2QZ5A

Crystal structure of the c-terminal domain of aida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
b'GTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQSLHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Axin interactor, dorsalization associated protein
molecule tags Signaling protein, lipid binding protein
source organism Mus musculus
publication title Crystal Structure of the C-terminal domain of Aida
rcsb
total genus 31
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14186 Aida_C2 Cytoskeletal adhesion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2qz5A00
4HLEA 2Q3XA 3L17A 4ANUA 3HN8A 2Q0ZX 4KITB 3IM1A 3QR1A 1DJIA 4AOFA 3HHMA 4Y1SA 4WEEA 3CSTA 2V4LA 4XZ4A 4ANXA 3ZIMA 1A25A 1DJHA 2CJTA 2QZ5A 4A55A 5G55A 3MJWA 3APFA 3L9BA 1DQVA 2A5UA 4FLHA 2UZPA 3GPEA 2R83A 3NSJA 3F01A 4FJZA 4MJJA 3ML8A 2ISDA 4WWPA 4L1LA 3KWTA 4FJYA 4QJ5B 3QARA 3W57A 2CHDA 2KI6A 2CHWA 3OAWA 2K4AA 3QR0A 3ENEA 1DJWA 4TV3A 3IBEA 2LHAA 4FHJA 4XX5A 3T8MA 5CCGE 4LCVA 4WAFA 4NS0A 4F91B 3ML9A 1E8WA 2YOAA 2YRBA 4L2YA 4QJ4B 4EZKA 1E7VA 1BCIA 2ZKMX 3QJZA 2WXMA 4Y1TA 2NSQA 1UGKA 4DNLA 3QAQA 4NP9A 3ZVVA 1TJMA 2CM5A 2DMGA 1E90A 3PRZA 1YRKA 5T8IA 3DPDA 2CJSA 5G2NA 2ENJA 4NPKA 4DK5A 5JHAA 4V11A 2RD0A 1QATA 3TL5A 4LT7A 2K45A 3M7FB 3FDWA 3APDA 3FBKA 1GMIA 3LJ3A 1E8ZA 4ICXA 4KZCA 2BWQA 3B7YA 1DJZA 2CHXA 2ENPA 1UOVA 3HIZA 3RDJA 4F93B 2FK9A 3P2BA 4QJ3B 3RPBA 3APCA 3PFQA 2B3RA 1DJGA 4IHBA 5EDSA 1RH8A 2WXIA 2NCEA 2WXOA 3L08A 2WXHA 1CJYA 4AJWA 5H4YA 2WXQA 4WWNA 3R7RA 3ZW3A 4EZJA 4URKA 1BDYA 3PS6A 2D8KA 4EZLA 4BGDA 2WXJA 1W15A 2N1TE 1DJXA 2CHZA 1UOWA 4IQHA 2Y3AA 3SD5A 2K3HA 2Z0UA 3CSFA 4GB9A 4FADA 4J6IA 4LDCA 1DJYA 1DSYA 2NQ3A 1QASA 3JZYA 3N5AA 4XE0A 5KJ7E 1W16A 5JHBA 5H4ZA 4BFRA 4WWOA 4FA6A 4F1SA 3DBSA 3S2AA 2JQZA 2WXFA 3NZUA 4L23A 4PS7A 4OVVA 5CCHE 1HE8A 1E8YA 2EP6A 3L13A 3QK0A 3OHMB 4ICWA 3L54A 3R7QA 4L1BA 1RSYA 2WXPA 3L16A 4PS3A 2X38A 3PYCA 4GNKB 1V27A 4PS8A 2CM6A 4F92B 3F00A 2WXNA 1WFJA 5CCJA 3PREA 1TJXA 3W56A 4KZ0A 2ENQA 4JPSA 2WXKA 2WXRA 1BYNA 3TJPA 1RLWA 4TS6A 1K5WA 4FHKA 1E8XA 2FJUB 4OVUA 4ANWA 3L4CA 4HVBA 4NPJA 3TWYA 1E7UA 2QZQA 4G11A 2A4ZA 4FULA 3NZSA 1WFMA 4QAMB 2WXGA 2WXLA 4TUUA 2K8MA 3KWUA 2DMHA 4ANVA 3F05A 3F04A
chains in the Genus database with same CATH superfamily
4P5RA 4E42B 4YWGL 5TF1L 3CVBA 3K3QA 3LPOA 2R1XB 2MOQA 1JL8A 2VTFA 5IIEB 5BS0B 1O6SA 4PHXA 1CT8A 5IWLC 2HKHL 4HHAB 4KZDH 4XBGA 3AXHA 3ZHLA 3ZZ1A 4FQCH 3SPJA 3WDIA 3ZIMA 2R59A 2A3TA 4ONFL 3GSXA 3I6GB 3S36L 5AG9A 1NFDB 1T2XA 2E5EA 2M26A 2DQCH 2AV1B 4F2MB 2BDNH 1A6WH 5DT1H 4DP5X 3I3EA 2R1WB 4N6QA 4TLSA 5EOQL 2WSDA 1LGVA 3QIWC 1IL1B 2O6EA 3WN5A 1NZRA 1UCBH 4Q58C 1U3HC 5KTEL 2HMID 1Z3RA 5D1XA 2X4SA 1OK0A 2DRUA 5K9QG 3UACA 1BVKB 4YHZL 1UGKA 3WL9B 2DAVA 4JPWH 1KCRL 1NPJA 4TLTA 1JGVL 3U4EB 2AABH 1UACH 1RJZB 1X5ZA 2OL3L 1CDCA 5E2JA 1VERA 1L0YA 1CC3A 4GAYB 3D2UA 3R4DA 3T3MF 4M62L 2KS0A 2OYMA 2OK0H 2X2UA 4JJOA 1E4XL 3WFHA 3TCLB 3FH5A 3IDIB 1FGNL 2QVKA 1E5UI 2ID5A 4PSPA 4HS3A 4GSQA 5BMFH 1L9QA 4JFOB 2E6QA 4XCNA 1KPVB 2Z8RA 4HAGA 4XO4A 4KWUA 3D4YA 1Y07A 1LVEA 5DVPA 3MV9A 4JPQA 5D1QA 2AQQA 4K94L 1LK3L 4QXVA 2E74C 4K5MA 1T0PB 3EFOB 1YCSA 4G72B 4KO9A 2ROYA 4PJ8C 3S5ZA 3NPSC 2LGNA 4XN4A 3VX0A 1QSZA 2KKQA 4M6AA 3AS2A 4LAQH 2QR0B 1YEJL 1HK6A 1WAEA 4MXQC 1SN2A 1TCMA 4Z95H 1BYNA 5CGTA 4ZTEA 2AJ3A 2XN2A 3SDDC 4W70A 3VRLE 4QHNA 5C08B 3BW9A 4QWWD 3BP4A 4B6ZA 1E4KC 4NQUA 5I0ZA 4DN4H 1NGWB 4RZKA 5DJ6A 3RWCB 1QVOB 1XGYL 5IR1B 4NHUB 2ZAHA 3ASOB 3UCRA 1KB3A 3BUYA 1CBVH 1L4IA 4ZW5A 2NR6A 1PJ9A 1QO3A 3D34A 3GGWB 2Y9RT 2BZDA 4RFOH 1DJIA 4CW1A 2B2XL 4H0IA 1F86A 1F3JA 1M1XA 1YNKL 5CMAA 1WA1X 5CP7A 3BSGA 4KHXL 1HHIB 3Q0HA 4ZOEA 3U0PA 3VFUA 1MG2C 3O2DA 2ADIA 1NCWH 4P2OD 3IWVA 4ZMNA 1N3NA 3QUZA 5I16B 4XNXL 4YHML 2WQXA 3GXNA 3I6LD 1T22B 5JYLA 3L3DB 1RZKH 1F2XK 4U1MB 4H26A 4ZXBB 3MRGA 3ZZLA 2PWHA 1A7OL 3TZVC 5ACZB 4HCIA 3EXJA 4PVLA 3B3BA 1X5JA 4N2OA 1E9QA 4YSDA 4DPBX 4P49A 3TNNA 1MW2A 1ZA6B 3K6DA 4WFHE 3AW5A 3O3UN 4P48A 4P2RE 3ILQD 2AERT 5FV2A 1KFAH 2FEEI 5CHNA 1A1OB 5E2WL 4G8EB 5D6DC 5I24A 3N40F 1A6AB 5F9DC 1SQMA 2FJFA 3DV6A 1OM3H 1HQ4B 4MCZB 3HZVB 3AT9A 1U95A 5I9QB 4XPBH 4K71C 3BEWB 2R2HA 3F7KA 3C5ZD 2ZCHH 3EF7A 4B50A 5FB8B 3GZPA 3TBWA 3OKOA 4IHOB 1MSPA 2V5RA 4D8PA 1KGCD 1CFMA 4BINA 3RB5A 5BMFL 2EYTB 3H9HA 3T2NL 1F2QA 2FBJH 1B2YA 2OL3H 2WWKO 4LLWA 4WWNA 4M29A 4OFDA 1MUJA 3O0LA 3KYKH 3IMBA 1XWVA 1U3JA 2JI3A 3D5OF 4BCZA 1CYWA 3MA9L 5F7HA 4ZUWA 1I1FA 2VO5A 4Y19D 3CN0A 3MLSH 4HLZG 2CO1A 4YGVA 5AAWA 1KXQA 1E8YA 2DLEA 4I87A 2CDEB 3FU7A 2YLHA 1AHWA 3CH8A 1EHLL 2BIIA 2HMIC 2J8HA 5JA8B 5LQBH 1BX2A 2DL9A 1OE2A 2RFXA 1KGJA 4G9FB 2OMTA 3O8XC 1AZZC 5HGHB 1PJWA 3TWYA 3BXNB 5CEZE 3EJJX 2Y1YA 4DOHE 4X8CA 2GABA 4ECNA 4OZIF 5DGQA 3RPKA 1ROCA 4Y9CA 4LKCA 1KTKE 1IGFH 2PXYD 1M6OA 4LZKA 4JO1L 3UTTE 1OW0A 3BJ91 3D05A 3DYOA 5ICUA 5C9JB 3RTQC 2ED6A 3MAWA 2O5NA 2X6AA 3GPEA 1C12B 3T0AA 3V0DA 3A4EA 1GCYA 1JNHB 4EUPG 1FJ1B 1NCCL 1J86A 3HHRB 4R2GB 3UDWC 1KIUA 1ZE3H 2EXTA 3GRWH 2K7PA 4FQXB 1H5BB 1TVHA 3LIZL 4JRFA 5BO0D 3T65B 1NC4B 4MSWB 1CICB 3HB3D 4IK7A 3VSTA 4F33A 2YAFA 4RQQB 5EV7A 4RMBA 2YRBA 2MNWA 3GM8A 3Q6GL 4P07A 1MQKH 3DO4A 3LH9A 5KJRL 1G7MB 5I66A 2V2WB 2B0SL 3FU3A 4HMDA 5I1AB 1FIGH 2VDOB 1CL7I 5C08E 3CSYB 4L3FA 5EIQA 3TYFA 4YH6A 1WBYB 4P5KA 3QA3B 3QSKB 3OKDB 3OR7B 1CB4A 2AV7A 2BOCB 1JMZA 1DVTA 1WO2A 4MD4B 5CZRA 3RL2A 4UWQB 4WNSA 4L2LA 1CR9L 2GG1A 2XPGB 2DB8A 4HH9B 4PS4H 1AFVH 5D1ZI 1SXSA 5T1LB 1BQKA 5FECB 2ATPB 1NANI 2I7SA 1WS7A 4U0RC 1BVZA 5IQLA 4KVNL 3UMTA 2DYPD 2ZG2A 5JNYB 1JNHA 3MA7B 3KPRE 4MDRA 1K8IA 3RRQA 1RIUL 7PCYA 1F4YH 5I1GH 3MNMA 5GHWL 1DQDL 2Z0UA 3JSSA 4JANB 4YE0A 3VMOA 3FMGH 3G5WA 5DD5L 1ZHNB 4WY7L 1IM3B 3RTQD 4QCIB 3IFOB 2G0KA 2ZOTA 1WQVT 2VR7A 2HZHA 4G6JL 4I48B 3EFDH 3II2A 1J1OH 3FB7A 3L45A 3H3KA 4MKMA 5IB3B 5FM4A 2GSIA 2XWZA 3O4LD 2VWEE 4HZ1A 1UUNA 5K1VA 2DWTA 2NY4D 3QC6X 1L5GA 2Y7SA 4FYSA 5FHBL 2EXYD 2J6WA 2Z8WC 3BDBA 4DKEL 1RVFL 2UZXB 2YEZA 2ZKXA 2HT2D 3CFUA 4QHKI 1UJ3A 2VQ1B 4NN7C 5CEZD 1U95B 4E9XA 5H35A 1FNEB 2O6CA 4JFEE 4NCC2 2A73B 4OKDA 4PGCA 2BP0B 3J8F7 5H94A 5BV7L 4OUUB 1Y6KR 5HYIA 5IZ7A 1RKRA 1DO6A 1N64L 5FIEA 4P4KA 3U48A 5GS0L 3RNKA 1L6ZA 3K4AA 3FO9A 5GISL 3N85H 4LP4A 2IPUG 1JK8A 2BXZA 2FZ3A 2VN3A 1NCIA 3TBSB 4LF3A 4Z0BL 1KXHA 3ZZQA 5DRNA 5HYEA 5T5FL 2HJKA 4Y7MA 3LZPA 1GHFH 2WP3T 4M9PA 4JG1L 5F7UA 5HYJD 2CO3A 3TV3L 1R3HB 2J21A 2PP9A 4CJ1A 3FKUS 4MNHA 1KELH 2JKWA 3VA2C 5CGBA 2DJUA 2YFNA 4I0PB 3RHWK 1CURA 2MNJB 4R2GC 3BN9C 3PP4L 3UTZB 2OMYB 2YEZB 1AD9B 4XPFH 2JQAA 4OQ1A 4HCRL 2YA2A 3DRQB 1ZT4B 1KIQA 3WD5L 4PJGE 1FGVH 1Z5LA 3DPDA 3ZKQD 5FGBA 4EN3C 5AB1A 1PYWA 4UINL 1ZLSH 1KNOA 4YPGA 1G9NC 4F8QA 3K81A 3W5MA 1S9XB 2CO6A 4CVWA 1N6QL 1MVFA 4W9EC 1KXQE 5DJAB 4B95C 1EFQA 3UP6A 3FO9B 3QUYC 1T7WA 5CU9A 2FZ3B 1BXAA 5T3ZL 4PJEA 2CSPA 2YAOA 1OT4A 4FXLA 1SDDA 1VFOA 4L1HA 3VH8B 3K6SB 3HI5H 2FHFA 4HDIA 1FFNA 4R8WL 1A0QL 2BO0A 4F58H 1QI4A 2WXJA 1S8DB 1CD1B 3ULVL 2R7EA 3PNWB 4HWBH 5GSVA 3ZTJH 1E3XA 3NEXA 1RHFA 3SDXA 2VLJB 3HZKA 1P4UA 4Z7NB 1QOKA 4JDEB 1I3RB 4JFEB 1S5HA 4ZOBA 4BDVA 3SO3B 1HEHC 1IC5L 2ED8A 4OGXL 3BX7C 3TBBA 3L1GA 3OHXA 2IALB 4YN3A 5IW1A 1HX0A 5HPMA 4NI6A 4ZS7L 3ARYA 4FQJH 2BNQA 1E4WL 1BM3H 1XBDA 4LRIA 4DFHA 2OTWB 2F58L 5EZPA 3M1BB 3K71B 4PWEA 2BOCA 4OZ4A 4LCWB 5EN2B 3AAZA 3BCFA 3ARBB 1NFKA 2YGPA 5TH2A 3TLRA 1GIGH 5CLXA 5ADPH 1NOFA 2CUMA 4IBVA 4JREB 1MAMH 3O4OC 4LNVA 5T1MA 4PWKA 3EFDL 2NY7L 5KVEL 1ES0A 2ATPA 4TTGA 4P2QD 3KLDA 4KTYA 4XGZA 3HZYA 1IQWL 4RA3A 2XTLA 3HE6C 2IPKB 3GHEL 2A5UA 3IDNB 1AS6A 4Q2ZA 5GGRB 5I1LA 4JG1H 5HVFB 1A7PL 1HSAA 1OAKH 4XXCC 3C8HA 5KUMA 5I5RA 5IREA 1LO5A 2FO8A 4ORZC 3PUUA 4PTTB 4ONHA 2AJXH 3ABLB 2V37A 4XH2B 1T1ZA 3G5YB 1M56B 2ZUYA 3QEHB 3VYNA 1I3UA 4JRYA 3NYKA 3MO1B 5C2BH 3MCLL 1E2WA 1HH6A 2C9RA 3NH7H 5A7BA 4PRIA 2Z31D 4PJ5D 1A14H 1KGWA 4PLKD 4PYGA 2VZSA 3TIEA 3Q6GH 4YHPB 4KJYA 1G1CA 1W8OA 3RKDD 43CAA 3IDYC 4G8GB 3F62A 2O5ZL 2VYRE 2IFFL 1J0KA 4KU1A 1JGEA 2WCGA 1HHHB 2F0CA 4HXAL 1AKJD 1KLFB 1K6QL 1WAAF 3OJ2C 4UF7C 1GGIL 4JN2B 2X53A 1MAKA 4LVHC 5IJKA 1J1OL 4OZGE 4PJAE 3V95A 4Y88A 4QGYA 4WJ5A 1QW8A 3VFSA 5IMLA 1AGFA 4HT1L 4KKBC 5EWIH 3VACA 3EGSB 2FUQA 3B3IB 5IJBC 3KLHD 4QF1A 2W07A 5K1NA 2AEIT 5GHWH 4H13C 4N68A 4WRLA 2VITA 1XAUA 1D7BA 4NCC1 2JJUA 4NAJA 2KZKA 4PQXA 4NAMA 3ALPA 3CGTA 3MUZ1 1T5WA 1JN6B 5KVGL 2XOTA 4LU5L 1T1WB 4AVIA 4OAWA 4PREA 4OGZA 1FVCA 2SEBA 1MHCB 3VD7A 5FK9A 1HHGB 1Z5YD 2Q8AL 5LQBL 1SUJA 4FZ8L 4LSVL 3RVWC 5C0CB 3DYPA 2VUOA 4HISA 1E4JA 4OZGB 1VPOL 4Z7OB 2JTDA 1NA8A 2OZ4H 4ALAH 3BP5A 5IBTL 4XT1C 3O3DA 5E2VH 1UXSA 5HDLA 1EA9C 3BWAB 3RVTC 3HE6D 1D5ZA 1GCFA 2CG9X 4GRLA 2R1WA 4PJ7B 1IGML 3WI9A 3QEGH 3T0VA 1S9YB 4JMXA 3ULUL 1QSFD 4GBXB 1FL6A 4PPTA 3CSTA 4HS8H 4XNYH 5DD3H 4HX1B 3CJJA 3KE0A 3LMJH 5CR8A 3VWKB 5KG9B 4OD3H 4HHWA 2Z4QA 3FU9A 3MGTA 1J9CT 3GM0A 4JY4A 2UY7B 2I07A 5DJCA 1CMOA 4UQCA 4JGNA 2NY2D 2EYSA 3FO1A 4W68A 4L3CA 1K6QH 1PTZA 3QXVA 4N0RA 4N90D 4GH7B 5DEGA 4PRHA 2G60L 1XGRA 3LYRA 4OFPA 5KSAA 2ZCLL 3LH2L 1MHCA 5BRZA 4NQDA 1AZUA 4PCSA 2K0RA 1E5AA 2XRAL 2UX6A 2ZSWB 4QHLB 4G8AC 4NKDB 4YR6B 5E1AA 4B9IA 5JOPE 3DSNA 4OCRL 1NEZB 1QA9B 1NWOA 2N01B 5HI5D 3Q48A 3EDEA 2C9VA 5ISZD 4OLXH 1YNLL 3C6LB 5CLYA 2TSBA 1OLZA 4KY1H 4NQCA 5K69A 4LEXL 1IGCH 4P3WA 4J3OD 3CVCA 5EUOA 4CDHA 1WAPA 2VDQH 3H9HB 4P2QE 3KPNA 3S37X 3BWAA 4C83A 4HS3B 2NTFB 4I1RA 1YY9D 1AGBA 2P5EE 1F0LA 3KWWA 1JFHA 4IOSD 5DC2A 3TL5A 2FEDC 4LP8A 4KZCA 1MQ8A 2DI7A 4OCSH 5JXAH 4OIBA 3RDJA 5IVXB 1KYOK 4HJ0C 4PGBA 2V8MA 1B2WH 5CEZL 2IG2H 3KPLB 4PRAA 1U3NA 3T6QC 4BELD 1IQWH 1GGTA 4HKBA 5C0BA 5F1IB 1R5IA 2X5PA 3B9KD 3CFTA 2YD5A 4H88H 1N5AB 1U93A 2VSKB 3W0WE 4GIAA 4M6ML 1JXKA 1A2YB 1HILB 3RB7A 1A4AA 4LDEB 2R9HC 3H7BA 5IB1B 3IS1X 3MRNA 4D0DB 1NIEA 5I30L 4XCEA 3WS3A 2AJ3B 3OMNB 4BWTA 4AUYA 4DPAX 5T1DL 4G43A 4WWOA 4TF4A 2B2XH 1IBGH 2IANE 1DQIA 1QPKA 1MELA 5D8JL 3PGDB 1YUHB 1G1OA 4GNKB 1H3UA 1RJZA 1WFJA 2F54A 2EIZA 1ZGLB 1YMME 5B8CA 2W1NA 1ZLWK 4O2FB 2CLZA 4YXHH 4M61A 3SODB 4FHKA 5EO9A 2C4XA 1U8QA 1ZLEA 3D2UB 4M7LH 5J11C 5C9JA 5LDUA 4L4TA 4TQHA 4ONOA 2ORBL 1I7RA 3VGBA 3ARDA 3THMH 3FXIC 2CDGB 1O9VA 1J1PL 1AP2B 1GL4B 2DJ4A 2LV4A 3VXSA 1AR2A 3HE7C 1E5YA 3EYVB 3MV7D 2XQBH 3MC0A 1L6PA 5I16A 2RIKA 4TNVF 3WFCL 3ARZA 3RP1A 1YUKB 2V17L 1T1XB 3O2WL 5IQ7L 2PXYC 3IU4H 4UU9A 1OTUC 3BGMB 3O8XB 4IRSC 4Q6IA 5GRVL 2AKRA 5L9DH 4G42A 2FT7A 1JERA 1FNLA 2BSDA 3FUMA 4WHYH 2F1BA 4JM4L 5D1QB 3V0VA 1WCBA 3EO0A 4TUKL 4DP9X 3WUWA 5JHLH 3R18A 4HA1A 3VFVB 1I9JL 4ZAKD 1HWGB 1IGTB 3DUUA 3NACL 3PGDA 5I30H 5DZOA 3RI5F 3R0NA 1YECH 4NIYE 4N0UB 4QRQB 1G6VK 3GLZA 5C0GB 4I1PA 5KN5A 4H1LA 5LXGL 4DP6X 1KB5L 2YBRA 4YHZH 4YC2C 2Z7ZA 2D0GA 1F11B 1URZA 2LT9A 5E95B 5EO9B 2W0LA 3JV6B 1IE4A 2VDKB 4MQXC 2GK0A 1M05B 2NYZA 4HWZA 3EGXB 2WGXA 4DP2X 4E5XB 2F8OA 5CGMA 4H25A 3GC3A 1BZ8A 2RHEA 4ZS6D 4PJ9C 2Q76A 4D8OA 3QUXD 3W5NA 2DQIH 3FHEA 5C09A 4UQBA 4QUOA 1GR7A 2GTWA 4N4YB 2DWDB 3LNIA 4E9YA 5I74B 2PO6B 2QSCH 1ES0B 2ZUQC 4KJPD 4AQZA 2BNUB 1IGCL 1A4JA 1U8JA 3FUKA 4JG5A 3QH3A 5FYKE 25C8H 1BD2B 1VHPA 1F3DH 2NY5L 3WBDA 5DUBB 4WTXA 1DVUA 4K3DH 2Q7AA 1EBPA 5D1XD 2A74A 4NO0B 2MQ3A 5BRPA 1DN2A 1RZKC 2YGQA 4HGKC 4YDLB 2F7RA 2G9HB 3S37H 3BAIA 1QBAA 2G60H 5FCUH 2NQ3A 3U4KA 1Q9KB 4F7MB 5BV7C 1FVEB 5J13C 1M3IA 1U3YA 2W9EH 1QAWA 3CIAA 4GIOA 3QZWA 4M62H 1KTDB 3P4OA 4PJEF 1A1OA 4Y4HA 3LMJL 3F7PC 3CLEL 4UDUB 3V0AC 4HD5A 4XPTH 4Q9BA 3BGFB 2N59A 3TEZA 5GGSA 5F0LB 5T5NG 3T2PA 2W0PA 3LD8B 1PKQE 1W0WA 1UACL 4JG9A 4NQSA 4GAFB 3N9GL 5CSBA 2W0FA 1J0YA 1BVLA 3DBXA 5F89A 2MHAB 3NCYP 3FQRB 4IOIA 3EYFB 1UD5A 3S35X 4K2UL 5KYYB 3KHQA 3LXBA 2BIOA 2X4OA 3HN8A 2R0WL 4ODHL 1FFOA 5HHOA 1QTSA 2UXGA 4NC0B 3OPZL 4EO5A 4QXTB 4YDJA 4JFFB 3G9VA 1UCBL 1NKRA 5DQJB 4R0LB 3VXUD 3WKQA 2OMNA 1PZSA 1XGTB 1KTBA 3AU1A 3HE7B 1HYSC 2YXVA 3N41F 1RMFH 4A6YH 1RZQA 2QZ5A 3CHXA 4UYPA 1KCLA 5JW5A 3F8UB 1NGQL 3AG1B 2FO4A 4NZRL 1QP1A 5HVHB 5I73B 2X10A 2XQYK 3B4NA 4UT7L 4MS8D 3BZDA 3LPWA 4K2UH 3KLSA 2PTVA 2EJ1A 4D2NA 3QQ3A 1RCYA 5DK3A 4C4KO 5CBAB 5LWYH 3Q43A 2AQRA 3T8MA 3SDCB 2N7AA 1WT5C 4FABH 1BW8A 4NS0A 2JKTM 5DWPA 1JPSL 1H3VA 2HFEA 4A7GA 1JWMA 1PS3A 3UBHA 4FFZL 5D70H 3TH4T 5FR3A 1IV8A 5KVGE 2OULB 1J11A 2JKXA 2XZQL 3D18A 4Z1PA 1EAOA 1A1MB 4YC2B 1VGKA 2CWRA 3DJSA 1IC4H 3D51A 4U0QB 3ZE0E 4CKVX 4CADB 3ZDWA 5SV4A 4N2CA 4B9GA 4F37F 4X5PA 3DV4A 3KBHE 3ZKNC 2G30A 5I0VA 3HS8A 1B0IA 2C3VB 1B9KA 1GGYA 2CIKB 5CU5A 2WTOA 1QTYT 1CLYL 1UOVA 5DQJA 4JANA 4Q97A 4M1GL 2PYFA 5ID1A 1MCHA 5L88L 1S3RA 1OAYL 25C8L 1CGSL 3VW3L 4FQIL 4DESA 2XTJB 3GMMB 4K3DL 3H7LA 3MJ9L 4PB9L 5J56B 3BE1H 3FO1B 2HWZL 4PGZA 3WEOA 2Y3AA 2QQKH 5DD1L 4PWHA 5I15H 5K9JL 5EEWA 4N5EC 1DVFC 3A6BH 2KBGA 5A2IH 4R9HA 4RQQA 5JHBA 1MCRA 1W8EA 4QHLA 1BBDH 4PRDB 5EUKB 1HZHL 3BAXA 3KPSB 1EK3A 4X99A 1RK0B 1Y18A 2DQJH 3CBKB 3HG1B 2XZCH 2ZSVA 3T6VA 3RAJH 2VRKA 1DBAH 3EGXA 3V4PH 2BIHA 3H0TA 1NIFA 4UT6L 1ZOXA 4LL4A 5F0PB 1Z0MA 1UHVA 1YEFH 2O6FA 4L0PB 1U30A 4LHUB 5I82A 3TP4A 4C54A 4X4YA 2IBGA 5BQ7B 5J1AA 3ORJA 4BIKA 3OKLB 5TE7H 4M6OL 4LLQA 2P28B 3MRPA 2GJZA 4Y5XB 2CU9A 2CK0L 3DX1A 4WW2F 4YE4L 4PLJC 5FO7A 3T1WA 2ESVB 1OGTB 5DJ2A 4KNSA 4TLKA 1E6JL 2BY1A 1OARL 2LR4A 1NGYA 2XG4A 2X4SB 3ES6A 4RMTA 3VI4E 4TKWA 2C7UA 4UQDA 4ZQKB 1CFTA 3LIZA 4WUUB 1HDMA 3F7LA 2VDPB 1NC2D 4MB4A 1QRNB 4TUKH 4YBQC 1MOEA 3TO4A 1NGXA 3HNVL 1ZA3B 2LOEA 1J05A 3EDDA 4BQBA 5C0RH 3RX5A 2X4RA 2NT0A 4K3HA 3M8OH 2R69L 2J1KA 1L9OA 4FL4B 1PLGH 4PV9B 4ZI8A 4RGNE 4OLUH 3C2AL 2FEJA 1YN7B 5HYQA 4U1NA 3UZQA 2AXGA 1C5DB 4LXFA 5E7FA 2UWEB 4AXWB 3VXQB 5KS9E 3KPPA 4KHTL 2VGLM 4ETQA 4JRLA 4R7NB 5IKCA 3SQOL 4KKCD 2NY0B 4YDKH 4KKBD 4YDVA 2IH3B 1BSIA 5A2AA 2DMGA 3UIZA 5T1KA 2J5WA 2HG5A 4HUXA 1TCRB 3N40P 2ZOKA 1T5XB 2R0KL 5HGAA 4MMZC 5FYLD 4AYBA 1Q1JH 2AXJA 2OCFD 1BQHA 3CMOL 2BVUA 3DI2B 4PJIE 3FDWA 1IAOA 1E8ZA 1X3DA 3CFDB 2NXZC 1AD0A 3V4VA 4WSJA 5PCYA 2W9LA 3O9WA 2H7WA 5D55A 1A1NB 3FQXA 2YAEA 2ADGA 1L0QA 2NPLX 4JFDA 1IVLA 4WW1A 1FVDB 5HI3D 1U8KA 2AFNA 2IF7A 2WANA 5AW4B 2Y1AA 5TDOB 1FL5B 5FHAL 3V0WH 1XB6A 5KSBA 4WW2B 1A3QA 4QHMA 4UV4L 5DHVH 3UGXA 3UGEA 3S35H 4E9SA 3MUHL 3UZVB 2FLMA 5F3BA 1PY9A 2D4DA 1QFWL 1RZFH 2PUQT 1KPUA 2CLRB 4HBCH 4AW7A 4ELMA 5KS9F 3MRBA 3MV7E 4FF9A 3CU1A 2Q86A 2CZNA 4GT0A 1WDAA 3DTDA 4GMSH 2OW7A 5J1TC 1GYAA 5KOMC 2C3WA 1JZEA 3QCTL 4Y9FA 3NDZE 3RGHA 2BERA 4PG9B 4HOZA 5FWQA 2G3ZA 4Z7UA 3NCEB 2LU5A 5E8PB 4CAGA 5DJAA 2EH8H 4M7LT 3VWKA 5I8KH 5KG9A 3Q7JA 1W9XA 4C4KT 5I6MA 1LK3H 3IGLA 5DMGC 4Y1AA 5JO5A 1UOKA 3TJHD 3L9RB 3C9NB 4BRVA 4ZT1A 4HU2A 1YJDL 4GFTB 3LH2H 1J8SA 3AMKA 3WJJC 4K8RH 2WIIA 4ANXA 1G7LB 4HKZA 4NB7A 4BE5A 2WLIB 1DVYA 1FIEA 1OB1B 1GOFA 4XNZC 1E4XH 4M6NH 4P2QB 3OAZK 1DQVA 2QPFA 4HBQA 4G5ZH 3BAEH 1QKZL 2HT3C 2OM5A 2CNZA 4K8RC 5DMYA 4Z3TA 3QDJE 4WWKC 5F1SA 1TEGA 2HJLA 1PLAA 4G3YL 4KK6C 1AJ7H 3MU3A 1UEMA 4F9PA 4LFHD 2BVTA 1I7UA 2A77H 3SCMB 3GJFB 1DCEA 4IKKA 4Z7WF 3IDJB 3FQUB 4AJVA 3HCVB 4U33A 4KQ4L 2QSTA 4U1IA 1L9MA 3WXWL 2UV3A 4MNGE 3IT8D 3TT1H 4XE5B 1MN4A 3CZJA 4Y16B 1XT5A 5DWUL 5HGBB 3LX9A 4X4MA 5FV1L 5C0BB 3IWUA 3GBDA 5DF0A 3DBXB 1MCJA 5F89B 5B22A 3CQFA 2VDQB 1LDPH 4NX0A 3EJTA 5BZWB 3NG5A 1RZ7L 2HA1A 3H54A 4ZUWB 4JPIA 1DO5A 2HLFD 4JY6A 1P7KB 3V8CA 1QUNB 4ADGA 4PW4A 3K0WA 4IHBA 4FEMA 4R0LA 1YYML 3KNBA 1BQRA 3L08A 4HSCX 2O5YH 5DFAA 5IK3A 4F80A 4ABWA 1KUMA 1R19A 3KYNB 5LNGA 2YMOA 4GKNA 3ZW3A 4YHYB 1T7ZA 3QEQD 3ZTNL 2LVEA 4F2ME 3KPSE 3BUBA 4GG8B 1I3GH 1R3IH 2CXGA 5F0MB 3DUSA 4CMHB 5SX4I 5E8NA 2WLHA 3QDGA 4OZGA 3IK2A 2R2BA 1IZJA 3K74B 3SBWC 4Z7AA 1A5FL 1FO0H 1SEBA 4GXVL 2APVA 4K8RL 2ED9A 4L23A 4OCWL 3N3EA 3IKCA 3QIBD 4HXAH 3GGWA 3RWFB 3CV5A 2WBJB 3SGKC 5FW8A 5IUCA 3PAUA 1DL7L 2QR0A 1UM4L 3NPZB 4QR7A 3ZTCC 1M2VA 4OV6F 5C0CD 1N67A 1ZJBA 4ZMZA 2JWYA 3VFPB 1ZLUK 1DBJL 1QSED 1YZZA 7PAZA 4I5BB 4XP1L 4KKAD 4MGXA 5LNEA 5KSVA 2FSEA 2DM7A 4JQXA 4JDVB 3SPGA 4S10A 1T22A 5BS0D 4ELDA 4NQVA 2CRMA 1DE4B 3AU0A 5FXCH 3TYGH 1JK9A 5HXMA 2HT3D 3CFBB 3TTSA 3AXIA 3I75B 3W9EB 1OGAA 5LN4A 3DROB 1G7IA 3OLEA 2PYED 2CALA 4RA0C 3WS6C 4EZMA 4GYBA 1LO3H 1ASPA 4S1SL 3WN5C 2VISA 3O11A 2DI8A 1M1XB 3D39D 1F97A 4RWYL 2Z91A 3N42F 3ZMEA 2NDFA 4XO8A 4E5XA 3VNYA 3WLWC 4N5UA 5FK9B 3ABZA 2Q76B 4ZX4A 4W9FC 3P3UA 2FD6L 1IJ9A 4LPXA 4LRNH 3SQRA 4PRHE 4TNWK 2L7QA 2OX5A 3CZNA 4NZTH 1CGUA 1IAIL 1PEWA 1F6AB 1L3WA 1JGLL 1MH5A 4H8WC 4JG0H 3UTQA 3ECBB 4XNUH 5J11B 5F6IB 1CD1A 1CFVH 3FT9A 4HCFA 2EDJA 4WU7A 3SDDD 1E4WH 4KV5F 2Q7NA 3GXFA 2DIAA 5FYLE 3RIFK 1YYLL 2L7UA 4AG4L 2XPYA 5LAXB 2XCMC 1DVQA 2WTPA 5JYMA 2F8VA 1Y1DA 1TFHA 1E50A 2ADFH 4RAVA 3VGEA 1Q38A 3P73B 3OKYA 5EUOE 3LNHA 4KKLD 1J9QA 4P59H 5EB9A 2QQLH 1MFBH 5D1QC 4AJWA 1SM3H 3BPOB 5FGCE 3NFSL 4DP8X 4FERA 3BQUA 4O58H 4BGDA 2K6ZA 4XVOA 4XC3L 1O7DE 4NO5B 1J05B 3SD5A 2HT4C 4ZMOA 2VR5A 4MMXA 4GB9A 3MOAL 5FO9B 2JCCF 5DJYA 1UCTA 1N6UA 1CE1L 1QA9A 1RPKA 1G7PB 3MODL 1MUJB 1E6JH 4P0DA 2XIBA 2D9QB 1YC8A 3GNML 2VR3A 4I9WE 4O02B 4UZGA 3CXHJ 5ISZE 3PP3H 4HJGA 2P5WB 2OMUB 4PS8A 1MRCH 3NRFA 4OJYA 3Q2CA 4K07A 1QNIA 3L5WB 4DGYH 5FO8A 4M5TA 1M4KA 3GMLA 1G0XA 2OMVB 5BRQA 4ERSL 3HB3C 2Z35A 4G42B 2W0KA 2IANA 4HIEA 3TBYB 2VNCA 1UA6L 4ODVH 3MLWL 5TK4A 8PAZA 1JG9A 3MOAH 3OPUA 3VXPA 1H9DA 2OJEB 1XH0A 2PO6C 5IVNA 5DSCA 1DQQB 3T04D 3TO4D 4I18B 2Q0ZX 2OR9L 5IQNA 1KEGH 1A7RL 4G82A 4RBPK 5B1CA 3O41A 1YVLA 1KJVB 2V4LA 4F7EB 1AYRA 1KCVH 3II1A 2KZ1B 2J8UB 4ZX6A 1RUKL 3I9IA 1ASQA 3P9MA 5AW3B 4RGND 5JQHC 2AQPA 1M6OB 3VAEA 1QWNA 2PLTA 3ZPDA 3C5ZB 5J13B 3ZYZA 4LQFH 2OTPA 3L3JB 1HQRA 4TYUA 4HOWA 3R1GH 3NCCB 2EILB 4U2YA 1JNNL 5H2BA 5FFOA 4HK0B 5JW4M 5LGJB 2H1PL 3LZOA 1WVZA 1OZUA 1MRFL 1T7XA 3G5XB 4YXLL 5FYJU 4H5SB 2VAAA 3S5LA 5D71L 3FBQA 4KUZH 4KZEL 1BOGA 2JJTC 3W39A 1JHTA 1TPXC 2WZAA 3I84A 4TSCL 5E99H 5EBWB 3WUZA 2J88H 2HN7B 3E2HC 3OZ9H 3TA3D 3QFJB 2ITFA 2FECI 3N1QC 1AAJA 1KXTB 2R2EB 2G3XA 4H8VA 1XF4B 1Q0EA 4J3SA 3UTOA 3CN1A 2E27L 4I0PC 1JGDA 4P57B 1ND0B 2BVQB 1KULA 1A6UL 2GT9B 3QDGD 4KO5A 1HJCA 1HXYA 2EDYA 1JN6A 1P53A 3ZKND 4HGWA 2EEBA 5I6KA 5D7KD 3QO1A 4YSRA 1KMGA 5JIKA 1FCGA 1NCBL 2VERA 2WBXA 4XN1A 4PP1C 4XRCB 5T3XL 6FABL 5IHHA 3BSZL 4PV8B 1KLUB 2QGBA 1G7LA 1RPQA 1MDAA 2ATKA 3SDXF 1CCZA 4DP4X 5ICYB 5ESVB 3RGVA 5IB3A 3V5HA 2ZOUA 5CJ8A 5HVHC 2LE9A 1KWKA 3V79C 2JXMB 5D7JB 1JNLH 2IDSA 4JN1L 4Y7OC 5K9OA 2ZWKA 4R26L 4NZRH 3O6FC 2HWZH 4ZUVA 2BNRB 2HAZA 3SKMA 2K3HA 3BPOC 2ADYA 1U2YA 3CSFA 3FUHA 3S5LB 2A6DB 4CGUB 1BVNP 2ZT9C 3EDFA 4NQTA 2QGCA 5KSAD 3U1SH 3CMGA 3NZ8A 3VGHA 2H0JA 4D3CH 4Z5RB 4AIEA 1ETJA 2WY3B 1E2ZA 1YMHA 4NHCH 5IT2H 2GJJA 3CDCA 4O2CA 2ICCA 2A99A 4BFBD 4H25B 4WFEE 1D5IL 3ULUF 3LNEA 3N0AA 3P0VL 2B0SH 1I8KB 1LDSA 4U6VL 5FLUA 1QFOA 3HUJB 3OJDB 4F2MA 3RFZA 4XMTA 5MP6L 2FWOA 3M7OA 4WV1B 4RVBA 3QORA 4X50A 3T65A 1IGIL 4NPYB 1OP9A 1NLDH 2XXCB 2PP8A 3F05A 2IDUA 5BRZB 1KZYA 3BH8B 3FFCA 1SXAA 4XH2A 4A38A 3BZEA 1BF5A 2X6CA 4MAUH 1NMCB 3L4ZA 3QDGE 4LSUL 3N44F 3J2PA 4HJTA 5EO0A 2NSXA 1GAFH 4OIIH 3UDWA 4Z23A 2WSPA 3WXVL 5AW5B 1OZTG 1Z9OA 3AS3A 5FFLA 1NCDH 2IOIA 1KJ2A 3OR7A 2Y22A 3AACA 3D48R 3L4YA 4MJJA 4MD4A 4HZAA 3TBTB 2OCCB 4MJ6B 35C8L 4B7LA 2GIXA 4MS8C 5T3ZE 1VGEH 4OM1L 4DCQB 2HG5B 3KG5A 4HUXB 1C8QA 4AEHL 4ZFGH 1EHKB 5EOTB 2P26A 5E9NA 3U9PL 1EEZB 1YMHB 4TV3A 3LPGA 4ABVA 3FFCD 2R0ZH 1FNGA 2VQTA 5F7EH 2MTPA 2XG5B 1JNLL 1X5LA 3PJSA 1MRDL 5DMKB 3K2UH 3K6FA 3S34H 3EOYG 3ZE0B 1T2JA 4A7TA 1MG3C 2NQDA 1NFIB 1P84J 1U0QA 2DW5A 1ZV2A 2RD0A 4M8QA 2F68X 4XHJD 1QACA 4W9ZA 5D7KE 3S96A 2B1AL 3ZIYA 4YSAA 1EEYB 5AOKA 3BPCA 3B56A 3L5XL 1CE6B 3UZVA 1BBJA 4R4ND 3V6OE 1H8NA 5EU7C 1CXKA 3E7JA 2JCCA 2MQ0A 1CG9B 5E2UL 2V7HB 3QNXA 3VQLA 4JFDD 5F3HB 4TSCH 5D1ZB 4PJDE 3RY6C 3KPSA 2WZPD 3KL3A 2W60B 4G80A 4XWGH 4DCQA 4CU7A 4ELKB 1ACZA 2EEAA 3QEUB 4C56D 3OKEB 5JHLL 4L4TB 3HRZC 2PPFA 4ODXA 5I6XC 2AK4A 3MR9B 4LIQL 4G6MH 4HQQL 1R4XA 2EECA 2D0HA 4OI9A 2JB5H 1NAKL 5BRZE 4LHUA 1FG2B 5IJVA 3QDME 2V17H 3O2WH 3WIFA 1T1XA 4KXBA 1D6EB 1TZOA 2DKMA 1Q8MA 2YQBA 5C07D 3RZCC 3MV9E 1A1MA 1U8HB 4HV8B 1TZGL 1VA9A 4ZZFA 5DUPH 4M7KL 4JVPA 4PWIA 3UTQB 1XZ0A 1KGUA 1FPTL 4TPRH 3AREC 3ZYJA 2HTLD 1WCBB 4HFUL 4Y2NA 4IDJH 2W38A 4JNXA 3LN4B 4G11A 2IH8A 3MRQA 4P4KC 3NT0A 1TQBC 1DQJB 1HKFA 1N8OE 3O3AA 2VE6A 2X05A 3ARFB 2XNAB 4OLYL 1UA6H 4RGMB 5CSGA 3VXSD 2E75C 3ZN6A 2X4RB 2FR4A 3RJOA 3DRQA 5TH2B 2R29A 4QTHA 1BLNA 5HDOA 2XWBA 2ICEB 1T89C 1X7TA 3MRDA 1EGJH 4KX8A 4N0FB 2D7TH 4F3FA 2VXTH 5C0BE 1UADC 2X41A 4Q56A 1A4KA 4ENED 2O61A 5E5MA 2FUTA 4I13B 4L1LA 4QTIL 3VI3F 2BHUA 1AO7A 1NFDE 2EIEA 2J6EA 1CGVA 1OCZB 4PIRF 1HT6A 2F1EA 2MMXA 5D4QA 2A9MH 5KVDL 5INDA 5DMIL 4CVXA 3AITA 1CK0L 4LCVA 5IJDC 1XGQA 3UAAA 1XGZA 4JZNA 2J1XA 4OLYH 4Z6AT 4LEOA 3BH4A 5TE6L 2XQBL 5AW1B 4CBZA 4YDKL 2YRZA 1TNMA 1CWVA 4Z95L 4J4PC 3TN0D 4MCNA 3G6JF 5IEHB 3WU1A 2ORBH 3GB7A 4IDJL 5FF6B 1U8OA 4PUBL 1PLCA 5IESH 1CDIA 2XNAA 3RPIB 5B4MC 2WVVA 1CXIA 2F1AA 4O4YL 3M7FB 1GW0A 15C8H 1GMIA 1KF9B 1NJ9B 4G1EA 1JTTA 4YDZA 2CIIB 4HJEA 3AGVA 5JUEL 2GK2A 3JWNE 2F08A 3H9YA 1N8ZA 1AXSA 2R2CA 4N0FA 4PI0A 5E5LA 1WA2X 1NAKH 3O3BA 2J8UF 3KYOA 4JG0L 4APQD 4GP5B 4U1HA 3IGKA 4M1DH 4XO3A 1X9RA 3NP3A 3LKPB 4IOFC 3QIWB 1IM9B 3C5ZA 3VRJA 3L3OC 3DETC 1FDLH 4TXVB 1BVLB 4H4NA 4JRXA 4ZQTA 1CZ8L 3DX0A 4JZNB 3OKKB 4U6HA 2EE0A 1MWAH 4K9EC 3G5XA 3INUH 1MF2L 1B2WL 3STBA 3CVHB 5DUML 2DQ6A 4R97B 5IEHA 4CKQA 1DBAL 2FT6A 3BMWA 1LHZA 2BIQA 2HN7A 5ALBH 4MZIA 1FVCB 4P3CH 1C12A 2JKNA 4BJLA 5JW5B 1LEIA 2ZUSA 4GQ9L 3KYMA 4YOKA 3QZOA 3RZCB 3JYBA 3EXLA 2VDQL 2HVKB 1BF8A 4M3KB 3RX9A 3QQ9D 4XHQA 5HHOE 1XDTT 3MUUA 4RBPH 3ZL1A 5FOBB 5IOPB 5D2LB 1H5BA 3NUKA 3WAKA 4M1CC 4HULB 1NSNH 3L17A 4RNRA 3HE6A 1H0DA 1VZIA 2I9TA 5DZ9A 4DW2L 3L3GA 3I3DA 1UYWL 1LEKA 3FSVA 3ZRCC 1WWWX 5C09E 3HS0B 3IETA 4X7CC 1FO0A 1H9VA 1UENA 3UJTH 4RGMC 3VW3H 4ZOCA 3HMXL 1W72L 4PY7A 4M7KH 4WI0B 3HPJA 5F3BB 2R0LH 4C59B 2VM9A 1AHMA 4P2RA 2QPEB 2B8OT 1GZPB 3IXTB 1NCDL 3DJZA 2WQVA 4HWEL 4UOJA 4ZG1A 4PWGA 2I25N 3UTTA 3MX0A 3PP3K 2W59A 3KYAA 3T8XB 2X1WL 4M5YH 1QSEE 5J8OA 5TF1H 1CXFA 3TBVA 3WIFB 2IDQA 4KBPA 1Q90A 1YPZA 3VD9A 3GLEA 1BWMA 3OXSA 3SCMC 1I7ZB 3QEGL 1SJXA 5E8PA 4CSSA 4Y19A 1W2KT 3QDJA 4J39A 5DUJA 1ADQA 4BXVA 2NQCA 2YWZA 1IGJB 2XWJA 3K6IA 4F7PB 3N1PC 3FO2B 1MCCA 5EBLA 1N5AA 3B9AA 2ADJA 3KYNA 3GSUA 4UDTB 4N90E 5EFIA 2IDTA 4APQA 1VF5C 4AENB 2Z64C 1I9EA 4MFHA 4X7SL 3V5KB 5E8NB 3U1SL 1RULL 2ERJC 3HNSH 4PY7B 3RPBA 1I9IH 2DEXX 3CFQA 3NSDA 4EUPA 3H8NA 4LL9A 3AC0A 2BSEA 3GLDA 3UJIL 3FO0H 4LPYA 2L0DA 1MI5D 3S4SB 2IQ9L 3AAZB 3BPLB 5DZVA 4UTBH 3U2IA 3UROR 4ZXBC 1DJXA 3WIHL 5J1AB 5HVGB 1YN6A 1KDIA 3QEQB 1HL9A 1CI5A 2HH0L 4GBXD 5DK0B 5EIIG 2GJRA 4J3OF 4IGBD 3WNJA 2ZNWA 4JKMA 4ODBD 1RULH 2A6KA 2BFGA 5KBMA 2HFGL 5JA9A 3Q8EA 3SBPA 1NCJA 2C1PA 1AACA 3QJUB 1U8MB 4NZFA 4Z7IA 2YD9A 4DP7X 5JHDB 1SMOA 4J8RB 3KPRD 4ALAC 1ORSB 2YJQA 1LP9B 3V0FA 3WXVH 1TTFA 5IHUH 4GFXA 4PJ8A 3P9WB 2QKIB 3C5SB 2JB6A 2H0FA 4QRRD 1G7QA 5KYNA 1E5CA 4PU2A 4FE9A 1CDHA 1KJMB 2V3FA 2IDFA 4JFYA 3S37L 2ITCA 1E5BA 3PABB 1ZHBB 3WTUA 2NXYB 1EANA 1INDL 4UQ3B 4AQEB 2TAAA 1EUUA 4OU3A 3ZMNA 2XV6B 1ANUA 3HHMA 1E4KA 5CJBA 4XP9L 4B5ZA 2QL1A 4MJID 2Z31C 3LRSA 5C2UB 2I85A 5JIQA 3UYPA 4OZHA 1KENH 5SWZA 4MWFB 3TFKC 3BIBX 3GDBA 2JIXA 3DC0A 1DEEB 1KYDA 1HHIA 4NQCE 1T4KA 3QNYB 2ARJB 1KNOB 2AW2A 3BWUF 4YPGB 3STLA 1ZTXL 2AAVA 1FZKA 4DT2A 4NJ9H 2MCMA 3GMPB 4JDTL 1N3NB 3QUZB 4HJIA 1DJWA 3VGFA 3QNFA 3PWUB 3T4AB 4KK8D 5AQ0A 3QRGH 4PJEB 2NY7H 5HBBA 5KVEH 1XF5A 5I28A 4JM2F 1BZ7B 2WOYA 3KH3A 1M2VB 4XB3A 2AGJL 4UB0H 5E03A 1BCIA 5I26A 3NCMA 4F57H 2R7EB 3PNWA 4CC1A 5AB9A 1JGUH 3TZVA 3V10A 1FFPB 3X3FH 3RDTA 1AI1H 4WGVB 2F58H 5CKGA 5G5DA 1X7QA 1ZHBA 5ESAA 1XMEB 4NQEB 3E9TA 4PJXB 4DZ8B 3BHBB 2XETA 3BP7A 2R8SL 4A2EA 5INCA 3FBKA 4YAQA 1P6WA 1Q1JL 1V55B 2V33A 3CH1B 1N18A 3WUWG 1IARB 2GBVA 1JPTL 4KUCD 4PBWD 4RFNB 3KGTA 1K72A 2XWBB 3CPUA 5I1DA 3D2UD 4MA3B 1XR8B 5HDBB 4O2EB 3F7QA 4AK1A 4NRYA 4Y2DD 2ERJB 1MLCA 4YHLH 3HVDA 4AMKH 4O58L 1GZQB 3DTXB 4BKSC 4QY8A 5DVKA 1S7SA 3VGAB 1Q0YL 1ET5A 2X4QB 1JYXA 2CDFB 3U0TA 5FYKH 4OLUL 4YVNA 1T21A 4X6DB 1W0WB 1KYFA 1DANU 1JNNH 3I50L 2FIRT 5DZLA 4TRPL 3VXSE 3HN5A 4OVVA 1BM7A 3GZKA 2EDKA 3WFBL 5HYJA 2WXPA 1B6DA 1FFOB 1RZJL 4FMFA 3FB7B 4X9IA 1TVDA 2CM6A 3ARDC 3CZEA 3GFUA 3F58L 1SXNA 2XWJB 3GEWB 4JPSA 2NT1A 4F7PA 2HRGA 2WNXA 3MLVL 1GMEA 1OAZL 3GUFA 1UXMA 4QRPB 1ZLSL 1HDMB 4AYDC 4TLUA 3LHPL 3DX9A 2WKOA 2PETA 3BP6A 3ECVA 5T1DH 2WXLA 5E1AB 4YR6A 1PQZB 4UUJA 3OTTA 4LT7A 4L4JA 3QJTB 1ETB1 1G9HA 1BJ1J 4JRXE 4WJKB 4PGCB 2KQMA 4O9HH 3VGDA 1XHHA 4NNYA 3RBSA 4XVTH 1MCIA 3MLRH 5D7JC 4N8VA 5TGBA 2E9IA 5HI4C 4PJ8D 3UMNA 1O7VA 2XZCL 1B6UA 1MRCL 1RERA 4Y5XC 4YDJB 3OC5A 4GRLD 3GXMA 4JFDE 2XN0A 5DZPA 4K5OA 2AJYL 3HEIB 5D96B 5KJ4A 3K8LA 1EIBA 5J06A 4X7TB 1OAXH 3VX1A 3ZTDC 3ZE0F 4AV4A 5BOZG 1J5OL 2K8QA 2BJML 2AAAA 4DVRH 3H2QA 2UXVA 2XBDA 5IV2B 4WZ9A 1F90L 4YGAB 1W72B 4MD5B 5EZOH 1TVHB 2HVBA 4QRPA 2WTRA 1XL4A 2A74B 3QZLA 4FQHA 3PDOA 2WZPA 3EUUA 4ZNEE 2UWEF 3V55A 1OAYH 3RZWA 3G7TA 4M8UA 5CEYB 3QS2A 1UD6A 4BSJA 5D1ZA 4NXKA 3QFJD 3I2CL 1DLFL 2YGNA 4N8CH 2UY6A 4E5XG 4N0YL 2XKUA 3EO1A 5FKAB 1GYVA 3SDAC 1NGZB 3C87A 1GZHC 3GK8L 2PW2A 3EDKA 4BFJA 4DP1X 1RZPA 5CXPA 4JB9L 2CLZB 1A5FH 4N1CA 5AVXB 3PHQA 2IVFC 3PHAA 2F8XC 4FKEA 1NUNB 3LXAA 2XKNA 4XNUL 5D7LB 5GZNC 4XI5D 3CDGA 2NLJB 3FAWA 1UKTA 1RP9A 5K93A 4FFWD 2YQGA 2Q2LA 4L29B 1HE7A 4Y19E 2BNQE 2GW5A 1M9WA 4G8FB 1CD9B 1AP2A 2X70B 4F1ZA 1JDAA 5SWSD 4D0CB 4EI6A 1OTSD 1J1XL 2FRGP 2GCYB 5C0JB 2VN7A 3Q5TA 3G6JE 4MCYB 3BGMA 3O8XA 2N1KA 5KYUA 2V3EA 4F8LA 3VG0H 2VXQL 3L13A 2HFGH 3O0RH 4N2HA 1RZ7H 2I27N 2NW3A 1XF4A 4B9FA 4A67A 3BZEB 4FZ8H 3OHXB 4LSVH 3RVVC 3BUQA 3D8MA 3HRZB 4GLRH 1FN4B 2B9AA 3P4LA 2KUTA 3P4MA 3OGCB 3M07A 1W91A 3B2MA 2Y24A 3B2VH 3Q3GB 4GAAA 1V54B 2OTWA 4KI5C 5AUMA 4PBDA 1UD2A 2CGZA 1NCTA 2K4WA 4Z7VB 5EPMB 1HOCA 3HN3A 1KIRA 1I7UB 3B7UX 3VXRD 2GJ6A 2WLLB 2R1XA 1PSKL 5AZ2H 1EHLH 3BDYH 4JFZL 4UT6A 5BRZD 1J88A 1I1AC 1YEHL 3AQDA 4NJAL 5EWIL 2XN9A 3FQTA 1OQXA 1B90A 3T1FB 1NDMB 4UBDD 1WAAE 4ZYKB 2XTJE 4XBEH 1PNCA 1QR4A 3INOA 4PJDA 1ZVSB 1QKZH 1MW1A 2K70A 1KGXA 3N1GC 4ODSL 4BKLB 5C07E 4PY8J 3FCSB 5CF3A 3RVXC 1JZ3A 3EOTL 5K33A 3GB7B 1XF2A 2PNDA 5DHMC 3ZO0A 2UUDK 1XIWD 3FB6B 4L8BA 2IMNA 3NCWA 4XNZB 4NRZA 5F2FA 5B7EA 1WEJL 1TYRA 1K3ZA 5FUCE 1QYGH 4OBRA 1IM3D 1S78C 1EDQA 2OTUA 3IJEB 2FWOB 3MUGB 1U21A 4WV1A 3ZTNH 5D4IA 3OGCA 3QC5X 2PN5A 4PVMA 2VABA 4PWJA 1XEUA 3QB7C 2K78A 4HWEH 5BNXD 3NIGE 1X5KA 2X2JA 4U1HB 1HOCB 5F96H 2AJXL 3EOAB 3Q5YA 2GIMA 1JD7A 2D31B 4G9DB 4AWJC 1Z3GH 4Y4FC 2CBMA 1NGPH 2WLJA 5E70A 2VLMD 4PJCB 3SKOA 3QWOA 3EBGA 4AEIH 1P4LB 1WZKA 5I19H 2KT6A 4L0YA 3GI9L 3ZK0A 1DVFA 2FX8H 3MNVB 5G4OA 3Q01A 3U7AA 3BUIA 4WI2A 1E65A 2ZAIA 4WJ5B 5IMLB 2V2XB 1SDDB 3BVVA 3S2CA 3RNQB 5ES4B 3NCFB 4JFDB 2J6EL 4UOW0 5D1ZD 5ALCH 4E9LA 4QKTA 2ED7A 1F58L 5GGQH 4OD1H 3F12B 1JI1A 4B9JA 1KBGH 2VITB 4KVCL 5F6HJ 5BZXA 1HCVA 2R15A 1AJ7L 3CVIH 3UBGA 2IEPA 3DNKA 4HUCA 4ZOAA 2BWIA 2BVOB 1P1ZA 4IM8A 4IRZA 4DEPB 4ZS7H 1IIIA 3GWJA 4A7UA 3TJHC 3WUWB 4UNIA 4HK3N 3NJXA 2FQFA 4ZJ9A 3OMZA 1SFHA 2VISB 3O11B 5E0QA 5JXEA 2IV8A 4WI0A 1HI6A 4QXUH 3OHXC 3DXAB 1ZSHA 4TQEL 3S5LG 4N0UE 1C5DA 2HCZX 4R4BB 1I8LC 5E2TL 4AXWA 4Z7UB 4L3AA 3I6SA 4B27A 2WVUA 4HUKB 4N8CL 2F53D 4PM1A 5DQDL 2ESVD 1FNAA 1QO3B 2WB7A 5C0AB 4GG6E 2EKJA 2VDKH 3SDXE 1AO7B 3QI9C 3ZR6A 4IBSA 3OXRA 4F8PA 4L4TE 2Y06L 4YK4C 3HG0A 1FE8L 2XKNB 2B7DT 3X1GA 5KW9L 2BVPA 2ZUXA 3ARGC 1EUTA 3FT4B 3FT3B 5IB4B 3LEVL 3W11D 2YPLA 2DBJA 1FZJA 4JO5A 3P11L 1IFHH 1M42A 4C83B 1P2CA 2IADA 5JPNC 3FO2A 3T0EC 1N6QH 3RU8L 2EXSA 2OSWA 1SNRA 3ZDZE 1LO5B 2EXYC 5KVFH 2PF6A 1S3KL 3ASWA 4OJFL 3HMXA 5HGDA 3ME0A 4AQAB 2F53A 4R3SA 3D4CA 2H9GB 1SHWA 3NCXA 3BAWA 4LVOC 4E9VA 3FZUD 2QV4A 4HUWB 1ZDSA 2VMFA 4M48H 1UQSB 1DBBL 5AKVA 2K3TA 2VRAA 3BLBA 5F7WC 5FHAH 3W0WA 2H32B 2CMRH 4PRBB 4X6FA 4JO2H 1OP3K 5I0WA 4QTIH 1YMMD 2R4RH 3MLTA 3QUMB 1GYCA 3GSWA 5TDNA 2Q86B 1IKOP 4QRSA 3EHBD 5DJXB 1SRDA 1OPGL 4HLJA 5JTWA 4FXTA 5CZVH 3GNMH 3ARBD 4Y2OB 3TVMA 2I60H 1S7TA 4QJ3B 1MVUB 3ISRA 1I8MB 2FIKA 1U8NA 1F1GA 4UB0L 1HCYA 2I9LA 2NW2B 4HFWA 2FH6A 2N1TE 4ORGB 3MHZA 3QDHA 3NFSH 2EYRB 1ADQH 4FTVE 3ILPB 1CQYA 4HGMA 4JHWL 3DX6B 1LEIB 4PD4K 3NSFA 4J2XA 3JWDL 4JEGB 4LRIC 5BVJB 2NZ1A 1B0GA 2BC4B 4M4RA 4GUQA 1OCCB 2VC2H 2ZTBA 3KBPA 4FXGC 4IJ3B 2A9AA 4CSZA 3ZZSA 1QSVA 3FUJA 1JF5A 3CVHL 1OVZA 1AR1D 1QBLL 3FSAA 4NFDA 4AYID 2FO4B 2IAAC 2RTTA 2HLEB 3EW3B 4YHOH 3TA3A 3F65A 4Q0XH 3BXNA 2CIIA 3QQ9C 1BP3B 3KCPA 4FLOA 1FWXA 1MFCH 4RIRB 1BEXA 5EEUA 3SZ6A 2I32A 4G9DA 4XCFH 4PRPA 1YN7A 3BOVA 2MCG1 4I1NB 3FMGL 3KWVA 1T83C 2EDLA 4BRJA 5FS5A 2AJSH 2KDGA 4FCHA 4WLCA 3S3DB 1FZKB 2D7QA 1ZXQA 2K9FB 4AVJA 3CUPA 5IHUL 4JDVA 3L5XH 5TTRA 1U6AL 5DVMA 3G6DL 3KH4A 5FA4A 5C0CE 3FOLA 4GO9A 2HLAA 4F7TA 2DYSB 3V4PL 1NKOA 4U3CA 2OR7A 5E6YA 3ISYA 5SWZD 4IKJA 5IQ9B 2BDNL 4M56A 4L8CA 1JWUB 2X4PA 3GI8L 2ZCKH 3V9CA 3QIUB 5KVGH 4XX1G 1ND0A 2CHDA 4PRIE 2VL4A 4QRRE 4ZFZA 3EO9L 1NH6A 2ZKYA 3DGDA 4L5FE 4KROD 4M4RB 4OLVH 4PMEA 2EDRA 1ASOA 2YD8A 2QELA 5DMJB 1CLZH 4Q4IA 5J6SA 4DQAA 3HPLA 5DEFB 1I9RL 4NNPL 3CTTA 1OTUD 4EZKA 4NKDA 4A7VA 2HTKC 3LQAL 2VKXA 4W9JC 2B39A 4Z7WB 1A9VA 3DUSB 2FYYA 3ATFA 1ZLDA 5DD0H 4H8HA 5C0BD 3T9WA 2ZOOA 2APBA 3MRCB 3QULB 3FRUA 2FGWL 4IYKA 1QNZL 3WLBA 4E0RA 1FLRL 3MN8A 3IB4A 3ZL4L 2Q6WB 4CUCA 1UM6H 4Z78B 2ADIB 1QABA 2ALWA 2K45A 2PXYB 5DZNA 1FG2A 1X6NA 4C4UA 1IBDA 2X4UA 5ICZB 1GAFL 2IO5A 3OB0H 1AQHA 4PBVC 5ANME 2HLAB 3HW7A 3N55A 4QEGA 3SKNB 3QYNA 3EKCA 3SE9H 3T1FA 2KPNA 2YD0A 2WYZA 2ZUWA 5DI8B 1HL5A 5L6YL 1YHPA 1QSEB 2ZXCA 1TJIH 2NY5C 3E8UH 3DECA 1LE9B 1CFQB 4H0HB 5CLTA 4J3XA 4PJ7F 5IFHH 2ZX7A 5B1KA 2CCVA 2VERN 4YFLI 3OD3A 3VU2A 1X5FA 4Y1AB 5JO5B 3L7FA 3IXAA 3MMEA 3RA7H 2QSVA 3OJMB 3Q06A 5KBKA 1YY8B 3ROOB 1SLUA 3ARTA 4GG6A 2NY6D 1JYNA 3W0WD 3O2DL 3QIBB 5IT2L 4PJ6A 3WJMA 2G75B 4G7VH 4NM4L 2PR4H 4PB0H 1RSYA 5HJGA 2P7TA 3U6XA 2X38A 4X5LA 1MDTA 1KY6A 3W56A 4PRBA 4IRJD 2VABB 5FKPB 1SHMA 3D3VD 2YK1H 3RILA 4HIJA 1K8DA 3G6DH 4GRLC 4FXGB 3BI9X 3V6ZB 2G3MA 4ZUTA 1NC2A 5GGSB 1T0OA 4QWWC 1GIGL 1QBMH 5ADPL 2AJSL 2P42B 1BA9A 2GJ6E 4I4WA 1B4JH 2HXAA 2F53E 2Q3ZA 4RFNC 2QTEA 1OCOB 2DL2A 2PWFA 1JAEA 1NCAL 5I6OA 4IBYA 1TETL 5JPMA 3B6SA 5HP5A 2ZG3A 4KXZH 2FL5A 5DLMH 2GI7A 4MNQD 1G6RA 4LBEB 4AUUA 5EF1A 4B97A 1J8HD 5C3LD 4LP5A 1XGTA 3HE7A 4PJGA 3PE9A 3HG2A 2X44D 4FEIA 4YL9A 5IOKA 4LSRL 4QRBA 5F0JB 3NIGF 3P0YL 5AD0B 1TUPA 1IAKB 2Y36L 1UXLA 4P46B 1SQ2N 2C3HA 3X12B 1XF1A 4UM9A 4JHWH 2HVJA 3WFCH 1YJDH 1ZPLA 4GI6A 4JQIH 2V8LA 4PJHF 1WZ1H 1BBJB 2WUBL 5EF2A 3C5SA 5I6PA 3SPCA 2NY5H 4F58L 5A3ID 4GRMB 4N0UA 1A22B 1WE5A 3MVSA 4RSVA 5C0GA 5EIVA 3SKJL 5A1AA 4S1QH 3VM5A 1PZ3A 3NZHH 4M7LL 1RUAL 4MB1A 4GRWB 5CUSL 5ACLA 5A2KH 3NESA 3GSVB 4DERA 3K72A 3WOVA 3P2TA 5BV7B 1ET8A 1QHQA 3D06A 3FTVA 4G6FD 1NSNL 1GRWA 2HX7A 1JRHI 3MRBB 1EPFA 2D2CC 2Y1ZA 2WN2A 4YUEL 1GJUA 3AY4A 3GTVA 4FLQA 4QRAA 1IBGL 4R4FL 5DQ9B 2FT8A 4IW4C 3L3IB 1A7RH 1AGEA 4M8RA 4H2CA 2VSMB 3ARPA 5H37A 5EHFA 3NJHA 3ABMB 4O2CB 4P06A 3WO4C 3WNPA 4HDIB 5HYJB 3U7WH 1FAIH 4FI7A 2OZ4A 1KYOJ 4KX7A 1JPGB 2X6MA 1P84K 4AE0A 4ERSH 2HJFA 4U1LA 3BLPX 1SY6A 2VXUH 3H42H 3PY9A 2QQQA 4A7SA 4I0PD 3IDUA 3VXNB 4LGPB 1BZ7A 5JLZA 4XE0A 1F8TH 8FABA 1OK8A 1X5HA 3QG7H 1DVXA 2F15A 3I75A 3W9EA 3TN0C 5EZIH 1TQUA 3GQFA 3OHMB 3QJFB 4RGNB 2A74C 3KM2A 3D08A 4Q9RH 3TZVB 4DO6A 2J20A 4UQ2B 1Y18B 3AROA 3N85L 4Z5RA 3OKOB 4X6DF 5B3SB 5SWQB 3DX4A 2WOBA 3LIUA 3U9UA 2EC8A 4KGLA 3WGVB 4PY8I 5CUSH 5CM1A 3MJ7A 1MCWW 3DSFL 5E6ZA 5IFAH 2PXYA 3B8SA 1ED3A 4NUJB 2WLKA 3HUJA 3OJDA 1II4E 3B9DA 1J1PH 5BS0A 4AKOA 4YSPA 2A9NH 1KC5H 2XRAH 4KITB 3NJJA 3BSHA 3ESMA 1SMDA 3MRJB 4TVPL 1QSEA 5SWSE 4QMEA 4DKEH 4CSPA 5DUPL 1NBVL 5MI0C 2YJLA 3E1ZA 2OMWA 2H47C 2KZWA 3L9BA 1MWAB 1CVRA 3DGGA 3P3TA 2JIXD 2H5UA 3PWNB 3GXUB 5GGSY 3D0VA 4BFGA 5C0FA 4H0LC 2ZXWB 3FN0H 3KJ4B 4HQQH 1V8HA 1JV5A 1JZGA 2IAMA 4KVCH 3LXCA 3EJSA 1CICC 1TETH 4MBRA 1P1VA 4NO0D 5ESVA 1N0LB 1RFDH 5ERWB 2F19H 5JHMA 3FUEA 4I8DA 4N8UA 5H35B 3TFKD 4YDNA 2XTJC 4PJCF 3GO1H 1UZ6F 4PRPE 3SDCA 1PBYA 2BNRA 2R56H 4H88L 1OALA 2E6JA 4EJ1C 4JFWA 3HZVA 4RDBA 5CAYB 1L9NA 1ECYA 3KDMA 2NTFA 4N2LA 1XAKA 2N56A 3FN3A 3PXJA 4JZJC 1D7DA 5T3ZD 3NZ8B 3GXDA 4BQCA 5DRNB 1SJEA 4IIQC 2F7QA 3JT2A 1U2CA 2XKSA 2DQJL 5IVXA 3KEDA 3UTSD 2FB4H 4XPAH 4HCRA 5B39A 3OX8A 3A47A 3A21A 2BWDA 3TYGL 2FQEA 2AK1L 3GRWA 3LZFH 3T3MB 1CO1A 4EPSA 3QXTA 3OAYK 2X2HA 2P52A 3EGSA 1CD8A 4PGEB 2D73A 1CGYA 4KXAA 2F7OA 4X4KA 5EU3A 1R3LB 2H26B 1X7SA 5KEZA 4L8CB 4OF6A 5IFHL 3EFOA 1J48A 2K6YA 1A6PA 5I66B 4XN8A 4Y5YC 5D7IA 4Y4HC 2DJSA 2MPAH 2QFRA 1OGSA 3GRWL 3REWA 3AABA 1HNFA 4YZWA 1WGVA 3JXAA 4JO3H 4M1GH 3FC8A 4AW4A 4GLRI 2RAMA 2L04A 2D4FA 5B38B 3KEHA 1MNUH 4RISL 2GJ6B 1T7YA 5AW7B 5E5UB 4POYA 4NWUL 4P5TB 2NYYD 3JV4B 3QO0B 4GEJA 1T80A 2B4CC 5JHLA 4HS8L 2FJUB 2YPLD 1HL4A 1WC7A 4CN1A 3ZE2B 5FKAA 5J9PB 1ZGLM 4ZYKA 3V7AG 2MFNA 5I6NA 3D85D 1B4RA 1AS8A 1IZKA 2A0LC 4CW1B 5HDRA 2YPVH 4NNPH 3PWLA 3TBVB 2CBPA 3U30C 5D7LA 3NK4A 5IBLD 3CX5K 1INEH 2C9SA 3BDYL 5LCVL 2DLGA 4JJ5B 4A2HA 3MRLB 3H85A 5KBNC 3O3AB 4ZFOL 1TSRA 4RRPA 3VUAA 1L7IL 5EC2A 1IFGA 2B1HH 2ZOLA 4NHCL 4X4ME 5KZCB 5C97A 4D0CA 2EZ0D 3FCTA 3HZMB 1NGYB 1AZBA 2XG4B 1NGQH 2BSRA 3GHEH 1UZ8A 3ECUA 3CU7A 5AOMA 4BH8B 2VLRE 2EXWD 2QLYA 3MLSL 3NJFA 4LU5H 4UDTA 5JIPA 4AEHH 2CHWA 4RCAA 4ZFGL 1WZAA 3P0GB 3VD1A 4W6YB 2F18A 3ZE1E 1A7BA 1XGPB 3TEUA 4ODTL 1RHHA 2XJKA 4ZSOB 1XIWB 3V4UH 2J5LC 3ZHDA 4C56A 4XTRD 4FG4A 3TIEB 4L4TD 3T2NH 3V4VL 1U42A 3KPPB 2JTYA 4ZUVB 3G5VB 4UM8A 1YQVL 3QA3A 2E4FA 5CN2A 1GZQA 5JZ7D 1DZ0A 4PGDA 5GXBB 4ONGH 5ANMA 2MQGA 1N6VA 4UANA 3WY3A 4Z7QE 3UOAB 2A6IA 4MA7H 3QI9B 3HTLX 1NIBA 5C0IA 4JB9H 2JNZA 4JKWA 2WYHA 3GK8H 4CU8A 3A4AA 4CSTA 3QUGA 2FBRA 3LOWA 1K8IB 4N6RA 4AJYV 2OW6A 4JRYB 1CDGA 3IMRA 3KL5A 4WWKB 1IGYB 2NY2B 2W65B 3TPUA 5CEXA 1R3KA 4NKMB 4GMTL 1EVTC 3FU6A 1CBJA 1A14L 3OBAA 3U4EA 5AVRB 1OAUL 3WKPA 1P5UC 4AMWA 3BP6B 2XC8A 3RVXD 1YEKL 3ZE2F 5GGTH 3RZCA 3EH5B 2FGZA 3VFNB 3PWVA 1DSFL 4BK5C 3DO7A 4ZSOA 5GGVY 4H40A 3VRJB 5HHNB 2UZIH 1UA7A 1UEYA 3PGCB 1L7TL 1WWBX 5IP4A 4JKKA 3VFOB 1AXTH 4X80L 5IGXH 3ALXA 4LQ1A 2F54B 2YMXH 2GHZA 3BKCL 1LM8V 1PF3A 4MJ6A 1CXEA 5GRYA 4FA7B 2CK2A 4XVTL 2AXFA 1DEEA 2LU7A 2NZ9D 4D7BA 2NY3C 5CP3H 4G1MB 32C2A 4TUUA 4AIZB 3MLWH 4UQ9A 3RWIB 3T3PF 4P9HL 1XGYH 1OWRM 4A1RA 1KB5H 3MBXH 1PL3A 4HWBA 4X8JB 4X0NA 3LN5A 2QKIC 1TQVA 3TO4C 4FNQA 1NAMA 4RRPG 2EE9A 1AQ8A 3H1ZA 1OAZH 2QPUA 1RUMH 2QMKA 2XLLA 4R7LA 4YK4B 2DM4A 1Z7JA 4ZFFB 3WFZA 3MNZB 1U91A 3IN0A 1ZGLP 1ZRUA 1GGBL 2ZWYA 4HKZB 4KKPA 4P57A 4PJAF 4MNHB 1O6TA 2Y0SA 4OZHE 5L8KB 4JFUA 5ETUA 5FM8A 3EH4B 3L4TA 4K94H 5F6HI 4J4PA 2OI9B 4NHUA 1PZDA 2WIMA 4OZ4B 1X5YA 4MS6A 1MCNA 4XO9A 4ZXBD 1RUKH 1Q1PA 3QXAB 1VSCA 5DQDH 1HOEA 1NAMH 5FDYA 3UAJD 3U4AA 3EZJB 3IDJA 4TNFA 2AXFB 3WIIH 4A7GF 4AV0A 2EUVA 1RUML 2ZXBA 4GBXA 4YZFE 4IGBC 2O26U 1F18A 2YAQA 3RGVD 4B3VA 4DUVA 4X5WA 5F7DB 3S4SA 5E6RB 1CFQA 4LASL 3BUTA 5JHAA 3M1CA 1BQ5A 1J0ZA 1GGBH 3BESR 4JY4B 1J5DA 4K7PL 4KJQC 1FFTB 3PIQA 5E6SB 1SFDA 2X12A 1EHAA 3A0OA 4LKXB 2VXSH 1J9SA 4KTGA 4LLDA 1NBZB 3FH8A 1LO2L 2XXMB 5DA4A 5TFSH 4B7IA 5D1QD 1S8DA 5GRXG 3RZCD 1XCXA 3MA7A 5CFAA 2C1PB 2VLKA 3OZLA 4NQCD 1SYVB 1TENA 2BC4A 5IK3B 2AGJH 3HI6H 4DGWC 1IJNA 4G59C 4QRTB 4EUPB 2OJZL 1OCWL 1GGUA 4M5ZH 4Z7VF 1HCFX 4LMQE 4PJFA 2JB6B 2AHIA 4V1DD 1KELL 1G7QB 1PLBA 4FQPA 1WHOA 2IG2L 1RHHB 3GSOA 3NJGA 1BLNB 4JFPB 1MKFA 2PCXA 4K7PX 4G7VL 2XWCA 2Z34A 1AXTL 1FL3A 4X80H 5IGXL 4UIMB 4EVNB 2GBUA 1IEAA 2WWKT 4FD0A 4GMTH 5DJ0B 4EIUA 4FQLL 3SCMD 3OQ3B 1D9KC 4ATWA 4HJGB 4AEFA 4Z7UE 1NDGB 2OCJA 2EQDA 2YIHA 3KGSA 3OAZH 2IBZX 2XZAL 1C16A 4LOVA 4OVUA 3K80A 4MWFA 3CDZA 4X6BA 2GUYA 3PJNA 4EIBA 2NNXA 3NIDF 4FAAB 5J12B 1AR1B 2DQEL 2ICWJ 4NGHH 5GRUL 1WFMA 3PDGA 3QJQB 2EDTA 5ENWB 4ANVA 4EXKA 1FH5H 1OPOA 1SUHA 3ZT6A 1DCLA 2WMPA 3QUML 3LPFA 4CDGC 3K2KA 2JKLA 1ZIAA 3T8VA 1MLBB 2Z1KA 2YC1A 43C9B 4N6RB 1QSFE 4WWKA 1O9WA 1BMZA 3BZFB 3KLAB 5I76B 3KVQA 4MD5A 4GUPA 4WUUA 4IRJC 1KEML 1UWEL 5CJOH 4J7RA 1CDYA 4GOSA 1ZEAH 4R97C 3DROA 2ZWSA 2OMTB 4DFIA 4YBHA 2ISDA 2D03L 4N2MA 4AENA 1D7CA 1I85A 4AZUA 2UX7A 3D33A 3SD2A 5C0CA 4MQSB 2BINA 2XZQH 1UT1A 2W5PA 3G04B 4R7DB 5E56A 4EF3A 4M93C 2MOVA 4WI7A 1O0VA 1EEQA 4XOCA 3BAKA 4EI5C 2XVKA 3L95B 4UIMA 4X9GA 4EVNA 3IBEA 1WISA 3BGFC 2Z93B 3S4SG 3MJ6A 5KVDE 5GS2D 2J3SA 4H1LB 1BMGA 2FJHB 4YSOA 3KXFE 2L7EA 1IKNA 1YDPB 3LZFL 3PPSA 4KQ0A 1MCPH 3QO0A 1YEDB 4KKAC 4APQC 1XXFC 1JZ4A 1WFTA 4UTBL 5DHVA 1QHPA 2H2PD 3PUCA 3B2VL 1BXUA 2WMPB 1PD0A 3EO0B 3QZPA 3QRLA 4FMVA 4NI3A 2VDPL 4X9BA 4LSDA 5LO7A 3JWDC 3GBNH 1BIIA 5AL0A 5IJVB 5LBSL 2OKMA 3O9WB 3WNNA 3TT3H 1TVBB 3O0RL 3PWJA 3QHFL 3CPLA 4L9LB 1DQTA 4R2GD 2BCKB 2LFEA 5DC4B 1RZ8A 4QRRB 4G8IB 3MLUL 4JQIA 2AEOA 2M1KA 4N3TA 4RZCA 1T0NB 2XN1A 5BJTB 2EH7L 3BKMH 3W38A 3BRGC 1UZ8B 4PRID 2DYRB 3C6LA 2OXHA 2J56A 4YHNA 3BAYA 2BSTB 3SGKA 4JE4B 4IMLA 4I18C 5IMOA 1G4RA 5C09D 3CVDA 2DQFB 3BC9A 1DHKA 3NJLA 3O6ML 1MWOA 3VXOB 3M46A 2A4CA 3K8KA 1TPXB 3FSWA 1AMYA 2VC2L 1MHHA 1I7TB 3II3A 3RTQB 3QZWG 1G0DA 4XODA 3TIDA 4KK8C 1RK0A 3STZA 4S1DC 3X17A 1S7XB 2CD0A 1V27A 4LIQE 3QULA 4R96A 5AYTA 3ZYIA 4PGBB 5E5MB 4LPVA 3FT3A 1B4LA 2PYEA 5EN2A 3MBEB 4XBPB 3V5DA 2R0LL 5T1LD 4BZ2L 5BZDB 3GJEA 4FTVD 1KIPA 2X40A 4GSXA 1ZV5A 1DBKH 4FNLL 4J3OG 1AR1C 4TSAH 5GJSH 1NOAA 2W91A 4B0MB 2C8NA 4DW2H 4EI0A 2X4OB 1OM9A 1RJYB 5CZVL 2J4WH 5AVWB 2PPEA 4OCLC 4PVNA 2UY7A 2XY2A 5DJCB 4Q2ZB 5I1LB 2WNKA 4RAUB 3UO1H 4PLOB 4AMXA 1YY8A 3ROOA 2DMCA 4YHIA 1BPVA 5E8DL 4NNYB 2UZXA 3QZNA 4PJFB 3WTTA 2UWEE 4YAQB 5IWLA 3AQZA 3P3SA 2EIZB 2UZYA 4JDZA 4E41E 1ZCRA 3VRLF 4OZGF 2N7SA 2E6PA 4PG2A 1QD0A 5FUZH 3P30H 3STZB 2A73A 4MA3A 1G4MA 4RFOL 4BFFA 1I7RB 1MF2H 1JVKA 1WTLA 1N59B 4O5LH 4MYWB 4U1IB 3RDTC 5JOFA 1MWAL 3QWOB 3V0WL 4X5XA 4CN6A 3KPTA 3DX7B 4LHUD 2OYPA 4U3SA 1BWWA 3QQ4B 3WHXB 2PABA 1TF4A 5JW3H 4JM2B 5BZZA 3OWRA 1EZSA 3QIWA 4FDWA 2P46B 3BVNB 3L1EA 3NGBB 4HFWB 3TEXA 1OF0A 5AVYB 5ITFB 3E8VA 4RMWA 3FFOA 4F7CB 3IYLW 3RWIA 3CMOH 4R84A 3VCLA 5LDSA 1R3JB 3S3CB 5JMOC 15C8L 4ICXA 1YEJH 4Q4EA 3JVGC 5DHXB 2CRYA 1FE8H 1IUZA 3LKQA 3U1PA 5A3IC 3I6KB 4I0PA 1LP9A 3APCA 4NN7B 4WNQA 4HKJA 3ECWA 1ZS2A 4ZPTA 3SQOH 1VEPA 4TNEA 5D9SB 3R7RA 3AMLA 3QNXB 3CFEB 5ICYA 2HP4A 4ADIA 2JK5A 5T5NF 4YDLC 3ULVH 4OT1H 5E51A 2ITCB 2NX5A 1BEYL 1T5WB 4N8PA 4ZMYA 3TURA 1PLGL 4AGOA 5DMIH 3LKRA 1QFWH 1RZFL 2IXQA 4MJHA 2AK4B 3WDJA 1RZKL 4XNBA 2OK0L 1Z9LA 3NQKA 2B9BA 1TFPA 4G8FA 5H4ZA 2FH8A 5AB0A 3ULVD 4JFED 1QLFA 2CGRL 2NUPB 5J6GA 1CFBA 4DZBA 2FAUA 3FPXA 1TJXA 3NJNA 1WPCA 1VCAA 2WO2B 4HUNB 3VB9A 1H3PL 5JW3L 2QBWA 3MOQA 1CF1A 3MV9B 1JGUL 3MXVL 4AE1A 3IN2A 3TCXA 3ZKXB 2ZOLB 3U7WL 3C60A 4EAEA 4OZHF 4CN4A 2ZPKH 2ICWB 4N9OB 4YBQD 1XF2B 4IBZA 5F9JB 2ZX8A 4ODWA 1TTGA 3QR1A 1GOHA 4QRRA 3EDJA 3V4LA 3MRRA 1TZIA 2FQGA 3QXWA 4HUWA 4UTAL 1KT2B 5E6IB 5K1JA 5DK2A 3BP4B 4PVBA 1ONQA 1AQMA 3HG4A 2CUAA 3FB5A 5F9WB 5F96L 3APMA 4FNRA 4XNQB 3S8WA 2HKFH 2OXHB 3F7VA 3DOSA 1OF2B 1JFQL 3IE4A 5I17A 1FPTH 2JV6A 1PD1A 3WTXA 2ITEA 4FJYA 3A6BL 4QRSB 5AKSA 4HMCA 1KPRB 1U92B 3RA7L 1PX4A 4W6WB 2N4IA 3UAEA 5DURB 1D2PA 3ZR5A 1K4DB 3MZGB 1WZ1L 5D1ZC 4Y2OA 2IH9A 3TVMB 3NQIA 5MENA 3QJHB 4GQQA 4XWGL 2EINB 4R7NA 5IKCB 2FATL 1DUZA 1MFNA 5AW2B 4A7QA 2AZUA 3IRPX 4JFFE 1U33A 2C9QA 4FMKA 1EAPA 2JJSA 3ABGA 2XXFA 4AGNA 2NX5D 1D5BA 5B1BB 5AZUA 1HHKA 3OLGA 4BZ1A 1OE1A 3NOIA 3B1TA 3HFML 4CJ0A 3WIHA 1AQDB 4GUOA 1MJ8H 2X87A 3DK0A 4Z7VE 5E1IA 2BNUA 1FRGL 5GZNA 5GGRY 1ZA3A 3RGVC 3O6MH 3I02A 1OTTC 5AOIA 1UKQA 5EULV 4NJAH 3VXUE 4M3JA 2YAHA 3R4RA 4D9RE 4HSAC 1MCOL 5HVWA 2ZUVA 4OIAA 5DUBA 3AT8A 5I76A 5HYQB 2CBTA 3HOGA 3MCKA 3MV8B 5LGHH 2JLLA 1MRDH 4U49A 3T08A 4Z7UF 2JCCB 3FTSA 2D8KA 4QRUA 3S8FB 4NUMA 2JKSA 1U58A 1EQWA 1MEXL 4OLWL 5IW6A 4WI8A 1MJ7L 4P2AA 3N06B 4N2NA 1ZT7A 1RU9L 4K73A 2HB0A 4NQEE 2VUYA 5I2IA 4PW9A 3ZBMA 5J4MA 2VXQH 1J18A 2WKLA 3IKCB 4NM4H 3UYRH 2YSSA 3UTTD 3IVKA 4ZUSA 3DVGA 4OKVB 1UWXH 4OBSA 1EAPB 4FQIH 1JCVA 5C7XL 1IFRA 2VOTA 3L4UA 5CCKL 2I69A 3FCSA 3QJRB 5GRJH 4NKOB 3OPZH 2PYFB 5ID1B 1PKQB 2G4GA 4L05A 3LS4L 4TSBL 2EDBA 4BFIB 1C5CH 4NPJA 4DKFL 3VFRA 4AZ8B 1FIGL 2VZUA 2NZ9C 3P77A 3S5YA 2N0MA 1G0YR 2MSPA 3T4AA 1MW0A 3X12A 1IU1A 1FZMB 3VXUA 3ARGD 2BY3A 4BH8A 4ETYA 3HE6B 3QYMA 1MJJB 1U36A 1AG6A 1IX2A 1VFMA 4ZPTB 3MTRA 2ZX6A 3ZTEA 3CVHH 1XR9A 5LGKA 1RZIA 4CILA 3P9MB 2V5YA 2EDFA 4XXWA 2Y5QA 3WNMA 3CSPA 3AWGA 2BNQB 4OCYL 5CBAA 3ULUD 1KV7A 4LVHB 3Q1EA 3ZE1B 3KLLA 4GKSA 5GGUB 3N43B 1P7BA 2KI6A 2WAHA 4TNGA 4HCGA 4I9WD 3QR0A 3PCYA 4GW1A 4FHJA 2YZ8A 1QLRB 1UYWH 1A7QH 2R29H 5ICXB 3MLYL 3HCVA 1H3TA 5D72H 3W9DB 3W82A 2DEWX 4UTCA 1NCNA 1XZWA 1PKOA 3BUPA 4NO3B 4QY8B 4WKZB 1Z5HA 4Y4FA 2GUOA 4R26H 2E7LC 3QJSB 3C6LD 3FT2A 3QZBA 4W9KC 1JGDB 1VACB 2HRHA 1W6LA 3C5XA 1WFOA 1FZMA 3OLDA 3L3DA 1OPGH 1NBYA 1CLOH 1YG9A 3ALWA 5KYUB 2KYIA 3MCG1 4TUJB 4NKIL 2WYTA 4LLVA 4XCFL 1A6UH 5CZKA 3ZKMD 4GXFA 4MLSA 4XVUD 4PGJA 5C6TH 3T2QA 3HRZA 1T20A 2DIBA 2ZNXA 2FWSA 2VW4A 3D39B 4HIHA 2AK4E 3OC8A 3OZ9L 3G3LA 4NN5B 1F4WL 3W81A 2VMJA 1ZIBA 5GGUA 2VQUA 3OAYH 2HRPL 5FUOL 3DDGA 1MPAH 2DD8H 3O6KL 2GVYA 1FVEA 5MHSD 1Y1UA 3EYQD 3LTVA 2DIEA 2VXSL 3QUXC 4YDVB 3OMAB 4BFNA