2QZ5A

Crystal structure of the c-terminal domain of aida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
GTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQSLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Axin interactor, dorsalization associated protein
publication title Crystal Structure of the C-terminal domain of Aida
rcsb
source organism Mus musculus
molecule tags Signaling protein, lipid binding protein
total genus 31
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14186 Aida_C2 Cytoskeletal adhesion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2qz5A00
4ICXA 2K4AA 4QJ3B 4NPJA 2ENPA 4A55A 5JHAA 2NSQA 3PS6A 3R7RA 2WXKA 4XX5A 3RPBA 2FK9A 3ENEA 3GPEA 3L9BA 3TWYA 3W56A 1DJYA 4FADA 4QJ5B 3F05A 4LDCA 2WXOA 4L1BA 5G55A 4OVVA 3L16A 3PYCA 3QR1A 3QR0A 3S2AA 3OAWA 3PREA 4DK5A 2ENQA 4F91B 4FA6A 1WFMA 4PS8A 1UGKA 3DBSA 3L08A 3L13A 4GNKB 2WXLA 3TL5A 2CHWA 3IBEA 4AOFA 1E7UA 3W57A 3ZVVA 4KITB 3ML8A 3N5AA 2QZQA 2K45A 2CJTA 4LCVA 1E8XA 4HLEA 2ENJA 3LJ3A 2CM6A 2CHZA 2WXHA 4WAFA 4F1SA 3KWTA 2A5UA 5EDSA 3T8MA 1RLWA 1DJIA 2BWQA 3PFQA 3CSTA 4BFRA 4XE0A 4F93B 5CCJA 2KI6A 1A25A 2B3RA 3APDA 4G11A 4MJJA 4J6IA 1TJXA 4ANUA 1DJGA 2LHAA 2QZ5A 2Y3AA 3QK0A 4TS6A 1QASA 1E8ZA 3APFA 2ISDA 3R7QA 3TJPA 1YRKA 1DSYA 2Q3XA 3MJWA 4EZLA 3SD5A 4ANVA 3APCA 4WWNA 2DMGA 2WXQA 4JPSA 3DPDA 3QARA 3HN8A 2RD0A 3JZYA 4F92B 1E8YA 4FJZA 3FDWA 4ICWA 1HE8A 1DJHA 4TUUA 4GB9A 4Y1SA 3F01A 3QAQA 4XZ4A 2R83A 2WXRA 4L23A 2EP6A 2YRBA 1UOVA 1WFJA 1RH8A 2NCEA 2DMHA 4IQHA 4EZKA 3CSFA 2ZKMX 1BYNA 3RDJA 1QATA 2NQ3A 2N1TE 4Y1TA 4LT7A 4ANXA 3ZIMA 1DQVA 5T8IA 4NS0A 1GMIA 3PRZA 4IHBA 4KZCA 1DJXA 4OVUA 1CJYA 2V4LA 3M7FB 2WXIA 4WWPA 5H4YA 1TJMA 4AJWA 1DJZA 3IM1A 2CM5A 3HIZA 4L1LA 2WXGA 1BDYA 3F04A 3F00A 4BGDA 4FLHA 4PS7A 5JHBA 2JQZA 3L54A 2CHDA 2D8KA 5G2NA 3L4CA 4FJYA 4WEEA 4TV3A 2K3HA 1K5WA 2CJSA 2X38A 5CCGE 2Z0UA 4URKA 2UZPA 3NZSA 4ANWA 2WXFA 3P2BA 4PS3A 4V11A 1E90A 4NP9A 3L17A 4QJ4B 4FHJA 2WXPA 4FHKA 4QAMB 2WXMA 2K8MA 4L2YA 3OHMB 3KWUA 3FBKA 2YOAA 4NPKA 1BCIA 3NZUA 2Q0ZX 4DNLA 4EZJA 1E7VA 4WWOA 4HVBA 5H4ZA 1UOWA 1W15A 1DJWA 3HHMA 2FJUB 5CCHE 3QJZA 2WXJA 3NSJA 3ML9A 1W16A 4FULA 3ZW3A 5KJ7E 4KZ0A 2WXNA 2A4ZA 2CHXA 1E8WA 1RSYA 1V27A 3B7YA
chains in the Genus database with same CATH superfamily
5GRWA 2YAMA 1VCBC 1IBHA 4GAGH 1YEIH 3SDCA 1SYSB 4FG6D 3DGGB 2RFXB 4G9FB 4Y4KC 2VIRA 3QJOA 4UDTB 4XB3A 4HAFA 5EU6B 3FT3A 4FNPA 4ZK8A 5IHZB 1E5CA 2G3NA 4E36A 3CZUB 3B2VH 4GXUM 2J5WA 1TNMA 1RIVH 5E6YA 4LBEB 4PJ6A 3N44F 4DP6X 4Y4KA 1WPCA 4GAYB 4KNQA 1JF1B 5HHOA 1HSAA 5DD0L 1B4TA 2XKNB 3H9YA 1T1WB 2G3MA 4Z8FH 1BPLB 3UABA 4B0MB 4D9QE 4PVBA 2JI2A 4KGJA 2ICES 5ICYA 3L3KA 2CGRL 5I1JH 5J7CC 3QWQB 4IBSA 4BE5A 2K0RA 4Y5XB 5F9AC 1NGXA 2ZJSL 3D9AH 4FFZA 3CN3A 4LLWA 5JIHA 4K8RH 2ISDA 3S34L 3MREB 4J2QA 4PGDA 4K3HA 4KMLB 3QUKB 4IBQA 2KL6A 2FH8A 3UTSE 3CD4A 4GI6A 2IV8A 4N8VB 3OLIA 1BLNA 2V7NB 1MUJB 2JKIS 1GIGL 1K3IA 2RA1A 5DYFA 3GXFA 3SYCA 2OM5A 1K8DB 4JKNA 1I1AB 2EEBA 2OL3H 1OW0C 1EUUA 1K6QL 4KU1A 4ZNEE 4BFKA 3ULSA 1Z5LA 5JXEC 2JB5H 1IB5A 3AACA 4M7LH 4R4NC 3T8XB 4AT6B 5EOQL 5LUMA 1SJVA 3HIZA 1IEAB 2V37A 1OW0A 2RQ8A 4OFVA 1CBVH 5GRZA 2F1BA 4WNJA 3QNYB 5G2NA 5SWSD 1N26A 3EF4A 3ZDXE 5D1XE 3BZFA 2C9XA 2N0KA 4XVUC 2XPYA 1SFHA 3KYMA 2OZ4H 3HC3L 3QXUA 2LU3A 5J12B 5DS2A 1FGVH 1XR9A 5E6IB 2BWIA 5JR1H 5IGXH 4CKQA 1LO2H 1TSRA 4S1DC 1NCDL 2EDRA 3FTXA 1WEJL 2GAZA 3RQ3A 4HBCL 2PLTA 4UZSA 5D5ME 2C3HA 1YDPB 2O1AA 1FJ1A 1WBXB 4XPGH 2FJUB 4PJEE 2P7TA 1LM8V 1U93A 2VO8A 3VXOA 1SQ2N 4NM8L 1ET5A 3T1FA 4XBEH 1MCKA 3LKRB 1TZGH 1QSVA 1FC1A 4HIJB 4GAGL 4KKLD 5HD8D 1M9WA 5AENA 1TZHA 3EXJA 4MJIE 1H8OA 2DL2A 5DVPA 2YPLE 2X0WA 4E41E 4RQQA 1KXQE 4A04A 3L16A 5F7EH 3B2VL 1RIVL 2VDPL 4AIOA 2PP9A 4Z23A 1P7KA 3JQOB 3B9VA 3W9DA 2ADGA 5GZOD 5EIQA 4MX7A 1CFTA 2H6PB 4IKIA 3VJ6B 4ZMLA 1HZKA 3BMVA 1J87A 3PQYA 3SDDC 1K85A 4Z8FL 1Z32X 4JCWA 4RFEA 3GJFK 1AXTH 1UQSA 5JW4Q 2A9DA 3W0WE 5I1JL 4RX4A 1BD2E 4OLWH 3BAYA 3CXDL 2GT9B 2HG5A 2XTJE 3TA4D 1FHGA 4H1LA 3D9AL 5D8JH 1DJGA 3COOA 4K8RL 5BZWA 3GMNB 2YSSB 1FL5B 1F3RB 4EQ3A 1YNTA 2XNAA 4RETB 2KPNA 5IT2L 3DX6A 3ARED 1K5NB 5K59F 2DBJA 4YXKH 1CS6A 2IPTL 4QRTB 1A6TA 3VMNA 5DO8A 4XX1E 1JTOA 4PV9B 1KJVA 2O4EA 4QXGH 4HZLA 4MHHG 1RI8A 1OK0A 4AZ8B 1W0VA 3TZVB 1DO6A 4MQ7A 4GRWB 1UKTA 2Y3NA 2A2QT 3IGAA 4MAYD 4NQUA 3LRMA 1E27B 1EAQA 5TE7H 3OMNB 4ADJA 2NW2A 1J0HA 3GGWB 3MV8E 4LVNB 3QORA 4OZHF 5F0LB 4M7LL 1UB6A 2VKXA 5A16B 1M3IA 2GJ6B 5CKGA 1MFAL 2VDNH 3P1VA 2DM2A 2NUPB 3L81A 4CSZA 3QPQC 1FUNA 2KDYA 3D30A 1CLYL 2CO7B 2OCJA 2X4TA 3QUHA 2EKSB 3DUUA 1H15B 2G5RA 3E6HA 3EIFA 3G08A 2P8LB 3QNXB 5IKCB 4AGOA 3REWA 5ALCH 1D5XA 3BSZA 5C3LD 2QPFA 3D2UA 1IBFA 3FO9A 4RWYL 1FGVL 1TVDA 5T3ZE 2QQLH 5DJ8A 5JR1L 2Z34A 4KJYB 1I8MA 3QUZB 43CAA 1LO2L 3OLEA 3TN0D 4J8QA 2OJEB 4LLMB 3MO1B 2L0DA 2WQUA 5BS0D 3MRCA 4NXKA 5HGDA 1JZHA 5DRNA 1U58B 1R3HB 4XPGL 2BRRH 2R0KH 3CMGA 4GW4A 3OMZA 1G7PB 4Y2OA 4J3BA 3B8SA 2FGZA 1YMME 2CXKA 2XU9A 4O51B 4CW1B 4R0LA 2C1PB 3MMEB 4XBEL 3VFSA 1TZGL 4Z7VF 1QFWH 3ECUA 4CN6A 2IOMA 4X4XA 4AEFA 2BNRD 2ZP9A 3GI8H 4PVNA 1JVLA 3GSXA 1KF9B 1M7XA 2ZWSA 4PJAF 4TRPH 4PJAA 5GGSA 3NFPB 3U6RB 3ROOB 3IYLW 5IHWA 1S7VA 1MKFA 5T1LB 5F7EL 1DEEB 2EICA 3WHE0 2H45A 5L4MA 2EO7A 5HHPB 4J3OC 4XO5A 2JJTC 2FGWH 1TVHA 3GMQA 3TL5A 4PJ8C 3DV6B 2IF7A 2FQEA 4X6DF 4E9LA 2H6UA 3TF7C 1AXTL 2NY0C 4WV1B 3TC9A 4J3OF 1CFVH 5C0BA 1TEGA 3BZDA 4OLWL 5AKRA 2JJTA 3RI5K 3VTTA 5LXVA 1IC7H 3BP5B 4BSVA 3M6DA 5D8JL 3KPRB 4G11A 3GMRA 1PX3A 1UUSA 5I74C 2ZOKA 3WBDA 2AMGA 5AAWC 5KYWB 5ESVA 1KGCD 3KPQB 4WIQA 3NQKA 3WFDH 3RNKB 1H6FA 3CFDA 3QEQA 4QYAA 2WCPA 2AQRA 4N0CD 2OQJB 5FGRA 4DO5A 3BIKA 4NYLB 3VD0A 1GGBL 1YEDA 5EIIB 3V5HA 4U1GC 1K2DA 1TXKA 1K4CA 2W9EL 5CZVH 1QR4A 3CVDA 4WGKA 2Y69B 3OKKA 5TE7L 1KLFA 3F7YA 3FFCA 3QUGA 1KPRB 3CSFA 3MV7D 4Q9QL 4IBLT 1JRHL 1P6WA 4IKKA 4R5TA 1MFCH 5CWSB 1CLVA 3D87B 3VGDA 3V6OC 5CJ5A 2VDNL 2F5BH 2F54B 2PTTB 4X7FC 1FVEB 4KZCA 4G7VH 3AADB 2ADJB 2OI9B 2F53D 1AR1B 5B8CC 2QADD 1IGJB 5LBGA 1NM9A 4Y9CA 1MCIA 5C0FA 3MRHA 1KPVA 1W2KT 3QG6B 1IUZA 2BP8A 2FYVA 3ESMA 2ZG2A 3X14A 4TV3A 1N12A 3AQZA 4PB9H 4QOKD 2QQLL 4J1UA 1M9SA 1ROWA 4L9DA 5FM4A 4PV1C 5DFVD 1J86A 1TCMA 3N1FC 4YSOA 3LPGA 3CBKB 3TA3A 2G9HA 2DMKA 4Z76B 3HBQA 1D5BA 3TJHD 4GJTB 3L9EA 3STLB 1PVHA 2BRRL 1FN4A 5FYLH 3UYRH 1WC7B 4MJ2A 1JHTB 3RNQB 4HUWA 4PJIA 1MFDL 4P46D 4UNUA 4W9JC 5DLML 4EIGB 1QPXA 1BOYA 1H3VA 5EOTA 1QFWL 4NKMB 4K73A 3GI8L 2Q6WB 3RIKA 5HPMB 2QGDA 1BZQK 3GXNA 4PTTA 3L3OB 1CD9B 5F96L 3DTDA 2QLVB 1MPAH 4LEXH 2OSWA 3L7FA 4G82A 4FFVD 4NCC1 3EDJA 4TQEH 4NPYB 3IKCB 2X4PB 3ASWA 3EH3B 1FL6B 2ZX9A 3TNMA 3LDBC 5DK0A 1OY3B 1N8ZA 1T3FA 5AUMB 5FK9B 1I1FB 3IFLL 5EU4B 2IALB 3QJFA 5I28A 2GPZA 1COBA 2V0AA 3FFDA 5CR1A 4GRLA 2X3CA 1CFVL 4GQPH 3SDCB 2EXYD 1Y0LA 4YHYC 3KNBA 1GZQA 2PP8A 4RMBA 3VFGH 2VIRB 3OKYA 4GRMA 5D7JD 2NT0A 1ZV2A 3UC2A 4UNVA 3HS9A 1Y7VA 3IFPA 1PAZA 3FT3B 2BSDA 4HZAA 2FL5A 1CD1A 5BUAA 2JCCA 1HQ4A 2LOEA 1DSYA 2WQ8A 2Y5TA 5F1SA 3MUJA 2V3EA 4Y4KB 3C2AH 1PZ3A 5DZNA 5HHOB 1HSAB 3F7QA 3WFDL 3PIQA 3LPWA 4QF1A 2WJ7A 2QJDA 4UOQA 3PFUA 4OI9A 4CC1A 3MV9E 3CQFA 5ICYB 5CZVL 5F6HI 3L3KB 5ACZA 1P5UC 2CO1A 3SQRA 3FHQA 1AMYA 1UOVA 4RA3A 3U1SL 3HKZA 5DCCA 5IHLB 1NGXB 4YPGA 3CZJA 4LLWB 1X7TA 1BBJA 4OZFA 4ILDA 4NAJA 2F5BL 2O6FA 4PGDB 4G7VL 3LXAA 4IMLA 4X5WA 1ZVHA 3ATFA 3SGEH 4ONOA 1N4XL 2WSPA 1BLNB 4HK3J 1F4XL 1WAAA 3VM7A 5IFAH 1AS7A 4F9PC 1HK6A 2AK4A 3GBDA 3N3EA 4L4TD 2KLTA 4U0RC 2ARJQ 3IETA 1OAXH 4PRDA 3VXNA 3ULSB 1YECH 3HRPA 1Z5LB 4FXLA 2WQWA 5DWUH 1OD9A 4FQ1H 4S11A 1Y6KR 1AHWC 2VZOA 4MZ2A 2RACA 3L3DA 1ZLWK 5FYLL 3UYRL 3BYYA 1ZKAA 3F58L 4EN3C 3MQIA 3DIFA 2NYKA 1I9IH 2WYIA 3E0GA 1TZIA 5MI0B 2WWMC 4X7CC 1W16A 2AEIT 3W5MA 3BN3B 3BZFB 3CHQA 4MQSB 1AHWA 3A5VA 4XN5A 2BK8A 3GM8A 4N9GA 4YDKH 3KYMB 4FQ2H 3ZPDA 1NC4D 3OL2A 1UA3A 1XSIA 1XR9B 4XAWH 4KKRA 4BHUI 4EN3A 5IUSA 5T1MA 1YN6A 4P48A 1MJ8L 3WS6C 4F33A 1MPAL 1WAPA 4YDNA 4TQEL 4G2AA 4XOCA 2GAZB 4F57H 4EJ1C 4IBUA 2EDOA 3KDPB 1FJ1B 3MTRA 2PN5A 3SE9H 2YD5A 2P7TB 4KPHH 1U93B 4Q89A 3JV6A 3WS6A 2WANA 2R15A 3IBEA 3VXOB 1WHOA 3DJSA 4Y9EA 5GXBB 2MQCA 3O3DA 1CICC 3T1FB 3S7GA 2ESVA 5LQBH 5CJXC 3TBWA 5JORA 5A3ID 2AEPL 2NZIA 3K2MC 1TZHB 3MBEA 3VFGL 1HU8A 3QAZC 4UQAA 3N04A 4NC2B 4PJ7F 1WS8A 2VR4A 4RQQB 1QRNA 2OPCA 1KYDA 4QRQA 1MY7A 1Y1UA 4HVBA 1P7KB 3W9DB 2ADGB 3MCLL 3PXHA 1ZXKA 1CFTB 2XVBA 4MX7B 2WLJA 3WCYA 2ROYA 5HDWA 1Z66A 2PCPA 3GI9L 1EEYA 1CGTA 1EERB 3PQYB 4ENZA 1U33A 3VXQA 1X44A 4RFEB 1NIAA 4XCYA 4ZFGH 2YA1A 3AT9A 1SHXA 1UQSB 1FPTH 4HUMB 2W91A 3PWPD 1KT2A 4PAZA 3IJ7A 4HMDA 2HG5B 1T7WA 5G4NA 1UD4A 4OUUA 2NOYA 4IHOA 4GO9A 4CVUA 4H1LB 3SDYH 5BZWB 3CPUA 3V7AE 1YNTB 5JLZA 2XNAB 1F4WH 2AJVH 3DX6B 2Z4TA 1URZA 1JNHA 1A6TB 3N1MC 1KJVB 1PZBA 1RK7A 3CCHA 4HZLB 5HDLA 5IFAL 1NAKH 4HT1H 2GTZA 3LPPA 4FQXC 4M62H 3D25A 1W0VB 4WJKB 4ZO7A 4EN2A 3BVTA 4MQ7B 1ACXA 3IGAB 2BERA 2Z65C 1OAXL 3C12A 3CHOA 4PPTA 5F7HA 5L6YH 1BXXA 1F58H 4MA7H 2NW2B 1YAZA 3EJRA 1UD2A 4UTAH 1YA5A 4OF7A 3QORB 2XWDA 4FQ1L 4HWUA 1UB6B 5CO1A 5DWUL 5HDRA 2COVD 3RGVA 3II2A 4FQXA 3MUUA 1MCNA 4BSJA 5ADPL 1IM3D 2EIKB 5I1EL 3STBA 4WO4C 2X4TB 1I9IL 2HMIC 1QVOA 3DUUB 4RZKA 2ENSA 3E6HB 2EADA 3G08B 4YDKL 5TDOA 4MB3A 2VSMB 3REWB 4HEPA 2EUWA 1D5XB 4DKEH 4JCMA 3D2UB 1IAII 4FQ2L 4JFZH 3BQVA 3FO9B 1I82A 3HCVA 4WEBH 4XAWL 5DJ8B 4F15C 2ALAA 3E1ZA 1I8MB 4HJ0C 3G9AB 4WO4A 2FATH 3PGFH 4KI1A 43CAB 3CZKA 3LN5A 2E56A 3GPEA 4ES9A 1P5VA 4IBWA 3F3HA 1SF5A 4DUWA 3FRPG 1AGEA 4F57L 1QSED 1BEYH 5DSCA 5HSFA 4CMHC 3MRCB 3QEGL 5HGDB 4I18C 2Y1VA 3BO8A 5DRNB 4AQ8C 3FT4A 2AMUA 4GW4B 3SE9L 2BP0A 4ZPVA 4BUHA 4KPHL 2FVNA 4OIIH 4Y2OB 1F3DH 2F74A 4UF7C 4R0LB 3VFSB 3OD3A 3DX0A 2NXZB 4L8SC 2YC1A 3ZSTA 3BAWA 5B1BB 1M56B 4I18A 4X4XB 1M1SA 4AQ8A 3D51A 3GSXB 3I74A 4JZNA 4E2OA 5F7MC 5DDHA 3EGXA 4LQFH 4PJAB 5GGSB 5T3ZH 1S7VB 1YYMH 4N2IA 3BKJH 1CDJA 5C0GA 1NBVH 5GS2H 2PWFA 3MJWA 1JZ7A 3GMQB 3X2QB 1TVHB 7PCYA 2CJ3A 2HUHA 4EKXA 1GY1A 4LF3A 2R56H 1OSPH 3FQ1A 3OKNA 1IC0A 3NAAH 4ZFGL 1G1YA 4PP1C 3SE3C 5C0BB 3E2HC 4QGYA 4BSVB 2YAHA 4ZQKA 1VEOA 4DGVL 2QDWA 2MNWA 3GMRB 2F9BT 1KGXA 2HFGH 3SE3A 2ZOKB 1F56A 2JFCA 1XBRA 2AJVL 2W0KA 2CNYA 5ESVB 1VDGA 3VUAA 2D0HA 2IXQA 4WHCA 3FMGH 2P5EE 3CFDB 4BH7A 3MKGA 3PV6A 1SPDA 3QEQB 1IAIM 5FUOL 1XL4A 3RIFF 1NAKL 4HT1L 2DYSB 5I74B 3BIKB 2NUTA 5A40E 1YEDB 4WWKD 3GZPA 4L4VD 1K2DB 3V5HB 1K4CB 4NRXA 3ZDWA 5F0PB 1ND0A 3OKKB 3TT3L 1KLFB 3F7YB 3FFCB 5L6YL 4RDBA 1F58L 1PX4A 2Z8RA 4MA7L 3T0XA 2IMNA 1VPOH 3U2JA 1BWWA 1ZPUA 4R4FH 1DVTA 2QVMA 3QHTC 2YFOA 4H2CA 4NPKA 4WU5A 1A1MA 1OZUA 1ADWA 1S46A 4PJHA 2NY2D 1ID5I 2JE8A 3ZTJH 5C0FB 1BYPA 3MRHB 1KPVB 4QHKJ 4YBQC 5HI5D 1LHZA 2BP8B 5AKTA 3VSQA 4ZMPA 3X14B 2XN9E 1I8KA 4JFZL 4WEBL 3V0AC 4LCIH 4OCSL 4J1UB 4Z77A 3ELQA 4Y4FC 2PPCA 3ARFD 3FSOA 3C6SA 3TA3B 1VSCA 2G9HB 1D5BB 1KC5H 2XJLA 1BEYL 2IPKA 2DQCH 2NZ9C 2HTKC 1DSWA 1PCXA 2ED7A 4I77H 5E0QA 1FN4B 3IT8D 4Y4FA 1FNSL 4OIIL 1OF2A 2EUVA 4HUWB 4PJIB 2XN0A 2JKXA 4GXVH 4FTDA 5EOTB 2OAAA 4KK5D 2Q7NA 4FQHA 3ZHDA 5DJAA 2Y7LA 2CM6A 2XV0A 2VH5L 1XGYL 4PTTB 3DARA 1E67A 4LQFL 4V2CB 5T3ZL 1R4XA 3UBXG 1YYML 1M7IA 3ATDA 4OJYA 2ZXWB 3L7FB 4XE0A 3RAJH 3BUYA 3ZTNH 4G8EA 1NBVL 1UD5A 4HGKC 4DO4A 2HTLC 3T3ME 5HYSA 3TNMB 2LR4A 5DK0B 1N8ZB 1RULL 1T3FB 3QB7C 1I1RA 3QJFB 4FOMA 1LDPH 3OSKA 4ZYKA 1OSPL 4JFSA 4AH2A 4JB9H 1BF5A 3FOLA 3NAAL 3DK2A 4FTVE 3FFDB 2HRPL 4GRLB 2HVBA 3FO0L 4R83A 1Q9KA 1XF1A 1Y0LB 4JZOA 4X9YA 4AL8C 3KNBB 5TK4A 1GZQB 3JUZA 1M57B 4GRMB 5EZLA 5ECJE 5GJTH 1BMWA 2OBGA 3IFPB 5CJBA 4FQLH 4IQHA 4EZKA 1S78C 2FL5B 1CD1B 2JCCB 4Y7MA 1HQ4B 3II1A 5IVXA 4CL7A 2Y5TB 4XP4H 3AS2A 1OAYH 4G6JH 5IVZA 3AXIA 4RGNE 2J43A 2JSFA 3BH9A 4GW5A 3PIQB 1NKGA 3L4VA 3O6LH 4QF1B 3DJZA 3H9ZA 4YHLH 2E7BA 5D72H 2FO4A 4W4OC 2CPUA 2JELH 4S2SA 4YSEA 1NFDA 1SOQA 4TXVB 4L48A 5ACZB 1DVQA 4MZIA 4KRLB 2ZIDA 5F0MB 3GPSA 4XOEA 5ELIA 1QR1A 4OLZL 4OD2A 1HDMA 1OAZH 4YPGB 4R4FL 1BBJB 4OZFB 4JDTL 4F2FA 1E5AA 4IRJA 3FTZA 4MD0A 3O3UN 3KLDA 1NUGA 2F7IA 4W4OA 4LPCA 4IMLB 4U3HA 4X5WB 1UC6A 1CGSL 1ZE3H 3QIBD 2J1KA 2PO6C 2IIJA 2VDQH 4JO8A 4LCIL 4HZ1A 3VGAC 5FYKU 3TURA 4YDVA 2X7LA 2AK4B 3QCUH 2M83A 3VSUA 4XPAH 3IETB 4PRDB 3VXNB 1MCSA 3BH8A 3IKKA 5LGYA 1IBGL 1DJYA 2DQCL 4KTEH 3CH8A 2HLFC 3GQFA 3L3DB 2ZKYA 4I77L 1N5AA 4OVVA 5EU7E 4H8PA 1YJDH 4JFDA 4LDOB 4PS4H 4JJ5A 2JLLA 3DIFB 4K7PX 2YGNA 1LQSR 1TZIB 1NCUA 4GXVL 4K5PA 1NMBH 5KBMA 5IBLD 2FEJA 3RL2A 4KRPB 1AHWB 5HJGA 2KDGA 4N9GB 4HHAA 4HV8A 4JPVH 4C4BA 3DOSA 3VDBA 1PZUB 4EN3B 2CHZA 1JZDC 3DROA 4OF3A 3JWOC 3CDCA 4OUOA 1YN6B 5T1MB 3ZYOA 5C2UB 1R5VA 1TF4A 3FXIC 4NZUH 1KV3A 3GWJA 4F33B 5AVQB 3PWJA 3RAJL 3ZTNL 3BE1L 4HIEA 1A64A 4K3JH 1OAQH 1EHXA 2KQNA 1WT5C 4WTQA 2DAVA 1YRKA 4ELMA 2AV7A 5I19H 3SYAA 5GS0C 3JV6B 1LDPL 4KTDH 5DQJA 4MQTB 2JKTM 4JB9L 2OMBA 2VM3A 3K3QA 3O3DB 2BSED 3SKOA 3OJMB 2ESVB 1KWGA 1LP9E 1DQIA 3SZKC 5JORB 3TBWB 1WT5A 4NNPH 2GW5A 1M7DA 1NOFA 1UXMA 2YHGA 2Z7WA 3DX8A 3MBEB 5GJTL 2I9TA 5LAPA 3U46A 2XWTA 4WHDA 1KJ2A 4FQLL 1QRNB 3FF8A 4QRQB 3PAZA 4LT7A 1BBDH 4N6QA 1I3UA 4CADA 4ZX5A 5EOCH 1YUHA 4LLDA 3QAZB 1OAYL 3BD4A 4PJ9C 2PCPB 4G6JL 1EEYB 1GMIA 1LD9A 3EDEA 4I7ZC 5EUOA 4M56A 3VRLE 5I1HH 2VMCA 1T83C 3O6LL 3BGFC 3T6XA 3VXQB 4YHLL 3UPAA 4XCYB 5D72L 5GHWH 2C5DC 4UB0H 1K9TA 2D8KA 2JELL 1J5DA 1KT2B 1KZQA 2VM9A 5J11C 2YQ3A 3BT2H 5AAWA 1RHHA 1T0MA 2X1XR 4PJ9A 2EACA 4OUUB 3QRFM 2K8QA 4IHOB 1OAZL 3V8CA 3UEQA 3NJLA 3S37H 2YD1A 3N91A 3CG8A 5JLZB 4M7JH 1XH3A 2C3WA 3BN9D 1P53A 1CQYA 3EBIA 5BZZA 5TD4A 1JNHB 3SO3B 4G83A 3QDAA 1CVSC 1N8OE 3CCHB 4P5SA 2VM4A 2GTZB 3D25B 4BXSV 3ZXAC 3WTXA 4F7CA 4LSDA 3ZE2E 3AQXA 4YOKA 4P57A 4PJCF 2DWYA 1FFRA 4XCNA 5I0VA 1B0IA 3ISWA 4AGLA 1KB5H 2F7RA 3RGVB 1WAEA 2N1KA 4FQXB 4P0DA 3VFWA 4IEFA 3S6CA 4PS4L 4PJDA 3QZWG 2ICWA 3S2AA 4W68A 5D7LA 1QVOB 5LWYH 1NTDA 3UYPA 3C60D 1ADQA 2FQGA 5TDOB 1TUPA 3EZ8A 3S97C 3W57A 2VLKA 3HCVB 3PGCA 4H5SA 2KZ1B 3VH8G 1CGUA 5LNDA 4K7PH 3X1GA 5IHBA 3GS0A 4WO4B 3LN5B 4NUGH 4NZUL 1MNUH 4AMKH 2J8HA 1P5VB 4UQBA 9PCYA 1AGEB 4P23C 4K3JL 4P9HC 3T3PF 1OAQL 5DSCB 4I1PA 4JPWH 3VSTA 2ITDA 1M71A 3BO8B 3R06A 3FT4B 3CZLA 4AV5A 2BP0B 4ZPVB 4ZS6C 4W9FC 4OM1H 4KTDL 4ANVA 3MROA 2ADYA 2F74B 1IQDA 1EWHA 4NQDE 3VD7A 3SE8H 2BSRA 2YC1B 4QHMA 1D7BA 2IBBA 3M86A 4I18B 4NNPL 3DETC 5A2CA 3DMMD 2VWEE 3EHBB 2Y7NA 4KK9C 4P06A 4OKVA 4JZNB 4OZGF 3MX0A 5DDHB 3EGXB 1MCEA 3ZYIA 2MHAA 3FQWA 1JHKL 3SD2A 5KWYC 3CXFA 2M8XA 1QFUH 3M46A 3WFZA 2FEDC 4IGBD 4XCEA 5C7ZA 3WV0A 5C0GB 1BBDL 1N68A 1J0KA 1PEZA 3HE6D 5TQ2L 3DYOA 2BVYA 3MJ8A 4YUEH 3FU3A 4C56E 5I1HL 2EJ1A 5AB2A 1OV8A 3PRZA 1UGNA 2H8PA 3QRGH 4LF3B 2X4UA 4MNQD 5IBUG 1VFAA 3OKNB 4Y2DC 1T7YA 4C4UA 2EDBA 4N90D 3KE0A 3QJVB 5GHWL 2R39A 4NQQA 4KV5E 4UB0L 3CFQA 3FZUD 4AITA 3BYTA 4M5TA 4P59L 4DOHE 3BT2L 4GO6B 1NC2D 4GAJL 5FA4A 4ZQKB 4HSCX 4IBYA 2EEXA 4Y2DA 5GSVA 2V7HA 3T0EC 4CJ1A 3S37L 3UAEA 5HYFA 1DANU 1FCCA 3EYUH 5CLZA 5MERA 1ZPLA 2DH3A 3E2HB 4M7JL 3ZZ1A 4JDVA 5BS0E 1TU2A 1FA4A 1VZGA 3QI9D 1G94A 1ED3A 5J3HD 3HPLA 3T4YA 2IXQB 5JOFA 3QO0A 2Z31D 3HMXL 4BH7B 5E08H 4IW4C 1WBYA 1IJ9A 3PV6B 1DJWA 3T0EA 3IN2A 1UXLA 2NUTB 4KKAD 4TL5A 4NRXB 1ND0B 1PNDA 4AYBA 5FO8A 3CFEA 5H8DA 5I23A 1Z1WA 4ESKA 1KB5L 2FHBA 2XC8A 5BRZD 3QJRB 2XA8H 4WU5B 2BM3A 1P7QD 1A1MB 5E1HB 5AVYB 1WK0A 4LCWE 4FRWA 3HAEG 5I6XB 1ZIAA 4PJHB 4HAKA 5LWYL 3HLAA 5GRYA 3NQIA 4PG2C 5FF6A 1JUFA 4U4IA 3GHBH 1HHJA 4PWEA 1CDHA 1I8KB 3N6YA 4N5ED 1P7BA 2DZEA 4K7PL 1MDAA 4R2GB 4DP9X 4Z77B 5AG9A 4UANA 5IMLA 2BIOA 4NUGL 1OGAE 1MNUL 2OJZH 3C6SB 1NEUA 2V5YA 2DI7A 3AWGA 4FQCH 1UXSA 1IAKA 2YBGA 3N40F 2Q3ZA 1TT6A 1WIOA 2IPKB 4JPWL 1HN1A 1JXGA 1MW0A 3QCTH 3PDDA 5CXPA 3AG4B 4UV7H 4AWJC 4Y4FB 1HZLA 4Y1AD 4OM1L 3FH8A 1OF2B 3I6LD 5I8EA 1BG1A 1KGCE 1S8DA 1CDGA 3KHQA 3MGAA 2FCBA 1AYRA 2DMGA 2BNQD 1KEGH 3HN8A 4FQHB 5DJAB 4Z78A 1SOSA 2R2BA 3N42B 4QYOA 1TTBA 4JE4B 2A4CA 1EO5A 3LB6D 4N2LA 3QUXD 1CGWA 3X1EA 3IAQA 1M7IB 5C08A 1HOEA 1QFUL 4TTDC 3BUYB 2APBA 1ID2A 2GUYA 4G8EB 3KCWA 2WBJA 2ZX7A 3FPXA 3VI3F 5HYSB 3IDGA 4G59C 2HJLA 2KC0A 1PDKA 3IRCA 1JVOA 2FBRA 5D2NC 4E5XG 3IDIA 1D5IL 1IT9H 2F53E 4RBPH 4ZYKB 3IDYC 4AH2B 3LS5H 2WO2B 1DLFH 3FOLB 3QHZL 5F7BA 4XWGH 2HLAA 1ICTA 4LB8A 3NJXA 1R3LA 1Q9KB 4GLRI 4JZOB 5D2NA 1X6LA 3OTTA 1WGOA 4QOKE 4WEEA 5EZLB 2ICWJ 3WEMA 1NIDA 3CZGA 1Q9LA 2GC4C 3U6XA 3O2DA 3FYIB 4NP9A 4PD4K 3EYUL 3L7EA 1IBYA 3LQMA 5IVXB 4YGVA 1JGDA 4XI5C 4S0TD 2CRIA 5J6SA 5JOPE 2QSQA 3KS0J 5IVZB 4W93A 4GG6F 1WICA 2XI9A 3BH9B 4GW5B 3FT9A 5E08L 2I60L 1DUZA 3FRUA 1MWAA 3DO3A 3QZPA 3HHMA 2XG4A 2FO4B 3RTQD 1V5JA 5IIEA 3Q48A 4S2SB 3RZCD 1NFDB 2XWCA 2GG1A 3JV0A 4WGVB 5TDPA 4PIBA 4MRCA 5DRZA 1QR1B 1GHFH 4Z3EA 3QIUC 2VR6A 1HDMB 4OD2B 4UT7L 1SXCA 4POYA 3NJHA 1TQUA 1JYVA 1NCTA 4P3CH 5JUEL 3TBYA 4IRJB 2XA8L 5DVNA 3LZFL 4MD0B 3RE0A 3CSYA 4NO2A 5AW5B 4XTRC 2EVGA 5EZOL 4M93C 3PYCA 4AIEA 4N2MA 5IB1A 1DN0A 1X6NA 3NOIA 1E3XA 2X1PA 3GHBL 2MTAA 4ZXBA 1IIIA 3C5ZC 4MCNA 4N1CA 4OW6A 3L48A 2CR3A 1U8HA 2IPUG 4M02A 4YDVB 2QZQA 2X7LB 3ZE1B 4PSPA 4G8GA 4Y19D 3WEOA 4L3AA 5B1AB 2ZX5A 5LXGH 2OJZL 2A9MH 4IIQC 3BH8B 5B38G 3IMSA 3DHPA 4QRFA 4BRVA 1MN4A 3U7AA 3C5ZA 1CURA 2XBDA 4WI3A 3QCTL 4XXDA 3VGAB 2YJLA 1N5AB 5CCJA 4UV7L 4JFDB 2E7LA 3BAKA 1IGCH 1AC0A 4JG5A 4JJ5B 3PWUA 5C0CA 1E28A 1BM3H 4BEIA 3ZZQA 3RL2B 4Z3TA 1CYXA 2O26U 1VERA 1DDTA 1WFIA 2MOGA 2P8MA 2X42A 4HHAB 4HV8B 4NBZB 3UAJD 3WL9A 3DOSB 3HE7C 5GPRA 3TH3T 1V3JA 3DROB 5KYUA 4GRWE 3BKYH 4LGSB 1R5VB 1HKFA 3BCDA 4NC0B 4R97B 3PWJB 3VA2C 1T66C 4BQ8A 1MCQA 3CWGA 3P30L 4HIEB 2QQKH 3RVXD 5FGCB 2AS5M 3AB0C 2ZKMX 1X3DA 1WTGT 3BUBA 3HE7A 3ZDZF 2WQRA 4ELMB 1IGFH 2GITA 4Y16D 2AV7B 3CX2A 1IT9L 5DQJB 3CUPA 3LS5L 1MY5A 3MN8A 4JN1L 3FU9A 3SKOB 5SWZD 1LO4H 3H56A 1NPNA 1RUKH 4UYQA 4Y9FA 4NN5B 1M7DB 3R4DA 3DX8B 2I9TB 3U46B 4L4TE 3T6ZA 2XWTB 4MS6A 1KJ2B 5JW4R 3V4UH 4EUPA 3MRDA 3WLWC 1E90A 3IMTA 3QZMA 4CADB 4ZDHA 5IW1A 1YUHB 2OMZA 2WY3B 1MCRA 4LLDB 3TCXA 1YYLH 5EUOB 1AIFA 1LD9B 1BEXA 2AEWA 1WISA 3WJJC 1X5FA 3V4LA 4EAEA 3UTTA 4OI7A 2PMZA 2FIKA 4JBSA 4CBZA 1BQKA 2DTMH 4AQ1C 5KBDA 1LJMA 2UY7A 5HHMD 1RHHB 1T0MB 4PJ9B 3RWDA 3WJJA 1GHFL 4ICXA 1QFPA 2A73A 2K4AA 3BGFB 4BCZA 4IJ3C 3KVDD 4P3CL 3NJJA 3RUGA 4G6KH 1LK3H 3ESPA 3LH9A 1P4UA 2VN3A 1SVBA 1XH3B 2DEXX 5IB5A 5J11B 1A7RH 2VJXA 5GS3A 4JO4H 5KZCB 2VLRD 3TFKC 3CFIC 3T0WA 4HK0A 1FNEA 1XBDA 5E95B 3ZKND 2EDHA 5AOMA 3KLQA 4F7CB 1W6LA 1OPGH 4RAHA 4P57B 5LXGL 3U9UA 3GSQA 3LJ3A 3QQDA 4XCNB 5CGYD 5DJ0A 1S7QA 4BZ2L 4FAAB 3VO0A 4K8RC 2ODHA 3LN4A 4X98A 3VFWB 4IEFB 1IGCL 4PJDB 2YRZA 2ICWB 4R26H 3UJTH 5D7LB 3FSWA 4PJ5E 3IS1X 1UWEH 3IPEA 1H6EA 3WTUA 3T2PA 1BM3L 3UYPB 4N8VG 4F2ME 2NY1C 4L3EA 2O6PA 3SD5A 3WIIH 2JVUA 1SXSA 4KHTH 3K4DA 2C9VA 4Q6IC 4QR7A 2V8MA 2VLKB 2NYYD 2IBZY 3QRBA 1YPZF 3PGCB 3QWOA 4H5SB 5F7DA 5D4HA 2KPWA 4V1DA 4O00A 2X2HA 5JQHC 4HJUA 2G5UA 2QQKL 4OKDA 4PGZA 4Q6IA 1EXGA 2ITDB 1M71B 1TQVA 2QMKA 5GGUA 3R06B 2N1TE 3DXAD 1S7RA 3FC8A 1KY7A 1VJSA 2WK2A 5GGRY 2O5XL 5CN2A 4P2RE 1F13A 3NN8A 3MROB 3L2NA 1IQDB 2BSRB 2WVVA 3GZKA 4J3VA 4Z0BH 4QHMB 3WKYA 1LO4L 2KZKA 4B9PA 4XHJC 5HGGS 3VXME 1AGDA 1RUKL 3FCGA 4OKVB 1NUNB 1SJEA 1OEZW 1Y18A 4DW2H 4Z7NB 3MX0B 2F7OA 2MHAB 3FQWB 1P6AB 4URKA 1C7TA 3NIFF 1LO3H 3TEZA 4C83B 1MZYA 3K71A 2IANA 2LFEA 3FU0A 4EXPX 4XCEB 2HKAA 4JO2H 2E7CA 2NCMA 1ULVA 4L05A 2W9DH 3D3VA 4KNSA 1Q0EA 3MJ8B 1YYLL 1IM9A 1AO7E 2D3JA 4P04A 2YMOA 2H8PB 3QJSB 5E8EA 2X4UB 3G5WA 1A1OA 1VFAB 2O6CA 2O6EA 1KJ3L 5CGBA 1W15A 3B3BA 2H26A 3VMOA 2DTML 2VCOA 1IRAY 5E9DD 1YNLH 3PL6C 4YAQA 3UBHA 4LPYA 4JREC 3U9PH 1G5GA 5FA4B 3ILQC 1L6PA 4N2BA 4UIMA 4IRSD 1XTMA 4LAJH 3T2QA 4Y2DB 5GSVB 2V7HB 4G6KL 3LZNA 4U1JA 5JTWA 3LRHA 5MERB 3HBGA 3FB7A 4JDVB 1TU2B 3CVHH 4WCYH 3JTTA 1A7RL 1ED3B 2Q9OA 3HPLB 3T4YB 4R8WH 1MRFH 2LLLA 4PGCA 3QO0B 5JOFB 1WBYB 3QH3A 4MA8H 4B9IA 1YEGL 3T0EB 1UD6A 2W38A 4M1GH 4C58B 2YD9A 4NO0A 3V0WL 1IAIL 1OPGL 3I9IA 4TSBH 5FO8B 3EJYD 3CFEB 4AC4A 3LSOA 5FYJD 1GRWA 3QYCA 3D4ZA 2H0EA 4XBPA 4HW6A 5DQDH 2IDTA 3NPZB 5EDSA 5F1OB 4Z7WF 4Z7WA 3RWJA 3UJTL 1Z9NA 1ESOA 1FIGH 2V5SA 4YBHA 3HLAB 3ETSA 2NXYD 3GEWB 5FF6B 4CU6A 1JUFB 3WIIL 1HHJB 3B2XA 3N0AA 4KHTL 4OGAC 4D0CA 3JWDH 2DM4A 4JRYD 5T5FH 1SM3L 3VXSA 1C5DA 4YE4H 4HGWA 4QXWA 4X7DC 5IMLB 2QQNH 5TJWK 3GDBA 5I8CA 3O0RH 1UXSB 1IAKB 2PP7A 1EHAA 2ZUSA 1AKPA 1OL0A 3O3AA 1WZ1H 2WZ5A 2HWZH 4GS7C 4Q7DA 2WN3A 5JHDD 4HCFA 5TFSH 1FFNA 3M17A 1IGMH 2TSBA 5I8EB 3G7TA 1W0WA 3TESA 2CBOA 3AJ7A 1Q72L 1S8DB 4YHZH 5D2LA 2WLNA 2H2SC 4AJWA 1NKRA 3VVVA 4Z78B 2R2BB 4QYOB 2QHRH 3VWJD 4G8FA 4DW2L 2B9AA 4FLHA 4K5OA 2K9UA 3ARDD 2PXYC 1G7IA 1KCVH 4TNFA 3W5NA 5C08B 1LO3L 5HJBA 2EDDA 4CILA 4LARH 3V5DA 3M88A 4JO2L 2E6JA 1V3MA 4YXLH 2WBJB 3MLRH 5A6LA 3UG3A 5J8OA 4R7XA 3RKDC 3IDGB 2HJLB 2W9DL 1PDKB 3HHSA 3IWVA 1E4HA 3NCCB 4EMZA 4PGJA 4WI8A 3IDIB 2PXYA 5D7KD 3MGTA 3L1FA 3K81A 5L88H 1QEXA 4LHQB 5FPIA 1P0SE 2HLAB 3EDKA 3BDXA 2AJ3A 2IBZX 4DGUA 1KYUA 1R3LB 2FD6H 3BZ4A 4GSDH 4NUQA 1YNLL 5D2NB 1W72L 4YR6A 2RQEA 3DDGA 3I75A 4FYQA 2WYZA 3U9PL 1Q9LB 1BGXL 2F58H 1XIWC 1A6VH 2FRGP 3DWTA 3IDYB 1EQWA 2LTQC 5DJXA 5BOZG 2NTFA 2EEFA 3FTUA 3L3GA 4HS8H 3L7EB 4OZIF 2I69A 3GM0A 2B1AH 3L9BA 4ORGA 4WCYL 4YGVB 1JGDB 1V10A 5C07D 3FHAA 4R8WL 1MRFL 2B1HH 1AE6H 1IBZA 1NZRA 1XIWA 2LABA 4GINA 1QABA 4GUQA 4MA8L 1DUZB 4I88A 4HCRL 3FRUB 1MWAB 2WUBH 3LTVA 4MXWH 4XB7A 2XG4B 4M1GL 5IIEB 3OJ2C 4TSBL 1L9OA 1XSKA 5TDPB 2Y07L 3N5AA 5AW8B 3II3A 3MLUH 5DRZB 2ZXEB 4LRNH 1ZLUH 2EIMB 3ALPA 1A3ZA 5LG1A 2DJSA 5DQDL 4BZ1L 3TBYB 2DMCA 3EGDA 3CSYB 3CIAA 4NO2B 2LU7A 1FIGL 4ZODA 4CA4A 4KK6D 5HI4C 3ZGIA 4A7QA 1DN0B 3JWNG 4RGOL 5IB1B 4RDQG 4N3UA 5JA9A 2ED6A 1QSZA 3BFQG 4ZXBB 4D3CH 4A2LA 2VKWA 3MNZA 2DJ4A 3WGUB 3WXVH 3JWDL 1U8HB 5EIIG 5T5FL 3V9FA 2OMXA 3CVIH 1DQQA 4G8GB 4M93B 2QQNL 4FXGC 1WSST 2AJSH 3BPOB 1J8HE 3MRQA 4FJZA 3N85L 2BCKA 4B9CA 3C5ZB 4RESB 4OGQC 1F4YH 1WZ1L 2E47A 4XXDB 2HWZL 5DD1H 2XN1A 2G2NA 3U4BL 43C9A 3O8XC 3PWUB 5FYKD 3RDJA 2X4OA 1IGML 4A7SA 4FXGA 4UAHA 5C0CB 4JM0A 4W4NA 4YHZL 1E28B 5H37G 2XIDA 3ABGA 3TOPA 4MB1A 4EBQH 2AQNA 4Y9GA 1L3NA 2P8MB 2QHRL 3AAZA 3HG0A 3WL9B 1P9MC 1MCHA 3O8XA 1TZOA 4QEGA 1P2CA 3JV5A 5KYUB 3ARXA 2FDBP 4QRRA 4PRIA 1KCVL 1PNCA 1JF5A 4OAWA 3O4LD 3B5TA 2CA3A 4LARL 4YXLL 1OIOA 2E9BA 3MLRL 4IK7A 5DD6A 2XY1A 3VTAA 3HE7B 5GZNC 1XGQA 1MW2A 3OWRA 4PVLA 1MCOH 5FCUH 2MKWA 1UWYA 4ZO9A 2GITB 1XB3A 2E9GA 4BE6A 3ZE0B 1U3HC 3CUPB 4MCYA 5L88L 5BRPA 3EAKA 4J3UA 1R46A 3ZDYF 4Y5VC 2FD6L 3IMUA 5GZNA 3H9SA 4GSDL 4MDJA 3A0OA 1OTUD 4WI9A 3WS3A 3SZ6A 2F58L 4HBQA 1A6VL 1U3HA 2EECA 4EUPB 1J05A 3POCA 4NRYA 3MRDB 3NIDE 3ESOA 4GRWH 4HS8L 4Y5VA 3TZVD 2B1AL 4ZDHB 5IW1B 3ESUF 2OMZB 1MWOA 4UOW0 1DJSA 1S3RA 3WHE1 1GZHA 3B43A 1AIFB 2B1HL 3PPSA 1AE6L 4JQXC 1KIUA 3QGVA 4X0NA 4BSWA 5F7UA 2QSTA 2LLGA 3TLRA 2J8UE 5FHAH 2WUBL 4IOSD 3UTTB 3LIZH 1UGKA 4ZZFA 1VADA 2FIKB 3DBSA 2Z0BA 4AK1A 3O3BA 4KAQH 5K33A 4D7BA 7PAZA 1ECZA 4U1HA 1A9EA 1BFSA 1R17A 2UY7B 2X4RA 3RWDB 2FYYA 2R29L 3MLUL 2A73B 4LRNL 4KY1H 4K9EL 3RUGB 5D1QD 1XGUA 1JIBA 3CGTA 4LSVH 4W70A 5D7HA 4KRNA 5IB5B 3RWEA 3P3RA 3NPSC 3QUZD 4FCHA 2HT2D 3EYVA 3APDA 3B2UD 1LQBC 5SX5H 3I84A 4IJ3B 4D3CL 1S9XA 4HK0B 1FNEB 5HYJD 2VDPB 3DVIA 3EJTA 2LGNA 3CVIL 4ZMOA 1BX2A 4U7SA 4AQZA 2RD0A 5C0RH 4X83A 5CLTA 1QNZH 3U9UB 3GSQB 3QQDB 4RSVA 2AXGA 5DJ0B 5EC1A 1S7QB 1RY7B 3T6VA 3VB8A 4P2OC 5A6MA 3SBPA 1F4YL 3LN4B 3DSNA 2CKNA 5DD1L 4X98B 4L23A 5E2TH 3VXUE 3GHEH 5D1ZD 1SY6A 5A43C 4WI6A 2VNCA 2HUEA 2WO3B 4DJMA 3ZR5A 5AOLA 4LOUD 2OMUA 2CGYA 5AKVA 1USQA 3WY3A 4L3EB 2QSCH 5T1LD 3PUCA 4P2OA 4E42A 2Y6SC 4X80L 4EBQL 1QZNA 3B2PA 4UQCA 3QWOB 5F7DB 3IM1A 4XB8A 3GBNL 1AGFA 4V1DB 3OMAB 2XETA 4EXKA 1J9CT 1GTFA 3E3QE 4MA3A 3GO1H 3UTPD 1OCOB 2NY1B 3QYNA 3WI9A 1MREL 2CJSA 3ZQ9A 1PCSA 2A6JA 3BSHA 4Q6IB 3PWNA 1QPPA 5GGUB 4PRHE 3G6JE 4H44C 1MCOL 2AP2A 5FCUL 3WIHH 1S7RB 2X40A 1A5FL 1N18A 3VD1A 4S1RH 3MRLA 3NN8B 3LS4H 3HVNA 2WVVB 1UFUA 4OT1H 3S9DB 3LKOA 4G42A 5DO2D 2VSDA 1AGDB 2B20A 2YFNA 3JWNH 4FP8H 4AZUA 3Q7JA 2YEVB 2CBQA 2X05A 1O9ZA 1SJEB 1Y18B 2WLMA 2W0PA 2WVSA 2OJ1A 3B2MA 4WEMB 5B39A 3V0FA 4OCXH 1R0AH 3K71B 2VMEA 3UTSA 5E1AA 2IANB 2NRDA 3D4CA 4AJYV 2P5WE 2FBOJ 2FLMA 3D3VB 4AY0A 2GCYA 2ZUWA 1IM9B 1WFNA 2WKOA 2DQJH 5I6NA 3NSDA 3M07A 4FQJH 5CR8A 4L1BA 1OO2A 3ZRFC 5E8EB 3T08A 4J3SA 1A1OB 2ENQA 3LIZL 1CK0L 5DFTA 4ZNEA 2DKUA 4NO3A 5CFAA 4KAQL 2H26B 3HB3B 3OKLA 3US0A 4QNPE 5D1XC 5CEZD 5DGQA 4CBPA 1H3GA 4YAQB 1AR1D 1YEEL 3UGEA 1EAPA 5GGSY 1PY0A 1YNKH 1KYFA 3HBPA 4UIMB 4KY1L 4XN2A 4U1JB 2N59A 2BDNH 2MTPA 5CFHA 4G80A 3FB7B 5DRXA 5D1XA 2Y7MA 1NFAA 1USZA 2HFFA 3RB5A 3JTTB 3VD3A 4JREB 1UG9A 3ARBC 3NZ8A 4PGCB 2X6BA 4J6IA 4FXTA 3VGBA 1KFAH 2E7MA 2J25A 4HOXA 4NO0B 5AYUH 4QTHA 5K1VA 5C0RL 1OPOA 1QNZL 5D5MF 1VFOA 5D5MA 5HPOA 1LMIA 3LSOB 3ARBA 4J23A 5E4OA 3NFNA 1UM5H 2VL4A 3R18A 4H1LG 4PJEA 2ZAIA 1T22A 4XBPB 5E2TL 4Z7WB 3CDGA 2A6IA 3GHEL 4L0PB 1GS6X 5CP3H 1JL8A 3RWJB 1T21A 5I6KA 5EO9A 3VYNA 8PAZA 3EJZC 2W1NA 5EFIA 4RBPK 1XSOA 4WHYH 1FZKA 3V0VA 1J9QA 2QSCL 4MJIA 3KLHD 1S9VA 4WY7H 4D0CB 4NC1E 4E41A 4X6CE 4N90E 1KXQA 1M7UA 3VXSB 2DYRB 1C5DB 4HGWB 1MXDA 4YVNA 5I8CB 4O02H 2NR6A 4PS7A 5JHBA 5KAQG 4H13C 1AQDA 2CE6A 2N7AA 1MFVA 4GBXC 3O3AB 4ERSH 3O0LA 3ARRA 3R8BB 3EGSA 1FFNB 4QHLA 1UOLA 3M17B 4S1RL 1EDHA 4YHMH 3FQXA 1W0WB 3KG5A 3LS4L 3W0WA 3GBEA 4BWTA 1BD2A 2BY3A 2WLKA 5D2LB 3TS8A 2YQGA 1J9TA 4GBXA 5FB8A 4OT1L 2AXFA 2Z35A 4GS7B 1HILA 4NQVA 1BA9A 4G8FB 2C9AA 4Y4KD 1LE9A 1UCTA 3IDUA 4GLRH 1OWWA 3ML9A 1G7IB 2BSTA 4OCXL 3ARVA 2CCVA 1R0AL 5I8KL 3V5DB 3NA9H 5GGVY 3PDOA 4Y9BA 3VGEA 3TU6A 5BRZE 4CGTA 1PMYA 1FDLH 2XZQH 3LZRA 3EKCA 3HHSB 3NFSH 4FFZH 3KLAA 4FQJL 1DBKH 2PXYB 3MGTB 1ZA6A 3FO2A 4BK5C 4PRPA 3QR0A 4AYDC 5E99L 3BFWA 4LLQA 2AJ3B 3QZNA 1S7WA 2CR0A 1KB9J 2AJXL 2DI8A 3BZ4B 3MV8A 3O9WC 4UNIA 4OCYL 2BXYA 4YR6B 3SJVE 2Z7ZA 4KITB 3I75B 1YNKL 3NABL 3V0HA 2EXWC 3A24A 5DJXB 2NTFB 3L3GB 3ZTEA 2BDNL 3ETBJ 2LU4A 4HJJH 5ESQA 5IROD 3DX4A 4UQEA 3RY6C 4ORGB 1RQ5A 3O9WA 5CCKH 1DJIA 3WY2A 3BQUC 3QJUB 3U48A 1XIWB 2H32A 2WQXA 1PIGA 1UZGA 3LRSA 5DHMC 4HD5A 1KFAL 1SHSA 2DQ6A 1JZ2A 5C8JA 2BNQE 3RY6A 3VACA 2V5MA 4BCXA 3D4GA 5JPNA 2BIMA 3BQUA 1WZKA 3MUGA 3US1A 1UM5L 1KEMH 3RYMA 4R4ND 3B56A 5JXED 1DBMH 2BMKA 3EGDB 1YMMA 1QHPA 4IKJA 2IAMA 5L4FA 3RIAK 2YRBA 5B3SB 5C1MB 3X13A 2ODIA 1QATA 4U05A 4E9WA 4NQCA 5CS7A 2LAAA 3QNFA 3KPMA 4OCWH 4WY7L 3MNZB 1MCPH 3P11L 4XVUD 3EUUA 5J1SC 4TLTA 3BP7A 1A3RH 2YXMA 4JFED 3PG2A 5FFGA 3CDYA 2OMXB 3SPJA 1DQQB 1RZ8A 4YN3A 4G7QB 1BREA 4O02L 1QD0A 4H0IA 5C7XH 3MRQB 4S1DD 4OCRH 1FYHB 4NKIH 5EEXA 1MCFA 2BCKB 4WSJA 4ERSL 3TX4A 2AAVA 5IM7A 1EUTA 4NNYA 4YFDB 4OJAA 43C9B 1I8LC 2X4OB 4HPOH 5FW7A 5FEBA 4YHML 4FXGB 4WNSA 3NACH 1MSPA 5CM1A 4W6WB 1AD0A 1FNFA 3NBNA 1SVCP 2ZCKH 2BINA 1I8UA 2H1LM 1YG9A 1ORSA 3AAZB 3A6CH 1TSHA 1PD0A 3VM5A 1V7NH 3WNMA 3O8XB 1I8LA 5EB9A 1P2CB 1C9SA 4NP4H 4O2FA 3RU8H 1GYVA 4QRRB 5GRJL 2E8ZA 5CCHE 4PRIB 1IBDA 3IDJA 3WKNA 3PQYD 3OG6B 4OAWB 3RGHA 3KM2A 1PZAA 3NA9L 4M61A 5IQ7L 4UT6H 2XV6B 1T89C 5DD6B 4JVWA 3SQOH 2XZQL 1MW3A 4RX4D 1XGQB 3NJIA 4H1LH 4PCSA 3K0WA 4FFZL 3U1QA 1DBKL 1EZSA 4AYSA 5E2UL 3SDDD 4MCYB 4YZFF 4DPAX 3NJVA 4XN7A 1CI5A 2GJPA 1AZUA 3ULUE 2HB0A 1BXAA 5DF0A 3H9SB 1P6FA 4WHTA 3EYSL 1EO8H 3Q8AA 3PP4H 4MDJB 1PY4A 1F2QA 4NI3A 1CR9L 3WS3B 1U3HB 1N6QH 2BOLA 1J05B 1L9QA 3HKFA 4CAGA 4NRYB 3UXFA 1H19A 4MYPA 3WEBA 3OLGA 4Y5VB 4ZX4A 4OJEH 4B3VA 2PWHA 3ZRCC 5CCKL 4ORZC 3WNOA 5EN2A 5IJVA 1FZJA 3CSTA 2VQTA 4YLCA 4BSWB 1KIUB 1HTYA 2ZONA 2W95A 4Q6KA 3GIVA 1QO3A 4BUQA 2XG5B 1VADB 3DBXA 3O3BB 1IZKA 2DQIH 3KGUA 1S6NA 1PD6A 2H2PC 4U1HB 1A9EB 2X4RB 3QPKA 2K78A 2WYHA 2FYYB 2AGJH 1KEML 4L5FE 1AI1H 2IQ9H 4RLDA 1DBML 3D2TA 5B3NA 1UH3A 1XGUB 4WO0A 1P1VA 1TITA 1XF3A 2XIBA 2YD7A 3QIWA 4OFPA 1PIFA 2QKIC 4LCCC 3QISA 4ADIA 5I15H 5HP5A 3RWEB 3QPQD 3EYVB 3VFTA 1AJ7H 4OCWL 4TNGA 1S9XB 1PG7W 5E1GA 1KTJA 1HS6A 1Z9MA 5SWZE 3FS9A 1BX2B 5LNGA 1CFMA 3P4OA 3ZT7A 4EKJA 3PJNA 4JO1H 3UX9B 5C7XL 2IPUK 4F80A 3LNDA 3T9WA 2AXGB 4NJAH 5EC1B 2XWBA 4OCRL 1DBAH 1JERA 5AW7B 3X11A 4MTMA 3DSNB 4OZFG 3ZIYA 2CA4A 4IRZH 1MEXL 2BY0A 3KAAA 3I50H 4HPOL 4V11A 1DUYA 3NACL 3VFPA 2OMUB 1ZE3C 3L1EA 3LQAH 1XCWA 4AGQA 1HWHB 4P2OB 3S36X 4E42B 3MFFA 1OK8A 3A6CL 1IL1A 1V7NL 3GZQA 1UADC 4NP4L 4LRIC 3B1UA 1UOWA 4CNIA 5CLWA 1AGFB 1G43A 5C6PB 4J6RH 1ZWIA 4MA3B 3CLEH 5HHME 1FZMA 1CE1H 2J8OA 4UT6L 2A6JB 2ZUYA 3SQOL 3U7WH 3V6FA 3PWNB 5DZJA 4J3OD 5DLLA 5C0BD 5D9SA 3TT1H 4LRIA 4PJ8D 4GFXA 1KV7A 1Q8MA 3ENEA 3MRLB 1UACL 4PJHE 4AGMA 4RGMC 3FAXA 5C0IA 1SYVA 1U8JA 4NNXA 2NY0D 3VFMA 3LKOB 3H85A 3HG3A 3I9GH 4G42B 4QKTA 2IFGA 5HDBE 3DVGA 1JZ5A 1DSFL 5IOPA 1EO8L 3NJGA 3KMDA 2VMJA 5HYIA 4AOFA 1HH6A 1UURA 2IJ0C 4I3SH 5B39B 4I3RH 1N6QL 3L4YA 3UTSB 5E1AB 3K6SA 3GINA 4G6AC 2ENJA 2FJSA 5MEND 1MIML 1T2QH 4ONFH 4UOJA 2WMPA 3CU1A 2GCYB 3A4EA 3AM8C 3FFCD 5ISZE 2MCG1 2CDEA 4AGPA 4KMQA 1QW9A 1V3LA 5ID0A 3Q1EA 1ETZA 3U6XS 4NO3B 4WKXA 5K9QG 3OKLB 2DQIL 2YGPA 2CO4A 3FB8A 2AGJL 1EAPB 1RV6X 3KPNA 4GEJA 2H1PH 5FO2A 1ZIBA 2R69H 1AZCA 2K7QA 1AI1L 2IQ9L 4YHOL 2H0PA 4G80B 4OLUH 4EDXB 3ZDXB 5I15L 5DRXB 2APSA 5D1XB 2HFFB 3HOGA 1MIEL 2W0FA 3DXAE 5A2JH 2IWGA 1AJ7L 3NZ8B 3EG9A 3QUYA 2EKJA 5GGVH 3VRIA 2R1XA 4U6VH 2XZAH 2R0ZH 3QG7L 1V54B 1G1CA 2XYCA 4QTHB 3KXFE 4JO1L 1RP9A 4PJXF 3KPTA 4HPYH 5D5MB 2X28A 2E9JA 3ARBB 3C9NB 1JTPA 1DBAL 3NFNB 3SDAC 4PJEB 1T22B 2HRGA 3IU4H 4TQPA 4IRZL 3CDGB 2A6IB 1JP5A 2J12B 1T21B 3DGDA 3E9TA 5EO9B 1H3XA 5EFIB 4FFWD 1FZOA 2EVHA 5D1ZI 3LQAL 1FZKB 1XHHA 1ZV5A 4ZJ9A 3V0VB 3SDAA 2VJ8A 4MJIB 5BPPA 1S9VB 4P5TC 2ZX6A 4E41B 3MXWH 3NRFA 4WK4B 1GYWA 4J6RL 4W81A 5E9DE 3CLEL 5HYQA 1AQDB 3HMXA 3HG1E 1CE1L 4OCNC 4P5TA 4JY5H 3U7WL 3O6FC 3TT1L 3PDGA 3EGSB 2BW4A 4QHLB 4U1IA 1J1OH 4JDZA 3DO7A 1QYGH 3FQXB 3F6LA 3W0WB 1LL1A 4I4WA 4TLKA 1BD2B 1QBMH 2OW7A 4YQXH 4GBXB 4AENA 5FB8B 4IBZA 2XTJB 2AXFB 4C54A 2Z35B 3O6FA 4HEPG 5BUPA 1BIHA 5KTEH 4Z7OF 1HILB 4NQVB 5F72S 3RPKA 2CDFA 1LE9B 4I3SL 1QFHA 2BSTB 3BUPA 4I3RL 1CL7I 1ZLUK 1CIUA 2VR5A 5A7EA 1X5IA 4KI5C 4KROC 5FYJE 2ERJC 4FGMA 1DQJA 2ZP8A 3PDOB 1T2QL 4ONFL 4PYHA 2OP4H 2DWTA 4TULL 3HJEA 1ROCA 3CHPA 3KLAB 3F7PC 4OZFH 4NSKA 4IKNA 1ZANH 2YWZA 5GGQL 1ZA6B 4PJGF 3FO2B 4KI5F 4PRPB 2A1WH 1QHQA 2WAQA 3DKHA 4TLUA 4LLQB 3UO1H 5IBTL 2QZ5A 1S7WB 4H7VA 4LOFA 2YRLA 2QMJA 3MV8B 4IBVA 2AV1A 2ZUUA 4JRYE 2N7BA 3SE6A 3U2SA 1TZ8A 2R69L 2JI1A 4FLSA 1NCGA 1UKSA 3DK0A 2VLJD 2YUZA 3QR2A 5AW6B 5ESQB 1T03L 3GBMH 3TYGH 2XKSA 1II4E 3O9WB 3ERXA 5JHDE 3K5SA 4X6BA 5FV1L 4YDIH 1MFMA 2EDMA 1YY9C 2H32B 3B8YA 3INUH 3LRSB 4U6VL 2H6OA 4HFWA 5C8JB 5J6GB 2B08A 4UIKH 5JPNB 3JXAA 2NYZA 5CJOH 2R0WH 5B7MA 1UEYA 3MUGB 2H3KA 2VN4A 2EILB 4CVZA 3IU4L 2CHDA 1WITA 2WHVA 2BMKB 4Q97A 1YMMB 2GY5A 2IAMB 3NIGE 3IPFA 3CFMA 3NZSA 1OSEA 1CVRA 4OY9A 4TUKL 4RVBA 3X13B 1HYSC 4C83A 2WWMD 4NQCB 3KPMB 2DM3A 4LHJB 3S88H 1KGUA 2DTSA 4RMVA 3BP7B 5LHDA 3MXWL 3NA4A 1KBPA 1RZ8B 1A7QL 3FTYA 4HIXH 1S2EA 4MBRA 1A6AA 3VDCA 1ZJBA 2X0VA 4JY5L 2ESVD 3FL7A 3QC5X 5IM7B 4NNYB 1OAKH 2WP3O 3VXTA 4AUUA 1EXUA 1J1OL 4IOIA 1QYGL 2DIJA 3LXBA 1VA9A 1CLZH 1AD0B 5JDJA 4XVJH 4ABVA 5ES4B 5F7LB 4ZMAT 3B2DC 15C8H 1CICD 4TMPA 4RZCA 4I48A 3P02A 1TR7A 3H3PH 4PW9A 5KANI 1ORSB 3SPGA 1ZVYA 1G0DA 2F7QA 3G04A 5JIQA 3I3DA 3BMWA 3DECA 4O2FB 2V3DA 3RVUC 1ZS8A 2CK0H 3IDJB 4DZ8A 5IJCC 1OXYA 4JFYA 3DSFH 4A2GA 4A2EA 5LJYH 1HIMH 5I0ZA 2DDQH 2CUAA 4M61B 1DQMH 5I75B 2P5EA 3V9EA 1XAUA 3SOBH 3G5YA 3RWCA 3SBWC 2OP4L 3D52A 5A7BA 2ADFH 5SX5K 4KXBA 2ZZUT 3MRIA 1KXVC 4FKEA 5C0AE 1R3JA 3UO1L 3CZSA 4LKCA 3TVMC 2WZPA 4CSTA 4WHTB 3SBWA 3VXRD 2XUWA 1NFIA 5JMRA 1G9EA 1G9HA 3C8HA 4PSRA 1O0VA 4PRNA 4EI6A 4GAFB 1KXVA 4M1CC 4EPSA 3OM3B 4C47A 3KYNA 3MR9A 3UADA 3ZKQD 3H6AA 3TVMA 4PWJA 3GBML 3TYGL 1CCZA 5HYSG 5J1AA 4AEHH 4HF5H 1DJHA 3HNSL 1BZDA 5KUKA 5EN2B 4BD4A 5IJVB 1FZJB 1BAFL 5FYKE 4JVUA 5IMOA 3GIVB 2J57A 1QO3B 4CRPA 3BUQA 3DBXB 2PCFA 1KJMA 4FQXD 1EPFA 2SODB 4PTUA 3TIEA 4UIKL 5CJOL 2R0WL 3ULUH 2G0KA 1FVDA 5FWQA 2K6YA 1TTGA 3SODB 1J0YA 2VAJA 2BH0A 3ATBA 3BCFA 4ODXA 2YR3A 1DVXA 1XF3B 3O4LE 2DM7A 3QIWB 4ONGL 3O3EA 4LSQH 2XVGA 2DL9A 4OSUL 4ANWA 2WXFA 2UX7A 2HMID 3WG7B 2YEZA 3VFTB 4YEFA 1I4FA 1EVTC 1KN4H 3S88L 1T5WA 3V9CA 3P4OB 4HJ0D 1RIUH 2OCFD 1WA0X 4LP4A 3QQNA 3QWRA 2XWBB 3X11B 3TEXA 5EF2A 4W9GC 2FB4L 5KJ7E 5F7FA 1B6DA 1OAKL 4FTVA 1RZIA 1DUYB 1M53A 3M8OH 3BP6A 3VFPB 3X3FH 1X9QA 5DA4A 1O7DE 2WXKA 4WW1A 4XVJL 4P5MA 1JI1A 2DKMA 5DYOA 4RGNC 4X5PA 3MFFB 1FQ9C 3DC0A 5C71A 1IL1B 4CNIB 1U8QA 4GAAA 1ZWIB 3FAWA 1FZMB 3WTYA 1DTUA 1Q0XH 2DDQL 1DQML 4Y89A 3V6FB 5E2JA 2GJRA 4YEEA 3SOBL 1GTNA 5D1QE 5D9SB 3O41A 3PAUA 2LT9A 4HEME 4H8HA 2ADFL 3EOTH 4BHUA 1DDHA 1I53A 2XVKA 4BZ2A 1V05A 3DI3B 3IPBA 2W9LA 1JAEA 5C0IB 1SYVB 4PP1D 1U8JB 4NNXB 3VFMB 4FA7B 1NCAL 5HYJE 3DVGB 5IOPB 2ZXBA 3ZMRA 3OMIB 1HH6B 1BHGA 4NJ9H 3K6SB 3UBFA 3UTOA 2ZWYA 5I76A 5IMMA 4AEHL 4HF5L 1XWVA 3C6EA 2WMPB 2G60H 4XNYH 2D7PA 2YKLH 5EU7C 2CDEB 2IFFH 2JQMA 2FX7L 2DMHA 5ID0B 1S7XA 5F8RC 1ETZB 2MQ3A 1VAHA 4I1RA 2VERA 1TTAA 1KFGA 3ULUL 3FB8B 1CU4H 2BS71 3RIAF 4YHKL 4H8UA 3KPNB 2MCPH 2XQBH 3MNDA 2VXTH 1YYCA 4L29A 5C08E 1W9XA 2WKGA 3D69A 4LSQL 3GXUB 1DBBH 3MLPA 2W0FB 3ZQWA 3ILDA 3SDXF 3R19A 3QUYB 3EG9B 1W80A 1EGJA 4H26A 4YBQD 3VRIB 2R1XB 4FFTA 5DVKA 3B7TA 1KUMA 1ZY9A 1L3WA 2E9WA 3FCSA 4XZUA 5BVJA 1E7VA 4OIBA 4HISA 4A7TA 4HJSA 2H0FA 3AY2A 3ECBA 2HTKD 2NZ9D 4L5FL 4G3YH 4NZTL 3RVTC 1EVUA 2O5YH 2BZ7A 1A3LL 4M7ZC 1XXDC 5E4AA 1LP9A 3CFUA 2Z6FA 3M8OL 1FZOB 3X3FL 3QDGD 2QVIA 5LKNA 4N0YH 3LPFA 2BVUA 4QXUH 3L4UA 3SDAB 5K1JA 4OZ4A 1OLLA 3QFJE 5JPMC 5FIEA 4RIRA 4X5LA 3UMNA 5E8OA 2YMXH 2F1AA 3APNA 3H4FA 4KQ3L 4MKTA 5CEZE 3BUDA 4JGUA 4X5RA 4Y8AA 5HYQB 1GKEA 4P5TB 3FU7A 2Y2TA 3VRLF 2HTLD 2K4WA 4JR9H 1YEKH 4U1IB 3HRZC 2YAQA 4JDZB 3DO7B 3EOTL 3NK3A 5BQDA 1MHPH 4I4WB 5I5MA 2E27H 2NY7H 2QVFB 4AENB 3WKPA 1MHHA 4TN9A 3O6FB 1TJIH 5TTRA 3EJSA 3SBQA 2Q8AH 1UJ3C 2VRAA 2CDFB 3B34A 1A6WH 4ZT1A 1RVFL 4MJ4A 4G8GE 2C4FU 4Z7UE 5F6HJ 1ZHBA 2ZOTA 5DK2A 1DVUA 4A68A 1J5HA 1DQJB 4M5SA 4M9OA 2V5RA 3GS4A 2PCYA 2IDQA 3QS3A 3V0IA 4F92B 1G0YR 4AXWA 1CYGA 1WZAA 2G60L 1F90H 1TO5A 4XNYL 3L95A 4G71B 3K6IA 4NSKB 2YKLL 5D96C 3NCJH 4XPHH 1QTYT 2IFFL 4KZDH 4KROB 3V0DA 3TV3H 1VGKA 3ZE2F 2ERJB 3T09A 3RPIA 3FFOA 5E5MA 5IMKA 1CU4L 2AV1B 2BVQA 1EHKB 1JZEA 1BP3B 2VZ3A 3LXCA 4N8CH 3U2SB 2MJWA 3ZTCC 2XQBL 1JBJA 5DZVA 2VXTL 5GZOA 1Z5HA 3QZBA 5E7FA 5IOKA 2EIEA 1M1XA 1S7UA 2D7QA 1MI5E 1DBBL 3GXIA 3I6GA 4KKPA 5CN1A 1TQBC 5LVEA 4X6BB 4KKBC 2R2HA 4AE1A 3GTTA 4DKFL 3MRBA 1KOAA 2PO6D 4OFKA 3OPUA 2GEQA 4D0DA 4PLJC 5AOIA 4LGPB 2EXTA 1MAMH 3OZ9L 2AW2A 4HFWB 4XO3A 4OJFH 1ANUA 4LGRB 4JFDD 5T1JA 4TVUA 5JDSA 3VW3L 2XX0A 3ZYZA 2VWEC 4CVZB 3GSOA 1FFPA 5JNYA 2J20A 3AREA 1R5IA 2HLFD 4B95C 4G3YL 4WSKA 2A4ZA 2O5YL 4OCMC 4X99A 4F8PA 1W72A 2X2UA 2X5PA 4UAOC 4FLOA 3C09C 5E23A 4NPJA 3S3BB 2DQUL 3TM6A 3MCYA 1ZK5A 5GRVL 1OTSC 3LNEA 2A7BA 2ZNXA 1GGIH 3BT0A 4MAYA 4QDGA 5F9OH 1TVBA 5I5IA 3EO1A 2FTAA 4WTZA 2EH7H 2YMXL 2I7OA 3TH2T 1J5CA 1E6OH 1GPOH 1PLBA 1A6AB 2WKLA 4RCAA 3BZEA 2PR4H 2X6AA 3C8DA 4UBDC 4C56A 4HCRA 4DN3H 2TRHA 1YEKL 4LHUD 3VXTB 1EXUB 3H7LA 1YN7A 4IOIB 4KV5F 3HZYA 3TN0C 5GS0D 2WXHA 4DPBX 1P1ZA 1HJBC 2NY7L 4FE9A 4M1DL 3F85A 4I2XA 3L1GA 4RZCB 2G5BA 4BZ1A 4I48B 1G1KA 1TJIL 3R1GH 2Q8AL 3JWDC 4HOWA 3G04B 3MJ9H 1FO0L 1IGIH 1A6WL 1L7IH 3NSFA 4XBMA 3TN0A 2AC0A 4NHCL 1ZS8B 3BISA 1UM6H 1QMUA 4DZ8B 2OYKA 5BS0A 1B88A 4UWQB 5BV7L 2P42B 4JFYB 4YSTA 5C97A 4Q9RH 2WQVA 2WQAA 2P5EB 3ASOB 1KXHA 3QQ9D 3G5YB 3RWCB 2MEJB 1F90L 1L7TH 2PPEA 4PJ9D 1NICA 2WIMA 3IVKA 4XPHL 4WWID 2UWEE 3QAQA 1A0QH 4P4RA 3MRIB 4YLBA 3TV3L 5AOZA 1A65A 1R3JB 3FUEA 4ODVL 5LCVH 4QWWC 5AVZB 1P4LA 4M03A 2L8AA 2IH9A 1NFIB 4JFEE 4U3SB 4N8CL 4Q2ZA 2ORBH 4PRNB 3QDJD 4EI6B 3MODH 4LCWA 4K2UH 3MRNA 3L5WA 3KYNB 5BNXD 3MR9B 3TVMB 2CXGA 3L4XA 1QFOA 4I0CC 2EYSA 5FYJL 5J1AB 1F3JA 1D7DA 4Y5XC 4OB5H 1KNOA 5CJQH 4X6EA 4G6FB 1OCWH 3W39A 3FN0L 4WVRA 4B9KC 5IMOB 4XHQA 1MAML 1ZEAL 1HNFA 3L1OH 3QJTB 4OJFL 3H2QA 2PCFB 1KJMB 1OGAA 5IG7A 4PTUB 3HFMH 3TIEB 3K8LA 1JNNL 4OIAA 5FOBA 1NBCA 3QDMD 5D7LD 3OR6A 1FVDB 4KO7A 3W11C 4UYPA 1WJ3A 5IQ9A 1AXIB 1U21A 1CYWA 1KCWA 4ODXB 4CDGC 3HBZA 3JT0A 4JHUA 1I1AC 2VLKD 3I02A 3O3EB 4KJWC 3D39D 3H9HA 1R34A 3H42H 2WNKA 3ZUCA 3MOAH 4QJ3B 3H8NA 3T5WA 2YEZB 2AQ3A 2C9UA 1I4FB 2VZVA 1RL1A 5HGBA 4NB7A 4JNXA 5EEVA 3MYZA 1PPIA 1Z0NA 5DD3H 1T5WB 3AXLA 5F9OL 1SQMA 2EH7L 3MV7A 4JL1A 1ACZA 1E6OL 3T3MB 3U4EA 5KBNC 2A0LC 2NW3A 1IV8A 2PR4L 5K59E 4P23D 3C5XA 5CP7A 1F18A 3VD2A 5E6IC 4GUPA 2F53A 4IMKC 5I5RA 4JY6A 4D2NA 4FTVB 1RZIB 3K72A 4ZS6D 5F7WC 3BP6B 3HI1A 3ZZLA 2YA0A 2R29A 3EDDA 2ZG1A 5EDXA 1JFQL 3IGFA 3Q2WA 2YXVA 2VMDA 4OD1H 1UWGH 4WW1B 5DJYA 4QOKA 3T8MA 4P5MB 3WJLC 3APMA 2Y1AA 2NY4D 4QT5A 5DYOB 4OZHE 1EFXD 2DRUA 3R1GL 3NGBB 4IMKA 3ASNB 5MEPA 3MJ9L 1GW6A 1IGIL 3MBWA 4KK9D 1U8QB 2RH0A 4DP7X 4P46C 1E8ZA 1M2VA 4WFGE 1UM6L 2VERN 4G1MA 1CTOA 3ARZA 4Q9RL 3WJLA 4RGNB 1KTRL 2ICCA 1TJGH 2DY2A 3H53A 3IFOA 4LL1A 3P2TA 1KPUA 3O41B 4OLEA 1L7TL 1MFBH 4P46A 4GT7A 4RFOL 2CMRH 5E03A 1IGYA 1KN2H 1DDHB 1H8LA 2IDFA 4XZ4A 4Z3GA 4Y2DD 5FO7A 5LCVL 1UATA 1RK1A 3OF6A 3LQZA 1HX0A 3MLYH 4NO5A 2MOVA 2C3VA 5F88A 4P2QE 3Q8EA 1TMQA 3L5XH 4AYID 3FQUA 2B59A 4K2UL 2X89D 2LFGA 2CM5A 5SWQA 3R4RA 5I76B 5TGBA 5IMMB 3MRFA 3OKEA 2FZ3A 4Z7VE 4OB5L 3DO4A 4FXKC 4KJQC 1W8EA 5CJQL 2YUWA 2Y22A 1OCWL 4ADGA 2MH4A 1SJXA 3L1OL 4PS3A 1S7XB 5T5NG 2L4OA 3EJUA 2ZOUA 5HGHB 3HFML 2A9CA 5D7JA 1HCZA 5EULV 5FO9A 3KWUA 2BS8A 1G4RA 1KTLA 1EJ8A 4FXKA 4LCYA 3LN9A 3VDAA 4JK0D 1E4XI 4ZFZA 4EUPG 2BSBA 2RCSH 3HZVA 1MJUL 4L29B 4UZGA 4X6DE 3HTLX 5HTSA 3D69B 1YEJH 4U2YA 1B0WA 1E8WA 2YN5A 3H42L 1B0GA 3MOAL 3CZFA 1U2YA 1OTTC 2JTYA 1BIIA 3ARWA 4H26B 5DD3L 1TNNA 2Q76A 4G8AC 4GRWF 5FYKL 3W9EA 1BXUA 4GI8A 5KOVC 3WYRA 4UTCA 1JN6A 5CZRA 3Q06A 3CTTA 3FCSB 1L9TA 2DOCA 4XZUB 3RL1A 5BVJB 3OAWA 3WKQA 5IHUH 1AP2A 3AS1A 3D8MA 1KBBA 2ZSWA 3UBGA 1OT2A 7FABH 3ECBB 3LIZA 5TDNA 4ABWA 2EDEA 5I1AA 2YPVL 3WD5H 3WEAA 4JJHA 4NWUH 4APXA 5MENE 4TVPH 1LP9B 5ILTL 4NN6C 4OD1L 4XNZB 3KBFA 4OZ4B 4UQIM 3UPCA 3HI6H 1RLWA 5HJ3A 4L4TA 4LP5A 3V4VH 3LNFA 4RIRB 2JJWA 1M6OA 2Z64C 5E8OB 3BX7C 1JXKA 4DFHA 3FQTA 2ZWZA 3AG2B 1X4XA 3FU8A 3RBGA 2A77H 3W82A 5E6SB 1OT1A 3NTCL 4TTDD 1DZ0A 2ZKHH 3CDZA 1BYOA 3FU7B 3PLYA 4BFJA 4N68A 1CL7H 3V6OE 3GXDA 1MFBL 3O81A 2NX5E 1K4DA 2WBWB 3O2DH 4IYKA 2CMRL 5EIVA 1KN2L 4H88H 4HMEA 1U8IA 4D9RD 1HOCA 3OKOA 1DHKA 1NC4A 1RLBA 4JPIA 1MHHB 1TPXB 3MLYL 5LG6A 4A66A 2NCEA 4MD4A 4MGXA 5KYNA 4OJDH 3L5XL 1I1YA 1JGUH 2Y36H 3HNVH 1MWAH 5DJ2A 4KX8A 1ZHBB 1FIEA 2GKIA 4WV1C 5DK2B 3M7FB 2FAUA 1NLDL 4XP6H 4PHZA 3IGLA 4AYMC 3MXVL 4LSSH 1BZ9A 4WW2C 4XI5D 4AXWB 4QAWA 1L0XA 3L95B 3HUJE 1C16A 1RJCA 5DMKA 3BAJA 1U4FA 2FJFA 2UZPA 4HJEA 1BJ8A 1VGKB 1WF5A 3P40A 4LO9A 5C3TA 2Y4SA 3RPIB 4WW2F 4WW2A 3JWNC 3WE1A 4OU3A 1R3IH 1CFNA 5E5MB 5IMKB 1CGVA 2BVQB 3Q5YA 1BCIA 1AXSA 4HWBA 4QRSA 5D96B 5F9DC 2ZNWA 2AI0H 2R8SH 3QIUD 4QRRE 2HPTA 2EVFA 2RCSL 4PJ5A 4QRPD 4F2MA 1M1XB 1S7UB 2DYPA 3I6GB 4RDQF 4XTRD 3C87A 5DD0H 3RNKA 1HQRA 1CTNA 2R2HB 3U0PA 2BZDA 3MRBB 5D7SH 1BF2A 1TG8A 4OFQA 4D0DB 3C5ZD 4UOW1 1DE4A 1X5XA 2CGRH 5E56A 2WNXA 3ZHKA 3FO1A 5JDSB 2K7PA 4CN1A 3BRDA 3IGUA 1VF5C 2UV3A 5IHUL 3JVGC 3VSVA 2ATKA 3GSOB 7FABL 1FFPB 5JNYB 4ZD3H 4P2RA 4JFVA 3AREB 1R5IB 3WD5L 4NWUL 4RISH 5GRUH 4X99B 2QL1A 5A2LH 3BVUA 1W72B 3VXMA 3JVGA 2XBTA 4YSDA 3UC0H 4M3JA 4ZMQA 3WIAA 3V4VL 4MAYB 1H0DA 1TVBB 3X1BA 3EO1B 3HE7D 1DYZA 2YK1H 1S7TA 1A25A 2OMVA 3LRLA 2A77L 1PZ5A 3C09B 4HG4K 3BZEB 2ZKHL 4C56B 1T66D 2H0JA 3KW8A 1PAMA 4P4KC 1AO7A 1CL7L 5EOQH 3RDTC 4TNWK 1PW3A 1B6UA 1DBJH 1VIWA 1JYWA 1YN7B 3O2DL 3HZYB 3MHZA 4H88L 1IVLA 1P1ZB 3QUMH 4DFIA 5CU5A 4H4NA 4TUOA 4I2XB 4P4KA 2JQAA 2PR9A 3UZEA 2G5BB 2LW3A 3RDTA 1CXIA 2B5IC 4HOZA 2ZICA 4YSUA 5CP3A 5I0DA 4N87A 1B2WH 1J12A 5D93B 2Y36L 5C6TH 5K1NA 3TN0B 1NWPA 4AKPA 5L0QC 5AZ2H 5BS0B 4HBCH 3ZUNC 3UTTD 3D34A 5CEZL 3WMQA 2EE0A 3WLWD 4XP6L 2APXA 3UG4A 2C7UA 1FNHA 2VR8A 4KUCD 4BGDA 1NMCC 1F02I 3IWUA 4NFDA 4ZTOL 4FJYA 4OBSA 4G8IA 3IVKB 4O02A 4P4RB 1URLA 5BQ7A 4B96A 1P4LB 3BRGC 4NKOA 1R3IL 2VW7A 4UM9D 2HX8A 4X0KA 5B1KA 2R8SL 4Q2ZB 4XC1L 2AI0L 3P3SA 1NWOA 4MAUL 3LOWA 5CUSH 5AYTA 1INEH 2VDPH 3HZMA 1E4WH 4LCWB 4APQD 1NCBH 3FQNA 3L5WB 3MRNB 4M7LT 4ZW3A 5L8JB 1T20A 2AJUL 3UDWA 1E3FA 2UZYA 5JIMA 2EYSB 1F3JB 3CFKA 3DDFA 2PUQT 1KNOB 5D7SL 2J5LC 1RSYA 4X6EB 3TFKD 3W39B 1AKJD 4XP9H 1GCFA 3LY6A 5BXFA 3FF7A 4PJ7E 1NDTA 4ODTL 2VW4A 5HHXH 1OGAB 5IG7B 4XX5A 3TWYA 3CXDH 3IE4A 5FOBB 1UYWL 3OR6B 3VFOA 1ILUA 4UM8A 5KYXA 1CMOA 1HXKA 2VXVH 5IQ9B 4XPTH 2ATAA 4TKWA 4ZD3L 4K8RD 2IC2A 3VU2A 5G4OA 2O30A 5IT2H 1CG9A 3BVNA 3I02B 1Z9SA 4RISL 5GRUL 2W92A 5KBLA 4JFFE 1NMAH 2IPTH 3H9HB 4V1DD 1CDIA 1XX9C 1OAUL 1S5HA 3BJ91 3AUVA 1EO7A 2NY1D 1NBQA 5HGBB 3UC0L 4NM4H 4E0RA 1L5GA 3KWTA 3ROLA 2JMRA 2EO1A 4U33A 3AXLB 4KY2A 2O61A 2YK1L 2Y2YA 3MV7B 3TYFA 4XWOC 3F6JA 5MI0C 3U4EB 3VXRE 1D3CA 2IDCA 2NW3B 3HMWH 1X5HA 4M6AA 5DZAA 1ZSHA 2VC2B 1MFAH 5FW6A 5CP7B 2ZG3A 4YVUA 1U3JA 4GUPB 2F53B 3V55A 3FUHA 1DBJL 2QADB 1CLYH 3CLFH 3DPDA 4JY6B 1BLIA 2NSXA 3K72B 3CFTA 3FQRA 1KCBA 5C0JA 3HI1B 3QUML 5ETUA 5DJYB 4OF8A 2PYEE 3NUKA 4BK8A 4QOKB 5D6CA 3OZKA 4QT5B 4RWYH 4XHJD 4PM1A 5MEPB