1JNNL

Crystal structure of fab-estradiol complexes
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
b'QIVMTQTPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPQLLVYNAKTLVDGVPLRFSGSGSGTQYSLKINSLQPEDFGNYYCHHFWNTPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN KAPPA CHAIN
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnL01
5DYOA 3RVVD 1T89A 3PG2A 5FM8A 1AO7E 2NXYD 4RAVA 1S78C 3OKEA 4KGJA 4GRMB 4V2CB 1PX3A 2L4OA 3ZE2E 3VGAB 3NH7H 4CNIA 2NW3A 2ITDB 5DMIL 2DOCA 2VLRD 3PWPB 3WBDA 3ZT7A 2VAJA 1RPQA 5F70A 4FFZL 5F6HJ 4HH9A 2ATKB 3P9WB 4S10A 1AI1L 1F4HA 5AD0A 1MRCL 5DD3H 3FQRA 3E0GA 4JO3H 1CFNA 3CLEL 4U0QB 5J1AA 4TNWK 4WI7A 1F3RB 1G7LA 4HBQA 1NEZA 2XZAH 1NBZA 3P4MB 4Y5YB 4ZSOB 2VUYA 4MXQC 2DQCH 2XXCB 5C0FB 1MHCB 3FQNA 3AREC 1RZJL 4DKFH 1RZGA 3RU8H 2CSPA 2E9WA 1T80A 2Y06L 3NACL 1YEKL 1FO0H 1NC2A 3VXPA 1JZ3A 3FFDB 5GHWH 2UUDH 1GGTA 3DI3B 4HX1B 4JFHD 4K94H 1ORSB 3L9RA 2VSDA 5I8OL 3C6LD 4KKLC 3D3VD 1H3GA 3AREA 3SE9H 1T1YB 3QT2A 2H9GA 1T21B 5ISZB 5CZXC 4CVZB 5CBAB 1E4XL 3BD5A 3BO8A 1KN4L 2X4TA 1M05A 2UVEA 3LCYA 4H88L 1YNTA 1F3JB 5E0QA 3HN3A 2ARJB 2PYED 1QTYT 3MROB 5DFTA 4ZS6D 5B38G 3MV7A 1BBDH 1OVZA 2IQ9L 5E1AB 2AQ1A 5L7XL 5AG9A 4DKEL 1G9NH 1N26A 1MPAH 3B6SB 3B8SA 4ODHH 4PR5B 1CL7L 5I0ZA 4YE4H 1OD9A 1FNAA 5LWYL 3X3GH 3ZTJH 1CU4L 2CK0H 4KJQD 1I8LC 1MIEH 1V3MA 3QUXD 4PV9A 4TRPL 4X8XA 4JVPA 4FN0A 3K2MC 3QUMA 4YHLH 4TSBL 1ZGLP 4PGEB 1F8TL 2DMKA 4R2GD 3WIHA 3VFRB 1GGCH 4FXKA 4LPTA 4X4XB 1KPUA 1PG7W 1ZLVH 4FABL 4TPRL 2B1AL 4WUUD 1I8LA 4U1HA 4P0DA 4G6AC 4J4PD 3JV4B 1Q9KA 3NGBC 4Z0BH 2J8UE 5DA0B 1AGDB 3B8YA 2W9DH 1JTTA 3GRWL 1AO7B 3PQYE 3MLYL 4OSUL 2P5WE 2Z0BA 1LEKA 4FZ8L 4JAMA 2Q6WB 1BAFL 1FV1B 1K5NB 1T03H 1HH6B 1T5XA 3CVIL 5I19H 5CJOH 3SY0A 1G7MB 1T5WB 1WBZA 2R39A 3IJSB 2VDOL 1FBIH 4PRNB 4JJ5B 3QUYA 5DI8A 3UJTL 1OF2B 1ZV5A 4X8JB 3UO1L 5ICXA 1H3UA 3R06A 3KYMA 4J6RL 5I1HH 3GKZA 3EDDA 1X44A 5I18L 4K7PX 5CFHA 5CJQH 1W0YT 2R0WH 4H8WC 5GGTH 4L8BA 3HI5H 4NN7B 5GS0C 2YUXA 3ZKMC 4OZIF 2PF6A 1YEDA 1MELA 4XPHH 2F5AH 3IRPX 1P5VA 4HGWA 2JCCA 2YD3A 1HWGB 1JNHB 2DWEB 1NBVL 4MA8H 1ZWIA 2CKBL 5B8CB 1NCWL 5GRYA 4PREB 4DK3A 3P0YL 4X9GA 2BY1A 1UACL 3QEUB 3MRCB 4LDOB 4OGAD 2ZSWA 4PJHE 3RZCA 4N0CC 4PRIE 3GM8A 4QHNB 3MV8A 3LHPL 1AJ7L 1I7TB 1YPZE 5I0DA 5H2BA 1WBYB 1FFQA 2BVQA 4PBXA 2ZG1A 4UT9H 4TSAL 5J13B 1QNZH 2MFNA 3OJDB 4LPCA 1EA9C 4CL7A 5HY9A 2AJUH 1D5ZA 2ICEA 1ZSDA 4I5BB 1X4YA 2WWMD 5GZNC 5C09D 1WFNA 5DUBB 3R4DA 3T3PF 3WFCH 5I76B 3RZWA 4LARL 4EDXB 1N6UA 4NO2A 4R90L 4U2ZA 5DR5H 2BNRE 1XGPB 2VDMH 5EFIA 2XKSA 4N9OB 5DRWA 5A43C 3WKML 5L6YL 3RWEB 4HAGA 2BHZA 1QUNA 2EIEA 5F6IB 2BCKB 4MA3A 5JIHA 4IHOA 3BFOA 5LXGL 3IFNH 4X6BA 4RFOL 2KUTA 5C0EA 3O2DA 2K7QA 2I60L 3T1WA 3VXNA 4GSDH 5TJWK 4MNQE 4OI9A 5EBLA 2IADA 3QO0B 5IMLB 4N8CH 4PRHA 3L5XL 2I5YH 3ILQD 4X6DE 5IQ9B 1EBAA 1MCFA 5DJZA 3PWPD 1FNLA 2EXWC 4X98B 4DTGH 5CIPB 3JTSA 4OM0L 2HJLB 4QT5B 1I9JH 1ND0B 1H8SA 1R24B 2BRRH 5D1ZC 2MCG1 5JOPE 3UZVB 4ZFGH 2C3HA 2CMRL 2DJ4A 4PJXB 5DJ0A 2P1YA 2RCSL 2F5BH 4R7NB 1UXWB 4J2XA 3BKJL 3WSQH 5IB3B 2YWZA 3CDGA 1CR9H 2P5EB 3V6FA 4EKXA 2EH8L 3LH2H 5D1ZA 3OB0H 4PJAF 4BSVA 4PG2C 5TE6H 1BFVH 3BH8A 3MJ8A 4L8CA 3HLAB 2VTFA 5KBNC 5GSVB 5HDQH 5DFWH 1AQDB 3ESVF 3SGEH 2AABL 3LVEA 1MFDL 3VD7A 4D9QE 1MRDH 1SQ2N 1CFQA 1SJEA 3MRLA 5ITFA 5D2LE 3QO1A 5F8RC 2VN4A 1YPZB 3LEYH 2D7OA 1I3VA 1ERNA 4PG2A 3GSVA 2AJZA 5B39A 2HFEA 4R96B 1L0YA 1F5WA 3FO9B 3MRMA 2YHGA 4HWBL 2XWJB 3MLWH 4JHBA 4NDMA 5GISL 3Q5TA 3LQZB 1YMMD 3MA9H 1RV6X 4XPGL 1AIFB 1QFWI 1EK3A 1JHKH 4JN1H 4XCEA 4WI4A 4YHIB 4NUGH 2Q8AL 5ESAB 4WW1A 1BOGB 4PJ8B 3VFUB 4KMTH 3PUCA 5IB5B 2BNRB 3TA3C 4D9RE 5ENWB 3E6FB 3NFPB 4U4BA 1UM4H 1P84K 5FGCE 3ARYA 1F6FB 4HIEA 1I8KB 2UUDK 3SCMB 2JTDA 5EUOF 5GZOD 4F7MB 4TTDC 1NLBH 3SDCD 4OZGF 3BD3A 5E8OB 2DBJA 4LSRH 3OHXA 1JGLH 1TZGL 5C0JA 5KANI 1UM5H 3PWJA 4KAQH 1EEYA 5CWSA 1J1OL 1KLGB 1A3LL 3TA3A 3BP7A 3PJSB 2EYTB 1NC4A 3FT2B 4TSCL 5I1LA 5DO2D 4YDIH 2BERA 1AXTH 3F7VA 4C4KO 3QDGB 1BZ9A 3VRLF 2LTQB 4MD5A 1AO7D 1NDGB 1U8IA 4XMKL 4JJHA 2YEZA 5E95B 3VA6A 5LGHL 2OSLB 4Z7UB 4KI5C 3E2HC 4JFPB 3V5KA 4ETQB 3PGCA 3PP3K 4JRYE 5F3BB 5TQ2L 3KLSA 4U3HA 1SYSB 4K94C 5IFHH 1DQLL 1VPOL 1X4XA 4OD1H 4DGYL 5I75B 4MWFA 1P2CA 2E7MA 4V1DB 2EXYD 2AJYH 1FO0A 1UQSA 1INDL 1U8MB 3D25B 4XVUC 2AK4E 1CGTA 1QRND 1JP5A 4LLYA 3VWJC 4F9LC 2ADFL 3D87B 2OK0L 4XZUB 4P2RE 5INCA 3IDXL 3T0WA 5IVXA 4FXLA 2EDKA 3W9DB 5FUZH 4LSVH 2IG2H 4NO5A 4ZFOA 2CDEB 3FT3B 4ODSL 5E8NA 1G9NC 3TLRA 3VE0B 1ZS8A 4F9LA 2B5IB 3N1FC 5EU6A 5D2LB 1JGVL 4GRWH 1XF3B 5C8JB 4WWKB 1RVFL 4HS8L 3TH4T 1I8IA 3I85A 4KRNA 4KV5F 3DV4A 4GUPA 2R1YB 5FYJH 3SDAD 3U9PL 2V5RA 4G7VL 4JDTH 2WBKA 2R0KH 1C12A 3MUY1 3A6BH 3MPCA 5DK0A 3B83A 5DEGA 1XCQA 1A6WL 3HE6D 4M7JL 4JO1H 4JZJB 3HUJF 5DJAA 4J3VA 2XWTB 1U3HB 1P4LB 4DKDC 1VKXA 1AGBA 1KPVB 3QCVL 2OTUA 4Z95H 3T1FA 3VRJA 3ORJA 1FVEA 1N4XL 1Z9MA 4JR9H 1DL7L 1JZ7A 4I48A 1SVCP 1G7JB 1GGIH 2AJ3B 3I84A 1IC7L 4FQHB 2DRUA 5BCAA 5IHZB 4ONGH 1LO0L 4MZ2A 2IBZY 3THML 3WN5C 2I27N 1BFTA 3JSSA 4E41A 4ELMA 3QIBB 4DGVL 1T66C 1BD2A 6FABH 5IHUH 3V0VB 1V3KA 4OF7A 2VH5H 4WY7L 4XNMB 1LE9B 5KSBA 2D9QB 2WINB 2A6JA 3V4VH 1JHLH 3PQYD 1X5IA 2P5WD 5BJTA 2D0FA 3WN5A 3DX7A 3BN9D 1NAKL 3NN8A 3FOMA 1S3KL 3RI5K 5FKAB 3RKDD 4JRYB 3HKFA 3K1KC 4C58B 2V7NB 3VFOA 4P2OD 1RZFH 4K3HA 1G0YR 3LY6A 2UV3A 3C08H 1FHGA 1H0DB 3O3DB 5E8DL 3WIFB 1AGEA 1I7UB 1QQDA 4K55A 2VAAB 1U36A 2FJFA 4DVBA 3ROOB 3WNNA 1U6AL 1F4WH 2V2XB 1SYVA 1UH2A 1Z2KA 2HT4D 1E28B 1PLGH 5GGTA 2AXGB 4G9DA 5FGRA 1RHHB 1ZA6B 1IAIL 1IBGL 2XRAL 4LLWA 4AK1A 2DQIH 5F7KC 4WHYH 1KCRH 1HI6A 4WTWA 5GIRA 4QCIB 2R9HD 3VMPA 2DKUA 3HPJA 3LKQA 3QNYA 4UV4L 3INUL 1S7XA 4ZD3H 5T3ZL 3QRGH 3IB4A 4P2RB 4M61A 2C9AA 4PUBH 2MHAA 1IM9A 4K3DL 1BQHB 4AYFA 3ARPA 4XNXH 3NABL 1ZAGA 4HWUA 1A0QL 3B5GA 3LEXA 1NUNB 5DLMH 4BZ1L 3VDCA 4G5ZL 3SJVB 4NQEA 4N5ED 3NCFB 5C0CA 3O81A 3MV7E 2HVKB 4OCLC 4JG1L 1N7ML 2NZ9D 2Q86A 3RTQB 3H7LA 1LEGB 3GK8L 4NQDB 4PRID 5I2IA 1RFDL 1FYTA 1V7ML 4C54A 2MMXA 5D9SB 2GFBB 1DN0B 4OZHF 2KBGA 3OAYH 3VFSB 3HG1D 2GSIB 3REWB 4OCRH 3U36A 1WICA 4PLJC 4RGNC 4X0KA 3AB0C 4I9WE 3WFEL 1MCBA 1XR8A 1IGIL 4ZPTA 4K07A 1NDMB 1FE8L 1CFTB 3MRJA 3CK0H 1JZ5A 4LCUB 5I30L 2YUWA 1FAKT 4EOWH 3OR7B 1G6RH 2R69L 2VABB 3MJGX 3B5TA 4YUEH 4HPOH 1FVCA 3BP5B 2GHWB 5I1JL 2R2CA 2JLLA 4QKXB 3OB0K 4UV7H 2FEDD 3SE8L 4KVNH 4JEGB 4HUUB 4P5KA 5AZ2L 2ZCLH 3F7QA 3ME0A 4I0PC 2CUHA 4PS4H 1IZKA 5E2TL 1UM6L 2PXYB 4RSVA 3WE6A 1U2HA 3EDJA 2R15A 3O45A 3PWNB 3N1MC 1PZ5A 3KWWB 3WFZA 3IGAA 2F58L 2VDNL 5FO9A 1RUQL 4MNQD 4NM4H 2MWCA 3WO4B 3KPSB 4PGZA 2A1WL 4I0PA 2IQAB 3QZWG 4G80A 1R3IH 1MLBA 4G6MH 3SDDC 3BSZH 2Z4QA 4GS7C 4F58H 2JCCE 2VZTA 3OXRA 3HMXL 1GAFL 5ADOH 3DLQR 2QQLL 5CZKA 1NMAL 4U1LB 1T0NB 4YHKL 3RX8A 3HFML 5F7DA 3U7YH 3SDDA 5HDOA 3H7BA 5JOPD 1A7NH 4JVUA 5CEZH 4XGZB 3CVHA 4FFWC 1KIPB 2OZ4H 1HINH 4LSQL 5BZWB 4P46D 3CU7A 4PJIB 3WD5H 5IQ7L 3RKPA 1F11B 4JHWH 1QOKA 2R1XB 3CFEA 4MHHG 4JRXA 1T1ZA 4Y4KD 2A38A 4Z7QF 5I9QB 3KLDA 4S1SH 4YXHH 4EDWL 2HT2D 2FX7L 4XCYA 4NZRH 5T1DL 5KZCD 1XGRA 4GKZB 1NGZB 4J3SA 4D9QD 1PD6A 4YEEA 4PGJA 3C2AL 2FD6H 1G7PA 2HH0L 5D5ME 5C86A 4L8SB 4WWKD 3MNZA 1RZ7H 1OW0C 3L1OL 1GIGL 3M17A 5KN5B 3CD4A 4HLZH 4Z7NE 3RWDA 4TULH 4R8WL 1C5CL 5F7YC 1QG3A 1W0WA 1MHPH 4BELD 1UZ6F 5JPMB 3NZ8A 4N8VA 4OIIH 4U31A 3RY5A 1QP1A 3TIDA 1P5UA 2AJXL 1OW0A 3KPNA 5DMKA 5JXAH 3HZKA 3TH3T 3U4BH 4QF1B 3S37L 5ECJE 3FB6B 4U6VH 3MYJB 4G8EA 1QFOA 2X1OA 5GJTL 4D9RD 4KDWA 3RHWF 1CVRA 1IEBB 1J05B 4PRHE 1IARB 3IXAA 1OAQL 4TUJB 5BQ7A 4X9FA 2Z35A 1VESA 3RWJB 2IGFH 4MJ6B 3PDOA 1F42A 5GXBB 1YYLL 3QIBD 5F71A 4EUPH 3G5ZA 4UINL 5EORL 5K93A 4S1QL 3HAEB 1G1YA 2AXHA 1KB5B 5DVNA 5H94B 2VMFA 3HPLB 3O8XC 4NHCL 3UC0H 4Z7VF 3RPIA 1F58H 5HHVL 4XVJH 3VH8A 3P9LA 1HN1A 2ADJA 1ZA3B 4P59H 1QKZH 4OCWH 5A16B 1MQKH 2XOTA 4N8PA 5DC0A 2JCCB 1CE1L 5C0DB 1CT8A 2DLHA 1WC7A 3O8XA 5DC9B 2CIKA 3B4NA 5JDJA 4JB9L 1RJLB 5GGRB 2EICA 1MF2L 1ZTXH 2P47B 4JFFE 4FTVB 5HGAB 2E9JA 4OCSH 3EOBB 5F6HI 2DDQL 2AK4D 3N85L 1RIVH 4ZNCD 3LKRB 3OL2A 1T2JA 2M8XA 4OLYL 5CJ8A 1CICC 3IDNA 5DJYA 1WSST 3VXTA 5BO1L 4PJFA 4IBLT 4BZYA 3OKOA 2UZIH 1UG9A 2VLKA 2APTA 3GIVB 4PJEF 1PZUB 3SOBH 1PQZB 1AXIB 4HC1H 3LPFA 4APQC 2E8ZA 2XZZA 2X10A 1FFNA 2ICWA 2DIBA 3MACL 1YEGL 1CICA 1G7QA 5D5MB 2MTPA 1V7NL 1FSKC 5EA0L 3K7UA 2Q7YB 2B1HH 4QRSB 5T3XH 1CTNA 2YD8A 4LASL 5BVPL 3Q3GA 4KKCD 2YUVA 3TV3L 3WUWB 1ZHKB 4APQA 4BKLA 2NY5L 2AXFA 4MA3B 1ZT4B 1SM3H 4JM2C 4F7EA 1WFTA 4U1NA 2D03H 4WIQA 4FG6C 43CAB 3LD8C 3O6LH 1M7XA 3MOAH 4NKOA 4BQBA 3RWFB 4M62L 1CLZH 1LHZA 3GHEH 1WBXB 4F2MB 3PV6A 4OF8A 2VLJA 4IS6A 3LS5H 3DHJA 1AQKL 5JQ6H 5TE4L 2W60A 3BP6A 1UKSA 3FHQA 4Z78A 4MJ5A 4XNUH 3S3SA 4F37F 4MXVF 5SWZB 1NFIB 1M7IB 3OKNB 2AEIT 5CD3B 1FFPB 2OL3B 1HKLH 1F6LL 4XC1L 4RMSA 4W4NA 4KI5E 3I6LE 2IPTL 2QHRL 4DK6A 5A2FA 3GJFB 4H26B 2W0PA 1AGFA 3OAYK 4D0BA 4KQ3L 1A6VH 3IAQA 3QWRA 3FN0H 4MZ3A 2NY1B 1PKQE 3RIAF 1QFWL 3PDDA 3NA9H 2DM7A 1L7TL 3AAZA 5GS2D 4K3EH 1AR1C 4GO6B 4FQ2H 2PCPB 5B4MD 5IVXE 2C1PA 1NC2D 4P9ML 4R26H 4BSVB 1IL1A 2E8YA 5C2BL 3F8UB 3RWGB 4JFFB 3VXME 3WFBH 1RK1B 2D7PA 1RUPL 3R8BB 5HGDB 5KW9H 4GW1B 3WHE1 4D0CA 4FQXB 1FFOB 4MXQD 5IB2B 3ARED 5EU6E 3VD4A 1I3UA 4J3WA 1B6UA 3ARUA 5FA3B 3ROLA 3ZDYF 3FB7B 1YUHB 4RIRA 5L2KE 1TIUA 1DBMH 3CXHK 4KKLD 4G8FA 5CJ5A 1XZ0A 1YZZA 2ORBH 5F1IA 2ERJC 3UAJC 3NFSL 5TDPA 5KOVC 5AYUL 3MV7D 1UXSB 5CINL 3V6BR 5GJSH 5DK2A 1DLHB 4P3CH 5I1CH 4PLKC 4O5LH 5FA4B 1KTDB 1Q0YL 1QO3A 2EDJA 3LSOB 2GTWB 4QEGA 1NFDA 2EYSA 4ODBD 4LHUA 5MEOB 1DFBL 1BFSA 4XHJC 3U48A 4MSWB 4G8GA 2A73B 2QQQA 4NJAH 1EMTH 2P8MA 4KQ4H 2A2QT 3BMVA 2R0ZH 3NCJH 1J1PL 5DWUH 3UROR 4E41E 4ELME 4WTXA 1G6RA 4W70A 4I9WD 4JG0L 3MMEB 2HFFA 1NC4B 4CU6A 4I4WB 5IIEA 3ZE1F 3IDJA 4WW2A 1S7UB 3WDIA 3LKOB 5IMMB 2E5EA 3DX9A 4MD5B 1EO8L 5C0BA 1DQDH 1OAYH 1JPFB 1ZKAA 1RMFH 1YQ2A 5JMRA 1SHMA 2CLVB 1C1EL 1IEHA 5FK9B 3K2UH 1AP2B 5CILL 1PX4A 4UQ2B 2CRMA 3JV6B 5ID1B 1T4KB 4KRPC 3FTGA 1SY6H 4OKVB 4G6AD 5FOJA 4PJDA 4LCCB 3BUYA 4CW1B 3RY4A 5MEQB 5D2NC 4YHPA 3OKKA 4CVWA 3QFJB 4U7MA 1MNUL 2AAVA 4QRPB 1NAML 2C3VB 4FMFA 2BP3A 3CIQA 3D85A 4JCMA 4CMHB 4PJCA 4UQ3B 1GHFL 3SGJC 4R6UA 5AEAA 5IVZA 1CXHA 3FL7A 4PTTA 4R97C 3AFLA 3ALWA 5FUOH 3BKMH 1FNEA 1K3ZA 1Z5LA 2DIJA 4NP4L 4XAKE 1PKOA 1K6QH 2YA0A 1Z0NA 2YSSA 5D2NA 1FQ9C 1PKQB 5EO0A 2WUBL 4FP8L 2W91A 1IGTB 2DLFH 2XQBL 1FAIL 3BPOC 4DOHB 4WFFE 2YMXL 1BEYL 5GGVY 2FO4A 3G6AB 3X12A 3SGJA 3IS0X 1MY5A 5ALCL 1VB9A 4TOYL 1WZMA 3L95A 2VDQH 3MGTB 1W8NA 3VXMB 3BH9A 1JV5B 3ARZA 4O2CA 3T2NH 1XF5B 1U41A 2OZ4A 3VWJB 3MRBA 4RAHA 3SKNA 43C9A 4NQEE 4JFZH 4Z8FL 2NLJA 1JK8B 2Q7NA 5CJXC 5D96C 5HYEA 5CEXB 3NAAL 3TP4A 5LBSH 3D39B 3FONB 4PGCB 5FO7B 5L2KB 4DN4L 5EDXA 2NY7L 1FYTE 2FX8H 2G75B 3UBXB 4HUMB 3UTZB 3BT2H 1B2WH 1OAKL 1CGVA 1R3LB 5D1XB 5CJXA 1IT9H 1UEMA 3RL1B 4IJ3C 1OL0A 1FNGB 5A40E 2HJKA 3UYRH 4UDUB 4XWOC 3QCUL 3T4YB 4N0CD 5F7EL 1TCRB 5I6XB 2OCFD 3S6CA 1MI5A 1JF1A 4M9PA 3QG7H 4ONFH 1FVEB 4D9LL 4KRMB 5DD0L 2YD5A 1T04A 3KGRA 3AXLA 4GKSB 4RGNE 4L3EE 5EC2B 1BVKA 4FRWA 2XTLA 5F9OL 4HULB 3GEWB 3FO1B 4HS3B 4X6CA 3U6RA 4G7YH 1NBYB 3QH3A 4K71C 3ZE2F 1KB9K 3K4ZA 4ELMB 3D18B 4U7KA 1FORL 2CO7B 3GO1L 1EFXB 1D5IL 1UGNA 1DQML 3BDYH 3T65A 5GZND 1MCKA 4ZYKB 3O6MH 2K9UA 4JPVH 1U8KA 1AKJA 1BZ7A 3MXVL 4ONHA 3CPLA 2IANE 2EYRB 4BQ9A 4ZNEA 2VITA 2FB4L 5DHYB 4X7CC 3LIZH 3P4LA 4DFIA 3VI3E 3O3AA 3KNBA 5D72H 2AK1L 2YN3A 3BIAX 4A6YH 2BX5A 4EUPA 5I73C 4AT6B 4PRHD 2YZ1A 3AU1A 5DQ9B 4GAFB 3X13B 1CZ8H 3DVNA 5GGSA 3RWIB 1MHEA 4HIXH 4Q58C 1UJ3C 1OARH 2R23B 2JB5L 4WFGE 1E4WH 5EZLB 5ESVA 1OTTC 2VUOA 35C8L 4NNYB 3IJHA 2F19H 4Z7OE 1V05A 2A9NL 1MQ8A 1H3VA 4C55A 4OAWB 1LEIA 1QEWA 5TH2A 4M8QB 5FKPB 5T1LA 4G3YL 1S9YB 4BUGA 3LQAL 1KSRA 2V7HB 4XI5C 4NGHL 1V3JA 1JPGB 1UJ3A 2VZVA 3S98A 2R0LL 2G2RB 5EWIH 5KJRL 2ZCHL 3STLA 3L5HA 3T0VA 1DLFL 1FDLH 3UTOA 5J06A 1P84J 3ETBF 1EXUB 3G08A 4E9LA 2HLAA 5A1AA 4NQEB 4DQOH 3DSFL 3PHQA 4RGMC 4XC3L 3IU4H 4NQTA 1A8JH 3RL2B 2NW2B 4YJZL 1F4YH 4HIIA 1C5BL 4JFFD 1T3FB 4OD2B 4UIKL 3DUUA 3FO0H 3MJ7B 1NFKA 3F58L 3TGXA 3SKJH 4W68A 4J23A 3B3IB 3RWHB 1KN4H 4K23L 1ZHLA 2PW1B 4LCYB 3S34L 4X80H 3V4UH 4K3JL 2ZWLT 1DDHA 4I2XE 2YN5A 5IESL 5HYSB 4ZODA 5BXFA 4WO4B 2VISA 2H32H 1E6JL 1QFHA 2Z91A 1MSPA 1QA9B 4I3GA 3JBG7 3BAEH 2I9TA 1JN6A 1R3JB 1KJ2L 3ZHDA 2W1NA 4U1MB 1TXKA 1Q72L 3VWKB 1J1XH 4PIRF 3ARTA 3HC3H 3NCYP 5J6GB 2APXA 5SWQA 2J8UF 2Z92A 2KL6A 3U83A 4L3EB 1BGXH 3TPUA 4OLZL 4Z7WA 4OGXL 2A6KB 3U0TB 5JUEL 3IVKB 1UB6B 1VGEH 3ZDXE 3TO2B 2PYFA 4AEFA 1CDHA 4LFHD 4DZ8B 3L3OA 3WIIH 2BVPB 5HGHA 5C08A 5LJYH 3MBEC 4ZFZB 1LP9A 1JI1A 4IIQB 4FABH 2I26N 3PGDA 1YN7B 5DUPH 1OD7A 1NCCH 4LIQH 4JHZA 3DTXA 4F33B 3KR3H 2IANB 5HPMB 1NC4D 4WV1C 3UTTA 1FL6B 2LQRA 5JO5A 5T5NF 5IF0A 3UJIH 3CSGA 2P7TA 2R8SL 2A0LC 3MBEA 4TTDD 5KG9B 4MAUL 5D71L 2DQGL 4EI6A 4EVNB 5BZDA 3MOBL 3N9GL 3Q1SH 2CQVA 2CKBB 3O3EA 4W6YB 1FN4A 5T1KA 2H41A 4D94A 3JWOL 1BM3L 1A6UL 5T1MB 1T1WA 1UENA 3PGFL 4WV1A 1BVZA 5EBWA 3LN4A 3RVTC 1NGQL 2DYPA 4QXGL 3W5NA 4Y16B 1FL3A 5DJXA 1RZKL 2E27L 1TJHH 2DKMA 5E4EC 3O3BA 4NO0A 2BSTA 1XEDA 1XH3A 4KI5D 4DKAA 1K8IB 3I6LD 4TTGA 1BX2B 4PRBB 5CP7B 3WMSA 4PJHF 3VXUA 1OGAE 4IDJL 4L29B 1YY8A 2GJZA 1U8QB 3GMRB 1RUAH 2UY6A 4PP1C 2YK1L 4H1LB 4HPYL 3L3KA 3BQUC 2GIYA 1YPZF 3IDMA 5HYQA 1LE5A 3MRPB 1YEIL 2LAGB 4NRXB 3GSUB 1GJIA 1RJYB 4KK5D 4XVUD 2M2DA 5CSZB 5AWNH 3VXMD 4WJ5A 5F3HA 4NKDB 3VWJD 2HKFH 1OAZH 3IAGC 1RUML 1YEEL 3D9AL 3MRNA 2VXUL 5LGJA 5EU6D 4C56A 2DTMH 2QEJA 3BQUA 3TJEL 4F3FA 2DD8H 1CK0L 3WL9A 3Q6GL 4I2XB 2X7LB 4U0RB 1HK6A 2O61B 2E7CA 1AXSB 3GSQA 3FHAA 1BLNB 1OHQA 3LPGA 1CFSA 3NVQA 3H6JA 5DQJA 3FN9A 1ZVSA 3BPNC 1IE5A 2JJSC 4N8VB 4QHLB 4JPKH 3DURA 2BOCB 5B38A 2AV1A 4U1GB 1MCSA 4LHJB 1DTUA 5I8KL 1T1XB 5IROC 3QCTL 3TN0B 1RZIB 3STBA 5DJCA 1F90L 3KHOA 1MUJA 1KJVB 2JJSA 3SQOH 5EZOL 1RSFA 3CDFA 3TBTA 3EDKA 3T8XA 5EPMA 4JFEA 1XF1A 5ID0B 1MIML 1XGQA 4BQCA 1A9BA 5IROA 2UWEB 1NEZG 3DHMA 5CHNB 1XF2A 3KPQA 4X6DF 5HHQB 5INDB 4E41D 1H8NA 1HSBA 2GITA 3X11A 2NQCA 2YRLA 3O4LA 5GGQH 3VG9B 1WT5C 4POZC 1QFUH 1MCHA 1MRFH 4GAYA 5LGKA 2YA2A 4GG6B 2YPLA 1SY6A 2W65A 2XKNA 1IAKA 3RGHA 4XP6L 3A6CL 2FATL 4JREB 2F53A 3MUHL 1A02N 3MNWA 4L3CB 4N0UA 3WDJA 1I9RL 4JDZA 1MFNA 3UXFA 3S96A 1EJOL 5IGXH 4FQIL 3GSNL 1WT5A 1KN2L 4LLUB 3TNMB 1U9KA 1WGOA 3IKCB 4JQIH 4Q6IA 1X6NA 3H42L 4YDKL 1ZANL 1U42A 1MJ8L 1EAJA 1X5FA 1IM3A 3KS0H 3TJHC 1VACB 4XWGH 4KTDL 1Q0XH 1OGAB 2R4RH 3Q5OA 2NY4B 2V17H 3I2CH 4NQXA 5HPOA 3MA7A 5D2LF 2EDRA 1DVFC 3OGCB 2EE3A 4W4OA 1EDQA 1T20B 4WFFD 4GMTL 3FO2A 4E42A 4ZTPL 4EZMA 2CGRH 3KPRA 1UADC 3G5XA 3MV9A 4NQSB 3MXWL 3PWLA 3I6GB 4KKAC 3TVMC 5EO1A 2FHBA 4POYA 4NQED 1DUZB 1DVFA 3L7FB 1NGXB 5J12C 4R3SA 2VDPH 4PJ9B 4K7FB 4O4YL 1KELL 4J3UA 1NFDE 3GHBH 3GSXA 4RMQA 1RIUH 4UDTB 4APQB 3DBXA 3MLZH 3O6KH 4OM1H 3TBWA 1FYTD 4JFQB 3TVMA 2YPVH 5MERA 3DO7B 3GJEB 3CAFA 1KUMA 4JGUA 4OIAA 3TO4C 4XH2A 1FGVH 4DW2L 1IC4L 3SGKC 4CDGC 3VXSA 3GI8L 3CFJB 1SEBB 5I66A 4NKOB 3G04A 1W72H 3NZHH 1NGYB 5IFAH 2HG5B 4LVHC 1QSEA 5C0BE 4JM2B 5KSUA 2VR5A 4DEPC 4RGND 4PLJD 4H0IA 4L3ED 4PD4K 3B9VA 3SGKA 3FOLA 2W60B 1H3PH 3IJYB 2Z93A 4GFTB 2VXSL 3C8DA 4HK0B 4XX1G 4PJDE 3OX8A 4F7PA 4TUOB 3EZ8A 4P3DA 3PIQA 1A2YA 1OM3H 3RA7H 3TYFA 5DJ8A 5KVEL 4XCCH 1I3RA 4PJCE 3IXTB 5IB4A 2N56A 2XIDA 3MO1A 4G9FE 5BVJA 3RNKB 2IAND 1KCSL 2GEEA 2XZQL 5JIIA 3KJ4C 4HV8B 5D2NE 2VDRL 1AE6H 1A7PL 3C8KA 5DJ2A 4F15C 4I0PD 1F3DJ 2FYYB 4QTHB 4UTAL 5JHDA 3GUTA 1JWUA 3GNMH 4M6OL 3MRIA 1NL0H 3VFVB 5IW1B 4OLVL 3JWDL 5CEZE 4WFGD 5TE7L 3ULSB 3EFFA 4GXUM 5EN2A 3EYSL 3DGGA 4ORGB 1YYMH 4QXUH 4XCNB 5E6IB 2DLTA 3SDDD 3GMPB 1TQBC 5GRZA 1J8HA 3BPLB 3MCLL 5FECA 1F4XL 1A6ZB 2NX5E 4WEBL 4NQVB 2IALB 3RUGA 4XPFL 5DEFB 1KT2B 4HWZA 2GAZA 1Y0LA 1IQWL 5SV3A 5CD5C 4LSDA 4M1GL 4GAGL 1VFMA 4ODWB 1WV7T 1FGNH 3U79A 1KJ3L 4J1UA 3F5WB 2IPKA 5TQ0L 1VADB 5E2UL 4LHQB 4F8TA 3PHOB 4G6FD 4FFWD 3QUKA 3UMTA 5C6TL 5MEPA 4HCRH 3QQ3A 2BK8A 3HCVB 1MI5E 2H32A 2XKUA 5DTFB 2ERJB 2FBJL 1PFCA 1AD0B 4OB5H 5IKCB 4OT1L 1Q38A 1TJGH 4QGYA 4NOFA 4OZFG 3MZGB 3BWAA 4X6CE 1QVOB 2NXZB 4HJGA 3ARBB 3GSRB 1SMOA 3ARDC 3O2WH 5DD6A 4LLQA 2C1OA 1D5BA 5ITBH 4GW4B 5IIEB 4I77H 5JNYB 1RULH 5FO8A 3FQUA 2H6PB 1BVLB 1TMCB 4HUVB 3DX9B 4ODUA 2XZCL 3G6DH 3OR6A 3JUYA 1OSPL 3ARDA 3VFGH 4ZNEE 2YPKB 3MLSH 5EOCJ 3CXDH 1D6VL 2VWEC 3BDXA 3WV0A 3CSBA 4G43A 2FWOB 5AZEH 2DQTH 2E7BA 1SJXA 1CD9B 2ZJSL 2IPUG 5E94B 3S88L 1X4ZA 3DIFB 3BIKA 1KPRA 3PL6C 3QEGL 2V2TB 4URTB 5EO9B 2ED8A 3I50H 4G9FB 4RQQA 2GI7A 3QEQE 4KRPB 3V5DA 1U2CA 1QLRB 1ZHNA 3QHZH 1ES0B 3VW3H 4XPBL 3SKMA 5SX4H 2ADGA 4YDJB 12E8H 3O6FB 5L0QC 4R4FL 4UUJB 3PNWB 1INQB 3T77B 3V4PH 1UWEH 3PL6A 3A67L 2OMBA 2GUOA 1MEXH 3RBGA 3CX5K 2FJHA 4IRSC 4RA0C 2XA8L 4HFUL 3AGVA 3ALXA 1SJHB 4YBLB 4NUJB 1MCEA 3ZO0A 3HHRB 3DJ9A 3RAJH 1UB5A 1G7HA 3C9NA 3O8XD 1XF4B 3NCCB 1HDMB 2CIIB 1FL5B 4JFYB 2R2HA 4MMZC 2WUCH 4U6HA 4FQQB 3HZVB 1P4BL 2NX5B 4NRZB 4LP5A 4P5TC 1B4JL 1R5VA 1OGAD 2J88H 4Q2ZB 3M8OH 4D0DA 3MODL 4YHMH 3GMLA 4KKBC 4NZDA 1NJ9B 1T0MB 2IAMB 3CFKA 3UDWC 3BRFA 2ZUVA 4ZUVB 1LD9A 4YHZH 1C5DA 4HKZB 1NANI 4QHMB 3MRGA 2E9BA 5JTWA 5DF0A 4H25B 4P5TA 5F1KC 4L5FL 1DEDA 3IFOA 4NBYB 2VKWA 2X4NB 1LGVA 2BFVH 1S7WB 1EJ6A 4PY8I 1G0DA 2BSSB 3MRDA 5F96L 1CICD 3G6JE 4PB9H 4N9GA 1N5YH 2EIZB 1CF8L 3UDWA 3CC5B 3KPPB 1HH9B 4DFHA 3U46A 3KXFA 4ZS7H 2EC9T 3RVWC 3U6RB 5FB8A 3QQ4A 4KJYB 3HI1B 2VZSA 4APQD 5C08E 4HUKB 4NHUA 4XNZC 2HTKC 4FNLL 3E8UL 2APBA 3FB8A 5ICYA 4L4TA 1WCBA 3BE1L 3FAXA 7FABH 2Q76A 3HZYA 3UTTE 5MP6L 4O2FB 2WZPD 4HKXA 1E27A 3ZT6A 1CGSH 5EC1A 5EIIA 2IH1A 2JK5B 3CDYA 3WKNA 2I07A 4P23B 4JM2D 2VLJD 1BBJA 3D2UB 1EEZB 4Z6AT 4LNRB 5M94B 4FG6D 4KFZC 4ZO9A 3BZFB 3CXHJ 1R3KA 4QTIH 1CXIA 1BQLH 4QRUA 5HSFA 2F54A 3QEQB 4B53A 4KHTL 4LCWB 2JCCF 4XXCC 1KLUA 4ZPVB 2VLLB 5FHAL 4BFBD 4PY7B 4XMPH 4PRAB 4LKCA 4YPGA 5T1LB 4UBDC 3BGFB 1CTOA 5DC4B 1A14H 3KYKH 3O9WA 4U1SB 4MNGB 1X5GA 4OLUH 4WHTB 5DVMA 4GXVH 3QWRD 4F7TB 1MAKA 4OZIB 4XXCA 5IW6A 3FB5A 2Q3ZA 5TPWL 2EDDA 1I7RA 1JWSA 2RR3A 3GBLA 3W2DL 3C09B 2NNAA 3T4AB 3CGTA 4MJIB 1D5XA 5JR1H 3IU3B 2CDFB 2HJFB 5T5FH 2XN9E 3C6SB 4M7ZC 4BQ8A 2M1KA 4HBCH 5I8CA 4PRPE 1MWAH 3NCYS 3F7YA 4LKXA 4JY4B 2YKLL 1AR1D 4HT1L 4ODVL 4XTRC 1X3DA 3KPTA 1OP9A 2R29L 2A6DA 1RAMA 3MFGB 5E6ID 4XXDB 3QDMB 5D5MF 2BDNL 4UB0L 2CLRA 3LRSB 3IDIB 1U8PA 3MLUL 2G5RA 1MCJA 3FZUC 5IG7B 5DZNA 4Z7NF 1NLDH 4NBZB 4DUVA 1MFBL 2G5BA 2NY0C 4W81A 3V5HA 3PDGA 2DLIA 3G6JB 1N59B 3BEVB 2NZIA 4O51B 4R7DB 8FABA 5DQDH 5F7LB 1KJMA 3W0WB 1HXYB 4HMDA 5MENA 4U7SA 3L6FB 4HK3J 3TCLB 2ZOLB 3QIWC 1IEAB 4NNPL 5SWSB 4LHUD 5D7LA 1P1ZB 4JFEE 2Y07L 3KYNA 3UAJD 1FG2A 3VFPA 3FFCE 1W72A 4Z0XB 5GGUA 4ODTL 3ARBD 4YXKL 5EOQH 5EOTA 1CBVL 1OWWA 2DM3A 4NQCE 1FZOA 2PW2B 1LK2B 2ZPKH 2VZ1A 4XHJD 3ILPA 3SE4A 3WS3B 5BMFH 3ZTNH 1FFRA 3P77B 1EVUA 5DA4A 3MZTA 5JPNB 1I7ZB 5C0BD 3X3FL 5HHME 4YNYB 2FJGB 5FCUH 2NMSA 4M1DH 2R1WA 3EIFA 3P30H 3RNQA 1NCBL 1L4IA 3CFBA 4XVSL 5E8PA 2QQNH 4GH7B 4PB0H 5IB1B 4CBPA 5A2KH 1XR9A 4HLJA 4LSSL 2DQFB 5EORH 1A3RH 1H15A 3D85D 1U91A 5CMAB 2OP4H 3FQXB 5DRXB 3EYUH 4XBEH 3TYGL 3CZFB 3QWOA 1D5MA 1GOFA 4YC2C 4G9FD 1TNMA 4KRPD 4PP2A 5DT1L 3BXNA 5FM4A 2C4FU 3UTSA 1I8MA 3TWCH 1L6ZA 2H1PL 1FC2D 4LDEB 3QZWA 2HVJA 5IEKB 2R4SL 1BFOB 3AS1A 3BESR 5KVDL 3QBTB 4AG4H 5I1GL 3KPRE 4QXTA 4UOW0 4NZUL 3KPMB 1JPSL 3CMOH 5DSCB 1D9KB 3MV9E 5DD1L 4JB9H 1KXQE 1H8OA 2X09A 2XN9B 5CEZD 4OJFH 2MSPA 1MAMH 1VFUA 4PRPB 2QR0B 1ZT1B 1EEQA 2YBRA 3DRTB 3WL9B 4PJBA 1XGTA 3T08A 5HHNB 1ADQH 1UWGH 4ACPA 5BS0E 1PYWA 3IFPA 3FMGH 1RIHH 2NX5D 4LAJH 1A64A 2ADIA 5EUKA 1B88A 4LPWA 4KHXL 5HTSA 4HCRA 5LCVL 1SEQH 2V9RA 4L4VE 4EBQL 3V52L 3D48R 4UZGA 2DQJH 3B2VL 4NM8H 1MREL 4M00A 1UA6L 1EEUA 2C4XA 4L8DA 5GGVH 1OPGL 2J6EL 3BPNB 1X6LA 4KZDH 1OOAA 1QSEE 1MI5D 1FH5L 3OJVC 4X5XB 2GJ6B 3FFCB 2H45A 5I1KL 4LEXH 4HGMA 5KAQG 5ANMB 3TNNA 2OJEA 2NY5H 5EUOB 2J12B 4XWOD 1CD1A 2COQA 5DD5L 4OZGB 1M7DB 4Y4FC 3ARGB 4NQCB 4MDJA 1P7KB 4DVRL 1MHHA 2KPNA 4LAQL 5HHPA 4OD3L 4MXWL 4MCYA 3CFCL 2ESVA 5FYLE 4WCYL 1S8DA 4ERSH 5HHOA 3UTQB 1AKJD 3I02B 1X7QA 5GRVL 2NY3B 4F7CA 4KI5F 4POUB 5FYKU 4Y4FA 4DGIH 5A3IC 4BFEA 2EEBA 1FP5A 4AH2A 4GQ9H 3RY6C 3MV11 4QY8B 1A1OA 3EO1A 5GRUH 3UBXI 1RURL 3KPOB 2DQUH 3WFDH 1JZ6A 3NTCH 4XRCA 5E00B 5IVXF 4KTYA 4P5MA 4ZO8A 3VFNA 2RFXA 3RY6A 1KCVH 4M5YL 7CGTA 2HA1A 3FT4A 2VDLL 2Y4SA 3GKWH 3ZLQC 3Q6FA 4ZFFA 2XTJB 3VD3A 2AJVL 3MREA 5T1LD 1MOEA 3MGOB 3RGVB 4YEFA 4HMEA 3JTTA 1I9IL 2VL5A 4M93C 1I3GL 3LN5B 2P44B 1EHAA 1ZHBA 2EECA 1GXEA 2GK0B 1OTTD 3LZFL 1RI8A 4BSJA 5F9JB 4JN2B 3MLVH 2EE9A 4MVBC 1CCZA 3K8MA 4IOIB 5D7IA 4PJ5B 3QNXA 3E3QC 2MPAL 4UILL 3RDTC 3WJJC 1RU9H 4HJJH 1BIIB 4XI5D 3S35L 3AVEA 1UKQA 1FCGA 2KH2B 2OQJA 5BS0B 1OQXA 4G6KL 4XPAH 4XP4L 1MLCB 2WLZA 4Q0XL 1KYOK 4XNYL 1DCLA 3VD9A 3FQTB 5ETUB 5JDSB 3DROB 3C5SB 3IDYC 3RDTA 3DXAA 3WJJA 3G5YB 2J7LA 2JELL 3CLFH 3QR2A 2HWZL 4L4VB 4NWUL 3NCEB 3U7WL 2AV7B 3I75A 1NCDH 5KVFL 3SPVA 3PWUA 1QFWM 3EYFA 3HI6H 5FCSH 5F7NC 4ELMF 2VIRA 5JHLH 3U7AA 3F7RA 1FRGL 3HUJB 3QULA 2JB6B 3Q5YA 1UYWL 3MRHB 4TUKH 3TO4B 1IGFL 2ATPB 3IDGA 3H2WA 1L7IL 4HXAL 2OXGA 3V8OA 2Z93B 1RJZB 1IGYA 4YH6A 1ETZA 3V0WH 1N3NA 2SEBB 4LIQE 5ADPH 1NAMB 1WLHA 4ESKA 4PGDA 5C08D 1K4DA 3QDJA 4LCIL 5HVHC 5K9JL 3TT3H 4DEPB 4A6YB 2VXTL 3PWVB 3DV6B 3SO3B 2DI9A 3L3HB 3VFTA 1LDPH 5A2LH 2GTZB 3HC0A 3UTTD 3WNOA 5IUSA 2BSED 3BKCH 5I15L 2Z31C 5HYIA 4KPHH 5HJ3B 5I1IL 4PBWD 3MBED 1QLFB 1JGUH 5H35A 3HS0B 1HXMB 1CG9A 5FHBL 4WDIB 4RWYL 5GS1B 4B7LA 5IMKB 5T1KD 3KLAB 5GSRB 1IGML 4DZBB 1F45A 2XFXB 1KTRL 3VI4E 1S5IH 4FQJL 1ED3A 1VFBA 2Z31A 2AKRB 4NKMB 2V2WB 2A0LD 4OF6A 4EN3B 3BKYL 4WHCA 5ALBL 1QSFA 4K8RH 3TBVB 4KUZH 5JORA 1U92B 4X83A 4NO0D 2Y7QA 3LV3A 1A5FL 5E99L 2CLZA 4P57A 2VE6B 4MAYC 4JGJA 1S9XA 3RVTD 5L2JB 3VXUD 4H20L 2XNAB 3ZKXC 4MD4B 1N5AB 5E9DA 1MWAA 2A74B 1MJUL 2EH7H 3ZYJA 4YHYC 3ABZA 3GSOB 4BQ6A 1JNNL 4MAYA 1X5ZA 1D9KD 1JE6A 1T22B 3SQBA 4Z7QE 2XN9D 1NBQA 3R1GL 4GG8B 4I3SH 1NUFA 5DJDA 2XWBA 1CIDA 4KZEL 4JANA 2IFFL 4PRPD 3P73B 4ZDHB 4PP1D 4RAUA 4X4MA 1P9MC 3OKDB 1KFAH 3BQUD 2BVOA 3RJDA 4FZEL 1LNUA 2CUMA 3LKPB 2Y23A 3KXFE 4JZOA 2V5YA 4P4KB 5FIEA 5IFJB 5HDLA 5ERWA 3MRRA 1JVKA 4OZHB 3F65A 1BREA 4AMKH 1DBKL 4LLVA 5FDYA 2VSCA 1KEGL 1XGUA 2H8PA 5AAMA 4JZNB 3H3PL 2DM2A 3A6OA 4QRQA 1P9MA 1K4CA 1IGCH 3QUML 2FEEI 4A2MA 3STZA 4ENEC 4U6YB 1IILE 3MNVB 4JY5L 4L4TE 2BNUA 3MLTB 3VXRA 5L8LB 3WIHL 1N6QL 3U0PB 3C5JA 1GZQA 1MFAH 3DRQA 4N0YH 4M6ML 1Q1JH 3UX9B 2D31B 1CQYA 1NMCC 1B0RB 2AJSH 4YAQA 3REVB 3MUJA 2H2PC 3QHFH 4JFED 3SGEI 3VI3F 3LKNA 3EOTH 3BHBA 5CBEA 2Y36L 3FFCD 5E5UB 3S5LB 1F97A 5D1QB 4NZTH 4NKIH 3QIUB 1UH3A 2F54E 4WHYG 2M26A 4AIZB 4NQCD 1EHLH 3BWUC 3SO5A 4Z7OF 4JFHE 5D7JC 5DJ6B 5F1NA 2EZ0C 4PRDB 3LEVL 5AUMA 4DAGL 5F21B 5EU4B 3NOIA 5HHMD 1FZJB 3W9EA 4X7EC 3EOAA 32C2B 1SBSH 3SBWC 3TBSA 5FYKH 3MRFA 2L0DA 1JHTA 2XXMB 1KTLA 4JO2H 2KQNA 5HI4C 4YQXH 5JLZB 4XHQA 4POZD 4Y19A 2FR4A 5D7JA 5BV7H 4HUXA 2FGWH 1JGDB 1CYGA 1KNOB 4HQQL 1JPST 1JFQL 5M7QA 4QYOA 3F12B 4Y2DC 4O58H 3SBWA 1AGCA 4YIQB 4IRSB 5LAXB 4OTXH 5C0IA 4LQ1A 5I74B 4GRLC 3LQMA 1VERA 3MCKA 4LSTH 4DWHA 1N8ZA 5DDHA 2VERN 1P7QA 3ESUF 4WUKH 3T0EB 2BMKB 4L1DA 5C0RL 1GZPA 4H8WL 4KUCD 5C7XL 4Y8AA 3TIEA 2D7NA 4JFXA 1KJ2B 2AI0H 4PD4J 3DMMB 3KPRD 4M48H 3S7GA 4JKMA 2OMNA 4JCLA 4YGAB 3H9SB 5DS8B 3MV9D 3TJHD 4GRLA 2VXVL 4LEOA 1ADQA 2QKIB 5J6HB 4PJEE 1HHHB 2ZUSA 4BK5A 5CUSL 1KC5L 2PO6B 1FVDA 3OKMB 4N9GB 2ZUQB 1DVFD 4I18C 5C9JA 1II4E 1HQRA 2UYLB 4HIHA 5F9DC 2EKSB 1KXTB 3KXFB 4OCXH 3VFMA 5MENE 1Q94A 1UZ8A 4EIGB 2NXYB 5BS0D 1G9EA 3AROA 1WFOA 3GSWA 5K9OB 2NY5C 5D7LE 5HGGS 2AERT 2AS5M 3MGAA 2GJJA 4KKAD 1YDPA 4Q6YA 3ZDXF 3TVMD 3L3DB 4PJAA 5E2VH 3WFHB 4YDVA 4AL8L 4RISH 5IK3B 2VOTA 1NKRA 4FXGA 2VLRB 4I18A 5I1AB 4FFVC 3WHXA 4L4VD 5IWLC 3CFDA 2R2BB 5EU3B 1HSAB 3CFIC 4ZXBC 5JQHC 3NFNB 1TVHA 3W39B 5C0AA 2Y1VA 3FCTA 4WTZG 4ALAL 2WBJB 5IJVB 1OCWH 1Z3GL 1QSED 1DEEB 3TO4D 1K8DB 4XMLL 2G60L 4NCDA 1A7OL 4Z9KB 1EGJH 1FCCA 3T0BA 5IWLA 5DXWA 4ZXBA 1HWHB 4FQCL 2YD6A 3FAWA 2EDHA 4UAOB 1KBGL 1HCFX 4P4RA 1VFAA 2CDGB 3EGSA 3H9HB 5JW4M 1YEJL 1YA5A 2EDNA 3WLBA 1JNLL 5K9KA 1OAUH 3GBNH 4MXVE 1N0XH 2ICWI 2A6IB 4J8RA 1GGBH 1YEHH 3C6LB 5FYLD 4UT6L 3D3VB 3BW9B 3LS4L 3R8QA 3DPBA 3ARFC 3L3JB 3VDAA 1YNKL 4KVCL 5FUCC 2WANA 4M4PA 4JFDE 3MJ9L 3BX7C 4R0LC 5FF6B 3NBNA 4HS6B 4CMMA 4PJ7A 2GSGB 4C83A 1FLRL 5I1EL 3E6HB 3ARFA 2OR8A 4JY6A 4PJFF 4GRWF 4ODXA 4X4YB 3JZ7A 5GS0H 2PYEB 4R0LA 2GK2A 2C7UA 2AEQL 4LSPH 3QXDA 4OBRA 4X6FB 3HNTH 4WNQA 5K9QG 4JLRA 2A83B 2ITCA 4OFPA 1LK3H 3CUPA 1KENL 4EN3D 1MAJA 1Z0MA 4IRJC 5D7SH 4O2EB 2LABA 4M5ZH 4PJBE 4S1RL 3I3DA 1DANT 1MJJB 4AENB 4HLZG 4U1KB 3ZDYE 4Y4HC 4M7ZB 1TDQA 1S9VA 1HOCB 4IDLA 3MLPA 4L4JA 1ZGLB 4R2GB 4X9IA 1TVDA 1AR2A 1MCRA 2ZOKB 1TQCB 4X9BA 4PJEB 1WZKA 3SKOA 4G8IA 3BISA 3QYCA 4IRJA 3HNVL 2HN7A 5IM7B 2H3NB 3EYQC 4RFEB 3SDXA 1H3WM 4ZUSB 1T0PB 4HH8A 1RUKH 2QADC 2WP3T 2ZKHL 3S36H 4QWWC 1A6TA 4Y4HA 3JVGC 1CDBA 1U8OB 5FOBA 3L3GA 2UZXB 1YNLL 5CD5D 4WU7A 3U30C 4HKJA 5HGBA 5JW5A 2XPGB 4JM2F 1DUYA 4E5XB 5AAWA 5IEHA 5J11C 3ALPA 2VDKH 3QJHA 3JVGA 3VXQB 1YN6B 1FZMB 1I1FB 3L7EA 3KJ6L 2B4CH 3CX5J 4JHAL 3QIWB 1CGWA 3VRIA 3O2DH 1Q9LA 5TDOB 4OZFH 5I16B 2F8VA 2QSQA 4U2YA 3RVXC 1ORQB 2YOCA 3EOYG 2WAHA 1T83C 4EXKA 3DX8A 5TF1L 2ESVE 2DQDL 1R5IB 2OTPA 3GSNB 4OQ1A 3ARDD 1C08A 2X4UB 4AEHH 3C87A 2DMBA 2P8LB 3NH7L 4ELKB 2N4IA 1QLEH 1T83A 4K2UH 1LO5B 5IMOA 1KCKA 1S7VA 1W8OA 2D3VA 3KHQA 2FL5A 4GBXB 1HYRC 4JO4H 5C07A 4K8RC 5DD3L 1ZE3C 3CNKA 4KROC 4LL9A 4MCZA 4NRYB 4JO3L 3IKKA 3HAEG 4JFDB 4QHKJ 5E8EA 4M1CC 4I13B 2AEWA 1ZGLM 3O11A 1W2KT 2XZAL 3EJZC 4YGVA 4XB8A 3HE7C 3WO3B 2DQCL 1QR1A 1WZ1H 2BSRB 3GB7B 4GLRH 4CN6A 3PL6D 4DKFL 3DARA 3RU8L 3AMLA 4ZUUA 1FO0L 2DS4A 1A6AB 3QA3A 5GHWL 1JRHH 3P4OB 4GKNA 4K94L 3G5VB 1W0VA 2X1WL 5DRNA 3GGWB 5F88A 3MFFB 3HE7A 2I24N 4NN5B 3KS0J 2E6JA 2WQ8A 3B9EA 3H0TA 3SE9L 5JOFA 1BJ8A 2OTWB 4KJWC 4IRSD 4ZFOL 1QBMH 1NFDF 3E3QE 5KTEH 1V8HA 4S0SD 4QOKA 3CJJA 5TDNB 1S7SA 2W9LA 5CZVH 3DXAE 4MYWB 2ID5A 5KVGH 1PG7H 3MR9B 4UNVA 4OCYH 5ICZA 4TQEH 2P8PA 5D70H 5J9PB 2AGJH 4R4NC 2OR9H 1FIGH 3FQWB 4XAWH 1BBDL 4ZAKC 1IAOB 3OZ9H 1RK0B 1MPAL 1HIMH 4P5TD 4ODHL 1XIWC 4DN3H 4P2QE 3MRQA 4NWTH 4YE4L 3VXOB 4OV5A 3WCYA 1GYAA 3X3GL 1G7IA 4BYHA 3QUZC 5CEYB 4KKBD 3BZDA 1NGWA 2CK0L 4EI5C 4XP1H 1MIEL 4PV8B 1UEYA 3KXFD 2BOBB 3BZ4A 4Y5VB 4YHLL 2FSEA 4D3CH 2JJWA 3WUWG 3KPLB 4U6XB 4ZAKA 1GGCL 4GAJH 4HDIB 1I4FA 4JKKA 3QDJE 1JZ4A 2FIKA 1XIWA 2V6HA 1G84A 2PTUA 4PJDF 3CSYA 3UJJH 3QUZA 2XY1A 1U8HA 1FJ1B 1U58A 4R4BB 4EI5A 1IMHC 3BVNA 4IOFD 2X4QA 1DQQB 4HIJB 4Z0BL 4L4TD 3S4SA 1VGKA 5F97E 3P9MA 4PJCF 2W9DL 4BH8B 4HHAB 3L5WA 4ZQKB 5C0GA 3ZSSA 3VA2C 3NIFE 2IFGA 4YHOH 5EBMA 4LVNB 2WBJD 1TFHA 2BNQA 1T03L 3HR5A 2HTKD 5I19L 4LRIC 2QHLA 4LQFH 2P43B 5CJOL 1A7QH 3WXVH 1QRNE 5BV7C 1GC1H 4DUWA 1FBIL 4PGBA 2X4OB 3V6ZB 2X70A 5ACZB 2GT9A 2F54D 4TVPH 4CN4A 5I1HL 1M71B 4YK4B 3ES6B 4LRIA 4RMTA 1HEZB 3KYOA 3HNSH 1QZ1A 2PUQT 4YWGH 4U6TA 5CJQL 2R0WL 2HRPH 5GGTL 1S7RB 5DFVC 4HAFA 2F74A 3HI5L 3P0VH 4LPVA 2NYYC 4KDVA 1CE6A 1Q9OA 4MX7B 5E9DE 4XPHL 2F5AL 1QFPA 2ICCA 4MQ7A 4YFDB 5F89B 4UBDD 4MA8L 2GCYB 2W9EH 5EZJB 1CGYA 3ZYIA 4ZTOH 2WIIB 4XPTH 3RWCA 1YMMB 2DL2A 4X5WB 3C5ZC 3GMMB 3PP3H 2Y5EA 4B5EA 5HYJE 3GBML 3QEHB 4KTEH 4Y5XB 5E5MA 5F9AC 1K85A 2ZSVA 3ZZ1A 3C60C 3V0AC 1JWMA 1C16B 4OQTH 1HHGA 3Q2CA 3WS6C 4RCAA 1MH5B 3IF1A 3KDMA 1NCUA 4LLDB 5EZIH 4X6CF 3BEWB 3C5ZA 4HFWA 2OI9C 3SDCB 2X42A 1LVEA 2W59A 3QULB 4UT9L 3L3IB 4XBPB 5TGBB 2OS7A 1QNZL 1EAPB 4P2QB 4XTRD 1YMHB 3C60A 1A4KB 3VXRE 1J87A 3WS6A 2J4WH 2AJUL 1U95A 2QBWA 4YXLH 3O41A 3VJ6B 3FZUD 5MEND 4LFHG 3WFCL 1DQJB 2V5MA 1HE7A 5BRZA 4K7PY 3RVVC 5DR5L 3RHWK 3QUYC 4HK3N 5D7LD 1VEPA 2NY0D 2VDML 3B9KC 3N50A 1MCNA 4LP4A 3SDYH 1HILB 2B20A 1NMBH 1JUFA 4LF3A 3O0RH 2P42B 4AEIH 4OZ4A 5KSVA 1EGJA 3IFNL 3QIWD 3T2PA 3ARVA 1OAXH 3I6KA 3QWQB 3QDAA 1P53A 1IKFH 3B9KA 2X4RA 4MNHA 4XP5H 1TZIA 4Z77A 3PABB 1QPPA 3QXAA 4GSDL 1H9VA 2H26A 1CG9B 4LBEA 1MCWM 2NCMA 3EYOA 1QRNB 2O5ZH 4OFIA 3QI9C 4N8CL 4KXZH 5DUMH 3O4OC 4KK8D 2I5YL 3IETA 3GMNA 1EERB 4Y19E 3OXSA 4S2SA 2IMNA 4O02H 4HZLB 1LO2H 1B9ZA 2R2EB 2Y5TA 4DTGL 4GBXD 4MA1C 3RZCC 1I9JL 2WWKT 3QI9A 4CADB 4JDVA 2BRRL 4HXBH 2JE8A 3U2SA 4ZFGL 3D0VA 4PYGA 4JFDD 4LVOC 4LSUH 5B3JE 3UTSD 1R5WA 2FEEL 4Y0GA 5ELIA 1S7QA 4GW5B 5FYJU 2F5BL 1IKNC 5CCKH 3SDAB 4PTUB 5FEBA 1IGJB 1N2RB 3L5JA 3WSQL 2A77H 4ZUWA 1GPOH 2VYRE 1CR9L 3LDBB 4MAYB 1ONQA 3LH2L 4HWEH 3NMEA 5HVFB 4YFEA 5EU5A 3HG1E 1BFVL 3HE6B 4QRTB 5TE6L 4X6EB 3X14A 3ZKXB 2ARJQ 5HDQL 4LRNH 4BH7B 4Z7VA 5HYJB 3B5HA 4TNVK 1IKNA 1OB1B 4D8PA 1MRDL 2OXHA 4NYLA 1KIQB 4U1IA 3G6JF 1U8LA 5ESQA 5I1DB 4QHUA 3LEYL 3BRGC 4OF0A 3TH2T 1BHGA 1Q9WA 4TYUA 2G9HB 3MBXH 3LMJH 5MI0C 1VSCA 2B4CC 4H5SA 2IH3B 2YC1B 1J9CT 3MLWL 2NTFB 2IPUK 4PJGA 3T0AA 3MA9L 3HA0A 1MVUB 3B2UD 2BC4A 1JHKL 4BSWB 5C0AE 4JN1L 3HZMA 4V2BA 3DUSA 5I8EB 2J8UB 3QUXA 4NUGL 4X99B 1OGTA 3PQYB 4KMTL 4RBPH 1DE4B 2P5WB 1MCWW 1K2DB 2RIKA 1UM4L 4OZFA 1S5HA 4HSQA 1L6XA 5LQBH 2E3VA 1WCQA 4MB3A 3ZSTA 1J11A 4P2OB 4BFIA 4OKDA 1NLBL 5JW3H 1LO3H 2EE6A 1JGEA 4JFOB 4FNLH 3GMQA 4LSRL 5HHXH 4F37K 1JGLL 4WUUA 1PSKH 1UM5L 4KAQL 4J4PA 1F13A 2X4PB 2P49B 3PP4H 4UT7H 4Z76B 3TBYA 4Y1AA 2P24B 4UIMB 1AHWC 2ESVD 4YDIL 1AXTL 1ZT7B 3QNZB 4RMVA 3WXWH 1F6AA 3OQ3B 3QPXH 5DHVB 4Y4FD 3U4EB 4RNRB 3RIAK 2VZOA 3VGHA 1KYOJ 5EU7C 3P4NA 1AHWA 4ISVA 4MDIB 1TZHA 1WWAX 5IFHL 1TPXC 5E2WH 3VDBA 4OD1L 1WJ3A 1S7TB 3MLRH 5FUCE 3M1BA 1U93B 4GMSH 1J0HA 4NT6A 2NY6C 5A3ID 4CVXA 3EDEA 3F62A 4QRRE 3CVHH 2AJYL 1I1YB 3HRPA 4ZUTA 4XNQA 2LAAA 1V3LA 4I3RH 1QBBA 3SGDH 2O5XH 3TCXA 4PJHB 3MLXH 3VFWA 5IR1B 2Y72A 1HHIA 2QQKH 5KSAC 4Y2DB 4PRIB 5CIPH 1I1AC 3FRUB 3EYVA 1EVTC 3U9UA 5IT2H 4Y2OA 4NO3B 2YRPA 4I8DA 4LSVL 3HG1B 2AP2A 5JOEA 2IG2L 1XCTB 5LG1A 1J5OL 1U3JA 2AEPH 2W0FA 3ECBB 3SDXE 3DGCR 1HHJB 3DYMA 5C1MB 5KSAA 4N0FB 4DCQA 2WW8A 3TZVC 4YPJA 1I1AA 3VFMB 5IV2B 1IQDB 4XBGA 1R3HB 3BPCA 4YO0B 2VQ1B 2JIXA 1ZEAH 4MVBD 2E9IA 5FYJL 4JDTL 2R0KL 2FO1A 3RDTD 3DXAD 3WJLC 3O2VH 5J89A 1URLA 3D69B 3TZVA 4RZCB 4ZO7A 3A6BL 1FZKB 4MB5A 5HYSG 2VJXA 1GRWA 1LILA 5KS9E 4JO1L 1LO4H 4RGOH 3OB8A 4P2QD 4W6XB 5C09A 3BDBA 3WJLA 1ZK9A 4Z95L 1YY9C 1QHOA 5FDWB 1A21A 4MNQB 1GGIL 3BGMB 3OG6B 1GC1C 4ONGL 4EQ2A 4MD0A 1A1MB 1ZVHA 3QDJD 4X6DB 4RFNB 2FZ3A 1KG0A 3ZKQD 6FABL 5IHUL 2PTTB 2X41A 5C07E 1F3DH 3MRKA 4NNXA 5D6CA 3OAZH 1E6OH 2BZDA 1CDIA 1GOGA 4PG9A 3V4VL 4Q97A 1JHLL 5EB9A 1J18A 2ILLA 1FNSH 3G9AB 2P45B 4K3GA 4KDTC 3OKLB 3ZKNC 1MCPH 4O9HH 4G42B 1RZFL 2EDTA 1A9EB 3C08L 2ITDA 1Z6JT 2EIDA 4KUCF 3P2TA 4P46B 3JWDC 3PWPA 3BZEB 4OI7A 1HHKB 4Q9CA 1F4WL 1A4JB 4Y5YC 3U0WH 2ATKA 25C8H 4Y4KB 1PLGL 4KDTA 3PXHA 4QRRB 5I17B 2KDGA 4IMLB 1UJTA 2DQIL 1KCRL 3K0WA 4KK6C 3T0DA 5KZCB 1AD9B 1D6EB 4ZD3L 1TVBB 2I9LB 1NGPH 4N1EA 3QRGL 1YEFH 4CN1A 3P4MA 4Y5YA 4ZSOA 2ZG3A 5C0FA 4JPIB 2ZP0T 1MHCA 4QOKE 4PUBL 1RZ8B 2NR6C 5LVEA 4XNXL 3CCHB 2WP3O 3LN9A 4H1LG 5E9DD 1IC5H 5DLML 3FFDA 4HX1A 1ORSA 2DWDB 1WEJH 4MAYD 1MJ7H 4OQTA 2UVFA 5KVMC 1A1NB 2O26U 5C70A 1WZLA 1T1YA 5HYJD 1T21A 5ISZA 3OGOE 4CVZA 5CBAA 3EO0B 2QADB 4X7TB 1CLOH 5DZLA 3GMOB 5FGCB 4Y7MA 3L7EB 2JJVA 4K9EH 4YR6B 4OCRL 5EOCH 5KS9B 1P4IH 3MJ6A 1F3JA 5F9WC 1RHFA 3UPRB 2ARJA 2D0GA 4H0GA 4KRLB 5E1AA 3CK0L 3CH1B 1P6AB 3B6SA 3VXRD 4PR5A 4JKPH 2IF7A 2IC2A 1B0GB 4EOWL 3RIFK 4HF5H 1G6RL 4FOMA 5IBUG 4YHNB 4XVTH 3IFLH 4YUEL 4HPOL 5E08H 2BNQE 2MQ3A 2J2ZA 4PGEA 4ENED 4UV7L 3VFRA 4KVNL 4X4XA 1EV2E 5L88H 3ZYOA 2ZCLL 4M43H 1VDGA 1OSZB 2OJZH 5E6YA 4CDHA 1INEH 4PS4L 1UVQB 4L9LB 3JV4A 5FYKE 2DBLH 2H2PD 1AGDA 1MFEH 1AO7A 3HRZB 2HMIC 2HP4A 1TETH 5SX5H 2EDOA 3QXTA 2Q6WA 2A9MH 4FQ1L 4NM4L 2YD1A 1FV1A 2AK4B 1K5NA 1U8NB 5TFSH 1HH6A 4NPYB 3BP4B 4H0HB 1R3IL 4G6ML 1G7MA 1GGYA 1T5WA 3DVGB 3BSZL 3IJSA 1S9WB 4Y19D 5A2IH 1M6OB 5D7JD 4F58L 4LLMB 2EZ0D 4PRNA 4JJ5A 3QFDB 1OF2A 1X5HA 4AM0B 4X8JA 4NN7C 5ADOL 5T33H 4RBPK 3RVUC 5DRZB 1CIUA 5HI4D 3U7YL 1U8JB 2ENYA 4NSKB 5B8CC 1A7NL 2HKHH 3WEXB 1DBAH 3HB3C 5CEZL 2X4SB 1Y18B 1HQ4B 2OZ4L 1P7QD 1WQVT 2IJ0C 1HINL 2X89A 3F6IA 3QJFB 4JPWH 3WD5L 4Y2DD 4JHWL 3VCLB 2XV6B 5F7UA 1JNHA 2DWEA 4GRLD 4YX2H 5IBTH 5B8CA 4S1SL 4YXHL 2Y6SD 1KCUH 4PREA 3MRQB 2LV4A 4NZRL 4P2CG 5IOPB 3QEUA 3MRCA 5JW4R 4WU5B 4XCFH 4NN6B 1EO7A 2FD6L 5DYOB 2HFGH 4J3TA 4QHNA 1O7VA 1RZ7L 4RAVB 3OKEB 1I7TA 2XACC 4HG4J 4TULL 4CNIB 5CKAA 2NW3B 2IWGA 4JM4H 1MHPL 1V5JA 1WBYA 4OIIL 1OTUC 3P11H 3ZE0F 4HH9B 3MV01 1IGFH 3OJDA 5JXAL 5AD0B 5C0AD 3U4BL 3FQRB 4I5BA 4U6VL 1CFNB 5J1AB 2B2XH 4E0RA 1AY1H 1BQSA 5DUBA 1G7LB 5I76A 4FFVD 1R0AH 4EDXA 1NEZB 1NBZB 1XGPA 3N1GC 3PF2A 4ZXBD 3BYTA 4XX1E 3FQNB 3T0XA 3RWEA 1RZGB 4FFYL 2IGFL 2D4FA 1VCAA 1ZLSH 3VI4F 1NC2B 1ZOXA 2BCKA 3VXPB 4Z18A 4S11A 1EZVX 3L9RB 4AZ8A 5BV7B 4ZG1A 2BJMH 4IOSD 3K74B 3AREB 3UC0L 1F58L 4LU5H 4XVJL 2H9GB 4P59L 3QO0A 1DBJH 5IMLA 1QKZL 4OCWL 1NSNH 1MQKL 3V2AR 3BO8B 2X4TB 1M05B 3OTTA 2F8XC 3WNMA 5IQ9A 5B3NA 3MV8E 1B90A 4WFHD 1YNTB 3ARFD 5GRWA 5HDBE 4KY1H 4X98A 4JQXC 5HD8C 1S9KC 5CIPA 4R9HA 1ZTXL 2QSCH 2HJLA 2GY5A 4QT5A 1Q8MA 1ND0A 3MV7B 4QRRD 2W92A 1R24A 3W82A 2O5YH 4OCSL 5C3TA 1RIVL 2NZ9C 4PJXA 1KACB 4PV9B 1CDCA 4M7LH 3QUMB 4JQXA 4R7NA 3W11C 1ACYH 1UXWA 2NPLX 3OAZK 3UZQA 2UZIL 5IB3A 4FQLH 2P5EA 1JL8A 4FXKB 3SOBL 4X7SH 1KPUB 1HZHH 4IRJD 4HC1L 4PJGE 3HLAA 2VQTA 5GSVA 4CVUA 1AQDA 4U1HB 4Q74A 1QBLH 2DQHH 4Y4HD 4UNTA 1Q9KB 1T7ZA 4WVRA 4Q9QH 3HMWH 1LEKB 2B1HL 4F8QA 3OMZA 4JAMB 1YPZA 2Q8BH 4S1DC 3UTPE 1CLYH 3RQ3A 5HXMA 1T5XB 2QADD 4UTBH 4QWWD 4R96A 4B50A 4L9DA 4PJ8C 3FO9A 3SY0B 1WBZB 3OWEA 3NGBB 1SM3L 2XWJA 1SMAA 2D03L 1YQVH 4GT7A 3LQZA 4IRZH 3QUYB 5DI8B 3SCMC 1AIFA 3O6LL 3MOAL 5ICXB 3R06B 4Y1AE 1CGUA 3KYMB 3QXVA 1CLZL 4YHIA 3V6OC 4BK4A 5ESAA 5L9DH 3GHEL 1BOGA 4PJ8A 2C26A 3VFUA 5IB5A 2BNRA 1LWRA 5ENWA 3E6FA 1YJDH 3NFPA 1XGYH 3LS5L 3OF6A 2JF1A 5JQ6L 3SCMA 4L8BB 2PN5A 3TT1H 4F7MA 2LTQC 2WWKO 1YEDB 4XNUL 5E8OA 2WMPA 3V6OA 1CFVH 1KLGA 2YD7A 3H8NA 5C07D 3AC0A 4HGWB 3PJSA 1ZWIB 2EYTA 1HKLL 1T2QH 4BZ2H 5CSGA 3FT2A 2VXQH 3QDGA 3ARWA 5EU7E 4MMXC 1QYGH 3KVQA 5I75C 1NDGA 1A6VL 2ZSWB 3FN0L 3RZCB 2OSLA 4Z7UA 3MV8B 2YD2A 3NA9L 3HAEH 2OBGA 4JFPA 4ETQA 4K8RD 1KB5H 4K3EL 5F3BA 4FQ2L 3I3BA 4KROD 1SYSA 4R26L 2DMCA 2W0KA 3HTLX 4M1CD 4LVOB 3VG0L 4Q9BA 2GYSA 5H2BB 3CDCA 3WFBL 3EHBD 2BVQB 5KW9L 2DQEH 4D8PB 4V1DA 3PHSA 5FM5O 1TJIH 2LVEA 2XICA 4OLXH 2R56H 2CRZA 2CH8A 2JJUA 1U8MA 3D25A 1FIEA 5HY9B 4ZOBA 1ZLWH 1D5ZB 2ICEB 1PDKA 1ZSDB 1JTOA 1KF9B 4K9EC 1DBML 4QOKD 2B5IC 4OGYH 4BFGA 4NO2B 2VR9A 4WWKC 4XZUA 5EFIB 5DRWB 2APWA 2ORBL 3W9DA 4KU1A 1IFHH 4NZJA 2CDEA 3FT3A 1NUGA 3QPQC 5GRVK 4KJWD 5SX5K 4IHOB 5GJSL 3VE0A 5MI0B 4P3CL 4X6BB 5I1CL 4O5LL 5D2LA 3M07A 2XQYK 1XF3A 5C8JA 2DTSA 5C0EB 4WWKA 4Q9RH 1REIA 2R1YA 3VXNB 1BIHA 4R4ND 1U3HC 4NJAL 1EMTL 4KQ4L 5EBLB 2IADB 2QJDA 4ZAKD 2R0ZL 3NCJL 4PRHB 5DWUL 3WNKA 3EFDH 1XIWD 1C8PA 3QISA 3QUZD 5DJZB 4RX4A 4Y1AB 4EI5D 4JZJA 3OPZH 2XWTA 3JTSB 1U3HA 4P99A 1P4LA 3QIBC 4M6NH 1OAYL 2CJUH 1KPVA 1RMFL 1S78D 3ULVH 3DWTA 3K2UL 4TVPE 3ZL4H 2BNQD 1DSFH 1DBBH 1G7JA 2QTEA 2AJ3A 3FJTA 1SY6L 3EO9H 5F7WC 5DJ0B 5IHZA 1BF8A 4MHHI 2X05A 4KGLA 4GXUN 3QIBA 4OLWH 3CDGB 4N5UA 3AY4A 3V6FB 3V0VA 2APFA 5D1ZB 4XNMA 2OR7A 2D7TH 5FYKD 1LE9A 2WINA 4JQVC 3BH8B 3MJ8B 4L8CB 5FUOL 3BKML 1K6QL 1CFQB 1SJEB 3MRLB 4PJBF 5ITFB 2DLFL 1CI5A 4ZSOE 5FKAA 4CU8A 4JRYA 3CX2A 3QO1B 2V7NA 2OL3H 2WM0A 3D0LA 3O3DA 1H0DA 3WIFA 4JQVA 3GSVB 1I7UA 2AJZB 2VDQL 3ROOA 4JGMA 5B39B 3CH8A 2HFEB 4HUNB 2V2XA 2HAZA 2D7MA 3GJFH 3T2NL 1A6PA 3ARXA 1E28A 3MRMB 1EBPA 2AXGA 4JFZL 1RHHA 1ZA6A 4NDMB 3BPCB 3HC4H 5DFVD 5DMGC 1UCBH 4QCIA 2NYYD 5LBSL 5CLTA 5CZXD 3ZYZA 4MA7H 3MOQA 5ISZE 4XCEB 4WW1B 2EKJA 4P2RA 2FX8L 3BT2L 1B2WL 1BQHA 4HIEB 5SX4I 3RTQC 2D9CA 2Q1EA 4WW2C 3DETC 1NKOA 3C5ZD 3QXUA 2EDBA 1M1SA 3OHXB 3UYRL 1AFVH 5C0JB 3SJVA 3PWJB 3S37X 1EEYB 5CWSB 2X9YA 2HVKA 3DYPA 3C60D 3TA3B 3BP7B 5L8KB 1BD2E 5I1LB 1MCOH 3QG7L 1F2XK 4ONFL 3RTQA 4P9HH 3GI9H 3F7VB 5DMYA 4RDQF 5KSBE 3U1SH 1LEGA 1BZ9B 4NQDA 3JV0A 5BRZD 1EUUA 1CN4A 1U8IB 2YEZB 4MD0B 4G7YL 1A7RH 5D9SA 2GFBA 1DN0A 3F7PC 1PW3A 1OT1A 3VFSA 3REWA 2GSIA 3V5KB 3PGCB 1WTGT 1CDYA 4G6JH 3ULUH 3BDYL 2ZCKH 3O6ML 5HYFA 4JPVL 1NCAH 1NDMA 1CFTA 1QSZA 3I9GH 4C57C 4MWFB 1P2CB 4WTZA 2FLBT 3QUYD 4LCUA 4XP9H 3B9KD 3E2HB 3OR7A 4LOUC 4J3XA 3TC9A 4NC1C 1FO0B 1UQSB 3LIZL 2VABA 2PXYC 3OAUH 2J5LC 3BP5A 5D72L 4A6YL 5FYLL 4MLSA 2D2OA 5FM5M 4LLYB 2AVGA 2K7PA 1BF2A 1CZ8L 4W6WB 4HUUA 5F7MC 4HIXL 5INCB 3ARQA 3WUZA 1OARL 3WO4C 1E4WL 5IVXB 4K7PH 5D7IF 3RP1A 2F19L 5B4MC 5IP4A 4NO5B 5GRXG 4ZFOB 2PXYA 1FPTL 5IVNA 5E8NB 3QI9D 4FMKA 3PWNA 1ZS8B 1L9NA 3KWWA 3FRPG 5C0CE 5EU6B 5EWIL 3KPSA 5C71A 1ITCA 5GS0D 1I8IB 3ZKMD 6CGTA 2WK2A 2IQAA 3DV4B 4GUPB 1KEMH 5GRJH 1FDLL 1YECH 3RZCD 3EKCA 3V7AG 1OTSC 3MV8D 1C12B 3H9ZA 4DQOL 2MCPH 5CGYC 4Y8DC 5DK0B 5DEGB 1XCQB 4M7KH 3IU4L 4UOJA 3ZT5A 1N64H 4U1LA 1F4YL 1T0NA 5DJAB 4PYHA 3FO0L 4NJ9H 5IHBA 3SKJL 3LRGA 5I9QC 1VKXB 1JPTH 1AGBB 4OLEA 4XGZA 1KIPA 2OTUB 4HZAA 3T1FB 3T09A 4P48A 4X80L 2BY0A 3VRJB 5BZWA 3V4UL 4I48B 4PJIA 1MFCH 5ILTH 1F11A 2R1XA 3MCG1 4L8SC 4MS8C 1ZLUH 3R0NA 4E41B 3BAEL 4RMRA 3QRFM 1G9MH 2MJWA 1BD2B 1J1XL 2VC2H 3HC3L 2B0SH 2DM4A 3LB6C 2FX9H 3IT8D 2VKXA 4GKZA 1NGZA 5KSBB 2A6JB 1BGXL 4WI5A 5F9WB 1YJDC 3NIFF 5BJTB 1KGCE 4L8SA 3WN5B 1VGEL 3DX7B 3NN8B 2ZUUA 3FOMB 3WIIL 5KN5A 3UTPD 3VFOB 1X5AA 5DMIH 4CU7A 3RBSA 2EDWA 2MKLC 1AGEB 1QQDB 4M6AA 4DVBB 2FJFB 5DUPL 5JPMA 1YC8A 1SYVB 1NCCL 4LIQL 4FFZH 3KR3L 1HYSC 1ZLWK 4G9DB 1AI1H 4LLWB 4Y1AD 1MRCH 4QF1A 3UJIL 1HI6B 3FB6A 5GIRB 1ITBB 5J1TC 3ISWA 3HPJB 3CLEH 3MYJA 3LKQB 3QNYB 1S7XB 3Q1SL 1IEBA 1J05A 4M61B 4TUJA 2MHAB 1IM9B 3LRHA 1RZJH 1G1CA 3RWJA 3NACH 2Y06H 4HKBA 4MJ6A 1YEKH 1TJHL 2EXWD 3LEXB 4NC2B 2UY7A 5KANG 4JRXE 3HAEA 5C0CB 5I8OH 5H94A 1KB5A 5D1ZD 3HPLA 3BYYA 2WNGA 2IBBA 2Q86B 1CDGA 4PJXE 1ZA3A 2VLME 1RUAL 5I2IB 4OF3A 5A16A 1FYTB 1E4XH 2RAMA 1KTKE 2NY6D 4H88H 5C0DA 1JJUA 2P5EE 3U36B 4X0KB 1CGXA 4LPYA 1RJLA 5AWNL 5GGRA 1XR8B 3N1PC 4ZPTB 5KSAD 2HKFL 3WNPA 1OAZL 3WDHA 2IQ9H 3GBMH 3MRJB 2YWYA 4FTVA 1I1AD 5HGAA 5L7XH 4DKEH 2XG4A 2DTML 1CL7H 2C3GA 2JIXD 3EOBA 2DD8L 3S3PA 4AIOA 3SN6N 5LWYH 1I75A 1CU4H 3LKRA 4RGNB 1IZJA 3AB0B 4TRPH 1FVCB 3X17A 1PGRB 4TSBH 3BI9X 1F8TH 3TZVD 4JPKL 3GIVA 1PQZA 4P5KB 1F2QA 1K9TA 4TPRH 3JV5A 2B1AH 3ULVC 5D5MA 3WE6B 4E0RB 5D8JL 3TA3D 3GRWH 3O45B 3KYAA 2EIBA 3SQOL 3MLYH 1PZ5B 2Q7YA 4OSUH 3IGAB 4QRSA 4HGKC 4FZ8H 3WUWA 5FO9B 1BAFH 4U05A 2DJUA 3GJFK 1ZHKA 3K4AA 4I0PB 3CVIH 4G80B 1MLBB 1ZT4A 2Z4QB 1RY7B 4WRLA 2VDOH 3V6OE 5GGQL 1YY9D 5H37G 3UJTH 3QB7C 1QFUL 1MRFL 3OXRB 43CAA 1CDJA 4KMLB 3UO1H 2F15A 4J6RH 5SV4A 3RWFA 3QDGE 5I18H 1WBXA 4F2MA 4KI1A 5F7DB 3SDDB 3H7BB 4WWID 5IGXL 4TVPD 4GS7B 2ED7A 5B3JF 3J7HA 3CVHB 3U4AA 2YZ8A 4Z7UE 4P49A 3MJ9A 4JQIL 1FLTX 3CFEB 5SWZA 1NFIA 2NY1C 1T1ZB 1M7IA 4JRXB 2Q20A 3OKNA 4PJFE 1FFPA 5CD3A 1NBVH 4GRWE 3ZKND 2CKBH 2OL3A 1NCWH 2VLKE 2Z8WC 4V1DE 4G6FB 4F57L 3VGDA 3TPKA 4XCYB 4XWGL 2EO9A 5FYJE 1Q0XL 1BOYA 3P0YH 1XGRB 2R4RL 1OP5H 1QRKA 1UACH 3GJFA 4FQPA 2WSKA 2V17L 4H26A 3I2CL 4OFDA 5DZOA 1AH1A 1G7PB 4FQXC 3B9AA 2FHCA 3MNZB 2CGRL 5JIPA 3LHPH 3M17B 3K8KA 2ARWA 1AJ7H 2PCPA 1BMGA 3RWDB 4KK6D 1W0WB 3RWGA 4JFFA 1RK1A 5HGDA 3NZ8B 4GW1A 1LDSA 2YXMA 4TSAH 1JYWA 2VDPL 1FFOA 2WBWB 2P4AB 4FQXA 4H1LH 3TIDB 4P9HC 5IB2A 3KPNB 5DMKB 2NR6D 5FA3A 3HZKB 4Y88A 3GHBL 1J0ZA 5ISZD 3S4SG 1RIUL 2DIAA 3MLZL 3FB7A 3O6KL 4OM1L 1YUHA 4KWUA 4G8EB 2YPVL 4LNVA 4LARH 1U3YA 4R90H 2B39A 1FGVL 4CUCA 2VLJE 5F1SA 3IXAB 1KXVC 3ULUC 3WKMH 5BQ7B 5L6YH 2Z35B 4HD9A 4NOBA 3PDOB 2BXZA 1W72L 3NZHL 1UXSA 1DLHA 1VEMA 5IFAL 1Z9OA 5LXGH 1BD2D 3G5ZB 5FA4A 1KTDA 1WAAA 3H9YA 4RFOH 3LSOA 2GTWA 2I60H 5MEOA 3RPIB 3OG4B 1H3PL 4Q6IC 4MSWA 1OWRM 3VH8B 3P9LB 2A73A 2ADJB 4PJ7F 2DLGA 5CP3H 3S5LG 1BZQK 3L5XH 1T66D 2RHEA 3MMEA 1OM3L 3RA7L 1CT8B 3LPWA 2PNDA 4XCCL 5H8DA 4I4WA 5KOMC 1WC7B 2LU4A 3O8XB 2CIKB 1BPVA 1S7UA 3LKOA 4LCCC 4UNUA 3EAKA 4W4OC 5IMMA 1MCQA 4OM0H 5J7CC 1JPFA 4CMHC 3Q0HA 2CLVA 1AE6L 5FK9A 1AP2A 1P7HL 1NPUA 4UQ2A 2HTLC 3JV6A 2CMRH 5ID1A 1KV3A 1T4KA 1ZLUK 4OKVA 1BP3B 2RCSH 4LCCA 3IDNB 1DZBA 3GNML 4CW1A 5MEQA 1NL0L 5DJYB 2HYMA 4EQ3A 3QFJA 3VXTB 1TENA 4PJFB 2HMID 3OKOB 3BKJH 4GRWB 4QRPA 1IM9D 2C3VA 2VLKB 4LPUA 2OX5A 1Z9SA 4UQ3A 2EH8H 1IC1A 1Y6MR 3SDXF 1FFNB 1YYML 2ICWB 4KK5C 4QXUL 2KZ1B 2AABH 1CICB 2K3TA 1MFDH 5C0CD 1G7QB 1PKQA 3GM0A 1ZLVK 1IGTA 2X89D 2MQCA 3G6AA 3Q3GB 4UOW1 5HBBA 1ZXQA 1ZVYA 1J5OH 2XYCA 2J8HA 4BKLB 3MGTA 3VXMA 3RVUD 4G8GE 1G9MC 1FGNL 2AXFB 1JV5A 1XF5A 2V9QA 4Z5RA 3VWJA 1X5LA 1GVIA 4HWBH 4F7EB 3HB3D 3SJVE 5KS9F 4U1NB 1FSKB 5GISH 5D1XC 1JK8A 2XA3A 4XPGH 4HCRL 5CEXA 3D39A 3FONA 4PGCA 5FO7A 5L2KA 4HW6A 4OB5L 2Q8AH 4NQDE 1TJGL 4CJ1A 3PV6B 5I6XC 2G75A 3UBXA 3UTZA 2VLJB 4IS6B 3O2WL 1QACA 1R3LA 5D1XA 3J8F7 5ITBL 3GZKA 1ODAA 2ZUYA 3BP6B 3LD8B 4I77L 3RL1A 4YZFE