3FO2B

Crystal structure of hapten complex of catalytic elimination antibody 13g5 (glu(l39)gln mutant)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
214
Chain Sequence
b'DVQLLESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catalytic antibody Fab 13G5 kappa light chain chimera
publication title An aspartate and a water molecule mediate efficient acid-base catalysis in a tailored antibody pocket.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 214
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo2B01
1OY3B 1NBQA 3VDBA 1C12B 3O4LE 3HHRB 2OTWA 3O6ML 1MCPL 4HCRL 5DRWB 4XP9L 2I9TA 5IB4A 3QP3A 3GM0A 1T7WA 5BW7A 3W0WE 4K7PH 1HQRB 4C56A 1RUQH 2R4RH 3UZVB 3HE7B 3BDXA 3GMMB 4LVNC 4PJ7E 4KTEL 1P6AB 3HE6B 3BUYB 3DIFB 3MRHA 1QBMH 3FO0L 5E2WL 5HYSA 4LU5H 5BS0B 3U9UA 4POZD 4NOBA 3PJSA 2BP3A 4M1GH 2IPKA 4PGCA 5DS8B 1QO3B 1W72A 5HHQA 3PIQA 1MCSA 5FYKE 4QXTA 4BJLA 1DQQB 2E9JA 1A1OB 1J05A 4OQTA 3RBSA 1IM9B 3AB0B 1SVZA 1T1YA 1UACL 2WBJB 1T2QH 3PL6D 3M1BA 3EW3B 3A67H 4XZUA 3GUTB 1H5BA 4OCLC 3T4AB 2M8XA 1QSED 2VDQL 4KRPD 1FL6A 1RJYB 2P8MB 5IK3B 5I1LA 1DCLA 4XNUH 2F58H 1M1SA 5D93B 4EDXB 3SPVA 2BNQB 3WCYA 1QACA 2X89D 1DQTA 2NY3B 3QHZL 4QRPE 3KPLA 4RRPA 2RHEA 4PYHA 5C0BA 2N1KA 4D0BA 4KK8D 3MREA 2CGRH 4O02H 1Q9OA 1FNGB 4PJFF 3TN0C 3P30L 1FE8L 5I19L 4JFOB 4OCMC 1T7XA 1VGEH 4Y2DD 2BC4B 3KPSD 2NLJB 2VDNH 1EJOL 5J57B 4POYA 4ZQKB 3C9NA 3L1OH 5E4EC 4ODTH 1JPTH 4WV1B 4P5MB 2HN7B 3MRLB 3GIZH 3ZDZE 1MRFH 1VACB 5JOPD 4RX4A 1IC4L 3QAZC 3SCMA 3RDTD 1AGBB 3KPNA 4IS6A 2A73B 4Q9CA 5D1ZD 3VRLF 1KLGB 2DB8A 3JTTA 2V2XA 5JOFA 2NQCA 1X6LA 5C07E 1JWSA 3U46B 1SEQH 5FO8B 3QEQD 2E8YA 3OL2A 4K7FA 5TDPA 2NZ9D 1QEWB 3TCLB 3X3FH 1T5WA 1BD2A 3HB3D 4PJ9D 1XGRA 3CJJA 4JR9H 4EN3A 4P99A 5C6PB 2CKBL 3FRUB 4LSTL 4JO2L 3BT2L 3RGHA 4B7IA 4NBZB 4F37K 3MCLL 1S7UA 3ARFC 4WW2F 2NY0D 1HINH 4UNUA 4M62H 3SDCA 4XCYB 1FGVL 1P53A 4FABL 2X4PB 4BKLA 1FYTE 1HH6A 5DJ6B 4AYFA 4OFPA 3LKOB 2J5LB 5EBGA 2O26U 5KG9A 1YC7A 3QI9D 3QHFH 4RFNC 5D1QA 1KGCE 4WDIA 4OLWL 5JHDD 5I1AA 5B38A 3OV6A 1KTDA 1I9RL 3UYRL 3MLXL 4KKAD 2DI7A 1UH2A 1AD9B 5F89B 1CGWA 1VGKB 1QFUH 5GQBA 3P0YH 43C9B 1BJMA 3C87A 5DMYA 1T1WB 1CE1L 2J6EH 4JKWA 3VWJA 5E00B 4GMSH 2FR4B 1AXSA 4HUMB 5CILH 3BD4A 3SE9L 2VITA 4G6JL 1NGWB 35C8H 2PR4L 5MP6H 3WNPA 3UTSD 5ADPH 4X7SH 3HUJF 2FD6L 5DTFA 4QHLB 2EKJA 3GGWB 4L4TE 5CP7A 5EU7E 3GMQA 1NCDL 3HNTH 2B1HH 4KMQA 2EC9U 5ACMA 3T0WA 3ULVF 1PEWA 5MEQB 4E0RA 5FYLL 4UUJA 2Q87A 1YYLH 1WV7T 3OB0K 1CDCA 1JF1B 3X12A 4PJ5E 1AQKL 4H0HB 5I1HH 2NY5C 5J6GA 4NQUA 5E5MB 2PO6B 2GI7A 5C0NC 1OTSD 4KKCD 5IHUL 1N2RA 4AENA 1NGYA 4QRSB 2YBRA 4H1LG 1A9EB 2D0HA 2N56A 5KVMC 4S1QL 3ZE1E 1MLCA 4F7MA 3MXVH 4PJBE 4YC2B 4CMHB 3CFEA 4NDMA 3G5ZB 2XOTA 4AH2B 5BVJA 3WDHA 1PW3A 2VE6B 5I1GH 5C0EB 4WHYG 4PRIB 5KJRH 4YX2L 3IXAB 1MOEA 4HUVB 5KSBB 1Q9LA 1MAML 5F9WB 4LHQB 5DUPH 3IDXL 4UT7H 5L2KE 3SGKC 3KHOA 4EI5A 1RIVL 3FHAA 4NRZA 4LPXA 4XRCB 1F6FB 1H3XA 3SKJH 5I30H 1A7NH 3U0PB 4KMTL 5IB4B 4ZAKA 4C56B 4XPAL 4LDLB 5I0ZA 3RTQA 5C2BH 5HHMB 5F7HA 3TF7C 1SM3H 3TV3H 4O58L 1YEJL 4LSQL 3VFMB 2ZG1A 1MREH 4P2OA 4QRPD 1C5CL 1IAII 1WAAF 4GLRH 3S5LG 3NA9L 2LU4A 3GSQB 4ELME 4MX7B 4NNYA 5EG6C 3IS0X 1MRCH 2MKWA 3I9GH 4OBRA 4OCXH 1J05B 1FIGH 3GHBL 4U1SB 1QSVA 5C2UB 1RUMH 1QLRA 4FXGB 4I5BA 2F8OA 1O5DT 3MV8A 4XZUB 4I0PB 4DK6A 5D9SB 2GSGA 5DGQA 1WEJH 1I8LA 4HXBH 3NH7L 4U1IB 1KCRH 3SPVB 1U8JB 5BRZB 1IC5L 3NACH 1ACYL 3BYYA 5DQJB 1NDMB 4P3DA 4QF1A 3NPSC 3OR6A 3K3QA 4MJ5B 5C07D 4IMKA 3FQXB 1B4RA 2AEIT 4N90D 4OFDA 4L4VB 1GGIH 4NT6A 1A6WH 3QDJD 4LLWA 2I60L 2ADGB 2NY6D 3FOLA 1K8IB 1YY9D 2UWEB 3V4PH 3P4MA 4UIKL 5I15L 1N0XH 5C09E 2BCKA 4R3SA 4PJHB 2Z91A 3F7VA 2NYYD 5SWQA 2ATKB 3IDGB 1NLBL 4IS6B 3KPNB 5C08A 3DX8A 1O7SA 2VDLL 2FBJL 4NKOB 4DGIL 3JTTB 2P5EB 4I1NB 1KNOA 4UB0H 1JWSB 3GSNH 1M7XA 3KAAA 1QFOA 1BM3H 5HHOA 4WHTA 1GCFA 3QDGA 5GGQL 4J2XA 5CJBA 1BD2B 4O5LL 2OZ4A 2EDRA 4EN3B 1JHKH 4IRZH 3UPRB 1NLDL 3DXAA 3GBML 1NC4D 3C6LC 2HLFD 4LF3B 3L3JA 4L29A 4NM4L 3TO2B 1S7UB 3V6FB 3VWKD 3LZFL 5DEGA 4P5TB 4R4ND 3PWPA 3SDCB 3JV4A 4FQIL 3MR9A 3MA7A 3RVVC 3FZUD 3LMJH 5T1MB 4FQJL 4BKLB 3FCTA 5EOCJ 5K9JH 4WEMB 4KXZH 5ICYB 4X80H 4GW1A 4DEPB 1EGJL 3RZCC 3TIDA 4DGYH 4HGWB 3HPJA 5IBLD 5AG8A 1AP2B 4HKXB 3IXTB 4P4KC 2DBJA 3U48A 1Z3GL 2E7MA 1INEH 5C0CE 2EEAA 3FRPA 5CZXD 2DQIL 2IH3B 1TTFA 3ALWA 1TLKA 4ZXBD 2KZ1B 1QHOA 2AP2A 3WLBB 1PLGH 5FA3B 2P5WA 5F1KC 1ZGLM 3B9DA 1NCUA 2AJXL 1U9KA 5EC2A 1P9MC 4O2FB 2G2RB 1T22A 1QR1B 2EDDA 5HI4C 3S34L 3WXWL 4BA8A 2DRUA 4JDVA 3SDAD 1QLFA 3UTQB 1PG7X 3T1FB 1G0YR 4ODWB 2AJUL 4XPHH 5DJ0A 3SKMB 4EQ2A 3MGOA 4NQCD 4OCWL 5D6DA 5CP7B 1FO0B 1BIIB 2ERJB 3CFIC 1ZT7A 4JB9L 5F88B 4I4WA 4K2UL 1OQXA 1KB5L 1CICB 4E0RB 1S3KL 2QQNL 5T1KD 3L3IB 2GJ6A 4NOFA 2ZUVA 4Z7QE 2R0KH 3BRDA 1FH5L 2F54E 1A7PL 3ARBA 2NY1C 4XVTL 3KXFB 2XKSA 2QLVB 4DUVA 4OKDA 3LEYH 4PFEA 4J4PA 2ZUUA 3DLQR 1LP9A 1ORSA 5CD5C 3MLWL 1HSBB 4Y4HB 3W11D 5DHYA 4FA8A 3QWRD 1JRHL 3FJTA 4F57L 5HGBA 1JTTA 3OKOA 5KSBF 3THMH 1DVFA 3B2UC 2W65B 4MDIA 1AR2A 3BX7C 2NW3A 1PSKL 4TOYL 5CJXC 5CLWA 4QXWA 4HLZH 1L6XA 4LASL 4OD1L 3MOQA 5FECB 4HV8A 3F12A 4PJFE 2Z31A 4K23H 1CL7I 3CDCA 1JNHB 1UM6L 5GSRB 1U8OB 5I8CA 4HUXB 4ODSH 1ZLUK 3V7AE 1CGTA 2NR6C 1PVHA 3BKMH 4EIZC 5T3ZL 2NNAB 1FNEB 1AQDB 3VMOA 4YBQD 5JIHA 1UYWL 5A40E 3QULA 5CKAA 2Y4SA 4IM8A 4ZMAT 4YPGB 5ICZA 4ZFOL 4GO6B 4ALAL 3I6GB 2J1KA 1F4HA 3H0TA 1S5HB 3VRLE 4K3JH 1EIBA 1T21A 4FQXD 2UY6A 3D3VE 5ID1A 4TPRL 2FECI 5T33H 1WWWX 3ZYOA 5GSVB 3WD5L 5EBLA 1A3RL 5E9DA 2MHAA 4AL8L 5K9QG 5ERWB 1OTTC 2UYLA 4QWWC 2A74A 2DM7A 3V0VA 2Q8AL 2EDNA 3ZE0F 1DJSA 1BGXL 2VLMD 3U79A 2DLFL 3KPPA 1S78D 1N3NA 1FVCB 1WT5A 1RULL 5ACZA 4P48A 1WZ1L 5L8JB 4KI5E 4F2MB 4OFVA 2ADJA 2QL1A 4UILL 1SBBA 4PRDA 4Z7WA 3EDKA 1OGAD 3HMXL 3TNMA 4U1NA 5F1IB 3GK8L 2UWEF 3MLVL 4MJ6A 4UOJA 1JPGA 2HAZA 1U91B 4MB3A 4QF1B 3OR6B 4PJHF 2V7HB 4LOUC 2DDQL 2AJSL 3NFSH 3SDDC 4BK4A 2PW1A 1WFUA 1H8NA 2Z0BA 3AY4C 4M7KH 5F9JB 1SYVB 1AXIB 4PGZA 3PV7A 3P4LA 3EKCA 2VDPL 5MERA 2VLJE 4JRYE 4PRAB 5IP4A 4PGEB 5F7YC 3QDMA 2C3VA 4H88L 4R3SB 3VXSE 3F7VB 2ZPKL 5SV3A 5FXCH 5C08B 5ADOL 2CLVB 3QG7L 1MCRA 2B4CC 3MROA 4NQSA 1IVLA 5FO9A 1BAFH 3QIUC 3MRKA 1A6AA 2ATPA 3W81A 2XQYK 1RZJC 3CFJA 1TTGA 5C0CD 1C5DA 2B0SL 2QHRL 4WU7B 3DGCR 1DSFH 4IOFC 1FPTL 2QQLH 2XICA 3HAEG 2AKRB 1HXMA 5MEOA 3VCLA 4U3XA 4NC1E 5EIIB 4X6FB 2FEDD 3CD4A 1JGVH 5EORL 3MBXH 3ELAT 3MA7B 2IF7A 3D2UA 4JKPL 3D85A 2FLBT 5E5RB 1W0VB 5ESAA 4F37F 1CN4A 2XZZA 1RUKH 3S97C 3LS4L 3B43A 4P5KB 2JB5H 1HHKB 4KZDH 1GAFH 3CCHA 4NWUH 4OLUL 4XPFL 2BJMH 1R3JA 2GAZB 2VXUL 4MWFB 3EYQD 4P9MH 5CMAA 3WBDA 5D2NC 2NW2B 2ESVA 2ZNWA 2JE8A 5I1DB 4PRNB 4XVSH 2YN3A 1MFBL 3O4OB 2LTQB 3LB6D 4Y5VA 3HRZB 5HYQA 1PG7H 1RZKL 5EC2B 1CCZA 3KGRA 5DC9B 1MWAL 1VHPA 4EVNA 1RHHA 5FUCE 4PLKD 2JCCA 1OPGL 1DBJL 2ADIB 1HHJB 4XNQA 5AWNL 5TE6H 1BVLA 4HQQL 2A6KB 4GLRI 4CN4A 5DD1H 3TJEH 1T04B 4HKJA 4KJPC 5EH1A 2OP4H 1FZJA 1QBLL 2J2ZA 1ZT7B 4BSWA 5CBAA 4YHLL 1ZMYA 2PYEB 4Q7DA 1BQUA 4NO0A 4L8CB 4CVZB 3RJDA 1LO5A 3EFDL 1MHCA 3UJTL 1KXTB 1C16A 4U6YA 1S9WA 1EFQA 4WU5A 1AR1D 5IW6B 4OV5A 1DDHB 1IT9H 1ORSB 3FFDA 3INUL 3BP7B 4JPVH 4K3DH 5HGHB 2IH1B 5T5NG 1TVBA 3SOBL 5DHYB 3BEVA 4YDIL 5FIEA 5HGBB 2PXYA 1XR9B 3JXAA 3TT1H 1MCDA 4X6CA 4RDQG 2VDOH 4NKMA 1EMTH 3RVTD 1V7NH 2H3NB 4ISVB 4YHPA 5JPNA 3D3VD 4YO0B 3F12B 2Z31B 5FYJU 3TVMA 4D3CH 3RKPA 4PYGA 4ZUWA 2OR9H 4PG2C 4OGYL 3BP5B 4P0DA 4H8WL 2HFEB 3IU4L 4P3CL 2AK4A 5FGRA 3DECA 2JK5A 4IRJC 5CJOH 1G1CA 5DRNA 2IWGA 2BOBA 3UTTB 5AD0A 3TYFA 1GGCL 3QXDA 1VPOH 1R3IH 3VXME 4OCYL 5F7WC 2EDHA 4PJGA 5IMOA 4YK4C 1P7HL 3AS2A 3HFML 1NGXB 1TQBC 2DTSA 1YMME 1Y6MR 1YN6B 4XCFH 2HWZH 2L0DA 4U0RB 3VA6A 3WUWB 5I1JH 3LN9A 2V5TA 5HGGS 3NZHL 2ZCLH 4GUPB 4OM1H 4EOWL 2MHAB 3IYLW 4XCCL 1PZUB 2EDQA 4LRIA 2HH0H 2X1OA 3QO1A 3QO0A 1A8JH 4ORZC 2JLLA 3LQAC 2UY7A 3A6CH 1A7RH 4HBQA 1D5BA 2VC2H 3JWOC 1B4JH 3KPPB 4HFUL 5ACZB 2EXYC 3FFCB 4R7DA 2R2HB 4F9LC 2VLJD 1RU9H 1S9YA 5LXGH 2ADJB 3QHTC 5T5FL 1F00I 1BQHG 3VXSD 3T2NH 3JTSA 1T66D 2D7NA 1NFKA 1RUAL 2YA0A 2R0LL 3VW3H 4R6UA 1A4JA 2CDFB 1JNNH 1XGUB 5IGXL 2DWEB 3BZ4A 5FDYA 4F9PA 1FFPB 1IAOA 2DS4A 5E5UB 5IIEB 4H1LA 3ULVD 4S1DC 1A5FH 2COQA 1U8QB 2YRLA 3VI3F 2AABL 1BP3B 2YR3A 5MERB 3O3DA 1B2WH 5D7IA 5EB9A 1MSPA 2ADFL 2C3VB 3QDMB 5EBMA 1JYWA 1YDPA 2O5YH 3K80A 3KJ4B 4YFLI 5KAQF 4Y4FD 3EYOB 1DQMH 3ZLQC 4F7PA 2XTJE 3MFGB 1KJ2L 1X4ZA 2CKBA 1Q0XH 4XWOC 1J88A 5D72L 2BSSB 4NQSB 3GSOB 1TZGL 1XF5A 3VFGH 4JM2A 3O6FA 3K8KA 5EU4A 1L9NA 4KK6D 5SWSB 4U1GB 5CEYB 3OXRB 1Q94A 3RVUD 4KUZL 2CLZA 3V0WH 3N9GL 1ZT4A 5SV4A 5DMGC 5CJQH 4Q9RH 2I9LA 3OKLA 2EZ0C 3HE7D 1V8HA 1HXMB 4KC3B 1S9XA 2HJLA 2NXZC 3HE6D 4CVXA 4Z78A 1I7ZB 1CDYA 3NAAH 4WVRA 4FQHB 5IQ7L 3BPCB 4JO1H 5BS0D 4S2SA 1TQCC 2GCYB 4MHHI 2LE9A 5TE4L 3GJFH 4DKFL 2P42B 3PWLA 1W0YT 3WS3B 3M17B 3PWVA 4WUUA 4JHZA 5IB5B 1IM9D 4LVNB 4YJZL 2WBJD 3MLRH 2OL3L 4MLSA 3H42H 4XWGL 4RGOL 4ZFGL 3GB7B 1UENA 5F21B 4D0DA 5HHME 2NTFB 1TJGH 1IBGL 2BNQD 3HLAA 1ND0A 3VFVB 3HPLB 4X5LA 1Z6JT 5CIPA 5E2TH 1QKZL 3GSVA 5GJTL 3T1WA 2LFGA 3P0VL 5GS0D 4KWUA 3ISWA 4HUKB 5L7XH 4JFHE 4FFVC 4NO3A 1DANT 1GRWA 4GG6A 3V6ZB 4U1JA 5TH2B 1P4LB 5CBAB 4JRXA 1GHFH 4IRSC 4GAGL 4UBDC 2FIKA 1T1ZB 2ZUYA 3B9KC 2X1WL 1JK8B 5J6HB 4NQEB 1MEXH 3ZE0E 3LPFA 1G7IA 3R1GH 3PDOB 4HC1H 4Z0XA 5GJSL 4ORGA 3TN0B 1S9WB 2DYPA 3EYFA 4WU5B 5HJ3B 1OGTA 2AXHA 4LCIH 3FT2A 1E4WL 4KHXL 4FXLA 5E4EB 2YS4A 4LLQB 1FL5B 3BEVB 4NNXB 2R69L 3QZWB 3QAZB 3NIFE 1EDQA 1OAZH 1OAUH 3KJ6L 3REVA 4NKMB 4KJWD 3FTGB 4IIQC 1GGBH 4PJHE 3U4EB 4MA3A 2AQ1A 4L1HA 1WF5A 5IR1B 4J3TA 5KVDH 3RVWC 2K7PA 5L0QC 2B1AL 2J12B 5IG7A 4JDZB 1NGZA 2H45A 2GSIB 1LO4L 2H6PA 2P24A 3IRZA 2P5EE 4N9GB 3F6IA 1I75A 3RWHA 1FJ1A 1HOCB 1I1FB 4KTDH 4R96B 3BSZH 2BX5A 4M6OH 3V95A 3CIQA 4JFEA 4QRRB 4WTZA 4OTXL 2KKQA 3ARFB 4JFFB 1IE5A 4JJHA 4S1SH 1PQZB 5JR1H 4HHAA 4LLVA 4ZS7L 3EJJX 3EYSL 4L9DA 2BNUA 2VR9A 3RQ3A 4PJGB 3LKRB 3HCVB 1KEGL 4WTXA 5I18H 4GBXA 1YJDC 1P6FA 3QUXC 1AKJB 3GSWB 3BAEH 4G80A 5A2IH 5KBNC 4NSKA 3QIWA 4YDJA 4RFNB 3ZE2F 1RSFA 5E6ID 2CXGA 4G42B 4NFCA 4M48H 4PTTA 3BZEA 1SJHA 3G04A 2XA8H 3QUML 4H26B 3RWJA 2CLRA 3H7LA 1HK6A 1IAIM 4WI7A 1ZLWK 3CC5B 3UZEA 3MQIA 4KVNL 3QCVL 4X6DA 4DW2H 2J8UE 4FQPA 2EYRA 4CW1A 2X6MA 4OFKA 3FQWB 3G6JB 2FX7L 4PJDA 3I6LE 1P1ZA 5DJ8A 2E6JA 1ZHLB 2PO6D 1I1YB 5FK9B 3W2DH 2KPNA 5FKAA 3RY4A 4C4KO 1QSFA 2YK1L 3UC0H 5EBWA 4M4PA 5B3NA 3TPUB 2DLGA 2MSPA 4XCEA 4PBXA 2VQUA 4H20H 3MOAH 1EXUB 2ID5A 4YHML 1RJCA 3LRSB 5T3XH 3TZVC 4X5XB 4YFLF 3MYJA 1I7RB 4Y4KA 4I77L 4HUWB 2W9LA 2XRAL 1WK0A 1MVUA 2YD7A 1G7PA 4PRID 3X14B 5JORB 3KXFE 4DN3H 1ZHBB 3P4OB 4K7PL 5IJVA 5FUZH 4QHMA 2R4RL 1UM5L 2F5BH 4JM2B 2IANB 1PFCA 4KY1H 2E5EA 4PJIA 2BY1A 5EZIL 3OGCA 1XIWA 5IFAH 3TEUA 4XBGA 2CLZB 2MPAL 5JW4M 2DQHL 3IDYC 4RZCA 1DQLL 4C56D 3QNZB 5E0QA 1S9XB 5HHMD 1T7VA 4DTGH 2WV3A 3MRQA 1JWMB 3CUPB 1OAKH 4W6XB 3S5LB 2D9CA 1UKQA 2VIRA 5A43C 4P23A 3BE1L 4QHNB 1KCSH 1R3HA 4LRNL 4X4YA 2HMID 4BFEA 3BH9A 1CLZL 5K33A 1CF8H 2YD2A 1FAKT 3DYOA 3M8OH 4XNUL 1EH9A 1U3YA 1XMWA 5ANMB 3ULUC 4MJ4A 4W70A 3VG9C 4BUHA 4ONGL 4JY5H 5FGCE 2FIRT 3TBVA 3T77A 4L3EE 1U92A 5ISZA 3JUZA 4JKMA 2CGRL 3P2TA 4O02L 5KVEL 2HA1A 4I0PD 4XC3H 3Q3GA 2O5XH 4M61B 1VGEL 1GC1L 3J8F7 4KVCL 4G3YH 2VKXA 4KJQD 4HIEB 2OTUB 2R0WL 2ZJSH 5BRZD 4UQ2B 1PKQB 4WGWB 5EZLA 1UM4H 2ZUQB 2IPTL 4OSUH 5D7LA 3VU2A 4U6VL 1OARL 3BXNB 3Q5TA 4NM8L 1BBJA 1BVZA 1AI1L 5HXMA 5CFHA 1NBYB 3PWUB 4L4VD 1EA9C 5KTEH 4ZUVB 3TO4C 4XMLH 3FN9A 1VKXA 2BRQA 4NO3B 1KG0A 1A6UL 3OKDA 3FQUB 4FTVE 4IMLA 3WKNA 2BVTA 5I1CL 3ZTNL 3F6LA 4HGMA 3X3GH 4C4KT 3HNVH 4K94L 4J3WA 4H0GA 3VGEA 3X3FL 4OD2B 4M7JH 3GMNA 3T3PE 2ZUXA 1YY8A 2CIKA 3NPSB 1M6OB 3PNWB 1XFPA 3PHQB 1RZGB 5C0IA 5E99L 4OFYD 4P9HH 4U31A 4PRHE 1T7YA 3T0XA 2P5ED 3EYFB 1DEEA 1DBMH 1OGTB 4GMTL 5ECJE 3FT2B 4CU7A 5CUSH 1MUJA 1BD2D 2J88L 2ZOLB 2VUOA 4LRIC 2C1PB 4M7LT 2ZKHL 5F1NB 3WDIA 1K9TA 3IJYA 4EN3D 4JG0L 1IQWH 3BKJL 3P73A 4LEXH 1X4YA 1GSMA 5EA0H 3PP3K 1A7QL 2P47B 4X6EB 4O2CB 4AQOA 4BZ1L 3KPRE 4P5TD 1J1PL 3DMMC 3MLSL 3SDCD 1KIRA 2O5ZH 4WGVB 4ZFOA 2HT3D 3DETC 3EOAB 1Z5LB 4PJGF 3VI3E 5JQ6H 3KLHC 4ZNCD 3F62A 2NXYC 4NRXB 1QFUL 1T0MB 3LQAH 1WBYA 3MRDB 3RWHB 1FJ1B 1X5AA 1EVUA 3IRPX 3STZB 3JWOH 6FABL 1WZLA 1QFPA 3C6LB 4W6WB 1BX2B 3WO3B 12E8H 1EEYB 4P4RA 4YIQA 2OZ4H 1RI8A 4KTYA 2XN9B 3H9HA 1T03H 2BNUB 5BXFA 3RJQB 4MVBC 1BFTA 2VISB 4DJMA 2EH8L 5DF0A 4R0LC 2IADA 2BVPB 3X13B 3RZCB 4BFIA 2YPVL 3BW9A 1UVQB 3HNTL 5JW4R 1DBBH 1A3LL 4OAWA 1YN7A 5KANG 2FH8A 3K2UH 2Z92B 3G6JF 4P4KB 1SJHB 5TFSH 3G04B 4XPTH 3QEHA 1NBVL 4YXHL 3HMXA 2HFTA 4QXGH 2VOTA 3BKCH 3V9FA 1J87A 4YLQT 3VFUA 3TBSA 5I75C 4RMQA 5D1XC 3KDMA 3FB5A 1IZKA 5I17B 1T1XB 4MD5A 4NO5B 4JRWA 4YWGH 1MCBA 3VRJA 4DFIA 3ILQC 5DJ2B 1CICD 3KYNB 1RMFH 4QYOB 4JPWL 4P59L 1RFDH 4OQ1A 2APXA 4CW1B 4TUOB 4ESKA 1S7RA 2C1OA 3R8BB 5EFIA 2YWZA 3KXFD 1JF6A 4N1EA 3MXVL 3VGDA 1T2JA 5HYJE 4LCWE 2JIXB 1Z9LA 4X9BA 4AMKL 4KKBC 3WYRA 1KLUA 4HBCL 2EIBA 3EIFA 5GGSY 3UBXA 3MV9A 2AEPL 4WI4A 4Y4HD 3D48R 5HI5C 5H35A 5DD0L 1T89A 3OKKB 5DJCB 2Z93B 3P9WB 3BKYL 3QPXL 3D69A 4JM2F 4M7ZC 2AXFB 2VDKH 4ZO7A 1GL4B 1RZ8A 4F8TA 2NY1B 2YD5A 4LBEA 4PJCE 3V2AR 1IGCL 1D5XA 5JHLL 5AAWA 1A7NL 1Q1JL 5CLTA 1DN2A 5T1LA 3TT3L 3EYUH 3IAGC 2DWDB 4I3SL 4AK1A 5DFTA 4ODVL 1QD0A 3L3DB 5IW1B 5C2BL 1KPUA 2YZ8A 3TV3L 1F4AA 3NCJL 4I3RH 5EO9A 3OGCB 3B9EA 3BFOA 1UB5A 3VG0L 1JGUL 3PQYB 2IQAA 5A1AA 1A1MA 3PGCB 1YNKL 2WINA 3EOYG 4RWYH 3P9MA 2PNDA 2HVJA 4OCXL 1AC0A 5BMFL 3TBTA 1UJ3C 1X5JA 2EDWA 2DLIA 5A3ID 2FX9L 1HCVA 1NFDA 1R3HB 3KWWB 5CCKH 3PABA 3TJHC 3FQTB 2V9TA 4PREA 5FDWA 1KCRL 4Q6IC 3EO0A 2Q6WA 3GMOA 4AIXA 3W5MA 2RFXA 3NACL 2HYMA 1TZHA 4MQ7A 3RVXD 1BQHA 5ISZB 4NKIH 4Q2ZB 1JI2A 2C3GA 2ZSVB 5F1OB 1GGIL 1KOAA 1LK2A 3W9DA 4ZUTA 1YMHB 3HI1A 2I24N 4JVWA 1J0IA 3E3QC 3CAFA 3L3GA 1LEKB 5EZLB 4HWZB 2AJVL 5CEXB 2WUBL 1AO7B 3LEXA 4UT6H 3ARZA 3GO1L 1AIFB 4X4MA 4HKZA 4QOKB 1I3UA 4GAFB 4Y1AE 3WIFA 4M4RA 1FAIL 3OAZH 3QRGH 1QFWH 3QNYA 3ESVF 3G6DH 4IMLB 4PD4K 3GSNL 4JKKA 3EOTH 3MRIA 3ROLA 4GQ9L 4HWBL 3Q48A 2G5BA 1F42A 2FNBA 3AU1A 4NRYB 2CIKB 1QP1A 1LO0H 3RPIB 3AXLB 3GMLB 5C08D 2ZNXA 4FMFA 3SDDB 5E56A 5GGVL 1GPOH 4K8RH 2XV6B 2WP3O 1Q38A 4OLVH 4HX1B 1DEEB 4HPOL 1L0QA 1QA9A 3DROA 3MRGA 5HHOD 4I13B 3DX7B 2Q7NA 3RIAK 2FO1A 4X80L 3IJYB 3RL2B 3CK0L 3TA3A 3HAEB 3B2VL 4NQDB 1OM3H 1XCQB 2BMKB 3GSXA 4DGYL 3FHQA 1MNUH 1YJDH 4FQLH 2H2PD 3PWPD 5IEKA 4WHDA 4Z77B 2L7UA 3QIUB 1INEL 4P2RB 4NJ9H 2J4WH 1KJ3H 5JPMB 4BH7A 4C83B 5C0DA 2X1QA 1FVDA 4G5ZH 1PLGL 3ZKQD 1OSPL 3UJIL 4LCCA 3WLWC 5SWSE 4HMEA 3K4ZA 4Z76B 1CFVH 3CU1A 3F58H 4QRQB 2DBLH 5F7NC 2F8VA 4PLOB 4YIQB 1DE4B 2W38A 1UB6B 2K7QA 2RBLA 2VQ1B 3BO8A 25C8L 1FLRL 4X8XA 4Z7UB 4UINH 1N5YL 5DI8A 1WGOA 2ICEB 1FFNA 4XPHL 4KPHH 1L4IA 4N0RA 3RKDC 3WEXA 5F3HA 4YEEA 5E2VL 4XAWH 3FB6B 5I16B 4GW5A 2WWMC 4R7NA 1J8HE 4HAFA 3E8UH 3PGDA 4HUUA 5ITFA 2D7TH 2EE9A 5HDBF 1OSZA 4XH2B 2PKDA 3U7AA 4TVPL 3ARGA 4NC0B 1DQDL 1UH3A 3NBNA 8CGTA 5DQ9B 5D2NB 3TBSB 4F7TB 1DFBH 4G8IB 3TFKD 4J1UA 3LPWA 4DAGH 3KDMB 3FB5B 1OD9A 1HWHB 4FFWC 3WXVH 4BQ6A 1CFQA 3LEYL 1RV6X 2PYED 3M45A 3S7GA 4Z8FL 4TUJA 1KPVB 1F6AB 4X7FC 4K3GA 4OLYL 2H9GA 2WQRA 3PG2A 4N68A 5EFIB 1YPZA 3MC0A 4HZLB 4LLYA 1NBZB 4PLJC 1EUUA 3L6FA 3VXUA 5C0FA 4IHOB 3RNKB 2FHCA 2D7MA 4ODHH 5INDA 3S4SB 3O3UN 4FNLL 3STBA 5H35B 2XFXA 4BH8A 4DUWA 5IKCA 2WNGA 2OJEA 1E4XH 1GIGH 1KJ2A 2ICCA 4GKNB 4ODSL 2XYCA 1SBSH 1BF2A 5GXBB 2BVEA 3H7BA 4CL7A 3CXDL 3BKML 1RIHL 4PJ8A 4PJIF 3ZHDA 2WP3T 3CMOL 3VFOB 1UZ8B 3IFPA 2HJFA 3ZL4H 4LBEB 1JNJA 3MYZA 1NGPH 5TPWL 3KYAA 5E94B 2FB4H 3B5TA 1ZSDB 1N7MH 2Z31D 4NQEE 5K93A 1NMAH 2CH8A 5LCVH 1GOHA 4PUBL 1HYSD 5J13B 1M7DB 3I3EA 4ZO9A 5JUEH 4IOIA 1QYGH 3IVKA 3CVHL 4H5SA 1XF4A 2AV1B 1MCWW 1I3VA 4YXKL 4XX1E 1P84J 2V7NA 3FONA 3UTTD 4ZUSA 2DQUH 1HKLH 4I2XA 3U7WL 5H37G 3AREA 4Y7MA 3L5XL 4J7RA 4MAYC 4ERSL 1KENL 1MCPH 1U95A 5B39A 4PLNC 2N4IA 4HCRH 4Y19B 4XP9H 5EWIL 1AGFB 5E9DD 1URLA 2DM3A 4IRJB 1JZ4A 4OFIA 3TIEB 4KTEH 2YXMA 4QRRE 2RFXB 5E2WH 4YK4B 1SY6A 3BESR 3IDMB 3FFCD 3ARVA 5D7SL 1TQBB 3RGVA 2AI0L 5ETUA 4M6NL 1SJEB 4X6BA 1NAMA 1JHTA 3VH8A 2BSTB 1ITCA 1QSEA 3C08L 4WWKC 1F3DH 5ESVA 4HJ0C 1DEDA 3T0EE 1KPRA 1V5JA 2P8PA 3NCMA 2OCFD 2X89A 2VWEE 3SDXA 3OZ9L 3CZFA 2DI8A 1GH7A 4D9RD 3GKZA 1X5GA 5HI3D 2DAVA 1RAMA 1F4YL 1UJTA 2VDQH 1XZ0B 2BY2A 3KPSA 4K9EC 5JNYA 2I26N 3QHZH 1A7BA 4CU6A 2WLZA 4LLMA 4TSBL 4PP1C 3ROLB 1MH5B 2A9NL 3QDMD 3V4UL 3FQNB 3ULVL 2WM0A 1FP5A 3G6JE 1HDMB 2EICA 3VMPA 3IKCA 1FE8H 3L3OB 1ZVSA 4JPIB 5D1ZA 4QO1A 4XI5D 3OSKA 3C09C 1RJZB 3OX8A 1WLHA 4YHKH 1EJOH 5D96C 1G7HA 3V7AG 5C71A 3IU3A 1CIDA 1HNFA 3QEQA 2B2XH 1EAPA 3MBXL 4J8RA 1IC4H 4YHNB 1LMKA 2X4UA 3TA3B 4O2EA 2CK0H 3G9VA 3V5DA 4DVBB 3NFPA 4GFTB 4YZFF 2BVQA 2FEEL 1GAFL 4KI5C 3O2VH 2OQJB 5IEKB 1O7VA 3V8OA 2HT4C 5TF1H 3RAJL 2EDYA 2DL2A 1MVFA 1YECH 1MCJA 4QCIA 4P9ML 4Z7UF 2CKBH 4LSTH 4ZSOB 4G6ML 3BT2H 1AFVL 4JO2H 3QI9A 1UQSA 4XVSL 3MCLH 3VGGA 3BN9D 5JHDA 1F90L 1LILA 5I2IB 5FGBC 5C92A 1NJ9A 2R1XA 4MNHA 1CD9B 1FGNL 5DYOA 2H8PA 3SKOA 1FGVH 1X5FA 3DVIA 4FABH 3OMZA 2NXZB 1DLHA 1T20B 3F65A 1WBXB 1Q9KA 4UT9L 3TBWA 1UXWA 5EU6B 4XVJL 5DSCA 4HK0A 5JIPA 5DEFA 1TQCB 5DD1L 3TJEL 5DJDA 4PTUB 4X98A 4DZBB 4OLWH 3ARRA 1R3KA 3OAUL 3WEXB 2OP4L 4KDWA 1I9RH 3CFDA 1CDIA 3UYRH 4MD4A 3SY0B 1CVRA 1NMCC 4FXKB 5ANME 3MUGA 2WIIB 4EUPG 3ZKMC 3MJ7B 3VFPB 3KYMB 1CE1H 1FDLL 3LKQA 5SWZB 4J1UB 4P2QB 1OF2B 4QTHB 1RIUL 1G9NL 5T5NF 2OR7A 1CFQB 3MCG1 4HD9A 4WI9A 5C0JB 4MNQB 5DWUL 4G6JH 3GRWA 1U8PA 5GS0L 5F6IC 2PR4H 2R2EB 2Q7YA 2H9GB 4RDQF 3BOVA 4NQED 2FD6H 4NC1C 5GHWL 1PKQE 2OXHA 3TN0D 5ILTL 3L6FB 3R0NA 5IVOA 2VDOL 5CIPH 1EMTL 1NCDH 4WEBL 4QTIL 2HRPL 3U1SL 1GOFA 1KTLB 5F7LB 5FYLH 3QXVA 2XFXB 4D3CL 2X4SA 4JHBA 4IRSB 3QFJE 2AJYH 1AQKH 1EO8L 2FGWL 3WNMA 3FT3A 1RZKC 4XAKE 3B9KB 4JFQB 1S7SA 4PJ7A 1QFWI 4MZ3A 1TVHA 5IHUH 3LH2L 4OZFA 4LLUB 1VCAA 3U6RA 4FFYL 1KT2B 5D2LB 3L3KA 4S1QH 2R56L 4U1MA 4HS3B 1A22B 5CEZH 3U2SA 3VE0A 1F3JB 1VFAA 3QH3A 4XCFL 3AM8A 3MUJA 4QRRD 1ZA3A 1Q8MA 3C2AL 3BP6B 3BH8A 3HC0B 3ARFD 1R5VA 4JFFD 4XMKL 5E6ZA 3RWDA 4IIQB 2IJ0C 4ZUSB 1ED3A 1T3FB 2Y5EA 3L5IA 1U8KB 2HH0L 1MAMH 5E8NA 5K9OB 1II4E 5L0QB 3DBXA 4GSDL 2W9DL 3QUKA 3AREB 2VC2L 1AKJD 1PBYA 1RIVH 4GOSA 4NQXB 4FQ1L 4POUB 2DM2A 2X4TB 5FF6A 1U95B 4QRPA 1RU9L 1K4CA 4ONHB 1LEGA 2EDJA 4KMTH 5DJXB 2X70A 4ODUA 1DBAL 3QXTA 5BO1H 3E2HC 2IGFL 4XPAH 1CFSB 4E9LA 3QIBC 4W4NA 1G6RA 1HH9B 1P7QB 3DV4A 4DCQB 1IGYA 3VW3L 4O58H 4F3FB 4HUNB 4Y5YC 1YEJH 4LSQH 4FN0A 1C5CH 4QRTA 4KGJA 3QUXB 4OZGE 3IFOB 3A6OA 1R3LB 5E1AA 1BLNB 3RHWK 3IF1B 1JE6A 3ZTJH 1MI5B 1JPFA 5MENE 3EYVB 1FG2B 1OW0C 3EJYC 5ESVB 5GGSB 4NBYB 3HA0A 2P8PB 3CNKA 5EUKA 3SDXB 1A0QL 3GHBH 3KPQA 2Y36L 3N1PC 3EFFB 5C07A 2H32A 4JFXA 1FC2D 4OGXH 1E6OL 3ARUA 2F53B 3DGGA 4QT5A 2O5YL 4JQXC 2VXVL 3C5SA 4KU1A 3SGJA 4WI3A 3QDJA 3TH2T 3NH7H 4YNYB 3KYKL 3IGAA 3OQ3B 4JAMA 2FJHA 3REWB 1IC5H 1ACYH 3VFGL 2ZUTA 4N1CA 3UDWC 4H25A 5IBTL 3FO2A 3DTXA 4OCNC 5C0ND 4ETQA 3EDJA 3BQUC 1ZVSB 3ZT7A 3C8KA 1OT1A 3OX8B 4L5FL 2X42A 32C2B 2XZCL 4S0TD 4UIKH 2ORBL 3QJHA 4JM2D 5I15H 2IAND 3NAAL 4ZOCA 4M1DL 4W4OC 5C3LD 2PTTB 1A6VL 3TZVB 3O3AB 1NLBH 4AT6B 1BOGA 2F74B 2ZP0T 3RU8L 1KBGL 2N7BA 5HYIA 3TP4A 3AS0A 1INQA 3MRPB 2VDLH 4KGLA 2FBJH 1U3ZA 2D7OA 4DGIH 1E4XI 2XA3A 1WC7B 3VWKA 2BVQB 1G7JB 3CU7A 4JLRB 3OKNA 3IDIA 3EO1B 5GGQH 4U1HA 3GFUA 3T0AA 1MHHA 2EYSA 3MLRL 4O5LH 4AJ0A 4MQXD 1NLDH 3GBMH 4APQC 3RA7L 4NM4H 1UQSB 2XY2A 3EDEA 5I8EB 3LZFH 4QLRA 2Q86B 4L4TA 4RNRA 1NJ9B 2B20A 4FQIH 4ELKB 3SHSA 3BP4A 5MHSE 4FQJH 2W59A 5H2BA 3FO9A 3RPKA 5ENWA 3PQYE 5HPMB 3ALPA 3RRQA 4ZXBA 2V17L 2D03L 1EGJH 1W72L 4Z7OF 4PJ5A 4X98B 1R3KB 5JA8B 1N8ZA 3FB7A 4OQTL 3QA3A 2E3VA 2UVEA 1Z3GH 5IVXB 5C0BE 3VG9B 2W9EL 5FM8A 3SDAA 4LKCB 2E9BA 2X09A 2DQIH 5DT1L 4M7LL 1I1AC 3O2DA 5GPRA 1MPAL 5FUOL 3AVEA 1FHGA 4F33A 4NQCA 2O61B 1DUZB 4TVSa 5CS7A 2AJXH 3T0DA 4PJBA 3NIGF 4C59B 5EUOB 2XWTB 3MJ9A 4MNGE 3S34H 3WXWH 4MD0B 3GIVB 1SYSB 2L7JA 4OZIB 4RIRB 2EKSA 3I3DA 4GKSB 2AJUH 1SMOA 4OLZL 1KACB 3OKYA 5L2KA 1AO7E 4JB9H 3TO4B 2R0ZL 4K2UH 4M5YH 3NCEB 4S10A 4POZC 3O4LB 3A0OA 4FQQB 4U6HA 4JHWL 4Z7VB 1S3KH 4QOKE 2A6DB 5D2LF 3QWRA 2FO4A 1U58B 1C5BL 1LWRA 5IB1B 5HBBA 4XVTH 5TDOB 3W0WB 5HHVL 1ADQA 4G8EA 1NUDA 1WZKA 1TVHB 3PL6C 3O8XC 3HNSL 1XGYH 3MLWH 4LSPL 4DZ8A 1NDGB 4D9LL 1JRHH 4YHZH 1MJJA 4EZMA 4JY6B 4ELMA 5I18L 3IDJB 1UCBL 3VXOB 1QUNA 4J6RL 2X05A 5TGBA 3G08A 3RX7A 3QXUA 3K4DA 4KK8C 3MRRB 4LASH 3C6LD 1ZANL 3BZFA 4OD1H 4HJJL 2PCPB 4RMWA 3BH8B 1FZOA 1Q0YL 2L4OA 2XN9D 4Y2DC 3DMMB 2E6PA 1A2YB 1UM6H 4JQIL 4OM0L 2IPUG 3OJDB 3RVVD 3WIHA 3F5WA 5CHNA 5A2FA 5IMKA 3DBXB 4WCYL 1CGXA 2QR0A 4JG1L 5GGUA 5J11C 1F2XK 5DO2D 4FQXA 5T3ZH 5BJTB 5D5MA 2NXYB 3RZCD 4LMQI 1UYWH 2AK1L 2P1YA 1GZQB 3CDFA 1RZFL 3RDTC 1D5MA 4P4KD 4HH9A 4ALAH 1CT8B 3W39B 3STLA 2A6IA 2X40A 1YEFL 3GMRB 1TENA 1KIQB 3QDAA 3DV4B 4YZFE 1F4WL 3SDXF 5CSZA 4TPRH 1DN0B 2QKIA 2IALA 3WD5H 4PJ9C 3TBYA 1HKFA 3NGBC 3RWCB 5C09A 3WNLA 1W8OA 4AL8H 1J0KA 4Z7UE 1HILB 3DX6A 1OGAA 4HIIB 1UADC 3ALXA 3GI8L 1ZLVH 2D4FA 3HZKB 3ZSTA 1BGXH 2NY0C 1R0AH 3MNZB 2DLFH 4YUEL 5T3XL 1FO0L 2JIXD 3GMPA 1RULH 5H8DA 1WZ1H 2D0FA 3PP4L 5I75B 5D1XB 4QT5B 4UILH 4FQCH 3HS0A 5DZLA 3JWDC 3HMXH 2HKHL 5EU5A 5I1EL 3N1FC 1UCTA 3GK8H 3MLVH 5HGDA 1FSKC 3QFDB 4GW4A 5DUBB 1JWUB 1E4KC 2NY1D 3O3BB 4R4BB 3TGXA 4Y5XC 2DDQH 2AJSH 1SVCP 5IFAL 3NMEA 1REIA 1D5ZB 2BNRB 2Q8BL 3OR7A 2ITDA 1F3DJ 1FYTB 5CD5D 3OAYK 4OT1L 2Y07L 2OSLB 4K07A 2VDPH 5LBSL 3B2UD 5J1AB 5SX5H 5J8OA 5JDSA 4CUCA 4M7ZB 5L2JA 3PWNA 4H88H 2ZPKH 3KYOA 4PJAA 5C0CA 3IJSA 3PQYD 3MO1A 3CFBA 1JZ8A 1OT2A 3M8OL 4X8JB 5KN5B 4JZNB 3S3PA 4YR6B 4ZS6C 4B41A 4XXCA 4PR5A 1JIBA 4BSVA 4G8FB 2BHUA 1CZ8L 1CL7L 5TF0A 1YEHL 1HSAB 2B0SH 1IAKA 2IAMC 4HF5L 2AV7B 1BJ8A 1AC6A 1FPTH 1FRGL 4UDUB 2VZ1A 1U8LB 4B7LA 5AUMA 2ZCHL 4KKCC 2E27L 4G8GB 3LN5A 1B6UA 4NJAH 4L4TB 3ULUF 3RWFA 5IVXF 1B0GB 4M9OA 4TNWF 3BP4B 5IFHL 1YEIL 3S35L 5IHBA 5ISZD 4ODXB 3MRNB 3QXAB 5DQDH 4U1LB 4GG8A 2AJZA 1OB1B 1XH3A 1J1XL 1UJ3B 1Y0LA 3LS4H 1BEYL 1RK0A 3VI4F 3WL9A 1OTUC 4PJ5B 3V6OC 5EUOF 5HVGB 1N8ZB 4OLUH 4QWWD 5EO1B 4XPFH 1BF8A 5JO5A 3FB7B 3QA3B 4GRMA 2X7LA 4P46C 4Y19E 3TM6A 2EDEA 3HNVL 2VXUH 1CFTB 3G9AB 5B8CA 4OZIF 3B83A 4M7JL 2JJSC 5GGRA 3EOBA 5JXEC 1S8DA 4LP5A 4M93C 4QOKD 3GKWL 3BUTA 1WCBA 3F7YA 1MFBH 4P9HL 1YYML 3ARPA 5DK0B 1MWAH 4Z7VF 1OPGH 1DBJH 4AEHL 4Z5RB 5AWNH 4HQQH 3D0LA 2FWOB 3SBWA 4PJFA 3DPBA 1CI5A 4LOUD 4MB5A 3N1GC 3SDDD 5IMMA 1MCNA 3C60C 3HI6L 5F44A 1QBLH 3MRBB 5L2KB 1W0WA 3RL1B 3UEZA 4GKZB 1ZS8B 3WFBL 4YHLH 5J9PA 1JTPA 1FZMA 5IF0A 2VUYA 3Q1SL 3QDGE 4U6HB 2MCG1 4LCUA 5L8KB 2O5ZL 1GJIA 1JTOA 1E28A 3MLTB 1GC1C 1JV5A 3EFDH 1BBDL 5JQ6L 3DXAE 3JV6B 4NQDD 5L6YH 5J12C 3VXNA 3FQRB 3CVHA 4KDVA 3D3VA 3INUH 5LG1A 2EDLA 4CNIB 1EPFA 3QIUD 4OIAA 4P2RD 4YGVB 3SOBH 3JV0A 4DZ8B 4YDIH 4YAQA 1KYOJ 4PY8I 1HHHB 3T65B 4XPGL 4ELMB 3O2WH 1J0ZA 1M05B 4RGNE 1A1NA 3G08B 4IOFD 1NCCL 2Z8RA 2XY1A 4WW2A 2VSDA 3DVGA 1XAUA 3I2CL 3DO7B 5INCB 4AEIL 5TFSL 5F8RC 1IEAA 1YY9C 2CQVA 1LK3L 2HJKA 2VN7A 2UVFA 5GS1A 1T4KB 3LKSA 5ICXB 4NZDA 4FG6C 4TYUA 4H8WH 4HEPG 5GGUB 1KCKA 2DQGL 3V5KB 4CVUA 4LIQL 4KDTC 1U8MB 1T0NB 4L8SA 2GTZB 3UROR 3MRMB 3LV3B 1ZGLB 3UYOD 3VJ6A 4U1KA 3NCYP 3Q6GL 3IFNL 4ZPVB 4ZSOE 2A6IB 4OCYH 5F7DA 1IGIL 2HP4A 3NABL 1JHLL 1PY4A 3HFMH 2DMCA 3WUZA 4UIMA 2MQ0A 1JGEA 1OAXL 2OMNA 2VLJA 5DA4A 4JRYA 3SE4A 1WVZA 4CJ0A 3HZVA 4ENEC 3NZHH 4KK9C 4HKBB 5C09B 1S5IL 3DRQB 4EOWH 3VXSA 2HLFC 4KRMB 4N0UE 4GAYA 5IB2A 5LWYL 3KNBA 3MRJB 2A2QT 3KPMB 1HE7A 1F5WA 3FO1A 3HUJA 4HFUH 9CGTA 1HEZB 4MXWL 4NKDB 1T83C 1IEBA 4KJPD 1LP9E 5T5FH 5EN2A 2Y5TB 4L9LA 5EU5B 2YPLB 4Z7OE 2D31A 1S7TA 2E9IA 5SWZE 1RUAH 4P2QE 2R0LH 1YEEL 4NYLA 1QVOB 5IGXH 2HVKB 3GSRB 2R1YA 3VXPA 4XVUC 3BVNA 3MBEA 3MNVB 1EHLL 4NN5C 5T1LD 2AABH 1I9EA 4QHUA 3KLAB 4QKXB 1XCTB 1C12A 3SDAC 3PWJA 2ADFH 3ZYZA 3VD5A 2DOCA 5DRWA 1G7MB 1BFVL 1KJ2H 2VL5B 1QLEL 1VFBB 1TJHL 1HQRA 5D72H 4N9OB 3HE7A 3GMMA 4JZJC 3ZYIA 1M7IB 3HE6A 43CAB 3BUYA 1LQSR 3DIFA 5BV7L 3BMVA 1MCLA 4XNMB 5EIVA 5BS0A 5FFLA 5D2LE 4PY8J 4Y19D 4KUZH 1KB5B 5JMRA 3N9GH 4ZFZB 4Z0BL 1NAKL 2AEWA 5DRXB 5DS8A 1QO3A 3O81A 3QQ4B 4OZ4A 1INDH 2YWYA 2ZG3A 1DQQA 5B4MC 4KKLC 5IQ7H 1S9VB 3T3ME 1AGCB 2WBJA 1WAAA 3GUTA 3ECBB 4GG8B 4Z7WE 3S8WA 5TE4H 3T4AA 4DKFH 1RJYA 2P8MA 4LLDB 3SE8L 3F8UB 3ZE1F 3LIZL 4EDXA 2F54B 1CG9B 3OG6B 5GGTL 3G6DL 4TRPH 1N5AB 2X7LB 3FT4B 1S7XB 1FNGA 4ZO8A 4RGOH 1NEZG 2Q76A 3DYMA 4ZFGH 4JFOA 4NN6B 2BVYA 4MA8L 2BC4A 2NLJA 3CXHK 1IBGH 1TETL 4CJ1A 4U7MA 4WWKB 2VYRE 4ZQKA 4XP4L 4OLVL 1T5XB 4WV1A 4LPUA 1QKZH 4P5MA 2HN7A 3MRLA 5GJTH 1VACA 3RP1A 5FOJA 3P0VH 3I02B 3OF6D 1NAMH 4K7PY 1TPXB 1AGBA 1KUMA 1ZV5A 3WE6B 1EEUA 3LAFA 5IQ9B 5IOPB 1OM3L 5K59E 4YQXL 2VDRH 2OYPA 3V5HB 4J3OC 3U46A 1Y18A 3LRGA 5FO8A 5J9PB 2GTWB 3TCLA 2ICWI 4HFWA 4LCUB 5E2UL 2VLKE 2X9XA 3VGFA 1JV5B 5ESQB 1UWXK 4ELMF 1K3IA 3TA3D 1LNUB 1DANU 4NO2B 4G5ZL 1CXLA 5KS9E 5DD3L 3QR2A 3VXQB 3ES6B 3KG5A 1CFVL 3C09B 5D96B 4XCYA 1E4WH 4BFBD 2VAJA 3S96B 4XGZB 2D0GA 5DJ6A 2R69H 4R26L 1Z9SA 5FYJE 1I85C 5DD6A 1G7LB 2CR6A 4RFEB 3QG6B 3T2PA 3KJ6H 4OI9A 3WO4C 4KPHL 3AMLA 5DMGD 2JJTA 4EBQL 1IGJB 4N8VG 2EZ0D 4U3CA 2NXZD 3DVFA 4Q9QL 2B1AH 4WI5A 1Q72L 5F89A 4XPBL 5EU6D 1VGKA 4JFPB 5D6CB 1RK1B 2ESVE 1LO4H 5KSAC 3EHBC 3IFLL 1CGSL 4ZYKB 5GS1B 1AHWC 3QEGH 1X44A 43C9A 4F7EB 1T1WA 3WKML 3WSQL 1DFBL 2AXJA 3L5WB 4LPYA 3HZMA 4OTXH 5E00A 3UTZB 3WXVL 5JZ7C 3OHXB 2GK0A 2JCCE 3DI2B 2W0PA 3WJLC 1NGWA 1ES0B 1NFIB 3LDBC 4N0YH 4ZS7H 5E8OB 3EYSH 7FABL 4EUPB 2BERA 1KEGH 4UNTA 4JN1L 4QHLA 3GGWA 4XHQA 5C9JB 1FNFA 4P2QD 1NANI 3QUZA 1UZ6E 2CDEB 2N7AA 2DIJA 4MNQD 1K5NB 5MEQA 4MSWA 5FA4B 3QUMH 1A21A 1JF1A 1U6AL 3CVIL 2P44B 4Y2OA 2K3TA 5E5MA 2PO6A 4EXKA 5I8KL 3MUHL 4KVNH 3UJJL 4FFVD 1F97A 2FHBA 5CBEA 1D6VL 4QRSA 3JVGC 1OVZA 1F3RB 1J1OL 2KQMA 5JW5A 2V2TB 5I74C 1A9EA 2FX7H 3GM8A 4L9LB 3WHXB 4IRSD 5BOZG 2VL4A 2IPUK 4LP4A 5L88L 1S7TB 4UBDD 5TDNA 5EUOE 4X6CE 4WW1A 3Q6FB 3B9KD 5JUEL 4Y8AA 1ZK9A 3PHSA 1J9CT 1TCMA 3K8LA 3G5ZA 4AH2A 2YK1H 4A6YB 2VE6A 1JFQH 1CE6B 4RAHA 3MBEB 5C0EA 1TDQA 1NQBA 4NFDA 4PRIA 3ARSA 3CX2A 4HUVA 5KSBA 2MKLC 3LB6C 4QHUB 4RA0C 1N59B 1MFEL 1VERA 2AK4E 5JTWA 2ICWJ 3BYTA 5D7JC 4DN4H 3HMWL 5KW9H 1MJUL 3VFSB 4Z7VE 3PWJB 4XRCA 1IKFL 4I77H 5CWSB 1MWAB 5ACLA 2XRAH 3U0PA 1RHFA 2OTPA 4UTBL 5C7XL 2YA2A 1UM5H 1P5VA 3ARED 2DD8L 4HWNA 3I6KB 4OZFH 5EZIH 3VFMA 3ZT6A 2AW2A 4JO4L 2MPAH 2BFVL 4LLAA 1QRNB 2DQHH 2VRAA 3GSQA 3O6LL 1DQLH 4MX7A 5F96L 4Z7QF 3O9WC 1P7QD 5HPOA 3QYCA 4PV8B 4OZ4B 2R23B 2RIKA 4U1SA 3ZKXC 4FXGA 4NNPH 3RGVD 5JIKA 3QUXD 4PGBB 3BE1H 1HNGA 4LVOC 4LRNH 4I0PA 4HLZG 5D9SA 1CLZH 1MI5D 2E7LA 4BYHA 3I75B 4MHHG 4U1IA 2V5MA 4JFYB 1U8JA 2BOCB 1WITA 3BJ91 4ONGH 1L6ZA 2C3WA 5BRZA 5DQJA 1NDMA 3F7QA 2RJMA 2E7CA 3QIBB 4MJ5A 3IETA 4WY7H 3FQXA 3ZT5A 2F53D 3SDYL 4I18A 5KVEH 5EOTB 4G6AD 4L4VA 2YUWA 2Q76B 4U2YA 3AAZB 2ADGA 1GC1H 2EXWC 1K8IA 3C5JB 1JN6B 1JP5A 4KVCH 2BHYA 4W81A 2Z35B 4LCYB 4YHKL 1QSZA 2R0WH 4LMQE 1P69B 2UWEA 5AAMA 4QRUB 1OQOA 1CWVA 4OCSL 2IPTH 2ENYA 15C8L 5LGJB 4U6VH 1OARH 2B2XL 4NM8H 1OP5H 3HG1B 4PJHA 4M6AA 1A64A 1AI1H 2ATKA 3IDGA 1NCTA 5IVNA 1L9MA 1KJVB 2AEQL 3DSFL 3U30C 4Y88A 4OFYA 1D5IL 5FYJD 3RY5A 3RNQB 4NKOA 1A6UH 2P5EA 2CK0L 1H15A 3EO9L 3GHEL 3RY6C 4WO4C 1Y18B 1OP3H 3ZTNH 1PAMA 5I1CH 2NY5L 3O2VL 4JGJA 4K94H 3D6GA 2DLEA 3TZVD 5B22A 5TF1L 3D18A 5FOBB 4HFWB 2A83B 3C5ZC 2LU7A 4JZOA 1YECL 1ODAA 4XX1G 1YQ2A 2NCMA 3MJ8A 3UPRA 4UDTB 5CP3A 5E99H 5DHVH 3VXMB 4LF3A 4XNYL 2YXFA 3QZWG 3TO2A 5IB3B 5DZNA 3V6FA 3H6JA 1CD0A 4P5TA 4F58H 1YMMB 4GMTH 2VLRB 2HRLA 2BNRE 4KI5F 2J88H 3MTRA 5T1MA 1FQ9C 2ZKHH 5ICYA 2UUDH 3HR6A 4JG0H 4PRPB 3T0EC 5DD6B 2NX5B 3BKJH 5E7FA 2VWEC 4RBPH 1LHZA 4HGWA 1J18A 1A7QH 1BZ7B 4BZ1H 1AP2A 4HKXA 4WUUE 3IXTA 3O41A 1MHEB 1J1PH 1IJ9A 3MLSH 3ZHKA 4HS8L 1CGVA 4OV6F 2IH3A 2GW5A 4XC1L 5IV2A 4TTGA 3WLBA 1I9JL 5FA3A 1LD9B 1C08A 5IWLC 4Y16C 5IEHB 6FABH 4M6ML 4APQB 4O2FA 3HZMB 2G2RA 1QR1A 1ULVA 3RIFF 2X4QB 3ULUD 2GT9B 1EK3A 1SEBB 1I7UA 4Y4FC 2GK0B 4OD3L 5DVLA 1BHGA 3MODL 5FYLE 3UTQA 3BI9X 4XBPB 3T1FA 4ODWA 1JVKA 1FCCA 4G8GE 1F45A 4R4FL 1JZ2A 1GGTA 1XT5A 2EH8H 3SKMA 1BZ9B 1FO0A 1BIIA 4GG6E 5F88A 2YPVH 2QADB 3QUZB 4JRXE 1A3LH 3RVUC 3WS6C 1CICA 3UO1L 1QQDB 3WFCL 2GJJA 1T0PB 4MSWB 3L3IA 5GGVY 1NBVH 3D0VA 4YXHH 2AJYL 2XTJB 3KXFA 4MDJB 4NQVB 1I1AB 3SE3C 1IL1B 5CEZE 2V9RA 3TO4D 2P4AB 1ZOXA 4HS6A 1EFXB 3O4LD 5CBEB 4JPWH 4P59H 1HSBA 4Y4HA 5F97E 5JW5B 2X4RB 2EDBA 4HK3N 2W65A 4FRWA 1FBIL 3W0WD 1FFOA 5TDNB 5CEZL 4WW1B 2YD8A 4AMKH 1CTOA 4D9QE 4HBCH 3IKKA 5IHZB 1XGPA 2CMRL 3E3QE 2ITCB 3IB4A 4MS8C 1ORQA 1OAYL 5FECA 4EIGB 2AEPH 3CXHJ 4GXUN 5DD0H 2MQ3A 5A16B 2OK0L 5D93C 1JNHA 2OL3B 3CSPA 4LNRB 1NMBL 5GSRA 1U8OA 4KH2A 4HUXA 2F19H 5MEPB 3BKYH 4LSRH 3QPXH 4MXVF 1HHIB 4V1DB 5EU3B 3BWUC 1G9NC 1FFRA 4LFHG 1FORH 2NNAA 1FNEA 1AQDA 5FYKD 1IGCH 3LHPL 2M1KA 2YEZB 2XZAL 5JHLH 1MCCA 3OGOE 4YPGA 1Q1JH 1P5UA 4L3EA 3MUZ1 3O8XB 3DMMD 3I6GA 1VSCA 3TT3H 1F8TL 4I3SH 4DGVL 1S5HA 3L7EB 5BO1L 1W2KT 4P57B 1CFNA 4ODVH 2H2SC 2VQTA 3DETD 3NCJH 3WJJA 2P48B 1CS6A 3KLHD 3G5VB 2NXYD 2EYTB 1NL0L 3BRGC 5GSVA 1J10A 3VG0H 1JGUH 1B0RB 5CSGA 4O00A 5ERWA 1YNKH 5CZVL 4CU8A 5IHLB 2EDXA 3DUSB 5LAXB 1FVCA 5BMFH 4HDIB 4MVBD 4JE4B 1MIEH 4OGXL 4F2MA 1MFCH 2FX9H 4M8QB 1JZ6A 3MLZL 2BDNL 5KSVB 1PGRB 4PJDE 3T4YB 5E8DL 1IARB 5F1IA 4GQPH 1U91A 2VZOA 4PRHA 4DWHA 1H3VA 1QSFE 2V7HA 3IETB 1U3JA 2VB5A 5D1XD 4I18B 5F8QC 1FIEA 2J5LC 3MRCB 5F9JA 1SYVA 3ILQD 3NGBB 3LN4B 5IROA 2RCSL 1ZTXL 4PRAA 2AJVH 3LSOB 2WUBH 4PGEA 2NY0B 4HWUA 3GO1H 4C54A 1MLBB 2J6EA 1IGML 2BY3A 4KKBD 1FAIH 1FYTD 1Z9OA 2CLVA 4NGHL 1P7KB 4ZO6A 2H26B 4YDVB 3ARDB 4AZ8A 1H15B 3DUUA 3QISA 1KGCD 1F11B 5E6IC 4GQ9H 4M5ZL 1FSKB 5MI0C 4HWBH 1HQ4B 3D18B 3EJZC 1NEUA 3GJEB 4JZOB 2YPLE 4WU7A 4Y5XB 4JHAL 3G5YB 3MJ8B 3H9ZA 5GGVH 1HHGB 3QUMB 2AKRA 1K3ZA 3DHJA 4I8DA 1U8IA 5EIIA 1SQ2N 1RVFL 4HPOH 2ED9A 4X6FA 3QUYC 2BVOB 4JQVC 1YQVH 1BJ1H 4XP6L 1W0VA 3CK0H 4F80A 1FV1B 3B2VH 2DMKA 4FZEL 3QSKB 1D6EB 4ZODA 3NFNB 3CDGA 2EEBA 4P5KA 1HHKA 5F72S 3T2QA 4JJ5B 3O41B 4L4TD 3GZKA 4M3JA 5GRJL 2GAZA 4MWFA 3LQZB 2J8UB 2NW2A 4RQQB 5IV2B 1AE6L 4BELD 1PZ5B 3VGAC 5I1DA 4AIZB 4PRNA 1OSPH 2IAMB 1X9QA 4PJ5D 3UJIH 1XGTB 1C08B 3HRZA 4DK3A 5HYJA 4LCWA 5KVFL 3KHQA 4IDJL 1I7UB 2ADIA 1HHJA 25C8H 3N06B 3JV5A 1FLRH 2A6KA 4YH6A 1D9KC 3X11B 3SO3B 1OP9A 1T04A 1N5YH 1H8SA 4UTAH 3QCUL 1I3GL 1DQJB 5DJAB 4ZFFB 3SJVE 2C7UB 4TQEL 5DUML 4KRLB 5E2VH 3A6BL 4U33A 4M5YL 5J3HD 1X7QB 4FQ2L 1IC1A 2PYEA 4JY4B 5BW7C 4E42A 5DVKA 4L8CA 4CVZA 5EC1B 4P46B 3D0VB 4TVPH 1DQDH 1FNSL 4LKXB 4LHUB 1R5IA 4J3XA 4M93B 4FZ8L 5L2KD 4ACPA 2DJUA 1FLTX 5IW6A 1DDHA 1XGQB 4HS6B 1IKNA 5GZNC 1XGYL 3BP7A 4NHUB 2CJUL 2HMIC 5HGHA 2IH1A 4XHJC 4Z8FH 4XP1L 2X4NB 4OLYH 4YHZL 1U3HA 4N0FB 1XR9A 1FFOB 4F7CB 1RURL 1CD1B 2VZTA 5T3ZE 1I8MB 4BZ2L 1RZIB 2H3NA 4ISVA 1XGPB 3IAQA 5HHNB 1ORQB 3C60B 4YO0A 1H5BC 4FNLH 4GRLA 4L1DA 2VABA 3OKMB 4G6KL 3WN5A 4JCMA 5HYSG 3U7YL 5IM7B 3BP5A 3RWGB 2FZ3B 3CXDH 1RIHH 4PIRF 2HFEA 2R1WB 2XWJA 3U0WL 3CMOH 2IBBA 2B4CL 4DKAA 4ZOBA 5TPWH 3ILPB 3K1DA 4PJXE 5FGCB 4Y89A 2DQEL 5J12B 4LQFL 3UTTA 4L3EB 2FATH 2R2BB 4J3UA 4NC2B 4PUBH 1RZJL 3MZGB 1CFNB 1LDPL 4OLEA 1NGXA 4V2BA 4XTRD 5HSFA 1YN6A 4TSCL 2XG5A 3VFWB 3CVHH 4JO3L 4YXKH 3WUWA 4NUJB 3SCMC 3WLWD 4AY0A 4GUPA 2J3SA 2X4OB 3V4VL 3U7WH 1R0AL 3L5XH 4LSDA 5GGTA 4ERSH 4JANB 1KENH 2C26A 3FFCA 2R2HA 4FTVB 2P43B 3RKDD 2WLYA 5EWIH 2DQTL 4JFZL 5C09D 4FQCL 4EN3C 1AD0B 5ELIA 2WWMD 5EZJB 3G5XB 2YPKB 1B9ZA 1UWEL 5DK3A 3NIFF 4UQ3A 3QQ3B 1DZBA 2CDFA 1XGUA 4PRHB 2DWEA 3SDCC 3GNML 1RY7B 1FFPA 1ZHKB 5D7SH 4WFFE 4NZTL 2AI0H 2EIZA 4M6NH 3Q5OA 5IIEA 2C3HA 1HI6B 2HT3C 3MV9E 5FEBA 4FFWD 3EDDA 4LSSL 3C08H 1I4FB 2YUXA 1U8QA 5D1QC 4BZYA 4JREC 3OZ9H 3QJFB 5BZDA 4PLJD 3KPRB 5ID0A 3EYOA 1F4YH 2W0KA 1TJIL 2AQ3A 2BSSA 3GSOA 5E8EB 5IJKA 1LEIB 3VWJC 3DUUB 3UMTA 2FLRT 5I76A 5F1SA 4TSBH 5SWSA 2VO5A 2A9NH 3V4UH 1TCRB 5CEYA 1CIUA 1S7VB 3ULVH 5B38G 3OXRA 3QCTL 1GYAA 1LGVA 2QBWA 1T6VN 4DOHB 4E41B 5LJYH 1NH6A 1HCFX 2V6HA 4HXAL 1U8IB 4NN5B 3ARTA 1I7ZA 5F9AC 4NJAL 5F70A 4FQHA 3BPCA 4GT7A 1P4BL 2LAAA 2J8UF 1CQYA 2ARWA 5DQDL 2YHGA 2GCYA 4HW6A 5DR5L 3S88L 1FZKB 5DURB 1K2DB 3WS3A 3CDGB 3M17A 3Q0HA 2FRGP 1K85A 2W91A 5IB5A 4MA7L 5TE7L 3RAJH 1UA6L 4BQ8A 3T8XB 1R5WB 4LARL 3VRIB 4IBLT 5T1KB 3GB7A 4G6MH 2GFBB 1AFVH 1I3RB 4MXVE 2NTFA 3SGEH 1DL7L 3E6FA 2F54D 1F90H 4FP8L 3VFVA 3HPLA 3WNKA 1FN4B 2GY5A 5HYJB 4LCWB 3B4NA 1FGNH 5A2KH 1JGDB 1QRNE 3H3KA 1NEZB 4X4ME 4UT9H 4XVJH 1U0QA 1YA5A 1YUHA 3ZMRA 3C6SB 4EI5C 1JZ3A 1ZXQA 3OAUH 1KIPB 3CZJA 4JEGB 4LVEA 2WANA 3V6ZA 4HJ0D 3ZDXE 1V3LA 1ETZA 2OX5A 5BCAA 5TH2A 1P4LA 1NSNL 5T3ZD 4NCDA 4PJCB 4E42B 5FGSA 4ZAKC 1X5LA 4OF3A 1T1ZA 1JK8A 3RTQC 5J6HA 3BD3A 4NQEA 2BK8A 3PDOA 3TN0A 1GGYA 1R5IB 1FDLH 5C0AB 1JCKA 1X3DA 2PETA 3V52L 5L6YL 4P2OC 1RIUH 1G9NH 1J0YA 5HJ3A 5DWUH 1OAQL 1QBAA 5GS0H 4LLQA 3IAPA 5I9QC 1FL5A 4NNXA 3DI3B 3S4SG 2RAMA 4PP1D 1U3HB 2F15A 1WWBX 3QZWA 2DJSA 2XZQL 5GHWH 1NCAL 3O2WL 5ILTH 1IFHL 1LDSA 4I3GA 3FTGA 3CDYA 1U8NB 1OWWA 4WEBH 4QTIH 5D71L 3HG1E 2HRPH 2MFNA 3U4EA 1AJ7L 4GRWH 3U1SH 5IR1A 3BPOB 4GRLB 2MWCA 3UZQA 1I8LC 2VABB 2YC1B 3E6HA 4IOSD 3WN5B 1MCKA 4PY7B 4JDZA 4NHCL 2K1MA 4UNVA 4LEOA 2GSIA 1EO8H 4P9HC 2FGWH 1C1EH 4N9GA 4HEME 4MLIA 2PTVA 1XF3A 4NKQB 2FX8L 1HOCA 1I1FA 4AM0B 2V2WB 2XWJB 4R96A 4N8VB 3LH2H 4IMKC 4QRRA 4HH8A 2QEJA 5GRZA 3D5OF 3IDUA 4FFYH 3ARFA 4JFFA 4Q0XL 2F5AL 4KI5D 1PQZA 2HT4D 5HDQH 4PGDB 4G9FB 2R56H 3LKRA 3HCVA 3CX5J 1ZT1B 3K1KC 4MCZB 2BSRB 1YNTA 2BXZA 1AKJA 3GSWA 2VLRE 3CLEL 4KROC 2CIIB 2PW2B 3WO4B 5KVGH 3C2AH 4PP2B 3GSNB 4G42A 4XMKH 2FL5B 4PRPE 3T3PF 2UZXB 2VAAB 2NX5E 4MQTB 1A6ZA 4MAUL 4H26A 2YMXH 4KXZI 4S0SD 4Y1AB 2LQRA 4ZTPL 4GSDH 1BQLL 2W9DH 3ZYJA 1N4XH 3CC5A 4FQ1H 5KSAB 1HXYB 4BQ9A 4JRYD 1N6VA 3TYGH 2FHFA 2GJZB 5D70L 2X9WA 1G9EA 3ESUF 1NUFA 3FQWA 1DBAH 4OIIL 3G6JA 1H3PL 3MXWL 1KELH 5F6HI 3R8QA 4TSAL 2IGFH 5FHAL 4X0KB 1E6JL 3LDBB 1ZHLA 4UQ3B 3B3IB 1I1YA 5AZ2H 5FK9A 3NCCB 5CZKA 1Q9WB 1NC2B 2GHWB 3DJ9A 3OPZL 3ZKMD 5TQ2H 2EIZB 1MQKL 3VXRE 3DURB 2IQ9L 3TPUA 5DDHB 3P11H 3KR3L 5C70A 4PB0L 4RGNC 3VFTB 1EXUA 1ZAGA 4QXUL 3LRSA 3QNXB 1LE5B 1A0QH 4X5XA 2O93L 2DTML 2Y36H 1S7WA 5BZDB 1E6OH 1I7RA 4HUWA 8FABB 5ID0B 4RA3A 3D39B 3MBED 2VXVH 1MHPL 1EHAA 3X14A 5JORA 3ARWA 1ZHBA 3KYKH 3P4OA 3OKEB 2QQKH 5I74B 1PX3A 3HC4L 5GISL 4X9IA 2IANA 4NFBA 5I1KL 5IBTH 5I76B 1LO3L 2Y6SC 2EDFA 3BWAB 4EQ3A 5EZOL 4WJ5B 2G9HB 2CO7B 3FRPG 5D6DC 3HZYB 4I2XE 4L5FH 4PV9B 3QNZA 2XZCH 2ZSWB 2ORBH 3DRTB 2MNUA 1K8DB 1ZLSL 1INDL 4M1DH 1A6VH 1JWMA 2APWA 3CUPA 3DSNA 1Z0NA 3SGKA 3S5LA 4YHIB 4QNPE 1Z2KA 1J8HB 3HRPA 1P2CB 5D7JB 4QHNA 3RU8H 2RB8A 1QRND 3ARBC 1KBGH 2KL6A 4V1DE 2IG2L 5ANMA 3CFCH 4NWTL 5JOEA 2Z9TA 3RWEB 5DJYB 4J4PC 4TRPL 5GRVK 2WUCL 2G75B 3QDHA 4Y8DC 1MFAL 3HI5H 1DVFC 5EOCH 4M61A 3RA7H 3NTCL 5I66B 4N5EC 2ZOKB 4EI6B 3E6FB 1KCVL 4HIEA 2OTUA 1MFDH 2NY3D 3FMGL 4UQ2A 1PKQA 2W0LA 1H3UA 3GEWB 3O9WB 3PHOB 1SY6L 1IC7L 2YKLL 3QIBD 4OZHB 4PJCF 2Z31C 3BXNA 2HTLC 4WNQB 2UZIL 1NAML 3ZKXB 1F02I 1BJ1J 1NBYA 1DP0A 1YUHB 3PWUA 2V17H 2D03H 2D2OA 4ZUVA 1W72H 3MNWB 3SQBA 1JUFB 3S35X 3L9RB 5KSUB 1H0DB 5BV7C 3FOMB 2QV2A 2VDRL 3FQUA 5HY9B 4OQTH 1ETZB 3NZ8B 3GBNL 5CGTA 2W9EH 3HG1D 5F6HJ 5JOPE 4OD2A 2NY7L 1E27B 5DT1H 1S7QA 4M7LH 2DQDH 3ZDYE 1MPAH 3Q2CA 4JM4H 5FUOH 4D8PB 1M6OA 3VFRB 1V7MH 3PNWA 3BIKB 3PHQA 1RZGA 2GUOB 4M1CC 4R90L 3KLDA 3B6SB 3LEVL 1QG3A 3H9SB 3QEQE 5F3BB 2WSKA 2AJ3B 2R4SL 4NZJA 1YEGH 1G9ML 2ZOLA 1G6VK 2C1PA 5F1NA 2IFFL 4X7DC 3VXMD 4G43B 2VXSL 4OLZH 1T6WA 1WT5C 4X6EA 3L7FB 3CSYA 4O2CA 3U30B 2R0ZH 1KV3A 3C8DA 2H1PL 1J8KA 1YMMD 3LKNB 2VLRD 4JHWH 4NZRH 3VGBA 4I9WE 1LE9B 4WO4B 2WW8A 3MA9L 2XNAB 4G7YL 3E6HB 1C5BH 3EOAA 1Z5LA 4LEOB 4K8RC 2NX5D 3C5ZB 4ZD3L 2PYFB 4NRXA 1T0MA 1PEZA 1XF3B 5HHVH 4I48B 2ARJA 3MRDA 1AXTH 3QEGL 5ALBL 3STZA 3K46A 3HNSH 3C6LA 1BX2A 2ED7A 5LGHL 4LSPH 1EEYA 1DBKL 4D9LH 2XN9A 2XQBL 1FL3B 4N0YL 5CP3H 4NQTA 4PBVC 5SX4H 1VEMA 1UCBH 1YNTB 2VISA 4J6RH 4UV4L 2Y1VA 3T0EB 3GJFK 2BVPA 3X13A 4APQD 3RZCA 1ZANH 3KJ4C 1UVQA 4HJJH 5B21A 2HLAB 1Q0YH 4GJTB 2Z92A 4P4KA 1X5ZA 4JQIH 5JW3H 1A6ZB 3UTSE 4XI5C 4OM0H 4WCYH 1TZIA 4JG1H 2W60A 1LO2L 4M00A 1K6QL 2AK1H 5I17A 2QADD 1T1XA 3QUZD 4NO5A 2FEEI 3ULUL 3AFLA 1RZFH 4Y16B 5DJ2A 3KYNA 4QYOA 1P9MA 4TUOA 1RD6A 3U4BL 1YEFH 2XTJD 4L3AA 3AROA 4JN2B 1AGDB 1F4WH 1I1AD 2JIXA 3BHBB 5FHBL 1EFXD 1IGFL 3UTPE 1A4KB 1JFQL 3GRWL 4HG4J 3RBGA 1MELA 1UXSB 3GI8H 2JB6B 3BEWA 3OKKA 5DJCA 5I71C 2Z93A 3SO5A 2XPGB 3BN9C 1CXEA 1XF2B 1EHNA 3DUHA 4YUEH 1M71B 1FO0H 2AXFA 2Z4QB 4TN9A 1ZEAL 4DN4L 3V6OE 5KW9L 1S7WB 2HTKC 3PP4H 1JYVA 3O3EB 4KMLB 1QNZH 4ZNEE 1R24B 4M8VA 2HKHH 5I1EH 2VJXA 1FG9C 2DWDA 2YSSB 1ONQB 4Y5VC 2OJZL 4V1DD 3L3DA 5IW1A 3LKPB 3D1MC 3S9DB 1QRKA 4JFDB 1J5OL 5CJXA 4KQ3L 4ZDHB 5JLZB 5E8PA 2Q8BH 2XQYG 4YXLL 3O8XD 3PQYA 4OT1H 3RUGB 4OF0A 2Y07H 3PGCA 4OJFH 5GS2D 2VXTH 3RWIA 5J06A 2XI9A 5LBSH 4HC1A 5FYKL 1KFAH 3OTTA 4KJYA 1MQ8A 4NNPL 3OB0H 1JF5A 2SEBB 3DX9B 3KWWA 3FQTA 2RQ8A 3MFFB 1U93B 5J1TC 2R39A 1KJMB 4I0KA 5HHPB 3S36L 4JFHD 3U9PH 1G7QA 4OZHF 3WFHB 2X41A 4WY7L 1KB9J 4Q2ZA 4MNGA 1CZ8H 1CL7H 1YEHH 2V5RA 4GRWB 1CDJA 1T80A 1GXEA 2ZSVA 4HF5H 2PXYC 1FRGH 3MUY1 5IMLB 3UAJC 3FN0L 3D87B 2BRRL 1MJ8L 1I7TB 3ROOB 1G6RL 1B90A 3QWOB 2ZCHH 5C6TH 2VXQH 2E27H 1YMHA 2APFA 1SJVA 3SKNB 3N50A 1LEKA 4HWZA 2CDGA 4NPYB 5CEXA 3OBAA 4MXQC 3MMEA 1AO7A 5IFHH 1YEIH 4OKVB 3S35H 3TVMC 3CH1A 1AIFA 1KN4L 4N90E 2R29H 1J1XH 4QOKA 3QDJE 4LHJB 4PJEB 3HC3L 1BEYH 3QFJB 4G7VH 5GZOC 5IUSA 4R2GC 1JNLL 4NZUH 1VADA 1S7QB 4K55A 4NRYA 3RPIA 4EDWH 3AXLA 4I9WD 3GMLA 1IEHA 3GKWH 3SDDA 1CLYL 1P84K 3AY4A 4MCYB 1YYMH 4X5WA 4F8QA 2JELL 5H94B 3ARDD 2NMSA 1CLOL 2DIAA 4HX1A 4Z18A 3DYPA 4F58L 3E1F1 1XEDA 5E2JA 4AEHH 1CTNA 3DX7A 4JKLA 4U6XB 3UCRA 3RL2A 3PDGA 4U3HA 3HAEA 4NQDA 1XR8B 1XCQA 2BMKA 3T08A 2DIBA 3HI6H 4MJIB 3CSYB 5EOQL 1P4IL 4HIXL 3WFBH 5FCUL 1FC1A 1YNLL 3EDFA 2NY4C 4Z77A 3Q1SH 1PJ9A 5D8JH 3GBLA 3QIUA 4P2RA 4PRBB 1VFOA 2LAGB 5E6IB 1V05A 1F4XL 1I9IH 5MI0B 5JPMA 1HYRC 4C83A 4QEGA 1BBDH 5JXAL 2QTEA 4YE4L 2ARJB 2BZDA 4F9PC 5ALCL 3MV7B 4Z76A 2VERN 1EUTA 4QRQA 1JJUA 1YEDB 3MCKB 1C7TA 3EAKA 1UGNA 1DE4A 2HFFB 5AZEH 4ZS6D 1UB6A 4KQ4L 2VQ1A 4OZGB 4DOHE 4E41E 3QUYB 1E4JA 4GXVL 4XPGH 4Z7UA 5DRZB 1KEML 4UU9B 2OMBA 4WUKL 3FB8B 5MENB 3I6LD 2ICEA 4D0CA 2IAMD 4KFZC 3PXJA 2EDKA 1NCCH 3EGSB 5BQ7B 5DK2B 4UAOC 3FB6A 5I16A 3MPCA 1KC5L 3I2CH 5C0GB 4AEIH 1CQKA 4LSVL 3UTPD 2FSEA 4XH2A 1LK3H 1DUYB 1EHXA 5DEZA 1TZIB 4JM2C 4YDKL 4NQCE 5DQ9A 2DQGH 5D2NA 4F7TA 3O6FC 2EDTA 5CD3B 4G8IA 4LIQH 2W60B 3VGAB 3V0AC 4JVUA 1OTUD 1U2HA 3Q6GH 1ZKAA 3IFNH 3O2DL 1KPVA 1F6AA 4P46D 1DR9A 3W9EB 1IGIH 3NABH 1JHLH 2BSED 1CBVL 4HZLA 2AS5M 3S3SA 4LHUD 1NBZA 3GJFB 4O51B 5JXED 2A6JB 1D9KB 2GEEA 4OLXL 1OAXH 4FOMA 3MJ9L 4IHOA 3RNKA 4G6FB 4MQXC 2OTWB 4KK5C 4OUUA 1S5IH 3S4SA 2VR4A 2XKNA 2VLLA 3BEWB 4GKNA 2I9TB 5LWYH 2F19L 4LSRL 4N0CC 2G60L 1FORL 2XKUA 4MXWH 3VFOA 1UZ8A 2WBWB 3MRHB 3C60D 5HDOA 5E94A 4JVPA 5HYSB 1ZSDA 3U9UB 3RUGF 3PJSB 1AH1A 2DL9A 5C0AE 1M7DA 1YEEH 2IPKB 4PGCB 1ADQL 1AY1L 1W72B 5HHQB 2ZUQC 3PIQB 4M03A 4LQ1A 4QXTB 1QTYT 2AV1A 2CK2A 3WIIL 5E8PB 1T1YB 2VDML 4L3ED 5C1MB 1EHLH 3BD5A 3M1BB 4WI6A 3MLYH 3NA4A 1HIML 1UKSA 1H5BB 1J0JA 7CGTA 5I1LB 1FL6B 3NVQA 3RWIB 1QOKA 2QHLA 1CU4L 5D5ME 4PG2A 2HKFL 4M43L 4Z7NE 3BN3B 4KJYB 3KPLB 1MIEL 1L7TH 1MFCL 3UX9B 4XBEH 4Y19A 4GRWF 1BFVH 2VZVA 1AGFA 5C0BB 4LL9A 4Q74A 4D0BB 4IRJA 3MREB 1QLEH 5HYEA 1TJHH 1Q9OB 3WIHL 3TIEA 5I8OL 3I50H 2VLME 4HJGA 5BV7H 5I1IL 1G7QB 4JPKH 3IDMA 4FTVD 3C9NB 4FG6D 5FCSH 2R9HC 4RISL 3D9AH 4JDTH 1SJEA 4MNGB 3BGAA 4G9FE 3WFZA 4Z0BH 2BSTA 1OGAE 4HSQA 1NAKH 4PJEF 3KPOA 3SCMB 5FB8A 5SX4I 2EE2A 4PRHD 4U05A 3ZO0A 2CDGB 2V2XB 5JOFB 3MMEB 3CH1B 5TDPB 4K7FB 3ULSA 5HD8C 2XG4A 1UT9A 1ZLUH 1T5WB 4F9LA 4ENED 3KS0H 3SE8H 1XZ0A 1XGRB 3LIZH 4KK9D 2B5IC 2D7PA 2AAVA 2P45B 5GGTH 4PPTA 4XP5L 2A77L 4KZEL 5F9DC 5GRUL 1I8KA 4N8CL 1MH5A 1PD6A 2DQFA 3KPRD 1V3JA 3FQNA 1E0OB 1HZHL 3OF6A 1VADB 1HDMA 2DM4A 2VZSA 5HDLA 3L3OA 1KSRA 1H9VA 4FFZL 1HH6B 4GBXC 4JPIA 2WIMA 4MA8H 4X7CC 1BECA 1TETH 4X5WB 1RJZA 3BPLC 5DO2C 1MAJA 4U7KA 5KG9B 1X5XA 4XP4H 3QIWC 5D1QB 4WDIB 3DV6A 3C2SA 5I1AB 4JREB 5B38B 2CRMA 1KTDB 4YHNA 1YQVL 3EBAA 3PXHA 4PJAE 4WTZG 3CLFH 1UWGL 4YDLC 1H3GA 4XVUD 4E41D 2BXYA 2C4FT 4YQXH 3KLSA 3ZTJG 4DVBA 1NCWL 2Y9RT 3S37L 3OJ2C 3QPQC 2OQJA 3D39E 4LSUL 2DKSA 4X4ZA 3VWJB 5E2UH 3B9AA 4OZGF 5F7EH 1AXSB 4B0MM 2VITB 4ZSOA 1EBAA 5DURD 1K4DA 2EO9A 4BSJA 5DD3H 4M02A 5DTFB 5I2IA 2LVCA 5IESL 3GMQB 1T20A 4RMRA 1WBXA 4ONFL 5EU6A 4R26H 1OCWL 1BMGA 4UUJB 4TVPE 5JA9A 1EERB 4UTAL 3X12B 3BGMA 4N0UA 4PTUA 1N64H 4D0CB 2FJGA 4DZBA 5J6GB 4Y4KC 4EBQH 5HYJD 4LCWD 5F7KC 5K9KA 4MZ2A 4Q9QH 2ZWLT 1N2RB 1U2CA 4AENB 1NGYB 1Q72H 5B4MD 4MMZC 3SQOL 3SY0A 1NGQH 3OJVC 4KKLD 2FSEB 3L5HA 2YBRB 4XPBH 5I73C 4FXKA 3IFLH 1CGSH 4S11A 2WIIA 4OGZA 3MJ7A 3VFPA 5I6XC 3KYMA 1MLCB 3WKMH 3WSQH 4F7MB 3IDNA 5SWZA 4P2QA 4QTHA 1OF2A 2Y7Q