2QZ5A

Crystal structure of the c-terminal domain of aida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
GTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQSLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the C-terminal domain of Aida
rcsb
source organism Mus musculus
molecule tags Signaling protein, lipid binding protein
molecule keywords Axin interactor, dorsalization associated protein
total genus 31
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14186 Aida_C2 Cytoskeletal adhesion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2qz5A00
3HHMA 4HLEA 2CM5A 5H4YA 3PS6A 2K8MA 3N5AA 3NZSA 2WXJA 4Y1TA 2UZPA 4QJ5B 2WXHA 1GMIA 4GB9A 2X38A 2ISDA 2DMGA 2RD0A 3APFA 1HE8A 4FHKA 2CHDA 5JHAA 3L13A 2CM6A 4ANWA 5CCGE 1UOVA 3DBSA 2CJSA 1E90A 3GPEA 2Z0UA 3B7YA 4ICXA 2WXRA 1DJZA 3LJ3A 4OVUA 1RLWA 3QJZA 2B3RA 4AOFA 3CSFA 4FLHA 2Y3AA 2NCEA 3JZYA 4WEEA 3FBKA 4BGDA 4QJ4B 1YRKA 3NZUA 4NS0A 5JHBA 1TJXA 1TJMA 2WXMA 3CSTA 3QR0A 4J6IA 4PS8A 3KWTA 2WXKA 3IBEA 3S2AA 2QZQA 5G55A 2ENQA 3ZVVA 2CHXA 3F01A 3W56A 1DSYA 4A55A 3RDJA 4JPSA 3OAWA 1DJWA 4NPKA 1W16A 3R7RA 4IHBA 4FHJA 4TS6A 4L23A 3R7QA 3QK0A 4WWPA 5KJ7E 4HVBA 4ANXA 4XX5A 2K4AA 1QASA 2V4LA 4ANUA 1E8WA 3L08A 1RH8A 4FA6A 3OHMB 4EZKA 2QZ5A 3APCA 4EZLA 1DJIA 2WXQA 3F00A 4L1BA 4ANVA 4WWNA 2CJTA 5EDSA 2R83A 3APDA 4XZ4A 4FADA 4EZJA 1DQVA 2KI6A 5CCHE 4LCVA 1E8ZA 1WFJA 4L1LA 3L17A 3M7FB 3ENEA 4TV3A 1UGKA 4QAMB 4KZ0A 1E8YA 3W57A 2K3HA 2WXFA 4NPJA 4V11A 4DNLA 4URKA 2WXLA 2WXIA 3QARA 4MJJA 2WXGA 3ZIMA 5CCJA 2A4ZA 1E7UA 2NSQA 4FULA 3ML9A 3L54A 3PFQA 3F04A 4PS3A 3PYCA 3TWYA 2ENPA 2CHZA 3QAQA 1UOWA 2N1TE 2Q3XA 3ML8A 2ZKMX 3NSJA 1BCIA 4WAFA 1A25A 2DMHA 3L4CA 4FJYA 2BWQA 3DPDA 4DK5A 3MJWA 4LDCA 4WWOA 1RSYA 2YRBA 4OVVA 3L9BA 2NQ3A 2WXOA 2YOAA 3P2BA 1BDYA 4F1SA 2ENJA 4BFRA 1DJYA 2K45A 4KZCA 2WXNA 4FJZA 4IQHA 1BYNA 4QJ3B 1E8XA 2EP6A 3IM1A 2CHWA 2D8KA 4LT7A 4KITB 3T8MA 3ZW3A 3SD5A 3HN8A 1DJXA 4L2YA 3PRZA 3KWUA 4F91B 4ICWA 3FDWA 3RPBA 1E7VA 2LHAA 4GNKB 4NP9A 1W15A 1DJGA 1V27A 3PREA 1K5WA 3HIZA 3QR1A 2Q0ZX 4AJWA 4PS7A 3L16A 4F93B 4Y1SA 2A5UA 2FK9A 3TL5A 1WFMA 4G11A 5G2NA 4F92B 3TJPA 1QATA 1DJHA 1CJYA 2WXPA 3F05A 4TUUA 2JQZA 2FJUB 5H4ZA 5T8IA 4XE0A
chains in the Genus database with same CATH superfamily
2YWYA 3ZE2B 1DBKH 5IB1B 3VRIB 2NY3D 2VZOA 5CGTA 4XCFH 2DPKA 3VGDA 3DSFL 2KPNA 3QJUB 3AAZB 4ZS7H 1SHXA 3CD4A 1HKLL 4MCYA 1TQCB 2P5PA 2AK1L 1Q0YH 4KUZH 5EO9B 2RALA 3OMIB 3MV8D 2B59B 3MMEB 4Y4KB 5DD1H 5GIRA 2NOYA 4B9PA 4Z7OE 4S1DD 3RHWF 1VEMA 3V6FA 1K2DA 3GXPA 1Z9MA 1BZ9B 1Q8MA 4A7UA 3DUUA 2BERA 3G6JE 4WUUE 4YFEA 5JNYA 4PJGB 1JXGA 1OZUA 5BCAA 3ROLB 4OF8A 2X1XR 1BVKA 3VFRB 2J8HA 8FABA 2CIIB 4HH9B 2ICEA 3WTXA 1D9KA 3MV7A 5AKTA 1I4FA 4K2UH 1E4JA 2GSGA 4RFEB 2BY0A 4XNUL 2YWZA 5SWSE 3WFCH 5GRUH 3HMWL 1HKFA 4JPSA 1C12B 3SDDB 3TVMC 1FAIH 2F53E 2ZWNA 4LCWD 2AHIA 1FBIH 5CMAA 4I0PB 1YYCA 2ENSA 1IO4C 3SDDD 3T0EE 3QE5A 1VGKB 5D1XC 2XQYK 1DQDH 5I15L 1SHMA 3MTXA 5JZ7D 4C4UA 4UQ2B 3MRHB 2LGNA 4ODSH 3HBQA 3CH8A 2JJSA 1BZ8A 3A4DA 4KJYB 5F7LB 4DPCX 3U2SA 4BA8A 4BIKA 1MJUL 3ZK0A 2GSMB 2E7BA 1OM3H 5EC2B 3ARDA 4LCCA 3B5GA 4HFWB 4KO5A 2YUZA 2VXSL 4ETQB 4AYMC 2EZ0C 1FYTD 5AVRB 1FVDA 1ZT4B 2DEWX 3EO0A 2AKRA 5D5MB 4I18B 5ETUA 2R0KL 1E7UA 3SQOH 1XXDC 2DWEB 4YHKH 3BUDA 4H88L 1ROCA 2ZWYA 4JKMA 3L1OH 1INQB 3BQUA 32C2A 2F6AA 2NY2B 2JNZA 2PN5A 2ZYSA 3D12B 4ZFOA 2YARA 1PYWB 4MMZB 3IMSA 1UJ3B 4TL5A 3F12A 4LLQB 4UQCA 1QSFD 2DM7A 3QDGB 1CF1A 1P7KA 3H9SA 3IFPA 5JIKA 4AITA 3ABLB 1DQDL 1MHHA 5HHOB 2NNRA 2F0CA 2IAAC 1INEL 1U8JA 2FSEA 5E9DA 3SPIA 4XWOC 3CVHA 2Z91A 1F8TL 3I6LE 5AVWB 3B5TA 3OJMB 3ZDZF 2EIMB 2X4UA 4X7TA 2QQNL 2XKSA 3BLPX 1BBJA 3NG5A 3RUGB 1H19A 5I6KA 2IXQB 3RIFF 2ADYA 3ULVF 3K3QA 3ZYIA 2J72A 1GGIH 4DKTA 4ZUSA 3IXTA 4XN1A 3GZOA 4DZ8B 3QI9A 2WLLB 1KTKE 4K94L 4MNQD 4YHKL 3OR6B 3WIIL 1SFDA 3CVIL 3HG4A 3MNZB 4TM9A 1NGYB 4N1HB 1I9JH 2GABA 2GHWB 5FM5O 3PGCB 2X40A 3Q8CA 4QYOB 5JHLH 3GZQA 4MQXD 1MG2C 4HIHB 2J5LB 3DV4A 5E8EB 3UPCA 4AGMA 4BD4A 3K46A 4GKOA 4E9RA 1OP4A 1Z9PA 3QUZB 3B2PA 2GSIB 3CDFA 5I23A 2AC0A 4LLWA 4ENEC 4M5ZL 1KOAA 2YK1L 3ISWA 4TVPE 3T0EA 3NQKA 2CLVA 2DW5A 2HUEA 1A7NH 1PD6A 4L8DB 4XTRC 4P48A 1DSYA 3WUWG 1DN0A 4NHUA 5FV2A 1INDL 2L7QA 4RESB 5BZWA 5EDXA 4TSAH 4RAUB 3FAWA 3MLUH 3B2UD 4ZFQA 2V17H 5DMKB 2VB5A 2G9HB 2Y5TA 4L9LC 1K4CA 1R34A 3ZXAC 4L3EA 3MLZL 2WIIA 4KY1H 5IFAL 4L4VE 3OHMB 2FWOB 3OJ2C 2Z1KA 4JPWL 1CR9H 5IROA 2GPZA 3EXLA 1CL7H 1SPDA 1OY3B 2DLGA 3FFCB 1UADC 5HVGB 2ZP0T 4S0SD 4HHAA 1RUMH 2H2PC 2AGJL 1PZUB 2XYCA 2V2XA 4IMKA 5I2IB 5DD3H 3EJYD 5IQMA 2OX5A 2WYIA 5JHLL 3A24A 1VHPA 2J73A 3CGTA 5G5DA 2EJ1A 3MV8A 3U1QA 3C5JB 3FXIC 1CQKA 2F54B 4YO0A 5LXGH 2Q8AH 1KLGA 5D7EA 4CBZA 4G8GE 5BRQA 3UGEA 1J8HD 2QQLL 4QRSB 4OGZA 5CSZA 4ZS6D 1KTJA 5LAXA 1EAQA 4JQIL 4CNIB 5EU5A 1OGTA 2FJHB 1FPTH 2FJFA 5LBSH 4AIOA 4OZGF 2YAFA 3IETA 1UB5B 3K6FA 2P5EA 3GBMH 4JS7A 3H3KA 3ZDYF 1ZVSB 3ZHDA 3HZMA 2AABH 1O0VA 3N9GL 1B0GA 2JV6A 3PP3K 2AJYH 3R4RA 4J3OG 2R2BA 2X4PB 3NJXA 4X9YA 5D2LA 3TNNA 4EKXA 3TJHD 4FTDA 1NWOA 5DYOA 1MCWW 5JHMA 3ILDA 2NY1C 1ERNA 3OL2A 1U58A 2NTFB 3CSGA 1ZLVH 2X4NB 3ZO0A 4Z76B 3QEUB 2WXPA 1NIBA 3D85A 3QUMA 3TT3L 4N2DA 1G6RL 2EYRB 3MRJB 5A6IA 2WGNB 1DANT 1JF5A 1NOAA 1JNHA 1NCDH 4LHQB 4QHLA 3GMNA 3L5WA 1NOFA 1A6ZA 2HFFB 3ARVA 4I1PA 4Z78B 2Z65C 1K4DA 3QFGA 5HVHB 3OR7B 5LXGL 1A3RL 2EE3A 2XV2A 1AAJA 3GMLA 1G9MC 2A9NH 1TT6A 4JFEE 1ZHBB 1B6UA 2I7SA 1DJZA 3K4AA 4PJ8C 5J12B 4KHXL 1R4XA 2JCCA 2CSPA 3AGWA 3GBNL 3JZYA 1RIHL 4UNTA 4XR8C 3T6ZA 3WE6B 5IJKA 2K3TA 5IHZB 5SWSB 2WXMA 3C6LC 3P54A 4RAHA 2NYZA 1XGQA 3MFGB 4KKQA 3GRGA 1SN2A 1J10A 1N64H 1P4LA 1FNGB 1UD4A 1F3JA 3QORD 4P23D 4P49A 5JQIB 3VWKB 1W16A 3DO4A 2P48B 2A73A 2WQXA 5I8CB 3U30B 4L0ZA 4ZPTB 2K4AA 1DBKL 3V2AR 4HOZA 6FABH 1NFDA 4FFZA 1CXHA 1MJ8L 1ZTXL 4RDBA 4WTQA 4A2LA 1BVLA 4P5MB 1URLA 2JKIS 4N2KA 1TOXA 4PGBA 2DLFL 3CK0H 3NTCL 1KB5L 4DGIL 3TESA 3H7BA 3QIBC 4Y5VC 1HIMH 3DTUB 4OB5H 3IRZA 1EHXA 4XT1C 1FSKB 4XP9H 1V3MA 2ZP8A 4EKJA 1DQVA 1F86A 2H9GB 4LQFH 1T2QL 2CZNA 5DJXA 1MCIA 4QCIB 4URTB 4NKIL 4X7EC 1N18A 1XMWA 2BC4A 3K71A 4L8CA 4TV3A 3SSGA 1MRCH 3VMOA 3KPPB 2A6JA 2DLIA 2VR5A 5I17B 1E9PB 1ZT7B 2F7IA 3JWOC 3MRMA 4MD4B 4Q2ZB 1BV8A 2DOCA 2UVEA 1RHHB 1CF8H 5CCJA 4K3JH 2B9AA 2GK0A 1F1GA 1ZLUH 2XHNA 3GBNH 5JO5A 1ILUA 2WUBH 1KJVB 2BVEA 1CBVH 3HI5H 3TZVD 3GSQA 1QVOA 5C09D 2GAZA 1KFAH 2AQPA 3GEWB 5BVJA 1YMMD 2VGLM 2X9XA 3TFKD 3RX5A 2EEXA 2JKSA 2R59A 1N6UA 2PNDA 2VDKB 3L9BA 3KPRA 3LKPA 3VDBA 1M2VB 3RHWK 4P9MH 2CDEB 1IC5H 2HLFC 5KG9B 4QOKD 3QUMH 2IQ9H 4LHUA 2Y1AA 1Q72L 5EU4A 3FTUA 2ZJSL 2PP8A 4G6KH 4Y5XA 5HGAB 1IBYA 4AX3A 2W92A 4IDJL 2HVJA 2HJLB 4IGBC 4OB5L 3D33A 4NDMB 1VIWA 1MCLA 1A9BB 4N8CH 4PD4J 4YK4B 4AQ8A 1QTYT 4G1EA 3HE7B 2F5BL 5JA9A 3QISA 4LQFL 4KQ0A 1WFIA 2A74A 4EMZA 2FO1A 3T0ED 5I1KH 1NBCA 3D25A 4G6AD 5CP3A 2K4WA 3B7SA 5H37G 1N5AA 1AHWC 4OM1H 1NMCB 5GS0D 4OF5A 2H2SC 4XPAL 5H4YA 4MDJB 2HFEB 1I7UA 2DDQL 3HVDA 3SE4C 4IRJC 4PR5B 1IJNA 2VN4A 1T5XB 1QI4A 3PWLB 1EO8H 2WK2A 2E9JA 4PJHA 1XD1A 5BJTA 4KKBC 1E4XL 1WZ1H 4GAAA 2I07B 3BAIA 4P59L 5M94B 2HLFD 2DKSA 1ACYH 2EDNA 2R1WB 3PNWA 4FNUA 5DURB 4JZJA 1EMTH 1H6EA 1ZSDB 1OLZA 4GMSL 4ZUTA 1CS6A 1NGQL 2CKBA 4PG2A 3QEQD 3S37H 4GW4A 3IS1X 4WZ9A 4PJEE 1M05A 2EZ0D 3R4DA 1XHHA 3KPMB 5F1IB 5GGRA 3WKYA 4JZOB 1EXGA 2O72A 1KBWA 5B22A 3VQ2C 3B1TA 4PG9B 1BWMA 3NCFB 3T6VA 4UV4H 2B1HL 2XXCB 2EVIA 3RZCA 2KLRA 5CNHA 3RKDD 4XBEH 1M6OB 1I1FB 2VABA 4FNPA 1U2YA 4QHMB 4HXBL 1WBYA 2FB4L 3LY6A 4XP6L 5CMAB 4M1CC 3EGXB 2ZXBA 4DP0X 4MJ4A 3BUIA 3IJSB 2NXZB 3QEHB 4WNSA 3HHSA 2VZ3A 3ENEA 4WFHD 1PZCA 2ZOOA 2J6EA 1YN7B 5GZOD 3B56A 3VXMD 1KGCD 2L7UA 3DNKA 3PHSA 4OD3H 3V6OA 5L4MA 2A99A 1HL4A 3VXMB 3T0DA 4FD0A 3I3DA 1RUQL 4YBLC 4HFWA 1BZQK 1RIVL 1CFTA 2ZPKL 1UT1A 4ETQA 4PMEA 4Y2OA 3E9UA 1WTGT 4H0GA 4M6AA 4C4KT 5C07B 2WJ7A 1LE5A 3MGTB 4DPRA 3CVHL 3HG1B 2Y72A 4KY1L 4XN4A 5ETUB 1TQCC 4OQ1A 3IDYB 2BFVL 2FIKA 5IQOA 4B5EA 3LZNA 3BQUD 2Z0BA 4QJ3B 5KSBF 3O3EA 1QSEA 3FUFA 4OCRH 1ONQB 4NQCA 4ERSL 1WYJA 4OZGA 1JHLL 3ESPA 2I25N 5JW3H 5TH2B 4HWEH 5DD3L 4HG4J 4Q9CA 1KDJA 4AKPA 5LQBL 5CS7A 2EINB 4UAOC 5FEBA 4IRZH 2FTAA 2X70A 5ACZA 1ZGLB 2G30A 2X41A 2ZOLA 3E3QC 2ED6A 4Q8BA 3ULUC 4JFDD 3U0PB 4R7XA 1PAMA 1M6UA 3OSVA 4WLCA 2MQ3A 2RMNA 3O3DB 4RWYH 4V2BA 2OI9B 2VNCA 3DX9B 4UOJA 1FYHB 4O2CB 3SOTA 4LDEB 2GJZA 2JQAA 2IO5A 3FTWA 3C87A 2VIRA 3PWPD 1CGWA 3UYRH 4XB8A 1Q38A 2G0KA 4NNPH 1CGYA 2VC2L 3ARGB 4X4XA 1B0WA 3EJSA 2M2DA 2R9HD 4S0TD 2HRPL 2JCCF 1JN6B 2QGBA 2IIJA 1J0IA 4EN2A 1PKOA 2UV3A 3VXRD 1CFBA 4YHYC 2XWDA 5GISL 1W72B 3DVNB 4O2FA 2CUMA 4X7SH 1CK0L 2EIDA 3SCMA 5F1NA 4H8PA 1J0YA 4Y2DD 2GSIA 4FF9A 1FZKA 4JPIA 2YOCA 3E6HA 3BSZA 3T0EB 1NLBL 1LP9F 2ZXDA 1A0QH 2DQJH 5EPMB 3EW3B 1CXKA 4LLYA 2FQFA 3VFGL 4JKNA 5IVXE 1SGKA 1QABA 2LLLA 2OK0H 1J12A 1RVFL 5MENB 4PWGA 1I7RB 4G6FD 1XIWA 2ZXWB 3H9SE 4JM2A 4NC0B 1YNTB 4RX4A 5EORH 4ACPA 4LCWE 2WB7A 2OM5A 3B9KC 2OSYA 2YQ2A 5DA4A 1NAMH 1VFBB 3DVGB 4NPJA 1PQZA 3R1GL 3JTTB 4JO2H 4HJ0C 2I5YL 1YY8A 1V54B 4NNPL 1G9HA 3KWWB 4R5VA 4AY0A 2NY4C 3L9RA 1TYJA 3LMJL 1OM9A 1ZT1B 1AS7A 3BP7A 5IBLC 2MCPL 3RY4A 5CLXA 2ICWI 3HKZA 4HX1B 3BISA 3MV9E 5ICUA 4KK8D 4Y16B 3LV3B 5C9JB 1RSYA 2G75B 4XH2B 4N6RB 1KBKA 3MJ7A 4OZFA 3WCYA 1E5YA 1NDGA 1EDHA 3E80A 4QRSA 5D1XA 3OKKB 3D7PA 2DI7A 2NUPA 4X9HA 4OFVA 3I9GL 1Z5HA 1VLXA 2KZ1B 1E50A 5AKRA 4GAYB 4HWBL 1ZJAA 4WTZG 4UT9H 4PCYA 1DL7L 3DIDA 1MAMH 3D69A 1MIMH 3ZU8A 2N0KA 4FXKA 5DZJA 1J86A 3FS9A 5IFHL 1D5RA 2NW2A 4H8WC 2OKMA 1A6VH 3WLBA 3RKDC 4WFGD 4F8TA 4QR7A 3D07A 3O0RL 4XMKH 5I1JH 1RCYA 5A2JH 3L6FA 2FUTA 3UBGA 2MOVA 5L2KD 2O6DA 4YIQA 5EEUA 1QLRB 2V2WA 1E5ZA 3Q8BA 1SOXA 2GQHA 2KZKA 2VERA 1T0PB 3JWNH 3U9UA 4TOYL 4PJ9D 3SDXF 5IJDC 3U9WA 2D31B 2HFFA 5J12C 3GFUA 3BD5A 4I9XA 1DBBL 1UXMA 1Y7VA 4YE4L 3E8UH 2CMRL 3EH5B 3ZMNA 4HYTB 1DFBH 3G9VA 4OGXL 2AJXL 3MLWL 5EUOB 3ETTA 3UERA 3QXWA 1FV1B 2VN3A 3HE6B 4FX5A 4GQZA 5KUKA 3T1FB 2H3KA 4ODTH 2VRAA 2LR4A 5IQ7L 1JXJA 3N44F 4N8VG 4XVOA 4Y4FA 1QNIA 3KWXA 4IYKA 3Q5YA 2FEJA 5SWSA 1LK3H 3WFHB 3ZL1A 4MZ2A 5DQJB 1XGQB 3MV7E 2ZCHL 5AZEL 5I1LB 4PJ5A 2OMNA 2ZWLT 2QGCA 4WF7A 2V2TA 3EGSA 3MXWH 1GGYA 4HUCA 4BFEA 4ZPTA 4XMKL 5I1JL 2Z64C 3MJ6A 1JZEA 1CICB 3NCEB 1SQ2N 4ZX5A 1C1EL 2YIHA 5LBVA 5I19H 1EERB 4EI5D 3H7BB 4UMGA 4JFPA 4A7GF 3US0A 2UZYA 2A4ZA 4LE8A 1CZ8L 1XWVA 2W9EL 3DYPA 1NAMA 4YHML 4M61B 4F57H 3GBEA 4PI0A 5C0FA 3NJFA 3BUYA 4K3EH 1YDPB 2APFA 5DVPA 5I18L 4LAJH 5LN4A 3E8UL 1PIFA 4MAZA 1KCBA 3L5IA 4KDTA 1TU2B 1QTSA 2XFXA 5T1KA 3KPPA 4JQVC 1AS8A 2OMTB 4WEMB 4AIZA 4ZX3A 2X2YA 3SOBH 3QUZD 1RHHA 5CKGA 3TPKA 4G82A 3F85A 4HC1L 5A2KH 4J5VA 2LQRA 4UQ3A 1YQVL 3MLSH 4HQQH 5I15H 5FB8A 4HT1H 3GSQB 1QO3A 3JT0A 5ADPL 3NN8A 1GC1L 2H3NA 3OKNB 5BVJB 3INUL 3K74B 3IB4A 5I9QC 4FKKA 3CFBA 4KTGA 1YPZA 4N1CA 1S9VA 5FYJL 4DEPB 3PL6C 5GGTL 2DQCH 1ICTA 1I1AB 2AMUA 2ICWA 5AOJA 4FP8H 3G5ZB 2DIEA 2H3XC 3L4XA 3QIWB 2VXVL 4JRYA 5F6HI 1NLDL 1SBSH 1ZVNA 4FCHA 5IB2A 2HVJB 3CN4A 3UTSD 1KY6A 4MMXB 3T65A 2P43B 5IVZA 3T2PA 1TZ8A 1MRDH 2FAUA 2OYMA 2J8UF 4P4KC 4FL4B 2NYKA 2WBKA 5EF0A 2E4FA 2ERJB 1EQWA 4KVCL 5TDNB 4EQ2A 2P80A 1DBAH 4M8RA 5KS9B 5DO2D 5I82A 4H8WL 4HALA 3VM5A 2A9AA 1V7ML 1QD0A 3MA9H 3TCLA 2X87A 5CD5D 2LU4A 1UD5A 4F33A 3HVNA 2YA1A 4YAQA 4K71C 3ULUH 4GG6B 3UXFA 1DUZB 1QG3A 3FO2B 3IJ9A 1AZBA 3HPLB 1O6SA 5C0AA 3PABA 1PZ3A 4OFQA 4NO0D 1E28B 3ES6A 5DVOA 3KL5A 3IMTA 4RZCA 3JBG7 3O4LD 2IVFC 5TE6H 2J8UA 4I3GA 4N3UA 2MHAB 1DLFH 5F7WC 2H45A 3BESR 3QJHA 4F7TA 1QASA 4F7PB 2CKBB 1KIPB 4N90E 2AV7A 1MCRA 1RH8A 2WNGA 2DWDA 3QZLA 4H13C 2WKGA 4PB0L 3EFDL 3KPMA 2ZOUA 4AZ8B 4GI8A 4JZOA 3VW3L 4R7LA 5FGBC 4G59C 2JSFA 1D6VH 5DHYB 5C70A 5JIDA 2OR9H 1R47A 3MROA 4G7RB 3VE0B 2UUDK 2LAGB 3O3UN 3ZRFC 2BIIA 2CQVA 4JJHA 1T7YA 4G8IB 2Z8WC 4JB9L 1HNYA 5C7ZA 1DBAL 3C9NA 2GFBA 3NGBC 4FE9A 4L29A 2EDMA 2OYLA 3R19A 2YUXA 4NRXA 3LVEA 4XCEA 2WB1A 3BE1L 4ZMYA 4OFKA 3D39D 4AKQA 3BGMA 3QUZC 5CEZL 4HMDA 4OCXH 3B2VH 4CBPA 1AGDB 1Q0EA 4ESKA 1EEUA 3CCHB 3MNDA 2IPTL 4BZ2H 4UU9B 5GJSH 5B4MD 1INDH 1NUFA 1AD0A 2R23A 3MV01 4WFFE 3M46A 2QPFA 4OQTA 1GW0A 2WXOA 5DJAA 4E5XA 5FC9A 4W9GC 4JDVA 1LO3L 1YEFL 1RVFH 4IBVA 4JKPH 5KJRL 1WK0A 2PP9A 3M17B 2NY6B 3ISRA 5IV2A 3EFFA 3EDFA 3UC0H 5CFAA 1Q1JL 4X5WB 2F19H 4LSUL 1NAML 1S7XA 5A40E 5SWSD 1BM3L 3RVWD 4AJWA 3GSNL 3HR6A 3VXSE 3P4LA 1E2ZA 1G94A 1MZYA 4KC3B 2FHFA 3K1KC 1K3IA 4LLMB 5BOZG 1CICD 1F97A 2EE9A 5IB5B 3LNHA 1UUNA 2A77L 3FQYA 3JWOL 3FH7A 5IJCC 4TUJA 3AQZA 3GYRA 2YMXL 3D18A 2EO9A 4UQIM 2ZOTA 4AEEA 3AU1B 3I6KA 3TO2A 4WI3A 4PJBF 3Q6FB 2CALA 5KYYB 2YD5A 2X70B 2VDOL 5DMIH 4W4OC 4G8FB 3ETBF 3QQDB 5JYLA 3RA7L 2VDPL 4KK9D 2WPGA 1T0MA 5D2LF 1QFWL 1MVUB 2YPLB 1ETA1 3LRGA 3Q2LA 1A9VA 1RLWA 3DJ9A 5E6IC 2FGWH 5J1AB 1UWFA 2TRYA 1JL8A 2BHYA 2ZONA 1YA5A 1ADQA 3QC6X 3UPRA 4L8SC 8PAZA 2X53A 2H7WA 1E67A 1AR2A 3BVNA 2ZUXA 4DK6A 3F01A 4ZQTA 4UT6L 4FXTA 5KVEH 4NPKA 2QDWA 5DTFB 3BN9D 4APQB 4GRLD 4KV5E 1BVKB 3PHQB 2AJZB 3H9YA 3IFNL 5F70A 1D9KB 3MV7B 2A9DA 3IU3A 4RGMC 4DWHA 3JT2A 4PVBA 1A6VL 5MEOB 1JHTA 4OAWA 3L5XH 3SDAD 4Y7MA 3C5ZC 2YEZA 3L9EA 4NZTL 1JCVA 1PL3A 4LSVH 1DQJB 1AR1C 4R83A 4KO9A 3ZKXB 4H25B 5FO8A 3GUFA 4L3CB 1G9ML 4M7LH 5E8DH 5KYWB 2WXQA 1KJ3H 2QKSA 3QJRB 4P3DB 5GJTL 3RILA 3HPJA 1KELH 2DD8L 3X13A 4FLRA 2VO5A 2IPUG 1NCBH 3HUJE 3IMRA 1EJFA 4MX7B 4JO4H 3NCJL 4PJIA 3LKRA 1B88A 2HKHH 2YPLE 3QO1A 3QCVH 1RJZB 5IK3B 4QHNB 1L6PA 2WLMA 1NTDA 3HUJA 1X5YA 4P2QE 1I3GH 1K72A 1XIWB 3VRLF 4Z3GA 1YNTA 4GBXA 3AB0C 5CP3H 5CKAA 5AB9A 3TH4T 2VQ1B 3MA7A 5A6LA 1KPUB 1GGBL 4L3FA 4N22A 3VFSB 3NVQA 4IBLT 4Z7WB 3AWGA 3UFIA 3RWJB 1A1MB 2DLTA 4P46C 4IQHA 4YL4A 2WWOA 4HKZB 5BXFB 1E8XA 1GZPB 32C2B 4QWWD 4X7CC 4FFZH 3RVTD 4KITB 2ZG3A 4ALAH 1GTFA 4LSVL 1BF2A 1WC7A 4PJ8B 2EECA 1A4KB 3MC0A 4MAUL 1N7MH 1U8CA 4X9FA 5HYFA 3P40A 1U2HA 2ZCLH 2WBXA 3RWCA 2E27L 3WEBA 4GJTB 3B4NA 1G4RA 1LD9B 4BDVB 3V6ZB 3LRSA 3CC1A 4U31A 4OZFB 4DFIA 1CZ8H 3TBTB 5J06A 2Y06L 1CL7I 4UCFA 4DAGH 2WQRA 4M8UA 3VXME 1C08A 3OKKA 5FYKL 2XKNA 3F7PC 5DEFA 1WEJH 1OGAE 3C08H 1PLBA 3NZSA 1G7PA 3L3OA 3US9A 4KI5F 3RGBA 3US1A 3AXLA 1HZHH 3APMA 4YZFE 3IJYB 1A64A 3SKUD 3DYOA 4YGAB 3F6IA 4AE0A 4LMQE 4P2QA 4XMTA 2GEQA 3HLAB 5E4OA 5K9KB 1R3LA 2CH8A 5DU7A 1SF5A 1BP3B 3OXSA 1MCJA 4JDZA 1Z9OA 2UUDH 1MCOH 1OPGL 3ARYA 1BVNT 2W88A 4P5TB 5KVEE 3GXUB 3POCA 4KXCA 2DWSA 1XF3B 4ZTPL 3Q9PA 1EJ8A 1RHFA 4FFZL 3V79C 1FZJB 4Z7VF 3FT3A 1TKWB 5HHXL 2DQCL 3NJKA 1H5BA 5FHAL 4JVWA 1IE5A 3FJTA 1IKNA 2P44B 3DIFB 4DTGL 3IDNB 4HVBA 3D2UD 4KKLD 5D1QC 5IMLB 2D31A 4HJIA 4NOFA 1W0WB 3O6KL 3FT0A 2WC7A 3N1MC 2NY2D 3QC5X 4M43H 1DBJL 4M9OA 4CA4A 5IY5B 2F9BT 4ZMTA 1S7VB 4N0FA 3B3IA 1RULH 3QXTA 3VQLA 1T21A 4DCQA 5B39A 4XNYH 5F88B 4Y4FB 2JIXD 5ADOH 2IGFH 1S5IH 2NW3B 4WKZA 5CSGA 1K5NA 2EQDA 1SXCA 3GSXA 1RUAL 2WD0A 4JQXC 4NNXB 5I0ZA 5K5YA 4GSQA 2K7QA 2VLKB 1OGAB 43C9B 1Y1DA 3F58H 4JDTL 4O58H 3FZUC 4GI6A 2H32A 5FECB 4DVBB 5KSBE 3L3KB 5ICXA 5LXVA 2GCYB 3HS0C 4BQBA 4KJPC 4KZEH 4K94C 1ZLDA 4WO4C 2VERN 4AM0Q 3TM6A 3LZFH 4JANA 2H1LM 2QJDA 1XTLA 4R4BA 4HJJH 3TO4D 2I9LA 1C8PA 1XXFC 2YFNA 4MJ5A 3OB0K 2V7HB 2B20A 1XVSA 1BF5A 2ADGB 5FYKD 3CUPA 4HXBH 1NGWB 2XTJD 1T6WA 4FKHA 1YJDC 1LWRA 3E2HB 4IW4C 3ZRSA 4GINA 1I7ZB 2YR3A 5FXCH 3WNPA 2P9RA 2AJVL 4OZ4B 4JJ5B 3RWFA 2BY1A 2C7FA 1WHPA 1XGYH 2KC0A 5C0JA 3VXSB 1BQLH 3FQUA 4O00A 1LE9A 3GRWH 3MRBA 3HHMA 4MNQE 5E8OB 1K9TA 4U3XA 2BP5M 3FQTA 5JHLA 1TR7A 1LEGB 2OMUB 2QTVA 3WTWA 1CDBA 1UJ3C 2ARWA 4KTEH 4GB9A 1IGFH 3KHOA 2X38A 2E3VA 4FHKA 1YY9C 1OAYL 1YEEL 4QHLB 4XRCA 3VWJA 3U4BH 4YJZL 2VW4A 2EUVA 4LKXB 1S7WA 1A6ZB 3GSOA 1OSEA 2WP3O 3ATAA 3I2CL 3MOQA 2Y36L 3VXQB 3NA4A 4Z78A 4AYID 5E6RB 3ZTEA 1ZKAA 4FLHA 3FQNB 4ZJ9A 4HCGA 5DGQA 4WWKA 5IF0B 3LS5L 3ULVC 3TT1H 2XY2A 3WFDH 3SBWC 4HV8B 4G6JL 1AC0A 3BKJH 3TJEL 1TO4A 1NBZB 2EDRA 1T03L 4MGXA 4N0UA 4PGCA 2OLDA 1SMDA 2PYEE 4NPYA 3AREC 3Q8EA 3UIZA 3WI9A 4AE1A 4V1DE 5ITBH 4N2GA 2JI2A 3LIUA 2GTWA 3MGAA 1P4LB 3OB0H 1NBVL 2ATKA 5JR1H 5MI0C 1XGYL 4PWHA 4YHZH 5EIIG 5JORA 3M88A 1ZXQA 4K8RL 4LSDA 3QEGH 1U30A 3FONA 5I8OH 4GXVH 3L48A 2DM4A 2XWCA 4IKLA 2VDOH 1GSMA 3V5DA 2OSLA 1J11A 1T0OA 3KD4A 2VLJA 4H1LA 4P2RA 2VN7A 4HPYH 5C3TA 3DOHA 3KPNA 4LOEA 2MFNA 1JS4A 3R0MA 4GUPA 2R29A 1SVZA 2GUYA 3VFTB 1V10A 5IJVB 1K3ZA 2NT1A 1LTXA 1W8NA 4AQ1B 4EI5C 2OJZH 3UCQA 3W5NA 1IC0A 4PB9H 4W4NA 2FWSA 4WJKB 1NAKL 4L8CB 4B0MM 2IV8A 1ZDSA 2MQGA 4MD4A 1R75A 2NR6C 1HHHB 4FYSA 1JZ8A 1G7MB 4LDOB 4E9XA 2QLVB 1DLHA 3L5XL 3IPEA 1IT9L 2GFBB 3GUTA 1HH9B 2VUOA 1Z9SB 2DIAA 2X89D 1IGYB 5E8DL 3HC0B 5TDPA 1SOKA 5ES4B 4HS6B 1URIA 4AQOA 2PO6A 1D7DA 4KXAA 5DJ0A 2SEBA 5E4IA 4HULB 3KH4A 1DCLA 4UU9A 1O7VA 3WJMA 2OW6A 1DN2A 1NC2A 4LKCB 5TGBA 2Q0ZX 3MUY1 4P3WA 2FEDC 1T1YA 5IT2L 2CD0A 2QKIC 1QSFB 1YO4A 3IMUA 3ARBB 3QDGD 5DQ9A 3VGFA 1WA1X 1GYWA 5IBUB 3NSFA 4XBPA 4NDMA 1KCVL 2AAAA 1F56A 1F2QA 4NRYA 3TWCH 4B3VA 1DEDA 2QSCL 4OFYD 2CK0L 1EDQA 3NZ8A 4XWGL 1JGVL 5EEYA 1XFPA 2MEJB 3I9PA 3L3JB 4BWWA 3FRUA 1H8OA 4QRFA 5DWPA 1WO2A 4LCWB 4JZNA 4QRQA 1KPRA 3AT9A 4C56A 1ZS8B 2CKBH 3LXAA 4NJ9H 1DQQA 4Y0GA 1L3NA 1NCOA 2P24A 5IVXB 4JPKL 5T3XD 3ZYJA 1MF2H 2EKSA 3DETD 5HI5D 3CFUA 2UXTA 5D7IA 4EI5B 1BD2D 3PNWB 2Q7YB 5DRXB 2I27N 3BP6A 3Q2NA 1T0MB 4QRRA 4IHBA 1FFPA 4J3VA 4O4YH 1T20B 1YNTF 3IMVA 3QUXC 4JHWL 3NJGA 2PXYC 4J3SA 3ROOA 3K4ZA 3KGTA 1MHCB 4YUEL 4U4IA 4ZNEA 2EEBA 4JO1H 5F2FA 3APNA 5K1JA 2YC1A 1KZQA 4EZKA 3CQPA 1MAJA 5EZJA 4K5PA 5FDWA 4JFFD 5HYJE 4M7JH 5B3NA 3SJVA 3QQNA 4Z5RB 5LGHL 1ZVYA 3LB6D 3AREB 5IEKA 5L4JA 3OHXB 1MN4A 1UA3A 4QHMA 3RL1B 2YEZB 1DQJA 1FZOB 1PTZA 1A1OA 2O26U 5FO8B 3BUBA 2VXUH 2C3VB 3C5XA 4JMXA 4P2RE 4RCAA 3VGAB 1XGRA 1S78D 1VADA 4ZX4A 1YAIA 4JFYA 5F3BB 4NQEE 1R5VA 3MRCB 4IJ3C 5HHOD 1FVEA 3BMWA 5GGRY 2IBZX 1MFAL 1DQMH 3CLWA 4KK6C 4HGWB 5F89B 3CN0A 1LDSA 1XR8B 4PCKA 3UH8A 4R4FL 3EYVB 1RJZA 4G8EB 1I1YB 5IK3A 2E47A 3MUHL 4MB3A 1IL1B 5BPPA 2V3DA 3S34H 3GINA 4JFOB 1R3JA 3LEYL 5IWLA 5I8EA 4CW1A 3ABZA 4H2CA 2VXTH 3K6NA 2FJSA 2IWKA 1OOAA 4K3HA 4HWUA 2XKUA 2MQ0A 3GKZA 4AL8L 2N59A 3QXUA 2AEWA 2APVA 4JG5A 3TH3T 1A2YA 3PREA 5DSCA 1L7TH 2YSTA 3KPOB 1ONQA 4R5TA 3QEQA 1GZPA 5D96B 2GTZB 1OLLA 2DKUA 1IBDA 2QQQA 1CXLA 4FQLH 4DVRH 3M6DA 3O8XA 4Z7VB 4XAWH 4YXKH 4HOMA 1UJTA 3CZSA 4PJ9A 1DQLL 1JPSH 1UZ6F 4WY7L 1AXTH 4ORGA 4RH4A 5D5ME 1NA8A 3NP3A 3RWCB 4XOAA 1G1OA 4U6HA 3KYKH 5IVOA 3JVFC 2GC4C 4Q6IC 3DGGB 1DQIA 2BHUA 4JY5H 2G0LA 3O6FA 3RWEB 1H8NA 4Z1PA 3E0GA 2FH8A 5DDHA 1DVZA 4NZFA 2IC2A 3MRIB 1KV3A 4WFED 3PXJA 1CYGA 1ZDQA 4TN9A 4X6CA 4OV5B 2HT2D 4WKXA 5CLWA 4X5QA 3SY0A 5E00B 2ZX7A 2WWKT 3D2UA 4FQQB 1AD9A 4R2GD 4G7VL 1LDPH 1SJEA 4GPVA 1T4WA 4DPBX 1U95B 2CJUH 5IREA 3R7QA 2ED9A 1BG9A 1L7TL 4JHBA 1A4AA 1BEYL 4EE2A 3FFDB 5JLZA 1FSKC 1JAEA 1XF3A 3HNVL 4HUWA 2J6WA 2ZTBA 1FZJA 4HKXA 1SYVB 4Y9CA 3C8KB 4N90D 3Q5TA 2G5BB 3ALPA 1QYGH 2BOLA 1HNGA 1BGXH 3PGFL 1UZ8B 4AT6B 3V4PA 4B96A 4F7MA 3ZMRA 4WY7H 3GSRA 4FADA 4JY6A 3A4FA 4QMEA 3NDYE 3DROA 1DVXA 2H2PD 4PWJA 1NGPH 4PRNB 1KULA 4G3YH 1XR9B 1RPKA 1UACH 4LCIL 3FOMA 4PY7A 1TUPA 2DEYX 3VRJB 5MENA 1XAUA 1YEDB 3E3QE 2AEQL 2AXHA 3HI1B 3C2AL 3TT1L 2WVVA 3UTPE 1JWMA 3C60C 3OSKA 3V0FA 3WUWA 4A7SA 4L4TB 4L9LA 1NBYA 4NKMA 3GI9H 4PS3A 3I85A 1A14H 1VFBA 4M03A 3WJJC 2HH0H 4U1NB 4TULL 4ZAKD 3HAEG 2BNRE 4X99B 4Z77B 4NEHB 5E08L 2BWQA 3X11A 1FA4A 3JTBA 3HZYA 2HN7B 2X28A 4OFYA 2YRBA 4F8OA 1OGAA 3BZFA 1FWXA 4KX7A 3BRFA 2A1WH 2HVKB 3KMDA 4E0RA 4Y5VA 2X4QB 4I9WD 4ZFZA 1A6UL 4CJ1A 1SOQA 5FW8A 2D2OA 1ASQA 3NJMA 4QEGA 4DVBA 3ARDB 4HPYL 4LCCB 5ESVB 1P7QB 1IFRA 1OP5H 4IHOB 1OCZB 1SLVA 4UQBA 2K6YA 1HT6A 3BAEL 3TN0D 5FCSH 9CGTA 4KOCA 2CO7B 4WFHE 4AUJA 1MFEL 4X9IA 4S0HA 4JHAL 4QF1B 2APBA 4XI5D 3VJ6B 4R7DB 2I85A 4A6YA 3GMRB 1IC4L 3VDAA 1PG7L 3F83A 4YPJA 2HRHA 2XPGA 2P52A 1OM3L 1YUKB 4ZAKC 2WSDA 1DVUA 1EXUA 4LFHD 1JXFA 1NOLA 5C6TH 2VXSH 3K0WA 1E40A 4OZ4A 5KW9L 1MXDA 3L5JA 3EJZC 1AGEB 2NW2B 1JNNH 3OMAB 3IGAB 2FECI 3PP3H 1WAAE 5C0CA 4UB0H 2CJSA 3W3BA 1I8LC 3TEZA 3N42B 3DTDA 4ORZC 3SBRA 1B4LA 3EXJA 3Q48A 3FQTB 5F7EL 1VCAA 4X2UA 1HSBA 2WO4A 2Z91B 1ORQB 4GQRA 4HBQA 5T3ZH 3B7TA 4BSVA 4XRCB 3O9WA 1UQSB 1I8LA 3DMMC 3Q8AA 1S7WB 1D5XA 4W9IC 5JPMA 3HI5L 1OGPA 1Q9KA 2KUTA 3L7FA 5CGMA 3D09A 4W9KC 2O93L 4NSKA 2B16A 4J6RL 5DZAA 5D1ZB 5FUZL 5CIPH 5DS8B 2VSDA 3D34A 2EILB 1IB5A 1PLAA 2OTWB 4HGMA 4FXGC 4U2ZA 3T1FA 1T3FB 1ZY9A 4B9JA 4PIRF 4Q56A 3O2DH 1G7JB 5H8DA 3QUML 3F7VA 3CTTA 1KZYA 4CMMB 2LAAA 5E8EA 5CILH 1Q0YL 2H8PA 3JV4B 5I1LA 1L7IH 1T7XA 4JRXE 5HI3C 2CHNA 1L6ZA 3QDMB 4HFUL 4LLWB 5DJ2A 3GM8A 4B9KC 3VUAA 4JFEB 1BX2B 4NO3B 5K69A 1QBBA 4DKFH 1VPOH 4XVUD 3ZJAA 1J0JA 1BOGA 5GSRB 2OMZA 4RAUA 1F4HA 2DEXX 3UYOD 3T2NL 1DUYA 5DMKA 3MX0B 5I30H 4OCLC 1EEYA 4NC1E 3SDAB 1NAMB 2MKWA 2Q2EB 4NC1C 4OVVA 3MCG1 1AIFA 2E6PA 3CAFA 4L0YA 3VQ1C 4N28A 1TJHH 4H8HA 5T1KB 1UT9A 2Z92A 3BWUC 4XPGH 5DQDL 4OLZH 2OMTA 4W81A 3FUHA 2R4RH 1KYOJ 3FU6A 1XB8A 3SDCB 4A2DA 3BEVB 3FMGH 5J13B 5A1AA 1HH9A 3S37L 3CU1A 4K9JA 3VG9B 2FL5B 2OAAA 1EFXD 2B08A 2NSXA 1M56B 5IGXL 1FNHA 4BUGA 1XCWA 1JK9B 2BVYA 2DY2A 2BIOA 4EN3A 5F7NC 3S3DB 5FF6A 3NEXA 1MFAH 2XU9A 1X6NA 5D7LD 3N1PC 1NM4A 1A02N 4OFIA 2ENYA 4XBEL 1U36A 2CE6A 3Q9QA 3PAYA 1SXSA 4L8BB 1IM3B 4WHTA 1XH0A 1YNKH 4NQEA 5IB2B 2Z8SA 4XBPB 1RIUL 2G3MA 1ZHNA 3CFKA 1E30A 1THAA 4GO9A 4BFBD 3LPFA 5HGDB 4AL8H 5FWQA 4HIEB 4O51B 4YLCA 4W9FC 4GY4A 4OSUH 2X4PA 2WVTA 2XV3A 4TQEH 5C86A 1H3PL 5BUPA 3LQZA 3G5YB 5FS5A 3QHFH 4I0PC 2OTPA 1R17A 1NC4A 2Q5BA 1LO0L 3H7LA 5LGJA 2KZBA 4QRQB 1J7VR 2UY7B 3B8SA 1FPTL 3TIDB 2VZVA 3PWVA 1JNHB 1PX3A 4G7SB 2PYED 2ZYHA 5IKCA 4LSPL 5GGTA 4PP2B 4J39A 4KUZL 1A7RL 4FQ1L 2BHZA 5GZNA 2VSKB 3GSWB 4MNGA 3NH7H 4I87A 4LMQI 5HDQL 3FYIB 2FCBA 4JM0A 4ZODA 2D03H 4HIIB 1YCSA 3PG2A 2O6PA 2KYIA 4IIQB 3H56A 4KO6A 4N2NA 4PU2A 4PJ6A 1PY9A 2BOCB 1BQUA 4P23C 4OTXH 3MODL 4JUSA 2YC1B 2DAVA 4DNLA 3LN9A 5FDWB 2JB6A 4ZQKA 3KLHC 3VWJC 3HG2A 4G7VH 2VDNH 4XPFL 4AYSA 8FABB 1FYTA 4G83A 3GMOA 1F4YL 5G4NA 2DWXA 4OQTH 1KB9J 5F1KC 1KJ2B 2OQJA 4P05A 4WWKC 4OI8A 1JVLA 3SPGA 12E8L 3G04B 4XOBA 1P1ZA 1MJ7H 5F3HA 5IB4B 4ISVA 4PBVC 2OBGA 4A63A 3C12A 1UA7A 2WKOA 2ZWKA 5T1LB 3SE8L 1CGVA 4FAAB 1UUSA 5EV7A 2CHWA 3CFQA 4YSQA 2AEOA 2XNAA 1N70A 4LIQH 4XC1H 2X42A 1A8ZA 5DURD 3P9LA 5JMRA 1EFXA 2N0MA 3D3VD 3ARBC 1RULL 5E5MB 3QO0A 4OH2A 3W0WE 5K9OA 1I1YA 1QBML 5AVQB 1KB5A 4XNYL 2HKFL 2X89A 1MIEL 3EH4B 3M17A 3SD2A 2IALB 5C7XL 4K5LA 4OCWL 1YMME 4Z8FL 4R4NC 4OTXL 3U9PH 3OQ3B 1TVBA 2RQ8A 4MDIB 3ZX1A 1HIML 4HLEA 5BO0D 4OLXH 3B5HA 2GAZB 1OWWA 2PKDA 4HA1A 4HSAC 5FM5M 1UATA 3V4VA 3HI6H 4A68A 1P5UC 2X2UA 3ULVE 1FRGH 1EAOA 2XVGA 2WIMA 4XXCA 1F6AA 1MHPL 3T4YB 1S7UA 4JFFA 1HN1A 1A6UH 2Z0UA 1MDAA 3I6KB 4HSCX 4LLQA 4MA1C 1YPZE 3HFFA 4KJWC 4ELKB 3WG7B 1BOYA 4DUWA 5CR1A 2BOBB 1LEKB 1RZIA 4WEEA 4CILA 5B39G 3CXHJ 3DETC 1TJXA 3R1GH 3MRFB 2FSDA 4NX0A 2ID5A 3V4UL 2RR3A 2W0LA 3B34A 4JFHE 5DDHB 5E1QA 3C5ZD 1Y6KR 3R06A 2A74B 1IC4H 3CFEA 5HHME 5GGSA 4TS6A 2P5EE 4DPAX 2YLHA 2VC2B 5DJYB 3M1CA 3T2LA 4HG4K 1OHZA 3VCLB 5I1AB 3V0DA 1HEJC 4PR5A 1AD9B 3RI5K 3IN0A 3LD8B 1S8DA 2YPVH 4M6NL 3EYSH 2FR4B 1JNNL 3KGRA 5IQNA 3GWJA 1J1PL 1FVCA 1WIUA 3FYEB 3H42L 3U4AA 4LVNC 3MNZA 1QLEL 5HYJD 3QS2A 4LCVA 5DEGA 4H25A 4HIXL 5L2JA 4NGHL 5B1AB 3IVKA 2JCWA 3I74A 1ED3A 3I02B 1R3HA 3S7GA 3V0EA 2E9GA 5L8LB 4W9LC 1FG2B 4J3OF 3ELAT 3TBYB 1QUNA 4GW4B 3S4SG 4OZFH 1DJSA 4M93C 1G7HB 2IOMA 3SGEI 5KYXB 4Q6IA 3TYFB 2CRZA 2G60L 2XG4B 4PJIB 3VXTB 5GGRB 1A1NB 4BFGA 5SV3A 4PG9A 2HG5B 3DSFH 3G6JA 4WUUA 4PY7B 5DUML 2ICES 4L3EE 2XBTA 1F45A 4BH7A 3FHEA 3HI1A 2CLZA 5IFJB 4IOSD 3CVBA 3IJHA 3V7AG 2VTFA 4IIZA 5AOMA 1CR9L 5JDSA 3U7WL 1OF0A 4MJIE 5EZIL 5L2KA 1CL7L 3LIZL 4IBZA 3PWPB 5J5EA 2LT9A 1XD0A 4U1NA 3EH3B 4L5FH 2C1OB 4OIIH 3LH9A 4XX1G 3R18A 2HPTA 1AGFB 1YLBB 1AQKL 1RP9A 2DQEL 3QAZC 1Z9NA 5E2TH 5ESAB 4Z3EA 5JOEA 1T2QH 1VZHA 3GHEH 7TAAA 2MCG1 3FUJA 3UAJC 4NGHH 4F7KA 5DZOA 4HCFA 4I48B 4HBCH 4FFYL 4KV5F 6PCYA 5ESVA 1QHOA 2NNAA 3UTTD 2VDLH 5D1ZI 3QG7H 2CDGB 5F7KC 4MJHA 4AQAA 3CZNA 5CJOH 3TBSB 1FL5B 1GMIA 3WV0A 2WUBL 2FNBA 1KEML 3HG1A 3OF6A 3VJ6A 5I16B 5JQ6H 1QNZL 1QHQA 4CNIA 3D08A 1TMCB 3KZ8A 3S5LB 3LQMA 4Z7UF 4TSBH 2LFGA 1HILB 4NHCL 4U33A 2VDMH 2WMPB 1NJ9A 3D51A 4X4MA 3AXLB 1S7RB 3IS0X 1R33A 1BSIA 1CO1A 1UWXK 3FBQA 4KRLB 1YC7A 1RIVH 4MD0A 5EZIH 4G9FA 4ZMXA 4ZUWA 3WHE1 3MLPA 2F7OA 3KYOA 4QRUB 3T0XA 2W0KA 3SCMD 5C07E 5AL8A 4DOHB 1NDTA 2QQNH 2W0FA 5A2BA 4Y16C 4WTZA 4F57L 1XB6A 1CDHA 4BCYA 4LVNB 4ZTOL 3K72A 5E1GA 1E3ZA 4M3JA 3QIUA 1PKQB 1X9LA 4IU2A 3W39B 2COQA 3MRJA 2ICWJ 4BSVB 2BSCA 3GS0A 4E9VA 4O2CA 3ZDYE 1YQVH 3MLSL 3X14A 2ZX9A 4LRNL 2VIRB 4F7EB 3NFNB 3WIFB 3GSUA 4NT6B 3DVFA 3TZVB 4D8PA 1S7VA 3L17A 3P9MB 3B3IB 4RDQF 3V10A 4NYLB 1T89C 1W72H 3QQXA 1CBJA 1NL0H 4KQ4L 1T21B 4P59H 4KX8A 5ALBH 4G8AC 3PV6B 2X3BA 4JCWA 1KLFA 3D0LB 3SODB 2FEEI 2NW3A 2GEEA 4RISL 3BC9A 5K1VA 1OAJA 1NGQH 5GGSY 4JRLA 5FA4A 4D7BA 1UXSA 4PRHB 2OFQA 1MCFA 1OT1A 3CPLB 4N8PA 4ZOAA 4Z95H 2DYPD 1UWYA 4OF6A 4LSSL 4U6XA 1UG9A 4BZYA 3FZUD 3AM8A 2NNFA 1BDYA 1L9NA 1P9MA 4BKLA 2RFXB 4ELMB 1A7OL 1H15B 3OPZL 1IRAY 2OMZB 2PR9A 4PGBB 3RFRA 4NI6A 3W9EA 1D5MB 4W1TA 4CUCA 2YD0A 2GT9B 2EDDA 3FDWA 2HUHA 2LHAA 4JEGB 2M83A 4M5ZH 1I3UA 4CL7A 2MJWA 1HAWA 3QQ3B 1IKNC 3SE9H 2HT4C 3EDEA 4E9SA 4BH8B 3PE9A 1G7LB 3OKMA 3FTGB 1UD8A 3O2VL 1F6LL 2VDNL 3AS0A 3ESNA 4XPFH 3CUPB 3V7MA 2NY3B 4KDTC 3HE6D 4KKLC 4PJAB 2PPCA 3ALXA 1T7VA 1JGDB 2YGOA 1GKOA 2CDFA 4N0UE 3HEIB 4DP9X 1JWUB 4PWFA 3VSUA 3CDCA 1ZAGA 3L3GB 4XXWA 2CWRA 2D4FA 3LV3A 2CO2A 1JK9A 4P9ML 5E8OA 3ASNB 2E9BA 5DO2C 1PCXA 1J9SA 3O4LB 5D2NB 2OR9L 2J7LA 3KM2A 3PXLA 1SDAB 4PJXB 2A3TA 4UYPA 5FW6A 1RUML 4ZPVB 1FQ9C 2E7HA 2H1PL 3U1SH 3OLGA 4XVTH 5HGAA 4EDWH 4LKXA 3MVSA 4F58H 4HUXB 4XCNB 1OT4A 4DGVH 4NQEB 1NEUA 2WLYA 3BLBA 5D70H 4YSAA 4ZFFB 4ZZFA 1ZLVK 4ZD3H 4YS4A 3FQRA 1EAPB 2J21A 1KCWA 4G1EB 4ODUB 4HZAA 3H9SD 3QNXA 1JGIA 3SE9L 1BFVH 1KENH 3IGUA 1IZJA 1N5AB 3BWAA 3O6ML 1D6EA 3N55A 2AJSH 4L4VD 2G3NA 2C3WA 3UP1A 3GJFK 4ATTA 2HFEA 4POUB 5GRVL 1BVOA 5EO0A 4BINA 2PPEA 2ITDA 3JYCA 4KRPD 3I9GH 2WOYA 2APWA 2DRUA 5K33A 3HNSL 4G43B 4A6YL 1QLRA 2V2WB 4WIQA 1LO2H 2EDJA 4Y4HB 5HDBF 4Z0XA 4KHXH 1Q1JH 3LQAH 4GMSH 4PJ7A 1UYWL 3BEWA 4Q97A 3O4OC 1Q9LB 3B2XA 5GRYA 3RX9A 1U91A 1HE7A 1FUNA 4PRIA 5FUOH 4G6FB 1U8IA 4GMTH 4YDIL 5IJVA 4XP1H 3FCTB 4P46D 1U8QA 1BG1A 4ZMOA 5D1QD 1DP0A 3KPTA 3MACL 4ONFH 4N25A 5DQJA 1KTDB 4PRPE 3VVWA 2IQAB 1YHPA 1BFVL 5DMIL 4PJEA 2X1OA 3CFJB 1WZLA 1PS3A 2AI0H 1M6OA 2B8OT 1KCUH 1HYSD 1DLHB 4C55A 1A0QL 1N3NA 4PRPA 2H6PB 1JV5B 3WXWL 2M1KA 4EBQH 1U8PA 3HC0A 2EIJB 5EBMB 4GIPD 4ODTL 5DJ6B 4ISVB 3DA0A 4X6BB 4S2SA 4OD1H 4B9CA 1A5FH 5EORL 1PDKB 1LK3L 4H1LH 4UTBL 1YN7A 2UZYB 3BKMH 2PETA 2NT0A 4DP6X 1NUGA 2Q9OA 2RH0A 1JG9A 3C2AH 3D85D 2WQSA 4ZMPA 2IMMA 4GAGH 5DRWA 2X6UA 2CJ3A 2W59A 1CUOA 2Z31C 3O81A 3QPXL 4PGJA 4I2XB 2WLHA 2IV9A 4BHUI 2CLRA 1BXXA 3HE7C 1OAQL 4HS8L 4HUVA 5DC0A 4NRYB 5C07A 3S8WA 4MDRA 4FFWD 2R15A 4KUCD 4P46A 4NO2B 2OL3H 3SDCC 1E0OB 1ID5I 3U6RB 3ERXA 2X9ZA 2YMTA 1QBLL 3X1NA 3OKNA 4YDKH 1MRCL 3UTPD 2JE8A 3WKQA 4E41B 4EOWL 3KPSA 3ARPA 1YPZB 4G1MB 1KPRB 5LQBH 4POZD 5IEHA 1VEOA 2VLRE 4JFFB 2ZG1A 3KGSA 1OOWA 1CBVL 5IR1B 4OD2A 2BIHA 4GXUM 2QSQA 1E4HA 4ECNA 3DO7A 2VDQB 2WWMD 4P5KB 4PJFB 4YWGL 4UT9L 4NFDA 4MMXA 3PQYD 5GGUB 2EYSB 3TU6A 3VXOA 5TPWL 4GQ9H 2R4SH 4P5RA 5E2VH 1RQ5A 3E8VA 2Y7QB 3SGJC 4Y88A 3P77B 3EJCA 4LSQH 5E94A 3OTTA 5BV7H 4M8VA 1MHCA 3GHBL 3J7HA 3HRZC 3I50H 4N5EC 5DJYA 1CDIA 1WFNA 4X6DB 4IDJH 3QSKB 1A7BA 1ADQH 2XQBH 1U8LB 3MNVB 4MXVF 2IANA 3SJVB 1RZKH 5FYKU 1E9OB 4D9RE 1FZMB 4JJOA 3SQBB 2BZ7A 1X5ZA 3RDTC 1MXGA 1O6SB 3F5WA 3IAPA 3AADB 4ONGH 1CVSC 4MLSA 5JW5A 2A7BA 4J4PC 1P5UA 1MUJB 4NQVA 3PYCA 4K9EH 3RWIA 3F6LA 1PY4A 3TA4D 1KYOK 4EOWH 2WQUA 3CQQA 1HHGA 3U30C 3IVKB 4O2FB 1YEHH 3FT9A 1KXVA 5I9QB 1F02I 5F3BA 5EF1A 1JZ2A 2B59A 3MMEA 5GIRB 3QWOB 2IG2H 2R69L 1PG7X 2FH6A 3E6HB 4YC2B 5FKAB 5PCYA 3VFGH 4Z7IA 3O3AA 1DVFB 3NIGE 4U1GB 4XP6H 2HCZX 5F89A 5TQ0L 4L18A 2V9QA 4UM9A 1RMFL 1UH2A 4A1RA 4PJGA 2NDGA 3QRLA 3MROB 4K73A 4WNQA 1MVFA 3D6GA 5DC4B 3K81A 1KT2B 1PW3A 1X5LA 4LOFA 5EOCJ 3IDJA 3H9ZA 1W72L 2XOTA 3IJHB 1FNSH 3JYBA 3KCPB 1I4FB 1NCJA 5IG7A 4AG4L 4X6EA 5DR5L 3FQ4A 2MRYA 2H0EA 3GMPA 2J55A 2BP8B 3S35L 3QWQB 5T8IA 1A2YB 4CVZA 3OGCA 4C58B 2ZKWA 2DL9A 3T8VA 4EIBA 2NZ1A 4ZX6A 2BO0A 3FF8A 1UXWA 5DVNA 4JLRB 4ABQA 1F1AA 3SQOL 1ND0B 2JTYA 2D7PA 4X6CE 4H88H 3U2SB 1RZJC 2SODB 2VXQL 3TIEB 1QWUA 2V5SA 4WHCA 3BDXA 3TV3H 3SKJL 5C9JA 1E2WA 3IXAA 2BVQA 1IQDB 2FQDA 3N1QC 2W07B 3MRRA 4HIJA 3S5LG 5JW4Q 3I9AA 3NCYP 3NEOA 1FL5A 3D52A 3OQRA 2WZ6A 3U2IA 5JHBA 1PD0A 3OD3A 2AKRB 2EEAA 1RMFH 3DVIA 3QI9D 1QQDA 5JIHA 1GOHA 4Q4EA 2R4RL 3IMBA 5AB0A 3VACA 1E9QA 3SY0B 1T1ZA 3M7OA 4KDVA 4AG4H 1WBZB 3OBAA 4FXKB 3TTYA 2YFOA 4FG6C 1UJ3A 3TBCA 4I9WE 3BAJA 3PWJA 3RDTB 1CU4H 5IOKA 1M71A 2BFVH 1A47A 4IBYA 3RVUD 3G7TA 4EUPA 2DJ4A 5BS0B 4A7VA 4RGND 1ZV2A 5IQLA 3ZKQD 3EAKA 4ERSH 3K72B 4E5XG 1AGBA 4LARH 4EF3A 1LO5A 3AVEA 1BQHG 5J1AA 4KKCD 1I9JL 4HH8A 4N2OA 5ITFA 2FHBA 1DEEB 5IJBC 1V7MH 1F0LA 4I77H 1CFSA 5AW9B 2AJXH 3FHQA 4TNWF 1XR9A 1G1KA 4F24A 3GSUB 4NT6A 5DTFA 1OE1A 3FOMB 4IOFD 4L48A 1U6AL 1HEHC 1NCGA 2FX8L 5SV4A 1YEDA 2AJZA 2WLLA 1D5BB 4BA0A 1HWWA 4GUCA 1QFWH 1BJ8A 3KEDA 4Q4IA 2FGWL 3MREA 1SHSA 4GG6F 1YEJH 1MFMA 3GLAA 4F9PC 2R7EA 1WE5A 2HN7A 3QUZA 1RK1A 4LSPH 3UAAA 4X8JB 5F9WB 3TVMA 3VXUA 2V2TB 1CFMA 4BZ1L 3X3FL 2MNJB 2QSTA 3TFBA 2E9IA 1SYSB 2O61A 3LN5A 3OKDA 4JO2L 3LEVH 4LARL 3ZUCA 1M1SA 3MLYL 4QHNA 4UQAA 4RFOH 3S88H 4WDIB 1W9XA 4AGLA 1K6QL 1TVHB 1E5UI 1DTUA 4XPBH 5AWNL 5CJ8A 1N2RA 2DYRB 5DT1H 2K8MA 2NR6A 3BKCH 2UZPA 3UTTE 4Y4FC 2DQJL 4K8RH 5AUMA 2V0AA 43CAB 3S3CB 4HPOH 1BQKA 4HKZA 3BIKB 4JKWA 2PO6C 1EXUB 4HT1L 2WN2A 1L3WA 2KZWA 4BK5A 1FFTB 1JWUA 3SJVE 2QTEA 3KXFB 4PJ9C 3BAKA 1SF3A 3QORA 1IM9D 4N6QA 5HPOA 2E75C 3MFFB 5I6OA 1GAFH 3N9GH 3ZR5A 2W9LA 3MV8B 4Y4KD 1A6WL 5DD5L 3P3YA 3UC0L 2OMWB 4QTFA 5D2NA 3HR5A 1S7TB 5IMMA 4XN9A 3C2SA 1OSZB 3WS3B 2YJLA 2O5XH 4V33A 3WNIA 2B1OA 2ZCKL 5CSZB 5LAXB 4FG4A 4X80H 5C7XH 3JWNE 2WCPA 1OGTB 4G7YL 1SEBB 3ARFB 3L3OB 3ZQWA 2OXGA 1AYOA 1Q9KB 3L7FB 4JFWA 2AP2A 2HYMA 4H44C 4IRSA 4LU5H 2VN6A 1E4WL 1KUMA 4X98A 4ZUUB 4F9LA 1HH6B 1Z9LA 4OLXL 4ZSOB 4CADB 2IADB 2L7EA 1YYML 4PJCA 3I3BA 1CDUA 2ITCA 4GXFA 4CN1A 1LL1A 3VD5A 3T2QA 2EDHA 2NCMA 4PBDA 2ITDB 5HD8C 2VZUA 3JV6A 1OK8A 1S9YA 2CGZA 4OGXH 3K5SA 4GG6A 2PW2B 3NRFA 3WFBH 3P11L 4WU7B 4DJMA 3QDMA 1E4XI 3X3GL 1RFDL 5BRZE 3H4FA 2CGRH 5D9SA 5FKPA 3EHBB 3TWCL 2CO3A 2A4EA 1QFUH 3AY4A 4PYHA 5H37A 5HY9A 4UT6H 1J1XH 3FO0L 5IQ9A 4FL4C 1NCAL 4WHYH 5DFAA 2JI3A 2VWEC 3O41A 3PUUA 4CSZA 3IFNH 3LHPH 2NXYD 3VW3H 1T4KA 1P4BL 5F88A 1HEZA 1CC3A 3CU7A 3MLTA 4QRPD 5FO9B 1F5WA 5IWLC 2XQBL 3C6EA 1K5WA 4MNGE 3QR1A 4PJ5E 3BN3B 3FQXB 2BY3A 3TBVB 4IBTA 4PJGF 4ZSOE 1KELL 2DD8H 1RU9H 3CFJA 2X9YA 43C9A 4GSXA 4WI0B 2OZ4H 5I8CA 3DWTA 4MA7H 1H3XA 1V05A 2FL5A 3LDBB 1RZGB 4X0KB 1JTPA 4L0PB 4QHUB 4M1GH 1Q90A 2X88A 3RG1C 5J8OA 2Q8BH 3QXAB 4FNRA 4NUPA 1D3CA 4O5LL 1AQ8A 4DZBB 5FF6B 1UENA 3H6JA 4IMKC 3TO4B 3L13A 4HK0B 2R1XA 1KFAL 3CZEA 4HQQL 4IJTA 4N24A 5D93B 2M26A 3O6LL 1J1XL 2JF1A 3NJJA 2R0WH 1CGXA 3K2UH 5D7HA 1XF2A 2GYSA 1FO0A 5CIPB 1I8MA 3VXRB 2J5LC 3VFMA 3LIZH 5DHDA 4ABVA 4IU3A 4NKOB 4BJLA 4AM0A 2YN5A 4JM2F 1CG9B 4LCYA 4NQCD 1JZIA 5DJDB 4JMNA 5E1AB 5JIPA 5CEZD 5F7MC 1TJIL 3RZCD 1IVTA 1U3HB 4X5PA 2KMWA 3G5YA 4MB5A 1B0RB 1OE2A 5C0BE 2H0FA 3KGUA 3KPSB 4Z3FA 3PU7A 4FYRA 4NQXB 4P99A 4EZMA 3L7EA 4UZGA 1Q9WB 1EHLH 2WQVA 3SDCD 3CXDL 3DJZA 3ZN6A 4CMHB 5DS2A 4LHUB 2VXTL 4WJ5B 4Q9RL 5T1KD 1BFSA 5KYYA 4WGWB 2QVFB 3VXPA 5BNXD 5DEZA 4FC3E 2AXGA 3QPQD 4QWWC 3RVTC 3SKOB 2EYSA 2CKNA 3DPBB 5FYJH 2RBLA 5B1KA 2RA1A 4UM8A 4DQOH 2IGTA 1RY7B 5B1CA 5F6IB 3VXNA 3ZIMA 3S9DB 4FP8L 4KH2A 3K2UL 4X5RA 3QFJD 1U92A 1UM5H 5ANHA 1WFUA 2O5ZL 2YPKB 4JY4A 5J13C 1IMHC 5EHFA 1KBVA 1UVQB 2DQMA 5E6YA 2IEPA 5FHAH 2ZOWA 1G6RB 5BJTB 3PLYA 2XIIA 3QYCA 3IDGB 1CU4L 5IHWA 5M95B 3FONB 2QR0B 4ZNCD 3BKYL 4DW2H 3V5DB 3ZE0B 4P2RB 1MWAB 3MSPA 4TVPH 5AEAA 4KROD 2IWFA 4NP9A 2XX0A 9PCYA 1EFQA 4JO4L 3TLRA 3V95A 5MHSD 3ZE1F 2X4RA 2ZXEB 3QIUD 4LRNH 1KGIA 4JFXA 5CU9A 3QCVL 4KXZI 3DJRA 4OGYL 3MBEA 3V5KA 1QBAA 1FGNL 1BMWA 3RFZC 5F9WC 1FGVH 2FQEA 3QG6B 4TKWA 5IHHA 1I3GL 4OCXL 1M4KA 3DK2A 1JPGA 1XCXA 4WEBH 4XMPH 2BCKB 1JD9A 3BIBX 1CI5A 4QUOA 3KCPA 4BRVA 2D7NA 2P5WE 4XO8A 2Y07L 3WUZA 1VJSA 3QFJA 5I6PA 1BAWA 3ISYA 2NYYC 1IGYA 1BMGA 5AW2B 4MQXC 2XQYA 7PCYA 5HJDA 1E5CA 4ZO7A 1J5OL 2OJZL 1LJMA 1U8NA 2WOBA 5D8JL 3GRWA 3RWJA 5EO1A 3NK4A 2AVGA 2XTSA 3V4VB 3Q1EA 3ZDWA 4EI0A 1X5JA 1RL1A 1WITA 3TIEA 5CZKA 2E46A 4JN2B 4S11A 1JBJA 1PY0A 1CXEA 1MNUH 4XPTL 5EBWA 2JB5H 4AC2A 4DGYL 2QHRH 2ZF8A 1LD9A 1O9ZA 5H35A 4WFFD 2H1XA 4XNQB 3MZGB 2JJTA 5AWNH 5A43C 2V4LA 3DUSA 1WH0A 3EZJB 1BREA 3IWVA 3VFUB 1C08B 4YDZA 1S6NA 3TNMB 4DP4X 5EC1A 1OAKH 1FAKT 2YBRB 1P0SE 3J07A 4WEBL 1E9QB 5DEJA 1VZIA 4LFHG 1OAUH 4HCRL 1BHGA 4OZGB 1QA9B 4R5XA 1U3HC 4D0BB 3T09A 3VGGA 3MRQB 1S8DB 2A74C 1XGZA 4OLVL 5TH2A 3T6WA 5CEXB 2WANA 4KTDL 5KVFE 1J87A 5AW4B 5E5RB 1JGLL 1HI6B 2B77A 2DQFA 5I1IH 3IAGC 5K39B 4OLYH 3OVUB 2YPLD 4M1DH 4QXUL 4KU1A 2AK4B 2C9RA 3MBWA 4PTTA 2ZOLB 3RGVB 1KXTB 2A77H 2A9ML 2J20A 1PG7H 2NRDA 2ZUQC 1S7QB 3F04A 2P8PA 3FCGA 1YJDH 2ENPA 3QPQC 5HI3D 5KZCD 4UQEA 4PFEA 4G6JH 2EDLA 2E8ZA 2VM3A 4KRPC 1WFOA 4FNLH 3PPEA 4DGUA 4C8XA 5C6TL 1ORSA 4Z7WE 3QXDB 4K23H 3H55A 4C47A 1YMMB 2J25A 4X5XA 5AD0A 2QADC 5BVPL 1R9FA 3G6DH 4PJBE 4MAYB 1V3KA 5EEVA 4BH7B 4JPVL 1PU0A 4PJ7F 2BSDA 3EFOB 5D4QA 3MV9D 3SE6A 5B39B 2IPUK 2OL3B 4NLHA 5ELIA 4G7QB 4TNVF 3TXAA 4P2YA 4Y9FA 3NSDA 4PRPD 5FCUH 1WF5A 3D05A 1WFMA 3QDME 3GSXB 15C8L 1LEIA 1ZK5A 2LTQB 1AO7D 5F1NB 1RK1B 2J88H 1CTNA 5E7BA 3VXUB 5ESAA 3A47A 5FO7A 3QIWD 4NENA 1SYSA 5HTSA 5T3ZE 4YC2C 4LLYB 3NIFB 2V8LA 5EC2A 1JZFA 3WFZA 1XDTT 2H32H 4NBZB 2LLGA 4TTGA 1IL1A 3GXMA 4ANWA 4PV8A 2EICA 2VDRB 3KNBB 4OZHE 4QO1B 1ZT4A 2ODIA 2X4SA 1WVZA 3D39E 4L37A 3NCJH 2BY2A 1RUPH 1TQSA 4WJG3 4F2MB 4J6IA 2AJUL 3QUYB 1SDDB 1I75A 3QRGL 43CAA 5C6PB 5J6HB 3K91A 4F3FA 2XVLA 3CDGA 5HGBA 1MVYA 3IDIB 4XP4H 2YPVA 3KXFA 5HSFA 2OCCB 4QRUA 5EF2A 4FN0A 4B97A 2UYLA 4ZW8A 5E6IB 3KS0H 3VXSA 3CHXA 1P7KB 3H9SB 3IFPB 3LKQA 4GRLA 3SDYL 4MNQB 3L2LA 4JGJA 4CN6A 1EANA 1MQ8A 4OR1A 5D96C 4RSYA 1RLBA 3WYRA 4HU8A 1ZK9A 5CUSH 4RGNC 1JHKH 3CHPA 1J9RA 1HCYA 2HT2C 4QGYA 3WU1A 1BIIB 4Z7UB 4BSWB 2MTPA 2LFEA 2FBJL 5FK9A 4OZIA 1E8ZA 2X4UB 5C08E 1S9WB 3NOIA 4HS8H 2JWYA 3DHUA 4X6CB 2MPVA 5B1BB 1AIZA 3X14B 2CO4A 4MQSB 2G4EA 4FI8A 4OLEA 3TJHC 2WXGA 1DQLH 1JPSL 1AR1B 4ABWA 2BXYA 1QBLH 3RIAF 1URZA 4TNEA 1LP9E 2ZUUA 3ZQ9A 4PJAE 3K8LA 2VWEE 2EDOA 3MN8A 4XNXH 3EJTA 3MI6A 5K59F 3WEXB 5ERWB 3KYMA 1DSFL 3BGFB 4PG2C 4M43L 3L6FB 3JV6B 3IKKA 2EC9U 1U8HB 5I74B 4DP5X 1YNKL 4GS7C 1GYVA 2QPEB 5I8OL 3QUKB 2OZ4A 3Q6GL 1L9SA 1JJUA 1F3DJ 1JE6A 4Q9RH 5JORB 3V4PB 4F7MB 5TF1L 2YD6A 3MLXL 3ZTDC 5EULV 1PZBA 2F53A 5B3JE 2OSLB 2YGVA 1H3PH 2EVHA 1DN0B 4NHUB 3UO1H 3SCMC 2A6IB 2PLTA 3B2MA 5BV7L 2ADIB 3MXWL 2NY5H 5CGBA 2A5UA 1AJ7L 5AVTB 2WVVB 3LD8C 3HZ3A 4OW6A 2IDQA 1FCCA 2PTTA 4IRJB 1OTTC 1HEZB 1U3JA 2CA4A 4H5SA 2Z93B 4QTIH 5J1TC 4WFGE 3EBAA 3V4LA 1G4MA 3NAAH 3NABH 4PJCE 5I8KH 3UOAB 4AGPA 3QB7C 3ILPB 3KAAA 4PGZA 2ZF9A 4G3YL 1DZBA 1CI3M 1Z32X 3RGHA 3ZL2A 4C54A 3T77A 1TEYA 4A7TA 3WJLC 2EC9T 2X4QA 5B7MA 2CBMA 4FKEA 4YQXL 1H5BC 2JFCA 4QHUA 4YGVA 5AW6B 2R27A 2DQIH 4NO5A 5G5DB 3B37A 4PP1D 2SEBB 5LN8A 4ENED 4ZOBA 1QFPA 2YO3A 2ZUYA 3DX7A 3UTSA 1G0DA 2YD7A 3BJ91 2TSBA 3MLXH 5IT2H 2C1PB 2GW5A 3II2A 1T83C 3OGOE 5C0FB 2AV1B 4R7DA 4A6YB 4JRYE 3QUYC 1T1YB 5CBEB 1S46A 2BRRH 3VYNA 2WN3A 4NZUH 2WTOA 4AZUA 3QZPA 1O5PA 5F3FA 3LH8A 2Q76A 4FQLL 3SYQA 2VKXA 3BWSA 3OWEA 3HZMB 4Z7VE 1AZRA 4ODUA 4QY8A 5KVDE 5AVYB 3L5HA 4LEOB 5T1DL 3OPUA 5E1AA 2E7LC 3PDDA 4ODWA 2DJMA 3H2QA 4CU6A 4M5YH 3U83A 2GITA 3CH1A 4N0CD 3CNKA 4JFZH 2WZ0A 4P2OC 4NJ9L 5E70A 1TZAA 3L7EB 4C83A 1RZKC 1Q9WA 4CGTA 1ECZA 3IDXL 3DOSB 3MXVL 5DO8A 4XCFL 4UBDC 3EADA 4Z0XB 2PW1B 3STBA 1MFDH 4IBSA 1BQLL 1A3QA 3CZFB 3ZBMA 5KW9H 3EOYG 3KLAA 2AXGB 1U21A 3WO4C 4PJDA 4GW5B 1SXNA 4AVJA 3MV8E 1E3XA 5DS1A 2AW2A 1NBVH 4HLJA 4MXQC 4OKVB 5CJ5A 2C26A 2NQ3A 3DURB 5F7EH 2XPZA 3QEGL 2WAQA 3UTTA 2K45A 4NI3A 4YDLB 4P5SA 2PCPA 1AZZC 4Z3TA 2BNUA 4P06A 2X1QA 1IIKA 4LASH 5KSAA 4CKQA 4D94A 1RIHH 4EJ1C 5J7CC 3BRDA 4LESA 5C1MB 5T3XL 5KSVB 1LVEA 3FUEA 3LS5H 3HPLA 1QI3A 5H94A 5C0AB 1FORL 3X1BA 1TQTA 3M07A 3BKJL 3OHXA 2BJMH 1JYWA 3FO1B 1XGPA 3VXUE 2NNXA 2MHAA 3I9IA 1CFNA 2Y25A 2A83B 2WVSA 4XNDA 1OGSA 4JFYB 4TPRH 3VB9A 2J8OA 4IK7A 3EYFA 1NCIA 2GJJA 5JR1L 1ZHLA 2NXZD 4GEIA 3AS3A 2YPVL 4CKVX 4AZ8A 4PVMA 1J8KA 1XR8A 2BS8A 3NJIA 1E6JH 2EH8L 5BV7B 3RWHA 4G8EA 3HUJF 3OLIA 2RACA 1J1OH 4DOHE 1EZUA 1JV2A 4H8UA 1E9PA 4HWNA 4I2XA 4KKZA 1I8KA 4NQSB 3BN9C 4NUJB 4R90L 4XNMA 3UC2A 4AVIA 1DCEA 1J5DA 1WRFA 3NZUA 3WL9B 4P46B 2EIEA 3WOVA 3CDZB 3VFPA 3T2NH 5FCUL 2NY6D 4PRBB 4UQDA 1HOCA 2FEDD 1YYLL 2DQHL 1BAFL 5JPNA 4ELDA 4L05A 1USQA 3D3VA 4Y89A 2OYKA 3WLWC 1KIRA 1M2VA 4WCYL 4WUUD 3WS6C 5HYSG 3V8OA 5DZLA 5I1DA 3P30L 5EF3A 2YA0A 4K5MA 5KSUA 4WHTB 2IQ9L 3K6IA 3EUUA 3BKCL 1SM3H 2HJLA 3IPFA 1T04A 5SX4I 5A3ID 3PL6A 4KJQC 4XNQA 1VB9A 2KI6A 2VXQA 2XN2A 3CHOA 3O6FB 4IMLB 4KAQH 4RWHA 3REWB 5EZOH 3AG1B 1JOIA 3L3IA 3PIQB 3VD1A 2VKWA 5DHVA 1A4JA 4JPKH 1NMCC 4YSDA 4KTYA 2ZWSA 2NR6D 4QLRA 2VAAA 4OV5A 2NY7H 4LLMA 4XOEA 3WFEL 1OCCB 4EVNA 5T3XE 1XH3A 2FO4B 4NZJA 4FFYA 2WSKA 4AJYV 2BLFA 2CCVA 1RZQA 5E0QA 2Z31A 5ENWA 3U7YL 3CVIH 4OCSL 4FQIH 4JHWH 1XSOA 2Y7SA 4E9WA 4MCZB 5K9JH 3O45A 1D2OA 2BXZA 1U95A 2OMYA 1FC1A 4AUUA 1JGVH 1LQSR 1UZGA 1NGZB 2NDFA 1EO7A 1ETB1 1HHGB 2WXNA 3GSWA 4J6RH 1S7QA 1EHNA 4HKXB 4LPUA 4KMLB 1II4E 2XRAL 5C0IA 1GGCL 2G5BA 2I9TA 3HB3C 1GW6A 1NGPL 1LM8V 4FEIA 4OIAA 4DIXA 3PAZA 3AWEA 5FKAA 5INDB 2NQDA 4D3CL 4BE6A 2XA8L 3GSVA 5F1IA 4DN3L 4PS7A 1MFBL 4UM9B 2NY4B 4RNRB 4RMWA 3RB7A 3ARED 4APQA 1CYWA 2IAMB 1FNEA 3RZCB 3PHQA 1HOEA 2ED7A 4XE0A 4B9ZA 4R9HA 2CM5A 5IG7B 2HT4D 1IAIM 2Y1YA 3HFML 3O6FC 3TTSA 4D9QD 3Q5OA 2BP8A 5KSBB 3T6QC 1ROWA 1F3DH 1PX4A 4LL4A 2C7UB 3WIHH 3X11B 4M5TA 4M7JL 4L4TE 5E6SB 2IOOA 3BPCB 4BSJA 2WTRB 4FQJL 1SBBA 2WWNA 1Q9OA 5I0VA 4G42B 1IGJA 2TSAA 3FH5A 2X4TB 1SFHA 4DHLA 1TO5A 5K9OB 3D4YA 2AITA 5DK3A 1X7TA 1H9DA 1IQDA 4IHOA 1CFTB 2MKLC 5FWRA 2CIKB 1CFVH 2NY2C 3EBGA 4JQIH 4PV8B 4JDEA 1Y07A 1MW3A 1A4CA 1TQBC 1QPPA 4LPXA 3VH8G 5GPRA 4A04A 5E9DD 3STZB 2OMVA 3UACA 2VT0A 5HDBE 3WENA 4NO0A 3DO3A 2X1WL 1DR9A 3DSNA 3RURA 1QQDB 4BV1A 4PQXA 3ARGC 2EUXA 5B21A 2E7MA 1QSZA 3C6LA 5E8NB 5CZXC 1ZMYA 3RFZA 2R9HC 3HC4H 5HGBB 3BGAA 1QSEE 1YG9A 4W70A 3T4YA 3LPPA 5BRPA 2PYFB 1SVCP 3OV6A 1A4KA 2X7LA 5D7JB 3IT8D 3MUZ1 1NDMA 2H26B 3HS0A 3PWJB 4RMUA 5AVXB 5KBMA 4UI2A 4Z8FH 5KOVC 1LEKA 4MNQA 1YEWA 1EEQA 2PR4H 2H47C 2MSPA 3MCKB 5BS0A 5LDSA 2FD6L 1KJMB 1EXHA 4XPAH 4BUQA 1DVFC 4P4KA 3N91A 4PJXE 1UGNA 3K6SB 1NMBH 5AVSB 1TVDA 1FAIL 4NUQA 5GGSB 1XCQB 3QUXB 4UT6A 5D4HA 1XSKA 3NSJA 1G7PB 4RQQB 4TXVB 4HU2A 4U3SA 1AXTL 2KLTA 4UT7L 3LN4B 1WT5A 2FGZA 1HDMA 5I24A 1RK0A 3BYYA 4IKKA 3QA3B 3X1GA 1FO0H 4PHZA 1TYRA 3O2DL 3QFJE 1MJUH 1SXAA 3KVQA 3QWRD 4M5YL 5TDOB 1OCOB 5JA8B 4XZUA 4P5TD 5ID1A 3WEXA 3F8UB 3U1SL 3B9AA 4XB7A 1FFOB 1L7IL 1M7IB 1UM4H 3NA9H 3MRLA 1UACL 4LCIH 3V4VH 3ZOAA 2XETA 1XIWC 5KVFH 5FGRA 3HTLX 5B8CB 4J8RA 4A2HA 1N4XL 2VDRH 3AACA 1FE8L 3HB3D 3TEUA 1MLCA 1GXEA 3UZVB 2G2RA 3OZ9H 2O61B 1IE4A 2FD6H 3EGDB 1IGTB 4HCRA 1J8HB 1BZOA 4IEFA 5BOPA 4MS8C 4Y7OC 4Z7QF 1JGEB 2X0VA 2Z34A 4JDTH 4P04A 1NGXB 1NCUA 3FT1A 3FTYA 5J1SC 1MCDA 4AC4A 3EJZD 2FBOJ 2VLLA 2IPKB 1N5YL 1KJ2H 4KQ3L 3N06B 1QMUA 3EHBC 3RBGA 2CA3A 3Q13A 4L4TD 2WKLA 3G9AB 3MRNA 4LBEB 1I31A 2AQ3A 4HJTA 4P8QA 1YRKA 1U3ZA 3A4AA 1F8TH 4KRNA 4PS8A 4J27A 5FYLE 4MQTB 3SDCA 2CHXA 3FTXA 4JHAH 3WELA 3G6JF 3WIHA 4UZSA 3TZVC 2MCPH 3P3RA 2IAND 2LE9A 1A7QL 4P9HH 3M86A 3TFKC 4Z7OF 2Z7YA 1XSIA 4Y19A 4WHDA 5CJXA 2GVYA 2O6EA 3IRPX 1KG0A 4R0LA 5BO1L 5IMMB 4PJAF 3P4MA 5HGHA 5HHNA 1E6JL 4B50A 1BW8A 1QEWA 1KNOA 1XF4B 3EHBD 5KAQG 1TQBB 1NGWA 2Q76B 2HTLC 1Y18B 3S3SA 4NXKA 5HGDA 4K8RC 5I1EL 2JXMB 1XX9C 4MNHB 5T3ZL 2Y36H 4JJ5A 3RWFB 2NSMA 3C6SA 2DTSA 3L3OC 3LQZB 4PJCB 2OCJA 4HEME 2ITCB 1AI1L 1CLYL 4YHIA 4WK4B 1XTMA 2XZZA 4I2XE 5JQ6L 2F8VA 5CN1A 5CBAA 3DXAA 5LWYL 4EIUA 2D3JA 5AAMC 4ILDA 4XCCL 3ME0A 4Z18A 3B6SA 3E9TA 1MEXH 1HCVA 3LYRA 4DK5A 5D4JA 1ACYL 5F7FA 1EEZA 3D06A 3V0WH 1IQWH 1VGEH 3V5HA 1H8SA 5IKCB 3EG9B 3VGAC 3GSOB 4PP2A 5I74C 1XIWD 3VXQA 4M4RA 1TENA 5T33L 4MNGB 2Y2WA 2YD1A 3SBQA 4F7EA 1J5CA 5C0EB 3CZKA 4XN8A 1NKGA 2NLJB 5DRNA 1DBBH 4R2GC 4A37A 4HV8A 2CO6B 1RJLA 3OAYK 1THCA 3FF7A 3CHQA 1NBZA 1AG0A 1QOKA 2BNUB 3AQXA 4NPYB 5J3HD 2AQ1A 4I0KA 3UGXA 3ULVH 1K85A 2QGDA 2EC8A 3MAWA 3TN0C 2VLMD 3T8XA 2W9DH 4OCSH 1F4YH 5FUZH 3WHXA 1YEKL 3DX2A 1RPUA 5H94B 5CD3B 4E41D 3CPLA 12E8H 1BQ5A 3HNTL 1IFGA 1MJ7L 3EGSB 2CCLA 2F08A 4JFVA 3FO1A 4U6XB 3SZKC 2DMKA 1D5ZA 5DI8A 4C57C 1XGPB 5KVMC 3SE8H 4XO9A 5FOBB 1CICA 2MCMA 3ARUA 2WXRA 4MQ7B 2HJFB 3LJ3A 4LIQL 4RFNC 1UASA 4U4BA 4NM8H 3VFTA 5GS2D 2VISA 3B3BA 4P57A 1L5GB 2XNAB 5BVPH 3QUXD 4HK0A 3B7UX 1HJCA 2ENQA 5I6NA