2QZ5A

Crystal structure of the c-terminal domain of aida
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
GTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQSLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, lipid binding protein
molecule keywords Axin interactor, dorsalization associated protein
publication title Crystal Structure of the C-terminal domain of Aida
rcsb
source organism Mus musculus
total genus 31
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14186 Aida_C2 Cytoskeletal adhesion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2qz5A00
4LDCA 4BFRA 3PREA 4L1LA 5CCJA 3OAWA 1BDYA 2WXOA 2CHXA 2A4ZA 4KZCA 4L23A 4QJ4B 1BCIA 2X38A 5JHBA 1UGKA 2N1TE 4ANXA 2EP6A 2NCEA 4J6IA 3N5AA 3L13A 2BWQA 2RD0A 2WXRA 3B7YA 2WXJA 3QAQA 4OVVA 4FADA 3TJPA 4WEEA 3F04A 2B3RA 2FJUB 2ZKMX 3L08A 4F1SA 4A55A 4F93B 2DMHA 3OHMB 3HIZA 4F91B 3S2AA 2WXNA 2CJSA 4FJYA 4XZ4A 1K5WA 2WXGA 3FBKA 4L2YA 3IBEA 4PS7A 3ML9A 4L1BA 4ANWA 4FULA 3QR1A 4XE0A 1DJIA 3LJ3A 3P2BA 5JHAA 4IHBA 1RSYA 2CHWA 2D8KA 3APFA 4ICXA 2ISDA 2WXIA 2WXFA 1DQVA 4URKA 1GMIA 4WWPA 3DBSA 4ANUA 2UZPA 2YOAA 3QR0A 2ENJA 3RPBA 2WXQA 3HN8A 3ML8A 3ZIMA 4FHKA 4QJ3B 5CCHE 1UOWA 1E8WA 1WFMA 1DJXA 4OVUA 4Y1TA 2CM6A 4BGDA 3L17A 2DMGA 4FJZA 2Q0ZX 5CCGE 1DJZA 2FK9A 3T8MA 2ENQA 3CSTA 3L4CA 4AOFA 1WFJA 2CJTA 4NP9A 3TL5A 4AJWA 2NQ3A 4MJJA 2K45A 2ENPA 4TS6A 1UOVA 2WXLA 3ENEA 2Z0UA 4DNLA 5T8IA 3ZW3A 4FLHA 4QJ5B 2R83A 1V27A 4KZ0A 1TJMA 3KWTA 4EZJA 3F01A 4HLEA 3DPDA 3GPEA 1DJYA 1DJWA 1DSYA 3IM1A 4G11A 3M7FB 3PFQA 5G55A 4TUUA 3L54A 3HHMA 1DJGA 4PS8A 4KITB 2WXKA 1RH8A 3JZYA 4NS0A 3TWYA 1BYNA 4EZLA 3PRZA 4GNKB 1E8ZA 4NPKA 5KJ7E 4Y1SA 1W16A 3F00A 4QAMB 3APDA 2YRBA 5G2NA 2WXPA 2CHZA 2JQZA 3MJWA 3ZVVA 2K4AA 2QZQA 2CHDA 1E8YA 1HE8A 2K8MA 2WXMA 4ICWA 4WWNA 3SD5A 2V4LA 3W57A 4GB9A 2Q3XA 5EDSA 3L9BA 4LCVA 3APCA 2K3HA 2NSQA 4XX5A 4FHJA 2A5UA 2Y3AA 2LHAA 1DJHA 3F05A 3QARA 4TV3A 2QZ5A 4PS3A 3QJZA 3NSJA 1QATA 4LT7A 4JPSA 4WWOA 3QK0A 4HVBA 4ANVA 1TJXA 1RLWA 4V11A 3W56A 5H4ZA 3NZSA 4IQHA 1E7UA 3R7QA 3FDWA 5H4YA 3RDJA 3PS6A 3R7RA 1QASA 2CM5A 1YRKA 4F92B 1E8XA 2KI6A 3CSFA 4NPJA 4WAFA 1W15A 4FA6A 1E90A 2WXHA 3PYCA 4EZKA 1E7VA 3KWUA 1CJYA 3NZUA 3L16A 1A25A 4DK5A
chains in the Genus database with same CATH superfamily
1LE9B 3GB7A 4M03A 3DO3A 1RZKC 4IOFC 1P4IH 5GHWH 2VR4A 5INCB 2Y25A 2V33A 4HMEA 7FABH 4KUCF 4MMXC 3CFBB 4B3EA 3O45A 3PPSA 1LM8V 1Z9SB 1SXZA 3AUVA 4EQ3A 4R7NB 2VLKE 5CLTA 4J8RB 1OAUH 3IJ8A 1ND0B 3LXUX 2Q3AA 1OOWA 1H9VA 5D7EA 5C08B 1KELL 3IBEA 3ZMNA 3MLPA 3VFUB 2QQQA 4KKLD 3E6FA 3DX6A 5L4IA 1ZSDB 4ODWB 5IB1A 4KROC 4M7ZB 4BHUA 3VDCA 4POZC 3PAYA 4WTZG 1SQ2N 2DWYA 4FABL 1TMQA 1VESA 1JG9A 2EO9A 4MNQB 4E5XA 1MCOH 3UADA 1OL0A 1T7ZA 2J5LC 1NGZB 4WI0A 5MENB 3FU7A 3BPLB 3BJ91 5DK2A 1SVCP 4H20L 1C5CH 5IKCB 5E9DE 3O3AA 5BZXA 2GJ6A 1KXTA 3TBTA 5F89B 4ZNEA 2IOMA 2WNGA 2YQ3A 3B7UX 4NO5A 1DCLA 2BPBA 5I1EL 4IOFD 2N3JA 3X12B 2EEAA 2WLJA 3FUEA 4F7MA 1KLUB 3FXIC 4MCMA 3K6IA 1YYLH 4OJAA 3IM1A 1RHHB 1OWRM 3QNZA 3BD4A 4U1SA 1XH2A 5D8JL 2XWJA 4PJGF 1XF1A 2X2YA 5D1QB 5F88A 4S11A 1IKFH 1HX0A 1QFHA 3VUAA 4OLXL 5I16A 1HXYA 2E59A 4H8WL 5IW1A 1SN0A 5F9OL 2MOVA 1GZQA 2YKLL 5GGVH 1U6AH 1I7TB 4YSQA 1H3PH 3P4OB 5FA3B 2G2NA 1Z3RA 1MCEA 1S6NA 1O7VA 3M8OH 3ILDA 4JFPB 3GIZH 5F44A 4OGZA 1IBHA 4XNZC 2ZXEB 1RU9L 3VXOA 2JCCF 2NX5D 5CO1A 2D3VA 3WBDA 3OKDB 2AI0L 4OLZL 4HF5H 5ITBL 1HFUA 3D2UB 3S5ZA 4R4NC 1S5IL 2WSKA 1GZHA 4HHAA 1TMCB 4V1DE 2ZWSA 3BUQA 1E5UI 3TN0D 3PABA 4CVZB 2J6EH 1PIGA 1B9KA 4YXLL 3A6CH 4MJ5A 4ZO8A 1CYGA 3VX1A 4FEMA 3RPIB 3R06A 3AROA 4L0ZA 1BEYL 2X6VA 5H35A 2B39A 1CFTB 4HEMA 4GUPA 4NCC2 3T77A 3REWB 2E9JA 3AGVA 2DTML 1UWXK 1OAYH 3OAZK 4X5PA 5CU5A 4GRWH 3HNSL 3KM2A 4MA1C 4WEEA 3RIFF 2IH8A 1C8QA 1GVIA 1OSZA 3H85A 1QRNA 1E28B 4P5RA 5FUZL 3O4LE 3GHEH 4A67A 4X8JA 1N3NB 2F54B 1X6LA 3I6GA 5AWNH 3MSPA 4GS7B 3B9AA 1OD7A 2X9YA 3IDXL 4GJTB 4P4RA 4DHLA 3VXQB 5GQBA 2WAHA 4LF3B 3KPMA 1JS4A 3SOBL 4LLDA 1D9KC 1F56A 3P4NA 1CFBA 3PV6A 4Y1TA 4FFYL 4ZAKA 3U4EB 2WCPA 3ARBD 3MJ8B 2N1KA 4RGOL 5EOQL 3U0PA 2P48B 4R4ND 4W9ZA 4PJGB 3TIEA 3ZE0E 3US0A 5CJXC 1QYGL 1U95A 4NQVA 7TAAA 4XPBL 2VLKD 2VDKL 2DIEA 2GEEA 3RL2A 1ZLEA 2VRQA 3KR3L 3DUUB 3LKSA 5D7LA 3ZW3A 2BCKA 2YGQA 1VGKA 3Q3GB 3SE9L 2XG5A 3T3MF 3QUHA 1ESOA 3WFDH 3VO0A 5D7IF 2AXJA 1YJDH 4PS8A 3LMJL 4I77H 5CIPA 1RZJC 4J1UA 1XR8B 4JUSA 3MGOB 4LPVA 4UOZA 4PV1C 2YAQA 5T33L 2JCCB 1UATA 2PWFA 4NHUB 3DMMA 1VA9A 2ARWA 3WFBL 4AG4H 1WFOA 1FFNB 4PGBA 5J57B 4LDLB 3NA9H 3WNKA 5JHDB 2EXTA 1UM6H 2C7UA 2QLYA 4OLUH 4GRMB 1A6UH 2GKIA 1JVLA 4Q9BA 3MRHA 4OT1L 3GUFA 3IMBA 3H6JA 1XSJA 5B38A 1BM3H 1C7SA 1WIOA 1L6ZA 3WXVH 2Z31B 3IF1B 2OMUB 3GNMH 2YARA 4JO2H 1ED3A 4UAOB 3RAJH 5FKPA 3R4RA 4JKPL 1FYTE 4X7DC 4ZPVB 4PRPA 4NAMA 2W9DL 3PQYA 3H4FA 2HKHL 3T2LA 4FNRA 4I85A 1QEWB 1TTUA 4HK3N 4EZKA 2E8ZA 4X6BA 2MNJB 1JAEA 1BJ8A 1KFGA 1QP1A 1T6BX 3CSYB 1JI2A 5F96H 1N8ZB 2P49B 1XF4B 3VFWB 5KJRL 5BS0B 2VMJA 4G42B 4HMDA 1JPTH 3Q5TA 5FPIA 3UOAB 5TE4H 2NNFA 1LHZA 4LIQE 4LSUL 3HPJA 4G70B 4MMXA 4OU3A 3QAQA 2VC2H 3H55A 4I1RA 1FNSH 1XAKA 4JO1H 1K4CA 4DKEH 1DQKA 4RAVB 1QBBA 4BJLA 3ULVH 2WWMC 4HIQA 1R4XA 1MLCB 3F7RA 4PJDE 4R4BA 3QJFA 5FUOH 4Y5VC 3FT4B 4QY8B 3T04D 3ZDZF 3BT0A 4GKNA 2HRHA 5FW8A 3WHE1 1KXVC 2CDGA 4FFVC 4C56D 2EDJA 4ICXA 2EJ1A 3G3LA 3BOVA 1XGPA 4PJCA 3L2NA 2RGSA 2XRAH 3GMMA 1E4WL 4JKLA 2UZPA 2OTPA 5EIVA 1R3HA 2OXGB 2R0KL 3QH3A 5ES4B 4GIOA 2E7DA 3T3MB 1BGXL 1XIWB 4JR9L 2AGJL 4MD5B 3BGAA 3KDMB 1MCWW 5D7IB 4UQ3B 4FQLH 2WZAA 2NNAB 2NYZA 2IWKA 2H1PH 2DWEB 4MJ4A 2WO4A 2F7OA 3D87B 5INDA 4Y19A 4XP4H 4XRCA 3K46A 4ZXBA 4YZFE 3NH7L 1PLBA 3UYPA 3O4LD 4PLKC 4WF7A 1U8LA 4HX1A 3EYQC 4JFZH 5HHOA 3L2MA 4K5LA 2AJ3A 4LVOB 4AZ8B 4W93A 5DJXA 3V4VB 1A66A 3K2UL 4CDGC 2NNCA 4ZMOA 5IQNA 2X6CA 4XCYA 2FJHB 3T2OA 5IBUG 3FFDA 3QIBC 4BD4A 4OGYH 4QF1B 4JFUA 4GAYA 1OW0C 2ZUYA 4JE0A 4KDVA 4DKFH 2G60L 2H4EA 3BH9A 5KAQF 1RUKL 2EABA 2BNRB 1IFRA 3AT8A 3P0VL 4C83B 3BD5A 3HI5L 2G4GA 3STZB 1X3DA 3Q13A 6FABL 2C5DC 1HINL 1LO3H 3SDAA 3QBTB 2BVPA 4JO8A 2DYRB 4WWOA 1R0AL 3VXPB 3HUJE 5DQ9A 4KAQH 4QXGL 3MOAL 1T0MA 2NY5H 5IMLA 5KN5B 4U3SA 4YGVA 3S96B 3LXCA 3HAEB 1F8TH 1XXFC 5E8EB 1GCYA 5AG8A 2VLME 4TVUA 5CUSH 1DN0B 4LCUB 1RZQA 2AMGA 1WGVA 1Q9KB 2EIEA 3FNKA 2JKLA 5GRJL 1JZ2A 3HNTH 3NUKA 3ZDZB 4LHUB 5FM4A 5JIIA 5JQIB 4ZS6C 4HPYL 3OC8A 4X5XB 3VM7A 2GT9B 5H37H 3G5ZA 4UILL 4N2CA 4YHNB 2V8LA 5H94A 2ODIA 1GGCH 2B4CC 2HG5A 4PJHE 1RPUA 4Q6YA 3NK3A 1RURL 4YC2B 2X4RA 4A55A 3QIBD 4Y2OA 3X3FL 1MFBL 3O8XB 2C3HA 1TTFA 3GMOA 3NDYE 4G6AD 3WJJC 5IF0A 2FB4L 2F2HA 2AEQH 1FN4B 2OZ4H 3NEXA 1F4YL 2VLRE 4ANWA 2R23A 2CKBH 3NZHL 4D8PB 2CHWA 4K7FB 4ELKA 1XGZA 5E99L 1XF2B 2EDRA 3HG4A 4OCLC 1T89C 1YN7B 5E9DA 1DDHB 1AG0A 3FTUA 3E2HB 1AG6A 3PGCB 3ZUCA 2ZYIA 2WB1A 2DTSA 4RIRB 1CFQB 1D9KA 4FOMA 3ZU8A 2Q0ZX 3PWVA 4NNYB 4Q58C 1S7VB 1WPCA 1BJ1H 3M17B 4LLMB 3QXVA 5AYUL 1P6AB 4WFHE 1OPGH 2J88L 1MHCB 4UUJA 3ZHFA 1C5BL 1N5AB 3KGRA 3E8VA 4PJAA 5CJXA 5T1JA 1RUQH 5I6PA 3VCLA 4U6XA 4ZS6D 2QV4A 5I74C 4YHOL 5BUPA 4UINL 2WQXA 2JJUA 3PDGA 4LSRL 4Y4KC 3CHQA 3X1BA 4JFOB 2JB5L 2P5EE 3PNWA 1N2RB 1S7WB 4YLQT 5I28A 1CICB 5G2NA 5F3BB 3ABZA 3ZVVA 1VF5C 2WN3A 1FO0H 1G1YA 1DQJA 2HG0A 1QI4A 4JL1A 4KJYA 3EO1B 1WUNT 3I3DA 2NZIA 1PG7H 4CRPA 1GXEA 2QR0B 1OTUC 3GK8L 5EU6B 1Y07A 2ZP8A 4MAZA 4U7SA 5I1IL 2CZNA 3I6KB 2K3TA 4P46A 4FGMA 4V1DA 5DU7A 3V9CA 2QZ5A 1SBSL 4KY2A 3UJTH 5SX4H 4UV7L 1KV3A 4D0BA 5KS9E 4XT1C 3HZYA 4URTB 2F8VA 1MHEB 1HQ4B 3NIFF 1T03L 4X8CA 3L3GB 1KT2A 3O6MH 5F1OB 4HJ1A 4UNIA 2TSBA 2CRIA 3O2DA 3S34H 5IESL 4EI5C 1I4FB 2IH3A 3N41F 4JM2C 4EPSA 2VSKB 1BG9A 4PWIA 4BXSV 2ATKB 1U8JB 1YNTA 2UXVA 1WS7A 1HSAA 3WD5L 1HWGB 2X4TB 3IRCA 1C12B 2D7MA 4M43L 4S1QH 3OXSB 4NAJA 1W8EA 3GI8L 4XOEA 2MRYA 2BMKA 4K8RH 3IJYB 3O4LA 1K8DB 1RCYA 2F6AA 3NCCB 1R6VA 2P47B 1F3JA 1RUPL 1TITA 4Y8AA 5CCKH 1XGRB 4JFDE 1UXWA 2V3EA 3NJNA 5FWRA 4HIJB 3S5LB 2RJMA 3IAQA 2PPCA 2QHRL 4A7GF 2YN3A 1YZZA 3PP3K 3KYMB 2NNRA 4JN2B 3GS7A 4GRWE 3GSNA 2L3BA 3VH8G 4X4ZA 3QQDA 5I73C 4G8IA 5HD8C 4QTHB 4AIXA 3W0WE 1WWBX 3G9AB 4ANUA 2DS4A 5CP3A 3WTWA 3IVKA 2VR5A 3UPCA 3L2LA 3U9PH 1FNGB 2VDRB 5I1AA 5MHSE 2XLLA 1OF2A 4DGIL 3WY2A 4HKJB 1IVTA 1KNOB 2WWKO 4XAKE 5HGGS 4A7VA 1KB5H 4OCYH 1WYJA 4EI5D 2JKRM 3OSVA 5C0EB 2CJTA 2ZKHL 4EXPX 2D9CA 1YECL 2QPDB 4UTBA 3C6SA 3VFSA 5IFAL 4YHLH 3UBXA 5EU4B 4H8UA 5FGCE 3FB7A 5IQ9A 4JPWH 2VLRD 2AJYL 1EAPB 1S9XB 2J3SA 3TT3H 3WHE0 1NAKL 2VOTA 3GMNB 4DGYL 3DRQB 2HJKB 3QFGA 4AGMA 2HMIC 1Q9WA 1IJNA 3VVVA 4YIQB 3NIFB 4ICWA 1S3KH 4AUJA 2OSLB 5EC2A 5K69A 2CU9A 1QZ1A 1OW0A 1XXDC 2BSDA 2H32B 5A2BA 4WFHD 2WANA 3HVDA 3FRUB 1FYTA 5A16B 2Y36H 5I18L 3MJ9A 2IQ9L 1QLFA 4KK9C 4ZUVA 4R26H 1J1PL 1KCSL 5LAXB 3TNNA 3ZIYA 4F8LA 3BHBB 3IN2A 4UNVA 4GMSH 3HE6B 4GFXA 4U1GB 3BEVB 4LT7A 1JV2B 2V2WB 4QHPA 1CLYH 4EUPA 3BIKA 5A2JH 4ABUA 5F3HB 4YS4A 3JVGA 3D85D 2WGNB 5ESAA 3LQAL 1J8HE 3GXFA 5KSAB 3MUUA 3LB6D 4Z23A 2P5ED 1LWRA 3TASA 4GSDL 2Y2YA 4N2EA 1T0PB 3PREA 2IPKB 2VABA 5JPNA 4OR1A 3MRKB 1PEZA 3P11L 2AFNA 3TNMB 3D3VB 3QZLA 3TEXA 4KKZA 5I1KL 3NJIA 3RGVC 3JTSA 1R5WA 5D96C 1MI5A 4PJDA 3VW3L 3B2UC 2EP6A 3ETBF 3FAWA 2CLRA 2R0LH 5HHNA 1CTMA 4I5BB 2A6JA 1NQBA 3KPRD 4XX1G 4DP0X 4OD1L 1BFSA 2Q20A 4DPAX 1F4HA 1CK0L 1AHKA 3ATFA 4JREC 5I5IA 4J4PC 1D3CA 4FJYA 5JZ7D 3MLZH 4WDIB 1EHLL 2CJUL 3AXLB 5K59F 5CBEB 1RJLA 4M3HA 4UOW0 1J18A 2EDLA 4KHXH 5F1IB 3WJJA 1FFOA 1THCA 3LEXA 3FL7A 4KHTL 2OL3H 4TOYH 2PPEA 1P4LB 4URKA 2VZ3A 1RXLA 1SM3H 3I50L 4G7SB 4M9PA 3WTXA 3GBNL 3D18A 4M5ZH 1T89A 3VFMA 5KYUB 1HQRA 8FABA 2HFFB 3L3HA 4FZEL 3DHPA 4R2GC 1DR9A 4JY4B 2ENSA 2J7LA 2E76C 2WBKA 5I5JA 3X11B 4JFDD 3ZTCC 1IGCH 4TS6A 3G5YB 2XOTA 5EEYA 1S5HB 2LVCA 4GW1A 2YO3A 4R97C 4TSAL 1JZ4A 1YJDC 3LEVL 2Z4TA 5DVPA 1DJWA 1U0QA 4JQIL 4XP9H 1M2OA 1UZ6F 4ZO9A 5IOPA 1KCRL 3EOYG 4DO5A 5KYYA 3W0WD 2CRMA 4WHDA 1PF3A 2YEZA 2FDBP 4Y4KA 1JPSH 4J4PD 4ILDA 3ZE1E 2VUKA 5MHSD 2X4OB 3CGTA 4L1SA 5ECJE 4NHCL 3V9EA 4YFLF 2JJSC 2LV4A 1QHOA 1QA9A 3GXNA 4XAKD 4LOUD 5EPMA 4O02B 3HUJA 4IGBB 4MD0B 4N28A 1QW8A 3D4GA 3H9ZA 1IC4L 3G6JE 2ZICA 4G71B 1TNNA 4R3SB 3GPSA 4FXLA 2VRAA 1LO5A 2OV0A 3DURA 4QMEA 5JQHC 4LNRA 5EUOE 3B2VH 3CN0A 1NH6A 3UZQB 4KKPA 2DM3A 3SE6A 1I1FA 3RVUC 1FC1A 4Z76B 1SGKA 3NN8A 3F83A 3LDBC 2W8CA 4LSPL 1SUJA 2QQLH 3IWVA 5I0ZA 2X09A 3R0NA 3NCBB 1ACCA 1F90L 3CFIC 4NRXB 2CQVA 4BSVB 1LO4L 3PYCA 1A2YB 5E8OB 1IAII 3CTTA 3DOHA 3L7EB 3EYVB 4OVVA 1QBMH 2L4OA 3UERA 4D0DA 1UJTA 2C3GA 4FL4B 4Z7OF 4JM2A 4NQTA 3ZZSA 4YFEA 1LDPH 2BNUB 4BRJA 3DPBB 4L4TB 2LR4A 5E4OA 5FYKU 2FUQA 5IVZB 2MCG1 4F5CE 1NUNB 3PL6C 4HAFA 4IDJL 3MNWB 4AL8H 1IU1A 2DQ6A 3T1FB 2JH2A 5CHNA 3TA3D 3ULVC 3VXUB 3WCYA 1MG3C 1LO0H 2UXTA 2VZVA 3ILPA 5F7KC 4X8GA 1VACA 5IHUL 1NC2B 5FK9B 1MCBA 3P30H 3PE9A 3ZUNC 4EI0A 4JLRB 1A22B 5JHLH 4K2UH 4XE0A 5DFVC 1TZIB 1NGXB 1UB6B 2NQDA 4YAQA 2XKNA 5AB2A 4JFFE 3ZY7A 5DEGB 3O3DB 1MFMA 1FH5L 3V8CA 4LGSB 4EOWH 5I9QB 4WO4C 3ZDYE 3QORA 2VXVL 4JBSA 1C08B 2AEPH 4K15A 4ZOCA 5HVGB 5BQ7B 1QHQA 2ZUXA 3DSNA 3HPLA 4PJ9D 3TZVD 4YHYC 4A6YA 2Y1AA 4LRNL 5BO1H 3GJFK 1YEEH 1DJZA 1TQSA 4RFOH 3V6OC 1IAOA 5F9JA 1LJMA 3MRIB 1CVSC 3OLDA 2X9ZA 4Z7QF 4RAUA 1SOQA 2VQ4A 5C0CB 3D85A 3Q2LA 2P7TA 1BAGA 3GQFA 3JWNG 4OQTH 2EUVA 4Z0XB 5C8JA 3DYPA 1GKOA 3FOMA 3MA7A 1KZYA 1L9OA 2DIJA 3OAYH 3WIFA 3BDXA 4AK1A 1GCFA 3AT9A 1SJEB 2H5UA 3PL6D 4N2BA 2QVIA 3A22A 1ITBB 4OAWB 2OMWB 4CGTA 2NXZB 2AANA 3W38A 3HC2A 2JK5A 5D9SB 1TT6A 1DVFB 5ICUA 3RE0A 1KXHA 3UBGA 2QZQA 5DEJA 2OX5A 4U1MB 1DL7L 2WMPA 1AGBB 1IO4C 4YZWA 4N4YB 4HJTA 4L9DA 3L3IB 2GAZA 2GUYA 2XVGA 2MNUA 5DFVD 4HFUL 5E2TH 3T3PE 5KS9A 4W9GC 1P4BL 3V52L 3B83A 2D7QA 2DN7A 3C09B 1UT2A 1D7DA 3WJMB 4J6RH 1NEZG 3L5WA 1LEGA 2B8OT 3NMEA 2CBPA 3V6FA 4Z7OB 1OY3B 3DUSB 3W2DL 1QR1B 4QNPE 4BFEA 3HI1B 2GY7B 2NY5C 4GLRI 4JDZB 3S3PA 2VL4A 2KLRA 3IDJB 4R7VA 4U2YA 3PP4L 2K1MA 2G2RA 4X6FB 1BIIB 4P04A 2NZ9C 4IU3A 4N2GA 4J7RA 2FHFA 3TCTA 4A63A 4FX5A 1MVYA 5A2LH 1JV5A 1B4RA 1JHKL 4YVUA 4XNYL 4O2CB 2J6EA 4MXWL 4CC1A 1FPTH 1NDMB 3IDNA 4P48A 2XWEA 2GFBA 4NO0A 3LPOA 4YSRA 4OZHE 2AEWA 4G3YH 4U6VH 1OP9A 3TH4T 4HEPG 4POUB 1NCCL 1SLWA 1NWPA 2IANA 2QELA 3L3JA 2XPGA 3OKNB 4OKVB 1IBYA 4BCYA 2EYTA 1N59A 4UV4H 4R0LC 2H26B 2R2HA 3RGVA 5J6HB 3QA3B 4F58L 4ZNCD 2P5WE 4PREB 1AGFA 3RY6A 1MNUL 4Z6AT 4GT0A 4X4YB 4IEFA 1U2YA 1U9KA 3DRTB 3IT8D 4J4PA 1DJIA 2FHCA 4Z7QB 4UM9A 4PRAB 1JGIA 4RNRB 2GYSA 1OK8A 3FB5B 5ERWA 1E4XL 2A83B 5DT1H 3EOBB 1KBGL 1FYHB 2ZX5A 1BFTA 5SWSE 1EDHA 1YEDB 2A9AA 1QWHA 3B7SA 3BAWA 5GS1C 4PTTA 1CGVA 4FA7B 4XBPB 1KJ3H 2DYPA 3WGVB 1HIML 1RZ8B 4Q52A 3QJRB 5EOTB 4FLQA 5TPWH 2DMKA 2NZ9D 4UQ9A 1H5BC 2C9SA 3W5NA 4NOFA 1OF0A 3PHAA 4DVRL 1G0YR 2MFNA 1INDL 3QYNA 5I15L 3CFKB 4M6NL 6PAZA 4H13C 3RWHB 1JN6A 4U0QB 3WNPA 3ARRA 3B9EA 1DQLH 1ET5A 4OLWL 5C7ZA 3GBMH 3O0RL 1GTFA 5L0QC 1GS8A 2F5AH 3OBAA 5DXWA 2LT9A 3HKFA 4L4VD 2G2PA 3ABLB 1AYOA 4ELME 2TAAA 1SHWA 1S7UB 5KEZA 4FQQB 2MQGA 1IGYB 4AYSA 2MPAH 2ADYA 5ECGA 1RK1A 5CWSA 1ONQB 2PR9A 5IWLC 3FO0L 5DRWA 1A1MB 2OQJB 5DZAA 3PGFL 3FF7A 5DJ6A 2BCMA 2R29A 2Y6SC 4JX0A 2JJSA 5AOJA 1D5IH 1KIPA 1UH2A 3RWEA 1F3DH 3IETA 3MXVH 4PBDA 1RVFH 3BP5A 1CXHA 3GRWL 4FMVA 4AGPA 4BK5C 1J8HA 4P0DA 3WUWG 2YSTA 2FX8H 5L7XL 3K6SA 4G1EB 1B3IA 4DESA 4NNXB 2GQHA 1U3HA 1C16B 5E8PB 5F7HA 2FX7L 3L3KA 5A3IC 3TC9A 1CMOA 4HZLA 5KSBE 2FWOB 1A7NL 2OXHB 3QCUH 1ZK9A 2OMTB 3HI6L 3LD8B 4WZ9A 1E5ZA 4N1EA 4HU2A 1WA1X 1KTBA 3KM1A 4OLVH 5CCJA 3QP3A 4WJ5A 3MV9E 4K8RC 4ZSOB 4OW6A 3KW7A 3P4MB 5EC1A 3N43F 3NFSH 4OQ1A 3QFDA 4HSQA 5FA4B 1HH6A 1AZRA 4G43A 4DUVA 4XC1H 3RIAK 1M6OA 1ZT7A 3IXTA 1WS8A 1X9QA 4PS4L 4XXDA 3FCTA 1P9MC 4ZFZA 3MRPA 2KL6A 3T6VA 2F19H 4O4YL 1CGWA 1TTRA 2PP9A 3H9SE 4JHBA 4AX3A 1F45A 1HCFX 4JK0D 5ETUA 2C9RA 5LXGL 2Y6SD 4M9OA 1S9WB 3RZCB 3MNVA 4EN3B 1IGML 4ODXB 1MCPL 3ARQA 4I7ZC 2BK8A 3HB3C 3MRLB 5G4OA 1EQWA 3EBHA 1UH4A 3BC9A 3VI3A 3WLWC 5AB9A 2MEJB 5JW4M 4GKSB 4JDVB 5DYFA 3LS4L 4MJIB 4NWTL 1QWUA 4WO4A 3H2QA 2P8MA 1MQKH 3PWUB 1E6JL 2A99A 2OMYA 4PJ6A 2BOBB 3WE1A 3BLKA 3V6OA 4X6CE 3QUXC 2R9HC 3INUH 5DHVH 1FZMA 1TPXC 2Y07L 4IK7A 2ENPA 2P5WD 3MLVH 2Y7MA 3NJXA 4TULL 1U30A 4FQ1H 4M48H 5C2UB 4K8RD 1NGPL 1IGIL 4LAQL 4ZFOB 4EZJA 4TVPH 1URIA 1QLEB 3HHSA 1PW3A 2ZPKH 4P5MA 1QUNA 3LMJH 1MCCA 3NJFA 5J7CC 5JMRA 4LEBA 3JWDH 2MQ3A 5GRYA 1FC2D 2YRBA 4HJGA 2K0RA 4QYAA 3OWEA 4KY1L 1MAJA 3WFCL 2O61A 3L5XL 5FF6A 5AKRA 3VXTA 4ODSH 3HN5A 5BRZB 1J86A 1ZT1A 3W1ZA 4O02L 1CLOH 4S1RL 3NYKA 5C0GA 5TK4A 2EVJA 5K9QG 1MFDH 1ES0B 3LTVA 3OJ2C 4L8BA 4L8DB 4KJQC 3WLWD 1HVXA 5E24E 1N5YL 2BP0B 1X4ZA 1YEIH 4ZUWA 3TM6A 4Q56A 3NABL 3N43B 3TCLB 4F9PC 5B7EA 1MIEL 4KNSA 3R7QA 2P44B 3V0IA 1MVUA 1X5KA 1HH9B 1FVDA 4TRPL 2W0FA 4UDTA 3BRDA 3QUXD 1BQLH 4NWUH 4I0KA 4F5CA 1YEJL 3SBQA 1MHPL 2YWZA 1IFGA 4DFHA 4MA7L 4S0HA 1SY6H 3LZFL 1Q0YH 2CHXA 2XG4B 2AV1A 3HG1B 3QZBA 3T0EE 3COOA 5H37A 1IGJA 5DRXA 4N0UA 2J20A 5C3TA 2VRKA 2ENYA 4DTGL 3D0AA 2FJUB 2O72A 1AP2A 3FH8A 4JFFA 5C71A 1UXLA 2RQEA 5GGSA 3LKPA 1C5DA 3JV0A 1KIUA 4AGQA 1CD9B 1X9RA 2XA8H 4XVJH 1BVZA 5DFTA 1HNGA 2CR0A 5EEXA 4QO1B 4LCCB 5EZOL 4B3VA 4KWUA 4WW1B 5C0ND 3CFJA 2YOAA 3VG0L 1IEHA 4KXZH 2ZUUA 4NQSB 2EVGA 1MW2A 2VMDA 2AGJH 3MV9D 2VXQA 1X5FA 1SRDA 3FTYA 5CZXD 4YH6A 1BBJB 1XR9B 4RMRA 4A2MA 1QQDB 2VXUL 3CZFB 1Z2KA 5HY9B 2QMKA 3TL5A 5CD3A 5EN2A 4ODHH 4Y5XC 3K4AA 1H5BA 3QB7C 2YD4A 3UMNA 3CVHH 3H9SD 2V9RA 3O6KL 1ZSHA 2GUOB 3FUFA 4M8QA 1DQDL 2NUTA 5DLMH 4D9RE 4P2OA 4P2RB 2J4WL 1LO2L 1PBYA 3GC3A 4UQBA 3L95B 3L54A 1OWWA 4OD3L 2DQEH 4PBVC 2UYLA 4I18B 1H6FA 2A6KA 3EJYC 3GJEB 2E7BA 4IRJC 2MNWA 2EE0A 4NOBA 2CDEA 3T1WA 1HZKA 1FO0A 3HG5A 3QJHB 3GHBL 4FG6D 5F9WC 1KB3A 2BVQB 1NICA 3IDGA 3Q2VA 3GGWB 4PJBE 5B8CB 2VN3A 4Z7AA 4J27A 2ZXGA 4P5TC 4J3OF 1Q90A 5EEWA 1NM4A 5DJDB 2UZXA 2BSTB 3OMIB 5I8KL 2PYFA 3S36X 4XCFH 5LQBH 4A04A 2Z92A 3NOIA 4BK5A 1IAIL 3BFOA 4WKZB 1YYMH 2GCYA 2OMVA 3OG4B 4N8PA 2A9NL 3D39B 4PRBB 1BHGA 3T0EC 1ZGLP 2IBBA 3QDAA 5CEXB 3BKCL 4Y4FD 4Z8FH 2I5YL 2MQCA 2H3NA 1IBGL 5HYJB 4HKXB 1CJYA 4KH9A 3ZE1F 1DFBL 2BIQA 4NM4L 5D7HA 4UT6L 2YD2A 3VQLA 1KWKA 4MGXA 3TP4A 5FHBL 4PJ8B 2Q9OA 4OFYD 4AL8C 3MR9B 1IC5L 3D2TA 3MTRA 3QJXA 2IDUA 4GXUM 3HE7D 3IK2A 3BRFA 4BZ1H 1R46A 7PAZA 4UDUA 3S4SA 2OP4H 4HUXB 3U9UB 2V0AA 4PP1D 4Z7WA 3BD3A 5DUPH 1TNMA 4G9FE 2CAKA 5SWSA 3ML9A 1F4YH 3HEIB 3ESUF 1I8IB 2ATPA 5TDPA 2A1WL 2IALA 5J3HC 2AZUA 1MF2H 1Z66A 4JAMA 4GG8B 4NYLA 2N7AA 4OV5B 1SYSA 4XCEA 1ETZB 1JZ8A 2R69L 2YAMA 3BQUD 5GJSH 5MEQA 3C6LD 2Z1PA 3S37X 3LS5L 4KGJA 2WW8A 4P2QE 4ZTPL 2BSRA 5IEKB 5FYKE 4FJZA 4OBSA 4E9WA 5TTRA 5CJQL 1QX1A 5BW7C 4FXKC 4PJFE 5BCAA 4L3EE 1XCTB 3EF4A 3N1QC 5JOFB 5HDBE 2JJTC 1KB5A 5ADOL 1MJ7H 3WLBA 3R1GH 3SYPA 1YNLH 5GZOC 4DPCX 5EEVA 3K80A 1UB5A 4YSEA 2A6IB 4I9WD 3WO3B 4ELMA 3PCYA 3QUXA 3L9RB 4ATWA 1IM3D 1EJOL 1NFDF 2EC9T 1GW0A 3TBSA 2VJ0A 3OMNB 4ADJA 1YY9C 4MQ7B 4ODUA 5T3ZH 3QAZC 2A74B 2GJPA 2FO4A 3TVMB 1HEZB 3NFNA 3U0WL 3FB8A 3EO9L 2XXFA 2WXKA 1M7IB 3C12A 3FO1A 5D1ZC 4LKXB 2A9DA 4A2EA 5KJ7E 1O75A 3IU4L 2B59A 4MQSB 2BO0A 2BNQA 3MV8D 1XF3B 1E0OB 3DDGA 1GJIA 1A7PL 2FNBA 3C8HA 2C9PA 4MDIB 5AW6B 3WTTA 3BH4A 4CNIB 4BEIA 1HN1A 1CDBA 2X1QA 3HS0C 3MRJB 4M6OH 4ZUUB 3DTDA 3EDJA 5FCUL 1MH5A 4X7FC 4YDMA 5FYKL 5AAWC 5KSBA 5ALCL 4UIKL 3IPEA 5EZLB 4DFIA 2BZDA 4FQJH 4E41E 4QHLB 2J43A 5J1AB 4D9RD 4MS8C 1MLBA 3WY3A 4ISVB 1WCBB 1TXKA 3EH5B 3TS8A 5FKAA 1HXMB 1BFOB 4PRIA 4H25B 4F9PA 3SDXE 4OH2A 2J8UF 3RX9A 1FNFA 3AUWB 2HX8A 2WIIB 2XA3A 2J72A 2HLAA 2Z7YA 4NAQA 4FCHA 4UT9H 4WW2F 5CSBA 2MCMA 1HE7A 1G5AA 3MKGA 2WCSA 2PO6C 3EOAA 1BIHA 4N9OB 5D1XB 1YY8B 3RJQB 4AITA 3KCWA 4WEMB 4EDWH 3EG9B 1EXHA 3V79C 1ILSA 5IEHB 2YC1A 3O2WL 5EZJB 3GSWB 3MV11 3QFJE 4FQHB 1HC1A 3VAEA 2IMMA 1AXSA 2X4PB 4JRYB 5EORL 3CUPB 1O0VA 2ROYA 2APFA 3LHPL 2UY7B 1DBJL 3HIZA 3DSFH 1XTMA 1LDSA 3IJ7A 4IKJA 1NL0H 9PCYA 2AC0A 4N0CC 1EHNA 5HGBB 1DANU 3QC6X 2XBTA 1SOKA 1FDLH 5CBAA 1MRCL 2Z7UA 5BVJB 5HVHC 2WBJD 5E08L 1F18A 1S7XB 3BRGC 4S1SH 2IDCA 1SJHB 1NFIB 2VSCA 4NQEB 1CF1A 5T1MA 3MACH 3BEWA 3PWNB 3QQ9D 4TUOB 3QNYB 3C60C 4W70A 1RERA 1NFDB 3IPFA 4QHNA 2EEXA 4JRXB 3FFOA 3FHAA 1I8MB 5JW3H 3OKMA 3CN2A 1ACZA 4LLYA 1LK2B 1ZWIB 1S3RA 4NRYB 4ZMLA 3NZ8A 3QDMD 2OTUA 3MRGA 5IOKA 2PO6D 5FFOA 3ROLB 1FL3A 4B9GA 4QRPB 4HWBA 3K5RA 3D7PA 2Y1ZA 1FG2B 5E7BA 4G9FD 3U79A 1KG0B 4XO8A 5EO1A 5IK3B 2CUIA 3VXSA 1LILA 5GGRA 4K9EL 1A6WH 1MUJB 1UEMA 5J12C 5F2FA 2AK4B 1KC5L 4KVCH 4MNHA 3T8XA 1NAKH 4CC4C 5GGVY 2GSMB 3L7FA 5IQMA 2EO1A 4Z7VE 3OZLA 4LOFA 4L8CA 1VFAB 5E94A 1JI1A 5FFLA 3MJ7B 5KVGH 2Q2EB 5CFHA 1ZHNA 2WXMA 4I3SL 3IRPX 3S88L 4IRJA 4LP4A 5DS8B 4N0CD 3L5JA 4U7KA 5FYKD 3GSVA 2WLLA 2FBRA 2J8UB 3GEFA 2G5UA 1T5XB 4L3ED 4WW2B 1SXCA 4N2DA 1QZNA 3AADB 3U4BH 2V7HA 4P5TA 5SWQB 1SN2A 1VGEL 4LE8A 4FD0A 4WWID 4JZOB 5MI0B 3VYOA 3C60D 1RZGB 2FJFA 1IEAB 2OJEA 3SHSA 1I9RH 2FWSA 4H5SB 2FYYB 4XZUB 2P8LA 2KPWA 2WY3B 2XC8A 2WTRB 3B3IA 3S37H 5MP6L 1UQSB 5DD6A 3FQTA 4R90L 3KPPA 4HK0B 4YDJA 3T2PA 1LE5B 4FA8A 2XPZA 5M95B 1KIRB 1U8KB 2QGDA 3T0EA 1G1OA 1ORSB 1XH3B 2K7PA 2L7JA 3UAAA 4JY6A 4RX4D 4AYFB 3IDMA 1ROWA 1OSPL 3HLAA 3LKRB 4BFRA 4PCSA 3S3SA 1HKLL 2AV7A 3BUPA 3P11H 3UTSE 5FO8B 3MOBH 1TVHB 4AVJA 1D6VL 3BSHA 4YDVA 4EIGB 4N6RB 4H0IA 1BPVA 3R0MA 1KN4H 2WUBL 3AJ7A 4LKCA 1MWAH 1G94A 3DLQR 5KUKA 2APSA 3MU3A 2FZ3B 3KYOA 3AG3B 2VDLB 1QSEE 3FQXA 2VUYA 4E41D 1AD0B 3FBKA 5A2AA 5B3JF 4XI5D 4CKVX 2L7UA 1G4RA 4HALA 1O6TA 5J6GA 4X99B 1JPFB 3WHXA 4AEFA 3U2JA 3QDGB 4LO9A 3ZYZA 2B7DT 2IG2H 1QVOB 4OZ4B 3ZGIA 4B41A 3ARWA 1WF5A 4QRBA 3UTTA 3VG9C 1E50A 4KQ4L 4MRCA 1E6OL 2NY6B 2GI7A 3UJIH 3UO1H 4Q0XH 3ET9F 3GF8A 4DGWC 3V4UL 3AU0A 2FIRT 3O41A 3KGTA 4OD2B 5JPMC 1J0IA 3LHAA 3QFJD 2PCFB 3M45A 5BW7A 4FXKA 1I3RA 1O6VA 4CVXA 5DJCA 2DIBA 2E75C 4I1PA 2JJTA 5GZOA 3KWWA 2XXMB 2KYIA 4XNXL 1CD0A 4NLAA 3T4YB 1JHLL 5C0AE 3LEVH 4GAFB 3VFTB 1S9KC 5ENWB 3BJLA 1MKFA 2VXSL 3MGAA 5D7SH 1MCDA 3JWDC 4PJBA 3QHFL 4I2XA 3V4VH 4TTDC 4EZLA 1VPOH 4OCRL 1NMCB 4M4RB 5AOLA 4FLSA 4PI2A 5D1ZA 3ZL4L 4XH2A 1GH7A 5E6IB 5ADPH 1AKJB 1ECZA 1HHHB 1TQCB 2H6PB 4R7LA 4Y16C 2X4UA 1BX2A 3EYOB 4P59L 1SLUA 1ZANH 4G7VH 3PGDB 4JB9L 4NN5B 1P7KB 4GKOA 4WU7A 1MSPA 3K72B 2FH8A 1MPAH 2CRYA 4PW3A 3WFHA 1PYWA 1DQTA 2YPKB 2ZSVB 2AAAA 1DBAL 3C2AH 3FONB 4XVTL 3VX0A 5DYOB 4KI5C 4TSCH 4X9IA 3DECA 1MJJA 4WEBL 5AAWA 2UZYB 4QR7A 1ZVNA 3NTCL 4XCNB 2NY4B 1AY1H 1IAKA 1KZQA 2WUCH 1IB5A 4PJEA 1QPXA 3O3BA 3FTZA 5BV7B 1FZJB 2KI6A 5MERB 3W11C 4XXWC 3MLSL 1IT9L 5M7QA 4LFHD 2MPVA 4WWKD 3ZT6A 1M71A 1X6NA 5DVKA 5IBUB 4CGUB 2V9UA 3D12B 5F1NA 5C6WH 1F02I 1CN4A 3N42F 5EF3A 1OKEA 3DVIA 4AK2A 4XO5A 2X38A 1OD9A 3V6ZB 3IU3B 3QULA 2CH8A 2HCZX 3JUZA 4TTDD 2VDPH 4B0MB 2FEEI 5LBSH 3VDAA 3B1TA 2MKWA 2JIXA 4HXAH 3L08A 2ZZUT 3FUJA 2EE9A 1MFCH 3OJDA 3ES6A 4M1DH 4Y16D 3WTVA 3CK0L 2EDEA 1K8IA 2X5PA 1QO3A 3AG1B 2C1PB 4PR5B 1LLAA 3F7KA 3G6DH 2MSPA 4YBLC 4C54A 3U2IA 3SJVD 1HNFA 4I3RH 2DL2A 4NQXB 3QZPA 1RSYA 4P2QA 1G0XA 1L9QA 1EZVY 1MJ8L 3CBJB 1JZHA 5IG7A 1L7IL 4PJFA 3T5WA 1JK8B 3T9WA 1JFQL 4JFTA 1N7ML 2AP2A 4ZFFB 1I7ZA 3UTSD 2ADFL 3EFFB 2XSKA 3H3PH 2AZAA 1QPPA 2NY2D 1WAAE 3O4OC 3WS3B 1KCKA 2C3VB 4G6JH 4OJFL 4Y4HC 2K6WA 3PG2A 2G75B 4MAYB 3RY5A 5FV2A 3ZTJH 1FGVH 2AQ2A 2Z93A 4JANA 4EEEA 4XPAL 25C8H 1MJUH 1OPOA 3W11D 3MXWL 1CXLA 3BESR 4MNQE 4PB0L 2N0MA 5F93C 5IFJA 3FK3A 1QSED 1KIQB 1BLNB 1BQHA 2Q8BL 3BAJA 3DJZA 4L05A 4OM1L 3V0EA 4AIZA 5MENE 2OK0L 1UACL 2EIBA 1TJMA 4Q9QL 2BRRH 4TUUA 1DQMH 5D7JD 4IHOB 3CPLA 3TO4D 1OAJA 3ZYOA 4ZTEA 1OAXH 4I3GA 1N8OE 4UF7C 3M1BB 3DYMA 4CC4A 1XCQB 3TO2A 3P77A 1R5IA 4LSSH 2DMBA 2B3IA 5DR5H 4AQEA 1S4IA 1KCLA 2ICEC 2PABA 4F33A 3CFEA 3QEHB 4E41A 1NTDA 4JN1L 5MEOB 4G7YH 5GSVA 1KPUA 1AS8A 1N6QH 2MHAA 3MFFA 1P69B 2GHZA 5FYLE 1U2HA 4AH2B 3DK2A 3D5OF 3NSJA 3PWPA 3N42B 3ARDC 2BVYA 4R5TA 2FH6A 2Y7NA 1XWVA 4LLQA 5C0AD 5JORA 1BQHG 1D6EB 1DLHB 5LN8A 3OTTA 3MJ6A 3ECBB 1IC7H 1I53A 3S35X 5BNXD 1EMTH 4WHTA 1SOXA 4L37A 1I3VA 3CMOL 5ACZA 3S3CB 3HZMB 1MN4A 1XVSA 4JG0H 1BVNT 4UQDA 3L3OB 5ISZD 3TT1H 1W0VB 3ZLQC 5HGAA 1SUHA 3BAKA 3K6NA 2I60H 1H8LA 5GGSY 1UWGL 4S2SA 3OR7B 1P5VA 5ICXA 3L13A 4J23A 3B7TA 1E9QA 2D7TH 3OKLA 3N40P 4YHZH 1CTNA 5AAPA 5C07B 3BIBX 4HS3B 1I85A 4P3DA 4QRQB 4XZ4A 1CD1B 1JDCA 3GIVA 5LWYH 2OPCA 2FAUA 3P2BA 2D2OA 5JHAA 3MRMB 4FYQA 1HZHH 2YSSA 3WTYA 4NZTL 5I5MA 3O11B 3B5TA 1UHVA 2VDRH 3L1EA 4OTXL 3MCLH 1I75A 3W81A 4FFYA 4L5FL 5BJTB 5E1AB 3I74A 2F54E 3NPZB 5LDUA 1OB0A 3MLXH 3FQRA 1TEFA 3KE0A 5D5MF 4NKIL 3EJRA 5A43C 4HUKB 3QJOA 4U1IA 2WGXA 2B77A 5DHVA 5AW4B 1SXBA 1NBVL 3GZPA 5L88L 3QUYB 5LVEA 4U0RC 4EVNA 3KLAB 4PJGE 4CVUA 4PIRF 4TQEL 3BSGA 2QV2A 3FTGA 1OHZA 1FL6A 3OSKA 1S9VB 3UIZA 1G4MA 1R3JB 5SV3A 3SCMD 1DZ0A 3VH8B 3N0PB 4YSPA 5I17B 4KOCA 2RCSH 1A5FL 1N4XL 4O2FA 5DA4A 5E2WH 1MFAH 1E4JA 4Y16A 5D72L 3AU1A 3J27A 4LCVA 2EIZB 5DSCB 2H32H 2VNCA 1MFEL 1T5WA 1CE6B 1I3GL 3BVNB 3KW8A 4LDEB 3K4ZA 1T5KA 4E9YA 4ZMPA 1UD2A 5T5FH 4MNQD 2CPCA 4JGUA 1SDDA 5G5DA 5KVGE 4YWGL 3RTQB 1C1EL 4N2FA 2NY3B 2XTSA 5F7NC 3P40A 1U8QB 4FFZL 4H88L 1UJ3B 3S36L 2A73B 1CLVA 1NCNA 3BDYH 2ITDA 4OZFG 1FBIH 1ZTMA 3BGMB 3JTTA 3RGHA 4UANA 2Q86A 3BP7B 3U7YL 5IT2H 1E4HA 5D55A 1MCQA 3NVQA 1EH9A 2YGPA 4NUJB 1ORQA 1DLFH 1S7RA 4LVEA 2D0FA 1QACA 3M88A 4WK0B 4BE5A 2XN9B 4JQXC 3TFBA 3IXAB 4XXWA 1SY6A 2KLTA 3X14A 1J5IA 1EBAA 2YEQA 2DI7A 2F1EA 3HCVA 4MX7A 3MLTB 5E8NB 1ZLDA 3ZTDC 1RK0B 1BD2B 2R2EA 1U8HB 5CR1A 3C75A 3ESPA 1GOGA 4BH8A 1EJ8A 1RZFL 4L3CB 4KNUA 4LVNB 1SZNA 1H3WM 5FYLD 5CJOH 5H2BB 3VFPA 2OA9A 5BS0E 3DGGA 2VDLL 3BWAA 3MZGB 4MLSA 1MWOA 3MRDB 4G8AC 3N85L 3ATBA 5AW2B 4GS7C 2WNKA 3FB6A 5CS7A 2VT0A 5KBPA 3ASNB 5IGXL 4ODTH 1ADWA 1XF5A 4XNQB 3SY6A 2EXWC 3LRGA 4FJ6A 5I82A 4ZFGH 4TN9A 4ACPA 3PPEA 5KVDL 2ZKYA 5FGBA 3T71A 5DJ0B 2F18A 1M7XA 1CCZA 1JD9A 3NSFA 2I07B 4PGEB 2P52A 4HOMA 2JQMA 2V2XB 4N6QA 3S35H 2W81C 4Y4HA 3ARGB 4N68A 4PGCA 4JFEE 3K71A 5ESVB 3C5SB 5F7EL 3KPQB 1TF4A 5D7IE 3KJ4B 1S9YB 3SE8L 4DNLA 3CVHA 3HC0A 1D7CA 3U30B 5C0BD 1W0WB 5D93B 2OJZH 1M3IA 5I19L 1KTKE 4G72B 4PG9A 2FEDD 1KJVA 4ORZC 3UTZB 4M1CC 2H0FA 1IRAY 5I1JL 3KPNA 4WI9A 1T1ZA 4M62L 3MLYL 3LSOB 3OD3A 12E8H 4NQDA 2ZCKL 2PW1B 3H0TA 3QPXL 4FQXC 3SD5A 5T3XL 2O6DA 3DOIA 4TNVF 4MMZA 1CIUA 1AXTL 2EEFA 1EEUA 3KPTA 2Z4QB 1MY5A 2ICEA 5TH2A 4AEIL 3FUKA 3MBWA 3CDZB 3TEUA 3CHXA 4NC2B 3PHOB 3ISWA 5B3NA 4KV5F 3MRCB 1XH1A 5DHYB 1KJ2L 1HZLA 4QOKB 5EBWA 5SX5H 5A2KH 4UAOC 3JTBA 3MLRL 3QO1A 4L2LA 4HIHB 4KXCA 5GS3A 4TNWK 2R4SL 2R2CA 3B9KB 3D4ZA 4DQOL 3F5WB 3ARDA 4QRUB 3KLHC 1ZLVH 4XXCC 4GAJL 1RIHL 1YRKA 4A7QA 5AZEL 3UTOA 3OC5A 1NBCA 3HFMH 1YEJH 2O26U 4G8GE 1LE9A 2YAPA 5I0YA 4OFQA 4QLRA 3QUMB 4HWZB 5INCA 1GS7A 1JE6A 5I75B 3ARSA 1GC1H 3CFBA 3PNRB 4W81A 4MA8L 1Z6JT 4M1CD 3D0LB 4U1JB 1PKQB 2YK1L 1Z9SA 1PCSA 3RJOA 1ZTXL 5DC0A 4R7NA 3FUNA 2WLNA 5KBLA 4J8RA 1ND0A 4FQXD 1W6WA 4GPVA 1X44A 2JB6B 4WUUE 3ZZQA 5C08A 1MAKA 2EZ0C 2VQUA 3MNZB 3P3RA 4KKQA 3VFUA 3CZNA 4ELDA 5FECB 2Z8VC 1ZSDA 1WAAA 4ODWA 1JF5A 2DQUL 3QIWB 4LLWB 5GS2D 1L9SA 2YXMA 2APBA 1B0IA 2C9QA 4Y89A 1CBVH 1E3ZA 1J10A 4MNQA 3RI5K 3FZUC 1GPOL 1OTSD 3D0VB 4QYOB 4G5ZH 2F0CA 5AZUA 3DHUA 1NGZA 5MENA 4XPTL 2VH5L 3RWGB 3B1UA 2XJLA 1WZMA 5IKCA 1WTGT 4W9CC 3VWJB 5F89A 5GGRY 4K23H 5DCCA 1X5IA 4L4JA 1Z0NA 1G6VK 3ZN6A 4CN6A 4D3CL 3X12A 1NBYB 3D9AH 2PYEE 4MKMA 3C08L 3SN6N 3ULSB 2J4WH 1KLUA 5C92A 4JCLA 2WYTA 4UQ2B 3JVFC 1RHHA 3MCYA 4F2ME 3H8NA 4ATTA 4XAWH 4K5PA 5T3XD 2EH7H 5D1QA 5IM7B 3GKWH 5DD0L 1D5RA 3MUHL 5CR8A 1D5ZB 1SVZA 4LRIA 4HKZB 1F2QA 3G5XB 1QUPA 5BUAA 3FQ2A 1ZJAA 2EZ0D 1J0JA 1I7TA 4L29B 5E4IA 4HLJA 3P4OA 2E9BA 4YDIL 5FA3A 4AYGA 3C5ZD 1X5ZA 4JFED 3W82A 1RPKA 2Z8SA 4LL1A 4JFPA 4XBEH 2Q10A 2IF7A 3M6DA 4P23C 2VM9A 2GB2A 1Z1WA 3LXBA 4NQCD 3IGLA 3FTWA 4EMZA 2YPVL 1KN2L 1QFWI 4AWJC 1TZGL 3OKDA 4HKBB 1IM9D 5EU6E 3NEEA 3AITA 3D2UA 2IEPA 3GRBA 4DP7X 4CN1A 4UOQA 4ZX5A 3SKJL 5EBLB 1KEML 2XNAB 4MYPA 3RB7A 1AR1B 3NZUA 4CVZA 5LCVH 5TQ0H 3LN4B 4LSVH 3QWRD 2G3NA 1EBPA 2VDQB 3VWKB 2E4FA 4JQXA 1NIAA 5E2VH 1KYOK 3KLLA 1HHJB 2W0PA 4ZODA 3JWOH 1YQVL 4B9CA 1CFTA 3KPSB 4MASA 1FGNH 2XIIA 3REWA 1NC4D 2MKLC 5ICYB 4OZIE 1CGSH 4MB4A 1N0XH 2BFVL 2M1KA 3JT0A 3O8XC 4UNTA 3NT0A 1NEZB 1E28A 5IJCC 1KTCA 1QFWH 4UQCA 2ESVB 4FC3E 4XMPL 2VN5A 3OL2A 1MCFA 1V5JA 1N3NA 5E5LA 3ZOAA 2F54A 5TFSL 4ZZKA 1GGBH 3E2HC 3VXQA 4P23D 4G8GD 4U3XA 3HS8A 4LF3A 2OFQA 1WA2X 2Q6WB 3EJZC 3U4EA 3MJ8A 5DD3L 3T0WA 1YNKL 2VR9A 4PJGA 2HFEB 4OI9A 3J8F7 3F7LA 4TMPA 3IGUA 3CC5B 5E5MB 3MI6A 3VE0A 3LH2L 4H2CA 2VXTL 1Y6KR 1ZLSH 3BUBA 3T4AB 2ZCHH 3DUUA 2NT0A 2X88A 4WUUD 5KTEH 2GTWB 3Q3GA 5KW9H 3VD0A 4AQAB 1YEFL 1I1AB 3LN5B 4ZOAA 4QXUL 4QXTB 1N68A 4G82A 1CICC 3IU4H 4IIQC 2IADB 4HA1A 3NPSB 1XR8A 3MGOA 1OAZL 3MYJB 1GAFL 5ANME 2JCCA 1NEUA 4X0KB 2FJSA 3E80A 1B4LA 4NHUA 4ECNA 1JZ5A 4NN7B 4AE1A 1FFNA 1HYSD 1FWXA 2IGFL 2XPYA 2JF1A 2CSPA 5JHDA 4KDTC 1JYWA 1RQ5A 4KTYA 3QUZC 4GRMA 3Q9QA 1T2QL 3CZLA 5A7EA 5IQ7L 3NIFE 4K73A 2UXFA 3VNZA 2PYED 2BJML 2X53A 1OIOA 2CGZA 4M00A 2Z31A 3IF1A 2OMUA 3B43A 2HT4C 2BS71 4WJG3 2AQQA 4ZPVA 5AVYB 5HYIA 1VFUA 5ID1B 3GLAA 4KO6A 2VR8A 3ZHNA 3PAZA 4XXCA 2X2IA 2CBMA 5I6NA 1PZ5B 1UA6H 2AJVL 3EHBD 2D31B 3CSGA 1BQSA 2QFPA 4ZRGA 3WIHL 3CSYA 2IWGA 1N8ZA 3OF6D 1XF4A 3RL1B 3KWVA 1WHPA 3VFWA 5BS0A 5DJYB 1KMGA 4G42A 1FNEB 3TV8A 1Z9NA 4MHHG 1O6SB 1NCJA 1TZHB 1TO4A 1BF2A 5IJVB 2R51A 1ZEAL 4KK6C 2DD8H 2R0ZH 4YBHA 4MNGB 1BPLB 3WUWB 4RAVA 3S2AA 1XO8A 3HZKB 1OGAE 3GKZA 1MLCA 5IFHL 2EACA 3IKKA 3FT4A 4YJZL 3AREB 1FCCA 3CFCH 1YMMD 2QSCL 4NSKB 1T80A 3QUZD 1F3DJ 3APFA 4AW7A 4NNPL 2HA1A 2DLTA 3ULUF 3CVCA 4IDLA 2IAAC 2EDMA 3B9DA 1MEXH 4Y9GA 2DLEA 3ZIMA 2NY0B 2O6CA 2OXGA 1JXGA 4OJYA 3P69A 3SKUD 4OVUA 5GS0H 2F5BL 1XIWA 4MD5A 4O9HH 3KDMA 1O7DE 4KO9A 5JIHA 5D7IA 5DWUH 5HGHB 4UQ3A 2ENQA 1OT2A 2NNAA 1J1XH 2DWEA 3ALWA 1TKWB 1OXYA 2A6DB 4PBWD 4QRRB 3CE1A 2F53B 2NQ3A 3CX2A 3KLDA 1ODAA 4WFGE 3GBDA 5J11B 2EE6A 2HP4A 3K4DA 1QLEH 4JQIA 2JSFA 4AZ8A 3MLUH 1VB9A 2WOYA 4PH8A 3GRGA 1NCBL 2BDNL 5AOMA 3V4VA 3BKJL 1B0RB 1I1YB 3QGVA 2FT8A 4AMXA 2QFRA 4S0TD 2FJHA 2WXPA 1RZ7H 4BQ9A 2PCPB 2EDKA 3V5HB 2WTOA 3ZK0A 4QF1A 4WY7L 2PXYB 3B2DC 4JFSA 4HFWB 1DVXA 4DZ8B 3GYRA 2BNRA 4AC2A 4BSJA 4C83A 4NRZB 3U6XA 4FXTA 2WD0A 3U6RB 4U1LB 5HI3D 1USZA 2IV9A 4KBPA 3STZA 4DO6A 2ZJSL 5IVNA 1CXIA 1CFVH 1PPIA 3WEOA 5BZDB 4CADB 2LU3A 3CHOA 4P23A 2FT6A 4PB9L 4D8OA 3VXPA 4HGKC 2ZCLH 4N5UA 1F11B 3LKQB 5C6TH 1QKZH 4CU8A 5KSAC 4P57B 5KN5A 2EEDA 3S96A 2LLNA 4PG2C 4NPJA 1T0NB 4PD4K 4K3JH 5E8EA 5IBTL 3QWNA 3A67H 4PWKA 1DN0A 4LCUA 2WKOF 4CL7A 3MV7B 1Q9KA 3KYKH 4DERA 2YGVA 3ZKMC 3SGKC 3K3QA 2FO1A 4X83A 4DSYA 3QHTC 4LHUA 4O5LH 2XHNA 2HTLD 2CO7B 3HBGA 4X5XA 5E03A 2GT9A 1E9OB 1BYOA 2AJXH 4TSBH 4HC1L 5B1KA 4YHNA 1N12A 2H1XA 4JHAH 4LL4A 2WZPA 4M7JH 1FP5A 2PR4L 2UUDH 5LBSA 2ILLA 2AERT 3HHRB 2CGRH 2CK0L 1TJGL 5K59E 2NNXA 43C9B 3UC0L 2EILB 1Z9LA 3KYAA 3MUY1 4MXVF 2KBGA 4YXHH 3O8XA 3ATAA 1CT8B 3ASOB 1O7DC 1FN4A 3OKOB 2A2QT 1GGIL 2K6ZA 5HPMB 3P54A 5IROC 2LU7A 4D8PA 3OXRB 4Q6IC 4K7FA 4WCYH 5E00B 3QI9B 3VXUE 5L8LB 1XF2A 3CXDH 3HAEG 4WWPA 1S46A 1L5GB 3VXRB 4UZGA 1JYNA 2I25N 2XV6B 4MQXC 1YN7A 3I2CH 4FNTA 5FS5A 2NT1A 4PRHB 1DDHA 3HRZB 3MUJA 3IEAA 3FSZA 3PGCA 3CCHB 4RIRA 1CFQA 3H53A 4X6DE 4Y9FA 3MBEB 4NNYA 4BGLA 4C57C 4GG6B 3EFOB 1S7VA 4I0CC 4WNJA 1MIML 3M17A 4LLMA 5DQJB 4F1ZA 1XZ0B 2X89D 1QFUH 3K91A 2B9BA 5TF1H 3ZKXB 4MB3A 1MHCA 1L0QA 2AJUH 3O2VL 3UGEA 2LTQB 4QTFA 1N5AA 1SYVB 2VMCA 5JNYB 3ZKMD 3RVWD 1ADQL 4HBCL 3T2NH 1JGLL 1TQUA 2XQYK 1OGAD 1UZ6E 1B88A 4ZMWA 2MCAA 2CLVB 3DO7B 1F00I 1FA4A 4NJAH 4A2HA 3OR6B 1GSKA 1E8ZA 1MELA 2YLHA 3E6HB 4Q9RH 4JFOA 5I6XB 2Y69B 5JXED 1N2RA 1S7WA 5T1KB 1CICA 5LB1A 2EINB 3K6DA 3M1CA 5F3BA 3SDYH 3EDKA 3ETTA 3EO1A 1R3LB 3A5VA 2Z65C 4GBXB 3SDCB 1NPUA 2O5YL 2X7LB 2CWRA 2QR0A 2NSQA 4NN6B 5EU6A 4PUBL 4KDTA 4IRZH 4H1LH 3S7GA 3I6KA 1F1AA 2WSDA 3SPCA 2HH0L 5EZPA 1EVTC 5D7KE 3IFLL 1BZ7B 4HZ1A 2ZE0A 1ZCRA 1CLZH 3ZTNH 1MHEA 1HQ4A 3RZWA 4F7CB 3L3GA 5LNDA 4FP8L 3WO4C 3BN9D 2DIAA 5F7MC 3GO1L 1AIFB 1I4FA 1UURA 4MMYB 4DWHA 3MC0A 4XC3L 2ATKA 2YPLB 5J0BA 1U8JA 3O6FD 1UFGA 4NZDA 4OGAC 2XT1B 3DGDA 5FWQA 5L4JA 5TF0A 1GC1C 2F08A 2X4TA 1C12A 5LAPA 3OXSA 2PNDA 1CU4L 2I9LA 1UUSA 3IJYA 1K8DA 3RNKB 4Z7WF 4G80B 3GI9L 3RDTB 1XD1A 2YA1A 2ZXWB 3LQMA 2Y7QB 2WINB 4LP5A 5E2UL 1XGRA 3AS1A 3WKML 4RWYH 2DWTA 3SYAA 4HIJA 2ZD0A 3ZKSD 3KLQA 3L3DB 4LL9A 3S5LA 3C9NB 3H42H 1EGJH 1LNUB 2IH9A 4IRSB 5KZCD 3KYMA 5FHAL 4AYDC 8CGTA 3EJUA 4GQ9H 4JN2A 4YHIB 1MJ8H 4J28A 5I9QC 3DOSB 1L7IH 2PW2B 3RWFB 3BKMH 1J5DA 3SBPA 3QJQB 4QTHA 5CZVL 4C59B 4PJIE 4BQ6A 2K9FB 1FNGA 5GJTH 4PV8B 3QQNA 4G1MB 3BP6B 2DQFB 1K6QH 1WWAX 1KNOA 4HKJA 3TTYA 2WLZA 4HXBH 5PAZA 4B6ZA 3F12B 1V7MH 3DDFA 5EBGA 1AGDB 1V05A 1Y6NR 2Z0BA 5L2JB 5ILTH 5C0EA 2HLEB 4CW1B 1KY6A 2YXWA 4L8CB 3U4KA 4AKPA 4PJ5B 1PU0A 3PHSA 4OGAD 1BWWA 3MQIA 3DBXB 5EU4A 2CG9X 5CD5D 3V10A 2ZG1A 3I9GH 4PJ7E 3U9WA 5EFIB 1EAPA 1XSKA 1S9XA 2YMXH 2H1LM 4HT1L 2NXZC 4CN4A 3JYBA 1G9NH 5E5RB 2JLLA 3GMNA 2KZKA 3DRQA 4LLVB 4BHUI 4RFEB 1T1WB 2XBDA 2HJKA 1FE8H 4KRPD 2HKFH 4R83A 1H0DB 4YIQA 3MA9L 1U36A 1MZYA 2NUPB 4XR8C 2R7EB 5FYJH 3C09C 2H32A 1ZIAA 1NDGA 5BUGA 1MREL 4YBQC 3FRUA 5A16A 3GRWA 2HRGA 1YLBB 5LAXA 4BH7B 3O9WC 1A3RH 2YBRB 1TETL 2F58H 3BHBA 3H56A 3CN3A 2CLZB 3BEVA 1JV2A 3W9DB 2WQWA 3TEZA 4YX2H 3OGCB 1YHPA 1LQBC 5F3HA 5ABAA 1CI3M 1LEIB 3EJTA 5J13B 1ZDQA 5KSAA 3N44F 2TSAA 3QDJB 3FRPG 4HOWA 5DJZB 2P80A 1JGUH 4PYHA 2IPKA 1BAWA 3KLKA 4A7GA 5FGRA 3MRKA 1EFXD 5E4EB 3JWOC 3TNMA 1F5WA 3D3VA 3SB3A 5C0JB 2I27N 3SGKA 1KLFB 5EA0H 4AVKA 5IZ7A 4JKMA 1COBA 4I9XA 5T1LB 2CBQA 4GSXA 4F7EB 2VERA 4I5BA 1FIEA 1WZLA 2NW3B 3G6AB 4GMTL 4X80L 4Y2DD 1RIUH 3KXFB 4APQD 1W80A 5D7KD 1KB9K 1T21B 5K9OB 5F70A 5DZVA 3AXLA 5CBEA 3ILQD 5F0MB 4BFNA 2DLFH 3OAUH 2QQNH 4X9GA 4FN0A 5D71L 3HJ0A 5F1IA 2CR6A 4M1GL 4YBQD 3UL4A 5DUBB 5IROA 1P4LA 4E9SA 3O9WD 2VR6A 4X5QA 2PWDA 1JMZA 2VDMB 3QIUD 4POYA 3N06B 3N1FC 1Q1JH 5AZ2H 5KYUA 4LGPB 2ARJQ 3EJJX 4PQXA 2HFFA 1PLGH 2R1YB 4WKXA 1J0HA 1JWMB 2JI3A 1RZPA 4YO0B 1GKEA 5JR1L 1WGOA 1UD4A 4JY4A 2ZOKA 4QKTA 4MJIE 5TGBB 3GMLB 1BQRA 3X11A 1U42A 2DBLH 4X9HA 3G5YA 1S5HA 1AE6L 4GP8B 3FSWA 1ZLUK 1UTDA 5I1DB 3WFEH 4WQOA 1G5GA 5BMFH 5EIIG 2QPUA 1KCBA 4KZEL 4UOJA 2V5SA 4FTDA 3IMWA 2FR4B 1KGWA 1F6FB 2JELH 2DLGA 3OPZL 2EQDA 4J3SA 4KQ3L 3AWGA 3ZXAC 1A7OH 3T6QC 3BPCB 2X4OA 4JEGB 2FATL 3NJHA 4NPYB 2Q7AA 2E7CA 2CALA 2AAVA 4B7LA 1I3GH 4O02A 4IGBA 4MD0A 4NBYB 4LASL 2HTKC 3N44B 4P9MH 4Q89A 1JXDA 4R3SA 4PS3A 4WRLA 1CB4A 3BDBA 4U1KB 3RG1C 2UXGA 2XWJB 3EADA 4L48A 3UZQA 5TE6H 5F1KC 5BRZE 3K8LA 1JNLH 4I0PB 4IQHA 4Z76A 1S2EA 2DQGL 5F6IB 3LD8C 4XN9A 3I9PA 2DQCL 5L2KB 1SMOA 2EICA 3DGCR 2O30A 2VISB 1DHKA 3MLWL 1RUAL 4NRXA 5HJBA 4CA4A 1A2YA 2EE2A 5E8OA 4DEPB 4BQ8A 2CO2A 1CG9B 3EYVA 3L7EA 4PIBA 5EULV 1ZV2A 4YSDA 1YDPB 2BNUA 2NY1B 2HXAA 5JHBA 4L4TA 2B0SL 1Z5LB 5IVZA 2YZ8A 2HVBA 2VLJE 4K3EH 4KO5A 3ULUL 2MOGA 3MNWA 4H26B 3HJEA 1A02N 2Y72A 3WE6B 1X5LA 3T1FA 3EIFA 3VXUA 3HG1E 3WS6C 5EB9A 4NKMB 2ICWB 3RWDB 5B39B 4W68A 1ROCA 3WELA 1NC2A 3FFCE 4PS7A 4Q4IA 3J07A 5FK9A 2VCOA 1PEWA 5CKAA 1XGUB 1OB1B 1QG3A 1QSFD 4JDTL 4JLRA 4M6ML 4EN3C 5IW6B 1TZIA 1NGXA 1UB6A 3HMXH 2A0LC 3BWUF 1ZPUA 3QG7H 1NCAH 5DEGA 3O3DA 5CJ5A 3EH4B 5HYSG 2NXYC 5GS0C 4Y1AD 1C08A 4W1TA 5BQ7A 1ACXA 1DJXA 4BGDA 3FPYA 5IBLD 3T8MA 5A2IH 1OSZB 2ARJB 1ZMYA 3D09A 1A9EB 1GY1A 3D4YA 3MRIA 4HWEH 3CBRA 1AZCA 4ZW6A 3EZJB 4FTVB 4K7PH 5C0CA 2CO3A 2XYCA 4X8JB 3A6BL 3UTQB 5D6DC 1UOVA 3I6GB 4DAGL 4DZBA 4Z0XA 5B3SB 3DIFB 1OM3H 2AQNA 4KU1A 4F57H 5EOCH 3P9MB 3CG8A 3NA4A 3MAWA 3F58H 1KFAH 1SJEA 2QHLA 3QO0B 1P7QD 3WN6A 3K2IA 1WIUA 4LLUB 2QPEB 3TWYA 2FRGP 5SX5K 1F6LL 3DX0A 5HHVL 3NAAH 4GRLC 5K1JA 3APDA 4OAWA 1CDHA 1WD9A 2B1HL 2OMWA 2QEJA 5DJ8B 1W72B 4PD4J 5D9SA 1ZLVK 4P2RE 4U1MA 1AGBA 5E51A 1NA8A 3UMTA 5EWIH 5EBMB 1AXTH 1FUNA 2VDOB 3IJSB 3L3IA 2GIXA 2J44A 4HS8L 5E8DH 5EU5B 4LOVA 3FQNB 4NZRH 4MJID 1SFDA 3WJMA 2NXYD 2NW2B 3N55A 4PJEF 1QR1A 1AO7D 3DUSA 2XXGA 1A14L 2E27H 1YQ2A 5CEZL 3HI1A 4S0SD 3O9WA 1DSFH 4NIYE 2AJSH 2ITEA 4JO4L 3NZSA 4JDZA 5HDWA 3VXMD 5HJDA 1G9MH 1MVFA 3IDJA 4RGNB 3MO1B 2FX9L 4X6FA 2XWTB 5BV7H 1BIIA 2V5MA 3B2PA 3Q1SL 1OCRB 4XNBA 5JDSB 1XBRA 4HHWA 1I9JL 3BFWA 2AW2A 5DHMC 5TE7L 2AEIT 4LDCA 4MJ2A 1IJ9A 4O2CA 5LCVA 1AFVH 1FRGH 1NDMA 4JRLA 1FL5A 1MNNA 3DVNB 2AABL 1TUPA 1CDCA 5KSUB 4MZRA 4LB8A 5B38B 4ZMAT 1UGKA 3BUDA 3II3A 4LQ1A 4OKVA 3TU6A 4JW3A 3OKNA 5HYJE 4AJYV 3MBXH 1J5OH 2DLHA 4XVSL 3IB4A 2H26A 4GRLD 1J05B 5J6HA 2QJDA 2WVSA 3QA3A 3QCVL 5FKPB 1DSWA 3U48A 1QEXA 4PREA 4PP2B 1NCWL 5CINL 3DX8B 3BWZA 4BWWA 3LZLA 1LGVA 4X4YA 3DRTA 4LCCC 4R8WL 1OQOA 5AAMC 4PRAA 4RISH 4RNRA 2WXFA 3FB5A 4BKTC 2A83A 4PY7B 4NLHA 3ZHDA 5KVFH 2K70A 5IB2B 2MQ0A 2XZQH 1F4WH 2R69A 3BZDA 3EOBA 5EG6C 3DJ9A 1YEDA 3L1OH 4XBPA 1P53A 1OSYA 2QGCA 3QQ4B 3TESA 3LZRA 1N26A 1J0YA 3GM0A 2A9MH 5EOTA 2ZOOA 3BAEH 3F3HA 3RA7H 2VLJD 1G6RB 4DN4H 1AMYA 1XEUA 4XVOA 2X3AA 1L7TH 5CILL 1Q4NX 4OCNC 4BFKA 4JPKL 3RWHA 1ECYA 1EUTA 3FFCD 3M46A 3ARZA 1MAMH 1H8SA 3GMMB 2A77L 3QUGA 4YQXL 1BVLB 5HTSA 4DN3L 3NCXA 2VGLM 3CVDA 3EUUA 5DUML 5CGBA 1OP3H 3ISRA 1AI1H 2DDQH 3UG5A 3BKYH 2YKKA 4PLOB 2NX5B 4AIEA 1S7UA 3DC0A 3LXAA 2J5LB 5B8CC 1M6UA 4FQQA 1RSFA 1IGYA 2PF6A 1R3IL 3Q6GL 5GISH 2HPOA 5KOMC 3W57A 4ERSH 1A3ZA 1B4JH 4XP6H 3D34A 4LCIL 1ONQA 1ETJA 5C97A 5INDB 1A1MA 2OQJA 3LIZH 1NIEA 1OVZA 5DRNB 3APCA 1QBLH 4QHKI 3TN0B 4AKOA 2Z8RA 4HUWB 4KKAC 3N6YA 4GSUA 1IL1B 2OR7A 4GXVH 2F68X 2UY6B 1UWEL 4M5YH 4G1EA 4DW2L 2M8XA 3VFGH 1T4WA 4NNXA 1VFBB 2WAQA 3D06A 1C16A 5E8PA 3LIUA 5FYJE 1B2WL 3RDJA 4WI3A 5IW3A 1DEEB 2FWOA 4OLYL 2OXHA 4RA0C 4AUUA 2OMTA 3B2XA 3VD3A 3TJHC 1IFHL 2E7LC 3L4UA 5D2NB 4M7KH 1T04B 5EO0B 2ZKWA 2IBZY 5EV7A 1KEGL 1F4XH 1WBZB 1YMHB 2YD0A 3D52A 4PJ8C 3BXNB 1CIDA 2B5IB 4ZSOA 2HZHA 3P4MA 1WP6A 3TF7C 3K2KA 1L0XA 2QQKL 5FA4A 3WUZA 3ZHLA 3U1SL 4C47A 1OV8A 4KMTH 4GUOA 1G7MB 4FDWA 4KK8D 5JOEA 2K7QA 5GIRB 4WNQB 3ZQ9A 2HRPL 1A1NB 3N04A 1BBDL 3ARBB 1K5WA 1OE3A 2UZIH 3FU6A 3HNVH 2IQAB 3WS6A 3DV4B 3Q8FA 4JFYB 2EIDA 1NKGA 4JRYE 4B9IA 3RZCA 1HHIB 2VLKB 5GZND 4XMLH 2VSDA 1G7QB 1QABA 4LXFA 4ODXA 4PEEA 3SE3A 4EN3A 2GJ6E 3MRLA 4RBPK 3VMPA 3GZKA 3SGEH 4OCXL 1IIIA 3HC3H 4JDVA 4MJIA 3LNIA 4OGXL 2CM6A 1LL1A 4XP1L 1CL7H 1WSST 1QOKA 2VKXA 2RH0A 3PWUA 4KX7A 3S8FB 1WRFA 5C9JB 3WKPA 2BOBA 3EW3B 4JHVA 1BAFH 4X7SL 4NP9A 1A4JB 1XDTT 5IV2A 4JO3L 1U8OB 1ET8A 1NFDE 3LH2H 3W5MA 1EO8L 4PJ8D 1M42A 3TJEL 2A74C 5D6DA 2G3MA 3V4PB 3TVMC 4GO9A 4NKDB 4U05A 4ZFOA 3TIDB 2R56L 3DJSA 3ZDXE 1G9NC 3P0YL 1LP9F 4FQIH 4J3VA 2BOCB 2P26A 2YMTA 1QNZH 4QRPE 4Z0BL 1GHFL 4PCYA 2Z91B 2GJZB 1RMFL 4N2LA 1UOKA 3TYGL 4LBEB 5D2LF 1VZHA 1SEQH 2AK4E 3IGAB 2HFGH 1NIDA 1NLDL 4XOAA 3AS2A 1PX8A 5BRZA 1KCVL 3WV0A 4YE4H 3FCUB 1YEGH 4LDOB 3EKCA 5BRQA 4JY5H 2GHWB 1ES0A 2GC7C 3DUHA 3HC4H 4L8DA 4BDVB 2H0PA 1NMAH 3CFDB 3VJ6B 4H8VA 2BP0A 2HVKB 3FO9B 4P9HL 2H2SC 4XMUA 1M7UA 3TCLA 1MW0A 1MW3A 1KB9J 3UBXI 2QTEA 1OGTB 1HH9A 4AV4A 4HEME 3BUYB 4MJHA 1NFKA 1E90A 3FO2B 4LU5H 3SDDB 5IB4B 4HUVB 4CMHC 1UCBH 1AANA 2VQ1A 2EVFA 1WE5A 2VLJA 4ENED 1J9QA 2C26A 1RL1A 3DX9B 4BK4A 3U2SB 1FH2A 2YD1A 2XG4A 3HG1A 1JRHI 4ZS7L 4C56B 5JHMA 4NUQA 2N1TE 3RHWK 1OLZA 4N0YL 4ZTOL 2VO5A 2YFOA 4L0YA 5C7XH 3A3YB 2IGTA 1HDMA 1V55B 2G9KA 1CDYA 1OP5H 2A9CA 3GXDA 2Y5TB 3H2PA 2DF3A 1D5BB 1WZ1L 4MDRA 4UTAH 4HPHA 2EIMB 1E5AA 3VTAA 4U3HA 4UTBH 3O6LL 1JSYA 4XPGH 4XWGL 4OZFB 5SWZB 1U2CA 5F8QC 3TLRA 1P5UB 4QO1A 3KJ6L 1GMIA 4LCCA 1SHMA 5AAMA 4WW1A 2KKQA 3O4LB 2C7FA 5HDLA 4NQSA 4PFEA 1TFHA 1WA0X 2H2SD 4TPRL 4FMKA 4AEHH 1OCWL 5IHZB 1NLBH 2VM4A 1LP9B 4UI2A 4Z95L 5CGYD 1BBJA 1RUMH 1RJCA 1XR9A 4LFHG 1HILB 1QQDA 3CZFA 1NCUA 2N4IA 3L9YA 5I6KA 5HY9A 1G87A 3K5SA 1AQKL 3R8QA 2V9TA 4QXWA 4JRWA 4M4PA 2Z0UA 5D2LB 3JV5A 4GXUN 4Y5VB 3MJ9H 3HG3A 5E5UB 1UYWL 5CNHA 3U1QA 5D6CB 1WAEA 2GUOA 3QEGH 3SQOH 4P2RA 3L95A 4JRYD 4W9HC 2LW3A 2XIDA 3QZOA 4QTIL 1YN6B 2YAHA 4I18A 2GJ6D 4QAMB 3U25A 3CFNA 3GJEA 1H9DA 1FIGH 3MODL 1W72L 2CHDA 1WFNA 1HJBC 4XCCH 4WWNA 3QJHA 2R0WL 3U83A 2WTPA 4PMFA 3GGWA 3DVGB 5B8CA 4GO6B 2JI2A 2IDQA 3H2WA 4WTXA 1QRKA 2ZP9A 3WFZA 2VDOL 3P3YA 4PRPE 1FV1B 1DBKL 2AQ1A 3PQYE 5DJDA 5MI0C 2BSTA 4EI6B 1NAMB 2Y1YA 4K94H 4N25A 4IRZA 3PLYA 4XGZB 4YZFF 4YHMH 5F6HJ 1QW9A 2ERJB 2CMRH 2IDTA 4LARL 2H7WA 2EUXA 2X44D 4Y0GA 5BRPA 3V0DA 2ED7A 4WKZA 1M1SA 3CLEH 3FPXA 3D39A 4PRBA 4R4FL 3WTUA 1MCJA 1H6UA 5CEXA 4GUQA 2XFXB 4QRPD 3QIBB 5HYJA 2NRDA 4HKXA 1NANI 3G7TA 1FORL 1KCUH 4BKLB 1BP3B 2WLHA 1BDYA 2E7LA 4XMKH 1A4AA 3QUMH 3IFNH 2AK4D 4ZAKC 2QTVA 4KUZL 2W9EL 1JERA 3FS9A 2OMXB 4PJ8A 4KZDL 4CAGA 2PTTB 4IKKA 3VFVB 3MR9A 3WSQH 3A47A 1A3LL 3SPVB 1TJHL 4H44C 5D4IA 2BZCA 4EUPB 4MAUH 1Q9LB 4LHQB 5JXAL 2W94A 1RIVH 2H8PB 3EH1A 3QRGH 1U58B 1TFPA 4PGJA 4HUXA 3U9UA 1LMIA 1R3KB 4KFZC 1EGJA 5K33A 3VGGA 5BZWB 3TH3T 1I8IA 4J2XA 1CFSA 4ALAL 1XSIA 4BZ2H 3AB0B 4JFHD 4GG8A 4ONFH 3QJSB 1EXUB 4X9FA 3V0GA 4JHWL 4OV5A 1RZKL 4HISA 1G7JB 3OWRA 2X41A 4LBAA 2AS5M 2JKTM 5HHXH 1ETZA 1UKTA 4Y19E 1ZPLA 5CMAB 1A64A 5GRUH 5DD5H 2ZIDA 1RLBA 3QXDB 5IEKA 1H3XA 1J87A 3ETBJ 1F58L 4TF4A 5HHOE 4PJHF 3CSTA 5JUEL 4PHZA 3EO0B 5KVFE 2YS4A 4X8XA 1XCTA 1TIUA 5JOFA 2FLMA 4JHUA 3V95A 1HL4A 1MDTA 3BCFA 2A6IA 2J12B 4XN7A 5DK0B 4KZ0A 3RKDD 4ZAKD 3L9RA 4MQ7A 1GY2A 1NMCC 2A74A 3TVMA 1HEZA 5I8OL 1E42A 3NFPB 5ITFB 3H7BB 2WHVA 1M7IA 4Y5YB 5I6LA 4LKXA 1TQCC 1KTJA 1NSNL 3A4FA 4TL4A 5DQDH 1ILUA 4WTZA 5IR1B 1XF3A 1ETB1 5D7LD 3FQWB 4MDIA 3S98A 3B4NA 4CNIA 3MUZ1 1JHTB 1Q72L 4LQFH 2XWZA 3MRJA 4ZUUA 2X4NB 4ETYA 1FLTX 2YGOA 3QJZA 4KFMA 3ARFB 5EZLA 1NCHA 3JWNH 5I74B 3DMMD 2NY4C 1G9MC 5I30L 3GJFB 3MMEB 4KKCC 4LOEA 2FHBA 4QHLA 5J1AA 3VGHA 4ISVA 5BV7C 5KANI 1WCBA 3EYSL 4UAHA 1AH1A 2YEZB 1HXMA 1BFOA 2N01B 2WO3B 4H25A 3UEZA 4CU6A 5EZIH 1W2KT 4J3OG 2ADGB 1PJ9A 4PW4A 1XHHA 4LNVA 5GXBB 4IKIA 2WIIA 2WXHA 2W07B 4Z7NE 3KH4A 2O5ZL 3FCSB 4YEFA 1I9EA 4BFGA 5D1XA 2R8SL 1YY8A 2XICA 4XMWA 3S2CA 4ZI8A 1HESA 1IEBB 2VDQH 2DQJH 1A4CA 3BZFB 3QZNA 2J1WA 1HHKB 5IB5B 2B15A 3EG9A 1CLCA 2L7QA 4A6YH 4PRPD 5IEHA 5EZJA 4G6KH 3GSWA 5HJ3B 3PQYD 4HZAA 3WN5B 4OB5L 4FQHA 1G7LB 3FMGH 4KQ0A 3FN0L 1ZV5A 2UV3A 2X4PA 4JRYA 3CUPA 3FTXA 5FOBB 2UY7A 4ZXBC 4DPBX 3NJVA 4IS6B 1CE1L 1GZPB 3RGBA 4PJHB 2WP3O 2QSTA 1YEKL 3OX8B 4EI5B 5J8OA 4AGOA 4LEXH 5BVJA 4OV6F 2BWIA 4N2AA 1S7XA 1SJHA 1NFIA 5C07E 1MW1A 1WEJH 1Z3GL 3HR5B 1PSKL 3N9GL 4GQZA 5DD1H 4NQEA 2PWHA 1U21A 3PWNA 4TUOA 4PJAE 3CFQA 3QNYA 1NFDA 2VLRB 2YAOA 4WUKH 2YUZA 4JRXA 3N2JA 1F97A 1I8MA 1E27B 3RILA 4GAGH 5CHNB 1LK2A 4QD2E 4NJ9H 1ZWIA 4NRYA 3QPQC 1CTOA 4RZCB 3MCKB 2EXSA 4W9JC 2W59A 5K9KB 4KROD 4H2AA 1NPJA 1JPST 2V37A 4POZD 1O9WA 1BQ5A 3ROLA 3SDAC 4QRPA 2XKNB 4TNGA 1FG2A 2ORBH 4LSQH 5HHMB 3V4PL 2JNZA 1EZVX 1ACYH 1KG0A 5IK3A 5C9KA 1UVQA 1MUJA 1CR9H 1DTUA 3DX4A 3RYMA 3H9YA 5I0XA 2AXHA 2AK4A 4NUGL 4U3CA 3EJPA 1HL9A 1NMBH 4HQQH 2YRPA 4IBVA 4XB8A 4Y19D 4O51B 1DBBH 4ZXBD 2Y22A 3MJ7A 5ALBL 4KI1A 5DS8A 5A6MA 4Z7UF 4FZ8L 5HHOD 2X0VA 4ONGH 2B20A 2J8UA 3E0GA 1JGVL 1T5XA 2C8NA 4YSOA 2P5EB 4G6FD 1S7SB 4WW2A 4I1NB 4K3HA 5D70H 3PWLA 4XNUH 3QR2A 5SWQA 2IWFA 4JZOA 5FO2A 3HG2A 4HJJH 3WNIA 1RZGA 1IEAA 2A3TA 4X9BA 4NGHL 4H5SA 2FYYA 4XZUA 4Z77A 3F7VB 2FWLB 2VDNL 2WTRA 3MX0B 3BVUA 5KVEH 4NM8H 3RFZB 1UQSA <