2CLVB 1NCBH 5TQ2H 4LQFH 2NPLX 2YD4A 5EC1B 3VFNB 5C0BB 3DECA 1K6QL 5KG9B 3MFFB 3T0VA 5DJ0B 4DOHB 4Z77B 1S7VB 2J12B 3QDJD 4O51B 2DQGL 4QRPB 3DPBA 3VFGH 2A73A 5LCVH 1DUYB 3O8XC 4BQ8A 2Q3AA 1YA5A 3U7YL 3VI4F 1ZAGA 2F9BT 2VABA 1VPOL 5CEXB 1K8IB 4MDJB 3MLPA 3H9HA 4LRNH 4YEEA 3OF6A 4LOUD 1CLZH 1AKJA 2YD1A 3M1BB 3PWLA 3RUGE 4GJTB 4UQ3B 1FVCB 5T1KA 5DC9B 2AAVA 4WO4A 4GKZA 1YJDL 1MFBL 4NRZA 5DJAA 4RQQA 2VDLH 4QHMB 3RX8A 4PGEB 5J56B 1JGDA 1U0QA 1AFVH 5EWIL 4KUCF 3D9AL 4LLMB 4PJGB 4XPFL 1GGIH 5DQJA 1A3LL 3N9GL 4KKLD 4NCC1 2HJKB 1QHPA 4XP6H 4XPAH 5BV7H 5IMOA 3MRIA 8FABA 1KXVC 5T1LD 3JXAA 1W72B 4ODWB 1BFSA 5FYKU 1PKQA 1AXSB 2JB5L 3D85B 4HUMB 4PJAF 2OBGA 3O6ML 2J6EH 3QXDA 2R8SH 1HHIB 2ARJA 4BSWA 5IB3B 1K2DA 4NNYA 5I6XB 1MNUH 2H2PD 4BH8A 1H3PL 2FR4B 2XZAL 1A7RL 1L0QA 3PGDA 1LEIA 2XWBB 4YGVB 1JF6A 2I9LA 2VL5B 3F58L 1LO3L 4CN6A 2IALB 3V0WL 4YDJB 4ZO7A 3V0AC 1OTSC 5BMFL 2R2BB 4PJ8D 4PJ9D 4YHOL 3LN5B 3RA7H 4CAGA 3L3GA 2D2OA 1U8MA 3BPLC 5IEHB 3B2UD 5F97E 2H8PA 3LIZL 4KK9D 5E2VH 4LCWB 3EO9H 3MRLA 3D2UD 3UTTE 5FO8B 2HN7A 1P69B 2F58L 5EBLA 1I3RA 1F3RB 4WI5A 2ICWJ 5F3BA 4OD1L 4Z8FL 3P11L 1TTUA 4J8RB 4XXCA 3QUYA 3RU8H 4ERSH 1I4FA 3IDGA 3LQAL 1WVZA 2A9NL 4OFIA 3JVGC 2WINB 3NFSL 4P5TC 3T04D 4S10A 4R3SA 4UTBL 2Z31D 1E4XI 1MHCA 3DARA 1QBML 1EERB 1X6LA 4G9DA 2NXZB 1G7MA 4OV6F 2XA8H 1OGAB 2OR7A 2PW1A 2HT3D 1JYNA 5GGRY 5IIEA 3H9SE 1T5WA 5FEBA 3QQ9D 3MRQB 2DQTL 4ZSOB 4CMMB 2ZUTA 2VZOA 3L9RB 5KAQF 4GQ9L 1J1XH 4H25A 4I3SH 3HRZB 3ZDZE 4FFWD 5D70H 4EUPB 1HK6A 1IL1B 4OF0A 5E00A 2GTWA 3O6FB 2ZCLH 2IEPA 3UO1H 4HPOL 3AVEA 2GJ6A 5HY9A 5CUSH 4J3UA 4M7JH 3HHRB 2QJDA 4A6YH 3GI8H 1RIVL 2OQJA 1OARH 3N85L 4MQSB 1T22B 5MEND 1UA6L 5D71L 2R2EA 4DUXA 1RZJH 3VXMA 2J4WH 4HS8H 4OZGB 1H8NA 1YDPB 3LPFA 3U30B 3EYFB 3O2DH 4XBEL 4HUUB 3ZKMC 5CD3A 1K9TA 1HINL 4F58H 2NY3B 1KJ3H 3KPNB 2XTLA 3FQNB 1T7XA 1BFOA 5I1JH 4Z7WA 5CJ8A 4ESKA 4O2CB 4UDTA 5I1DB 2MHAB 4PRDA 5IQ7L 5F7DA 5CEZD 3QUKB 5D72H 4M6OL 3AU1B 1EGJH 4P5MA 1YJDC 3GSNB 1JI1A 1HKFA 3RI5F 1ZLWK 1L7IL 4QLRA 2XV6B 4HPYL 4KRMB 4HUVA 4TSBL 3UPAA 1M7IB 3P77B 2VN7A 4DAGL 4EDWL 4RISL 1MCOH 1J87A 2A9MH 3WD5L 1LNUA 1BF2A 4R96B 1JP5A 3QUZA 4M9PA 5F9WC 1S7SA 4F80A 3U4EA 5JUEL 1NCAL 4BQCA 5BZDB 1BFVL 2ZUXA 4KTDH 3QO1A 1MJ8H 2M2DA 3DV6B 3PF2A 3VI4E 2H3NA 4M3JA 4G6JH 1JYWA 1PZUB 1P4LB 4JQXC 3SEPA 1RIUH 2QKIB 3VRLF 1AR1D 4UB0L 3IJHA 1U6AL 1RUAL 1X44A 2C4FU 4WTZG 1JMZA 1EPFA 2AV7A 4BSVA 5HSFA 1EEQA 2X10A 5F1SA 3OF6D 3QUXA 1AKJD 4L8DB 4PB9L 4WW2B 1QFUL 2XWTB 1YEEH 5T1KD 1I8MB 4WO4D 5IK3A 4HMDA 1AGEB 4OCSH 5E99L 2P43B 1ZV5A 2YN5A 5ANME 3AM8A 3NABH 1WT5C 5JXEA 3V4VH 4JRYE 1CGYA 2AJ3A 1LHZA 1ULVA 2E9IA 1P7QD 4JDTH 3S88H 1CL7L 1AGCB 2OTWA 4DN3L 3WNKA 3I75A 3VXQB 1R0AL 5C0IA 4D0CB 4N0UE 1B4JH 2FL5B 4HIXH 5C8JB 4PJAE 2UY6A 4B5EA 2QR0B 1DBAL 4WWKA 3CFEB 4M6NL 1M05B 1B88A 1T0MB 4GOSA 4QHNA 2R0KH 4HLJA 4KHXL 4EZMA 3LQAC 3HMWL 3K3QA 1DDHA 2A6DB 5F7UA 2FWOA 3MROA 1RULH 4D0DB 1D5MB 2YRPA 1EHXA 1FH5L 4PJDB 5JQ6L 3O3EA 3DVIA 2BSTA 4HC1H 2NY2D 2NY5H 5T3XD 4JM4H 2CXKA 4BM7A 1IAKA 1WSST 4D94A 4YK4B 1ACZA 4FQXC 1FVDB 5FO9B 3H8NA 2BSSB 2ERJC 5BRZB 5CEZH 2HAZA 4AT6A 1BZ9B 2BVOB 5JO5B 3K81A 2HJFB 1JPFB 2DMKA 5DR5H 1I85C 3EGSA 4JO1H 5C6PB 3A6CH 1XZ0B 5EZIH 3IRPX 2BERA 5L0QB 3QNYA 3UC0L 5TDNB 5HGAA 1A7PH 4DWHA 4HK3J 5SX5H 2W9LA 5LXGH 3QI9C 5DEFB 1WBZA 4DGIL 3IU3B 1GGCL 3GZKA 2XQBH 5AWNL 1V5JA 2APBA 3QUYD 5DUMH 5C2BL 3U2SB 2BHYA 5E6IA 5D96B 1CD0A 3U7AA 4Y4FB 2DQCH 2Q20A 3MRBB 3OTTA 4OTXL 2HT2C 4GRMB 3S35H 5DMJB 3D1MC 2OR9L 3SN6N 9CGTA 5K9OB 5C07A 1BWWA 5K9KB 1LD9B 1MRDL 5E6YA 6FABH 4XZUB 1EIBA 2XN9B 2QSTA 3QR2A 4JG0L 4XAWL 4Y5XA 4ZFZB 1INQB 1K3IA 4K71B 4YXLL 4KQ4H 4PRHB 2LAGB 2WSKA 4U6TA 5E9DE 1PLGL 3NAAH 1ND0A 2K9UA 5D1ZB 5J12B 5SWZB 2G60L 4PTUA 4TSCL 1FDLL 4JAMB 4BZ2H 3VXRB 5F1OB 3MRKB 1FFPB 1L7TL 4OZFB 2WK2A 2GJ6D 4WDIA 1JZ8A 4F3FA 5TDOB 4HCRL 5DJCB 1JGLL 1F4YH 3OX8A 5DI8B 4L3EE 3L3OA 1J7VR 1TQCC 5GSRB 5J4MA 2B5I