1JNNL

Crystal structure of fab-estradiol complexes
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
QIVMTQTPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPQLLVYNAKTLVDGVPLRFSGSGSGTQYSLKINSLQPEDFGNYYCHHFWNTPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN KAPPA CHAIN
total genus 50
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnL01
2R9HC 4Z0BH 1KELH 3LKRB 1I1AB 4P5TB 4PJGA 1T3FB 3K4AA 3MFFB 3TT3L 3TN0C 1XCTA 3WUWA 3QH3B 2GAZA 3NGBC 1BVLA 5JOFA 1WVZA 4PG2A 5F7DB 5IMLA 5I1HL 3WS6C 5GGQH 4GKZA 2XKNB 3B3IB 1MSPA 2CLRB 3FB6B 1KLFA 2YD6A 3SE9L 1MCWW 3BZFA 3QDAA 2A73A 1XGUA 1LEKB 1FH5L 1RZGA 3BGFC 3EYQC 4JY5L 35C8H 4RA0C 4OT1H 5FM5M 2DQEL 1KIRA 2AP2A 4B7LA 5F7FA 1J18A 5D96B 4XRCA 1Q0YL 3NCFB 5EOTA 4URTB 2FX7L 5T1MB 4MJ2A 4P2QA 2NY5H 3CD4A 3DYMA 3V5DB 1SJXA 3WN5C 2YKLL 5KSBE 1G1YA 1YECL 3GMLB 5MEPA 4FQIL 4HD9A 4EI6B 4TUKL 2IPUG 3EFFA 3KPMA 1NL0H 4M1DL 2AKRB 2DQFA 4PJ5E 5EU5B 4KK6D 1P1ZA 3WFDH 5DD3L 2X4PA 3VFGH 3REVB 4LOUC 1NLBL 3MNWB 2Z91A 3MBXH 4PP2A 5ITBH 4L1HA 4R9HA 1KBGL 1I9RL 2HP4A 2KDGA 5KVDL 4H5SB 1YPZA 3P0VL 5F89A 1MNUH 1HQRA 4R7NA 3I9GH 5TGBB 4S1RH 4TUOB 4MJID 3IFLL 4ZUWB 4B50A 15C8H 1DBJH 1YMHB 1SY6A 2O5XL 3O2DA 3T2PA 4O58H 5EBMA 3CU1A 4XNYL 2LU3A 1PFCA 3OF6A 5I8OH 3JV0A 1JNHA 3NAAL 3QUXC 4UIMB 4HW6A 2EEBA 1CDCA 3BN3B 1INDL 3CZFA 2VXUH 3PWJA 4R0LA 3GJEA 1CD1A 1NC2A 3MODL 3OXRB 1EJOL 3ARGD 3GO1L 2R56L 5CEZD 1ZVSB 4M61B 2I27N 4EUPA 3RKDC 4JR9L 3S35X 2ADJB 4OZHA 4H0GA 1HE7A 1U8KB 2VLJE 3TH4T 4CL7A 2H3NA 4OLEA 1CI5A 1MCQA 3KLAA 2DLIA 3S37X 5FDYA 5A2LH 4U1MA 2X4QA 3BP5A 2CRZA 3ZE2F 1Q9WB 1OT1A 2J8OA 1HHJB 2OL3H 3C60B 5GSRB 1K4CB 2V9QA 4P3CH 4QOKE 5IW3A 2GW5A 2BOBA 1IGYB 3DMMB 4F15C 3NIFE 4JGMA 4LSTH 2EDHA 4A2MA 4NP4L 3S8WA 1PSKL 5F3BA 3QXTA 1T1XA 3BO8B 4WHCA 5E5MA 3S5LG 3SDYL 3L3IB 2R23A 2B1HL 3OXSB 5HDBE 1IGFH 3MV9D 5GSRA 1WT5A 3TZVC 1M05B 2VITA 5FYKE 2BC4B 1EBPA 3QG7L 3BP4A 4NPYB 4OZFH 4JQVC 1Y6MR 3EYUL 3IT8D 4P9ML 4FQHA 4LCYB 3A6OA 3SJVD 1K8IA 7CGTA 4X5WA 4F7CB 4M1GH 5HHQB 4R26H 2APVA 4HUXA 1KYOJ 2ZCHH 4JJHA 2OZ4H 4Y5YB 1FORL 1FRGH 3M45A 1XCQB 5CGTA 4Z7OE 4P2RA 4XAKD 4PY7B 5ISZE 4M43L 1ZANH 5B38G 3ARBC 4IEFB 3VFSB 1YJDH 2BJMH 2VIRB 3B6SA 4LK4A 3ULUD 4AT6A 4Y8AA 5IROC 3QBTB 4PJ7B 3B5HA 1LK2B 2H1PH 5C07B 1MHPH 2UZIH 5JDJA 4G8GE 2JJWA 3OB0H 1F6FB 3NCEB 1T21A 3GIVB 1X9QA 1J0HA 3MRIB 1DUZB 1JYNA 4WJ5B 4QXTA 3WE6B 2YOCA 4PY7A 2CKBL 1B88A 3ARGB 5IROA 4JDTH 4JZOA 5I15L 2VDOH 3BAEL 4JO2L 4HKBB 1VCAA 3ZT5A 3H0TA 5I18L 4JVPA 1AD0B 3O6KH 2RR3A 4OD1L 2P7TB 3GEWB 4RFOL 4FQCH 2A74B 3ILPA 5D71H 3IKKA 1BFOA 4E42B 2CJUL 3KG5A 3NFSL 4HLJA 4PGCA 5K9JL 3LIZL 1UM4H 1P7KA 2CDFB 2E27L 2XWBB 3TO2B 5FYLD 3X3FH 1NANI 4PRAA 2J8UF 4DKFH 32C2A 4MA7L 4U33A 3W39B 4JN1H 5KANI 1IQDA 4BQ6A 4ZFFA 3AY4A 5IESL 5TF1L 3QUMH 2LE9A 3QJFA 3DI3B 1G9MC 1NC4A 1FL3A 1XF5B 1TJGL 1QNZH 1YEKH 3SE8H 3U4EA 5HHMB 4FQLH 4QRQA 2J7LA 5DMKA 2F19H 43C9B 2YPLE 3B9DA 4U1SB 4AM0A 1FL6A 3MRFA 4JPWL 5LGJB 3IXAB 4JO3L 4UILH 3V0WL 1T21B 2NY6D 1X5LA 4UBDC 5I1DA 5EIVA 2C5DC 5MI0C 4QRQB 4R4NC 5D5MA 5F72S 4LCIL 4YE4L 1ACYL 3TIEB 1L0XA 2DQHH 4NHUA 4L5FH 3JWNC 1AD0A 3QFJE 1BFSA 2OX5A 3BW9A 3V0WH 1CDYA 1FE8L 5DMIL 1A7QL 3PHSA 3Q5TA 4AIZA 1OCWL 1Q8MA 1HCVA 2F54A 2Z35B 5MEND 3UYPA 4R26L 4OBRA 2D03L 4LCWE 2DL2A 2FIKB 1OP5K 2DAVA 3ES6A 4WUKH 2XZAH 1MREH 5EOCL 1J05B 2EH7H 2RFXA 1FFNA 4LL9A 4Y5XB 5IMMA 3VI3F 1JYXA 3F7VB 2WWMC 3KPQA 4DVBA 3EOAA 5JIHA 1RIVH 5E1AA 3I2CH 5EBLA 5JUEL 2JJSC 3UDWC 4DVRH 5TE7L 1I1YA 5C0EB 5JW4Q 5T1DL 4UNUA 1X6NA 2HLAB 4HK0A 1FNEB 5ESAB 3OPZH 1E28B 1IGJA 1SHMA 2DBLL 1NLDL 4CMHC 3EIFA 2Q7YA 2P8PA 5J9PA 2E7LA 1TZGH 5FCUH 4FQ1H 3TNMB 4HIJA 2IMMA 4F7MB 2VMFA 3QEUB 4LCCC 1AP2A 4YHZL 1D5MB 4QRPA 4NJ9L 4AEHL 3I50L 4QGTA 3A0OA 4XMPL 2AK4B 3GI8L 4IRSA 1QFHA 4JREC 2AXGA 4XBEL 2FR4A 3RAJH 3VWJB 2ED9A 4R7NB 4NRYB 5HBBA 4MA1C 3IJSA 1VEOA 1TVBB 3VI4E 2DD8L 4HF5H 3WS6A 2APXA 1ORQA 3U7WH 3WNKA 4QRPB 1HINL 1EXUB 1CLCA 1WAAF 5I9QC 1JZ4A 4Q6IB 3IFOB 3PXJA 1JPGB 5DVLA 3UZQA 4RZCA 4EN3D 5L9DH 4MNGE 3PWJB 4ONOA 4PGEB 3T77B 1UXSB 3WKMH 4HT1H 4NN5B 3O11B 2GT9A 3Q6GL 4LAJH 5JPNA 1I4FB 4UZGA 3PXHA 1A7BA 1MRCH 3LEXB 4YXKL 1RUAL 3U9PH 3BPNC 5BS0B 1CFNB 3IU4L 2YUWA 3VXUA 1BWWA 1FV1B 4FXGA 1K4DA 1KN4L 2UY6A 2DICA 1J8KA 1KEGH 1QQDA 2LQRA 4DK6A 1T7ZA 2R0WL 3B4NA 3GKWH 3D5OF 3NABH 5DQDH 4M7JH 2HJLB 4MJIB 1IEHA 4M6AA 4JFPA 1D9KA 4LSTL 2R2HA 5GGSY 2QSQA 1XR9A 1AD9B 5CINL 4DN3H 3N1QC 3O4OB 1AO7A 1V3KA 1X4XA 3C6LB 2AJXL 1EVUA 4JLRA 1IJ9A 2UWEB 1KUMA 2VLRA 1CLOH 4MQTB 2QR0B 4X4YA 3T0VA 1CGVA 4TVPH 3ULSA 2FEDC 2NYYC 4K3DL 2R4RL 4OF8A 4OZIB 3KPNA 5ACLA 1UWEL 1IGMH 1O0VA 5EZLA 4G8GB 2ESVE 5ICYB 4G9FA 4LSQH 2FLRT 3MNZA 4PJXB 4WCYH 3WIIH 1EO8H 4HFUH 3SDXE 3DGCR 1MFNA 4Q2ZA 2DQDL 3CDFA 1YQVL 4S0TD 4NRXA 1CG9A 3DGGA 3P77A 3FQTB 2MPAH 3TPUA 5JHDD 4DUXA 3VFWA 1JHLL 1NCAH 2M8XA 4LSRL 2DI8A 3BDYL 1E4JA 4KY1L 2X1XR 2ADIB 3L3JA 1JGVH 1ZXQA 3CFIC 3TVMC 4F9PA 3KAAA 1NGPH 4E5XA 3KLSA 3FMGH 5D6DC 2VXQL 1ZTXL 4LCUA 4YEEA 1MAJA 3PNWA 5AAWA 6FABH 1B6UA 2VXSH 3MV7E 3QXAA 5JZ7C 2B5IB 2C26A 5BOPA 3MXVH 4QRSA 3IKCA 3DSNA 4FOMA 3PDOA 3RBSA 4HDIB 1OB1B 1CVSC 3QDME 3OWEA 3VFGL 4EN3A 3KWWA 3NN8B 5KVFH 1N26A 1JI1A 3V6FA 1S7UB 2VAJA 4PGDB 5JLZB 2HFFA 3WFHB 4TSBH 4NUGH 1XIWB 2ARJQ 1TVHB 1R5IB 1D9KC 4WFGE 3RZWA 2MNUA 5CINH 1BX2A 3WIHL 3FB5B 3H9SD 3CZJA 3VXRB 5EU3A 2XQBL 5C0BD 5JXEA 4HXAL 1XEDA 4O2FA 1I8MB 3LKNA 1U2HA 3SO3B 4U1KB 2YD3A 2ESVD 2F58H 4ONHA 3RZCC 3TBTB 2JB6B 3NCYP 2NY0D 1ETZB 3LKQA 4LLDB 5EPMA 4RIRB 3HB3D 1UT9A 1CLYH 2NXYC 2RIKA 5JW3H 1BLNA 1YZZA 5E8PA 1XH3B 3G5YB 5BVPL 4XP4L 4LVOB 3X14A 5FK9B 5JQ6L 3EZ8A 4P2CG 2F5BH 1AGFA 3B9KD 4PJHA 1MLBA 2MKWA 5I1AA 5I19L 1C5DB 1N8ZA 1KJ3L 5GRJL 3U0PA 3O4OC 1U95A 4C59B 1IKFH 4Y4FA 3HMXL 1ZT4B 5CIPA 1GC1H 4OD1H 1T7XA 5I1DB 4XNMA 5ALBH 4IMLA 1VPOH 3BQUA 2FEEI 4YO0A 3GUTB 1PYWB 5DMGC 1JV5A 2DLFH 1ODAA 1IEBA 4OJFH 2HTKC 1BM3H 2DRUA 3CPLB 3UJJL 1NAMA 3BW9B 1M4KA 5DD0L 1ZT4A 5CIPB 3ARFA 4NFCA 2XZQH 2VWEC 5SWQA 4HXBL 2AV1B 3PIQB 2Q76B 3TA3C 4F9LC 3INUH 2FYYA 1RSFA 1V3JA 3T3ME 2XQYK 5HD8C 4YDJA 4PYGA 5TE4H 3R4DA 1Q72L 2ADFH 3SE8L 3OKOA 2EEAA 3BPCB 1S7SA 1A4KB 5SWSD 2GY7B 2E9WA 4UI2A 1IC4L 4PLKC 4NKQB 1YN6A 4KJYB 3X11A 3K46A 5CBEB 4X6FB 4YHYB 4KQ4L 2FYYB 3DVNB 1A9BA 3BGMB 1JWUA 2AERT 4U1LB 5MEQA 5AZEH 5ICZA 5AG9A 4EUPH 3QUYA 3L1OL 3HI5L 3O4LA 2GUOA 4P4RB 1F3JB 1K8DA 4TSAH 3BMVA 4MA3B 1IGJB 5C0BB 3CC5B 4ZOCA 2GY5A 2R2BB 3AU1A 3MROA 1RZ7H 4DW2L 4L8SC 3V6OA 5A3IC 1T7VA 4HJGB 2E9JA 4XRCB 1CGUA 3IDJB 4RGNC 4TVPE 1QA9B 4MXWL 3MLWH 1OGAD 2ZSWB 2QADD 4FFZL 2P49B 3CDYA 4PV8B 4Y19B 1F90L 2F5AL 4G9FD 5CWSB 5J6HB 1W8NA 1JGEB 4DUVA 4QWWC 3V7AG 3QHZH 3DWTA 2ID5A 5D2LB 3RTQC 1D5BB 2K3TA 3G04B 5KVEL 3ZKNC 5DK3A 1OAUL 4NQVA 4JG1L 5FFLA 1QYGL 1QFWL 1LO0L 2GK0A 4WFFE 4OLZL 4G9FE 3O3BA 4UT7L 2I07A 4QHMA 1FSKC 3P30L 2AEWA 1J12A 2ZUYA 4N0RA 3P0YH 1CLYL 1WFNA 1DUYB 4E9LA 2KKQA 1H3GA 1KPVB 3UPCA 3DOSA 5HGBA 3IAQA 1WK0A 3RNKA 2AGJH 4QTHA 4ODWB 1A14L 1J1OL 1OOAA 2NNAA 3AS2A 2EDQA 3U4AA 5IBUB 1XGTB 4C56A 4L3ED 1UC6A 1IC4H 1QNZL 2NY3C 4YZFE 3QPXH 3BX7C 4KTEL 1MNUL 1K4DB 4WEBH 2VLKB 4L8DB 1YNLH 5FGRA 5CJ5A 3QDJE 1QSZA 5E03A 3JVGA 5DFTA 2AS5M 1E6OH 4HJGA 4JCMA 2CLVA 4LVNC 5BZDA 5EU7E 1OHQA 3O0RL 3D25A 2EH8H 1KNOB 4MDJB 2P4AB 3I3DA 2CK0L 4BFGA 4NKMA 1QUNA 3L5HA 5D7IB 2FZ3A 4XAKE 5KS9F 1UH4A 1PD6A 4PRNB 4XP5H 4HEME 3AC0A 3IDNB 1KCRH 1MCKA 2XN9B 1KFAH 2V5RA 1WIOA 1DN2A 4RMVA 3OKMA 4G9FB 3LKOB 2VDQH 1AHWA 4WW2C 1Z9OA 4JDTL 4EI5C 4R4FL 4U3HA 1P9MC 4MCZB 3SGEI 2VLMD 2LVEA 3TBSB 3H9HA 2DQDH 5I8EA 4I4WA 3ULVF 1P4LB 4KH2A 4M5ZL 1UM5H 2EDKA 1UXWA 2DQGH 3NAAH 4RQQB 3CVHB 4KK8C 1G9MH 4MZ3A 1EFXA 2DQCH 2FHFA 2WINA 3H3PH 3IXTA 1DBBL 2WWMD 4Y8DC 5FKAB 3WDHA 4I48B 1IKNA 5I1KL 3HZKB 3KPRB 1N3NA 1BZ9B 3GIZH 3BPLC 4Y5VC 1HYRC 1FFPB 4DEPC 5IG7B 5J1SC 4RAVA 2BXZA 4M02A 1I7TA 1KJ2A 3VJ6B 1WISA 3QZWB 4G8FB 5D1QB 1KCVH 4PJAB 2G75B 4G80A 3ZL4L 5FYKL 5IWLC 1JF1A 3CFBB 4ZD3L 2OL3B 1I8KA 3HZYA 4G8GD 1IM9D 5DJXA 5GJSH 4YHYC 2XRAL 2JE8A 3WFHA 4RAVB 2W92A 4K7PX 2CXGA 5ALCL 3OKNB 3IF1B 1ERNA 2YD2A 3VXMD 3EDEA 3U2SA 1YEIH 1F8TH 1TENA 1TQBB 3LHPL 3ZL4H 4Q58C 1BFVH 5JORA 4OSUL 3SBWC 4EI5D 3TM6A 1EEYB 5JHDB 3DSFH 3W9DA 3SCMC 5E6YA 2B1AH 1T03L 5DURB 4XNYH 5EBWA 4JZJA 5LGKA 1AKJA 4OIIL 5JW5A 2BNQA 1ZLUK 5DVNA 4P2RE 1UWXH 3MV9E 4XTRD 3HLAB 4JR9H 3GZKA 3C08H 3CVHA 1JMXA 2I25N 5FA3B 4D8PA 4EDWH 3GO1H 1NKRA 1RUQH 3O3DB 1I3RB 1CICD 4X9BA 1G6RB 1S7WB 2W0PA 4MNHA 5E4IA 5TQ0L 2X2YA 3BVNA 1N3NB 2PF6A 1WBYB 2OZ4A 4HAGA 3K8MA 1S9WB 1RK0A 2C3WA 5KSBF 5DJ6A 1F90H 2L0DA 4G6KL 4ETQA 3PL6C 4LLYB 4F7PB 4MAYA 2AJVL 3B83A 5FB8A 2Z8RA 3RVWD 2YZ1A 3QUZD 1J0KA 4WI9A 3ZHDA 1L4IA 1JZ7A 3TN0A 3FAWA 3S36L 1UZ6F 1DQDL 3HC4H 4LSUL 2OP4L 4HIJB 5DXWA 4BH8A 4QRTB 5TDOB 2OR9H 1G7HB 1MLCA 3TIDA 4KQ3L 3V6BR 3CSBA 3ZDZE 3JBG7 4JRYA 3DPBA 2EH8L 4LVOC 1KIUA 1HXYB 1IFHH 5E6ZA 2FH6A 5BS0E 2FECI 1IQWL 4ZOEA 2J5LB 5F9DC 5HXMA 4XGZB 4R4BA 3B9KB 4P49A 1BEYH 5CD5D 1KT2A 3MV01 4R8WL 1LO3H 1Q9OA 1OGTA 2WBJB 4P23A 4PJDE 5DLMH 3JZ7A 2VQUA 2IANA 3F62A 1CD9B 2HN7B 1G7IA 4KVCH 1XF5A 3MOAH 3O6KL 3DUUB 5T5NG 2GCYA 1P4IH 2HG5B 3VFNA 4RZCB 5ENWB 3LMJL 3G5VA 3EOAB 4KFZC 5E2UL 4LBEA 1XCTB 3TYGL 1HINH 1GRWA 5D7LD 4YHMH 4OT1L 1AY1L 4P2RD 4XPBH 1G84A 3STLA 2EE6A 3VD4A 2ATPA 1WZKA 3QULA 4XMKH 5DS8B 2X7LB 5I0DA 1GGTA 3KVQA 3LQAC 3SE4A 3ZMRA 3X13B 1CCZA 5CGMA 3FAXA 3PGDB 2C7UA 3FRPA 5DR5H 1CE1H 5IB3A 4RFOH 5D2LA 5C0NC 4X7FC 4HS6B 2OQJA 1MVUA 1MIML 1HHGA 5ILTH 2J6EL 1T1WB 4PD4K 1SM3H 1I3GH 1FAKT 2L7JA 2HRLA 1WIPA 2F19L 4ZMAT 1OAQH 3WD5H 2ZCLH 4MJ5A 1FJ1A 4KKNA 2X40A 4G3YH 2DBLH 4HIIB 4MNQE 3PDGA 3BWUC 4M7LL 1TETH 3HUJA 3U1SL 3P40A 4WI6A 5HD8D 4C54A 3TV3L 5IIEB 4X9IA 1TITA 4DW2H 5I8CB 3NGBB 1RV6X 1HQ4B 2X4SA 4P23D 4Y2DC 3C60D 2IFGA 3H9ZA 1TCMA 3QQ9C 2X4RA 4V1DB 5GGUB 4TSAL 3JUYA 2PO6D 3QNYA 2IG2H 4U7KA 3HUJB 4TULH 5FO8A 1ZHLB 3D0LA 4CDHA 4KK8D 3RA7L 1AQKL 2GJJA 3DHJA 4ZQKA 3LD8C 3O41B 1HHKA 1AJ7H 3DYOA 5J56B 1AO7E 3MRHA 3EOTL 3AS1A 4E41D 3BPNB 3HS0B 4XCFL 5C08D 4HULB 2XG4A 4X8XA 5FCSH 4JRXA 1LD9B 3EZJB 4YZFF 4UAOC 2VKWA 2FATL 4FQPA 3KPTA 5EFIB 1OGAA 3VGAB 1G9NL 2Z4QB 1F3RB 1JPTL 5I1LA 1ZVSA 4JM2C 4QHKI 3O41A 1MCPL 4LEOA 4EVNB 5I1EL 2DLGA 5D1ZB 4CN6A 3QI9A 3V8CA 4NOFA 2D0GA 2DWDB 3FB8A 1C08B 3L3OB 5GIRA 1Z0NA 3HAEG 2IFFH 4U7MA 1CT8A 1KN2L 1ORQB 4Q6IC 5I9QB 2JJVA 1INQB 4KGJA 4PD4J 1EEZB 3U9UB 4BFIB 4WUUA 5EN2B 3GSNH 3QZWG 4TTGA 1ZGLA 3FB7A 4GXUM 2AJ3A 5F89B 1EO7A 5KOMC 3GHEH 2AXFB 2Y06L 5IQ9A 3HMXH 5HPMA 5C0AA 2D7TL 4U6XB 1I7RB 4AQOA 2EKSB 4J7RA 4PFEA 1NQBA 2JLLA 3WD5L 3SCMD 1CVRA 1T1XB 1MCCA 3IYLW 2EXWD 1FCGA 3MLYL 5L2KE 4Z77A 5HHOE 1W72L 5C0JB 4YBLB 4JFFD 4P5MB 3NTCH 1ZHKB 1IGTB 3UBXB 3ULVE 3CH8A 4KZEL 2R2EB 2VABB 2EE9A 5DD1H 1L9MA 3LKPA 5DDHA 3VFOB 5L2JB 1XGPA 1CFVH 3AM8A 3IFPB 4RISH 2VH5H 3BJLA 1QSFD 4PJFB 4RAUA 1NEZB 4PJHB 5FUZL 3P9LB 1CICC 1A0QH 2H3NB 2R2HB 1PQZA 1SJHB 3DLQR 2IALB 1HEZB 4PGCB 4GAGH 4NNPH 3BWAA 4P2OA 2QKIB 2E6JA 2ICWI 2JB5H 2VLRB 3GK8L 4NYLA 3LRSB 2F53B 3WJLA 2I9LB 4CU8A 4QRUA 1EHLH 1MCEA 3TC9A 4OF7A 3BEWA 3Q2CA 4XCNA 4C83B 2AJUL 4LSQL 2NX5E 4YHKH 3FCTA 4P4KD 5JMRA 5IB5A 4H88H 1S7TB 4UT9H 2FX7H 3QRGL 3UTZA 1FAIL 3OZ9H 3VXSE 5HVFB 1D5XA 5JOPE 1EUUA 1WIUA 3MOBL 1TJHH 2GSGB 1F4WL 4K23L 2B4CH 1K8IB 1YNKH 3FQNB 2EECA 1U0QA 2V6HA 1I3RA 4J3UA 4LFHD 5C0RH 4PJ9D 3QNXA 4OLUH 3V95A 2AJSL 2EO9A 2ZUQC 4B7IA 3IETB 1T20B 3W2DL 4NM4L 3FOMB 4ZFZA 4YFLF 5MENB 3MRCB 3S88H 1NBQA 4ETQB 1UVQB 4PLKD 3RY6C 3BIBX 5C70A 1AR1D 5ICXB 3TYFB 3QJFB 4ESKA 1LDSA 5GISL 4UTBL 4ODTH 2IQAA 3ZHLA 5IGXL 1X6LA 4BH8B 1TZGL 1MELA 5FCUL 5TDOA 3BZDA 3CUPA 3LY6A 2ITCB 3GSQA 5DYOB 5MENA 5DJ8B 4J1UA 3VXQA 1HCFX 4U31A 4WY7H 2BSRA 2BVOB 5EBGA 1GOGA 2CIIB 3WO4B 2DM7A 5DTFA 4D0BA 1YNKL 3BIKA 3BP6A 2W0KA 2B1AL 4Y16B 5GGSB 2VLKE 4C56E 4B53A 3VCLB 3Q0HA 4DZBB 3WJJC 4A6YL 5A2KH 5TJWK 1CICB 2P48B 2DD8H 1NEUA 1R0AH 3HUJE 3PJSB 1IC5L 2F53D 3C2SA 2BHZA 4YH6A 3UJIH 3V6OE 1ADQL 2W91A 4LAQH 3L7FB 5DUBA 1BJ1J 2AJUH 2BVEA 4LRNL 5GRZA 4HUUA 1JHKH 2DQJL 1ITBB 1CD1B 3VFUB 4DEPB 1EH9A 4HH9A 1HZHL 3U7YH 5E9DA 1NDMA 4IDJL 3CLEL 5C09E 4LLMA 4QNPF 4GMSH 1UJ3B 4LQFH 1HXMA 3D39A 5HHPA 5C7XL 3IVKB 1A47A 3SDCB 3ZYJA 3BSZH 2DQTH 4M00A 2MMXA 1BOGB 2ENSA 3K4DA 2AXJA 3LS4L 4L29A 3ARBB 4PJIB 3MLUL 4NQXB 4JFEA 3RVXD 4QEGA 4UQ3A 3O0RH 1NFDA 4OBSA 4OZGE 4UUJB 1N2RB 5KSVA 5EIIA 4NFBA 2X9WA 1RMFH 5DUMH 2VNCA 2WW8A 5K9OA 5FF6A 4CJ1A 1LEIA 2FJHA 4QHNB 4G8IB 1KCKA 4JEGB 2XKSA 3HE6D 3O9WC 4XPGL 1D6EB 4Q6YA 3MLXH 2FSEB 4KHXL 5GGRY 4NJAL 2VE6B 4TOYL 5IT2H 3DETD 1MCNA 2R0ZL 2Q8BH 4PTTB 3VWKB 3R06A 5AD0A 2DI9A 1RZKH 4ELKA 2P8MB 2I26N 3RWCB 1OAXH 2YWYA 4RFNC 1C5CH 1MHHB 1LE5B 2ED7A 3TFKC 1NCDL 2KQNA 1H8NA 4FABL 1DUYA 4DVRL 5SWSA 3EYFB 5INCA 2A6DB 2CRMA 3F12A 2WP3O 3F7VA 5ID1A 4BFBD 5J06A 3MBED 1ZLSH 4DK3A 1AIFB 2H32H 2I5YL 2MJWA 4HZAA 5E24E 1KB5B 4YHNA 4H20L 4XAWL 3TCLA 3WFCL 2Y7QB 4MJIE 2G2RA 1L7IL 4APQB 1K9TA 1I1AD 1I85A 4OZFG 1FP5A 1CIDA 3DO3A 4N0UE 3GSUB 4JDVB 4WHYH 2BCKB 5CSZB 4NQCA 2XRAH 1IAKA 4X6CB 3KNBA 3I6LE 2BSED 5E94A 4YHIB 4PY8I 1K3ZA 1SMOA 3D87B 3SJVA 3G9VA 4LIQH 3W2DH 3OJDB 3WFEL 1UZ8A 5DHVA 3QPQC 1A64A 4PJ9C 3W81A 1MEXL 1AP2B 3ZE0F 1GZQB 1RURH 1RFDL 4NQVB 4PJIE 3GSOB 4KTYA 1KNOA 4L3AA 2Y5TA 3MV8B 5IW6A 4JM4L 1LHZA 1MI5D 1T2XA 3BOVA 4M93C 4RMSA 2VISB 3S37H 2IG2L 3DUHA 4NRYA 1JPFA 1YYML 5C0AB 1CFTB 3MV9A 1QSFA 4NFDA 1CD8A 3NIFF 5E00A 4O02H 2WAHA 4G7YL 1CGYA 8FABB 1YEDA 1BZ7A 3IS1X 3O6FC 3LIZH 1NCUA 4O2CB 3AROA 2DMBA 1FFOB 1MFEL 5ADPL 1XGTA 3EKCA 4NDMA 4N0CC 1FIEA 5C0RL 3QQ9D 3GI9L 5DRXB 1JZ6A 4JVWA 1J1OH 3CAFA 1F4XL 2GITA 4X7TB 3UBXA 4HFWB 4G7YH 5HYQB 3FFDA 1MCSA 4JN1L 4O2EA 3D3VE 1AIFA 4PTUB 2CLZA 5I17A 5GGTA 4XBGA 1A0QL 1CE1L 4YAQB 5CGYC 5D7KE 5ABDE 2APBA 1JHTA 2V7HB 1ED3A 2ARWA 1F11B 1JPTH 5CSZA 3ULUC 3BWAB 4P2OB 4QRRD 4HFWA 3RWFA 3UX9B 2H9GA 1PEZA 3VFWB 2EIZB 1F3DJ 2W07A 1S3KH 4NRZA 3L3KB 2YXFA 2NXYD 1OF2A 5ERWA 4YXHH 5IHBA 4JPWH 4N8VG 4WEUD 3HR5A 2FDBP 3TVMD 4WW1A 1FO0A 4HQQH 1I1FA 1PKQA 4F8TA 3G9AB 1G7PB 1RZKL 4M1GL 4H8WH 2F5BL 3EBAA 1SEQL 5F9JA 5GS3A 4PJ8D 5GS0H 5DRZB 3U7AA 5DSCB 3PP3H 5T5NF 1JPFB 3FHAA 2JIXA 5BXFB 1Q9LB 4YDIL 3PL6A 3QEHA 3WHE0 1BEYL 2P5WD 4M5YH 1NH6A 4OIAA 1A6UL 1BZ7B 1ZWIB 3OX8B 1A7NH 3MV8D 4KZDL 2RQ8A 5C6PB 1MI5B 1XGYH 4XH2B 4Y4FB 4DCQB 3SE3C 2BOCB 4PB9L 1SVZA 1XF1A 1QRNB 3ECBB 1FFOA 3I3EA 1KGCD 4QHLB 3RWDB 3N85H 1M7XA 1NAKL 2W0FA 3FB5A 2BNQB 2G60H 1V7NH 5CSBA 3PL6B 3QEHB 4WENB 4DGVH 2WQRA 2H2SC 4K07A 3BHBA 2ZUWA 2AK1L 4Z7NE 2VLRD 3X12B 1MCRA 5T1KB 3QDMA 1MQKL 4OGXL 4QXWA 4PJCB 3S97C 3CMOL 7FABH 1A6PA 3HE7D 1U3JA 2P8PB 5J9PB 1MWAB 5TE4L 4MD5A 1AXSB 3LKSA 1BVZA 4IRZL 2QJDA 2VLRE 5HI4D 2IADB 4MJ6B 4Y2DB 3PNWB 3QA3B 3I75A 2V5YA 3S7GA 2LV4A 2VERN 2EIZA 3SPVB 4DGYL 4IDLA 5FM4A 5JW3L 3UPRB 4X4ZA 1EZVY 4N8CH 3EFDH 4OIBA 1KC5L 1IGCH 3MFGB 3STZA 5ITFA 2VZVA 1EHXA 4R4ND 3D2UA 4IMLB 4L4JA 4ZUSB 4JRYB 2XG5A 4M43H 5IOPA 4JY5H 2HA1A 5FO9B 4RGMC 1FVEA 3QCUH 3LCYA 3DIFB 3V5DA 4PRPB 1FJ1B 5FOJA 2O61B 1LK3L 3L9RA 4LRNH 4HFUL 1BD2E 4R4BB 2EDFA 4FTVA 4D0CB 2JCCF 3BH8B 1IC1A 3LKNB 5EORL 1CK0H 1QSEA 3QH3A 5LCVL 1VFBB 1I3VA 4NJAH 3WHE1 1A5FL 1MFAH 4HLZG 4PJ8B 3KXFE 5J13B 3TH3T 2Z91B 3C8KA 2IPKB 5BJTB 3BVNB 3NA9H 4G7VL 5D1QC 3S88L 1UWGH 3B2UC 3MCKB 3ZKXC 5B4MD 3MRKB 4PS4H 2A77H 5L8JB 4KMQA 1MF2L 2YUZA 3OKEB 2XV6B 3PG2A 1WTGT 2FHCA 4RWYL 5FB8B 1JWUB 2IBZX 2W1NA 5FYJH 3C5ZA 2ADGB 4TQEH 4LU5L 5T1MA 1HHIB 4EJ1C 4TPRL 4PJEE 3MRRB 5F1IA 3BQUB 2WSKA 3QXVA 3REVA 4HWEL 4QXUH 1P7QB 4S2SB 3MBEA 4ERSH 2DDQL 1P53A 1OP5H 3NZHL 1AGDA 3V4PH 3GMMB 1MJJA 1WFTA 4JLRB 3QUZA 3FQUA 2ARJA 4XPTL 5D2NE 4YK4B 1OSZB 1WZMA 5IF0B 2MCG1 1NMAH 3GGWA 3EO9L 3HG1B 4M1CD 5GGVL 4OLYH 4WW2B 2EYSB 3O8XC 3WEXB 2YBRB 1BVLB 1LE9A 2VN4A 1LP9E 3GSVA 1MHCA 4XMLH 4XP9H 1DQQA 3DARA 4W6YB 2LVCA 3V4PL 1UEYA 5DO2D 1BQSA 3CFJA 5E2VH 2X89A 5D1XD 4PV9A 2VDQL 1N0XH 1R3KA 1LO4L 4QY8A 1FDLL 5M94B 1MFBL 3HPLB 4LU5H 1V3LA 2ZUQB 5GZND 5KZCD 3GSVB 5KW9L 1U3ZA 4XZUA 2DLTA 3UTSA 3D18B 5KN5A 3J7HA 5F3HB 1N59A 1DQQB 4PPTA 4BQ8A 2IQ9H 3D25B 4GUPB 1Y18A 4YFDB 1J0JA 1K8DB 5TDPB 2AJYL 4ZAKD 1P4BH 2X41A 5FYLH 4G6JL 1JI2A 3ARSA 1D5ZA 4NN5C 1EERB 4I5BA 4WO4D 5IBLC 5ISZB 3NCJL 3TO4A 2F74B 4J8RB 4UBDD 5HGAA 3WXVL 4LP4A 1D3CA 2R1XA 3BEVA 3IAPA 3RWJA 4NOBA 3PE9A 4CN4A 2DKUA 4P57A 1GIGH 1YYLH 1KCUL 4F58H 5B38B 2Z31D 5TDPA 2XNAB 2X9XA 2VXSL 4GRLC 3RVUD 3RGHA 3KS0H 1BPVA 4PRIA 1QBMH 3QAZC 5E99L 1HQRB 5B21A 1FZKA 1R24A 4KK9D 2CO7B 4X0KB 4OQTL 4G6AC 5SWZA 4HGKC 1TQBC 1NGWA 3E8UH 5JA8B 1J0YA 4JG0H 3RHWK 4GKSB 2OMBA 2UWEE 4S1DD 3BDYH 3MLTB 4RQQA 4WFFD 5CJXC 3SKMB 3UC0L 1Q94B 1U8NB 3EFDL 3V2AR 5HYIA 1WCQA 1QHOA 3DRQA 1MHCB 4ONFH 4MDIA 5BRZE 3K2MC 4U0QB 4G6ML 4FZEH 4EDXA 3LSOA 1XGRA 5IG7A 3QDGB 4I0PD 4JFXA 4I18C 2ZCKL 2MQCA 4U1NA 4O2EB 5DHYB 3BRGC 5GJSL 5C8JB 3VXMB 4F80A 1J8HA 3JV5A 3H8NA 4NJ9H 5IFJA 5ETUB 5C6TL 1R5VA 1M7DB 4GAYB 2X4UA 3RWIA 1NBYB 2OSLA 4EI5B 3QIUD 4Z7QF 4UNVA 3EDJA 5KJRH 3OG4B 4ZFOL 1P4LA 4N0UB 4LF3A 3C8DA 4YXLL 3VXTA 3W9EA 3T4AB 1CL7I 3QFJD 3MRLB 3MR9A 5L88L 1VERA 3IDYC 2VH5L 4ODTL 5C0AD 4L8CB 5EO1A 3BN9C 4Y5YC 3PABB 2A77L 4JM2D 4KV5E 1P9MA 3VRIB 4P57B 3KPOA 1JIBA 1R5WB 3CDGA 1P7HL 4J6RL 3U9UA 4LKXB 3GBMH 1WSST 2IQAB 2C3VB 2VYRE 2YR3A 3T3PE 1NC4B 1ZHBA 1IEAB 5D5MB 5C08E 5JNYA 4JKLA 4NPYA 4I3SH 2DKMA 2BRRH 4AK1A 5E08H 4QF1A 5E56A 1MHEB 3HAEB 3CVIH 5D7SH 2CUHA 1B4RA 2I9TB 1AE6H 5D4QA 3VG0L 1YN6B 4DCQA 4AM0B 3REWA 5EOCJ 2HVKB 1S7TA 3PWPB 1JNJA 5L9DL 1A9BB 3BGMA 3DMMC 4UDTB 4YLQT 4F15B 1GVIA 4F57L 4WFGD 4FP8H 3IS0X 5IHUL 1ZVHA 4QRRA 2P8LB 4DTGL 4BA8A 4YDIH 3TIEA 5D9SB 2RFXB 1WWAX 4Y5XA 4KRNA 4L9LB 1G1CA 3K74B 2NXYB 2ZUSA 5BRZB 1Q0XL 2NY3B 5FUCE 1H5BC 5D5ME 3FN3A 4KKAD 4NN6B 3RWIB 3PWPA 4OQ1A 2PTUA 1BIIA 2CK2A 2BSTA 4PJEA 4U49A 3T0AA 1KYOK 2CDGA 4WW2F 3VFMA 2PXYB 4NYLB 1B0RA 4KRMB 5HTSA 5F44A 5ESQB 4HEPG 1Q0XH 1FO0L 1VFAB 3MRFB 2LU4A 4CAGA 1FHGA 1FSKB 4KU1A 3KPQB 3STZB 2A74A 5E8DH 1A14H 3D69A 4Y4FD 4F57H 2ZOKA 4HK3J 5IB5B 2PXYA 3QFJB 5JIIA 4G6AD 1AY1H 3PGCA 1W0VB 2B2XH 1NFIB 2ICWJ 1DEEA 3OAZH 4QHMB 3P30H 1FNHA 1JF6A 4IOFC 4P2OC 4Z7WA 4H26B 2I9TA 4WI8A 1QFWH 5IMMB 4WI3A 1RFDH 1P5VA 4LSSL 4PRDB 4AIXA 1NC4D 1T83C 1MCJA 1RZ8A 5CD3B 2ATPB 4WUKL 2A1WH 3LN5B 4LMQE 4FXKB 4W6XB 5IESH 1J88A 4HX1A 4HUUB 4AH2B 4QRPE 1JFQL 2IAMA 3MZTA 2QADC 4YNYB 3ZTJH 4KXZH 3RDTB 2GT9B 2GEEA 3S37L 4M3JA 1MPAL 2DF3A 4AMKH 2A83A 3FO0H 1NCCL 2IANB 4X6DE 3VFTB 1J87A 4MXQD 5DJ0A 2NY4D 1JZ8A 3ZTNL 2AXHA 1YEGH 1S9WA 2MSPA 1MY5A 3GKZA 4G42B 1J1XL 3ESUF 1VPOL 4N68A 3TF7C 1KJ2L 1KULA 5C1MB 3QUZC 1U6AH 4WI5A 2IAMB 5I16B 1IAKB 2BNUA 1N6QH 5DTFB 3FQRA 3BIAX 3RUGE 1GOFA 1H3TA 2VRAA 4LDOB 5B39G 5K9KB 3IGAA 5DS8A 3FONA 5T3ZD 3ZO0A 5E6IC 4KHTL 5M7QA 4NO2B 5TDNB 2Y5TB 5J6GB 4LVHC 5MERA 1GXEA 1INDH 5IB1B 2UZYB 4FXGB 3QWOA 2UWEA 2EZ0D 4Q74A 3VFRB 3SHSA 2LABA 3ULSB 1HSBB 2B1HH 2VUYA 4PTTA 4XTRC 3VWKA 3B9KA 3GBNH 3TJEH 1ONQA 3TV3H 4NP4H 3FO1A 1QBBA 4JFPB 2WMPA 2F8OA 5DC4B 5BW7A 2PW1A 3P4OB 1RY7B 4HIIA 1DLFL 3W11D 4LHUD 4PRHB 3ALPA 2HJFA 2HFGH 2DQTL 2OP4H 3OR7A 1I8IB 2R1YA 1KV3A 4U1IA 4HMDA 4GRWF 5EC2A 4X9GA 3HNVL 2IGFH 5I6XC 2NY5C 4NZDA 1MFDH 1X5JA 4PY8J 5CMAB 4ELMA 1QRKA 1UB5A 3LH2L 2LAAA 1F5WA 1KIQB 5I19H 4POZC 3T1FA 4D9QE 4P5KB 4JO1L 5E8NB 3T0EA 2YRPA 3EDFA 4MLSA 3SKOB 2YZ8A 4LPUA 5CEXB 5IHLB 4GJTB 2IAND 4FXLA 3ZHKA 1CTNA 2IANE 4J23A 4HWBL 4NSKA 35C8L 5C0CA 3QUMB 1MCLA 1U8JB 2NY2C 4Z7UF 2Z4QA 3PGFL 2XN9E 4GKNA 2KL6A 4W4NA 3RWHB 5TGBA 3SE9H 2QADB 3CFKA 2UY7A 4QCIA 3ZKQD 4KRPD 1IL1A 2DWEA 5DWUL 3QR2A 1UM5L 4NKDB 4PGJA 1NMAL 5L2JA 3SDCC 4LAQL 5HI4C 3L5XL 1PGRB 4X4ME 1PG7W 4TRPH 1FGVL 3AXLB 4J4PC 1MJ7L 4LLVA 3OG6B 5J1AA 4LDEB 3HE7C 5DEGA 4OD3H 5D2NC 3UYRH 4KPHH 5LBSL 5TPWH 1F02I 2N1KA 4Z7VF 4RGOL 3B9KC 3QEQA 2HJKB 3LV3A 2VL4A 3U4BL 5IM7A 4NO0D 5DVOA 3WL9A 1TNMA 5FYJL 4MJIA 1RJYB 4LLVB 5HY9A 1TPXC 4IHOA 3D3VD 3O9WD 1VKXA 1CFQB 3RWGA 4PRHE 3NN8A 1KJMA 2CR6A 3NA9L 2WANA 1OM3L 2A6KB 4TTDC 4GMSL 2QR0A 5SV4A 4I1NB 4W4OC 4PGDA 5JLZA 3UTZB 1MFAL 3T0BA 4OZGF 4GBXA 1D9KD 4HPOL 5DRWB 1FZJA 3OKLB 5E00B 4DJMA 4P4KA 2BZDA 3KWWB 4FMKA 4IHOB 2CPCA 2PYEA 2VLKD 3S34L 4AQ1B 1GZPB 3O3EB 3QQ3B 4XNZB 5FHAL 2YA2A 4YHLH 1LO5A 4FZEL 5IB2B 4NM8H 3QG6B 5EUOA 4XB8A 1BQLH 3F7YA 5IVXF 5IVXB 3D9AH 4L3EE 4ERSL 5GZOC 4OZFB 1B0WA 2P24A 3CCHB 5DHXB 2GTWB 5D9SA 3DETC 5KVMC 1OD9A 4C58B 5DMIH 4XNXL 4MWFA 4Q9RL 4GH7B 4ZUVB 1J10A 2JCCA 2F54E 3O6LH 5AWNL 5GJTL 3VG9B 1MWAL 4FTVB 4YDKH 5JTWA 1J8HD 4JY6A 1RQ5A 2A6JB 4I3GA 4BQBA 2CXKA 3MLZH 4KRPB 1QEWB 1U8HB 1KCUH 4NNYB 4I13B 4N5ED 5EU4B 4HPOH 2GSGA 4GXVH 4XMPH 4LLQB 4TUJA 4GG6E 5F1NB 4JFDA 2XWTA 5C0IA 4Z78A 4PJAE 3RVXC 4U1HA 1LP9B 4M1DH 4XP1H 1C5BL 2Q86A 5GZOD 3FL7A 3IETA 1FLTX 2D31A 4XNQB 4XVJL 3SCMA 3C5ZB 1FN4A 4LPWA 5DWUH 5I30L 3I84A 4H0IA 1KJMB 4UINL 3VXUE 3KPRE 4HKBA 4S1QH 4HMCA 4PJDB 3PP3K 2NZIA 5EA0H 5I2IB 1MF2H 5KW9H 2ATKA 3IDGA 3ZKMC 3JXAA 4X7EC 3VXNA 2DOCA 5IJKA 5FECB 3HRZB 3QHFL 4YDJB 4NWUL 5C86A 1DBBH 3D3VB 3O9WB 2OJEB 1J1PH 2R0WH 4PJIF 1LO4H 4W6WB 4E42A 5LBSH 5TPWL 5B4MC 3A6BL 1DN0B 5DT1H 1JGUL 3U46A 2NY7H 1GGBH 2OMNA 1VADA 2J8UE 2GYSA 4YXKH 3IDXH 4C55A 4JB9H 1UM4L 3OJMB 1QFOA 4LPVA 1UACL 3X11B 1RK1A 2PXYD 1T22B 4Y5XC 2R4SL 1F4YL 1DTUA 4UU9A 1AFVL 2EIEA 5CZVL 1UYWL 5L8KB 2H26B 4MD5B 5CBAA 1YA5A 3MRHB 2MCPH 2R39A 5MENE 2VAAA 5GRXG 4FRWA 4XBPA 3QWRA 2CKBH 2HT2D 1YEGL 3CX2A 4WO4A 4YO0B 3GUTA 1AQKH 3KR3L 2QSCH 3LDBB 5C2BL 1C1EL 3Q1SL 5HHXL 1S9KC 1DFBL 1S7VB 3VFPA 2NW3B 1RUKL 2WWKT 2ZNWA 3BYTA 3VH8B 1JZ5A 5F88B 3RIAF 3QO1A 5I1IL 4PB9H 3SGKC 1L0QA 5FYJU 1E6OL 3QDJB 3SDDA 4IOIB 4ZUWA 5KTEL 3G04A 2FATH 4PV8A 1CQKA 2V5SA 4Y19A 4BH7A 4ZDHB 3TA3A 4F9LA 5EB9A 1LQSR 2J4WH 4Y0GA 1J8HE 4ELMF 5GS1A 1K6QL 5IVXE 3F8UB 1TTFA 2QQLL 2VDML 1OW0C 3SDXA 3WO4C 1PZ5B 3VH8A 4OGYH 2R1WB 5E08L 4OI9A 3IDXL 4L8DA 4X6FA 2OLDA 4P9MH 3AAZA 3RDTD 3QRFM 1Q72H 5CEYB 2F53E 1VESA 4ODXB 1YMMD 4M61A 4YXHL 3ZKND 3U46B 4PLOB 4J6RH 4U6VH 5CJBA 4OLWH 4P46C 3P0YL 4IOSD 2NR6C 1KENL 1QOKA 4V2BA 1A7RH 3UAJD 2X09A 1IE5A 4HXAH 4A6YB 4OUOA 5D8JL 3RNKB 1EFQA 1ZTXH 3PWUA 5I1IH 2ZSVA 3NFSH 4XP6L 1FC1A 4XXDA 5J7CC 5FDWA 3QEGH 1Q1JH 4PGZA 1XF3B 1K5NB 1NMCB 4UU9B 5EZIL 1DFBH 3TZVD 4QHKJ 5D2LE 3H9SE 5FEBA 2M1KA 4ZXBC 3M17B 3LDBC 1G6VK 3DROB 4Z76B 4YHML 3MGOB 4PRIE 1OTTC 1FNLA 1OPGH 2RAMA 4XBPB 1KTDB 1U2CA 2RCSH 5KSAD 4NKIL 1A1MA 4PJXF 3VXSB 4RBPH 3C5SB 1RVFL 5JHLL 1H8OA 4Z7VA 4KKBC 5FM8A 5B8CA 1PEWA 3DNKA 4P3WA 5IEHA 4HPYL 4N0FB 3L5WA 4X5XB 5JOPD 4H25B 3HMWH 4MB4A 3MJ9H 1EGJA 3OMZA 4X6CA 3PWLA 4OD2A 1JGUH 4NBXB 5FYJE 2NZ9D 3VMOA 4B5EA 1IFHL 3S4SB 3SGEH 5B3NA 2B7DT 3S5LB 3QIBC 2XWBA 4Y2OA 1RJLB 2GITB 1EO5A 3ARGA 4UOW1 5T3XH 3RKDD 1FBIL 1QFWI 4RMUA 2PTTA 5K9QI 3MLTA 4XCCH 3GSOA 3O2DH 4M7ZC 2XXMB 1WAAE 4NHCH 4ELKB 3DTXA 4OSUH 2Y25A 3GNMH 4F33A 5CILL 4NWTL 1GC1C 3ARDD 3TVMB 3L3GB 4MAYD 2CUMA 4NUGL 3S34H 3U0TB 3GKWL 4ZSOE 2BHUA 1WICA 3L5JA 1AQDB 3BKYH 3PWUB 3DTXB 2F54D 3NCJH 4PRAB 4J8RA 1KB5A 4CVXA 4YHNB 4GXVL 4PRBA 4RGMB 3THMH 3W5NA 3NIDF 2FBJL 5JORB 3GSWB 2G2RB 4MHHG 5E2WH 5JHDE 4YC2C 4WIQA 5SX5H 3KDMA 4DN3L 3DUSB 4P5TC 4GQPH 4LLWB 5SWZD 5H2BA 3IFNH 5F9JB 4XWGH 5JR1H 4D0DA 3QB7C 4NT6A 1QSFE 3CSYA 1HYSC 1P7KB 1RHFA 2CDFA 2PCPA 3U4BH 1GPOH 4G5ZL 4MNGB 4O4YL 5B8CB 2XTJE 4LLYA 1GHFH 4IOFD 4NUJB 3KLDA 2ILLA 5ESQA 4X8JA 4QYOB 2Y9RT 2C3XA 3QFDB 5EUKB 5SWSE 1U8QB 2BNQE 5IT2L 1MY7A 2P5WA 1S7WA 4ONFL 4MMZC 3MRBA 1YEIL 1QRNE 3BFOA 3MLXL 3VD9A 2J6EA 1JZ2A 1HI6B 1H3WM 2J8UA 3O4LE 4J3SA 4Y2DD 3O2WH 4XI5C 2FHBA 4KK5D 3ZDYE 1MHEA 3HAEA 2ORBH 1DANT 2EZ0C 4JAMA 2PR4H 1RJCA 2GFBA 4K3DH 3F5WB 2BY2A 2EC9T 1PKOA 3IJHA 5CS7A 5EBWB 3MRBB 5JOFB 2HAZA 4LGSB 5A43C 1EEUA 4K71B 4QRTA 2CKNA 2YD4A 1KIPA 2OR7A 2JJTA 3K3QA 1GGUA 5DQJB 3K4ZA 2DQUH 1QTYT 2R9HD 3OAYK 2WUCL 1D7FA 4QXGH 1CL7L 4D8PB 3SDCA 4G8EB 5HHOD 3RUGA 3MRJA 1I3UA 4ISVA 4BELD 4P0DA 1ZGLM 2P47B 4UIKL 2D4DA 4MAYB 1X5ZA 5GHWH 1HH9B 3CFBA 1BLNB 3G08A 2D31B 4P48A 3SCMB 5EBLB 1R3HA 5K9OB 5DJXB 1VA9A 3P73A 2K7PA 4MZ2A 4GKZB 4P2QB 1A2YA 2HVJB 2BVPA 3BZEA 1EPFA 2F54B 2Z35A 1MJ8L 4OV5B 2DM2A 3GNML 4G8EA 1XGUB 4HWNA 4HDIA 2M26A 3DXAD 5IKCA 4OLVH 3T0EC 1NBZA 1ORSA 1SY6H 5KJRL 1QLEL 4R3SA 1I1AA 3D9AL 1XIWA 5FXCH 4FQXA 1DQMH 2AABH 3GSRA 4ZODA 3SPVA 1SEBA 3O6FB 2DB8A 1F97A 1YPZB 2DL9A 4GMTH 4I2XB 4TN9A 1LO0H 2AXGB 4L9DA 4ZSOB 4P5TA 4PJGB 3B9AA 4OCSH 5TE6L 2QSVA 2GSIA 1FVCA 3BPLB 3BGFB 1ZWIA 4X6DA 2K9UA 4LOUD 3S3SA 5D7IF 1IAMA 5SX4I 4OLXH 1AO7D 3OHXB 5DJAA 4RMTA 4WV1A 4HS8H 2FJGB 5K9QG 2D03H 1H3XA 3FO9A 3BRFA 3N1GC 3MRRA 4JFHD 3W0WA 3HHRB 1DBKH 5D7JD 3NPZB 1J0ZA 4HWUA 1CE6B 4OCRL 3PQYD 1G6RH 4LBEB 2OJZH 1TJIH 4TUOA 2BVUA 1BZQK 2X05A 2G5RA 4LPTA 5HVWA 2AEIT 4ZS6D 5KS9A 2X4TA 4HJJL 4I2XE 3ZTNH 5BCAA 4HS6A 5DD1L 4AEIL 1GAFH 1QFWM 3QXDA 3RNQA 1KPUA 1N0XL 1AI1L 2JF1A 43CAB 1KB9K 2L4OA 3OZ9L 4PJ9B 1RUPH 4J3XA 2NY6C 5I1KH 3OBAA 3RX5A 3QIUA 3OKEA 3FFCB 2DYPD 1DLHB 2YEZB 4NZRL 2IPTH 1DBML 5JA9A 2VSDA 1F4HA 4X7SL 3T04D 2R15A 5K9JH 3G5XA 5IV2A 5E4EC 4FZ8L 1UXSA 1LK3H 1WAAA 2AJSH 4GRWH 2XZAL 2JJTC 1M7IA 1N0LA 3RGVC 3P4MB 2J4WL 4XVTH 4KDVA 4A6YH 2FCBA 1U92B 1URLA 1FDLH 1UKSA 1AC6A 1SEBB 5DJDA 4F3FA 1DVFA 3ZTJG 1WFOA 3HA0A 3K2UH 4K7FB 4X7DC 3JTSB 4PREB 1S3KL 5EZIH 3FB8B 2DWDA 2EDLA 4NGHH 1T1YB 3EYVA 1CXFA 4X99A 1RD6A 4FFWC 3FRUA 3OKDB 3CX5J 5EO0B 3UAJC 2AV7B 3CFJB 2OTWA 1T2QL 4QHUB 2W65B 3B8SA 5GGVH 4ORZC 3T0EE 4KROD 4AIOA 4YHPB 3L7EA 1LEGA 3ESVF 1NJ9B 3FB7B 4L3EB 1DEDA 3OKYA 4FFVC 4IRZH 1ZHKA 5GGRA 5A2JH 3HZMA 2DBJA 5HHMD 3P9WB 4JHBA 1LK2A 5C07A 5MEOB 4CUCA 4WFEE 3QI9B 4PJBE 5D72L 2EDEA 1KIQA 4KUCD 5HHQA 3P9LA 1QO3B 5AG8A 1H15A 3RU8H 1OAKH 4WJ5A 5JPMB 1OARL 1YMMB 5M95B 3WYRA 1BJ1H 4KKCD 3QIUB 4AENA 1X5YA 3BE1H 3RIFK 5CEXA 4M1CC 1EIBA 3NCBB 4F37F 2VO5A 1CT8B 4RRPA 3ARBD 1INQA 5JDSB 4Y89A 4OKDA 1A3RL 2XZZA 1TETL 5DI8A 2I07B 5AZEL 5D1XA 2DIAA 3MREA 1NDGA 2DM3A 3R0NA 5I30H 4WU5B 1HEZA 3U0TA 3NIGE 3QCTL 2VDLH 3NFPA 1QPXA 5FO8B 3TO2A 1PG7X 4YWGH 3HRPA 5H37G 1YNTA 4FFWD 5DRNB 4TSCH 4OKVB 3ARGC 1NBVL 3WFEH 5AUMA 3P9MB 3LRGA 2V17H 5HI5C 4Q9QL 2PXYC 1I7ZB 1TQCB 2PETA 3RL2B 5BV7H 5EO0A 3FQXA 4YWGL 1G7QA 3QIWC 4MGXA 2IFFL 1DE4A 1A9EA 1FNSL 1BHGA 3WE6A 4NGHL 2HFEB 3IFPA 5DT1L 1EAJA 1EEQA 2VZUA 4GG8B 4KZDH 5DK2B 5F93C 1AGFB 3DXAA 1MRDL 3D2UD 1PAMA 4QRUB 4JG0L 3EDKA 2XYCA 3OV6A 4OFVA 2VDRH 3C6SA 2Q76A 4Z95H 1FZKB 1R24B 2VR9A 2ZWLT 1OP3K 1AGEB 4M8QA 4ODUB 1TTGA 3BPCA 3OKOB 4L9LA 3CVHL 4L4TE 5HDQL 4JANB 4K8RL 1XAUA 4H8WC 3MRPA 1NGQL 3ARZA 3ETBF 5E8OB 3UTTA 3FT4A 5EWIH 3O4LB 2GUOB 4P4RA 4ZUTA 1INEL 3EGSA 4ZPTB 3ROLB 4ZUUB 1DSFH 4R0LC 2VJXA 4NC1E 1G6RL 2V2XA 4V1DE 3BIKB 4U3CA 3P4NA 3RL2A 2X10A 3U4EB 3C2AL 2Q8AH 1S9VA 4XVSH 2VDOL 3BAEH 3LQZA 1I3GL 3U36B 3WXVH 4EIGB 5EU4A 2HT4C 4LHUG 2FGWL 1L7IH 1UA6H 4TRPL 3EOTH 2WUBH 1BOGA 3MOQA 4LCWB 2Y6SD 2GJ6B 1F13A 1M6OA 5AYQA 3VFVA 2F9BT 1HOCB 1DR9A 2GQHA 1YJDL 1OSZA 2BJML 4RGNB 2AABL 3NIGF 5TFSH 2B0SL 4NQSA 3VCLA 2WIIA 4PLNC 3IDIA 1A7PL 4MSWA 4ZPVA 3PWVA 5HYJD 1S7RA 4LHQB 5E2VL 2GSIB 4PV9B 4AH2A 4X6DB 1MLCB 4HWZB 4M7LH 3K81A 5HGDB 4M62H 4WTXA 1YQ2A 3MRPB 3EOYG 2A6JA 4KDTA 3B5GA 5E7FA 4G6KH 3W0WB 3OTTA 2X1WL 3TESA 4ZFZB 1HWHB 4PYHA 4DGIH 3MBXL 4KI5D 1K2DA 4ZD3H 2V2WA 2Z8VC 3VFUA 2BHYA 4MAUL 3H9YA 3VXUD 3VRJB 3KXFB 4GQ9H 3MRNA 4L29B 4JFDE 2LU7A 2G5BB 2O5ZL 1EX0A 3TNMA 5JIPA 4XI5D 1EHAA 3LEXA 2OK0H 4NQED 3BSZL 3C5JA 3F7PC 5D7LB 3NFNA 3LEYH 3KYOA 4XMKL 1U8LB 1KJVB 3GB7B 2V2WB 3TWCH 2AK4A 4OZ4B 4Q9RH 2VKXA 1MRFL 2QQQA 4QOKD 1FG9C 1T03H 3UBXI 2HT2C 4WFED 3LD8B 4JM2F 1X5FA 5FKPA 1UZ8B 2ZCKH 4O5LL 1Z9SA 5JO5A 1WZ1L 1IZJA 4NQDA 4CW1A 3CK0H 3BXNB 4PB0L 3MOAL 1A5FH 3CLFL 1CICA 1AO7B 3C6LA 2PTVA 3ES6B 3U83A 3S96A 3IJSB 4GS7B 1GCFA 1TVBA 4Z6AT 2LTQC 1U8MB 2FO1A 2BNRE 3KYKL 3RQ3A 4F2MB 1UH3A 3OGCA 4L4VE 4RDQF 1ND0A 5CCKL 4XC1H 5K9KA 4ZG1A 3T8XA 1U6AL 1HHHA 3H7BA 3O3AA 4X9FA 4PBXA 4XP5L 5JR1L 1DCLA 4NQCE 1QBLL 1JCKA 2DQHL 4ALAL 5J8OA 5J6GA 5CBAB 2EEDA 1J7VR 2C1OA 1QFUL 1RZGB 1LEKA 4AEIH 2Y4SA 1T4KB 4A6YA 1NCCH 4MCZA 1U3HB 4OF0A 1DQDH 3CXHK 5I8CA 2X6MA 4NZTL 4UILL 3TJHD 4LQFL 3T8XB 4W68A 3T77A 3T0DA 1CFSB 4MYWB 1GGIL 2VR5A 3UZVB 1XIWC 1IM3A 5JZ7D 4K3EH 3GJFA 1UB6A 1VGKB 2C1OB 3IDNA 4IRSB 4EXPX 4NSKB 5J3HD 4JFDD 5D7KD 4KTEH 3ARFC 4MVBC 1OP9A 4OLUL 5C08B 4HS3B 1R5WA 3UO1L 2P43B 1FGVH 4FQ2L 5L2KB 1NANH 4NCC1 3VXUB 4HUMB 4N5EC 1RUQL 4Z7VB 4KHTH 3E0GA 2DQFB 1VSCA 5EU5A 5I75B 1MVUB 4IMKC 4KI5E 2HFGL 4N8VB 1XR9B 4NRZB 2AW2A 3QJHB 4OCYH 3SKJH 4HIHB 3OPZL 2VXVL 2VTFA 4KKBD 3TN0D 4GO6B 4N0YL 3K8KA 3Q5OA 5D1ZD 2D7NA 2I24N 3QNZB 2NY1D 5TDNA 4Y4HD 2VWEE 1S7UA 4RFEB 4IRJB 3NPSC 1BBJB 4M48L 4BQCA 1TZHA 3EHBC 4JZNA 2WP3T 4OZIF 1JK8B 1MUJA 4AZ8A 5FIEA 1YDPA 3FOLA 4XVUD 4DQOL 3ARRA 4CVZB 4HCRH 2MQ0A 2FEDD 3N9GL 1X5KA 3RY5A 2PW1B 3P4OA 5E9DD 2XTJC 4LKCB 3PQYA 1YNLL 3GJEB 5D96C 1OCWH 1F4XH 1YEEL 1RZJL 3VE0B 3CH1A 3PV6A 5DC0A 4K8RC 1C12B 4POUB 4NO5B 1VEMA 2VLJB 4PTUA 2NXZB 4TSCL 4DOHE 2BK8A 3LAFA 3HB3C 1ZA3A 4FQ1L 1E4XI 3FT2B 5T1KA 3RZCD 3EOBB 4YFLI 3VGFA 3C6LC 2BY1A 5C0JA 3AUVA 5F9AC 4XPAL 1P2CB 3BUTA 2HWZH 4P5KA 3DO7A 1T1ZB 4OD2B 2XY2A 5E7BA 5C0AE 2IADA 1R3HB 5HHOA 5C0DA 2BVQA 3ET9F 2NCMA 1WQVT 4OI7A 3OAZK 3HMWL 1R5IA 2PTTB 1PQZB 2XTJD 1YEHL 1RZKC 4O00A 1DEEB 5DVKA 3RFZC 3EYUH 5T3XE 3BKJL 4J4PD 2Q3ZA 4NWTH 1P2CA 4Z7WB 1ZGLB 5GRYA 3T65A 1WF5A 2FO4B 5CJOL 4F9PC 4Q9CA 3BMWA 4K3HA 5IP4A 1YY8A 1M05A 2FB4H 1QP1A 4QCIB 5KTEH 2ZG2A 3C5ZD 3P11H 5C92A 3VWKC 5I15H 1SM3L 1VFMA 2PNDA 4NNXA 4XWOD 2GTZA 5I1GL 3ULUL 4HXBH 4HKJA 4JKPL 4KKAC 5KSBB 3X3GH 1WWBX 3OX8A 2HKHH 4JRXE 5FK9A 1JGDB 2CLZB 3MJ8B 2IBBA 3R1GL 5KSUA 1H8SA 1EBAA 3D2UB 5IBTL 3RKPA 1QVOA 3KJ6H 3EDDA 4NCC2 5HSFA 2FBJH 2CSPA 1A4JB 1NCDH 1QSED 1G7HA 5IQ7L 2J3SA 2GCYB 2HG5A 3QQ4B 3RTQD 7FABL 5E5UB 1YEFL 5C0CE 1AJ7L 5D2LF 4NQEE 1YUHA 2EYRA 4JKWA 3G5VB 3CVIL 1DUZA 1NUNB 2IALA 4PUBH 3N1PC 4JB9L 1CWVA 4Y5VB 2YHGA 5I1CH 4G6MH 3D48R 4PJHE 1NGYB 3GMOB 5FUZH 1IEBB 3BI9X 3QUYB 1UFUA 2XKUA 2Y06H 1KPUB 3GBML 4MA1B 2OBGA 2J2ZA 4PJ9A 3EJYD 5C0BA 3VWJC 5KG9B 3MRQB 1S5HA 5H35B 4NO3A 3SGJA 4NQDE 2EE2A 4LRIC 3D1MC 4BSWA 2A0LC 1HHGB 4RX4A 3QP3A 1T2JA 1Y6NR 3ARWA 4Z7OF 5EC1A 4KQ3H 1PW3A 2BOBB 4YXLH 2Q8BL 3S9DB 1I75A 5F96H 4JHWH 4NC2B 4HBCH 1SJVA 4JPIB 5LG1A 5BV7L 1OL0A 3LOWA 1QHPA 1DVFB 2ZG1A 1CZ8H 1JGDA 4YPJA 4BK4A 1GC1L 2C7UB 3EO1A 1RI8A 2R0LL 4OZHB 3WDJA 4L4VB 3WEXA 3EYVB 4F7TA 3BDBA 2CGRH 1LD9A 3G6JE 3ALXA 2E7BA 4UT6L 4R0LB 5HHXH 1C1EH 1LEGB 4M9OA 4L8BB 2HTKD 4I9WD 3SDCD 1LP9A 3JV4B 4YIQA 3V5HB 5I8OL 5ISZA 4S1DC 3MXWH 3FKUS 5FKPB 1UZ6E 1KENH 3GMPA 5F1IB 2YRLA 5DMYA 3B6SB 4Z7WE 4KK9C 4DUWA 3BO8A 2BY0A 4Y4KB 3I9GL 4PJDA 2X4RB 4UUJA 3W0WD 5E5RB 5BMFL 3ULUE 3JWOL 4K3JL 4F2MA 3SDAA 2AJZA 5KSAB 4YGVB 3MRIA 1NGZB 4UMGA 3E6HB 4GRLA 3GGWB 1NPUA 1PX3A 3KXFD 1WC7B 3OQ3B 3QO0B 2P5ED 3DX6B 2BVYA 1WZ1H 3QUYD 4PGBB 3VD5A 2FSEA 2HTLC 3HFML 2MOVA 3N1FC 4P59L 1N5YH 4FFYL 1ZKAA 3DYPA 3SDAD 5I73C 2DN7A 4NM4H 2VXTL 3W0WE 5KSAA 5DD6A 1RMFL 1RK1B 3T2QA 3U1SH 3ZSSA 1WJ3A 3HNSH 4M4PA 4L4TD 4GKOA 3MLSH 3FJTA 1Q0YH 2ZJSH 1N5YL 2DLFL 1EK3A 5D1XC 2CIKA 2ICCA 1XF2A 4FQQA 3MRGB 3RWEB 5ALBL 1SYVB 3IU3A 3ARDB 1BQLL 4EQ3A 1CDUA 3MJGX 1ZLUH 3VXPA 4ZFOB 3SGKA 4EDWL 3SQOH 4PRIB 5DD5H 4XX1G 2ICEA 3FN0H 5T33H 2W9DL 2KUTA 4X0KA 4U1NB 4CMMB 2ZG3A 3ZKXB 3HG1A 1DP0A 1ADQH 2YMXH 3GSUA 3RPIB 4YBLC 3NOIA 2XNAA 5EIQA 4BUHA 1B90A 5EU6D 2CMRH 4X6BB 4ZO9A 1KLGA 2OL3A 2YUVA 1LGVA 3ARDA 3IU3B 4WWKC 2H32B 1PDKA 4MQSB 3VI4F 5DJDB 4L8SB 4Z5RB 4R90L 1XR8B 4ZS7L 4OM0L 1CU4H 4XXCC 2HLFD 4I4WB 3OB8A 4F8QA 3CSPA 3PP4L 3MTRA 4ODWA 1QD0A 3RPIA 3TBYA 3VMNA 4CADA 2YUXA 2BRQA 4XHJC 4G9DB 4PRNA 2ZKHL 5C0ND 1KGCE 3ZLQC 1RZFH 5GS1C 2CK0H 4Y4KD 1FCCA 5J12C 4EDXB 1TQCC 1U9KA 4PGEA 3ARXA 4X7SH 4Y88A 5AYUL 4RGOH 2IPTL 4GT7A 3SJVE 4H1LB 4K9EH 5FGCB 1AKJB 1AXTL 1UM6H 1KPRB 4JHAH 5E8OA 3A67L 1JYWA 3MA7B 1OGAE 4LIQE 5HDQH 3I85A 4J3OC 1WLHA 5FKAA 1I7TB 2Q8AL 3VJ6A 1F2QA 5CIPH 5FA3A 1GAFL 5IR1B 4G6JH 2YD9A 4KDWA 1PJ9A 2MWCA 4UQ2B 3QIWA 4U1JB 1BZ9A 5F9WC 3QFDA 5EUKA 5ID0A 1PLGH 1UCBL 2DJSA 3MLRH 5IMOB 1HN1A 1GL4B 1N6UA 2CKBB 3TBWB 5IMKA 3QEQD 1CS6A 4P3DA 1CU4L 5DJ6B 3ULUF 5A16A 3GBNL 2XN9A 3RY6A 4XPFH 3DVIA 2EDJA 4P2OD 1ZHBB 3JV6A 3QIUC 2APWA 1A6ZB 1CF8L 4Y1AA 3L5WB 4CJ0A 2ICWB 4HG4J 3HI1A 5T3ZH 4JJ5A 3IU4H 4DGYH 1ES0A 4JFOA 4NM8L 4PJCE 1VDGA 5F21B 5LCVH 1MCPH 1CK0L 4D0DB 3MV8E 1F6LL 4NNXB 2YD1A 4YFEA 4M9PA 5DRNA 1I1FB 4HUNB 1EMTH 3T2NH 3RVWC 3T4YA 2ICWA 2BSRB 2BVOA 5DMKB 4MSWB 2WINB 4LVHB 5I8KL 3CMOH 3V6ZB 3VA6A 3GSNL 3TWCL 1N64H 2FRGP 2Y07L 4EQ2A 1W72A 1D5IH 1HSAB 4POYA 3K7UA 1EEYA 5JHDA 3HNTH 4IIQB 5KANG 4LLMB 1WTLA 3RA7H 1F42A 4KC3B 4TQEL 3DX9A 3MRMB 4HK0B 2E3VA 2BVPB 3BZEB 3O8XA 2FLBT 3GSQB 3QQ4A 4J3VA 1MIEH 2G75A 4ZAKA 4RX4D 3QIWD 1PKQE 25C8H 1V8HA 1EHNA 3TCXA 5E1AB 5EO9B 3KXFA 2EDOA 1Z9LA 1NGQH 3LN4B 3O6MH 1QLFA 4GW5B 2O93L 3OR6A 4XHJD 2IGFL 3N0PB 4PJ8C 4E41B 1MOEA 5FYKD 1RZ8B 5CD3A 2CQVA 4GG6F 1TIUA 5I74B 4FNLL 3MRJB 1OTSD 3RUGF 4YEFA 3E1F1 3I6KA 1YPZE 1AR2A 4WHTA 2GJ6A 5EO9A 3KHOA 1IM9A 1QLRA 1OTUD 4JFEB 3CXDL 1OSPL 5CP7A 5IVNA 1KFAL 3B9VA 5C3TA 3QRGH 3LQAL 1JPST 3MJ9L 1BOYA 1DQLL 4RMRA 1Q9LA 4OLZH 3X13A 2ESVB 4JFYB 4KVNL 2P8LA 2A73B 4MA8L 4H26A 1OARH 3KPMB 1IBGH 1BM3L 1OAQL 4JO1H 2R29L 4HK3N 4QHLA 2NTFB 1B0GB 1SBSH 2HN7A 4P99A 4RMQA 3IDMA 1HDMB 4H5SA 4D9RE 4G8GA 1FZOA 3L3HB 3HZVB 2VR4A 1G7IB 3QPXL 1DL7L 1GGCH 1Q1JL 1BBDH 3ZSTA 5HGGS 4X4XB 2MFNA 3D0VB 3I6LD 1CR9H 2AKRA 2P5WE 1BD2A 2EXYD 5E9DE 3LQAH 1ZAGA 2J1KA 3IDMB 3N85L 1OAYL 2AVGA 4U6VL 5A2IH 1JWMA 4MNQD 5T5FH 4APQC 5D70H 4DKFL 1E4WH 4FTVD 1M71B 3L1OH 4LSPL 1AI1H 4MD0B 2EC9U 3MLYH 2N56A 4OCYL 3SKJL 3H3KA 2VISA 3V5KA 3BQUD 1XF4B 1RIVL 3PGDA 2UWEF 5IB1A 2D3VA 4WEBL 2VSCA 1BJ8A 4AG4H 4JG1H 4N8PA 1TJGH 3IDUA 2OQJB 3QT2A 5JOEA 1J86A 5CP3A 1LNUB 2VQ1A 1LDPH 1SBSL 3UPAA 2AXFA 2GI7A 3LPFA 4JCLA 3ZKMD 5DD6B 4K55A 1NUFA 5CHNA 1MIMH 5ILTL 4JDVA 2EKSA 4ONGL 2HMID 5CEZL 5HYQA 3WNMA 3BISA 1E4XL 3E6FA 1TCRB 2XPGA 3Q48A 4KDTC 1UKQA 4Z7QE 5ADOH 1U92A 2EKJA 2JELH 2CIKB 5HI3C 4ZNEA 4YAQA 2FD6H 4PLJD 1GZQA 3L95B 1CD0A 4FABH 1XCQA 4OCRH 5EG6C 5JHLH 3RDTC 4OZ4A 1OGAB 3RI5F 4U6HB 1Q9KA 4RIRA 5D7JC 1UWXK 1KJ3H 1ZS8A 5GRJH 4O9HH 3QIBA 3WL9B 3TPUB 4CMMA 2PYFB 5E8PB 1T0PB 4Z8FL 1K3IA 1ZHNB 3B43A 1SQ2N 1FLRL 5F7WC 1ACZA 4KMLB 4MA8H 4WDIB 4HS3A 4HIEA 3RWGB 1AGDB 3HE6C 4GSDL 3WNPA 2F74A 3OXSA 5HGAB 2YXMA 1FG2B 5FOBB 5FHBL 4Y1AE 2ZUVA 3UJTL 2EICA 3NACH 3VXRA 3BE1L 5F7HA 2D7MA 4LSPH 1NCNA 2XZQL 2DWEB 2APTA 1IGYA 4QT5B 4LDLB 1H15B 3IFLH 4E0RA 2VZ3A 1I7ZA 2XICA 3P3YA 4GKNB 3RWHA 1JTPA 3DV6A 5F97E 5D7SL 2QSCL 5C2BH 4Y16D 3V6FB 2DQIL 1QFUH 5KVGH 4KROC 1NC2B 4HJJH 5E5MB 4F7EA 1D5IL 3PIQA 1QR4A 1DDHB 4QY8B 4HHAB 5IVZB 4N1EA 3TBVA 5LKNA 1Q94A 3AB0C 2PR4L 4IDJH 3BH9A 4P46A 5DQJA 4NRXB 3BP7B 5J1AB 4TVSa 2XFXA 1DBKL 3WDIA 1CFSA 1G9ML 3QDGD 3MREB 5JQHC 2YPLA 1Y18B 3B2UD 1XGRB 1DQTA 1RJYA 3J8F7 1A8JH 2R29H 1RZFL 6FABL 4OCNC 1JZ3A 3GIVA 4HZLB 3UTPD 5IM7B 1CDGA 3C60A 4PR5A 1N7MH 5L2KA 2HFFB 3R8QA 1GJIA 4XWOC 2AEPH 4O5LH 4OZFA 4GMTL 2E8ZA 3VFSA 1GHFL 5ICXA 3TYFA 4EI5A 3G5ZA 4JFZH 5HJ3B 3X12A 3DV4A 5DK0A 4WWKB 2P7TA 4J2XA 2YA1A 5DRWA 1DJSA 2E9IA 4M8VA 2A9NL 1KLUB 1U8JA 3ZT7A 1OSPH 3VDAA 1U8IB 4OAWA 1PLGL 4R3SB 3RIFF 1JMZA 4ONHB 1GH7A 5I1HH 1I1CA 2MHAB 2BOCA 2OK0L 2FWOA 3WBDA 5GQBA 2X4OA 1CGTA 4HF5L 3VXSD 5J1TC 1CGSH 1IC5H 1VEPA 5GRWA 3WKNA 1D5XB 2NY1C 1IQWH 1QSVA 4R4FH 2P24B 3CCHA 1R3LB 4HH8A 4JRYE 4L3CB 3LS5L 5CUSL 4LCWD 5DEGB 3ZYIA 1NDGB 1RULL 1JYVA 3UC0H 3E3QC 4XNQA 5K59E 2YPKB 4NWUH 3MLSL 1P4BL 5GS0C 1HIMH 4F7EB 4Y19E 3FCTB 3QIBD 5EPMB 3H9SB 3FO9B 1UXWB 4M62L 3SBWA 4XWGL 4QXGL 2QTEA 3PWPD 2DTML 4MWFB 5E95B 3DIFA 3F7RA 3JTTA 1CE6A 2DJUA 1A6TB 2DQIH 1V5JA 2D0HA 3NIDE 1MFBH 2Z8WC 4KY1H 4GS7C 4PG9B 1VHPA 1H3PH 3T2OA 4F58L 3EJYC 1T20A 3HFMH 1ZLWH 1N64L 1A21A 2X4TB 2Y07H 5GISH 3VGBA 5DVMA 3QPQD 4XCEB 3HTLX 4LLUA 3BKYL 2CDEB 2IJ0C 3O3UN 4JQXA 4KK6C 3ARED 4GFTB 1UQSB 4ZXBA 4Z78B 1A6TA 2EDNA 5ECJE 3JWOH 4I18B 2NQCA 1EO8L 3FN0L 4PJBB 5T33L 5HGHA 5KSVB 2P44B 1N2RA 3M1BB 3BEWB 4UV4H 3V0AC 3GMNA 1YMME 4JGUA 5DYOA 1LO2H 1I1YB 4XCEA 3MUZ1 1S78D 3C6SB 4QTIL 2ZSWA 5CLWA 2HLFC 5HHPB 1FYTB 4DZBA 1JUFA 3C2AH 4HBQA 5TFSL 2AJXH 4RMWA 1WFUA 4H1LG 2HH0L 3GMNB 5DJYA 2Q3AA 4I0KA 5I1EH 2Z92B 2CIIA 1Z9MA 3RRQA 4C56D 2XIDA 4JO4H 2YN5A 3F58H 3LB6D 5IF0A 2VXTH 3QFJA 2FGZA 2DLEA 5CZKA 4KZEH 4FG6C 5CKAA 1UWGL 4MMXC 1Y6KR 1G7JB 3WJJA 3LH2H 3VD3A 1W72H 5CGYD 1FNEA 4GG6B 3N50A 4ZUUA 1F3JA 1TTUA 1KTKE 2O26U 3F12B 4XVSL 4X4XA 2IWGA 2Q7YB 3SN6N 4N9GB 1I4FA 5FGBC 4NNPL 3O45B 4BJLA 3HG1E 3VGAC 2AI0H 3KPSA 4FFZH 4KRPC 3RGVA 4UAOB 5HHME 1JWMB 2A9ML 5CEYA 5DJ8A 4J1UB 5A2FA 2EDXA 2ZOLA 4GBXC 4HKXA 5IW1B 3E3QE 5C07D 3MGTA 3K1DA 4MS8D 4P46D 2AEPL 5HVGB 3VXRE 5EOQL 2OYPA 2ED8A 2PUQT 4UOW0 3RU8L 4OB5H 4OJFL 3ARUA 2CGRL 1LEIB 4YHKL 5EC1B 5GGQL 3V7MA 4ODSH 3V4VH 5BMFH 3KS0J 4X98A 2R1WA 3AS3A 1FO0H 1WGOA 2ADFL 4P2QD 5T1LD 3GHEL 3PGFH 2IPUK 1UGNA 4PP1C 2VDPL 3O11A 3T0XA 4ODXA 3IFNL 4OZHF 3DRTA 1PG7L 3RX7A 3F6IA 4PGBA 1X3DA 1TCRA 2XPGB 3NCCB 1HXMB 4QO1A 1A1NA 3MLPA 3ULVD 2DKSA 4OQTA 4JPVH 3OKMB 5IB4B 3W5MA 4FXKA 4Z7VE 3M17A 5CP3H 4JFFE 5LXGL 1JPGA 4ENEC 1DLFH 3UJJH 1YN7B 1EFXD 1ULVA 5D7JA 4XP6H 2NW3A 1U58B 1ONQB 5BV7B 1KTLA 1CFTA 3FFDB 1B2WH 3O6FD 1YEJH 1E27A 3FT3B 3MUGB 3MLVH 1A1OB 5ACZB 4GAJH 4KTDL 3MR9B 3MRLA 1FYHB 1KB5L 2FJFB 5L7XH 1Q38A 3FTGB 4NN7C 4KJQC 3GSWA 3UTSE 2A1WL 4YPGA 1FORH 5D93B 4KVCL 1XF2B 5FUCC 3UTTD 1CXIA 3HE7B 1TZIB 3R8BB 1ED3B 4U1IB 1ZT7B 4NDMB 1Z6JT 4POZD 2AK1H 2AI0L 2MKLC 3MUJA 1AXIB 4H8WL 3JUZA 2ICES 3BZ4A 5DFWH 4QNPE 1EAPA 2DM4A 1XIWD 5FV2A 3ARQA 1IM3B 3S5LA 2NY7L 4LSVH 3MCLH 2NY6B 1WBXB 5IHZA 4PJHF 2IBGA 3PABA 3GMRA 3I6GA 4L5FL 2V2TB 3GMQB 4UT7H 4YDVA 2RHEA 3ROOB 3RWFB 1XR8A 2IEPA 2NY0B 3QHTC 1NGPL 1ZGLP 5LXGH 3L3KA 2AJVH 3DGGB 3FFCD 1K5NA 4P4KC 2DYPB 5I1JL 3MBEC 1YEEH 4N90D 3TVMA 3ULUH 5GXBB 2YRZA 4O9HL 3LMJH 3TBTA 2EO1A 2HYMA 4DAGL 4P9HH 4D94A 4M6MH 4JHZA 3VXSA 3T08A 3DHMA 1F4YH 1KJ2H 4ZTOL 2VB5A 3OSKA 3VXME 1KTLB 3PHOB 1ACYH 4IMKA 2GJ6E 4M7LT 2H1PL 2N4IA 5F1OB 4NQTA 4NT6B 5JXED 4O2FB 3FMGL 1ZSDB 5C0BE 1HH6B 5E6IA 5A1AA 2QQNH 5LGHH 3GJFB 1UB6B 1VGKA 1UWEH 2R8SL 1S8DB 3KDMB 4KXZI 1E4WL 3X3GL 4KMTH 3HE7A 3G6JF 1F3DH 4XPAH 4Y4FC 1H3PL 3ZT6A 1G7MB 4TNWK 3WFZA 1NC2D 1XGQB 2EC8A 2O5XH 1LWRA 2BRRL 4J4PA 4N8VA 4WU7B 3HC4L 1VKXB 1JNNL 4OZGA 3WIFA 4ZFGL 1NFIA 4TOYH 5CLTA 5KBNC 3HI1B 5BQ7A 1OAKL 1OB1A 1DZBA 2EXWC 4LMQI 4Z7WF 4WRLA 1IM9B 1QLRB 1WWWX 4LIQL 1S7XA 3SY0A 4KI5C 5EU6A 1KT2B 1QBAA 4RFEA 2O5YH 4K7PH 2QBWA 1MJUH 5K33A 4YHOL 1J5OH 5E8EA 2XKNA 3B3IA 5F6HI 1FZJB 3RWDA 3EAKA 3ROOA 4Z7NF 1A4JA 1WBYA 3TNNB 3FO2A 3DJ9A 1KCVL 4K2UH 3DX7B 5L88H 3L3JB 3AXLA 1X4ZA 4JY4B 1HKLH 3QG6A 1FVCB 2FO4A 2QQKL 2B20A 1W72B 3VDCA 5INDA 2FH8A 5I71C 3MC0A 5EOTB 2BXYA 3R1GH 3WKML 4YDKL 4WV1B 1OLZA 1DL7H 3KPLB 3CH1B 3PV6B 1I9IH 5F7EL 5LVEA 4FFVD 2CLRA 4D3CL 2CDEA 5H8DA 1HIML 3HC3L 3LRHA 3PDOB 4N0YH 4X80L 1IKFL 3GMLA 5MEPB 1SY6L 2Z31A 4QRRE 1U8LA 4ZAKB 2UUDH 1QKZL 1AH1A 3KYKH 2VL5B 1OP3H 1I9EA 1O5DT 3PV7A 3OXRA 3ARTA 2PO6A 2OS7A 1EJOH 4MJ6A 1DVFD 4LPYA 4JJ5B 2BFVH 2J88L 1T3FA 3F7QA 5FHAH 3LKSB 5CWSA 3RPKA 3BPOC 5J6HA 3C8KB 1ZLVK 1C7TA 2F53A 1CF8H 4GAFB 3WCYA 3T0WA 4S2SA 5B8CC 1BFTA 2E7MA 2XI9A 4JPIA 4P4KB 3KPSD 4KKCC 4ODHL 3QUZB 1DLHA 2W9EL 5HHVH 2E7HA 4PBWD 1LP9F 2Q20A 3OGCB 4X6EA 1CLOL 2VXVH 1PZUB 2DQUL 1NFDF 1K85A 1A3LH 1H5BA 4P23C 4R96B 5IVXA 3CFEB 2ATKB 3U7WL 5A40E 4W70A 1KIPB 2FX9H 3HRZA 2DTMH 1S5HB 4GG6A 4PJXA 2WZPD 1EV2E 3FO2B 1U3HA 4ZUVA 1I8IA 4JHAL 2YEZA 5FYKU 1MJUL 1J5OL 3HI6L 2VUOA 5CUSH 2DQGL 3MA9L 1V7ML 4K94H 1XT5A 2Y1VA 1NMBH 3H42L 2YBRA 3AMKA 3FOMA 5KN5B 3QA3A 4FTVE 3MNWA 3WHXA 5GS2D 3WFCH 1RUAH 1MWAH 2UVEA 3L5XH 1MFCH 2WQ8A 3LS4H 1FYTD 1D5ZB 2X7LA 3D85B 3SO5A 3SDAB 1A7PH 4LGPB 3QDHA 1Z0MA 5F8QC 2VL5A 1ZV5A 3KLAB 3BKMH 1Q9KB 3GBLA 1A7QH 3BN9D 3HC3H 3JTSA 4PREA 5F6IC 4D3CH 1JRHH 4TVPD 4XZUB 4YR6B 2SEBA 5IOPB 4IRSC 2QQNL 2QHRH 1P5UA 4RFNB 1BQHG 1JNHB 4PRPA 5H35A 1EHLL 4HUWA 1P7QD 4PRHA 3HR6A 4HUVA 1KTRL 1F8TL 1JFQH 5HGBB 2QKIA 4X6EB 4WO4C 2ERJC 3MGAA 1KCSL 1MH5B 4S10A 2BNRB 4X80H 1S9XA 1L9NA 4MDJA 3DRQB 3MCKA 5J57B 4UB0L 4NQCD 1E0OB 2YKLH 4YGVA 4MNQA 2OTPA 1J1XH 4L9LC 5GZNC 2EIDA 4XB7A 1I7RA 3HPJB 3UZEA 4OFDA 3BUYB 5KS9B 4L3EA 1JGLH 2EIBA 4OUUA 4V1DD 3BH9B 1RUML 4P46B 4QTHB 3ZYZA 1EVTC 1N6VA 4I48A 5CJXA 3M8OH 1T6WA 2R8SH 2VLLB 4J12A 3ULVH 5IWLA 1U3YA 2C4FU 5JIKA 2YPLD 1AKJD 3HC0B 3EO9H 4OGYL 5T1LB 3C8HA 4R2GD 2JKXA 4XXCA 5DEZA 3WSQH 2FNBA 3MRGA 3RWEA 3GMRB 4GLRI 3LN9A 3DV4B 4PJCF 3GHBL 1MCIA 5C9JA 4NQEB 3VI3E 1L0YA 4ZTPL 4Q0XL 3WS3A 2VQ1B 5L6YH 1T5XB 1R3JB 3ZDYF 2HT3C 3NFPB 1F58H 2FZ3B 4HJ0C 3QEQB 2R69H 1ZEAL 2YPVH 2XA8H 3T3MF 4KVNH 5F8RC 4QOKB 5E8DL 1IC7H