1JNNL

Crystal structure of fab-estradiol complexes
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
QIVMTQTPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPQLLVYNAKTLVDGVPLRFSGSGSGTQYSLKINSLQPEDFGNYYCHHFWNTPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN KAPPA CHAIN
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
total genus 50
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnL01
1BVKA 4XP9H 5EO9B 1Q72H 4Y4KC 5JIHA 2HN7A 4TYUA 1KENL 2EICA 4RRPA 3RA7L 4O2FB 2NY2C 1W72H 4L3ED 3QEUA 4NDMB 3TPUA 3EHBC 3F7PC 4FFVD 2YWYA 1D9KB 1P2CB 4JY4B 1GGYA 3GBNL 3RWCA 1XF4A 2NX5D 4GOSA 1KIUA 4PLJD 1U8OB 4OF7A 4LFHD 1I8KA 1YJDC 2NNAB 4NNYB 4O51A 4HWEL 4PJ5A 3E6FA 2MOVA 5F7WC 1K6QH 1RUKH 3BJ91 2OJEA 1U8NB 3CFBA 4L5FH 1U93B 1YMHA 4LVHB 2FJHB 4UQ3A 3P77A 4PJDB 4PREA 4CU7A 4ZPTB 1KPUA 2XG5A 4D9LH 2QSCH 3BGMB 4M43H 4QRTB 4APQC 2AI0L 2O5XL 1FZKA 2HFEA 1JPTH 4Y5XC 4LARL 5BOPA 3RZCC 3GSWA 5HYJD 1N59A 5GZOC 4YZFF 4R4FL 2X89D 3RAJL 3I6GA 4B50A 2I25N 5KTEL 4KMLB 3WDIA 3DX7B 4GQ9H 1FCGA 2QSVA 2XICA 1JGVH 1X44A 3FHAA 2F53E 4PJBA 5ISZE 4HC1L 1BZ9B 1X5HA 4U7SA 4LSVL 3WMSA 3IKCB 8CGTA 1DLHB 3GB7A 3RGHA 3DGCR 1MCPL 3WNPA 2CRMA 3FT4B 3L5IA 3F6LA 3HE7D 5GSRA 1P7HL 5J4MA 3U0PB 4DVBA 2ZCHH 1XIWD 3MUGA 1EMTL 4QXUH 5I75C 4G9FD 1GGBH 1YYML 1X5JA 5I2IA 5EU6A 2X10A 4LRIA 5F1OB 5J12C 3ZE0E 1A6PA 5EFIA 4RMUA 5CZXD 1FFOB 2WUBH 1FPTH 3L1OL 1FRGL 1F6FB 1U8JA 3DRQB 4M6MH 4UB0H 4U1KB 1NDMA 4HK0B 1WCQA 2QQNL 3STZB 1AGEB 2E7BA 1CI5A 2PR4H 3A67H 5L0QB 1MIML 5EH1A 5EN2A 5D1ZA 2WBJA 1MHEB 5HYJB 1VFMA 1D3CA 1MJ7L 4LCWA 4X5XB 1QR4A 1DP0A 3BD3A 2AKRB 4GKOA 3QDJA 3T08A 2R4SL 4XMPL 4YE4H 4L29A 2ZP0T 2DIJA 2VZVA 5DMGC 5EOQL 3JSSA 1F58L 2OZ4H 2VQUA 4I0KA 4OD3H 5DRNB 4MNQD 5EB9A 4YQXL 1H0DA 1BD2D 5E6IA 4FFZH 3O3EB 1A14H 4XVUC 3MLYH 1NGQH 5H94A 2DWEA 1UEYA 1J0KA 3BKYH 2R1WB 4PRID 2NZ9D 3KPOA 1FHGA 2ZG3A 5H35B 3HE7B 2C9AA 2W0PA 2VZ1A 2OS7A 1ES0B 1A64A 1T80A 4FXKB 4QHLB 4TTDD 3L3GA 3UTTE 4HJGB 4RAHA 4CJ0A 1E4XI 5FYKH 1INDH 4XXCC 3QJFA 4G9FB 1JP5A 2QADD 1X5KA 4Z8FL 4J3SA 1NAMB 1U58B 1TCMA 4TSCH 1R24B 1YYLL 2R23A 2H6PB 5J7CC 5IHLB 2DLEA 4JJ5B 4NP4L 2JB5H 1JGEA 1OAYL 3AAZA 3V4VH 1D6EA 2Q8AH 2SEBA 5T1KA 4O02L 4LSTL 3MNWA 3I9GL 2ZPKL 5L2JB 1XF3A 2I26N 4JO1H 1PKQE 3VFNB 1DDHB 3ZMRA 3LPFA 1RIUH 4PUBL 3UJIH 2BNRE 1CDGA 3LPGA 2EE9A 2GSIA 5C0BA 4P2QE 2PO6A 1AFVL 1SJEA 4KRPD 3HPJA 3WLWC 3RKDC 1V3JA 5SWSD 4HH9B 5BXFA 2Z91A 3QEGH 4MNQB 1S3KH 4PG2A 3ELAT 3D85A 5IM7A 4GS7B 2MQ0A 4Q9CA 2Y25A 1JYNA 15C8L 3KHQA 3LKNA 3WS6A 2NY1D 4PRIB 4RQQB 3RY6A 1KXQE 1D6VH 3DBXA 5AEAA 5L2KD 3DUSB 1TVBA 4QRSA 3K0WA 1KLGA 1MFAL 2OTWB 2YA1A 3DOSA 1KTDA 3NACH 4F58H 1QSFA 2GK2A 1KB5H 4WHTB 3RHWK 5DFTA 4OCXH 1T7ZA 1W0WA 2H2PD 4IS6A 6FABL 5T3ZH 5E95B 1SHMA 4WU5B 3ULSA 4KDTA 2IFFL 5H8DA 3HCVA 4XP1L 4ZS6C 1I3UA 4O9HH 4NQEE 3UTSE 4QRQB 4D9QE 1I8MA 1DN2A 2H26A 2OM5A 3UTOA 5GJSL 4QHKI 1RURH 1BEYH 1JUFB 3KPNA 3L7EA 4KRPB 3UYOD 5SWSB 1XGQA 4GKZA 4KFZC 2F9BT 2DDQL 1DVFD 1UGNA 5JOPE 5HGAA 4BH7B 4WNQB 2N4IA 4AY0A 5I66B 4YZFE 3V5HB 1JPGB 4JCLA 5I16B 1RMFH 5HPOA 1ZVSB 5DYOA 4WO4D 5HHVH 2NY1B 4JCMA 4ISVB 5HGBB 5BS0E 1IFHL 1RSFA 3BDYH 1AO7E 2AVGA 5L2KB 2W59A 4F8QA 3UZEA 4JVPA 3GNMH 1JTTA 1A4KA 4LAJH 1SVCP 4NO0D 4KC3B 1Y18B 4WFEE 4JM2A 1FP5A 5FCSH 3K8LA 2N7AA 2CK2A 3P9MB 5IQ7H 3X3GH 2HVJA 3HZKA 3HC0B 3OJVC 4RWYH 4LKCA 5I1GH 1FIGL 3UPRA 1A0QH 5D4QA 3TN0A 3VU2A 2JJTC 5TH2B 3QNZA 5FDWA 1YJDL 5GGSA 2BVEA 5DD3L 4LNRB 1A6AA 1E28B 3QULB 4YHLL 2Y6SC 1RAMA 3SKJL 5TFSH 1S8DB 4LMQI 1XR8B 1SYSA 3W11D 1OAKH 4Z7UB 4PJXB 1T0PB 1FFRA 3ISWA 3MLWH 1DVFB 9CGTA 1JWMB 3TT1L 3KLSA 4X5LA 2H9GA 2GSGB 5GGQH 1NPUA 1LE5B 2VH5H 4RGND 5IMMB 1A9BB 2Y5TA 2E7CA 3D3VE 1EEYB 2CR3A 2DWDB 3T1WA 3OKKA 2P44B 3PL6C 3RWJB 2F5AL 3HUJB 3CJJA 2VXTH 4BSJA 1EO8H 2AJVH 3QA3A 5F9AC 1PAMA 1YEDA 4CNIA 4BKLB 3PGCA 2XFXB 3M1BA 4MA8L 4MLSA 3RTQA 2C1OA 3MRRA 4LPWA 1UKSA 3NAAH 4YX2H 1HCFX 4ZUTB 1CBVH 1T6WA 1J1XH 4Y8DC 5A2FA 1Z5LA 2XWBA 3KPRD 3FB8A 4ZSOE 5F8RC 5HYSA 5DMKA 3N85L 2EEDA 5INCA 4OGYH 1LO3H 4M93C 5CCKH 4JPWL 5KSVA 4OZHE 1NCTA 4S1QL 5TE6L 3MQIA 4YUEH 3TIDB 3LKPB 3VJ6B 5DJCB 4QTHA 5TQ0H 4MJID 3GMOB 3MTRA 4U33A 4FZ8L 3P73B 3K8KA 2IQAB 1KB9J 1VA9A 3U0TA 1J88A 2UYLA 3V0VA 4KY1L 5IJVA 1F11B 5I17B 5I1DA 2VZUA 1FNLA 1DN0B 4KZEH 1CFNB 1QYGL 2X1XR 2O5YL 1HHGB 2E9IA 4OT1H 4HWNA 1I9RL 2VISB 4NJAH 5CGYC 2IPUG 4K7PL 2ESVA 4M6OL 1QSVA 1QFUL 2CGRL 1MUJA 5F7EL 4N90E 1ORQA 1YN7A 3GI9L 4ZUVB 2FGWL 4Z77A 1BQLL 5ACZB 2NY6D 1S7QB 1N7ML 1WBZA 3ARPA 3ZYJA 5ALCH 1AKJD 4MXQD 4R96A 2HT2D 3IDIA 5K9KB 4P3WA 3MRPB 4R2GB 3KPLB 4LSQH 5DK2B 1A7OL 3KPRB 1LDPH 2F53B 3SQOL 3ARQA 4BQ8A 4UTAL 2G2RA 2PYFA 4CDGC 5DHYA 1DFBL 5AZEL 4JN1L 1R3IL 1T1YB 1RU9H 1AGFA 1XF5B 4AEHH 3EDEA 4MB5A 3LZFH 5D8JL 1NBQA 1T0MB 2YRLA 5DUBA 1JGLL 4DWHA 3WFBH 4MJIB 4YFLF 3MLUL 5I1JH 3SOBL 1NBYA 1EEZA 1UZ8B 2CK0H 5J1SC 4OIBA 3G5ZB 4HFWB 4LLQA 3O4LA 2PW1A 4L4TA 1U8HA 4LOUD 2ITDB 3VFVB 2ZNXA 1Q0YL 3KS0J 2RB8A 3SDYL 3ZHLA 4JG1H 1RUAH 4OAWB 4U0RC 3FKUS 3H0TA 3I2CL 2WIIB 4XVJH 5JPNA 3MNZA 3PHQB 5A3IC 2ADJB 1F4HA 4IRSB 4FN0A 3SE3A 1ODAA 4PJ5E 1EX0A 4JY6A 4K55A 1NMAH 4X4XA 3TNMB 1NEUA 4PV9A 1FFPB 4IOFD 4U3XA 1SBSH 3RWFA 1S7WA 4XRCB 5DJAA 3QUML 1PD6A 2XWJA 2G75B 1CF8L 2NY6B 3BKJL 3JWDC 3FFCA 1VHPA 1MJJB 3JWOC 5HY9B 1F3RB 1AKJB 2C7UA 4P2QD 4WW2B 2G5BB 2X70B 4F33A 3K2UL 3U4AA 3V52H 4PJBE 5D7KE 5FECB 2UVFA 4XNZB 2VTFA 1LO4H 3G08B 4IOSD 3AU1B 4MYWB 3V4PL 3ZHDA 1EZVX 2KZ1B 3SBWA 1MHCB 3FQTA 1ZVHA 3O3DA 4QF1A 5CEZE 2PYED 5GS0C 4JM2F 1VPOH 5J1AA 1YUHB 4LQFH 3TNNB 5E2WH 1TQBB 1C16B 4MAUH 5EIIB 2A9MH 4JPIB 5JPMB 5JHDA 3PWVA 2FX9L 4U6TA 2NCMA 5FDYA 5F3BA 3MXVH 5C0ND 1S7XB 1ZLUH 2OI9B 2DQHH 4HKJA 4ELKB 1DSFH 5F9DC 5EU6E 5GHWH 3FOMA 1FDLL 4JFZH 4AM0B 4H26B 3P0YL 1WZMA 2A6DA 3ULUH 3BEWA 1IGCL 4IRJC 1EO7A 1LK3L 3QDGA 4MX7A 1XF2A 3WFCL 4OLWL 1CZ8H 2I5YH 3NOIA 2FLRT 1NMCC 3IDMA 1FG9C 2R56L 3UCRA 4R7DB 4Y19A 3L5XH 2O5ZL 4NQED 2FECL 3ME0A 4LGRB 3P11H 1P5UA 3BIKA 1ZHBA 4LCWE 4P2QB 1S7UB 5K9JL 3GIZH 3EKCA 4KKBC 5FHBH 5IVOA 5CGMA 3QDJE 3VWKC 4K8RC 1ZK9A 4LEOA 4UV4H 3RWEB 3H3PL 4PRNA 1QBML 1H8NA 2EXWC 1KJVA 3LV3A 5GRUH 3ZSTA 2IMMA 1CFTB 2PYEB 3EOBA 5ILTH 3RJDA 3ULUE 1F4XH 1I9IH 1A6UH 1BVLA 4KJPC 4P23D 1TTUA 4D0DA 3PGFH 1KPRB 5TQ2L 2HJKA 5ICXA 4OLZH 4X8JB 4EDWH 3FZUC 3ZKMC 1ZSDA 4KI1A 1HHIB 4WFED 1B4JH 5DA4A 5FKAA 3WIHL 3EO0A 2R8SH 1J0HA 2DMCA 2VDLL 2BVPA 1YY9D 2WBKA 1OAQL 3TJEL 2QTEA 2FHBA 4KDWA 3LY6A 4OZFB 2JIXD 1MJUH 3UTZA 3TZVC 4NRXA 3ROLB 4NN6C 2Q6WA 4OUUB 5FGCE 3QUZC 1KCSL 5KVFL 5HHPA 3G5YB 1NCBH 3SKNB 1EEUA 3SDAC 4JGMA 4IJ3C 4NQEB 3UTSB 4R4BB 1A9EB 1CICD 4A6YA 2Z93A 4MDJA 3QR2A 4OCYL 1MRFH 3BX7C 1CXHA 3G6DL 5ID0A 3VD5A 1T5XB 5C0BE 4Z9KB 4LKXB 5CILL 5KSBA 3WD5H 2X4UA 4XNXL 1YDPA 4GBXD 4NFCA 3QIWB 1R3HA 5IF0B 5FFLA 1EHXA 1WZLA 2C3VB 5GIRA 5GQBA 1NGZB 4JFXA 3LN5A 4JKWA 1CK0H 1PZ5A 3FN9A 2Y5EA 1ZGLM 25C8L 3DMMA 2XQYK 4N0FB 5BS0B 5JHLL 1AO7B 3V6ZA 4OZIF 4P23B 3VXOB 3NFNA 3RWDA 4J4PA 5FXCH 1Z3GH 3BXNB 4P49A 1IM9D 3RWGA 2FSEB 5ECJE 4AT6B 2ICEA 1SJHB 4KZDH 4D8PB 1TVHA 4M4PA 4PV8A 3RL1B 3QPQC 1QSFE 2NQCA 4QWWD 1DE4B 5DZOA 4ODWA 3PWNB 1O7VA 5DXWA 2JIXB 3CPLA 4PP1C 1UM5L 1WBXB 1I1AC 2R9HC 1KN4L 1WUNT 2DD8H 4OUOA 3FB5B 4U3HA 5HI4C 5TF1L 4JB9H 2X2YA 5KVDH 2XKUA 1NAKL 3CFJB 1AR1C 2AJYH 3H8NA 2FO4A 5EZIL 3L3JA 1MY5A 1X3DA 1K9TA 2EYTA 5D1QC 2ICCA 3PDOB 1U3HC 3P4OB 5I76A 1FO0B 3NCJH 4X9HA 4ETQA 1C7SA 3PNWA 2ED8A 3KPMA 1KCLA 1BQHG 1MWAA 2Y07H 4U7MA 4ZD3L 2D7NA 2FJGA 5B8CC 2GT9B 3MZGB 3VGFA 1TQCC 4BFGA 1XCTB 1OQXA 1CDYA 1HOCA 3O3AA 4ODXB 3VFGL 1PJ9A 4JDZB 1JHKH 3VFOA 1XGRB 2NMSA 2GUOB 2AV1A 1MSPA 2YR3A 4DUWA 2IADB 1W8OA 4GAFB 3EYFA 4WV1A 4BSWB 3M07A 4WCYH 1F6LL 4XPAH 3BMVA 4JANA 5HJ3A 4ZSOB 3O45A 1YEKL 3V0WL 2CIIA 4PFEA 3N1PC 2A74A 4FQHB 4Q7DA 3SGKA 5I8KH 2A9NH 3FN0L 5BW7C 4MS8D 1G7LA 3K4AA 1BZ7B 1LEGA 1FVEA 3MJ9A 1L7TL 4XI5C 2FYYA 3Q3GB 4L8SC 3LSOA 4D9LL 2HT4D 5E8OB 4R97C 4HS3B 3DX9A 1F8TL 3JWDL 5ESAA 1OGAA 3JWOL 4ZXBD 4HMCA 4PP2B 4XPHH 5F44A 3NMEA 4YDIH 2F54A 2YBRA 2GJ6D 4QEGA 4U1SA 1CGWA 2D0HA 2VLLB 1GZPB 4FZEH 1JGVL 4NKMB 3MGTA 1B0RB 1J5OH 2K7PA 1TPXC 2Z31C 1KC5H 2Y1VA 1I7RA 4M02A 4GO6B 5EC1B 1RZIA 1P7KA 2OL3B 3LHPH 5IIEA 4CUCA 5GS0L 5FO9B 4F9LA 4AENB 4OD2A 2R0KH 5FYJD 2MHAA 5D2NC 5C0IB 1JGDB 4JKKA 1DBJL 2I9TA 4OI7A 1UH2A 1BVKB 5D7KD 2MQ3A 1B0WA 5DUMH 3MFFA 4HKZA 3CC5B 2FBJL 3MOBL 1R0AH 2HN7B 1KEGL 2EKJA 2DBLH 2DQUL 3B2VL 4WENB 1JWUB 3ZTNH 2CLZA 4K7FA 4RISL 3NZHH 1JNJA 5DD6B 4R90L 4TULL 1LO2H 1JZ7A 4M9PA 1FZJA 3C2AL 4KKAD 3QNXB 3TPUB 3T0ED 4OGAD 1CL7L 2PR4L 3WSQH 4F57L 1IAKA 1QSED 3SHSA 4ZXBB 4GAJH 4XHJC 5C07A 3SQBA 2VDNH 3GO1L 3BVNA 4D94A 4PJ5B 4BYHA 1ED3A 3E6FB 4F9PC 3B9EA 2P49B 2UUDH 3CFBB 4HJ0C 1YMHB 1PQZA 4K8RL 4NRZB 4UQ3B 3P77B 5J6GA 3DIFA 1KPUB 3GRWL 4OD3L 1LK2B 2ESVE 3K8MA 5ALBL 4F7PA 3WN5A 3FT2A 1OARH 3QO0A 5CHNB 5KSBF 1SJVA 1FZKB 5D1ZD 4X6EA 2WBJD 3KAAA 1FAIL 2HFEB 3B4NA 3FT3B 3EJZD 1N59B 5E2TL 3KS0H 4NJ9L 3KLHC 5HGHA 5L8JB 1HH9A 1ONQA 3MNVB 2V17H 3ARDC 2V7HA 3BGFB 3J8F7 4ZFZA 1LE9A 3WUWA 4ZO8A 4BFIA 1RHFA 3VFUA 3GB7B 3QPXH 5SWZD 4TUOA 2FZ3A 5HYQA 5E8DL 2YN3A 4TSCL 2OMNA 2DIAA 3VXSD 3DYPA 2Q8AL 4K71C 5GSRB 4LBEB 4L4VD 3VG9C 3GKZA 3T0EB 1S7SA 3O4LE 4Z7OF 3FAWA 4L4TE 2DQIL 1K4CA 3O9WA 4DTGL 5I2IB 5MHSD 5EU6B 1I85A 5SWQA 2YD8A 5EFIB 2UY7A 1U8MA 2EO9A 4K3GA 1BPVA 5D7IA 2V2WA 4PJHF 4NZDA 4HS8L 2DB8A 1U8JB 1NDMB 2DTMH 3ZL4L 2UZIH 4JQIH 1N2RA 1OD9A 4DOHE 1EHAA 3HNTH 5EN2B 5BQ7B 5A43C 5D1ZB 2WBJB 5CSZA 4CN1A 1MFEH 2BNUB 4I3SL 2WW8A 4JLRA 3FFCE 3QG7H 1D6VL 1RK1A 1TDQA 2PO6D 5F6IB 1FN4A 4PBXA 4Z7VF 2FX8H 1VEOA 3WFHA 3HMXA 1AHWC 1CDJA 3VFRB 1IAOA 3NACL 2VSCA 4ELMA 1H0DB 3MUY1 5JXEC 5JTWA 3O6LL 2ZUUA 3RIAF 3VXSB 3KPOB 1JRHI 4I4WB 2C4FU 5T3ZL 4L4VB 2PXYC 4OLYH 5JHDE 4G8GD 3L3GB 4KJQD 2VR5A 1I7UA 3NCYS 2QLVB 3FN3A 2DQEL 3Q2CA 3WFEH 5KVMC 4O4YL 3BWUC 3GMRA 1QSFD 3T1FA 2R23B 4YBLB 1LWRA 1T83A 4LRNH 5I15L 2A1WL 2IBBA 3AAZB 1IAII 3QDGE 1IGYA 1UEMA 3O6KH 3MV7A 4JZNA 1HXYA 2SEBB 5T1KB 1NCAH 2VUOA 1HNFA 5GZNC 3MNWB 1FNGB 1E4XL 3C09B 3X17A 3OKDA 5KOMC 3ULVF 1XF3B 1JHTB 4Y19E 1D5XA 1DL7H 1RMFL 4JPVL 4DKEL 2UWEF 4AIZA 2IGFH 35C8H 5EC2B 1CR9H 3ARGD 2H45A 4B41A 2XZCH 3UO1H 2GSIB 5C0BB 5IB2A 2PO6B 3ET9F 3EOAB 1SJEB 4M1CC 3T4AA 3HPJB 5F1IA 1NCDH 2Y23A 4N9GA 5DDHB 5BXFB 5FF6A 5ERWB 2Z91B 3X13B 4BSVA 4G7VH 3U4BH 1P1ZB 5IM7B 2H1PH 5DD5L 5GRWA 1YNLL 2VWEE 1H3WM 4L8BA 1CFBA 4KJWC 5I1GL 4GRMB 3S8WA 3IFOB 3OSKA 3RVWC 5KBNC 3TA3A 1BJ8A 1QZ1A 5FB8A 1TVBB 4G8GB 4QRSB 3T0BA 4KJYA 4Z95H 1XR9A 1GZQB 2V7NB 1INEH 1C5CL 4BELD 5BO1L 2VDKL 4OIAA 3UJTL 5IFJA 1B9ZA 1KTDB 1INQA 4NQTA 1QSFB 4HWZA 1UA6H 4NO2A 2CSPA 3S3PA 5MP6L 4DFIA 2QKIA 4QCIB 1W0WB 1OTUC 1E6OH 5EBLB 5SX5H 5I8EA 4YXHL 3ULSB 3MLZH 3MROA 1AXTL 4P9HH 3CSBA 4PGEA 5AYQA 1I3GL 3ORJA 3TIEA 1BREA 5D96C 5DJ2A 4LLDA 1NSNH 2H26B 3ARGB 3UBXG 2BSSA 4GXVL 3L7EB 1RJZA 1IKFL 4I3RH 5GGTH 2XKNB 4M61A 4NQCA 5KSBE 4LSSL 4HQQL 4NPYA 5ADOH 1KB9K 2AXJA 4FTVD 4G6FD 4EUPH 3PP4L 3H9ZA 3D18A 4YX2L 2ATKB 3C60D 4WI9A 3P3YA 2CUHA 1J1XL 4KMTH 5DYOB 4UAOB 5EDXA 4ZFGH 4WEBH 1A4JA 1IAIH 5J0BA 5CEXA 4X6CA 1A4KB 3BUYA 2GIYA 4IM8A 4WGWB 5DFWH 3A6CL 4GQPH 3RTQD 4JM2B 2FJFA 2WAHA 5HSFA 2HVJB 1BF2A 1V05A 2XZAL 3HZKB 4NUGH 3NCYP 4LKCB 1WJ3A 2VDPH 5C92A 4Z7OE 1I1FA 3UPRB 1D9KC 4HLZH 4LF3B 4OB5L 3TN0B 4HAFA 2VQ1A 5FDWB 1X5ZA 1RUML 2P5ED 3MV01 5GGSB 4JPKH 2NR6D 5C0AE 2YSSA 1A6AB 1GL4B 4GXUN 2UZYB 1TZGL 4PJHE 4LVHC 3IXAA 3I85A 1T22A 1E4KC 4J3XA 4XB7A 5D7IF 2UUDK 2YHGA 4MMXC 3SJVA 5I8OH 1TXKA 5CJ5A 3OKOB 4EN3A 4FTVB 5CBAB 5GPRA 4P59L 4G6FB 4MHHI 2H9GB 1UH4A 3C60B 3MJ9H 1KCUH 4NBXB 2Z8VC 3HN3A 2ILLA 2OP4H 1KULA 5K33A 2Y5TB 5EU4A 4M8VA 5KSAC 2ESVD 5C0FB 3KLAA 5MERA 2VAJA 1FV1B 5AZ2L 4RNRB 1YEDB 2AV7A 2WINA 3BW9B 3SE9L 3HB3D 3B43A 3PGCB 3RTQB 1SEQH 2C1OB 3MRRB 4MA7H 3MV8D 3QXWA 4ELMF 5HHNA 4Y2DA 2D4DA 3PXJA 4RZCA 1Z5LB 3ILQD 3D1MC 1DQQB 2XY2A 4XNQB 3D69B 3UZVB 2ID5A 5DMKB 1FYTA 1AQKH 1I3RB 4HCRL 5KSVB 3MC0A 2Y4SA 1ND0A 2D03L 2DJUA 3MRJA 4OCNC 2P5EB 3X14A 4LIQH 3BZFB 2R39A 4P48A 5TGBA 2DM2A 1JYXA 3S88H 1TCRA 1MQKH 1FNSH 2CKNA 5IK3B 3EUUA 4LPVA 3U0TB 5JW4N 4H0GA 5CZVH 2QV2A 4X5WA 2UYLB 4CMHB 5L0QC 1T0NA 1A7QH 2M26A 5I1DB 4ODVH 4V1DA 2X4OA 1F97A 5HVHB 2UWEE 1OGAE 4OFYA 4QTIL 1GIGL 2F54E 3QUKB 4P5TA 3IXTA 2D7QA 4NT6A 5FGSA 2QEJA 1QUNA 1G1CA 1E27A 3FTGA 1UWGH 1EERB 5CZKA 2ESVB 4L1DA 4S10A 1MUJB 1RIHH 3MO1B 4RMTA 1BZQK 3BYTA 5D70L 4LIQE 4Z77B 5IFHH 3MV8B 3HA0A 3HE7C 3INUL 1G0XA 3SKOB 1VENA 2BSTA 3DVGB 4MAUL 4K23H 5KSUA 4OZIB 4D3CH 1WSST 3N1GC 5C9KA 1BOGA 1OTTD 2CDFA 3R1GH 2PYFB 4ZO7A 5DHYB 1PBYA 4ZO6A 4H88H 4D0CA 5CZXC 5GGVL 2RCSH 4Y2OA 2NY3B 2YKLH 5DUBB 5DD0H 2BVYA 3D2UD 2VZ3A 3O81A 1CDIA 3MBXL 3PDGA 4HIJA 3WJJC 2OJZL 5J56B 4TSAH 4LLQB 4XNMB 3BKMH 4JFPA 4L4TB 1U8HB 1P9MC 4NNPH 1CXKA 4UU9A 3NIDE 1S9VB 3T4YA 4KUZL 3H0TB 3QIBA 1F90H 4LCCA 5JA8B 5C07E 1IGFL 3MNZB 5BZWB 3GI8L 4PBVC 1IEBA 3LKSA 2AXGA 3LN4A 4A2LA 4JHAH 3DECA 1DUYA 3OF6D 5E00A 2EH7H 4EIGB 3DVIA 4DOHB 2J88L 4GS7C 5E99L 1S7WB 4I0PD 5GRUL 5DJAB 2VERN 1FG2A 2NZ9C 4JDVA 2VXUL 2WNGA 2AK4D 2C7UB 3FQXA 3VXRA 2R0WL 3C8KA 4F33B 3F6IA 4W4OA 1TENA 1SY6A 4HEME 4M48L 4EVNA 4HIHA 4X6CF 3FQRB 4TNWK 2CKBL 4L8DA 1WZ1H 1U41A 4GRLA 5AD0A 2QQQA 3O3DB 4QF1B 3QIUC 2IBZX 5IKCB 5J1AB 5CAYB 2DKSA 4U6HB 2OQJA 3KPSD 1AD0A 5E2VH 1PSKL 1ZHKA 1MFDH 5CUSH 5JHDB 3SDDA 1RZFH 4U1LA 5DTFA 1S9KC 3RGVD 4M6AA 3HMXH 1F00I 1HINL 2BY3A 1NFIA 2YPVH 4HKJB 4Q2ZA 3QI9A 3BHBA 1FO0H 4OCSH 4JQVA 1JNHA 2BDNL 3BEWB 3CDCA 1T89A 4KRPC 1UACH 5E1AA 4J3TA 3QDGB 5D7IE 4O2CA 3JVGA 1XF2B 4JKPL 1G7JA 5IBUB 1N0XH 3TF7C 1S9WA 3NCEB 1RFDL 3T8XA 1A3QA 1O5DT 5F7DA 4ENED 3TCLA 4AQ1B 1CK0L 3U7AA 1DQML 1PEZA 2NY1C 2I07A 2D7PA 5TDPA 2B5IC 3DSFH 2GY5A 3I3BA 1HEZA 4XBGB 1MELA 2DLGA 4OKVB 5IB3A 2F5BH 1JHLH 4LEOB 3MODL 3RVXD 3NFSH 5T5FL 1CG9B 4M6NH 4ELME 1I7TB 2WWMD 1KJVB 3LV3B 2FL5A 3EOBB 3MLRL 5EO1B 5ICZB 3WIFA 2J8UA 3KPSB 3SDXF 1BVLB 4D0DB 3FRPA 4J4PD 3HHRB 1IC7H 3BP4A 5ICXB 4GUPA 1D5ZB 5A16A 2CMRL 1KCKA 1ZSDB 2GFBB 4MZ2A 5FKAB 4DGIL 3EO0B 3CH1A 5HYEA 1GC1C 4XCCL 3UYPA 1JPSH 4U6XA 2VE6A 1C1EH 3BSZH 4NRXB 3WJLA 3MV7E 4AEFA 4Z0BL 2Y07L 2BOBA 4NM8L 4EEEA 1ZANH 3D9AH 1RULH 5C0AD 2IALB 4M5YL 4UV7H 3BISA 5C0GA 4BZ2L 4LSRL 4A6YB 2Z93B 5GSVA 3T0VA 1A6VL 3U30B 2YMXL 1AXSA 2EDYA 1VACB 2VDOL 3WS3A 5ID0B 1EGJA 3OR6B 4PJ8D 1N8ZA 4XVSH 5KSBB 2X4UB 1YDPB 1R3HB 4OF0A 4TQEH 5C7XL 4K3DH 3WFZA 3ZZ1A 4JFXB 1J9CT 2CLRA 1U8KA 4PJEA 2OR8A 1PZ5B 1MQ8A 4JFOB 4BM7A 4CL7A 3DPBA 1RUQH 3NFNB 3LRGA 2PUQT 5HHQA 3C08H 1CGSL 2HRPL 2OCFD 3RWGB 5E70A 3KPPA 3I50L 2HLAA 4OFDA 1HN1A 2PTTA 4AEIH 5I1CL 3THML 1KCRH 2M8XA 1WEJH 4AK1A 4HBCH 4PRPA 3W11C 4ODWB 3GMMA 3WE6A 4RIRA 3ROOB 4Z76B 1A22B 3KYNA 3GSUB 3CPLB 1CDBA 1V7MH 5D1XA 1IARB 1IZKA 1IGIH 2ZCKL 3GIVA 4JHWL 2UVEA 2BFVH 4WU7A 3QZWA 1P4LA 3KWWA 2C4XA 1EUUA 4QO1A 5H37G 5C0AB 2FO4B 5ADPH 3L3JB 1AQDA 3OKEA 4OGXH 4N0CC 4PJHB 5C86A 2EYTB 4TUJA 2BCKA 5EUOA 3IFNH 3MLVL 1IE5A 3CX2A 2CLVA 2XRAH 4ONOA 1J5OL 5I76B 1G6RA 4PJ8B 3IETA 5HYFA 3PNWB 4KHXH 3VRIA 5DUPH 3ULVD 1OM3L 1MWAB 3CLEH 4NQCE 1J11A 1UYWH 1CVRA 2GITA 1U8LA 1FZMB 5FYJH 5KJRH 2FJGB 1T04A 1IQWL 4R2GC 2W0KA 4WHYG 4Z7QF 4UT6H 3ARBA 1ROWA 3O3AB 3O41B 4R0LA 4Z7VB 1NAML 2FD6L 3UXFA 4N0YH 3VFOB 4LP5A 1ACZA 2DJSA 2AV1B 4X6CE 2GTWA 2VZTA 4NIKB 4XH2B 5GGRY 3B9AA 2B4CC 5IFAL 1FNAA 1MH5A 1T4KA 2GTZA 3EYFB 4WV1B 4OF6A 3EO1A 4EI6A 2C5DC 1RVFH 4JANB 3RBSA 2H8PB 4Y4KD 3O45B 3V7MA 5MEPB 5EZOH 1DQJA 3L95A 2CIIB 3KJ6L 3MBEA 5F9JA 3D25B 1MFBL 3GKWH 4MDIB 1UG9A 1J12A 5C0CA 4HK3N 4IRSC 2NW3A 1BMGA 1G7LB 4WWKC 1IKNA 1LEGB 5LVEA 3VWJA 1FVEB 2I60L 3GGWA 4P4KD 1LGVA 4YFLI 1YN6A 4XT1C 3MJ7B 4OTXL 3Q1SL 3SJVE 2Q76A 3TJHD 4FQJL 1BGXH 4LLUA 1FFNA 3DX9B 5HHOA 2UWEB 5F7LB 5ESAB 1OGAB 5IBTH 1HIML 1B6UA 2F54B 2YBRB 2HT2C 5DD1H 4OCWL 4G43A 4PJ9A 4ZS7L 4LHQB 3MGTB 4XNZC 1YMMA 2EDQA 4FQLH 2ZG2A 3O2VH 1I7RB 3QPXL 2YD4A 2ORBL 1RZIB 4CW1A 1P7KB 5GZOD 2DQTH 5IIEB 4PRDA 5C2BL 3CU7A 1OSZB 4NCDA 1TQBC 1OAUH 1YPZA 5IJKC 1K85A 2DQDL 3F12A 4LOUC 1NCCH 3JV0A 1F4YH 3ECBA 1L9MA 2NW2B 5HI5C 1T66C 2OI9C 1OF2A 1FYTE 3MFFB 4HKZB 5E1HB 5JZ7C 3S98A 3HI5L 3PHSA 3CUPA 4J23A 2VLJA 4IHOA 4K7FB 1QLEH 2J4WL 1FJ1A 4P4KB 1YEFH 2QQLL 5EIVA 4ORGA 2XNAB 5EO0A 5FM5O 2AQ3A 3SDCA 4DUVA 3ES6B 4IOFC 1BF8A 2FB4L 3NPZB 5FEBA 3FB7A 2HWZL 1IAKB 2GAZB 4HIXH 4WJ5B 5DJ0B 1CD8A 2VXVL 4M1DH 4V1DE 4JDTH 3QUYA 4QHMB 5DZNA 3VXMA 5JNYA 3BVNB 3QWRD 1ED3B 1UADC 4PLNC 1HWHB 4DEPB 1S5HA 3QCUH 5J6GB 3DIFB 2CRIA 5SV4A 2EKSA 4XAWH 3WN5B 3FT2B 3QO0B 3KHOA 4TUKL 3NZ8A 2VYRE 5FOBA 4HF5L 3DNKA 1FL5A 2ENSA 3LAFA 4PJEF 5HGHB 4ODSL 5KW9H 3LEXB 4O2EA 5DMGD 4R6UA 2V7HB 2OR9L 4ZFZB 4QRPA 2FIKA 4DFHA 4HX1A 4BFIB 1GPOH 4P4RA 3VFUB 2PCPA 1GC1L 1JV5A 1EIBA 2FZ3B 3EYOA 3IU4H 5HYQB 4HGWA 1OPGH 3O6MH 4NO3B 2PF6A 4N68A 1KNOA 3BQUC 2P8PA 1AJ7H 4RAUB 1JZ2A 3MGAA 1T1WA 3RL2B 2NY5C 4YPJA 3C6LC 5J12B 1QVOA 1K4CB 1MFCH 3O9WB 5CD3A 1HILA 4JO4H 1QRKA 4OCLC 4XNYL 2APTA 4YNYA 4ODTL 2DTSA 1U8MB 4I9WE 5D7IB 2V2WB 4EZMA 3GSOA 1QPPA 3U9UB 1JWSA 4WVRA 3QIWC 5IMOB 2AQ2A 1V7NL 4RA3A 1N2RB 1KJMB 3MLXH 5DJ8A 3CZFB 5CSZB 5FUOL 4CADA 4J1UA 4Z7QE 4YC2C 4LPCA 5F70A 4I48A 4JLRB 2R4RH 4P23C 5F7FA 4HPYH 1RK1B 4XAKE 4NHCL 3U36B 5L9DH 1ZVYA 3VXRE 1RZ7L 5DRWA 2WLZA 2YD2A 2C1PA 2DQGL 4OM1H 5CJOL 3HMWL 1IEAA 2EDJA 4ELMB 3GSRB 2I24N 4OM0H 4QRRA 3O6FA 3SCMD 4JO2H 1G9MC 3VXUA 4L9LB 5FYLD 4TTGA 1E6OL 5DS8B 3QUXA 4ALAH 4G42B 4LCUB 2XOTA 3SKMA 3WV0A 2HKHL 5EU5A 1AD9B 3VXQB 4RDQG 3DUUB 5T1MA 3ZTJG 3BE1H 1Z9OA 2WANA 1PLGL 1Q0XH 3GMRB 1RY7B 1QP1A 3T1FB 1NSNL 3W2DH 3LRSA 3LEYL 1B0GA 1OQOA 1IM3A 3QISA 4NWUH 4PR5A 4KK6C 1JRHL 5GGTL 3K46A 4I77H 4JZNB 1HXYB 4NC1E 3BGAA 4ZS6D 1BWWA 3EO9L 2HLFC 1AGBA 3V5DB 5ADOL 4EXPX 1FGNL 4FHBD 1EUTA 3OKDB 5GS1A 1WITA 4Z18A 1RUPL 1HKLL 4AIZB 1KN2L 4H25B 2GW5A 2ICWJ 4PRAB 3VG0L 2IG2H 4JM4H 1IAIL 4K9EH 1UVQA 4N9GB 3RX7A 4A2MA 4NQCD 4RFNC 2B4CL 3PWPE 2XT1B 1Q9LA 4JQXA 1CDCA 5ANMB 3ARFA 4Q0XL 3LH2H 3N1MC 1BBJB 4L8BB 3S6CA 1NLBL 3SCMB 2PN5A 4OD1H 3L3DA 2VDPL 4JGUA 1WCBA 3HAEG 1YPZF 2J8UE 4NO5B 3BAEH 5LXGH 1U0QA 5FB8B 1MHHA 1CXFA 1TVDA 3BT2H 4X7CC 1OP5H 3PWUA 4CU8A 4JFHD 4OF3A 3QDAA 4OZ4B 5LAXB 5IFJB 3OAYK 4I18A 2VXSL 1JYVA 5B38G 3VFPA 3WNOA 5IW6A 4UINH 1BQHB 2QKIB 1U92B 3OZ9L 4L1HA 1YY8A 4IEFB 4H1LH 5I8EB 5DFVC 2ZKHH 2BERA 3JTSB 4XVTH 4X98B 1MVUA 3MROB 3UTPE 4LLYA 4PGEB 3T2PA 5I1AA 4I8DA 1KCUL 3CNKA 3OJ2C 4NKQB 3RY4A 5DURD 5JOEA 3I3DA 3OXRA 2A83B 4LLDB 3RVTC 3MSPA 3F58H 4MNGA 4O5LH 4U1NB 5DLMH 2VUYA 1RJZB 1T2JA 3FO0H 3L5WA 1KEMH 4XPGH 4NQCB 1S7RA 4WWID 5D71L 2YZ8A 4XPFH 1N0LA 5HGGS 3D18B 4U1MA 1MREH 1UM4L 1FE8H 4PJEE 4DKFH 3PL6D 5DJXA 1L6XA 3HS0A 2Q1EA 1N26A 1FIEA 2R15A 1I75A 1MVFA 4X6CB 4DZBA 3BUYB 1HHKA 1T5WA 4MS8C 2VKXA 2HYMA 2D0FA 1TZIA 1CQKA 4YBHA 4NQVA 4PLOB 1NDGA 3OKNA 4X6FA 4XHQA 1K3ZA 3HG1A 2Y06L 5DR5H 4MJ2A 3P2TA 4PRPE 3RZCA 3S36X 1W2KT 2E7LC 1OSPH 1A7QL 1JGUH 4F7MB 1EDQA 3TBYA 2JELH 1JI2A 4DQOH 3H9HB 4OLVH 2IJ0C 4IMLA 2EIZA 5EG6C 3Q6FB 5TF0A 3L3IB 5DURB 3TWCL 3U2SA 3MRNA 2D7TH 2W9EH 5EUOE 3HNVH 1FL6A 2W65B 5LBSH 3REWA 3AMKA 1C5DB 3SJVB 3WXWL 5M95B 4HV8B 4C55A 5JOFA 4X9GA 3T77A 3IU3A 1ZT7A 1JNNH 2YA0A 3E3QC 2OTUA 2L7JA 2ZUVA 5BMFL 5CGYD 3PL6B 4HULB 3BGFC 4U1HA 1GH7A 4NFDA 3UC0H 5EU4B 4Q9RL 2HJFA 4XBEH 3KLAB 5MERB 4LVOB 1Q38A 1OT1A 3GZKA 1DEEA 2CUMA 2WINB 1RJYB 4X7TA 3O2DA 1SM3H 2KQNA 5HHNB 1KIPB 4Y2DB 3SDXB 2E8YA 2NY5L 4UT7L 1A7PL 1NQBA 1LEKB 4OGAC 1K2DA 2VXQL 2J6EL 3NIGF 1KENH 1FYTB 1EVTC 5BVJB 4KK5C 4LRIC 4HS6B 4UUJA 1ND0B 3MRJB 2IPKB 1F90L 4P2OD 1MAKA 1UZ6F 5C0CE 2OSLA 2EDNA 5TGBB 2EDDA 3IFLL 1J0JA 1TCRB 4TN9A 5GRXG 4KTEL 1IAMA 3F65A 1ZLVH 2YD3A 3QXDB 4X5WB 1J0YA 3GBNH 1A3LL 3GSXB 1T0NB 5D1ZC 3W9EA 12E8L 3FONA 2WBJC 5DMYA 4YXKL 3EJZC 3KPQA 4HWEH 5HHOE 3KYOA 4M1GL 5C6TL 2W38A 3U6RB 4PS4H 4JAMA 2BSRA 4NT6B 5F6IC 1N4XL 2Q86B 3ARWA 3P40A 2AI0H 1E27B 3FTGB 3MCKA 5F3HA 5C8JB 5SV3A 1RZ8A 1B2WL 4WI3A 1YMME 4LARH 2V2TA 1UJ3A 4R4FH 3U83A 3RAJH 4JFYA 1HWGB 3ALWA 4UTBH 1N6VA 1G9ML 4GKSA 5KTEH 4RBPH 4NOBA 3BPLB 2W9LA 3IDGA 4OV6F 4PY8J 2ZUSA 3TBWA 2BSTB 4YGVB 5KSUB 5E2VL 1CXIA 1YPZE 4HC1H 3LB6C 3VXRD 3LQMA 4LSVH 4P2RD 3PQYA 2CDFB 1LHZA 3STLA 2X4PB 1MCPH 3TT3L 1U8PA 4D0CB 4JFDA 1A1MA 5DZLA 3FO9B 1FO0L 4URTB 4YBLC 4P2OB 5DK0A 4GRLD 5D93B 2VLJE 1DLFL 4FMKA 3IDYB 2C3XA 1VSCA 1W8NA 4HIJB 4YLQT 1EMTH 2WM0A 3TO4A 1YYMH 4D0BB 1ZS8B 3SDDD 4UIMA 3IJSA 4MJ6B 4AYFA 3C09C 5F93C 5L88L 4G8FB 1YEJL 5D7LA 1J7VR 4UU9B 4QHUA 2KKQA 4NZJA 5TE4L 3L1OH 1W0YT 1FRGH 4IRJD 2D7MA 3MJ8A 4J8RB 3VXME 2QQNH 2PO6C 2B1AL 4M7KL 3K81A 3LN4B 1MIMH 1IQDA 1DUYB 3H9SD 3LQZA 1KTKE 4XP4L 5E00B 1F2XK 4XCEA 3JTTA 3CSGA 5E94A 1F4WL 1MJ7H 3ARUA 3WS6C 1FG2B 3GUTA 3N9GH 4PJ7F 2B1HL 2D7OA 4XMPH 3C5JA 2VAAB 1WGOA 3CVHB 3FQXB 1F58H 2R1XA 3VXRB 4YQXH 5CWSB 1XAUA 3PWPD 3TO2A 2EXWD 4QRPE 4XPTL 1OP5K 4E42B 3BDBA 4OQTL 4UZGA 1GGCL 4L8DB 4MB4A 3NCCB 3I6KA 4GRLB 1ADQA 3DX8A 1HHHA 2HJLB 3C2SA 2BRQA 1MRCL 3FZUD 3MR9A 4KDTC 4Z8FH 3SDDB 5IB4A 2R29L 4RAVA 1A6TB 4U1LB 4UQ2A 5DTFB 2XQBL 4NBYB 5D7SH 5DHVH 4NP4H 1NFIB 3QI9B 1OAYH 3ZT7A 1XT5A 2YPLD 3BHBB 2XTJE 3ARGC 2LV4A 3VMOA 2MCPH 3TZVD 4NKDA 4OZFG 1Z6JT 4O02H 2E6JA 2OL3L 4LSTH 5E1AB 1OL0A 4PYHA 2YRPA 4LSPL 4MHHG 2DL9A 3I9GH 1Q94B 2ZPKH 1G7JB 2N56A 1EFQA 5GRVK 1VFBB 3PGDB 4HK3J 4TQEL 3OR7A 3S97C 2W9DH 1PDKA 5F7DB 3C8HA 4PUBH 1FVDB 4Z0XA 1K8DB 1QD0A 3WLBA 1KUMA 4KI5F 2ARJA 1PYWA 4UAOC 1AFVH 2I07B 1IILE 3QBTB 1K8IA 5TDPB 1J05B 1KTLB 3QDMD 4YEEA 1HEZB 3OAUL 3ZKND 3C08L 1REIA 1D5MB 5IB3B 3I6LD 4DN3L 3PWPB 1BJ1J 15C8H 1TZHA 4JM2C 2BJML 5B38A 4GG6A 3QQNA 1IEHA 1K5NA 4E41D 3OJMB 1KG0A 2FL5B 2YD5A 2QSTA 5E9DD 1KACB 4OF5A 3WO3B 4QRRE 3VXUE 3WIFB 3NIGE 3TN0C 2F8XC 2IH3B 1IGIL 1MFAH 4JZOA 3LKQA 4HUUA 4K3HA 2Z4QA 3BP4B 4WTWA 4LP4A 3I75A 5A16B 5H2BA 4RMQA 1UZ6E 3CGTA 3VI4F 1Z0NA 3UBXB 5E56A 3BP7A 2YPLB 4Y16A 3ZKSD 1KBGL 3TZVB 6FABH 4PRPD 4U6XB 2VE6B 2R9HD 4NN6B 5CSGA 2D4FA 2E5EA 2A2QT 3NN8B 1F3JA 1QBAA 1XGUA 2EEBA 4XP1H 3O3BA 4L8CA 4HIIB 3QRFM 2BOBB 2ZZUT 3BN3B 3QCTL 5B4MC 5GJSH 4OV5B 5C0GB 1U3HD 5GSVB 2DLFH 4BJLA 3WS3B 2DDQH 4M8QA 4HEPG 1JNLL 4GKNB 3RTQC 3QO1A 3E6HA 1MCWM 4KK8D 4E41B 1U8KB 3MRIA 4PJEB 1G9NC 1IFHH 4FRWA 2DF3A 3GJFA 4NQDA 2W0FA 4M3KB 3PDDA 1FQ9C 3EYVA 5HDQL 3RX8A 4CKVX 5D6CA 3CIQA 1ZGLP 1L0QA 4HMDA 3GKWL 1IGTA 2NR6C 3KPPB 4ZO9A 2HLAB 4JFFA 2PTTB 4X7SL 2HTKD 3C5ZD 3CXDH 3FO2A 4U1JA 4PRPB 1GVIA 4L3CA 4CMHC 2HFFA 4RMWA 4K3JL 3GJEA 1YJDH 2EH8L 4YR6B 5F7UA 5DD3H 1P4LB 3KWWB 5JW3L 4YHLH 1B6DA 2G9HB 1G6VK 3CCHB 4XI5D 1U8QA 1SEBA 5IOPB 3SKJH 4TVPE 3RWIA 1AQDB 3OKEB 4KRMB 5IMKA 3VWJD 3QG6A 4X4YB 2JCCF 4TUJB 2LAAA 2X1PA 2X4TA 4F80A 2VITB 4MNGE 4XTRD 3IETB 1IC4L 4JREC 3TT1H 2WQRA 2EDHA 5GRYA 1OD7A 3DURA 5LGHL 4X9IA 4DAGL 4BQCA 2CDGA 5HHOD 3L3OA 1W72A 3VFSB 1TQCB 1B88A 3E8UH 4MJ5A 4UIKL 2EO1A 2YC1B 3WHE0 1L0YA 2XQYG 2F5AH 5I6XC 3DWTA 2L0DA 1VDGA 1N6QL 1T7YA 4R0LB 1AP2A 4QHNB 3S35X 4MA8H 4RDQF 2GTWB 2NY3C 2YD6A 4X99A 3MRBA 1TITA 3MCLL 3C5ZB 2GTZB 1MCJA 3EO1B 3HG1E 3N85H 4XZUA 4G5ZL 1S9YB 4RMVA 4JPWH 4ZUWA 3F62A 1SBBA 4S1QH 5TE6H 2F19L 2FWOB 1WFTA 1X5LA 5JQ6H 5EOTA 3L95B 3MBEB 2MSPA 3UYRL 5EU3A 5D72H 3MV9D 4FZ8H 4XCYA 1X5YA 2VLJD 2NW3B 4QXGL 2RHEA 4RRPG 2NPLX 3SE3C 4GRWF 3VWJB 3GSNB 4J3VA 3GGWB 4L8SB 5MEND 3FB6B 4KY1H 4NZRH 1VFAB 2AP2A 2XY1A 4XCNB 5FK9A 3VRJB 5ESVB 5E24E 1QYGH 4XXDB 4CVXA 1PX3A 4FA8A 4LLUB 4XHJD 1FFNB 1C5BL 2O5YH 3W0WD 4BA8A 1AGCB 3B5TA 2D31A 5HHOB 2LU4A 1FORL 4KI5E 4N8PA 4WHCA 3VFMA 3VXMD 3P4MB 1NCWL 4HJ0D 3ZDXF 4K7PH 2NLJB 4M6OH 1QFUH 2CGRH 2HVKA 3GSVA 3K7UA 5F7EH 1NL0L 1AIFA 1YMMB 4PB9H 2Y7QA 2FGWH 1BQLH 3TV3L 1XEDA 3S36L 3OG6B 3SBWC 1N7MH 4CW1B 1ZKAA 4XC3H 5C08D 4PRDB 3KLHD 1ZLWH 1QQDA 4JRWA 4KVNL 4WUKL 5FGBC 4GG6F 1N64L 1A7OH 4S1RL 4UTAH 1H3GA 1YPZB 1DFBH 2PETA 3JZ7A 4U49A 5AZEH 4JN1H 1R3IH 1XGYL 3T3PF 4GW1B 3ECBB 4JRXD 1GYAA 2E6QA 1OF2B 4JO4L 1JGLH 4Y89A 4DZ8A 1SVZA 3KR3L 3MV9B 3MLUH 3QXAA 2J12B 3SOBH 4JRYD 3CUPB 1X4ZA 5J6HB 2VLJB 1UCBL 2A6IB 3VWKA 2L4OA 2EYRB 4J6RL 4IHOB 3FRUA 2DM3A 4S1SL 5FV1L 1FJ1B 4JZJA 3GRWA 5C9JA 1Q0YH 4KTDL 1P84J 1WVZA 4ORGB 3SDYH 5EO0B 3SDCB 3T65A 4HFUL 4NM4L 3I2CH 1X5GA 2X9WA 3W0WB 3Q6GL 2VLKA 3P9LB 4XGZA 3RI5K 3QUYB 2E7MA 3VXMB 1FNEA 1C7TA 4PJAA 4HPYL 3U46A 1VADA 1XGTA 3EFFB 3CFKA 4OSUL 4OM1L 3BP6B 3MRFA 3QUMH 5D2LA 1CF8H 2EKSB 2VWEC 3BKJH 5IW3A 2FIRT 1AGDA 4U1GB 3D0LB 4I1NB 5FOBB 3RHWF 3QUZA 2CQVA 2VJXA 5CKGA 3X12A 4E0RB 3K2UH 2RBLA 4ALAL 4X4ZA 5IHZA 3QAZB 5IESL 1CXEA 3V4PH 3PQYE 4JRXB 4QRPB 5F97E 5JXED 4HX1B 4P4RB 1M4KA 1JV5B 4JRYB 5MEQB 2FX9H 1KNOB 4Y5YA 3S5LA 2PXYD 4YDVA 4WEMB 3BPOB 1A2YA 2H3NA 5C70A 1DJSA 3QUXD 3NTCL 5DI8A 4U6VL 3LMJL 3VGAB 3L9RA 4UOW1 5T5NG 4FS0A 1MPAL 3P0YH 2R69L 5E5UB 5TE7H 5CD3B 3DHMA 5D7LE 3GMQA 1XCQA 1IGCH 3U30C 1WTLA 4YNYB 5D7JA 1DQDL 2RFXA 1H3UA 2V2XA 3BFOA 3GSOB 1GHFL 5F89A 3ZLQC 1JWSB 3QFDA 2R56H 2O5ZH 1NGXA 4PRHA 4G80A 3RVXC 5CEYB 1KB5A 3HR5B 5HDOA 1MEXH 1G9NL 2WWMC 4Z5RA 5I1EL 2BHZA 4N1EA 2YD1A 3QP3A 5DJ8B 1Q9OA 5K9JH 3KG5A 4CADB 4J1UB 4YDJA 4QXTB 1ZWIA 1GGTA 4OJFL 5FA3A 4J4PC 1DQTA 3K4DA 2JJWA 5LXGL 5IV2A 3H3PH 5DRWB 1QBMH 3QEQD 5ETUB 1GAFL 2C1PB 3KXFD 3S37X 3VCLB 4XCFL 5BV7B 4XP5L 4KJWD 3MLTA 2D3VA 4QRRB 3O6FB 3RVWD 5TQ2H 2PXYB 3AM8A 5B8CA 3CVIL 1UQSA 3QUXB 4CVUA 4NOFA 3SKMB 5GRZA 4IDJL 5FM8A 3WIHH 4YHZH 1MCCA 4POYA 2VDLH 1HDMA 2Y9RT 1SMOA 1OAQH 3TJEH 1ULVA 3TVMA 2P48B 4GRWE 4NFBA 1BJ1H 4UILL 2LTQB 3D39D 5KN5A 1HH6A 3B9KA 1J1OL 1F2QA 5AYUH 3LRSB 1B0GB 4PJ8C 1BFTA 1KCSH 3ARYA 1NGYB 1IM3B 5KVFH 3OXSA 1R5VA 3WNKA 3NCMA 1H5BA 1MLBB 3WFDL 1RIVL 4FQIL 2H32H 4FABL 1CT8B 4AIOA 2H41A 4XPFL 4OCYH 4B7IA 3CFEA 3DARA 2X4NA 5GS1B 4OGZA 1ZGLB 3G6DH 1MREL 4NRYB 2P8MA 2EE3A 1C12B 3O4OC 4PJIA 3RUGA 4DKFL 3A6OA 3F7QA 5JA9A 5CILH 4XNXH 5BW7A 1ZT1A 2ZUXA 4H20L 1UVQB 3PF2A 1CLZL 1KJ2B 4P3CL 4O58L 2F74A 3KXFB 4Z7WA 2YUVA 4WV1C 3ARFB 3N1QC 3T0DA 4GG6E 25C8H 5CIPH 5JHLH 2BRRL 4EDXA 4OQ1A 5MEOA 1MRDH 4ZTPL 3T3PE 2EC8A 3L3DB 5D6DC 1FSKB 1WFOA 1VKXA 5ABDE 3BZ4A 4R4NC 3SGKC 4KXZH 4OLVL 3MOQA 3PWUB 2DQFA 2Z31A 4KTYA 2N7BA 5GISL 5JUEL 1ZT4B 3HG1D 3ALPA 4J3WA 1UM5H 1PW3A 5F9WB 1KN4H 2VOTA 5INDA 5IW6B 1D5IL 5TF1H 3ULVC 1QA9A 1ZEAL 1QRNA 1NAKH 3VMPA 4PG9A 4WI2A 1MHPL 3IGAA 4XWGH 5E4EB 5EZIH 1PKOA 3NGBB 3G9VA 1WICA 3F5WA 1KPVB 3UAJC 1UWXH 5I1AB 1NCUA 3IJHA 4N8VG 2A77L 5TDOB 3QEHA 1QFOA 2YZ1A 1QFPA 1QBLL 1XF1A 3DXAA 3OHXA 4XBEL 3L5WB 4XWOD 5E8NA 4EBQL 1N5AB 1WWCA 4O00A 5ENWA 4F9LC 4G8EA 4FFWD 4F37F 1DANU 1A1NA 1OVZA 4KI5D 4PJ7B 1JPST 1ZLWK 3REVA 3VFGH 4BK4A 5KSAD 3QCVH 4NQDE 1ITBB 1HE7A 3U4EA 3HS0B 3W39A 3BOVA 5IEKB 5IT2L 1T5WB 3MA7A 4NQVB 4N0UA 4X6FB 1NDGB 4P4KC 3FHQA 4JFFE 4WHDA 4YBQD 5B39G 3HG1B 1YEKH 2AJUL 1UB6A 3V0WH 4FG6D 1KT2A 1MLCB 1WFUA 5HYSG 2CRYA 5E08L 2X7LA 3RU8L 1NUGA 5BZDA 3TJHC 3P4LA 4HHAB 3FN0H 1QO3A 4R7NA 4S2SA 4HXBL 4WUUA 3ARVA 1I1CA 4N9OB 4HBQA 3TBYB 3GSQB 1L7TH 4C59B 5IWLA 4KQ4L 2BY0A 2EIZB 3C9NA 3E2HB 4PS4L 4DEPC 3U2SB 3MRNB 2WUCL 3IJYB 3REWB 3UBXI 1YNKL 3PV6A 4I5BB 1F8TH 3JWDH 3JWOH 4WW1A 3WN5C 1Q8MA 1URLA 1FZOA 3GMNA 5AG8A 4UTBL 3T77B 3CAFA 3CVHH 2OTUB 1GOGA 5JDJA 3PXHA 2NY7L 3L3KB 4MNHA 3U9PL 1JZ3A 5E8PA 4YIQA 5KSAB 2VLRD 1OAXH 4LCIL 2HJFB 2A73A 2W60B 5GS0H 2MCG1 4FXLA 4JO3L 2BNQA 5FO7A 3SGEI 2BHUA 4M7ZB 1DEEB 1OLLA 4D9RE 4X7TB 1DBJH 5C6WH 4ZTOL 1BFVL 4ODHL 2IC2A 1K2DB 2FBJH 3MOBH 4HKXB 3S34L 1AH1A 3CH8A 3O9WC 4A6YL 1KEGH 2DQUH 1JE6A 3B2VH 5K93A 1I85C 1NBVH 3C5SA 4UUJB 3QJHB 4RISH 5EBWA 2X4RA 1BWMA 4R90H 2ZJSL 4WFHE 4AMKH 2OSLB 4TULH 2YD9A 3C2AH 4WI5A 4EKXA 1I3VA 2DM4A 1AHWA 1YEIL 1CL7H 4F57H 1G7PA 3TO4D 5IVNA 4LLWB 4G7YL 4GT7A 5BRZA 3DUHA 5CD5C 2VDRL 5J11B 1H3PL 3GO1H 4JR9L 4WFFE 3FCTA 3S35L 4ZOBA 2LAGB 4MQ7A 3N9GL 2GYSA 3HRZA 2FRGP 3KYOB 3GMPA 4K8RH 4NHUA 3LKOA 1G7IB 4P3DB 4PJIF 2BSRB 3GRWH 3RUGF 1I9JL 2VLRB 5ALBH 1EAPA 3MCKB 4JKMA 5F3HB 4MXVF 1RZ8B 1A6ZA 1FAIH 2V2TB 1U6AL 1UJ3B 8FABA 5DC9B 2APXA 5E2TH 2VN4A 4JFYB 4DK6A 5I8CB 4NJ9H 1WBYA 3VD9A 4GKSB 3FQUA 4LVNB 2EDLA 4Z7WF 1EFXA 3UTQA 4L9LC 1U91A 3GK8L 1CXLA 2DM7A 3TBWB 2VL4A 4ERSL 4OZHF 1U95A 4M00A 3AUVA 3N50A 1R5WA 5E8DH 5DJ6A 1MAMH 1XGPB 3STLB 5IB5B 1SQ2N 5D7SL 2Z35B 4LL9A 5SX4I 3BP5A 4E5XA 3QIUD 1A1MB 3I02B 1KF9B 2MCPL 5F7HA 3H7BA 5IHUL 1EEQA 2XWTA 1JPFB 1MWAL 4MD5B 1QOKA 3S7GA 2DQIH 3TO4B 2AABL 4FQXA 4HWUA 1BJMA 4DTGH 3IB4A 3CDGA 5JO5B 2W9DL 1WC7B 5D7LB 4CVWA 4QHUB 4MAYA 3GBML 3TBTA 2VLKE 3SPVA 4HS8H 2JCCB 1A6WL 3MJ8B 3MRMB 3FO1A 5K9QI 4WRLA 3ZL4H 4IMKC 4PJAE 3WNLA 5FYKE 5IBUG 5F88A 1E6JL 1CE6A 4OZGA 4D2NA 1IQDB 3LQZB 5K9OA 3AS2A 1CTNA 3JTTB 4I3SH 5D2LE 3IDJA 3SCMC 2ZOKA 4GH7B 4MQXD 1ZHNA 3C5JB 4KMQA 4FOMA 3HE6A 4BK5A 2IANA 2EE6A 5T3XD 4Y88A 2OK0L 4FFYL 1PG7H 4MCZB 4PYGA 4I13B 3O6LH 4TNVF 3QIUB 1X5AA 3IRPX 5D9SA 2EDKA 3I6KB 2FEDD 3ULVL 1M05A 1NLDL 3GJFK 1AR2A 5CINL 3B3IA 3K3QA 2DQEH 4GMSL 3UJJL 2J1KA 1NC4D 4O4YH 4GAYA 4UQ2B 2BVTA 2APWA 4BH8A 4LAQH 4GRWB 5I15H 4EI5A 2A1WH 1UWXK 2DLFL 3PHOB 3QXUA 4PGDA 4OLXL 4R8WL 5GS2D 1CE1L 3SO3B 3BH9B 1E4XH 4V2CB 3EOTL 3RVVD 4NDMA 4HXAL 4PRHE 4JPVH 3OR7B 4DKEH 3S3SA 3PUCA 1MAJA 1D9KA 2LU7A 4LDEB 1IC5H 4JY4A 2B5IB 3AXLA 2R0LL 4HPOL 1J1PH 1PYWB 3HAEB 1MNUL 5T3ZE 1U8OA 3MRCA 4H8WC 3WL9B 4PJBF 2NNAA 4NNYA 4MQSB 1N6UA 1H3TA 3EYUL 5DD5H 2FJHA 2W07A 1YNLH 4PJDA 5C0EA 3PJSB 2DN7A 1TZHB 1JZ5A 3F7VA 5DJYA 3BGMA 5B38B 3NFPB 4QRTA 4GG6B 3CXDL 3MUZ1 1NGWB 5IW1B 4U31A 4EIZC 4YHOL 2WWKT 5CBEB 1GGUA 5I1KH 2MKWA 3EDJA 4JZOB 5GGRB 1C5CH 5BO1H 2VDKH 2Z4QB 3UJTH 3HFML 1NC4B 3I75B 4N8VA 2EZ0D 2FHFA 5DSCA 3IKCA 4JFFD 2CR6A 5MP6H 1DLHA 2Z8SA 2YWZA 4HUWB 4UNUA 4Y16B 2H2SC 1S78D 4YXHH 2J3SA 1DZBA 4YHNA 1F3JB 2AJSH 4L3EA 1AXTH 3O3BB 2G60L 4ZFOA 3U0PA 4EN3C 1I3GH 3OJDA 5HYIA 4N0CD 2F8OA 3E8UL 4PIRF 2FGZA 4FNLL 1IRAY 4NNXB 1C08B 3S37L 4LPTA 4XBPB 4PJIE 4GXVH 3FMGL 3RUGE 2NX5A 1IKFH 5IEHA 2VABB 1OGTA 4MXWL 4MXVE 5F6HI 4LSSH 3EYSL 4HQQH 4M8QB 4LVOC 2BVQA 3DRQA 1MCHA 4QGYA 3PP4H 3VA6A 5B39A 1LO0L 1X6LA 3OGCB 2J2ZA 1AGEA 1QNZL 4Z7WE 4R2GD 3IF1B 4Y2DC 3ULUF 1NANI 4XB8A 1NC2D 4NCC1 2F53D 3R06A 5ISZD 2VLME 5HBBA 5J3HD 3GJFB 3GMLB 4NZTL 5HYJA 1JZ4A 1L7IL 2GHWB 3S3JA 1RZKC 4X5XA 4XNUL 2MMXA 1O7SA 5JQ6L 3A6CH 5T5NF 2AKRA 5F7MC 3R8BB 5D72L 1UKQA 2XYCA 4C83A 4S0TD 3GM0A 1IGTB 5EPMB 1BX2B 4LDOB 4D9RD 1AE6L 2XZAH 4TOYL 4JFFB 1FFQA 4U1JB 4NZRL 4OB5H 3G5VA 1T2QL 4L3CB 4WFGE 2HFFB 3MRDB 3LS4L 3GJEB 3HE7A 4HUMB 1RUMH 1QRNE 3BZEA 1Q9WA 4QHLA 4IRSD 4G6KL 1CIDA 1XIWA 1TZGH 1KIRB 4WWKD 4WFHD 4XMLL 5J1TC 1SEBB 4G9FA 4P5TC 5GJTL 4NC2B 3RWIB 4MD4B 3RVUC 1U58A 2P7TB 3CFIC 1QTYT 1R24A 3EZJB 5J9PB 2M1KA 4JJ5A 2X4TB 3DXAE 4PB9L 3KYMA 4P59H 5JW4Q 4LPYA 1M71A 1M7DA 3DURB 5FGRA 4WFFD 4XC3L 3HTLX 1JK8B 3BPLC 1LP9A 3CFDB 5DEGB 1P84K 3L3OB 1W72B 2FHCA 1WFNA 4MJ5B 1NC2B 5ISZB 43CAA 4G6ML 1KGCE 2V9QA 1DDHA 3ESUF 2X44D 4YO0B 1D7FA 1AP2B 5AZ2H 3IDNA 2AXHA 3TLRA 3SE9H 5E2UL 4F37K 4LLMA 4P2OC 1OW0C 4UT9L 5D93C 4X99B 1EA9C 3IDYC 4N0UE 3UTTD 2DMBA 1BD2A 2BY1A 4XZUB 4RFEA 4NQXB 2XN9A 2LFGA 5HI5D 1PG7X 1T66D 4HCRH 4ZUWB 5I30L 4PRIA 1EBAA 5JZ7D 4RQQA 2D03H 4DVRL 5EOTB 4KAQL 4HUXA 3PP3H 4P9ML 2F58L 4WUUE 5EU3B 5ID1A 3QIBC 4WWKB 3ABZA 2A6JA 4XCYB 5EOCL 4UBDC 1GRWA 4WY7L 1CLYL 3T09A 1IGJB 4WHTA 5FK9B 4N1CA 1PGRB 1BFSA 4CVXB 4EXKA 4QTIH 2BNRD 1GIGH 5FYLL 4QT5B 4RA0C 2D31B 3SE8L 4IRZL 4M62L 5KANG 4QRQA 1EBPA 2FH8A 2P42B 5E5MB 3GSVB 1QLRB 2HVKB 4W4OC 3VH8G 4AG4H 2XZQH 4C56A 5TJWK 1JUFA 1DR9A 2P5WA 5D70H 2BNQE 5SWSA 4YK4B 3INUH 4GRLC 1XH3A 4OI8A 1QQDB 4WNQA 5I66A 1FYHB 3UTTB 4CRPA 3V5HA 1JPGA 5I16A 3QYCA 4Y0GA 3SDDC 1IT9L 2VB5A 5GGVH 1FC1A 3WUWG 4ISVA 5HGBA 3LIZL 5TE7L 3RJQB 5CJBA 5L2KA 3MX0A 3QI9C 3IS0X 4DZ8B 5FO8A 3QXAB 1Q9KB 3BQUD 3MBXH 4JQVC 3RNQA 3ARRA 2OJZH 4X6DA 1CLCA 1T89C 1Q1JL 3DV4B 3ARZA 3JVGC 4JZJB 4NC1C 3P9MA 5IUSA 3C6LD 2IQ9L 3H3KA 2MPAL 3UTSD 5I74B 5BRZE 1DBKL 1PKQB 4HW6A 4KUZH 1MEXL 4D9QD 3TBVB 2BNRB 1IGFH 3BEVB 3GI8H 4H8WL 2WZPD 5KG9B 5EZLA 3DHJA 3MREA 1FNEB 5JOPD 5D7JD 3VI3E 4M5ZL 4QY8A 4U2YA 5FV2A 3QULA 3QIWD 3U46B 2J88H 3JV4A 3MRHA 3R0NA 5E99H 5BVPL 1KYOK 5E4IA 4PRHD 2VXUH 4PJXA 4ONGL 4WI6A 5BS0D 2E8ZA 1DVFA 1AO7D 1JWMA 1JF1A 4OFPA 3RWHA 3OTTA 1HNGA 2CD0A 2R0WH 1LE5A 5F71A 3S96A 4M48H 4WO4A 5IHZB 1QFHA 4FMFA 4OBSA 2HG5B 4YHZL 2CKBH 2IAMD 2R2BB 5EULV 3BPNB 4KKCD 4PGJA 2QQKL 3HUJA 2Y36L 3ESVF 3MGOA 2CIKA 3VRLF 2VQTA 3BQUB 5F8QC 4NO0A 1NEZA 1PSKH 5AYUL 1A8JH 4OFIA 5E2JA 3S5LB 1OHQA 4YDVB 5LQBL 3WJLC 2H3NB 4X0KA 1AC0A 3C6LB 5DI8B 1TLKA 1HINH 1QKZL 4WHYH 4K07A 2JJSA 2UV3A 3L9RB 2BDNH 3GMQB 4LCYA 4HT1L 1MOEA 5GGUB 1DEDA 1RZJC 1TJHL 4JKPH 3LKPA 3T0XA 4KK6D 5DJCA 4X80L 5D7JB 3ZKNC 5F1NA 1G7HB 2V2XB 1RFDH 5F89B 4XPBL 2HLFD 2IQAA 3K2MC 3QHFL 4OZGE 4PRHB 1DQMH 1KB5B 4F3FB 3D3VD 3DVNA 1F11A 3G5XB 4YC2B 5IGXL 1WT5A 5I17A 1LP9F 1Q9OB 1RZKL 2DMKA 1DN0A 3EYQC 4YDJB 1MRDL 4G8IA 5E6YA 2PKDA 3CSYA 1HHGA 2BC4A 3AGVA 3VA2C 3MODH 4YHML 5IV2B 4XC1L 2E9JA 5T5FH 4NQUA 5JW4M 2IANE 2VISA 4ONHA 1HXMB 4K94C 2IAMB 3FQNA 5CFHA 5IMLA 3KJ4B 3MXWL 1SYVA 5E7BA 5KOVC 3MLRH 3MRGA 1L4IA 2DAVA 2VLMD 2Q20A 3TM6A 3MLTB 2RJMA 4JY5L 1O0VA 5GGTA 2GJJA 2ZWLT 5ACZA 5D1XC 1S7QA 2FR4A 2VDQL 3OB0H 1I8LA 1ZTXL 2CMRH 4XWGL 4EUPA 3RPKA 3KPLA 3VGGA 3KPRA 4DGIH 4TNVK 4ZNEA 4YPGA 4UI2A 4XCCH 4RFOH 3LQAC 3FQWB 1T1YA 5IQ9B 1HH6B 3B9KB 1A7NL 4WFGD 4Z0BH 3S9DB 1OP9A 1U2CA 4MJIA 4NM8H 5DFVD 4FQ1L 1R5VB 1QRND 5E0QA 1H5BB 1KCVL 3K74B 4M5YH 4NN7B 4Q6IB 4BZ2H 4LSRH 1F3DJ 3QQ4A 4KK8C 1A6VH 2X4NB 2YMXH 3D3VB 2VDOH 4NWTL 3RVTD 4HKBA 4OAWA 4PJIB 3RUGB 3AREA 3QCVL 1Y6KR 2A0LD 4R0LC 2VZOA 4KH2A 4N90D 4PBWD 3AY4A 4ZUSA 3PHQA 4TVSa 3DSNA 2ED9A 5HVFB 4RFNB 5C7XH 5GXBB 2YUXA 1A5FL 2P4AB 4PJDE 4Z7WB 1EH9A 2HTKC 3C5ZC 4DGYL 1FFPA 4YHYC 3J7HA 2WQ8A 4NUJA 4XRCA 5KZCD 2KH2B 1KGCD 5FOJA 2ZSWB 3FOLB 4OZHB 2X9XA 1CGSH 4YHPB 5MEOB 2HRPH 4S1DD 3GFUA 4ODUA 1D5BA 4Y7MA 1NUFA 3MBEC 1AKJA 3I50H 1U3YA 4WW2A 2X70A 3BZ4B 2DQJL 5I1CH 4KVCL 3THMH 5I0DA 3DGGA 1J10A 5FECA 2DQFB 3VWJC 1BIHA 4KQ3L 1VFOA 3D0VB 3KGRA 3SN6N 4F7EB 5BOZG 2XG4A 1LVEA 4X6DF 2ZCKH 4JHWH 4XTRC 5L8KB 3P4NA 1QRNB 1C16A 3ZHKA 4JPIA 3DI3B 4L3EE 5JPMA 3F5WB 4PJ5D 1UJTA 3V4UL 3CVHL 3MLVH 5L6YL 1S7XA 2HKFL 4YFDB 4PJ9C 4NGHL 3QEHB 1OAXL 2NX5E 1OM3H 3DXAB 1R5IA 4DW2L 3UDWA 1MY7A 5E8NB 1B3JA 2NXZD 2VNCA 1IQWH 1ZA6B 1YEGH 2FATL 5ENWB 2YRZA 3BN9D 1CFQA 1K4DB 1QHOA 4BQBA 1CCZA 5HVWA 1MIEL 3OQ3B 3REVB 5DJDA 4AH2A 3TPKA 5KZCB 1NAMH 2FD6H 2W92A 5HYJE 3MJGX 4N5ED 1JJUA 1FNFA 1ZLUK 3W39B 1XFPA 5CEZD 4CDHA 3UROR 3RIFF 5EWIH 5IFAH 1NBVL 3VRLE 2ADFL 4AMKL 1V5JA 3QEUB 3RWEA 4N0UB 1QFWI 2EDXA 4AL8L 1UB6B 1KT2B 3KJ6H 2PYEA 3SDCC 3NBNA 4P46A 1KTRL 5EU6D 2X7LB 4KK5D 4PY7A 5BZDB 1MFBH 5CGTA 1XF4B 3RWCB 1P4BH 1VCAA 1JFQL 1HI6A 1I8KB 4WGVB 4O51B 1FBIL 2I60H 1CQYA 3DTXA 3QUYC 4X8JA 1QEWA 3NPSB 2OJEB 3VH8A 1HHIA 3VMNA 4PREB 6CGTA 5K59F 5AAWA 4OTXH 3Q1SH 2PW2A 4FQJH 5CP3H 2DLIA 3V7AE 5DVNA 4XMKL 2DI9A 5FM5M 4QXWA 4W6WB 5HHME 2IPTL 5BRZD 3PV6B 4WW1B 3GSWB 4TNWF 1HIMH 2NXZB 4U1GC 3GMNB 3I6GB 2Q7YA 3MLSL 4LCWD 3BDXA 1LP9E 4OCWH 2BX5A 4ZS7H 1ZHLA 3SKNA 3ZTJH 3QDJD 4PJBB 1X5XA 4R4BA 3QAZC 5DVKA 4KROD 3X11A 2ORBH 2A73B 1MAML 5E6ID 1EHLL 5C2BH 2BNQB 1TETL 3MRQA 4LKXA 3ULUD 3WUZA 2HMID 2X5PA 2L7UA 2DQDH 1OAZL 3ALXA 4DVBB 3LB6D 3BPOC 4U3CA 3MUGB 5J57B 1BD2E 3MA9L 1JMZA 5T33L 2W1NA 4GAGL 2XN9E 3OBAA 3VGAC 4PB0L 5J89A 5JORA 4PRIE 3HI5H 4WTZA 3VXOA 2XTJC 3BXNA 1NGPH 4TRPL 1RZJL 2J4WH 5EBWB 3CD4A 1EGJL 1V3KA 4OIIL 2QQLH 1TJGL 5T1KD 4N8CL 2FB4H 2YOCA 1QG3A 4FQXD 4N5UA 1DE4A 2HWZH 5BRZB 4M7LL 2VXVH 2D0GA 1NMBL 3HAEH 3CDFA 3FB5A 4LCWB 3FCTB 1A1OA 4MQ7B 1IGMH 5C0BD 3HRZB 3CFJA 3GMPB 3VGEA 3QDJB 3OGOE 4QRUA 3TC9A 4L29B 3BRDA 1CICA 5F21B 5T3XH 4KROB 4K94L 3PDOA 1EAPB 3D85D 2ITCA 4TUKH 4P5MA 1RZGA 5E6IB 1PG7L 1FO0A 3SE4A 4HF5H 5BV7C 5H94B 1A6ZB 1ORSA 2DWEB 4C56E 5LGJA 3WIIL 8FABB 1QLFA 2P5WE 1OWWA 5SWSE 4J3OC 4ODSH 4GBXA 3O6FC 3FQUB 4RGOL 3U7WL 1A3RH 1EFXB 1U91B 5GRVL 4B53A 2WWKO 2HRLA 1F5WA 2GT9A 2OR9H 5GS3A 3QUXC 4NCC2 3QJFB 4HUVA 1HK6A 4QNPF 3OB0K 4ZNCD 1U95B 5DT1L 1GC1H 3LQAL 1EXUA 5DJ6B 3RX5A 5L2KE 4LAQL 3MLPA 1XGRA 3BP5B 1JGEB 2LTQC 1IM9A 5HPMA 1D6EB 1LILA 2I27N 5FGCB 4WI8A 4X6DE 2XWTB 1T20A 4FQXB 4YEFA 3OV6A 5GS1C 2JJVA 4XNYH 3HKFA 2ICES 4ODTH 1IC5L 4MAYB 3TBTB 3SPVB 4HZAA 4OCRL 1J1PL 5IVZA 3ZKXB 4MCYA 4BUGA 4EOWL 1BZ7A 3A6BL 4NSKA 3Q3GA 1V7NH 1X7QA 2X4QA 5CJQH 3D85B 4NKOA 4OQTA 4JQXC 1UFUA 3LKNB 2YN5A 1QBBA 3ARFC 5FUOH 1MCIA 1VGKA 5E8OA 5A1AA 4PJXE 3IDJB 1BAFL 5DC4B 3IFPA 3DBXB 2AJXL 4NHCH 5FKPA 1RZ7H 4PP2A 1FSKC 4U1IA 1KLGB 5I1KL 1DBAL 1KXVC 3H42L 1ZHNB 1JL8A 4H0IA 5FCUL 4YWGL 2DQGH 1GZPA 5DVOA 5CJOH 3ETBF 3HMWH 2EDWA 4JM2D 1VEPA 2IANB 4Y4FA 1QFWM 2FX7L 5D5MA 3GSNL 1YEEL 3HUJE 4I18C 5F9WC 3VDBA 3U48A 1P7QA 4IS6B 3TN0D 1M05B 1VESA 1M7XA 2UZXB 4MZ3A 2HKHH 2AJSL 3FRPG 3RDTA 5E4EC 1OY3B 3HCVB 3QHZL 1EJOL 3NGBC 3NIDF 3VFTA 4ZOEA 1JGDA 3P30L 2JK5A 5JW4R 1PLGH 1B4RA 1I8MB 4BH8B 1IC1A 1NFKA 3LEYH 3CC5A 4EI5B 5K59E 2BSED 3KPNB 2CO7B 4PGDB 1JRHH 1XGQB 4GKZB 4NKIH 4P5KA 1JWUA 4WI7A 5HGAB 3EO9H 5IG7A 5EA0L 3ZYIA 5DD6A 1FGNH 5ELIA 5C0RL 5B4MD 1RUPH 3QNXA 3T3MF 2K7QA 1HKLH 1J86A 3QQ9D 1KN2H 5LWYL 2E7LA 4FQCL 5F72S 3VG0H 5TPWL 3AXLB 2VDML 4ZXBA 3MRCB 2GJ6A 2B4CH 3CZJA 4DGVL 5EORL 4RGNE 4Q0XH 4NRZA 3BIBX 1OOAA 5C0EB 3MZTA 3OG4B 4Y4HA 3F7VB 1LK2A 5DJYB 1NLBH 3VXTA 43C9A 2VSDA 2O93L 5CHNA 2AEPL 1F3DH 3K1DA 3FT3A 1KSRA 4YGAB 3QNZB 4H1LG 3MNVA 1KJ3L 1A21A 4N8VB 2VXSH 3KPRE 4ZNEE 3E2HC 5DSCB 2EDFA 5FYJU 5B3JF 4PLKC 1SYSB 3OZ9H 3PIQA 5FUCE 1IJ9A 3HI6L 4CVZA 4XWOC 4MJIE 4LVEA 4YHNB 1LO5A 4L3EB 4LBEA 3QZWG 4FFWC 4ZFOB 4G3YL 4KI5C 3OJDB 3T0EA 2AGJL 3ZT6A 2VN7A 4PGCA 4ZMAT 4G6JL 3OKKB 3TH3T 1UXWA 4ORZC 1QSEA 5JQHC 1T2XA 2NX5B 3E1F1 2VR4A 3QA3B 3NABL 5IEHB 5B21A 1OGTB 5HHMD 4CNIB 4MB3A 1V8HA 5D71H 2BVQB 3M1BB 2W91A 4M7ZC 5CJXA 5B39B 2MJWA 3WKML 1UM4H 4R26L 2EIEA 4YBQC 2XWBB 3M45A 2VKWA 3FB8B 3R06B 5BQ7A 4FG6C 4Q74A 5HYSB 3RFZC 5INCB 4QNPE 2BNUA 3PV7A 4OLUL 2O61A 4MSWA 4BZ1L 4KUCF 4XX1E 1MCLA 5J13B 2NY3D 3V5KA 4QTHB 4X83A 4DCQA 4C83B 1TNMA 2Y06H 3DROA 5JXAH 4UNTA 3NA9L 2DQCL 2EDTA 3P0VL 3AB0B 3O4LD 4L3AA 5SWZA 3VFRA 5ESQA 4L4TD 3V0VB 5IJVB 3K80A 3G5VB 1ITCA 1IZJA 1CGUA 2XN9D 3I84A 4HD9A 7FABL 3VXSA 1OCWL 5J11C 4I4WA 3BZEB 4YDKL 4L4VA 5K9QG 1Q9WB 5FHAL 1XIWB 4PJCA 3TWCH 3QWQB 1I7ZA 2JE8A 3Q5TA 4HG4J 4MMZC 4AG4L 2R2HA 4JREB 3WXWH 5BV7L 5JMRA 2B8OT 2XZQL 5HHMB 3T0WA 1ORQB 1UJ3C 1YN7B 3KYMB 1CLOH 1CFVL 3MRLA 1M71B 1M7DB 3FFCD 1WBZB 4LVNC 5BMFH 1LP9B 3D5OF 4R96B 1Y0LA 5C09A 2WV3A 1FNGA 3IDIB 3L3HA 2IEPA 2LVEA 3UP1A 1KFAL 5DO2D 5I6XB 43CAB 4Q9RH 2G2RB 1JHTA 3WNMA 3VE0A 1KV3A 1IL1A 5EC2A 1AGFB 1H8SA 2DRUA 5DQJA 3IDNB 4OZFH 2D9QB 4C56D 3EOAA 2KQMA 2P5WD 4LLMB 1NBYB 5DDHA 5D5MF 1EEZB 5ERWA 3X13A 3F7YA 2NY5H 4UT7H 5JHDD 1A7PH 2PW1B 3O4LB 1P1ZA 2RGSA 2VXQH 3TO4C 4X6BA 1BD2B 2J6EH 4UOW0 3GHBL 4RFEB 1G7MA 1JBJA 2XN9B 3OAZH 4K3EL 2V5SA 2PYEE 4GRMA 3RIFK 3FL7A 3IFOA 1MCOL 5JPNB 1HKFA 4HUXB 3TFKC 5ID1B 3IFLH 4FP8L 4G8GA 2A6JB 3QDGD 4HWBL 4JY6B 1GZQA 2YK1L 3JUZA 2V7NA 3BH8A 4KTEH 3GM8A 4X4XB 4KGJA 2QADB 5EU7E 1KJ2L 1T03L 1BLNA 1A3LH 4PV9B 12E8H 2YXFA 3RWFB 4Y19D 4HLJA 5I1IL 4QCIA 4YXKH 3T3ME 4M1GH 2XWJB 5C6TH 3VW3H 5EBLA 3FFCB 4KPHH 2COQA 1JYWA 1N4XH 2DJ4A 2XA3A 4XP6L 5I73B 1B2WH 1IMHC 3EGSA 5IHBA 3KYAA 3T04D 4PGBA 3ARGA 3U1SL 5LGKA 3FQTB 1G9MH 4C56B 2P5WB 5HHXL 2XKNA 2AW2A 1XH3B 1ZLSL 4YAQA 5LCVH 3PWVB 2BHYA 3BKCL 5SX5K 2NY4D 2FEEI 1G0DA 4K7PY 1AI1L 2ATKA 5F3BB 3IAGC 1L0XA 3TT3H 4TVPL 4L4JA 3FOMB 3SGJA 5AAMA 1HHJA 4JFQA 1DLFH 2A6DB 5B3JE 5FO8B 3CK0L 4MX7B 3RNQB 3BMWA 4HZLA 2M2DA 4X6DB 1TJIL 3KPTA 2QHRL 3SO3C 5L88H 3IDMB 1YEJH 2DBJA 5E7FA 4Y19B 3ILPA 5TE4H 4OKDA 3V6OA 1GGIH 4LEXL 2F8VA 1CU4L 4LF3A 3ZT5A 3BIKB 3C8DA 1ZHBB 5HD8D 2B1AH 2X42A 4M7KH 4MQXC 5EZLB 3VGBA 3QB7C 5DMIL 3MREB 2FBOJ 4QY8B 4XP4H 1I4FA 3QWOA 4PRNB 3JV4B 3MRHB 1F4WH 3O0RL 4TPRL 4LU5L 2KUTA 2B1HH 3DMMD 4H5SA 2FEDC 3DX6A 4LHUG 3OB8A 3MACL 1JF1B 3OKOA 3RWHB 4FTVA 3OKLA 5CBAA 5IROC 2HJKB 2NY4B 2ARWA 5DRZA 3C60A 1X5IA 3S96B 5KVEL 3O3UN 4WO4B 4XPTH 4OQTH 3RBGA 1GGCH 3CDYA 1BOYA 2BVPB 4RFOL 5C0FA 3MGOB 3W5MA 2CIKB 32C2A 4Y16C 1FV1A 2G5RA 4NO0B 3UTZB 4RNRA 1NEZB 1AY1H 3BW9A 1MRCH 2QBWA 2Q6WB 4UDTA 3HC4L 5HHPB 4F2MA 1GSMA 2R29H 4X0KB 2XQBH 3M8OL 5CP7A 3RVVC 1HQ4A 3P0GB 1PX4A 1WQVT 5CMAA 3VXPA 1DQQA 4MDJB 4HMEA 4XNQA 3D69A 1I3RA 4LCYB 4P2YA 4Q9QL 2OL3H 4PJCF 4LSPH 2P5EA 2VIRA 2JJUA 3BZFA 5HI3C 5F1NB 2AK1L 1TIUA 5GIRB 1A47A 3WBDA 3LN5B 3RP1A 3O2DL 5IK3A 4KDVA 3QNYA 3CMGA 4MA3A 3DVNB 2E27L 3DMMB 3V6ZB 2PTVA 3RWDB 3OAUH 5EIQA 1Z9LA 3ARED 4H1LA 4G8IB 3O8XA 4JJHA 4DN3H 2P1YA 3CSYB 3QUKA 2BC4B 4RGNB 1F6AA 1PG7W 4GW5A 2BJMH 2ICEB 2EZ0C 1TVHB 4ONHB 4PV8B 1E4WL 5D5ME 3MOAL 4KKLD 4KHTL 3FQNB 5IMLB 4YJZL 5EZJA 1UWEL 1SYVB 5FUZL 3MRGB 1S78C 3MO1A 5KVGL 1VGEH 2XA8L 1OP3H 2MFNA 3BIAX 1S7TA 3HNSL 3MV8A 2FR4B 4R4ND 4M7LT 3SKOA 3DVGA