3FO2B

Crystal structure of hapten complex of catalytic elimination antibody 13g5 (glu(l39)gln mutant)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
214
Chain Sequence
DVQLLESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Catalytic antibody Fab 13G5 kappa light chain chimera
publication title An aspartate and a water molecule mediate efficient acid-base catalysis in a tailored antibody pocket.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 44
structure length 214
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo2B01
3OR6A 2R2HA 4N5EC 3ULSB 5IVNA 1HYRC 1RK1B 3D5OF 2R0WH 5DYOA 4P5KA 4AL8H 4TULL 3MUJA 4M7ZB 2VABA 3CH8A 4X6EB 1QLFA 1HXMA 4LKCA 1T4KB 3GI8L 4YHOL 1RU9H 5KSAD 5DJ0B 3ZYJA 3PXHA 2YA1A 2CDEB 1UA6H 5JOEA 3R1GL 3O41B 3BQUA 5FO7A 5CP7B 5DUBA 2F19L 1UJ3A 4NHUA 1LO5B 5IESL 4WIQA 4PJIB 3GSUA 2E7MA 1CZ8H 4HWEH 2VDQL 3LRSB 4XH2B 5I8EA 3I9GL 1P7KB 1Z9SA 3TO2A 3MRLB 4PJ5A 2QSCL 1RJLB 1MCIA 3LKPB 4NQDA 4RWYH 1V5JA 4L8SB 4J6RL 2DBJA 5I8OH 3BT2H 3QJFB 3TN0A 1FL6B 4LCYA 1L0QA 1QR1B 1X7QB 4F7MA 4M6NL 3NCJL 4OFKA 4ZUSA 3GIZH 2RB8A 4TNVF 5FYKH 1AO7D 4U6XA 4P4RA 1UB5A 4NO0D 2IALA 1WIPA 5ADPH 4Y4FC 2Y06H 1OAYH 2FBOJ 5L8LB 1TZGL 3JV4A 1BVLA 5BZWA 3V2AR 1IC5L 1K6QH 5A3ID 5E56A 4PRDB 3PE9A 1S3KH 5I19H 1RUQH 1MLCB 3E6FB 1P5UA 2EDJA 2IAMC 1PD6A 3QQ9D 5HYJD 4RISL 5DO2D 1YJDC 1MJ7L 1WFOA 3VA2C 1DUZB 4NT6B 4JG0L 4R2GD 4AEIH 1JFQH 1Z9MA 3EDEA 4NPYB 1M71A 4LVOC 3BZ4A 4LVHB 3CSYA 4M43L 3G04B 2Q7NA 3TH2T 3U2SA 3U4EB 2VDKL 2EXWD 2FO4A 3C5SA 1MFCH 4OLEA 1JPTH 2ENSA 3KPTA 3QIWB 3RWGA 4NZTH 1GOHA 4AIOA 4HT1H 5E8PB 3WFCL 4XP9L 4OZHB 4P5TC 1YMHA 5EDXA 4L8CB 2DIBA 2VC2L 2IEPA 5CWSB 3BRDA 3CFCL 3FONA 5DUML 3MJ9L 1IQDB 1UYWL 4ONFH 2R69H 3MRQB 5I1IH 1P9MA 1GYAA 4KROB 3VFOB 5C6WH 3V6OE 4V2CB 2F54B 3WEXB 3HE6C 2G9HA 4HEPG 5B8CC 1CFTA 4Q0XH 4JFFA 4XPGH 3P4NA 1BGXL 4J23A 1D9KB 4P46D 2X1PA 4LGPB 4OZGE 5DHVA 3KXFB 3G5YA 4KQ4H 3O6FC 5BV7H 2IADB 4HK3N 4ELMA 1F6LL 3BDYL 1I1AB 2XY2A 2DTSA 3UC0L 4WGVB 1U8PA 4G9FA 1W0YT 4POZD 4NQCB 3MRBA 3H9SB 5FA4B 1HN1A 3S36X 4GT7A 2HJKB 4TNWK 5CLTA 3BEVA 4O5LH 4YAQA 5J89A 5D1ZC 3GMPA 3U0PB 1AC6A 3QUYD 3DYPA 1BZQK 1H3WM 4N8VA 4NHCL 3EYOA 3T09A 3S35H 4BSJA 5D7LA 1WC7A 1MPAH 1ZLWK 1A4JA 3T4YA 3S37L 1J1XH 3FTGA 5KBNC 3MLXH 4ZQKA 1F42A 3AC0A 1YMMD 1LK3H 1QG3A 2GJ6A 4KVNL 2VTFA 4KTDL 4JDVB 1JTOA 5HTSA 4ERSL 5DQJA 2YC1A 5JXEC 4BZ2H 5IB4A 3HC0B 1KJ2L 1RK0A 2Y5TB 3I6LD 5H94B 3BZEA 3KLAB 3LS5L 5D6DA 3HCVA 2EKSA 2PO6A 3VRJB 5T3XE 1MCKA 3WFDL 4ZPVA 5CCKL 3RWFA 5ANMB 5FYJU 4OV6F 3OGCB 3ROOB 3MCLL 4HQQL 3SCMA 4XRCA 5E24E 5CILH 2W9EL 3PP4L 3FB8B 2AXFB 5FKPB 1CLCA 1TDQA 3OX8B 4Q7DA 2X4QB 2PCPB 5AZ2L 3QZWA 4YGVA 4QF1A 2V2TA 1CD1B 1VERA 2OTUA 1NAKL 3TZVB 3ELAT 4PJHE 2R56L 2F58L 2EIBA 3U1SH 5CBEA 1FDLH 4FQQA 1FZMB 4X6FA 3O81A 1MNUL 3L7FA 5EFIB 4QRSB 5D93C 3X12B 4LCWD 1P5VA 4KTEH 2DQCL 4AJ0A 4C56D 4KK6C 5H35B 4UBDD 1T66C 1BBDL 2DQTH 1RZIB 3T3MF 3ARDB 3BAEL 3N1GC 4H0IA 1CIUA 4Q9RH 3MV9D 5KSAA 1T04B 4GBXC 3HZVB 1T1WA 5L2JB 5IMMA 1EZVX 2EYSA 4DN3L 4N9GB 1A9BA 4KHXH 1H0DB 2FRGP 4Y4HB 2DRUA 3IDGA 3JWNC 3GM8A 3IFOA 4YHKL 1DBMH 4ODHL 3IFPB 3TV3H 4JREC 4LEXH 5DS8B 2X70B 4G6AD 3G08A 3VFTB 2ADIA 3TEUA 3VW3L 1SYVB 4RBPH 2VDOH 2IGFH 4XNZB 3OKNB 2R1YB 2EC9T 4R96A 2EIDA 4S2SA 3BH9A 1AQDA 4FN0A 1BX2A 1G7PB 2ZWLT 4Y5VB 4PRAA 3FHQA 1SY6H 1G7JA 4BQ6A 1EDQA 4FABL 4DVBA 2NW2B 1ORQB 4I48A 1Q9OB 2FGZA 2B1HL 3PABB 3SY0A 3V0VB 3FO9A 4PGBB 1FP5A 5T5NG 4GMSL 5ITFB 4NNYB 1IKNC 1QNZL 1AO7A 4KUCD 3SPVB 1FGVH 1JK8A 3NFPB 1JGVH 1NCAH 5L6YL 3WKNA 4NO0A 2XZQH 5GRUH 4K8RC 4LARH 1G9ML 4RRPA 2NW3B 2GSGA 4D9LL 1IGMH 1FRGH 1MHEB 4K7PL 1DN0B 2AJUL 3TP4A 2A9NL 5ESQB 4ZFFA 3EYUH 4DK6A 4PV8B 2OL3H 5I1DB 4OFIA 2D7TL 3W39A 3BYTA 5F1SA 1KGCE 2IBZY 2VZSA 3ZO0A 4NUGH 4PRPE 5DD6B 1OM3H 3S5LB 5HYJA 2APVA 4MJ5A 1T0MA 3RTQB 2X4TB 4FQPA 4PJ8C 1E28B 1J87A 1HNFA 5I1LB 3HC4H 4OCYL 1CG9B 3BVNB 5CGYD 3J7HA 3UTSE 5ISZE 4OLYH 2EDKA 1X44A 2ZUWA 4M7LH 4P2CG 4PRNB 3QEQB 3KVQA 4R26H 1LEKA 1FH5H 3ZMRA 2ERJB 4X4ME 3L7EA 1MCOL 4BA8A 2CDGB 2HP4A 3SE8L 1CT8A 3TA3D 5HGAA 2AV7B 4M6MH 4QNPF 2Y07L 4FFZL 3I75A 4UINL 2EEDA 4PLKD 2VKWA 1J8HE 2FEDC 4M48H 2DQDL 1Q0XL 4OB5L 1NCNA 3ET9F 5DMKA 4QRRE 3UROR 2HFGH 4UV4L 8FABB 4K23H 3LSOA 5A2JH 3BP4B 2BFVL 2F5BH 3F7VB 5DEGA 3MX0A 1JMZA 3WS3B 1HH6A 4FQIL 3STZA 3NZ8B 2EDLA 1ND0A 2GAZA 4I0PD 1G6RL 3TJHC 4P46A 1C12A 4KRLB 4PJEE 4U1LA 3X14A 5SX4I 4Y5XA 2F5AL 2Q86A 4KQ3H 1GC1H 4GXUM 2GYSA 1MJUL 5HDQH 4YZFE 3VD7A 2VITA 3L3OA 2IANB 2GW5A 1BWWA 2D0GA 5J3HC 1PG7L 2IPUK 5BRZB 5DC4B 2FJFA 2X9YA 4YHZH 5JO5A 1HI6B 5HVHC 4JRWA 4YHML 1FCCA 1DL7H 2NLJA 1VFUA 3LMJH 2OI9B 1MWAA 2VLJD 1YY9C 4H1LG 4WGWB 1A7QH 4JFPB 3ULUE 3MV8D 1A0QH 1HSAB 1UWEL 2VE6B 1I7TB 1C5CL 4O2FA 1YEEL 3DURA 1OQOA 5GS2H 3SDXA 1Y6KR 4CVUA 2HVKB 3U0WH 4YBLB 1T0PB 1BJ8A 1A5FL 4PJ9C 1YMMA 4D9RD 1BIIA 2J88H 1U6AH 5IB5B 4KI5C 2COQA 5JQ6L 3S96B 2DYPB 1FL5A 3RL1A 4NQSB 4YQXL 3F58H 4IHOB 2R2CA 4LSQH 2J8UA 2PR4H 3EJZD 4F9PA 5LCVH 1H8NA 2X4NB 4NYLA 3G9AB 5AD0B 5ALCH 2V17H 3FQRA 1YNKH 2BOBA 1ZVHA 1VFAB 5DDHA 5D96C 3BE1L 3I50H 4X7TA 1LEGA 5DJCB 4K71C 4OQTL 2IBBA 5DR5H 3IF1A 3AB0C 5C9KA 1D5BA 3QISA 1ZTXL 5IIEB 2AKRA 4M61A 2V5MA 3DV6B 2QADC 1EAPA 2C3VA 3CXDL 3BP7B 2R0LL 2OR9L 1ZWIA 2FX8H 5FYJE 4LMQI 3R06A 1IEHA 1R5WB 4YIQA 3SDCB 3WHXB 4RFOL 4LCWA 4C56A 5LAXB 4HWBA 2CIKA 3P4OA 3LD8B 5F89A 3K4DA 1BBJA 3MV9A 5HHQA 1NEZB 2BVPA 1J0HA 4OZFA 4CVZA 1IRAY 4MXQD 3U4BL 4NC2B 3L3DB 3CC5B 1FG2B 5KS9A 4MNGA 1XCTB 2CO7B 4AT6B 4OD3L 4UIKH 4GAYB 3EAKA 3QPXH 2XACC 5FUOL 3CPLA 1W0VB 4L1DA 4M8QB 4Y89A 4MJ2A 4LLYA 5ICZA 1H5BA 3MC0A 4NO5A 4I3RH 1B0WA 3MRPA 4JZJC 5EBMA 3ULVL 3BH8A 5D7IA 4K3HA 5KVDH 3LPGA 5CD5D 5EUOF 5E8DH 4HULB 1OT1A 1WZMA 4MQ7A 1U8MB 1A6AA 4TSAL 1R6VA 4OF6A 3MUHL 4IOIA 2HLAA 1KEML 2ICEA 2YSSA 2JJWA 2P8LB 3T3ME 4PJ7A 4ODXA 4PJBB 1T22A 5F88B 3FZUC 4P2OD 1MFAL 4MJIB 3M1BB 4Z95H 3EYFB 4F7PB 3VWKA 4GJTB 4UB0H 4S0TD 5GGRB 2EDYA 1UM4L 3DRQA 2UY6A 2XI9A 4XI5C 1FIEA 3WO3B 2VDLL 1F45A 2EXYD 3QXVA 4L3CA 3ARWA 5HI3D 1VPOH 3VXPA 1LK2B 1ZVSB 3KJ6L 1NMCC 5C1MB 3IFNH 5JLZB 4TTDD 5HD8C 2AP2A 2R1XB 4O58L 1G7HA 2ICWJ 2J6EL 2JCCE 2Z93A 3OF6D 3ULUH 4HGWA 4X7SH 1L7TL 3RVTD 4KRPD 4X6CB 1GGCL 3U0TA 4KXZH 2CUMA 3L5WB 1I8KA 3SJVD 2XICA 5CIPA 4JAMB 5KAQF 1LWRA 4PUBH 4LVNB 4JO2H 2CRZA 4JHAH 3NBNA 3Q6GH 2NY2B 3TA3A 4TVSa 4UTAH 3O2DA 2H45A 1LP9B 4K3JH 3LPWA 5FFLA 3C8KB 3O6LH 3OKYA 3ARGC 1J7VR 5ERWA 3J8F7 5FYLD 1UZ8B 1ZS8A 5SWSE 4HMEA 2Z31C 2VDMH 2ILLA 3TVMC 4X5WA 4M3JA 1U3JA 3VJ6B 1R5IA 1P84J 4A6YL 4IMKA 2C26A 3FOMB 4ZAKC 3GK8L 4I0PA 1C8PA 5I8KL 3U2SB 3RA7L 4FQXB 4X6DB 3WIFA 4D0DB 1AE6H 3NIGF 4GG8A 2LFGA 3GKWH 2VISA 5FCSH 5TFSL 4GKSA 2C1PB 4M1DL 4Y19E 4WI2A 1QBLL 5JOFB 3GSRA 4JFZL 3CFEA 1L7IL 1FYTE 3EKCA 2MKLC 1P4BH 1KEGH 1K2DA 2NYYD 3IJSA 3LRHA 2W0FB 5HYEA 2FATH 3BKJL 4NQXA 4KJYB 1NL0L 5HHPB 2OYPA 2JJUA 2R29H 4K2UH 1Q1JL 1MVUA 4JZOB 3ZKNC 3L1OL 4LLWA 1LE9A 4U1HB 1OVZA 3MV8A 3SKMB 3T0EB 1GIGL 2HFEA 3EFDH 3P4NB 4TOYH 2R4RL 1YNLL 1D6VL 2OXHA 4LLQA 3QIBD 1WF5A 4OCRH 5E7FA 1R3HA 1J5OL 3P30L 2FH8A 3ZSSA 3IDYB 5CEYB 4DKEH 1ZANL 2R0ZH 5FUZH 2PYFA 1FPTH 5EORL 1JRHH 2E6JA 1UFUA 4N0UB 1TTUA 3OAYK 1QFWM 3VWJA 4L3ED 3PWJB 1UC6A 1ZE3C 4G6ML 1IQWH 3BEVB 3O6KL 5D7JC 3RVVD 5CINL 3SKOA 3ZTJG 1BREA 3DARA 4AL8L 2EH7L 4L4TE 4PJAB 2BDNH 4Z7NF 2C4FU 3T4AA 1RU9L 5BQ7B 1A4JB 3QXDA 3DVIA 1F2XK 4LLUA 4O51B 4P2YA 2R39A 4MVBD 5C9JA 1V3JA 4J3VA 5JW3L 4I18C 2I27N 4OZIB 4HH8A 4CAGA 4CN6A 1A2YB 4ODWB 1J11A 5DJAB 2CDFA 4HWEL 2P8PB 4KI5F 4BSWA 4U1JA 5EZJA 5F3HA 1MSPA 4IOFD 3WD5L 1S9WB 1WCBB 4D0BA 4NBXB 4NUJA 4MXVE 2VZUA 3VXMD 3HZYA 1NDMB 3PIQA 4NCC1 4YWGH 3RRQA 4QHUB 5CEXA 3D39E 1MVFA 5I8OL 4Y1AB 2G75A 4H20H 2G5BB 3DTXA 3TESA 1YPZE 1R24A 1U8QB 3BIAX 3OB0H 3GIZL 3V6FA 2J2ZA 4ALAH 3G6AA 2VAJA 2PW1A 3IJHB 3VXRB 2E7LC 3CCHB 4NRXB 5IB1A 4E41D 2HG5A 2EIZB 5MEPB 1YN7B 1V7ML 1GZPA 5E6YA 3QXAB 3PWVA 2Y06L 3ZDYE 1OAYL 4Y5YA 4U7MA 4MDJA 4H5SB 1RZKC 1I1YB 1KCVH 2EDRA 2OZ4L 3U6RA 2DKUA 5MENE 3HAEH 4IM8A 1M05B 1FVCB 4IMLA 4EI5C 2I25N 4NRZA 2FJHB 2V5TA 2HH0H 1TVDA 3BFOA 5FGCE 4L3AA 1IEAB 3B2UD 5EZLB 1I3RA 3A6CH 1A14L 5B4MC 3VFPA 1KTLB 4AEIL 1YECH 1EJOH 2ZSWA 2QHRH 1BJMA 4P23D 4MD4B 3DV4B 4OCLC 4EEEA 2ZG3A 3TPUA 3EOYG 3OWEA 1MFCL 1NGQL 1IT9H 1BLNB 4JKLA 3GSVB 4GUPA 1UVQA 3FQWB 1BJ1H 3JWOC 4HT1L 3TFKC 2F74A 3JV6A 3SQOH 4YO0A 2VIRB 1AI1L 5T1LD 5EPMA 3BIKB 3VFNA 2UWEE 1VFOA 2Y6SD 1MY5A 2OJZH 5BVPL 5EZIH 1JF6A 3V8CA 1CLYH 2AJZB 4OZ4B 3UO1H 1KN2H 1NQBA 2A83A 2VRAA 5I1IL 1RUML 1FBIL 5GXBB 3I2CL 2AEQH 3SJVA 5M95B 3KWWA 4ZPTA 3BUYB 4PGCA 4ONHB 4ZS7L 2XTJD 4WDIB 1BZ9B 4XPGL 4DJMA 4OLZH 5JR1H 4PY7A 3FFCB 1WLHA 3MRNB 4U1GB 4KK6D 1YY8A 1H8SA 3AU1A 5I30L 4M7JH 2X4RB 4NSKA 3RZCB 1M7XA 5IVOA 2FB4L 2M26A 5HPOA 5B21A 4GBXD 3IDXH 5GGSB 5GPRA 3OJMB 3OAZH 1DLHA 1DBJH 1P1ZB 5I16A 3S5LG 1N6QH 4OLXH 4KKNA 5DD0H 4ELKB 5IQ7H 4YDJB 2AEIT 1VKXB 1AFVL 4UTBH 3PF2A 3ARFB 4I0CC 4O5LL 1V3MA 1PQZB 1E4XL 3WS6A 4CMHB 4ZXBB 5GSRA 3WCYA 1XIWC 3VFWA 4U6YA 4OTXL 3GIVA 5EU3A 1ED3A 2AJVH 5HGAB 1J1XL 4GW1B 1XGYL 4JKPH 1KPRB 4LGSB 4MJ6B 3MLXL 4B53A 1LK3L 3G9VA 5D1QD 4GAGH 1CVRA 2W0PA 4LLDB 2MHAB 4LK4A 4AH2B 3EYVA 1U8LA 4JPVH 5E9DB 2VLRE 4I2XE 5DVOA 5GRVL 4G9DA 2DD8H 4H1LH 4P5MB 2F8XC 3MSPA 1ND0B 4JLRB 2XN9E 5CILL 3BP6A 4XVUC 4QRPD 4F15C 2KKQA 5IROA 4KK8D 3B5TA 3QIBA 4PRHA 1B0RB 3C2SA 1T2JA 2YA2A 5D2LE 1QSED 4UNUA 1G9NH 2DJ4A 4F37F 3E3QC 1VGKB 1QSVA 3BGMA 3QULB 4G8GD 3NIGE 4RGNC 4JVUA 3U1SL 4OF5A 1UWXK 3FT4A 1FDLL 4L3EA 3L3KA 5F7EH 4QHKJ 2BVUA 3ZDZE 5SWQA 3RUGE 1LD9B 4X0KB 1P7QD 5BCAA 4GKNA 4Y2OA 3EDJA 3PDOA 5DFVC 5D7KE 3ESVF 1FHGA 2DQTL 4HSQA 2D03L 3K4AA 4OKDA 3VXUD 1S7XB 2GTWA 3HZMB 4KHXL 5T5FH 4J1UB 3MLRL 1OB1B 4JFHD 1NGWB 3MODH 2NY6D 1E4KA 5JXAH 3FN3A 2X7LB 2IGFL 2CKBH 5C0CD 4XP4H 4JN1H 1MF2H 1ADQA 1R3LA 5FYKD 2H8PB 3VXMA 2AERT 1SY6L 3H3PH 3FO2B 4P0DA 3E2HC 32C2B 5IF0B 3KPSB 5IQ9A 1NCWH 2IQAB 5EN2B 4KFZC 3UCRA 5I1HL 3U30C 1AXIB 1FGVL 4OT1H 1JGVL 4W6YB 1NCAL 4X98A 3TWCL 4E41A 4M4RA 3L5XH 3MACH 1NFDE 1ZHKA 3N9GL 3FQNB 3G6JA 3QXUA 4C54A 3T0XA 2Q8AL 4KMQA 1ES0A 4XX1E 4BFIB 2EKJA 1HXYB 1YEFH 3KXFE 2DLTA 3WYRA 2Z4QB 5KJRL 5D1XC 2GIYA 3HUJB 5F89B 1C7SA 2OLDA 1LGVA 4LRIC 4ZODA 3UTTE 1F90L 5C0BD 1ZOXA 4WV1C 2EYTB 4M1GL 4KI5E 1U8IB 2Y72A 4NUGL 1NSNH 3OKLA 3S7GA 1OM3L 5E8OA 1NEZG 1F11B 3DUSB 3O9WB 1J9CT 5IHBA 2V5RA 1Q8MA 1QQDB 5HHXH 3VD4A 2QQLH 2YD9A 1I9JH 1Q72L 1EXUA 3ZKMC 3NZHH 3L3GB 4Q9QL 4M7LL 1NLDH 4IRJD 2VAAA 3LRGA 4OI9A 4P23A 1R3IL 4BH8A 2ARJQ 1ZEAL 2X05A 3QNZA 1FH5L 3BPNC 3MOAH 3O3EB 2WV3A 4K8RH 2Q6WA 2XWTB 3O4OB 3WV0A 5D72H 4M6ML 2X4PB 1JPGB 3ROLA 4DUVA 3QUZA 4JGJA 5T3XL 4H88L 1IAMA 3B3IB 4PJGE 1JUFB 5T1LA 1A6VH 4IOIB 4PJXA 3BO8A 4ZSOE 2FHFA 3TCLB 4Z77B 5IB2B 3BP5B 3MGOA 4WO4B 1T83C 4WUUB 3IYLW 4PJ7B 3OAUH 1S7VA 4X6BB 1T7ZA 5A2KH 3KPNB 4J3SA 1NKOA 3VWKB 5EUOA 4PYHA 5F9OH 3CXHJ 1KUMA 3CLEL 3QUXC 4OV5B 4NC0B 5E6ID 1J1OL 4A6YA 4L5FL 3GJEB 3SGEI 5KG9A 5IMOA 5CBAB 5C0AE 1QKZL 1TVBB 25C8H 4ZO6A 4G6JL 3T3PE 1RVFH 1UG9A 4FTVD 5JNYA 2NXYC 4WFEE 5HDQL 1WT5C 1WZ1L 2IPKB 3JBG7 4LP5A 3W0WB 3GSQB 2G2RA 5JPNB 3V5KA 2F53B 1DL7L 4JJ5A 3WN5A 3NH7H 1FFQA 1JNHB 3P73B 1RHHB 4Q6YA 4NQTA 3U79A 1URLA 1A7QL 3BD3A 1N5AB 4NRYA 5SWZD 1A0QL 2ITDA 2BNRE 4D0CB 3IVKB 2ED8A 1UEYA 3VG0L 5JIPA 4EDXA 2J88L 2B4CC 4KKAD 5D1QA 4Z7VB 3QNYB 2BNRD 4Z7WE 2XQBL 3SE3C 1QEWA 4HH9A 4Q97A 2Q76A 2DMCA 3RI5K 3F58L 2HYMA 4YC2B 1KJVB 4R7NB 2PR4L 4TSBH 4KY1L 1Z5LB 4B7IA 5LCVL 2DLEA 5SX4H 3WDHA 3N1MC 2FHBA 4P2QB 4U7SA 1YNKL 3HMXH 4QRPA 2YPLB 3AS1A 4EXKA 1CE1H 1GGUA 3OPZL 1MH5A 3WLBA 5I17A 3IJYB 5E99H 3I50L 2SEBB 2OQJB 2DLGA 1QSEA 2VLKD 1A47A 1K5NA 5I66A 3CZJA 4AENA 4NKIH 1REIA 4MZ3A 1WFUA 1AXTH 1CFVH 1YYLL 1K2DB 5HD8D 1N59A 4AEFA 5DTFB 4Q2ZA 4HG4J 2FECI 3IDJB 1YA5A 1P7QA 3QO0B 3DX8B 3HR6A 2I5YH 3C5JB 5K9OA 3ZTJH 3VXUA 3B9DA 3RY6A 5DWUH 2GITA 1KJ2B 1H3UA 2P49B 1YEDA 1TVHB 5DQDH 2CRYA 5J12B 1S7WB 2J5LC 4JM2B 4NIKB 5IR1B 5K9QI 4E0RA 3LDBC 1I7RB 3LKQB 3GMRB 4QGYA 2DIJA 5GS1C 4KU1A 4R4NC 4M00A 3WJLA 5C07B 3QPXL 3M45A 4BKLA 3G5XB 2YS4A 5C0CA 5J6HB 2CLZA 5IJKC 5C0GA 3UZQA 5MP6H 5IMKB 3IGAA 4O9HL 1PW3A 4HUVB 4HC1H 4QRTA 4K3EH 4HX1A 3P77B 4OAWB 1Y6NR 4XNQA 3KYMA 4OIAA 4Y16C 4NZRL 4Z7OE 4HXBH 4QOKD 5EUKB 1GGBH 3W9EA 1RUAH 1RFDL 3ZE2E 5C3TA 5J57B 3KPRE 5HHVH 1J0YA 1R3JA 3VXTB 2ATPA 2VLMD 1B6UA 2CSPA 4FOMA 1L6ZA 4Z95L 2HJLA 4HPOL 4WHTB 5F3HB 5IEHA 5FA3B 1VEMA 1RIHH 4OF3A 3WHE0 4YPJA 2C7UA 3H9HB 1XCQA 3EGSB 3PL6B 5M7QA 2NY3C 5I6XB 5C0BA 5E08H 1EEZB 3G5VB 1FNGB 4Z7QF 1JGUL 2P45B 1GZQB 3IFNL 2HMIC 1N64H 5KSBB 5HDOA 4HK0A 4ZFGH 4YBHA 1NC4D 3DGGA 2A6JA 3ULUL 3DMMB 4FP8H 1MCPL 3LQZB 3KHQA 3NTCH 4PB9H 4X7SL 3OG6B 4IRJA 4NGHH 4JHWL 2V7NB 2ADFH 4NO3B 4HCRH 4NNXB 2R1WB 3VGAC 4WWKC 4APQD 1HCFX 1PKOA 1EEYB 1OSZA 1R5VB 3QIUC 4PUBL 4JHAL 4CNIB 2WWKO 4UTAL 1JV5B 1DN2A 3C5ZB 2OTWA 3TF7C 5DMGD 4K3JL 2C1OB 3CDYA 1AD9A 3O6LL 3ARRA 3BW9B 4R4BA 4NQEE 2HVJA 1MLBA 3LOWA 4L4VE 3QDGE 4HS8L 4W6XB 4Q9BA 4WTZA 2ADGB 4KWUA 3VFMA 4UDTA 5T1KA 2X1XR 3L6FA 2R8SH 4HWZA 1KCRH 1QFUL 4RIRA 2DTMH 2CIIA 1MRCH 4D9QE 1RZJH 1BHGA 5K9KB 2BERA 5E6IA 5JHDE 2IH1A 1SYSB 2V2WB 5ETUA 2C3XA 1JPST 2FZ3B 2VH5H 4ZS6C 5FYJL 4OKVA 3VA6A 2A2QT 3Q3GB 2NTFB 1BD2B 1FFOB 1QFPA 5FF6A 4G3YH 1DVFD 4XP5H 3MRGA 3L3HB 5EU6D 3X3FL 4WWID 2GK0A 4HV8B 4KJWC 1C08B 4JQXA 4LOUC 3VGBA 3VI4E 4KUZL 5TE4H 2A83B 2FATL 3LKOB 1NFIB 1KB5H 3LKNB 1DP0A 2WUCH 1NBVL 4HWUA 3ES6A 4YR6B 1UXSB 1U91B 5SWZA 5EU4B 3RWIA 3KPMB 2GQHA 2I07B 4O02H 4X8JA 1I75A 4X9HA 1CGSH 5F7DB 3WUWA 2F8OA 3TT3L 4LSPH 2XRAH 3B9KA 4P4KC 4NC1C 3THMH 4YUEL 1G6RB 3CFKB 2R0ZL 4N1HB 1FN4A 1TTFA 5E00B 1FPTL 5DRNB 3E6HB 3GO1H 3TIDB 3F7PC 2A9ML 4ODVL 2V7HA 3QUML 3LKSA 5J13B 5IT2H 3NFNA 3GGWA 5LKNA 1JWMB 1TJHH 3V4PH 3MLUH 3JSSA 4P9HL 5EO0B 5HDLA 1CXKA 3QFDB 1UKSA 2BDNL 2XFXB 4JY5L 5DURB 1HQRB 3ABZA 4YBQD 3NACL 1K8DA 3QG7L 1MI5D 1ZA3A 3X11B 3WNLA 2NY4C 1DBAH 4GKZA 4N90E 1S9VB 3TFKD 4MJIE 2VZ3A 4JANA 4WHDA 1YQVL 2HWZH 3PP3K 4F7CB 5GS0C 4GRWE 4ZO7A 5B3JF 1BFVH 3MGTB 4H0HB 3PXJA 4TTGA 4S1DD 4PGZA 3GNML 4G9DB 4BUGA 3REVA 3HPJA 4J12A 1G0DA 3FQTA 3O4LB 3KNBA 1WBYA 4LIQH 2V2XB 3HG1B 4Y2DD 3CVHL 1WITA 4PREB 3H7BA 1MCEA 1RZGA 4ALAL 2NX5D 3U46A 1KJMB 4PJCF 5DJ6A 1FVDB 5D2NB 1OP5K 1P84K 3O3AB 1CE6B 1CCZA 4QHLB 1Q9KB 3WNPA 3SO3C 1LO3H 1YEIH 4HFWA 4TNVK 4WTWA 1OGTB 5K9QG 3D85B 3U7WH 3K0WA 3H8NA 1UH2A 3O8XD 3SDDD 1RMFH 1H15A 5I15H 1DLFH 4FQ1H 3Q2CA 1KNOA 2HTKC 4TUOB 3VD9A 2WAHA 2HLFC 1S7UA 2HH0L 1KF9B 2OL3A 5IHUH 1WBXA 3T0WA 3A6CL 5ICXB 4UQ3A 4YH6A 3KYKL 4QRQA 4OF8A 1RZ8B 1W0WB 1YECL 1KC5H 1JNNL 2QHRL 3F6LA 5GJSH 2XY1A 4GRLD 2DQFA 3TYFA 2PETA 3X3GL 4G80A 5HI5D 2D7PA 3VXSB 2YHGA 3OBAA 1XF4B 2HJFB 1HILA 1KPVA 3K4ZA 3TBTB 1TIUA 2CLRA 3E3QE 4Z7UF 4L8BA 1NC4A 2A1WH 4RGNE 1B6DA 5IVXA 4GG6E 5EZIL 4KGJA 5JUEL 4M5YH 1CLYL 5K9JL 1K4DB 3ZT6A 1JNLH 4MQXC 4OGAC 3IS0X 4QT5A 3ARQA 4BQ8A 2Q3ZA 2Z91B 1KFAL 2AEQL 2R2BA 4YHLL 1YJDL 4PG2A 4APQA 3B6SB 3ZYIA 1L9NA 3O3BA 1DQDL 3G6DL 3HNSH 4LSSH 5JR1L 2NY0C 5J6GA 1WAAA 3ZLQC 4ZFOL 5BXFA 9CGTA 1PKQE 4PV9B 1HHHA 1AR2A 4OSUH 3ZHKA 3BKCH 1AGFA 4DCQA 4JFOA 3IDXL 3HRZA 2VXUL 1DBJL 3MV7D 5DD3H 1EO7A 5EWIL 1N6QL 4KKCC 4BZ1H 3JWOH 4UIMB 1GVIA 5CP3H 5DD0L 2XNAA 5INDB 1E6JH 1MREL 5LXGH 3W11D 3W5NA 2BVYA 2D2OA 4UTBL 2KPNA 3RDTD 4MAYC 1KLUA 3AS0A 1WTGT 3MLYH 3MROA 3QEHA 1WWCA 1MAML 4BH7A 2MQCA 4LHUB 4XBEH 5E94A 1JE6A 2AJVL 4IRSB 4GRWH 5D70H 2MSPA 3JUYA 1VESA 1HZHL 3P11H 3QQ4A 2DWDB 3D69A 3I6GB 4F7EB 1KT2B 3MV01 3SDAB 4OFYD 4YDLC 1DVFA 4GW4B 2X2YA 4XPAL 3BKYH 4UT7H 3PGDA 1MJJB 3LIZL 5EU6A 5DJ2A 5EOQH 3WXVL 4XMKL 5CD3B 2YPKA 4S1RH 1X4ZA 3QDME 1T03H 1LHZA 4JPVL 4X4ZA 3WFHB 4KJQD 1HEZB 2GT9B 2ZUQB 3V0AC 1KTDA 4Z76A 5H2BA 2DD8L 5FGBC 3P0VH 5J11B 3FRPA 2QR0B 4UT6L 3QDMD 3WDJA 5I18L 3D2UB 4JQIH 4UU9B 3IXAB 1BEYH 2O61A 5DUPH 2J12B 3GB7A 5JW4Q 4XVSL 4Z8FH 1I8LA 2A38A 4Z0BH 2BP3A 5FV2A 1YNTB 4CRPA 1A1OB 1H3TA 4G6FB 4UMGA 3GRWA 3SOBH 3DIFB 5DK0B 4LASL 4YK4B 2PYEE 2B7DT 2EDQA 3MLWH 4F9LC 2QQNH 1BFOA 4JY6B 1L9MA 4NKMA 4UNVA 4GSDH 4WI7A 2X4OA 3EOTL 3V7AG 2APXA 4PGDA 3CSBA 5DEFA 2IPTH 5JMRA 4HUXB 1MI5A 1ZLVK 2MQ3A 2DWEA 2QL1A 4WFGD 3RWHA 4PJIF 4XVTH 3MOBH 2LE9A 4QO1A 4I4WB 5HGBA 3MODL 3H6JA 4DGIH 1JWUB 1SJHB 3B8SA 3KJ4C 1T1XB 2IPUG 1TQBC 4BZYA 4OD1L 1CICC 3LHPH 3QI9D 2VL4A 3MYJA 3UJIL 5HYSG 3BPOB 5C08D 1NCWL 1A6UL 4Y2DA 3AREC 4XVJH 5MERB 2BSTA 3PWNB 2NX5A 3UX9B 2FBJH 4V1DB 4OUUA 1W72A 1BWMA 3MZGB 4RAVB 3OHXA 3WJJA 2EECA 3L5XL 3G5ZB 1YC8A 3MACL 35C8H 4ODTH 4Z0XB 2WINA 5HGHA 1MIML 3GM0A 4MD5A 3CLFH 4F2MB 1O0VA 3WO4B 2VUOA 3BEWB 3MLTB 3NGBB 5K9OB 3O8XA 1QRND 3SDDA 2D4FA 7CGTA 2FD6H 4JFXA 4XP1H 1FIGH 1U8HB 3WUZA 5B3JE 2FIKB 1RIVH 4AMKH 1ACYH 1JZ7A 1VGEH 4HXAH 5FO9B 3V79C 3IDIB 5BS0D 1E4WL 1NDGB 4CU8A 1G1CA 2DKMA 3HE7C 3QJHB 2QQLL 5F3BB 1F4XH 1I9JL 4IJ3C 43C9B 4RMVA 4H8WH 3FOLB 5HGDB 1HYSC 2IQ9H 1N4XL 2O5ZL 4GRLA 2D7NA 3GSXA 3IGAB 1BZ7B 3SE4C 1TZHA 1EGJH 4JRXB 4K8RL 5GZOC 3M8OH 4DZ8B 1RUKH 5GRWA 5D72L 5LG1A 4HBCH 1CN4A 4OZHF 5ICYA 1IGCH 2BOCA 3SBWC 4BFGA 3DXAB 3QP3A 1I8IA 2YZ1A 1A6VL 2H9GA 3QPQC 5BO1H 1HHKA 1T5WB 5IG7A 3I84A 6FABL 1VA9A 2X1OA 5T33H 3LB6C 5HXMA 1F6FB 4RQQA 3MUY1 1CGWA 1T20B 4P9ML 3V5HB 3C6LD 3STBA 5F1NA 3QDJD 1U58B 2HJLB 3LN5A 5E4EC 5F9OL 3KPQA 5GGTH 5L7XH 3H42H 1VDGA 4P3CL 4PJDF 2VN4A 2ORBL 1PYWA 1MRDL 2NZ9D 4MB5A 5LBSH 1ZT4A 4OD2A 5L0QC 25C8L 2CQVA 5CJOH 1RVFL 2D4DA 2KDGA 5TDNA 3MV7A 1FZJA 5MI0B 4HS6A 1YYMH 3HNVL 3P9LA 4Z5RB 4F33A 3DVGA 2DQGH 3RDTA 4N68A 2ICES 4XB7A 4JFQB 2IFFH 3I3EA 4UI2A 3F5WA 3EBAA 2AK1H 4AIZA 4FS0A 1S7SB 5DRZB 3KLHC 4KK5C 3KYNA 3PWPD 2BCKB 4Y4KD 4WJ5A 2OTPA 2CXKA 4ZUUA 2NR6C 5GGVL 4KDVA 4R4BB 4LKXB 2HVJB 4OFYA 5IMLB 1N3NB 3NCMA 4L29B 2WBJC 1YEKH 2UZIH 5E5RB 3KYOA 5JQHC 3C9NB 5JZ7D 1N0LA 3P0YL 1LILA 3ARBC 5T1KB 4MLSA 1HK6A 1NGPH 5EU5B 1MHHA 3FKUS 4OFPA 1CR9L 4ZUTA 2LTQB 3HMXL 2AQ1A 1OAXL 4JPKL 1CE1L 4I5BB 4KK9C 4LBEA 1P69B 2Y5EA 4JKKA 2BVQB 5CSGA 4IIQA 4FFWD 1R0AH 2XWJB 4NKIL 1SQ2N 1AXTL 5GGQH 1CFVL 1QYGH 1F3RB 4ZD3H 3MLVH 3LH2L 4F58H 5I1EL 4ZDHA 4I9WD 1A6TB 4WFFD 5D5ME 3QSKB 1QBMH 1SMAA 2QEJA 3OXSB 2I5YL 2A74A 3BQUC 2FX9L 5L2KD 4JEGB 3DRTA 4NN6C 1KYOJ 3PHSA 1UJ3C 4GXVH 2CJUH 4WCYH 5MEQB 5DD1L 4QHNA 3RNKA 4JFEE 5HHOD 3VDBA 2DBLL 2NXZD 2RHEA 1SJVA 1AR1D 2QLVB 3IXTB 3D0VB 4XCYB 3U48A 5IBTL 3STLA 1PLGH 1G7QB 5HPMB 2HKHL 3BZDA 4FZEL 4U1MA 1RJCA 4XHJD 2BHYA 1VACB 3ARVA 3TN0C 4RAUB 3IDUA 5I9QB 5MP6L 3NCYP 3MRKA 2ESVD 5C0RH 3TNNB 4QYOB 4EQ3A 3CFBB 1AY1L 1FFPB 1GGIL 3QI9A 4DZBA 3L3JB 3GSOA 2ZCLH 2V5YA 3CXHK 1DQQA 4XC3H 1A6WH 5C08A 3OKKB 1A02N 3GSNL 4GRMB 3NVQA 2DLFH 3ECBA 4R2GB 1ITCA 1XR9B 4HXBL 3PJSB 1J88A 1A21A 3WBDA 3T1FB 1ZLWH 1GGBL 4LVNC 4D2NA 5DC9B 1G7LA 4MDIA 3RU8H 3UBXB 4HIEB 4MX7B 5HHVL 3AMLA 4HUWB 3UTOA 2Q87A 5IFJB 2ZCKH 2YD8A 2VDPL 5EBGA 5TGBB 3D3VE 3IDMA 4LPYA 5CUSH 4YNYA 3QCVL 3REWA 4G8IA 1RIHL 3NAAL 4RCAA 4P99A 1EIBA 4LPWA 4LDLB 1QRNA 4R97C 2BNQE 5E08L 3BXNB 3IU4L 5DMIH 2HRLA 4NC1E 5F9WC 2CUIA 3DVNA 5BS0A 1IE5A 4LFHG 2W9DH 2JB5H 3V7AE 4ZFZB 2BVOB 3U46B 3NTCL 4PB9L 1I1FB 1AHWA 2OSLA 4CDGC 4NP4L 2H6PA 4WW2B 4LSUH 4HCRL 3I3DA 5DGQA 2ATKB 2RIKA 1CLZH 1ZHLB 4ACPA 3U36A 1I8MA 2XA8H 2XOTA 4HUUA 1YUHB 3DUUA 1FZKA 1KJ3H 5AG8A 4OZGB 5I0DA 2FWOA 4MXWL 5FO8A 1P9MC 1D5MB 4NQVB 3LQMA 2HT4C 4PJCA 4JQVA 1A1NB 1NCDH 3T2NH 1F8TH 5E95B 5LGHH 5C0FA 1HHGB 5DJZB 1DZBA 3QUYB 1T1ZA 3MRJB 2X4SB 2RFXA 1E4JA 1MFBL 4Q6IA 4PIRF 5E03A 3C6LA 4TULH 4L9LB 3QDJA 1KCRL 1XH3B 4XAKE 4HG4K 4C83A 2V9TA 4YHOH 1A3QA 2AGJL 4HKXA 4JFDA 2EDNA 5T3ZE 5I1AB 2VN7A 4XCNB 2DQFB 1U8OA 4JKMA 4UQ2A 1UZ6E 5IFAL 1VCAA 2GTZB 2F19H 2IFGA 5FM5O 3D25A 2MMXA 5HI4C 2VDQH 3V5DA 3DETC 3NPSC 1H3PH 3WE6B 4G3YL 4XP5L 3QA3A 5CJ5A 2QSCH 3OKOB 5B38B 1T21B 1NGYA 3TO4B 3VG9B 4KV5E 2PUQT 3DX9B 3QIWD 1KB5L 4QCIA 3ARXA 3MREA 1IAKB 3NCJH 3ARPA 3D39A 3PWPA 2DAVA 1BVKB 2GEEA 4Z7UA 2JTDA 4YX2L 4Y4KA 3ZE1E 1FZOB 1ZXQA 5D6DC 2PO6C 4ZTOL 1IGJB 4H1LA 3TGXA 1BF2A 2KL6A 2XRAL 4LSPL 4F57L 3HTLX 1IMHC 3EYQD 2QKIB 4KROD 3THML 2F54D 2D31A 2VNCA 4MA1C 4PJHB 3SCMC 5JA9A 4PJDE 1TZGH 2GY7B 4UDUA 1IC5H 1BP3B 1OAUH 1D9KD 2LVEA 5IT2L 1DANU 4N1EA 1EX0A 4AG4H 1NBQA 1TJHL 5ESAB 3BDBA 3V4PL 4RISH 1S7TA 1C16B 4HIIA 1I1AD 3RJQB 1MJ7H 1FFNA 1U8NB 4UAOB 3RHWK 4LHUG 1KIPA 5GSVB 1F6AA 5CJBA 4JG0H 4NQCD 3H9SD 2VLLA 1DBAL 5FDWB 3ZKSD 3WFZA 1IGIH 5I73C 3PGDB 2HWZL 5IOPB 1ULVA 5KSAC 2YPKB 3KPLA 4R0LB 5ENWB 3S35X 3KPOB 4LLMA 3RNQA 1JTPA 2BSRB 5EOTB 4I8DA 1E4XI 1TJGL 5GGUA 3P4MA 3WFCH 3VGGA 3UDWA 4LPCA 4DGVH 2CKBA 5HHOA 3SGDI 1TPXB 5DUMH 4E9LA 1UYWH 3L3IB 4EN3B 3NIDF 3MBEB 3OXRB 4CJ0A 5F9JA 1J10A 4NM8L 2ICWB 2I60L 3QO1A 2UYLA 1BGXH 3TBYA 3KR3L 2XV6B 3MRCB 2ESVA 3A0OA 1LO3L 1YEIL 5E2WL 4NKMB 1U2HA 5GS0H 5C09A 2FNBA 3BDYH 3MRDB 1DLFL 4FQ1L 5C0EA 1M4KA 4PRPB 3UC0H 3TZVD 1GOGA 1CWVA 2P5WE 2P5ED 4ZUWB 3VXQA 2DWEB 4CW1A 1WTLA 3IT8D 1D6EB 1GSMA 5T3ZH 5TF1H 4PJBF 2VR4A 2LU4A 3UTSB 2PW2A 1NGXB 5A3IC 5ISZB 4QXTB 2OK0L 2FH6A 4LCCB 2VXTL 3ULSA 1RK1A 4NHCH 1XGTB 1P7HL 3ARDD 4HKJB 4X6EA 2FJGB 3D6GA 3QQ9C 1T4KA 2I9LB 5GJSL 5TQ0H 5DJ0A 5DO2C 4X9FA 2CDEA 1IM9B 4Y4HD 2XZCL 3UBXI 3QHZL 1OD9A 3O41A 4KVNH 2C9AA 5CP7A 4ERSH 4M6AA 2OJEB 1LO5A 4PJIA 3RGVB 5ACLA 4YHNB 1I7UB 4XH2A 3LRSA 3PHOA 1CFNB 5HHME 1J8HB 3LS5H 1P7KA 2VUYA 2A1WL 3MRLA 2EXWC 3QFJE 4JRYE 5F7LB 4X6CF 4OUUB 5FM8A 1RZKL 4QRRB 4RGMC 4M5YL 1RJLA 3MCLH 4FZ8H 4WU5B 1RIUL 3LKPA 5MEOB 4HQQH 3RQ3A 2DJUA 2NY1B 4L8SA 1AQKL 1U3YA 3DSNA 3PP4H 3QJFA 3EJYD 5GZND 1FL6A 1QR1A 2B8OT 1X7QA 1BM3H 2P42B 4PRID 1JYNA 1DDHA 5E8NB 1LP9F 5E7BA 5AZ2H 4PJEB 2AK4E 4NN5C 5DI8B 2JJVA 2E3VA 1NAKH 4MQSB 2R56H 3QHTC 5IK3B 3VGDA 1U3HB 1NGZB 3DBXB 2VR9A 4HAFA 1TQCB 1I9RL 4X83A 1X6LA 2VLJB 1AKJD 4G7VL 5DD3L 4P46C 1GRWA 3JWOL 1BBDH 1QSFE 5J1SC 1AGBB 3RUGA 5I8CB 3BAEH 4HKZB 2P48B 1KIRB 4Y5XC 4AEHH 4PRDA 1V05A 2P4AB 2AV1B 4N0YL 1WFTA 1M7DB 4X6DF 1MLCA 3E6FA 3MLYL 1EHNA 3OL2A 3C2AL 3RTQD 3DROB 2DDQH 4FHBD 4POZC 1DUZA 4YHKH 1DBBH 2G60L 2ZZUT 3WDIA 5D70L 5JA8B 4NN7B 4NT6A 4TRPH 5I75B 3VW3H 4H0GA 4ZYKB 4NPYA 2MCG1 3QEQD 3MA9H 1MQKL 3G04A 3OR7B 3U4EA 5ADOL 3RVWD 1T0NB 3QAZC 4FABH 4RMSA 3QIWA 5I71B 4MA3B 1DEEB 3I85A 3ORJA 5E8PA 4OZHA 3HG1E 2YD1A 5F6IC 1NUGA 4L8CA 1QNZH 5AYUL 5CWSA 3L9RB 2WNGA 4F9PC 4FQJL 1BEYL 1IAII 1IQDA 3MRIB 3MRQA 4R90H 3MO1B 1G9MH 5EULV 3VFOA 2AW2A 2F54A 4K7PH 4Z0BL 3WEXA 2AJUH 1Y18B 3HMXA 5TDNB 2Z35B 2A9NH 3UYOD 3M07A 2FO1A 4HW6A 4U3HA 1BQHB 1I3VA 3SN6N 3SOBL 1D9KA 1OGAE 5DJYB 3HA0A 3RWEB 3KXFA 3MLWL 4F37K 5F6HJ 1A7RL 1BQLH 2GJJA 4PJAF 1QHOA 2IMNA 1HYSD 4HJ0D 2IADA 1I1AA 1EBPA 3EOAB 2IAND 2FCBA 4M93C 2YPVL 4OZIF 5BRZD 4OCYH 2A6IB 3BD4A 1MCFA 1NAMH 4NQCA 3H9SA 3B4NA 5FA4A 2MOVA 2HJKA 4UBDC 2O93L 3SGKA 1OTUD 3U0PA 3VFSB 4DGIL 2PXYB 3ZKXB 4IOSD 3SE8H 3VXSE 5E5MB 2Y07H 1XGPB 4FFZH 2AXJA 4UINH 4W70A 1TETL 3MJ8B 4HS3B 1JBJA 4JDVA 4G6AC 4PJFE 3GHBL 2DQDH 1VFBB 1KB9J 2DYPD 4OB5H 3QUMB 3HC0A 5FKAB 1INEL 2Y5TA 5H94A 4XVJL 1LE5B 3KLAA 4P2OB 1H5BC 3QQNA 4WFHE 2CLVB 3Q6FB 3VRJA 2BFVH 3C6SB 2FBJL 4HC1A 3FT3B 3WIHA 5M94B 4M03A 4WI5A 1A6ZB 5ANMA 3ROOA 3OGCA 3BJLA 3L5JA 1G6RH 5HY9B 3MPCA 1M7IA 3FB8A 2AXFA 5FKPA 5E8EB 4RFNB 1ZGLB 3U9PL 3OX8A 2X4QA 4N8CL 2PCPA 1T2QL 1CD1A 1T7WA 4XP1L 1FIGL 1GPOL 3U7YL 3TZVA 4TVPE 1PG7H 3KPPB 5C86A 1FZMA 4YHMH 2CR6A 4MNQE 1IAOB 5EFIA 2JCCB 3BGFB 4QRSA 3AM8A 3SDCD 2DM7A 3X12A 2NR6D 2BXZA 3PQYE 1EFQA 2L0DA 3UAJD 5H35A 2P24B 1RZIA 3ARDA 2Y7QB 4MD0B 1UWEH 3CVHB 1I3GL 5DLMH 1C5CH 1T04A 3HZVA 5L2JA 5JOPE 3S9DB 3GUTB 3BISA 3OAYH 4Y4HA 1H0DA 5AAMA 1A5FH 1X5ZA 4QRUB 1EGJL 5CGYC 4LAJH 2O26U 4ZO9A 5JQ6H 2E6QA 1F3DJ 3IFPA 5DS8A 2E9BA 2X70A 2HN7B 3VFTA 1SYVA 2YMXL 1N6UA 3NPZB 2R1YA 3OKNA 5SWSB 7FABL 4FXKB 5FCUH 3VGFA 4Y5VA 5T33L 1FV1B 4OLWH 3TA3C 3V6BR 3P40A 3LVEA 3VFUB 3BPLC 1OTSD 3HAEB 4KZEL 2NW2A 3UBXG 4AM0B 1ORQA 3LEXB 1TNMA 2ZUXA 3BE1H 1Q9OA 3PABA 4X80H 3REWB 4PGBA 1D7FA 5ITFA 4NNYA 4OQTH 3SPVA 2UVFA 3NFPA 4PJ5E 4Y19B 3CXDH 4L1HA 2R0LH 4IMKC 5LBSL 5F7KC 2NW3A 2Z9TA 5CJOL 5DK2B 1MHEA 1FYTB 4BM7A 43CAB 1DN0A 4I0PC 4NQDE 4C58B 2H32H 4RFOH 5ESQA 4DEPB 1YYML 5K93A 4Y4FB 4PV8A 3ARTA 5HYQB 1EUTA 5I1DA 2FIRT 5KTEL 1TXKA 2H6PB 3VI3E 3U4BH 2HA1A 2IFFL 4RAHA 5DD6A 3S5LA 1T6VN 2VQ1A 3RTQA 1GAFL 1XGRB 2X4TA 4WEBL 2IAMB 1E28A 5B39B 5I1LA 4OD3H 5C0ND 1CG9A 3BVNA 3RIFF 1CD0A 1XF1A 1YEHL 5CEZE 4PRNA 3QEQA 4O2EB 5FUOH 3HB3D 2AJSL 2UZIL 3MR9B 4ZFOB 1CK0L 4LVOB 1JPSL 2CDGA 5TE6L 2RFXB 2NY2D 2AV7A 4U6TA 4GS7C 1EHXA 3CD4A 1G7IB 2E8ZA 5E2TL 4XHQA 4LU5H 5C0JB 2M2DA 4L4TB 1NUDA 1KEMH 3EJZC 4P5TB 1P53A 4OCWL 3VWJC 1CBVL 8FABA 2VYRE 3OV6A 3BP4A 5E70A 1R0AL 1QBAA 4KJPC 1MFAH 2RR3A 3F7VA 3D0LB 2VZOA 2YKLH 3WS3A 1H3GA 4CGTA 3NZ8A 5F70A 1QYGL 3HE6B 4ZD3L 3MLVL 3VFRB 5IVZB 4F58L 4TVPH 5B8CB 2B4CL 4FQXD 1CDIA 3PWLB 1TCRB 5B38G 1QBML 4P2RE 1TNNA 2IANA 3O6FB 4O58H 2J7LA 4F7TB 5BRZA 3RX7A 3JVGA 1WQVT 1YPZB 1HI6A 1HHIB 2BSED 2ZUTA 1A7PL 3FB5B 4JFFE 4RX4A 4G42B 3Q48A 4QTIL 5FHBL 1SBBA 2D31B 2J8UF 4MXQC 4JFPA 1CDHA 3D18B 5D1ZB 1HSAA 2IWGA 2VE6A 3T0ED 1I7TA 3MRFB 1NCBL 4ELME 2AXHA 4LSVL 2HVKA 5C0RL 2EDFA 1KIUA 5IB5A 4OZFG 1JJUA 2XKUA 4G9FE 4JO1H 2ZCLL 3S96A 1K9TA 2DYPA 1WVZA 3MRHB 4NQSA 5MENB 2X1WL 4HIIB 1EFXB 4R4FH 1A6PA 1N7ML 4IHOA 2KQMA 1KIPB 2B20A 3TIEB 1AGCB 4Y5YC 2LAAA 3K3QA 2FECL 3KDMB 5D7LE 2X4NA 3O0RL 3RU8L 3BN9D 5CD5C 2CRIA 5AD0A 4HHAB 5IJVA 5I8KH 1EPFA 1U42A 2DF3A 5IM7A 1ZLSL 2GJ6E 3QXWA 1VFAA 4LLMB 5CUSL 3HUJF 5KOVC 2EC8A 4M1DH 1A3LH 5DJCA 2DQJL 4W4OA 1QBLH 4JFZH 1FE8L 2BY1A 2DI7A 1L7IH 3GMMB 3MLSL 4EKXA 5IIEA 2DOCA 3DV6A 1JZ4A 5KS9F 5AWNH 3BP7A 4YPGB 1P4LB 1T1YB 4U1SB 1R5WA 2UWEB 2C3GA 1IFHH 3WHXA 3R4DA 1NL0H 1IILE 2JB5L 3C60A 5LAXA 2EXYC 2YRPA 2IF7A 5HI3C 3L1OH 5D93B 2ZPKH 5JORB 1NEZA 2R4RH 1YNLH 5FOJA 1D6VH 4M1CD 4TTDC 5CEZH 5I1GL 1K4CB 1N5YL 5D7IF 1B0GB 1UWXH 3L3DA 3BYYA 3CC5A 4Y1AD 1FG2A 4GBXB 5DEZA 4U6HB 1J5OH 3P30H 4EI5A 4DFHA 1XCTA 3RVTC 4KRPC 4AT6A 2XZAH 1JMXA 3HR5B 1B88A 4GAYA 3VXRD 2WW8A 4GAFB 1ZHBB 5EORH 1XF2B 4HJJL 3S36L 4JREB 1W0VA 4M8QA 4TSCL 1DSFL 1F8TL 4G6MH 4YFLF 4PJ7F 5C3LD 3X17A 4RMRA 1C7TA 1T5XB 5CINH 3FHAA 5GISL 3EOBB 2EH7H 1CD9B 4Z18A 1NANI 1U8MA 2W0LA 5TDOB 4LHJB 5JW3H 5CP3A 3UTZB 3TCXA 2ZOLB 1KYOK 2P8LA 5I76B 1VADB 1Q94B 3BGAA 5IW6B 3U7AA 4PJBA 1C5DB 3PHOB 5F88A 5BZDB 4MJIA 3WS6C 3M1BA 3EYFA 5FXCH 1H3PL 4U1KB 4F7PA 3T08A 3QWQB 5GGRA 3WD5H 3NCCB 5L9DH 1QR4A 2VLRB 4I2XB 5CSZB 1EO5A 1UGNA 1AO7E 3T65B 3ZDXE 1LK2A 1ZVSA 5T1DL 3UTPD 4YFEA 5JLZA 2XN9B 2YUWA 1DDHB 2NYYC 3W2DH 2R1XA 2A77L 4G8GB 3VFGL 3CU1A 1KXVC 4C55A 4Z7VF 4PJ8B 4X6CA 5IUSA 1HDMB 3TH3T 3H9ZA 5D2LB 4QHKI 5GHWH 2VDNH 3K7UA 4NKDB 3L5WA 1V7MH 4OCSL 3JUZA 1O7SA 4JAMA 5IWLA 4NFDA 3SHSA 5HYJE 5IROC 2WIIB 3RUGB 2DIAA 3QIBC 3FFCD 1OF2B 1OAUL 1GXEA 1LP9A 2PTVA 3ZKQD 4LQ1A 2OZ4H 3C8KA 4AG4L 3T1WA 2NTSP 4Y7MA 4K94H 5H8DA 1UZ8A 5DJXB 4MA8H 1WK0A 1LO2L 2ITCA 3O3DB 1ZK9A 4FMFA 1AIFB 4R8WH 4O2CB 1LQSR 4F3FA 3VJ6A 5B22A 4DW2H 1A14H 3RVVC 4EIGB 4PD4K 2UZYB 3FOMA 2VB5A 3ARFD 5INCB 3V4UL 4LQFL 5KVGL 1IGIL 4ZXBD 1JIBA 2EIEA 4FQXA 4X6DA 4D0DA 1NGQH 3EDKA 1WISA 4MVBC 1CL7L 1CXHA 2C1PA 2CKNA 2JJTA 3OKEB 5JOFA 4WI9A 1IC7L 4JM4H 1JZ8A 1CFSB 1AI1H 1E4KC 1RY7B 3R0NA 4DGVL 5BVPH 3NCYS 2UVEA 1OD7A 3IAQA 4IOFC 3SGJA 2W0FA 1JGLL 2YA0A 3F65A 1A22B 1RUMH 1FBIH 3DO3A 4KJYA 3I2CH 5E9DD 5F7NC 5HVHB 5HHPA 2L4OA 4JZOA 1H3VA 4NKOB 1NFDB 2AXGB 4U1HA 4ZS7H 3SKMA 1XZ0B 3T0EA 1AP2B 3S34L 4JHZA 3LEYL 5JW5A 1MFNA 3HS0A 5I30H 4J2XA 1BQHG 3RVUD 2FB4H 5CHNB 3UTTB 5GS0L 5D6CB 5CEYA 4PJ9B 5JW4N 1NCTA 5DJ8B 3OJDB 3V52L 4XTRC 3BZFB 4N0UA 3FMGL 4CU6A 3DWTA 5K59F 3PWJA 1AFVH 5T3ZL 5TF1L 2OMBA 5F1IB 3SDXE 1E4XH 1K3ZA 2H3NB 4JN2B 1D3CA 2X9WA 1YMME 3BDXA 3C08H 4PJAA 2IBGA 4OTXH 5KOMC 4ORGB 5DHXB 5BQ7A 4O51A 3SGDH 1MCDA 5TQ0L 1XGYH 3IU3B 3I6LE 1AJ7H 2Q7YB 5D96B 2J8UE 3B2UC 4OZIA 4YXLH 4WEMB 1MAKA 3OB8A 3N50A 1A2YA 3CK0H 4ODWA 3UZEA 4K71B 2I9TB 5KSBF 3AB0B 2ZSVB 5DJAA 1NMBL 4P23C 4PJGB 4RZCB 4HUNB 2P8PA 2QADB 2BRRL 4ZSOB 3GMNB 5C2BL 4XAWH 1S9WA 4JCLA 1WCBA 1JGEB 3GSNB 4FZ8L 1NDMA 4IBLT 1M7IB 4QHUA 3FFDB 5D1XA 3QUZC 3KPSD 5EC2B 4Q9CA 2OCFD 4Y1AA 3K46A 4JGUA 4PG9B 4WV1A 2G5BA 1BM3L 2Y6SC 5EOCJ 1SVZA 1U8QA 3H3KA 5CFHA 2A73B 3IJHA 3VXRA 4J7RA 3CCHA 4NRXA 4LCWE 5C0AB 8CGTA 2WQ8A 5E2JA 4C56E 1QLEH 2EIZA 5MEPA 1YN7A 4CVWA 1HIMH 3MV9E 2XTJC 5GGTA 3QXAA 4HF5L 1MCJA 1JVKA 1A9EB 1KPUB 2E8YA 3VCLB 5KS9E 2D03H 4MNGE 4JZJB 2Q1EA 5KANI 4AEHL 4H5SA 1UB6B 1I1YA 2VMFA 1M05A 1QO3B 1FVCA 4P59L 3ZZ1A 3O45B 3NA4A 5LWYL 2GJZB 1V3LA 2FJHA 2BNRB 2DDQL 1EHLL 3O9WD 1H9VA 1I1CA 3MLRH 2WP3O 1DBBL 1IEAA 2LU7A 1PG7W 1QD0A 5EZLA 4TRPL 3WN5C 3EO1B 4LEOB 1IZJA 1N6VA 1KTLA 2XG5A 4KTYA 4G43B 5D7IE 1CDCA 2XIDA 4Z7WB 4MD4A 3DV4A 5ALBH 3MA9L 5SX5K 2DQIH 3UPCA 1XR8B 1MCCA 1RJYB 4YDKH 3LEVH 2MKWA 1BLNA 1LDPL 3C87A 4JGMA 2HT2D 3GSVA 1OW0A 3FQWA 3CMOH 5D1QC 1X5AA 3AROA 2VLKB 3HAEG 1NFKA 1T7VA 4JDTH 1OT2A 3F7YB 5I1HH 5I1JL 2VIRA 1NMCB 3BIKA 1DBKL 2VDRL 4LPUA 1EV2E 3ILQC 2BY0A 2UV3A 2DMBA 1ZLUK 4H26B 5CZVH 2AJZA 3TWCH 2RQ8A 4WO4D 4OZ4A 2DLIA 4R90L 4WUUD 2BNUB 3N9GH 2Q8AH 1RULL 3BUYA 5E1HB 1KG0B 4ONHA 3VWKD 4WDIA 1BZ9A 5KJRH 4KK8C 1MWAH 4NJ9H 3FFCA 4MB4A 3CU7A 3MRNA 1F90H 3OKDB 4IS6B 4M1GH 2X4RA 4HLZH 3RZCA 1BQLL 3VDAA 4WHYH 1U8JB 4PP2B 4N0CC 1JGDB 1FC2D 2VQ1B 5GGSA 3ARGB 1P1ZA 3W0WD 2AJYL 5KN5B 1KB5B 3ILPB 4ELKA 3L95B 1IGTB 1Q72H 4YDJA 2Z31B 1NAML 1VKXA 2F53D 3TVMB 5B39G 4Q9QH 1R3IH 3ARFA 5L8JB 1ZEAH 2WANA 1OP9A 1PQZA 3RY6C 5FM5M 3AY4C 4ZAKB 2FHCA 4ZXBA 2CXGA 3WKML 2EC9U 5BVJB 3EDFA 4K3DL 4GW1A 1SEQL 4QOKB 1KPRA 4XPHL 4MJ6A 5J1AB 1IAIH 1U8KB 4ZUVB 3LKRB 4H88H 5T3XH 5E1AB 5KSUB 3WJLC 3MJ7B 2NY6C 1UM5L 3SO5A 4MB3A 1CFBA 1F2QA 1Y0LB 4LLDA 3N1FC 3PNWB 2MHAA 4AH2A 3VRLF 5E9DA 3QEUA 1J0KA 3KPRB 3HNTL 2APWA 4P5MA 2F9BT 2W1NA 2ED9A 5J06A 3SKNB 3ZSTA 4JLRA 4QXUL 3CLEH 4P2QD 1IARB 4P3WA 1J1OH 1G7MB 2YPLD 4L5FH 1RQ5A 1PVHA 3MXVL 5D7SH 3B5GA 3MBXL 3MMEB 4NWTL 1QKZH 1B0RA 4OZFH 2PNDA 4G6JH 2DS4A 1U36A 4K3GA 1WZ1H 1VGKA 2EYRB 3P9WB 4ETYA 3QULA 2VLJE 4GFTB 1IC4H 3MNWB 3MV8E 2XKNB 3AVEA 1LD9A 4X0KA 3GBNH 4NOFA 4D9RE 1EAJA 5D7JB 1S7XA 5IP4A 1S5HB 2VXQL 3T8XB 2GFBB 5DLML 1XF3B 3VG0H 3HZMA 1WICA 2BHZA 5K33A 3TJEL 4AIXA 1IGYB 4J1UA 1YDPB 4NZUH 1OB1A 2XQBH 4J3UA 4I18B 4IRJC 1NGWA 2YK1H 1ZA6B 1Z3GH 5C07D 3ULVF 15C8L 4NQEB 2X7LA 1HWHB 4L4VB 3INUL 4BSVA 3QDGB 4KY1H 3VWJD 5FCUL 4I77H 3G6JF 2H8PA 4OLWL 3FO2A 5IJVB 4JY4A 3FO0L 4KJPD 3C09C 3WMSA 32C2A 5IF0A 3KPSA 5IM7B 3OPZH 4QWWD 1FNEB 3PP3H 2IQAA 2XPGB 5EN2A 2QTEA 4X80L 1KENH 5ESVB 5JHLL 2HT3D 5JHDB 2N56A 3MLPA 1FNHA 3GJFB 1IM3B 2BJML 2PN5A 5CMAB 1WSST 5DHYB 2VQUA 2YUXA 1YYLH 4NFBA 5BV7C 4URTB 2YZ8A 4AZ8A 5ID0B 3FQNA 4FQLL 3D9AH 4LSRL 4U1NB 2E5EA 4BFIA 1HXYA 2LABA 5E6IC 3C60B 4MYWB 2Z4QA 3HUJA 3V6ZB 3PL6D 2P8MB 3RKDD 4L9DA 1PY9A 2EYTA 1U8IA 1N2RB 4JHBA 4B5EA 1N26A 1OP5H 3O2DH 2BK8A 4J3XA 2ENYA 3GBMH 1F11A 3DUSA 3O9WA 4EI5B 1QQDA 2NCMA 1O5DT 1EERB 4JQXC 3DMMD 3GHEL 1KB9K 3TPKA 2MFNA 3L3GA 4PJXF 3MNVB 4NZDA 1U2CA 3VH8B 3GFUA 1GGYA 1PX4A 1NCCL 5FB8B 1Q9LB 1PY4A 5KANG 3O3EA 4O9HH 2LQRA 2XWTA 3UYPA 4K07A 1GJIA 1J1PL 1O7VA 2X4PA 3C5ZD 1JPGA 4KKAC 3PG2A 1F58H 3B9KC 3WXWL 4LU5L 5KVMC 4NZRH 3B3IA 1JUFA 1P6FA 3QR2A 2DL2A 2RAMA 4ZNEA 1U0QA 1RFDH 3TCLA 4Z77A 5IB2A 3BP5A 4WO4A 4HFUL 3P9MB 3S4SB 4OI8A 4WUUA 1MELA 3TNMB 2ID5A 3WLWC 4X6BA 4HIHB 2YKLL 4HPOH 4K9EC 3KPNA 4YHIB 5EO1B 4XT1C 1BVZA 5KAQG 1JN6B 4C4KT 4GRWB 4OV5A 4TVPL 4I3SH 1IEBB 3GJEA 5EBWB 3ZE0F 4MCYB 1JGUH 1CD8A 5CBAA 1TVBA 1PAMA 1BD2D 5SV4A 3EHBD 3OKMB 2IPKA 4U2ZA 5KSVB 2E27H 3W0WA 4DQOH 3SJVE 3GSQA 4KKBD 3CZFB 1MCPH 1Q9WB 5JPNA 4N0FB 1QA9B 4YE4H 2F53A 4ZTPL 3T2QA 4JHWH 3DX7B 4XCEB 1JNHA 3P73A 1RHHA 1SJXA 5E2VL 4GMTH 1N5AA 1OARL 3MJ9A 4WI8A 1JL8A 2YUZA 2A6KB 4AQOA 5FYLE 4D0CA 3UJTH 3IVKA 1I7ZB 1KXTB 1XIWB 4JPWL 5T1MB 5FHAL 4G6KH 4JO1L 4Z7VA 3QNYA 4HS8H 3FL7A 2ITCB 4R4FL 2B39A 3WHE1 4BQBA 5IB3B 1KJVA 4R7NA 1M6OB 4F3FB 2ARWA 2R2EB 3RWDB 3DJ9A 5DJDB 5IW1B 4JZNB 3W9DB 2XXMB 1Z5LA 1QFUH 1L0YA 3MLZH 2WLZA 2JJSC 4RMQA 1D5ZB 1ZT7B 2AJXH 5DT1L 1MUJB 4P2QA 1JPFB 3DECA 2YPLA 2VZVA 1QVOB 4PTUA 1FLTX 3IJYA 5DURD 5FYJH 1FQ9C 2SEBA 2OQJA 5HHNB 1A3LL 3WFEH 4F15B 3TYGL 4DAGL 3BESR 1X5YA 3X13B 5DSCB 4HZLB 2A6DB 1J05B 2ZUUA 4H25B 5AWNL 4G7YL 3X3FH 3UP1A 5DTFA 4RGNB 4QNPE 4KUZH 3IDJA 2ED7A 4GG6B 1IFHL 1RZFH 3EFFB 1NBVH 3QO0A 3DX8A 5C0DB 4K7FB 3C5JA 4RMUA 4KPHH 5DZNA 1BOGB 1KJ2A 2ZPKL 3VXNA 1TVHA 1K8IB 1S7WA 12E8H 3O4LD 4JM2A 4LFHD 5CEZL 5IR1A 1HE7A 4KC3B 5JW5B 3HS0B 3TT3H 4XWOD 1I7RA 4L3EE 4PRHD 3LKQA 4XX1G 3DX6B 3GMRA 4YUEH 2XZAL 4MCZA 5F71A 5EO9B 1PKQB 2XQYK 5C07A 4HKBB 1JHTB 5MHSD 4OGXL 3S88L 4XBPB 4PG2C 3WNNA 3G5XA 4APQC 2A9MH 4ODVH 4F80A 5J6HA 4RFEB 3QUMH 5IMKA 4W4NA 2X1QA 5FYKU 1ZLVH 1F3JB 5FECB 1I85A 2FX7L 1B4JL 4HUVA 1INQB 5DMGC 3CFDB 2JIXB 1ZKAA 3D85D 4P9HH 1FLRL 1FO0B 3FRUB 3P77A 4OAWA 4JY5H 4XWGH 1QLRB 2JE8A 3E2HB 2LV4A 3NACH 3QG7H 5EUKA 4PRBB 1KN4L 3B2VL 4DTGL 5E5UB 3U30B 1GC1C 1NC2B 1YQVH 1QPPA 3VXTA 3VXME 4GQ9H 3HPLB 4TQEL 2DB8A 2ARJB 4HUMB 4MS8D 4WHTA 3GNMH 3IDNB 3Q0HA 5FA3A 5DMYA 5DC0A 2CUHA 1LEIB 1HH9B 3H9HA 2AJ3B 3EGSA 3QDMB 5L9DL 3PL6A 1JWSB 1FSKC 2BSSB 1EEZA 3G5VA 1FNGA 4JE4B 5D1XB 4TUJB 5A16B 2AVGA 5JDSB 1GZQA 4E41E 5F7HA 4KRMB 4YDVA 4WV1B 3CVHH 4OLUL 1DVFC 1KOAA 4N1CA 4BK4A 5KSBA 2MCPL 3W2DL 3G6JE 3ULVD 3QRGL 2RBLA 3DMMA 3S8WA 3LQZA 1XF5B 1A4KB 5C92A 5GHWL 1L0XA 2V7NA 2VDNL 4XTRD 3CSGA 4WU7B 4NO3A 5DRWB 4NNXA 2R1WA 1ZHNB 1R5VA 1EEYA 4D8PB 1NANH 3HZKB 3CH1B 1XGUB 2B1AH 4CNIA 3BPNB 4FG6D 3S3PA 3TH4T 2NNAB 1JV5A 2PYEB 3C5ZA 1E6OL 1IL1B 2C1OA 2X89D 1I8LC 3BW9A 5DRXB 1PGRB 3BKML 4K94L 1W8OA 2ADGA 4MA8L 4PR5B 1JI1A 1FNSH 4R8WL 1TMCB 3RGHA 4DW2L 4M8VA 3KYKH 2CK2A 2W38A 3ISWA 1EO8L 3P3YA 3RL2B 1HHJB 3RX8A 1JNNH 1MAJA 4MAUH 3S97C 3DO7B 1IBGL 5LJYH 5EOCL 2DICA 5K9KA 4YBQC 4CN4A 3X3GH 1SYSA 3GZKA 2V2WA 3UPRB 4PJXE 2FZ3A 3QUXB 2H26B 4IRSD 2C5DC 4JPIB 5BW7A 3Q3GA 1QBBA 2NTFA 1BD2A 4RMWA 1PBYA 3QUZD 4JM4L 1FFOA 2E7CA 1CS6A 2M1KA 3SDAD 1WEJH 1A1MB 1XGQB 2NXYB 3JTTB 3L3HA 1HOCB 5JUEH 3HHRB 4HV8A 4S1DC 5EUOE 2XTJE 1C08A 5K9JH 3U9UB 3KGRA 2OXGA 2EDDA 2XT1B 2J1KA 3V4VL 3LKOA 5C0IB 1NFIA 4GAJL 5BJTB 3LKNA 2AQ2A 4TUKH 5LGJB 1KFAH 4YHLH 1YJDH 4X99B 4YR6A 1UXSA 1U91A 3L5IA 5EU4A 3KPMA 1MFDL 1DQDH 3G6DH 2I07A 2IG2L 1JNJA 4Y2DC 1CDGA 1CXFA 3D2UD 5F7DA 3IETB 3JTSB 3V9FA 2E7BA 1G6RA 3CFKA 3WJJC 5ELIA 3NA9L 3WFBL 2VXUH 4PS4H 5E00A 4OCNC 5EWIH 5DRNA 3E6HA 3ZE0E 3TIDA 3RPKA 1MREH 4G6FD 1DE4B 1YQ2A 5AYQA 2ZP0T 1RZ7H 3O8XC 1FJ1B 3SDDC 1JWMA 3CDGB 5I1KL 1MAMH 1VB9A 1LO0H 1MHCB 5EO0A 3BWUC 3C08L 3FN0H 3QFDA 5IGXH 3LN9A 2XFXA 1HQRA 3UTQB 4ENED 1Q0YH 4LPXA 1HZHH 3X11A 1AJ7L 3Q5OA 4YXLL 5FOBB 4OM1L 4WUKL 3CK0L 1S9VA 4XPAH 3WL9B 3LIZH 3WXVH 4UILH 4XMKH 5D9SB 4UZGA 1C1EL 4F7CA 5JPMB 1DQLL 3HMWH 3ILQD 4NWUL 4OLVL 4GRLC 3MGTA 4XPTL 4Y88A 3QEUB 4QRPE 4M7LT 4XAWL 3LZFH 5ILTH 5HI5C 2W9LA 3MCG1 4ONGL 5DFWH 3RWCB 2W60B 3K8LA 1QSEE 4UT6H 5I18H 2VR5A 3O4LA 3FO1B 1RJZB 4G8GE 5I74C 2V2XA 3HG1A 3GSWB 2ZUSA 2J5LB 3QB7C 4OZGF 2HKFH 4PREA 1MRFL 5F7YC 4XVSH 3TC9A 1JYWA 1EUUA 2QQQA 3LDBB 3IKCB 4S1QL 4V1DD 1KJMA 2X9XA 3RP1A 2DI9A 4N0CD 1FVDA 2P44B 1F4WL 4QXWA 4FA8A 5GS1B 2FLBT 5D2NA 3BMWA 1QLEL 1U95B 3VXUE 4LGRB 3O3AA 1CE6A 1HIML 1M1SA 4QHLA 1Q9KA 4LASH 4OQTA 4QTHB 2LU3A 1PX3A 1WV7T 4NZJA 4DOHE 5D71H 1OGTA 2FEEI 5EU7C 5HBBA 3D85A 4YHPB 3EOTH 4XZUB 1MEXH 5C71A 4R3SB 1D5IH 1K3IA 1H8OA 4MMZC 4JFHE 1CQKA 5JTWA 4HPYL 4TUOA 2X4UB 1J0JA 4ISVB 2QJDA 4Y16B 5C0CE 3W11C 4YJZL 4ODSH 5HVFB 4XNYH 5FYKE 5ICXA 2K3TA 3RDTC 3B8YA 5IVXF 2ZUYA 3BSZH 3CX5J 3BWAB 1RZ8A 1W0WA 4BSVB 5ALBL 1NMAH 1WJ3A 2DQIL 4OD1H 4JRXD 3I3BA 4YDKL 3LEVL 4JY4B 3RWJB 1S78D 3VXSA 3UJIH 1OPGL 3WSQL 1XF4A 2HJFA 2RCSH 4YGAB 3V95A 2D9CA 2NY3B 3TBTA 1A6UH 3CMOL 1ZT1B 2FGWH 4LAQH 3DXAD 3SE9H 4JDTL 1WAAF 1MFEH 2YWZA 1CGVA 2X40A 5CZVL 1S9YB 4KJQC 1K4DA 1DUYB 2FL5B 4Z7NE 2JK5B 4PJHF 2Z91A 3PGCB 5C0BE 4OI7A 5TH2B 1MIMH 3B6SA 2GSIB 4KRNA 4POUB 3MRRB 3QBTB 5JDJA 1OAZL 3VGAB 4WWKB 1RPQA 1MWAL 4NJ9L 5GRJL 4BJLA 1NUFA 4EUPB 3HLAB 3QIUB 4AY0A 5D5MB 4IIQC 4JFYB 2X89A 3QG6B 3TM6A 4QY8B 4PV9A 5TQ2H 3IFLL 3MUZ1 2RGSA 5IBLD 2YOCA 2MWCA 2Z8SA 1E4WH 3OGOE 3HN3A 4PTTB 4JFEB 4R9HA 2R0KL 4S1SL 3GMLB 1QFWL 4UIMA 2VO5A 5INDA 3F7RA 1OL0A 4FQHB 1JYXA 1N4XH 3FB7B 2EH8L 1E27B 2O5ZH 1T7YA 2UUDK 4J4PD 2J6EA 4X5LA 1JYVA 4LHUA 3VH8G 1IZKA 3MUGB 4IRSA 1AXSB 1VFMA 4JO4H 3EJJX 4M9OA 1IAIL 1R3KB 4CVXB 3MXWL 2DWDA 3I6GA 4F7EA 2I26N 1KT2A 3QWRD 3SDAA 4GW4A 1CQYA 2HAZA 6FABH 3PWUB 1MJJA 3KHOA 5ACZB 1KBGL 2V9QA 5CD3A 5EBLB 2YEZB 1HSBB 3VE0B 3WFHA 1HEZA 2GT9A 4J8RB 1RHFA 4P9MH 5T1KD 3DI2B 3QI9C 4RDQF 3EZJB 3S4SG 3GBLA 3LAFA 3PGFH 5CZXD 3CVIH 2QR0A 4FTVE 1UXWB 2H1PH 4TPRH 3A6OA 3D3VB 3D2UA 4HWBL 4P3CH 3IXAA 4UU9A 2ORBH 5D7SL 1MRDH 5IKCB 2BNQB 3I6KB 2YXFA 3EZ8A 4ONOA 4HIXH 4X4XA 1ZSDB 4P4KB 1YNTA 3HNVH 1N0XH 1IC4L 3MFFA 1A1OA 1RURL 5SWZE 1MCQA 1NBZB 3DIFA 5DK0A 3F7QA 3GMQB 2V5SA 1GCFA 4JY6A 3GBNL 2Q3AA 5I1CL 1QFOA 4WY7H 2A0LD 4JCMA 4GLRI 4HUXA 1KCKA 5IV2B 2JB6B 1QACA 4MWFB 5GGVH 1GOFA 2OP4H 2X44D 1OY3B 4DEPC 1AHWC 3B9KD 3T0BA 4NZUL 3JWDC 1CF8H 1X5LA 2NY4B 4I4WA 3TBVB 2YK1L 1Z3GL 3D1MC 3QEGH 3P0YH 1JWUA 1SJHA 1T1XA 1FL3B 2VL5B 4MNHB 5HYSB 3WLWD 4I77L 1VENA 3QH3B 2H2SC 2VLKE 1CR9H 3KS0J 4HDIB 1GL4B 5FK9B 1OAXH 4JPKH 4JQVC 4PJEF 4PTUB 5HJ3B 1KENL 2BC4B 2D7MA 5MERA 1FNAA 1AGDB 1D5XB 3PWNA 4AEEA 2PKDA 4V1DA 4DN4H 4X5XB 4Q6IC 2P7TB 4RAVA 4JDZB 4YZFF 2AAVA 3C6LC 5ITBL 5AZEH 3G5ZA 3HI1A 4JR9L 1V7NL 2Q8BH 3TBWB 3LH2H 4Z0XA 5I1EH 5IEKB 3MRMB 3D9AL 5IFHL 4F2MA 1J12A 1T89A 3BEWA 3SO3B 1RUPH 3MLTA 1BQSA 2FX9H 4LF3B 2NZ9C 3VXNB 3ULUF 1DCLA 5DD1H 1U8HA 3RPIB 2W65B 2FIKA 1NKRA 2DBLH 2F8VA 4FQCL 4LPVA 4P2RA 4QXGH 5FO9A 3O2DL 3IDIA 1JZ2A 3GBML 1NDGA 4M62L 3QJHA 1SEBB 4NDMB 4MCZB 5IBTH 1OP3K 5F3BA 4EI6B 2GCYB 43C9A 4U0RC 5J9PB 2HKHH 4FZEH 5AAWA 3FOLA 5HGDA 5A40E 3O2VL 1S9XB 2EZ0D 1QZ1A 3GDBA 1P2CB 1BZ7A 1AY1H 2J3SA 4PJDB 2YD2A 1OQXA 1GGIH 1OAKL 3FT2B 4JRXA 2B5IC 2CK0L 3EYSL 4QOKE 4Y4KC 3RIFK 3WIIH 3HRPA 1B2WH 1UJTA 4DZ8A 4RSVA 1MHPL 4OCXH 3GSNH 1F58L 2YXMA 3DXAA 5KW9L 1CFQB 2VLME 3VGHA 5JZ7C 1UQSB 1T5WA 4EVNB 2ZUVA 3F8UB 2EDTA 3K2MC 3AS3A 2OZ4A 1F5WA 4AQ1B 1G9NC 1EEQA 1T20A 3V5HA 2VDPH 5J4MA 4LNRA 4WW1B 1U58A 2YBRB 1WFNA 3A6BL 2FYYB 4E42B 3QCVH 1FAIH 3NAAH 3DOSA 1WBZB 3H0TB 4I3SL 5F7UA 5IVXE 4FFWC 2XXCB 3IU4H 2FSEA 2NY0B 1ETZA 2VWEC 3E1F1 4G8EB 5A2IH 4YDVB 4P57B 4JG1L 3MYZA 2E27L 3FB6B 3N0PB 4LRNL 4DQOL 5CLWA 4Z5RA 4YE4L 4E5XB 4S0SD 4ZG1A 5GRXG 3ESUF 3TO4D 4LCUB 4NP4H 5T3XD 2C3HA 3AXLB 5C6PB 4YHYC 1S7QB 2JELL 1WAAE 4M02A 4JFQA 4J4PA 4QHMA 3NFSL 4ETQB 1BAFH 3UDWC 4U49A 4MAYB 4GMTL 4YLQT 1S7SA 5DRZA 1ORSB 2NXZC 3UJTL 1AR1C 2BCKA 4ZMAT 4HJGB 4K9EH 4MXWH 2XWBA 2Z8RA 1JHLH 2P5EB 4G6KL 4XNXH 3NN8B 3QWRA 4LKXA 5IMLA 1N3NA 4L29A 1NLBL 3QCTL 4PGEB 4XHJC 3C9NA 5GJTH 2P5WB 4YDLB 1FC1A 4BFEA 1MFBH 3RY4A 1YEGH 4PLNC 3E0GA 5EU5A 3F12B 3MLZL 5KZCB 2AGJH 2AJXL 1TZIB 4NQUA 1KCUL 2DL9A 4KKLD 1NAMB 4I5BA 3MTRA 2QSTA 5IFAH 2DLHA 5EU6E 2BVQA 4HD9A 3ALXA 3WFEL 2XWJA 3GMOB 2Y23A 1ONQB 4M7ZC 4XGZB 2MQ0A 2JCCF 5HHMB 2E7HA 5GS2D 2IH3B 2ADJB 3CUPB 3V0WL 3QFJB 4JRYB 1A6TA 1OLLA 4Z78B 2ZOKB 3IKKA 1BPVA 1RZFL 3OXSA 5C8JB 4PRIB 3U82B 3ZHDA 3MGAA 4HIJB 3QQ3A 4KPHL 3KG5A 5A2LH 5MEQA 5IHZB 1CL7I 4YX2H 4IRZL 2AABL 12E8L 1S5IH 4XXDB 2GUOB 1J8KA 2WM0A 4FQ2H 1F4AA 4ZTOH 3IXTA 3D0VA 3FAWA 3VRIB 4F57H 1AKJB 2AK4B 4XCYA 4OF0A 2NQCA 4EN3D 3MBED 1NJ9B 5TDPB 5HGGS 4UUJB 1G7QA 3CNKA 5HPMA 3VU2A 4L8SC 1QHPA 3TBSB 4ODUB 3T77A 1VACA 2Z92B 2O5YH 4RAUA 1SM3L 1U92B 4POYA 4DKFL 3TNNA 1JF1B 1X5JA 4QYOA 3KJ4B 3CFBA 1FFPA 1TQBB 1MI5E 2WQRA 1QSFB 5T5NF 3L3JA 3P2TA 3H7LA 1CICB 2NZIA 3OKKA 5ABDE 4GRMA 1KLGB 2X09A 2XTLA 5F21B 1KGCD 4XWGL 4PRPD 1PSKH 1XFPA 2Z0BA 2EDXA 2ZJSL 1XR9A 5GGRY 4R7DB 3PJSA 2EO1A 3T1FA 3AREB 4NNPL 2FR4B 3MNZB 3UBXA 5EZOL 5IW3A 4HIEA 4M4PA 4MX7A 3UTSD 5ISZD 2R9HD 4HUWA 5IFJA 4GQ9L 3LS4L 3Q1SL 5TGBA 3PV6B 2WWMD 1NCUA 4YXKL 2H2PD 3S37X 1TJGH 3VFVB 4FXGB 1IM9D 1CI5A 5DQ9B 1T3FB 1CGXA 3BXNA 4MA7L 2NX5E 4KVCH 5BMFL 4XP6L 1MY7A 4B0MM 5EIIA 1WWWX 4XCFL 3RGVD 4LVHC 1J8HD 1SY6A 1N8ZB 4PP1D 1X5FA 4ZFZA 1Z9OA 3HI6L 2BVOA 3R0MA 4NM8H 4Z9KB 1I1FA 3HE7B 3QIWC 1OTTD 2I60H 4QRRD 5FYLL 3V6OA 3T2OA 4U4BA 4IJ3B 2NY1D 2WWKT 3KR3H 4WW2A 3DHJA 5F9AC 2ATKA 5F6HI 2HFFB 4OJFL 4C4KO 1ZHLA 2Q20A 5E2WH 2B1AL 1YUHA 1OGAB 5EA0L 4OZGA 4TYUA 1FVEB 2Y36H 3PDDA 4KAQH 3EYQC 1D5MA 4KROC 4NQVA 3ZT5A 2H32B 3HFML 1U3HD 1A1NA 2VKXA 5AUMB 3HC3L 1HHGA 2BRQA 3K81A 5DJZA 5HVGB 1CU4H 2Y1VA 3LQAC 3LN4B 4AK1A 3QUYA 2OK0H 3MRJA 1AGEB 1FNSL 2VXTH 5TPWH 1D9KC 2X4SA 3GJFH 4L9LA 1ZAGA 4GH7B 1MQ8A 1XH3A 1CDYA 4X4YB 4MAUL 2OM5A 2DQUL 3FCTB 2X42A 1I1AC 5EB9A 5I1AA 3ULUD 4XCNA 3SKUD 1F4YL 4CADB 2XZCH 3QHZH 4L8DB 5E4EB 1S8DB 4MXVF 4XXCA 2GTZA 1NBYB 3BHBB 1X5IA 3CFJB 5F96H 3W5MA 3U4AA 3SGKC 4PJFB 5L0QB 3O6MH 1YPZF 1WEJL 3WE6A 1RZKH 3OKOA 5B38A 3BPCB 1T21A 1S7RB 4P3DB 1RIUH 3TO4A 4LCIH 4KHTL 3DNKA 2KZWA 3FQUB 3DX9A 1AQKH 4TUKL 5EU7E 1YN6B 4HEME 4WEUD 4WNQB 3