3FO2B

Crystal structure of hapten complex of catalytic elimination antibody 13g5 (glu(l39)gln mutant)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
214
Chain Sequence
DVQLLESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catalytic antibody Fab 13G5 kappa light chain chimera
publication title An aspartate and a water molecule mediate efficient acid-base catalysis in a tailored antibody pocket.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 214
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo2B01
1ULVA 2OL3H 4ORGA 1I3VA 4YEFA 1MFNA 5E4IA 4PG2C 4M1GL 5FYLL 5TH2A 3O8XB 4TUOA 5J7CC 2OL3A 3C5JA 4G43B 1KJ3H 3T0VA 1FNAA 1QRND 2XXCB 2OJEB 1IJ9A 2HVJB 3ZYZA 5DRNA 5DJ6A 1HHJA 1UEYA 4AEIH 1UB5B 3V4PL 4HXAL 4YR6B 4K94L 5ALCL 2CK0H 4G7YL 3VWJD 3P9LA 1ZT7A 5C08A 4NOBA 1ZLUH 3KPNA 4NKIH 2MKLC 3DXAB 4PJEB 1YEKL 4XPAL 2O5YH 4P2RE 5ADOL 1RVFL 2YD5A 1TDQA 2WIMA 5DFVD 4CVXA 2OJZH 1C5BH 1CL7L 1CICD 3LRHA 3WD5L 5IKCB 4F7EA 1P2CA 1VESA 5T5NG 5FGSA 1LO4H 3DVGA 1MAMH 4EXPX 1T0NB 3O3EB 2OTUB 2DDQL 2BSTA 5I30L 1F4WH 4FQCH 3AREB 5DURD 4TVPD 5KSAB 1J1PL 3U79A 4WO4B 4LCIL 3MROB 1P7QD 3Q48A 4OZIA 4S11A 2F5BL 5I15H 2VSDA 4RDQF 1G6RL 4PTUA 4FABL 3FN0H 1MCPH 2UY6A 4Y19E 4LCWE 3ZYOA 3PL6D 4PJAF 4G7VH 1UM6H 5SWSE 3Q5YA 1FIEA 4YXKL 3HR6A 5FYKH 4JFFB 3VFMA 1C08A 3PABA 1QLRA 1CXIA 4I0PC 1NGPH 2PYEA 2WSKA 3SO3B 1KJ2B 3TN0B 3BP5B 5K9QG 2Q1EA 3MRFA 4BFGA 2B20A 4WCYL 4LMQI 2I25N 4PS4H 4MA1C 3MRNA 4O58L 1CE6A 4Y16A 4WI9A 4IIQB 3H9SE 4ONGH 3TEUA 3MV9D 4M7ZC 4C83B 3T0WA 5IGXL 5D2LF 1KCVH 3IFLL 4HUNB 1KB5B 5GGUB 1VADB 1BBDL 2M8XA 1XR9A 4NPYB 4QYOB 5E70A 3S36X 1FFNB 4I3RH 2F53D 4U6TA 4AL8L 3FO0L 3OB0H 3S88L 4FFVC 3UBXB 1ZVSA 2IFFL 2DQUH 5GSRA 2X42A 4GBXB 5IB5B 4D9RE 4WHYH 5DD6B 1CQKA 5L8LB 2AEPL 3MUZ1 1JJUA 3RQ3A 3MCG1 4FTVA 1F02I 4M7KH 3MNWA 3QUXD 2F54D 4X0KB 1R5IB 2H32B 2IBZX 3SDXE 5E2VH 5HHPA 1KJVB 3WS3A 2V2WB 3C09B 3KWWA 1A7QH 5LXGH 4JG1L 1ADQA 1BM3H 4OAWB 2R2HA 3DGGB 3L7FA 3QQ9D 4JDVB 2C4FU 2BNUA 3T0ED 1QG3A 2Y25A 1OAUH 1X6NA 5ESVA 1EA9C 2L7UA 1UKQA 5KSBB 5C6WH 1AE6L 2UUDH 3KYKL 3QDHA 4YX2H 5K33A 1CFTA 1OHQA 4UB0L 2GCYA 2DQJL 5B39G 4A2LA 3G5YA 2DD8L 3KXFD 5EBGA 2E5EA 2P5WD 4OJFL 3SDAA 1T66D 1QR1A 3NA9H 4KDVA 4PJXB 3RDTA 2WANA 4U0RC 4QXGL 1OAQL 3LDBC 3DX8A 2HRPL 3PHQB 5EZJA 2B1AL 4Z95H 1ZHKA 4L3AA 3SBWC 5D7LD 3G04B 4XMLH 2APXA 4CMHB 2RQ8A 4GSDL 3QDMA 4TN9A 1T1ZB 3MV8B 1U8OB 5FYLH 4HV8A 4ZOAA 3LKQA 5MENA 1E6JH 1FO0H 4RAVA 3TO4C 3IJYA 4ESKA 4X99A 4KMQA 1JZ4A 5C08D 4QOKB 3AM8C 1QFWL 3FB5A 4HXAH 5I1CL 3IAPA 1TITA 1HSBB 3CDGA 2OXHA 1QFWM 4XP1L 3O45B 4M43L 3PIQB 3MR9A 4GAGH 3U0PA 2OZ4H 1IGJB 4Z7VE 1WFNA 3TBSB 1T2QL 4U4BA 4F33A 3QEQB 4L29B 4XX1E 5E9DB 5ISZD 1YEKH 1IGIH 1NMAH 4LF3B 4ODXB 5MI0C 2EDDA 3E2HB 1U3HC 3QXUA 4D0CB 2D2OA 2GJJA 3WD5H 3X13A 4LKCB 3LRSA 3QCUL 4S1DD 1RMFH 5EZOH 1J11A 1EUTA 4JR9H 4WI3A 3I9GH 4G8GA 3ZDYE 1P69B 1CD8A 4G5ZL 4G8IB 5I1IL 3RZCA 5DMIL 3QG6A 2QQKL 3CFJA 5I66B 2R4RH 1LP9A 5FYKU 4UOJA 4MSWA 1PG7L 4KK5D 2EXWC 3TPUB 4BUHA 4ZUSA 1SJHA 4RCAA 2KZ1B 2YN3A 4S0TD 3S96A 2BXYA 4XCFL 2B7DT 2ZJSL 3NCMA 4RGOL 3VG9B 1H5BB 4POYA 4LPWA 5DJZA 1K4CB 4X5LA 5SX4I 1A7OH 1EVTC 1OT1A 1I8IB 3IDGA 2DTSA 3VFGH 2R0KH 3GSXA 3QO0B 2PYED 3TIEB 5FYKD 4P23D 4K8RH 1IC5L 5DC4B 5DVLA 4YWGL 3GHBH 4BYHA 4OGZA 2YR3A 5C0FB 3RUGA 2ADIB 1N0XH 1EHAA 4XXCC 1QSEB 5E7BA 1J0HA 2FBJH 1QACA 4RA3A 4Y16D 4LLYA 4HJJL 4KMLB 1OP9A 3QUZA 3NCYS 3T8XB 5DT1L 1A1NA 3PQYA 4IM8A 2X4QA 4V1DA 2N7AA 3MV01 2PTTA 4MGXA 5BVPH 4JQXC 5J56B 4U1HB 3S35H 3MREA 4NZRH 4Z5RB 3H3PL 5EPMA 2VWEC 2X4SB 3O2WL 4LSDA 4EXKA 1R24B 3PDOA 4HK0B 5CCKL 4HKXA 2I5YH 25C8H 4QRSB 1FZMA 3G5ZB 3L3GB 2ZPKL 4CMMA 4IMKA 4AL8H 3DJ9A 4GUPA 5AYUL 4IRJA 1E4XH 5I73C 2PXYC 5J11C 1KJ2L 2IFFH 4FTVD 3FB8A 1XF4A 5D2NA 3SE9L 1RZ7L 3AXLA 1KG0B 5C0RL 3CFBB 5BS0D 3ZKXB 3WE6B 5JOPD 2BVQB 2DRUA 3LZFH 1REIA 3TJEH 4NQCA 5IV2A 5IVXF 4OF8A 3BKYL 1MUJB 4X80H 1OWRM 5C6PB 3VRLF 2C1PB 3ISWA 3WIHL 1AGEB 3S37L 1KB5L 3F7VB 4M62L 4PLKD 3EYVA 4XWGL 1FP5A 4U6YB 4N90D 2CJUL 2E6QA 3NACL 4LSQH 5L2KE 1I1AC 3VXSD 3B2UD 1DSFL 5L88H 3LS4L 1CDGA 3F6IA 2HG5B 1S8DB 3ULUH 4KUCD 3MOBH 4PJFA 3SDAD 2AXFB 2N7BA 5KVFL 4UTAH 5FEBA 5D1ZA 2A77H 4NYLB 2ZUQC 4XC3H 1FNEB 1A8JH 3BKML 3KHQA 4FQ1L 1T04A 3RX5A 4FMKA 4NO2B 4YHOL 5BZWA 4HDIB 1UWEH 3FZUC 4QXGH 4HS3B 5ADPL 3K7UA 3V0AC 1Q9KB 3ILPA 4PJ7E 4ORZC 1UZ8B 2IADB 1CFQB 4ZFFA 2FIRT 5MEND 2R23B 1KGCE 3LQZB 1DL7L 2HRLA 5FYLD 4NO5B 1XGQA 2P5ED 4P46C 2VDNH 1RURH 4EN3A 4ZAKB 1FG2A 3TYFA 3MNVA 5EUOF 1A3RH 2OM5A 4HPYL 5I1CH 3PF2A 4F7MB 3GSRB 4KVNL 3THMH 1EXUB 4XP1H 4ELMB 1GGCL 3WDJA 4XBPB 4HGMA 3KPRE 2ZG2A 4X83A 4OFIA 3I75B 5LQBL 4CN4A 3QIBA 3V0VB 4YDIH 1XCQB 1XGPB 4ODBD 4JPKH 4R0LC 3T2OA 4X4XA 4N68A 3U0WL 3Q6FB 2R2BA 3RZCD 5KOVC 4ENED 1QLFA 2CRYA 4HFWB 4XZUB 4DZBA 3MJ9L 2NY2C 1ONQB 2VMFA 2HLFC 3TA3A 3EGSA 4JVUA 5INDB 5FDWB 4B5EA 4HWEH 5T33L 5IQ9B 3QEGL 3CLFH 1YJDL 1S7UB 4WUUD 5IVZA 1MCLA 3G9AB 3B8SA 2GJZA 5D7IA 2WLZA 3UJIL 4C56A 1D6EB 2R39A 3HZVA 2D31B 4F7TA 3QSKB 3P0VL 3EFDL 4KJWD 4NQDE 5CD5D 2DQCL 3OF6D 3HI1B 4QT5A 1OGAA 4P2RB 3F8UB 3U1SL 3LMJL 3TBYB 1AGCB 2VISB 1OARH 3BGMA 4DTGL 3QIUC 5F7KC 1FVCA 3EJZC 5HHQA 1JN6B 4FQXA 5I9QB 4PJ5D 4K8RD 2HT2D 2DI8A 5IEHA 3GSQB 4PJEF 1FZKA 5GS0H 3FO9B 4M7ZB 4JFEE 4PR5A 5F8RC 4LMQE 4OGYH 2LU3A 3ROLB 3H42L 1JK8A 1FLTX 2VJXA 4L3ED 3Q3GB 3RGVA 2V7NA 1MCJA 1SYVA 1S3KL 4ZFOB 4NO3B 4PJBA 3Q1SH 2UY7A 1DANU 4FQLL 4Y19B 1I3UA 4OF5A 2NTSP 4YNYA 3O2WH 2J8HA 1U3JA 1UYWL 4LCWB 32C2A 4IRJD 4LLDB 4F9PA 4QNPE 4OIIH 5CCKH 2GEEA 4JDTH 2HFFA 3NZHL 3V7AG 2AV1A 5SWSB 5HYIA 3FB6A 4EDWL 3B83A 3SJVA 1MCDA 5EA0L 5IR1B 1CDHA 1KJ2H 2P45B 2H3NB 1YNLL 4MCYB 3PJSA 1TFHA 5EO0A 2CXGA 5F93C 4OKDA 3WDHA 1MHCA 1BQLH 3QA3A 1BZ7B 2X10A 1RU9H 1XF5B 4XAWL 5SV3A 4J12A 4P2QE 5DUPH 4Z7WA 3BE1H 4NCDA 5I1EH 1QEWA 3FHQA 1CZ8H 1D5XA 1M71B 2ITDB 3CFCL 3RWDB 3ILQD 4HIEA 3H9SB 1MFBH 3MRHB 2WBJA 4XBGA 2ADFH 4XWGH 5FAAA 2X4UA 1T2XA 4PJCE 4MLSA 2A9NL 2HKHH 4HUWB 4LU5H 4MNQD 4OCNC 4XBEL 2C9AA 2W65B 1S9XA 1HK6A 2BC4A 4YDVA 4U0RB 4Y1AE 1TNMA 3BDXA 4GKSB 3ULUD 3V5DB 1NFDE 4OLYL 3QIWC 1R3LA 3VDCA 1MCOL 2AJSL 1WWAX 1UWXK 3H9HA 4N8VB 1P4BL 3C8KB 4JREB 4EI5C 1OQXA 1HH6A 4HEME 3CFDB 4RQQB 5I1KL 1T1XA 2AV7A 1T0PB 2H32H 2W0KA 4QRPA 5A2JH 1EEYB 1F45A 3KPPA 4JN2A 2VDOL 4GQ9L 5C0GA 1U9KA 1B0WA 3SDXB 4EVNA 4NN7B 3Q6GH 2FJFB 3RFZC 3QUMB 2E9WA 1JGEA 5B3NA 5DMJB 3MSPA 2FECL 3BO8B 1HH9A 4KV5E 5FDYA 3FQWB 4J4PA 3TBTB 4I48A 1YNTB 4G8FB 1OOAA 1T22A 4UU9B 3NAAL 2YD4A 3F7YA 1DN0A 4WU7A 5MI0B 5E95B 1UACL 1WUNT 4OIBA 3KYOB 5MEQB 2KQNA 4HPYH 4BZ1H 2MJWA 3BWAA 4HLJA 2EDFA 4RGND 5F1NB 3UAJD 4QXTA 3MJ7A 3RVTD 4ELKA 1X3DA 1Y0LB 3QIBD 5D71L 5DDHA 5KSBF 4KGJA 3HMXL 1OM3H 5D5ME 1SJEA 4L8CB 5CEYA 3VFWB 5LQBH 1B2WH 1FORH 2VE6A 4M1DL 3OTTA 2GKIA 5DJCB 1S5HA 4FQJL 4H5SA 1JFQL 2DYPB 3HKFA 3TA3D 3X17A 3IDXH 3HZYB 2QADD 4PJXF 5IB2A 3O8XD 1R6VA 1F3DJ 3A6CH 3MFGB 5KW9H 1KNOA 4MAYC 3MODL 3NFPB 4LGPB 4TTGA 2VXTL 1M4KA 3GSOA 3EDKA 4C56D 3EDFA 2GK0A 1FPTL 5TE7L 2BHYA 2YPLE 1VGKA 5KANI 4ONOA 3QXAB 4L8BA 4DKFL 4YHML 5JQ6L 1A3LL 3DXAD 4H88H 1JPGB 3P0VH 2JCCE 3EFDH 3EYOB 3N1PC 4Z7VB 4NN5B 1NEZB 3BP6B 2IAMC 2XKNB 3GMLB 1Q1JL 3U1SH 3V6FB 4PB9H 1GZQA 2MKWA 3LMJH 5E0QA 3LB6C 3RWFB 2ZKHL 3IDNB 3RNKB 1JNNL 3PNWA 4JPIA 3TPKA 3DRTB 3VXQB 3RX7A 5D7JC 3PGCB 3F7RA 4OM1L 4HJ0D 2XTLA 5GS0D 5L8KB 3RGVD 1NJ9A 3H42H 4G9DB 3UDWC 1AXTH 4WO4D 2YD9A 2VLRD 2ICWA 4YFLF 1AH1A 3RJQB 1OF2B 1DBMH 2WIIB 3FFDA 5JO5A 4I2XE 1F6AB 1ZEAH 2PXYB 1VPOH 5J11B 1HIML 2ZOKA 4LHUA 4Y4FC 3OX8B 5IQ7H 3SJVD 5AZEL 4LVHB 4PP1D 4R96B 4O4YL 5LAXA 3NZHH 3H3KA 2IBBA 3JTTB 1ZAGA 4L3CA 4D9QE 5E8OA 5F89B 2ZUVA 2W0FA 5EA0H 3RAJH 4ZUUB 3KDMA 1U8HA 1BD2E 4KGLA 4R8WH 4RFEB 2XQYK 4GAYA 1U8PB 3V6OE 1KIQA 3BN3B 2X7LB 1DUZB 1NLBL 1JYXA 5ICYB 3MC0A 3MLPA 2WBJD 4ZFOL 2DB8A 1G9NC 1XEDA 2W1NA 1INQA 4E41E 3SKOB 1A64A 1JGDB 1JCKA 4LPCA 5ANMA 1QFHA 3SE8L 3MRDA 4K23H 3U6RA 1UM5L 1ZMYA 1ZHLA 3OAYH 4K3EH 4TULL 4Q9RL 2BRRL 3BH8A 3J7HA 4HWZA 3OJMB 3QUYC 4CL7A 3L3IA 3GBNH 5TF1L 5DS8B 5HHMD 1YC8A 1M7IA 4D9LH 2FX7L 2E7CA 4AMKH 2D03L 5GS3A 1FC2D 1YA5A 4NBXB 3C6SA 4ZPVB 4E0RA 3RBSA 4ZODA 2VLKE 3JVGA 4RMWA 4F7PB 43C9A 1TZIB 1IL1A 2JB5H 1UVQA 3KHOA 1G84A 4GBXD 4YJZL 4OF3A 4QRPD 2R4SH 2NR6D 4LLQB 2AQ1A 3T3ME 4HC1H 43CAA 2FJHB 3P9MB 3MRCB 4WHTB 1AFVH 3AVEA 5JOFA 4AG4H 4WRLA 1BZ9A 2QTEA 1XGUB 3V4VL 2Y06L 4J8RB 3CUPA 3H9ZA 3NBNA 3I3EA 4MMZC 5IG7A 3C9NA 3CFIC 4GQ9H 1A6ZB 4LVNC 1HHIA 1F3RB 3L3HA 4K3HA 4Z7NF 5A2IH 1S78D 3O3DB 4GT7A 5KTEL 1AGFB 1MLBB 5L2KB 1AO7A 3D2UA 5C0AE 1R3IL 5C0BD 1WZKA 3CSYA 3GMNA 3EO1B 4JO4L 4LRNL 3T0BA 1KCRH 1FZOB 3NAAH 4J6RL 1GL4B 2V2XA 1GGBL 3TNNA 1UACH 5DUBB 1D5IL 3LRGA 2ZCHH 1MQKH 3RY6C 4LSUL 4X9IA 2XPGB 1ZK9A 1I85A 4QY8B 2CKBL 4WW2B 2OSLB 5DK0A 4CJ1A 4PLJC 1CK0L 1G7JB 3QUML 4PJ7B 1KUMA 5BV7B 2G9HB 4X6BA 4XNZC 3W81A 3VRJA 3K8MA 4CW1A 5CD3A 4OT1L 3G6JE 3SGJA 4WI4A 1FDLL 3HZMA 4QOKD 5C86A 5C09A 2ZOLB 3RHWK 2VH5L 4KMTH 3GJEB 1BLNB 4PJHA 3QFJA 1RZKC 5MEPB 4DKFH 4WWID 2A6JA 5JPMB 4JY6A 3ECBA 1DVFC 2VDRH 3KPRB 5MP6L 1NMBL 3UTZB 3U2SB 3GO1H 5GJTH 4NZTH 3D3VA 4QHUA 4DUVA 3L7EA 3OGOE 4PD4K 1H8NA 4XVSL 5EO1B 4ELMF 4M9PA 4LSPL 1BIIB 3DV6A 2CDEB 5C0DB 2FZ3A 5JPNA 5A3IC 4WTWA 1JNNH 3ARDB 4PRBA 2A0LD 2GTZB 3QPXH 4HWBH 2EIDA 3RPIA 1FFOA 3LEVH 4DAGH 3KR3H 2AEIT 4P5TB 5BW7C 1XIWA 2NYYD 4G42B 2QSCL 2QKIB 3HFML 4PGCB 1A6PA 1U8JB 3AROA 3QDJE 1P84K 2XKUA 4JAMB 4RMVA 2Z35B 3B3IB 5L2JB 1P4IL 1ES0A 5SWZE 4FQIL 4KY1H 4OZGB 4WV1C 2MPAL 2FEEI 4Y5YC 3VXRA 4OLWL 3IFOB 1OW0C 1TZGH 3WIFB 4NQDB 5EOQL 4I9WD 1S7XA 2HYMA 2IMNA 1IEAA 4NIKB 3CC5A 3T2NL 4N8CL 3SDDA 5HY9A 2PF6A 2DBJA 4PBVC 5FOBA 1RZ8B 2DWEB 4TUJA 1HXMA 4JFEB 5ESQB 5ILTL 4QHLA 4PRHE 4M1CD 3BH9A 3B9EA 5C0EB 1BFOA 1NLBH 2AEQL 2YN5A 3PWJB 4XVUD 2NZ9C 4PJGA 3AB0C 4HW6A 4OLEA 1EH9A 1NGQL 1A6VH 3LN4B 4GXVL 3VGDA 4JRWA 5I18L 3VFVB 4LHQB 4W4OC 5C70A 1NAMA 3SGDI 1IQWL 2AQ3A 1UB6A 3QO1A 5BVJA 5J9PB 1CGXA 4V2BA 5I8KH 2APBA 2XG5A 4L5FH 1X5KA 3RWEA 2HFTA 3MYJA 3OGCB 4JFPB 4RX4A 3WSQL 4YHLH 4KTYA 2P24A 4XPHH 2WLYA 4W68A 4YH6A 4JANA 1RD6A 1GOGA 2VXUH 4FFWC 2R1XA 5CINL 1TQBC 4M6OH 4X4YA 3BW9A 5DMKB 2E3VA 4P2OC 4NSKA 4Y5VC 5TQ0L 2J6EL 1NANH 4P2QB 4P4KB 5IFHL 5JTWA 3W9DA 5E08L 2Y72A 1H8SA 1AO7D 3D2UD 3UO1H 3P30L 1LEKB 4JG0H 2GY5A 4AEHL 1FN4B 3IAGC 3WXVH 1A7RL 1LMKA 1PEWA 4POUB 4PJCB 4MCZA 1QFPA 3D1MC 3LSOA 1JWMA 5CUSH 4Y1AB 3VCLA 3GGWB 4KAQH 1I4FA 1X6LA 4NUJB 1NFDB 4APQA 4U6XB 2BVEA 4JFHD 5E6YA 2YA0A 2P46B 5GRJL 4R4BB 1CF8L 3QXDA 3S6CA 1MCQA 2H45A 2CMRH 4OCWL 2ICEA 4LSUH 4Y2OA 4XP5H 1T5XA 1DBAL 1IC4H 1GC1C 3BT2L 3U7YL 5L0QC 4CN1A 5DFWH 2R1YA 4XC1H 4L1HA 1WBZA 4FZEL 4YGVB 2CR6A 2XFXA 1NCDH 3QUMH 4BSVB 2VL5B 2GSGA 5EU7E 4CGTA 5C09D 1I1YB 1WZ1L 2AW2A 1DQMH 2X4NA 1NUGA 5IFAL 4L8SA 4LIQH 4MJ6B 3K1KC 1AR1C 5IIEB 1BQHB 2AABH 4RSVA 1GHFH 4O9HH 3NTCH 4W6WB 4ZDHB 4ZUVB 1F4AA 1F2XK 1RZJC 2CGRL 2NY3B 2X05A 4YPGB 4QRQB 1FIGH 1VDGA 5GRUH 5MP6H 3RIAK 2DI9A 3MRPA 3DX9A 3HG1A 4B41A 3VW3L 3DETD 2EC8A 1VGEH 2APVA 3C8DA 4WFEE 4KRPB 5EZLA 1YY9D 4NJ9H 5BV7L 3VA6A 1PKQE 1X5AA 4F37K 2Q76B 4ZS7H 4KZDL 15C8H 3C87A 1KLGA 3OKDA 1ZLWK 3FOLB 1JE6A 2P49B 1RZIB 2NY6D 4JJ5A 4Y4FB 2QSCH 4X5WA 3GI8H 4HIJA 3VE0A 3HC0A 5K9KB 5A2KH 4AT6B 4ODUA 4X5XA 3LV3B 1T1WB 5GGSA 2YPLB 5IHZB 1QD0A 4WU5B 4XPTH 5EU7C 5D7KE 4M6MH 4HZLA 3OR7A 2MPAH 3SN6N 1EBPA 1KEMH 2UYLB 4OLWH 2ZUWA 4P2RD 1WSST 1N2RA 3CFEB 1KIRB 2XZAL 3C60A 3KJ4B 4KK6C 1Z5LB 1JF1B 5ETUB 4LDOB 5EU5A 3N1MC 5I71C 1KF9B 1PG7X 2QHLA 3ULVE 1B4RA 3I6LE 4Z7VF 1AD9B 3K46A 1S7VA 1KT2B 1AQDA 4ZTPH 1MIML 2ZG1A 3UYRL 4AY0A 5ILTH 3UJJH 3GIZL 2AJVL 3QUYB 2CPCA 3FMGL 2YK1H 1MY5A 4Y5XA 4D0BB 5FA4A 3IJSA 5HJ3A 1CLYL 2VR4A 4BQ8A 1VACA 4QRTA 4KUZL 3WIIL 4XRCB 4I2XB 4Y19D 3ZDYF 1MRCH 1X5GA 3K2UL 2W60A 4N1EA 3P73B 4LCWD 4QRRA 2GT9B 4OSUL 1SVZA 5KG9B 3JSSA 5DJAB 1RZGB 4U6VL 1MY7A 5GRZA 5EWIH 5F7WC 4X6DA 5T1LA 4DVRH 5CJOL 2IPUK 1SVCP 1AQKH 3VXUE 5E56A 2YUZA 4JKPL 1S5IL 4LVNB 1RHFA 2GHWB 3C6LC 4BA8A 4LHUG 1BD2B 1D9KC 2Z9TA 1HSAB 2NW2A 2Y07H 4UNTA 3BEWB 2VERN 5GGQL 3BYYA 5I8CB 1JZ8A 4QHNA 1F11B 1T0MB 2EH7L 3VFRB 3H9SD 2A6IB 3ULVC 2W92A 4E41B 4LNRB 3FT4B 3WJJC 4RNRA 3B9AA 5KVGH 3W5MA 4NQSB 4KHXL 2ZUSA 1OP5K 5C9JA 5IROC 3GHEH 2JIXA 2JELH 2XRAH 4UIMA 4APQD 3DO3A 4M6NH 1OLLA 2BVPB 3TVMC 3HE6C 3WJLC 5ICXA 3GSNA 3OJDA 2VLKB 3DIFB 3IXTB 3DMMC 4I18A 5KVEL 4XNZB 3SCMB 1JWSB 1CF8H 3AS2A 1S7RA 2BERA 3S37X 2EDKA 5HYFA 1A6AA 3NA4A 3T77A 2M2DA 3QCTL 4QF1B 3QNXB 4NM8H 5HHVH 3MBEC 5IEKB 4KKCD 4Q6IC 2A83B 2IPKB 3T4AB 2H1PL 4UTBL 1U91B 2FEDC 5HHOE 4DCQB 5B8CC 1FH5L 3WHE0 3WEXA 4WFGD 3PWNA 4J3UA 1T20A 3WS6A 2PW2B 4HX1A 4QXUH 3ARXA 1KTDA 1T7XA 4RBPK 3QDAA 4LCYB 5F7DA 2BSRA 5I1DB 5LBSH 2AP2A 4LQ1A 3X14A 5C0AB 4FZ8L 3VMPA 3VXME 2X4PA 4YHKL 4NZJA 1RPQA 1FJ1B 3HZKB 5DQ9B 3UXFA 4JM4H 4YDJA 2JJVA 3V0WL 4BFEA 1KTRL 2DICA 1I9JH 4U6HA 4JY5H 1CGTA 1KN2H 4QTIH 4HLZH 3ULSA 2WM0A 1DQLH 1G7QB 3IFPA 4LLMB 1Q94B 4Z18A 3S4SG 4TOYL 4S1SL 3KS0H 3ZKMD 3QWOA 2DYPD 1W72H 3CAFA 2ARJQ 5DO2C 5GISH 5BV7H 2H9GB 1AI1L 4OLXL 4LLUA 3ES6A 2VDQL 3MLSH 4KZDH 2QLVB 1RSFA 4XAKE 5INCB 5AUMA 5EFIB 4WW2F 4Y5YB 5A40E 5I2IA 3G6JB 3T4YB 1S7QB 3MO1B 1AD0B 4PJ7F 4LDEB 4PRIE 4PV9A 2YOCA 2LFGA 3UEZA 1IAII 3MA7A 2V17H 2BY3A 2C3WA 1VA9A 3AFLA 3K1DA 4NWUL 1JGVH 3RWJB 2PTVA 4Y4HB 3SKUD 4NC2B 3P4OA 5DMGC 1LO0L 3HNSH 2XWTA 4JZJC 3NFSL 3ARGC 4X9HA 1U8LA 5D1QB 3G5VB 3QCVH 5H37G 4PRAA 1U8MB 4OI9A 2LVEA 2BXZA 2WZPD 4X6EB 3LEYH 1AIFB 5IK3A 2F5AL 1IM9B 3JWNC 3GSUB 4NHCL 3NGBB 4N0UB 3UX9B 2R0LL 4GRWE 3VMOA 3IFNH 2DQTH 4QKXB 1JPSL 5FUCE 2J2ZA 4NKMB 4GMSL 1I3RA 5IBLD 1LHZA 3LKPB 3QDJB 4QCIA 5CSZA 1MCKA 5SWZB 5JW5B 1NGXA 2LV4A 2WUCH 2Y4SA 2DM3A 1S9VA 2VXSH 4MWFB 1CD1B 35C8L 6FABL 1RJYA 2LAAA 1G9NL 3DSNA 4JB9H 5DMYA 1HYSD 3KYMB 1UC6A 2NMSA 3KPMB 5CEZH 4OZGF 5IF0A 2MFNA 3RNQA 1VEOA 4LEXL 2OR8A 1ZLSH 1TJIH 5C7XH 2IANA 1OLZA 5DTFA 4LSTL 2AK4A 2A73A 2YUXA 1IAMA 4GW1B 4PRHB 3BEVA 5FO7A 2COQA 2NY1D 2IBGA 4U0QB 3SDCC 4PREB 1F3JA 3BN9D 4FN0A 1AHWA 1L9MA 5FA3A 3D0VB 2UWEE 3O4LE 1MF2H 1RUPH 5BCAA 2VAAA 2YMXH 1F13A 5J06A 2LABA 3LKRA 4XCNB 1GXEA 1ZT1A 3O6LL 3HE7A 4KKNA 5DLML 5B3JE 3G5XA 4GXUN 1OSPH 4NP4H 3VA2C 3GMMB 5L0QB 1TVHA 2OXGA 5K9OA 2PCPB 3MRLA 1N5AB 4M5ZH 5H94B 4M4RA 1S7TB 1J8HE 1OL0A 1U36A 3BPCB 2DTML 3BKJL 2EDNA 1NBZA 1WZMA 4JE4B 4YHPA 2NY7L 3B9KC 3Q2CA 4QNPF 1FC1A 3SGKA 5D93C 3P4LA 4MS8C 5E4EC 2KUTA 3VFUA 3IDIB 3ZDZE 1F58H 3SQOL 1T1YA 1YDPA 3FTGB 5JXED 3C5ZC 4N1CA 4KRNA 3IDJB 5F21B 3DHJA 4CNIB 4K9EH 4UTBH 4YXHH 5EO9B 2GITA 4GH7B 4I8DA 3VU2A 2VXQL 4JQIH 5L2KD 5MERA 1M1SA 4U1KB 5D8JH 3BGFC 5LWYH 2BJMH 2EC9U 3L9RA 1Z0MA 3VDAA 2FIKA 3FKUS 1FYTA 1NAKL 2IPTL 5DHXB 1JNLL 4GW4B 5DZNA 3LN5B 3I3BA 2VL4A 3DVNB 4PJCF 2FO4B 2XT1B 4PRDA 5F9AC 2AK1L 3R1GL 5GS1C 2RHEA 2GI7A 4ZXBA 3WO4B 1NFDF 4XWOC 2G75B 5GGVY 1ORQA 1NGZA 1P6AB 3PXJA 4OKVB 1RZKL 4LP5A 3PWVB 1KGCD 3QT2A 3S3SA 4Z9KB 5I1JH 2QV2A 3S97C 3QEUA 5D1XA 3OKMB 3LKSB 3D6GA 2KDGA 2NXYC 3CVIL 3K74B 4M5YH 3TT3L 3AS3A 4K2UH 1DJSA 3PWPE 4OGXH 4P5KA 3BESR 2IGFL 4FQ2H 1MFEL 1AR2A 4G43A 5HGHB 1KBGL 1VKXB 3EOAB 3MMEA 5JHDA 2MQ3A 4KV5F 4WNQB 3OQ3B 4YR6A 3HPLA 1BVLB 9CGTA 1NKOA 4U1GC 1H15B 1QKZL 4N9GB 1BX2B 4HF5L 3LEXB 3ARDD 4OB5H 1N3NB 1PKQB 4JCLA 4WTXA 4K7PY 5IMKB 2Q7NA 4P5TD 5KSUB 5B4MD 4OZHA 2R0WL 3TCLB 4UDUB 3OMZA 4TPRH 4F7CB 1DR9A 4P3CH 4ZTOL 1IGML 4OCRL 12E8H 3O6KH 4NRYB 3Q0HA 5IJKA 4U7KA 3UTTA 3VI4E 1DQQB 5SX4H 3FAXA 4GMSH 3CZFB 3WXWL 4F80A 2E7MA 1TJGH 1R5WA 1K4DB 2H2SC 3QHZH 3ZHLA 2MHAB 3MROA 4NQDD 2LU4A 3ZTJH 5E5UB 4CADA 1D9KB 1CT8B 3O2DH 4F2MB 3MGTA 4LFHD 35C8H 4JRXB 2BOBB 1MEXL 4HIHA 4NQXA 5IMLB 3TZVA 2AK4D 5GGVL 5CEZD 2VZSA 3O2DA 3EO9L 1HCVA 2FL5B 4HKBB 4XP9H 5HVHB 1BFVL 3BAEH 3NZ8B 1S7SA 4JFED 1OAYL 1PAMA 4KPHH 1KXVC 1KPUA 4YIQB 2R2CA 3GIVA 3FCTB 4MZ2A 5TDOA 1QRNE 4KZEL 4XPFH 3NH7L 2BCKA 1KEGL 2X9YA 4HMEA 1S9YB 4PP2B 5F6HJ 3O3AB 4RIRA 3VI3E 4KQ3L 1N5YL 4PJ9C 2QR0A 5EH1A 3TVMB 5IMOB 1GAFH 1HHGB 2Y6SC 3HE6B 3NCEB 4HJGB 1HNGA 2BNQE 2E27L 3HE7D 2X89D 4LEOA 4OUOA 1KIPA 3VGGA 5C2UB 2F8VA 3DMMB 4LSVL 2EDTA 3SKMB 1AY1L 4LPVA 5LGHH 3LIZH 1M05A 2J8UE 1X5JA 4QXWA 4C83A 1KTLA 1X9QA 4G8EB 1K3IA 3ARFC 5I76B 3MBEB 4DEPB 4Q6IB 4P0DA 2AVGA 4HMCA 1VERA 3KYNA 4OLUH 5E2JA 1OWWA 2QSTA 2H8PA 3NCJL 3VXUB 5FM5M 4S2SB 3MBXL 1WC7B 4UV7L 4ZPTB 1DDHA 3GM8A 3LCYA 4K7PL 1NCWH 4L4TB 4R4FH 4TVPE 4P4KD 4UUJA 4MHHI 4W4NA 5E99L 1C8PA 3HAEB 5GJSL 2AJYH 2K7PA 5DYOA 1N4XL 2UUDK 4KJYA 5EIIB 4K71C 2ATKA 1DLFL 3KPQB 3B6SB 1X44A 4ZO6A 1X5ZA 4YAQA 1YEJH 1MRDL 1KJVA 2X9XA 4Y4KB 5D4QA 4CDHA 5FF6B 4Y1AD 2P7TA 2CIKA 4G6FB 4OAWA 3NPSC 5F7EL 3RVUD 2G60L 4R7NA 3T2QA 3DI3B 4WWKC 4Y7MA 3BJLA 3VWJC 3OZ9H 5CBEB 2D7OA 2QQLL 1YPZA 1Y6MR 5BOPA 4PLNC 5E2UH 3VXTA 2MOVA 1I7TA 1Z9LA 4A6YB 3RWHB 3JV4B 1R5VA 1CICC 2VKXA 3ZE1E 3S98A 7FABH 2NNAA 1LO2L 1JP5A 1RZJL 3T0XA 4DN4L 1IGTB 4WEBL 5HHOB 4WI7A 1G9EA 1HINL 1E6OL 2Y5TB 4GKNA 2OX5A 4JM2A 3T3MF 3ARWA 2NY5C 3MLZH 5CILL 4FFZL 1PQZB 1BGXL 3BPLC 4GRMB 4HQQH 4NUGH 5DD1L 4GG8A 2OR7A 2F53E 4JZJB 5E6IB 4KJQD 4HGKC 3ARGB 3VXMB 4FA8A 2VC2L 2IGFH 2XN9D 3K4DA 4KWUA 4HD9A 4XPGL 2NY3D 4X4MA 2HJLA 2W0PA 4F58L 1IC1A 3BQUA 1P4LA 3D18B 3G6AB 5DJ0B 4YEEA 3GMRB 3PL6C 3CCHB 3FRPA 4NQVA 4MNGE 2GAZA 4Z0BH 5C6TL 3O45A 5B21A 4KRPD 3PIQA 5E1HB 3PDGA 3O6ML 1QKZH 2XICA 4OF7A 5B38A 4OGAD 2F54E 4O2CB 5IW6B 8CGTA 4X7SL 3W0WA 4D3CH 4H20L 2H6PA 2HTLC 1B6UA 1IEBA 2B2XH 1IM3A 2IFGA 3LKOA 5DEFA 1J8KA 3SKNA 1JHLL 2AKRB 4D0CA 4HT1L 1CFSA 3T0EE 3UTTD 4LPUA 1DE4A 5F9WB 3WFBL 2BX5A 1EK3A 2HFEA 5KJRL 2X1PA 2HJKA 2YPLD 4PRIB 1I1FB 1JYVA 4HLZG 2GTWA 2P5WE 3H0TA 1WBXB 3G6JF 5CP7B 4P9MH 3QULB 4TUKL 1F4HA 4URTB 5FECB 3LH2L 4YPJA 3TZVD 1IARB 5JW4R 4XNXL 5F9DC 4YHYC 3RP1A 2HVKA 1PX3A 3LVEA 2F58L 3OKEB 4JQVA 5AEAA 5FKPA 5JORB 1K4CA 1INEH 1UWGH 5FK9A 5GGVH 1SMAA 3QDGB 4HH9B 4EBQL 4J3OC 2W59A 1BFVH 1OAYH 3MLYH 5KSVB 1HILA 1YUHB 1KELL 4JZNB 1FLRL 5FO8B 4KZEH 4GRWB 4I13B 4X8JA 2UZIH 3QUXC 3MRGA 5C08E 1P7KB 3FO2B 5HPMA 2R69L 3NCFB 3QNYB 3L5XL 3BFOA 4DK3A 3BPOC 4XH2B 3BMWA 3FT2A 1ZKAA 2BDNL 4M8QA 3P4NB 1D5MA 3QQ9C 3T0EC 3EOTH 3GI9L 2X4TB 3IETB 3SKJH 1T83C 1RQ5A 4XP4L 5DJYA 5E4EB 1VFMA 3T1FB 1LK3H 5DQJB 3C5ZB 2I26N 4J2XA 5J1AA 4D9QD 4HK0A 3ULVL 3TO2A 3PP3K 2EYSB 1WIPA 2W91A 1I7ZA 5EBLB 3V7AE 3NCJH 4H26B 4QRSA 2NLJA 4O51B 2F9BT 5CMAA 1RHHB 2HT4D 4OZIE 5M94B 4Q7DA 5DWUH 1Q0YL 5ABDE 1HKLH 4LPXA 4N0FB 1NDGB 2GUOB 2RR3A 5EG6C 1MNUH 5K59E 4MD0B 3DUHA 4NGHL 1GOHA 1EHXA 2FGZA 4OQTA 1KG0A 3G08A 4E41D 4JZOA 5E8NB 3WE6A 2CDGB 2BVQA 4LFHG 2UWEB 1DLFH 2IH3A 2P8LA 3GJFK 3WFCH 3HNTL 1YYLH 4MXQD 1BEYL 1NCCH 1VFOA 2HA1A 2A74B 3MRQA 1C5DB 3DX7B 4GRLA 2PYEE 1GCFA 2K7QA 3L3OA 3QQ3B 5F9JB 1A1OA 3IRPX 2PW1B 3N06B 1J8HB 1A6TA 1SYSA 4MQ7B 3MLTB 4AQOA 4EUPH 2QQLH 3CMOH 3MLRL 2YRPA 4Z8FH 2AXFA 4Q9BA 5DJDB 3WKMH 1NCAL 4I1NB 1R0AL 1MJUL 2NXYB 3AS1A 3O4OC 3O6FA 4JM2D 4EUPA 1A9BB 2GJ6B 4PG2A 5TGBB 4UT9L 4FXGB 1JPFB 1LO2H 3W39B 4YO0B 3S3PA 4UQ3A 4PV8A 1QA9B 3CSPA 1TTUA 3CDFA 2SEBB 4FFZH 5D72L 2AJUL 2DQIL 2L4OA 4U1GB 2OMNA 2ZCKL 2BFVL 2VC2H 3DSFL 1U8QB 3TNMA 1WV7T 4R6UA 5FKAA 5FGBC 4CRPA 4AENB 2YUVA 4FTVE 2EYRA 4OD1L 3DO7B 3FQRA 3VWKB 3BRGC 1F4YL 3LHPL 1RIUH 5C2BL 5DVNA 1KCUL 4A6YL 4E9LA 5B39B 5JOPE 3N1FC 1KENL 4IMLB 3HR5A 4X9GA 1G7LB 1YN7A 1EXUA 3E8UL 4ETYA 4U2YA 5FCUL 3U36A 5ITFA 3O2VH 4NDMA 1HYRC 4P23C 3HCVB 3I75A 3GK8L 4H20H 1PEZA 1WITA 4BSWB 4N90E 4WDIB 1IRAY 4UILL 4Y16C 4HT1H 3GRWH 3LPGA 3Q6FA 1KPVB 4D0DB 4J1UA 5JXAL 5DSCB 4JRYB 2HT3C 3PWPB 3EYQD 1NC4A 1ONQA 1F8TL 3MFFA 2FHFA 1QVOB 3GRWA 5INDA 5FDWA 3RU8L 4Y4HD 1YC7A 1CLZL 2YC1B 4U1NB 5ERWA 1S7UA 3EDJA 2YRLA 3L5WA 3EUUA 5DRWA 4OFYA 4YLQT 2PO6B 3BUYA 5D1QD 1IMHC 1EMTH 3D0LA 3QDME 4I0PA 3D85A 4RWHA 1A4KB 4U1IA 1LDPL 4PJ9B 3RVVC 1YEDB 3HI1A 5MENE 2MSPA 1LEGB 3P40A 1IGYB 4K7FB 1FGVH 1G7HA 1FGNH 2HWZH 2IALA 1PYWA 2ATPA 3S7GA 4LLWB 3QQNA 3V52L 3UYPA 3WHXA 4TSBH 4YBQD 3ARFB 1MREL 1HE7A 3DLQR 1MIEH 2WWKT 5SWZD 3UTSA 1CXEA 4PLKC 4XVJH 1AXIB 2NY4D 4DZ8B 3SOBL 5GHWL 4YUEH 1GGTA 1Z9MA 3B2UC 5EOTA 4XP4H 1ZANL 3VFSB 5FOJA 1UJ3C 3WLBA 3SDAC 4IOSD 2G5BB 5IM7A 3F7PC 1G9MH 4LPYA 3TFKD 4Z0XB 4G8GE 2WWKO 5CS7A 2VITA 4ONFH 1VFBB 2MCG1 4LLDA 2VUYA 1X7QA 2Y7QB 4NQEA 5J12C 4DKEH 1LP9E 1KFAH 4EEEA 5DD0H 2DM4A 3RTQD 3WNLA 4I77L 1QRNB 5A1AA 4HPOH 3BSZH 1NBQA 4OCMC 4MCYA 1I8KA 4WUUE 3ULVF 3U0TA 3QFDA 3NPSB 1QBAA 1MJ7H 4GLRI 2O5ZL 4LCUB 3QI9B 2BNQB 1FNSL 1VFAA 3GKWL 3VWJB 5HVGB 1RUKL 1ITBB 2OP4H 3VRIB 1M71A 3TYGH 1MWAB 3BP4A 2NW3A 3CU7A 2J8UB 2QQNL 1SMOA 3MRHA 4JHWL 3RUGE 2RCSH 5DHYB 1R3KB 4UDTB 5EBMB 2J88L 2AXGA 4PJ5E 1CGSH 4WFFE 4ALAH 1JHKH 4OUUA 2W65A 4S1QH 5GIRB 2Q6WA 4I3GA 1T21A 4XPBH 3O6FD 3RHWF 4IJ3C 4V1DE 1G0XA 2ICWI 2EDJA 5EUKA 4D94A 2JLLA 1JGUH 3B9VA 3BPLB 3QG7H 3H7BA 5IFJB 2VQ1B 1P7QB 4L9LC 5KVDL 3WO3B 3RZCC 1LE9B 1CVSC 4ENEC 2ITCB 4PRNB 2FWOA 4Z76A 5I1AB 4IDLA 1O7SA 3QJFA 5KBNC 3TO4A 2CLZB 4BQBA 1EEYA 2V7HA 6CGTA 3MJ8A 3AM8A 2CKBA 5SWQB 1CDIA 1E4WH 3PL6B 2CRIA 4LQFH 3TV3H 1FZJB 4N0YH 1AKJA 3V6ZA 1FQ9C 2X09A 3JWDH 1K8DA 4FP8H 5GRYA 4LVOB 5A43C 2V5SA 4G8FA 3UTQB 2Y36H 1ZHNB 1KN4L 2A6KA 2ARJA 4O02L 4NQCE 4P57B 3LHPH 4KJWC 5CD5C 4HIIB 1LD9B 1U3HA 3DTXB 5E5MB 2QSQA 1UKTA 2MQ0A 1U58A 4P59H 5DR5L 2RB8A 1RJLB 2GSIA 5I1GH 1U8IA 4K8RC 2HT2C 1YMMA 3GK8H 1Y18B 1K5NA 5EU6A 1C5CH 2NXZD 4UAOC 2BMKB 3FRUA 4ODSL 1JRHL 5DJ8A 5DJCA 4PJFE 3OKOB 3HUJA 5D7SH 4GFTB 1NC4D 2FX9H 2YPKA 5CBAB 4ZYKB 5TJWK 2V2TB 4LAJH 5JXAH 4YHYB 1QFUL 3IF1B 2B1HH 5ACZA 1NBVL 3ULUE 2F53B 5D6CB 1BAFL 3KNBB 2R2EA 3NFPA 1J1OL 1FV1B 3L5HA 3RU8H 1MPAL 1J1XL 1MFCH 1TENA 4IMKC 3GNML 1QQDB 4CVWA 2B4CH 1JHTB 1TETL 3D85D 3MRRB 4IRJC 4HXBH 2VUOA 3W9EB 4XVTH 1ZA3B 5EB9A 3MRBB 2WINB 4MNGB 1CG9A 1UA6H 5IB4B 1TCRB 3QUXB 2F54B 3MV7A 3QHTC 1ZHBA 5F72S 4HBCL 3BP6A 3NFNB 3IDYB 1A9EB 1ED3B 3BPOB 1J10A 2ENYA 2EYTB 2VABB 1HEZA 4DN3H 2FO1A 2C7UB 2VXVL 5SX5H 3FRPG 2ENSA 3T0EB 1N59B 1BIHA 2X4OB 4NO0B 1B0RB 3ZDXE 5FXCH 1D5ZB 4QWWD 5BMFL 5B38G 2ZSWB 1WJ3A 4BUGA 2AERT 1WFOA 3ZHDA 1CR9H 1CIUA 1DLHA 3RWGB 3L1OH 2P5WB 5D7KD 2DN7A 3ELAT 5IHUL 4KDTC 1JPTL 5B22A 3PV6B 5GHWH 4ORGB 3MLVH 4ODHH 2BP3A 4XCEA 1DEEA 3QHFL 4NJAH 5J57B 3TBVB 4TUOB 2OL3B 2NX5A 4AH2B 3C5JB 3I6LD 3F65A 4R26L 5I75C 3VH8A 5DRNB 5DJ6B 1HHJB 3OAYK 4X7TA 5EU4A 3MOAH 5D7IE 4RGMC 4FG6D 4C56E 2BSSA 4WY7L 3U4BL 4HCRH 2IEPA 1FSKB 3P9LB 3QP3A 1ZT7B 5C08B 3KPNB 2YPVH 1U8PA 3SGDH 1B4JH 4BM7A 3ZE2E 1OGAE 4BK4A 5ICYA 1I1AA 4OD2B 5T5NF 4UT7L 3QR2A 4GRWF 5LGJA 1IKNC 4CVXB 2YD6A 4H25B 4F7EB 3CSGA 4KKLD 2DKMA 3DVGB 2EKJA 3SE4A 1QHOA 2BSTB 3O4OB 4LAQH 3VJ6A 4HULB 4PLOB 5I19H 4JHZA 2BRQA 4RGNC 3ARQA 3QNZA 5EU3A 1S9WA 3RVTC 1UH2A 5E8PA 3X12A 5J3HD 1FAIH 3V4UH 2Q7YA 4OZIB 1L7IH 2DLGA 1QYGH 3KPLA 4F8QA 3O3UN 4PJBE 4PTUB 1OCWH 2I60L 1G7IA 2XA3A 3FT3A 1A5FL 1KC5L 3TA3C 5HGDA 1IGCH 1CTNA 1JV5B 4ZFZA 3O8XC 2J8OA 4P46A 3WNOA 1MWAL 3H2WA 1AKJD 1RUQH 1XAUA 3SJVE 3VFMB 1C08B 1QO3B 5CZVL 3PABB 2EZ0D 3I6GB 1QLRB 4PJIA 3SHSA 5J4MA 4I4WB 2PYEB 2UWEF 3W82A 1I8LC 2YD1A 4Y8DC 4P23B 1A6UL 1O0VA 1WWCA 4MA8L 3MRFB 4Z7WE 5B3JF 3N85L 5K9JL 3MRNB 4TVPL 3D25A 4R0LA 1AC6A 5HD8D 3DUSA 4Y16B 1YMMD 4AZ8A 1CDUA 4MMXC 2EEBA 1FNHA 1MCWW 5L9DL 3CH8A 4G3YL 1E27A 5DR5H 3U48A 4ZS6D 8FABA 5HHOD 2Q8BH 5AAMA 2EXWD 4HJ0C 5GS0C 5L8JB 1XR9B 3MXWH 4XNYH 5TQ2L 3RGVC 1V7NH 2OSLA 3ZDZF 5KSAC 1MCCA 4M48H 3N0PB 1SEQH 4WO4C 2VDPL 4NRZA 3DX6A 3IB4A 1Z2KA 1ZVSB 2G9HA 1OGTA 5E6ID 2VR9A 1QFUH 1A7BA 2BOCA 5GSRB 2Z8RA 1RUAL 3WLWD 4EUPG 5FB8A 1F42A 4JKMA 2OR9H 4B53A 3C2AL 1I7UA 4Q0XL 4FTVB 4QRPE 2EDRA 3RA7H 1WTLA 3MNWB 2Z31A 3MV7D 4PP1C 3QIUA 1BLNA 1RUMH 3MACH 5HHPB 4HUXA 3WS3B 3KWWB 5AWNL 3MLXL 5ICZA 3M8OL 2PYFA 4R97B 1Q9OA 3QRGL 4YHIA 3Q5TA 1PLGH 4EI6A 2R2HB 1TXKA 3L7FB 3SO3C 4B7IA 4P3DA 3BIBX 4AJ0A 1PZ5A 1J7VR 1WWWX 4XAKD 5CJ8A 4LLVA 5E1AB 5HSFA 5CZKA 1MVFA 1F97A 1CFTB 2GCYB 4NWTH 3VXSB 5C0BE 2WBJC 3G5YB 2XY2A 1ACYL 4PRID 5I6XC 3F58H 1UJ3B 4XP6L 1QBML 3SDAB 1A2YB 1ZGLM 1QR1B 1RFDH 2OTWA 5MEOA 4DW2H 1DQDL 1EBAA 5DA4A 3RDTB 4PY7A 5J12B 1GVIA 4GG6A 1EFXD 5DD5L 4BH7A 3OXRA 4JAMA 4P49A 3DX8B 2Z35A 2VZ3A 2NX5D 1U95A 1ZHKB 3M1BA 2WQRA 1DQJA 1XGRA 2YEZA 4OZGA 3P9WB 3QDMB 1A4JA 2XWJA 5ID1A 1UFUA 1OSZB 4DGIH 4HV8B 4NBZB 3LKQB 4BKLA 4GBXC 5MENB 2DQGH 3I50L 4RAVB 3IJYB 4R26H 1A6WH 2NR6C 1MRFH 5BO1L 1EUUA 2FATL 3IAQA 3FB5B 1HXYA 4RZCB 3CDGB 1OP3K 5F7YC 3U4BH 3BYTA 3MR9B 3C09C 5ESQA 3U0PB 1LDSA 2ZUUA 2R56L 3ARZA 4F33B 4CBPA 1QNZL 1X5YA 1S78C 1I3GH 3DECA 3WV0A 3O81A 2UVFA 3MQIA 1Q9WA 3ZLQC 3GMPA 3TESA 4IJ3B 5F70A 1UKSA 3QIWA 2EE9A 2P1YA 4M61A 5GGTH 3VI4F 1RIVH 3X13B 1XGYH 3LRSB 1QTYT 4Q97A 2OL3L 4MD4A 4QHKI 4EI5A 4OLZH 4UZGA 5DRXB 2ZSVA 4L9LB 1ZVHA 4FQQA 3RZCB 1MAJA 4MJIA 2EO1A 3QG6B 5FHAL 3CFJB 1LP9B 1KJ3L 4MSWB 4NCC1 4LKXA 1SM3L 3RKPA 3KVQA 2IG2H 3UPCA 2CDFA 3S8WA 4EOWH 2JJTA 1SJHB 4ZSOA 4ZUSB 4AEIL 4XCYA 3S96B 1XR8A 4M7LT 5GRWA 1T89C 2VLMD 4ZOBA 3U7WH 2CK0L 4WUUB 5IMMA 1HDMA 5DJZB 4X6FA 3VXOA 3IDGB 3O4LD 4X6CA 2MMXA 3EKCA 4GW5A 4IRZH 4NKIL 1CXKA 3GSXB 1MWAH 4ZFGL 2O5YL 2BNRD 2HMID 3STLA 4HFUH 3VI3F 3UC0L 4K7PX 3MLWH 2OJZL 1C5BL 1LEKA 3I02A 4GMTH 2X41A 1LO4L 1MAML 4PJ5B 3OBAA 4E42A 1A6UH 3QZWA 1EO7A 5CJQL 1CIDA 4FQCL 2J8UF 3NCBB 3M07A 3QUZB 2XTJE 2CUHA 5C0ND 4DUWA 1MJJA 1A1NB 4L4VA 2DQEH 2X4QB 4JO1H 4U6XA 4V1DB 5TDPA 3E2HC 2PTTB 4QRUA 3BVNB 5ANME 3T1WA 3I6KB 3NOIA 3MREB 3NIFE 5I15L 5HVFB 3FN0L 1MCPL 1CVRA 3PDOB 4MAYA 2A0LC 5HYJA 4M7LH 5F88A 3MUGA 3BGAA 4HKXB 1UXWA 3FONA 3F7QA 4MXVE 1FZMB 2F74A 2NYYC 3OKLA 4CMMB 4G7VL 1JGLH 1UM6L 4ZOCA 4GUPB 4BSVA 2VDPH 4IRJB 1M7XA 3AU1B 3FB8B 2H2PD 1I1YA 1YEHH 1NGPL 2VDLH 1I7RA 2Z31D 3AXLB 5A2LH 1EEUA 3VWKD 3E6FA 2IAMA 1B3JA 4NQCB 5IV2B 2YS4A 3BUTA 1U2HA 4N0CD 4QGTA 5DEGA 4ZUVA 4PS4L 3EW3B 4KFZC 4QRQA 5D7JA 5JZ7D 3BDYL 3EYVB 3R4DA 4ONGL 4X98B 1QBBA 1AO7E 1MH5A 2C4XA 3FL7A 5F1IA 2VLJD 1IAIH 1Q9LA 1QFOA 1PW3A 1ZVYA 4PJFB 5I8EB 3ZT5A 3BZ4B 2Q76A 4MNQB 5D1ZB 2ZNXA 3ZE1F 4XVUC 3FQUA 3V5HB 1Z9OA 4I0CC 4NC1C 1HHKA 1T04B 2HAZA 4Y4FA 2DQUL 1B88A 4JPWH 1DQDH 1WWBX 1TJHH 5BZWB 4UNVA 5H2BA 2B8OT 4AT6A 3MXVH 3JVGC 3FO1A 4U7SA 3ILPB 4U1JA 4M7KL 3U4EA 1ADQL 4ZFFB 1ORSA 4RGMB 5E2VL 1KXTB 1F90L 1HOCA 1QSVA 1A7QL 5IBUG 5LXGL 1XF2A 1XGQB 1BM3L 5FYJH 3WFEH 1KIRA 2BZDA 2QJDA 4EN3B 3ZKXC 5C09E 1FG2B 5DXWA 3TYFB 5ETUA 4R7DA 3MNVB 1NMCB 3WCYA 2VN7A 3QFJE 3V7MA 4YX2L 4B0MM 3MLUH 1FL5B 4P3WA 1U2CA 1DN2A 3D3VE 4D0BA 3NVQA 4XX1G 1GJIA 1BBJA 2CUIA 3CJJA 3QIBB 1FCCA 2CRZA 1LQSR 1S7WA 3LD8B 3OHXA 4I2XA 4X4XB 2R2BB 4MJID 1L0XA 1WFTA 1QLFB 4DZBB 3FQTA 4W6XB 4Z95L 4XMLL 3TA3B 1C1EH 3EGSB 2QADB 4KTEL 1EJOH 5GPRA 1FNFA 5FHAH 5DHVA 2ZUTA 1E6JL 1FO0L 1SM3H 2FBOJ 3HHRB 3FFCA 3VGBA 5IVZB 1CL7I 2GJZB 3SY0A 2ORBH 5D7IB 3WN5A 3ZYJA 4C56B 2Q8AH 3HZVB 3SE3A 2FJGA 4F7TB 5JLZB 3VXRE 5J13B 4JY4A 4KJPC 3QI9D 2BNQD 4GAGL 2OZ4L 1OGAB 1A47A 4ODWA 4ZFGH 3VH8G 4R9HA 2EDLA 1IGIL 1ZLVK 3BGMB 1NMAL 4RFOH 5BZDB 4ZAKC 1FVCB 5HHQB 1TLKA 4NZUH 3FT4A 3UC0H 5IEHB 2WAHA 4PRPA 1P1ZB 2QL1A 4PR5B 1I9EA 1RULH 1NGYA 4I5BB 1RMFL 4L4VD 4XGZA 1JK8B 5EZOL 5IB3A 3LPFA 3ARVA 4JR9L 1HZHH 3I9GL 5CJQH 3MRMA 2GFBA 4WTZA 4PJGE 3RGVB 2EH8H 2V7NB 3A67H 3EFFA 3DIFA 5IVOA 3DETC 2R4RL 1SYVB 4FQHA 5E2WH 4MAYD 2VLRB 4TNWF 4PJBB 3DYPA 5HYJD 3B5GA 1YY9C 3R8QA 4YNYB 3HA0A 3ROOA 3KLAA 2E7LC 4OZIF 1AP2A 5I1HH 32C2B 1T3FA 1A7OL 2NY6C 5K59F 5IESH 3VFGL 1ODAA 2R0KL 3FB6B 1CLOH 3SJVB 5T1MA 3AGVA 5IW1A 3EJYD 1Z6JT 4B7LA 4JFDD 5EO0B 3MJGX 3PJSB 4K8RL 3GHBL 3IXAA 1MHCB 1DVFA 3QA3B 5T1KA 4OD3H 2XNAA 1N0XL 5I1DA 3HI5H 1MHPH 3IT8D 4Z7UA 4FQPA 4Z7WB 2FBJL 2VZTA 5D7JD 1QEWB 3ZMRA 1D5XB 1NEUA 5KS9A 2BVTA 2ICES 4HIEB 5I9QC 2WBJB 5I6XB 5BVPL 4XBGB 3BDYH 3S35L 2X4UB 4NZRL 3MCKA 5L6YH 3SPVA 5BW7A 3ZZ1A 4R3SA 1FL3A 5IT2H 2KKQA 4NM4H 1S9XB 2BC4B 1ZGLP 1EZVX 3FB7A 4OFVA 4YDVB 1JTPA 2CO6B 2I5YL 1W0VA 25C8L 3CXDH 4H8WL 3MUHL 1R3LB 2E6JA 5HHMB 4IHOA 2EKSA 4X8XA 4H0GA 1E4XL 2XWBA 3H9HB 1T6WA 5INCA 1TCMA 4WV1A 5EFIA 2FYYA 4HGWA 1L7TH 1HH6B 4K3GA 1S7QA 3VFPB 1T1XB 1QLEH 4OCYH 2AV7B 4QRPB 3A0OA 1ERNA 3BD4A 3X3FH 3IVKA 3GSWA 3LZFL 2VIRA 3TJEL 5C0GB 4ZD3H 5DZOA 4OCLC 4EVNB 5BQ7A 1ADQH 1B0GA 4OFKA 4X80L 2OTPA 2F19L 1H3XA 1T5WB 3NIDE 1F90H 4MDJA 4FOMA 1HH9B 1UWXH 4I48B 2E8ZA 4WI2A 1T22B 5FYJD 4WFGE 3G5VA 4LSQL 2HFGH 3M45A 3F7YB 1U8MA 1DN0B 4F3FA 4NO0D 3PXHA 4CU7A 5L88L 1UCTA 3ULUL 3MOBL 4MYWB 1XMWA 3BWAB 2ZG3A 5C0BB 4QXTB 4LIQE 3MJ7B 4UTAL 4ELKB 2A77L 4W4OA 2X4RA 1JZ2A 4XC3L 4N0UA 1SJEB 5EULV 3HG1E 3C08L 3EHBD 5CEYB 4MVBD 2VE6B 3OV6A 5IVNA 2YKLH 1RK0B 4KQ4L 4KUCF 1QFWI 1UWEL 1S5HB 4H5SB 3R06B 4G6AD 4XXDA 3OPZH 3BIKA 2V6HA 1OQOA 5IB2B 1XCTA 3MNZA 4HS6B 1J18A 4F15B 4JREC 1FAKT 4IOFD 4MWFA 4P2OA 3HNVH 4Y5VA 3KAAA 4KTEH 2EDOA 3GSOB 1W0WA 2Z8SA 3B43A 4PY8J 3I2CH 1NSNL 2GK0B 3LAFA 2VDNL 3MPCA 1RURL 3TC9A 1F4XH 3GMQA 4KKCC 1A3RL 4BZ2H 1GIGH 4NN7C 1T03H 4MJ5A 4GW1A 3THML 1N6VA 2O26U 3VXPA 1UXSA 2C3GA 4IDJL 5ITBH 5TE4H 3MOQA 1BREA 3UZEA 1M7DA 4L8SC 4PRPD 4GAJH 1S9KC 1GZQB 1X4ZA 4YDIL 1X4YA 5T3ZH 2IBZY 3PNWB 4JPIB 1CBVH 1OAKH 1UQSB 4JPKL 5GZND 5EBWA 3WHE1 4X7CC 5HYQA 5SV4A 5HDOA 1NJ9B 2IQAA 4LDLB 4MDIA 2ICWB 1N7MH 1J0ZA 3IJHA 1SY6H 2PCPA 2VDKH 4HWEL 1OPGH 1U93A 3FFDB 4J3WA 5JO5B 1RAMA 3CLFL 1J12A 1SBSH 3ZKMC 1SY6A 2ZOKB 4LHUB 4ZO9A 4HS8H 4YQXH 4XTRD 3CIQA 1LP9F 3F6LA 1HQRA 4X6DE 4C58B 5LAXB 2D7TH 4Q9CA 1RI8A 4MQXD 2YD7A 2FB4L 4L3CB 1DVFD 5FUZL 5E8OB 1I75A 1OARL 2W0FB 2X1OA 5TFSL 2AXJA 3KDMB 1U8HB 4MA7H 5JW4M 4YHNA 2PUQT 5FGRA 4GAYB 2FSEB 3X11A 5JA8B 1KIQB 5GS0L 2EDHA 4OGYL 5A3ID 4NN5C 4GJTB 2XTJB 4DGVH 3FHAA 1INQB 4GW4A 2ESVA 3DARA 5J0BA 3SGEI 3IDMA 5ANMB 3MRDB 1C7SA 3U6RB 1I9RH 5HI5D 3Q1SL 1ZHLB 3G6DH 3BH8B 3AMKA 4HWZB 1CXHA 5HDBF 3QZWG 1M7IB 3D48R 2F15A 4LBEA 4OIIL 4W6YB 5F3HA 2V9TA 3C6SB 4JDTL 4H8WH 2P43B 3B2VH 1IL1B 1UVQB 1ZOXA 1QPPA 5IBLC 43CAB 4BFBD 1HHHA 1BQLL 5JOFB 2OMBA 1BZ9B 3BXNA 1RU9L 4LVHC 4X7DC 3UBXI 3WUWA 5DUPL 3CUPB 3BE1L 3EOAA 5IG7B 3C9NB 1XH3A 5I1EL 3VFOA 1CZ8L 4O2EA 1HYSC 1HHIB 4KTDH 3KPSA 1ITCA 3L3HB 2WUBH 2F19H 4UV4H 5FM8A 1PY9A 1MFBL 1N64H 2ADFL 1AO7B 3D2UB 2EDEA 1E28A 3CSYB 3GMNB 2HKHL 3H7LA 4LU5L 2NY1C 2DMBA 1MCEA 2V2XB 5LKNA 3NIGE 5IMKA 1MHEA 2VZ1A 1H3VA 3DNKA 1CFVH 5KSUA 3BN9C 5M95B 2CLVB 4F7CA 3RDTD 2MCPH 2BVOA 4PJFF 4WW1A 3C08H 3WFDH 1YNKH 1ZE3C 2IH1A 1GOFA 2BK8A 4FFWD 4KQ4H 3L5JA 4NRXA 4OZFH 5DK0B 3ULUF 3CZFA 1FNLA 1NC2A 1CTOA 1CN4A 1FRGL 3WBDA 4P2OD 4X6BB 3QDMD 1PSKH 2R0ZH 3VRJB 1R3JA 2A6DA 2YXMA 3C6LA 4NFDA 4OZFA 2P42B 1TVDA 3Q6GL 5CIPA 4CW1B 4PGDA 1CT8A 1TQCC 2C3XA 1IKFH 4N5ED 4JRXA 5C71A 3HZMB 1OT2A 2YD2A 5C09B 1NSNH 1TTGA 4TVSa 2FL5A 5JXEC 4X7EC 3QFJB 4XB7A 2A6JB 2A38A 1CXLA 3WJJA 1N6QH 4BZ1L 4JY6B 3ECBB 4QEGA 5IROA 2KL6A 4C57C 4IDJH 3D3VB 1MI5A 4M3JA 4QHUB 4ERSH 1OM3L 3L7EB 4ZO8A 3ZYIA 3ZDXF 5HGBA 1B2WL 3MRJA 1FORL 3TVMA 5JPNB 1CLCA 3DV6B 4PJDA 2FZ3B 3WJLA 2EIEA 2O61B 5T3ZD 1BOGA 3O41A 4HIXH 3EYUH 4PRBB 3DMMA 2XQBH 3FAWA 3SKMA 4G8GD 3RPIB 3EOBA 3U9PH 3IDXL 3CX5J 3A6CL 5KW9L 1VEPA 5I76A 2DLFH 4YFLI 1FHGA 4TSAH 1FL6A 1TVBA 2NY6B 2GK2A 2R29H 4WW2C 4DK6A 3CDYA 5HGAA 5C0CA 3KYAA 1ES0B 4U05A 1DZBA 3CU1A 2ILLA 4ZPTA 5ESAA 5B8CA 5BV7C 4L4TA 3VXRB 1QSZA 3RY4A 1FVDA 2I9TA 4O00A 4H88L 5ENWA 1JZ6A 3WNPA 2CQVA 3L5IA 3OR6B 3BRDA 1IEAB 4P99A 4PB9L 2FB4H 3CC5B 5FUZH 3OXSA 3MA9L 2ID5A 3SDDB 2YWYA 5TFSH 2IANE 3ZE2F 3B6SA 2AK4E 4NNYA 5FOBB 1WCBA 4TUJB 4WFFD 1MJ8H 3CPLA 1HXMB 5CEZE 4QHLB 4HKJA 3P0YH 3QUZD 3BH9B 2ESVD 2L7JA 1BFOB 2J7LA 3PGFH 4S1RH 2Z4QB 3PQYD 2X9WA 4V1DD 1AXTL 4PJGB 4KI5E 1K3ZA 1PX4A 2ZCLH 1SJXA 1JIBA 3S36H 1BOYA 3NN8B 3DVFA 1DBML 1V3JA 4K3DH 3W11D 3I3DA 3ARDC 1ZEAL 4K07A 5LJYH 1VPOL 1SEBA 3QO1B 5BVJB 5T3XE 3OAZH 1I1RA 1H3PH 4P5TC 5B4MC 5EOCH 1KB9J 1QRKA 5IQ7L 4PJBF 3RWEB 3E3QE 1IVLA 4WTZG 2CLRA 3MYJB 3TWCH 4L8DA 2P24B 3BKCH 3R0NA 1BVKA 2AXHA 1MAKA 4JANB 2FH8A 1TNNA 2W07A 2R1XB 1V3KA 3RAJL 2APWA 5EC2A 3QEHA 4X4YB 4PGZA 3BW9B 4R8WL 4NQCD 4JZJA 3BRFA 3KPSD 3ZSSA 3FOMA 2R8SH 5JDSA 3W9DB 4XHQA 1C16A 3JUYA 5D96B 2HKFH 1TZHA 3JV6A 4N8PA 1U3YA 3QB7C 5DUMH 4BZYA 4Z7WF 1OB1A 4K23L 4K3EL 4MCZB 4LCCA 3LSOB 1G7PA 3DVIA 1CU4H 3F12A 2A9MH 4RMRA 1MFDH 1JWMB 4RWYH 4PBXA 1FYTE 3GBNL 4PJ8A 3VCLB 1I4FB 5D1ZD 5BJTA 4D9LL 4APQB 4AMKL 5J6HA 3CFKB 1X5XA 4KDWA 2B0SL 3STZA 3QXDB 2FECI 2JB5L 3HE7C 2ICEB 2AJXH 3ZL4L 5L7XH 3MUY1 1T5XB 2R4SL 2NTFA 3E3QC 2R1YB 1ND0A 3QQ4A 4HC1L 3VGAB 1AFVL 4AG4L 2KQMA 1FRGH 2XFXB 2VLLA 3IS1X 2GSGB 5I16A 4D8PA 4AM0A 4XMPH 2CXKA 3CXHJ 4EN3D 2I9LA 3HC4H 5H35A 2X4NB 5KN5A 3OKEA 1FFPA 2DL2A 1T7YA 1R3HA 3SDCA 5F9OH 1NFIA 1P9MC 4L8SB 1EEZA 2J1KA 2J3SA 3QDGA 4P4KC 2A2QT 4JO3L 5JHDE 2YSSA 1KCRL 4XNMA 1JF6A 1JWUA 2F8OA 3PWLA 2XN9E 4QGYA 4K9EC 5EN2A 3CDCA 2ZCHL 4JZNA 3MRPB 3DX9B 3CH1A 3CK0H 1BQUA 3HG1B 1ROWA 2XZQH 1MQKL 3WNMA 4M7JH 3FO2A 2X1XR 4YXLH 4LASH 4BH8A 1M6OA 5EZLB 4P48A 3WMSA 3P3YA 1A0QL 2J4WH 4UT6L 3PV7A 4NKOA 4KROD 3P4NA 3RVUC 4N0RA 1RK1A 4OZHE 3OKDB 1KLGB 1MHHB 3B9KA 2X4TA 3X3GL 4JJ5B 4X5WB 4HIJB 1EPFA 3VE0B 5C0CD 3C5ZA 3HC0B 5IBTH 5JR1H 4PGBA 3TIDA 3UTTE 4ODUB 4X5XB 2R1WB 3K8LA 5GGSB 4GLRH 2YZ1A 1INDH 4HWNA 5EBLA 4KMTL 2OYPA 3VXNA 5C0JA 3CNKA 4OZ4A 5CGYD 4LLAA 3OR7B 4N0FA 1OGAD 4MD0A 1N2RB 2VDRL 3WL9A 1NL0H 3GO1L 5GJTL 4NZTL 3C60B 1DBJH 2J12B 4FQXD 1FFQA 5EU5B 3VD7A 1NFKA 2CDGA 4AIXA 2CH8A 1NLDH 4KJQC 3MA9H 1AQDB 2NY3C 2DOCA 2W9DL 4U1SA 3QPXL 4HWBL 1C5DA 1GGIH 4DAGL 3LEVL 4Y5XB 5GS1A 4MB3A 4MQSB 3KR3L 5DJ2A 4YC2C 5FA4B 3IJSB 5HJ3B 2HN7A 3ARTA 3TT1H 2XYCA 3MRIA 3B9DA 5FUOH 1MOEA 4DJMA 1VACB 4QRTB 4Z77B 4KRPC 2PW1A 4LGSB 4OGAC 4EQ3A 4FFYL 3VFNB 4KY1L 1G1CA 5A2FA 4JFYA 5JW4Q 3O3BA 1U8KA 3K4ZA 4ZUTA 5HHNA 1DBBH 1TZGL 1A9BA 2GJ6A 4X6DB 5T1LB 1LO5A 4NT6A 5K93A 5F6IB 1NCBH 2GQHA 4JLRA 1LK2A 4Q6YA 1J5OH 1JPFA 5C3LD 5MHSD 3W39A 4YO0A 4MHHG 3ORJA 4GQPH 1YQVL 1UCBL 1HN1A 1UM4H 2HLAA 2DJSA 1V3LA 5LVEA 2NW2B 2GW5A 5JMRA 4JVPA 1N26A 4PUBH 4U1LB 3TZVC 4QHNB 4QTHA 2XZCH 3GZKA 3KJ4C 5HYEA 2NY1B 2M26A 1JI2A 3KG5A 5EORH 4HH8A 1YEIH 4RNRB 1A6VL 4R2GB 1E4KC 4IOIA 1U8NA 5C9JB 2D4DA 2JIXB 4XMKH 4PJ8D 4HUMB 3ZSTA 4UIMB 3T3PE 2ADJA 2D9CA 4OTXH 1GH7A 5I8KL 3T09A 4L5FL 3NIFF 4N1HB 5ICXB 3K3QA 2FX8H 3GSNB 5A16A 1EAPA 5EC1A 3SDYH 4YHLL 4I18B 4XPHL 3PWUB 1YPZE 5BRZA 2B0SH 1L6XA 4OLVH 4G6KH 1S7RB 5C8JA 2VXUL 1GZPA 1IC7L 4LARH 3N9GH 5ALBH 1A6AB 3T77B 3ZL4H 2JJWA 3JV5A 1TQCB 4M6OL 5CZXD 2HP4A 2Z92A 5DSCA 4JRYA 4MB4A 3PWPA 3AC0A 4MQTB 4NCC2 2E9BA 3KPOA 3S5LA 4MA3A 3FQXB 4NKQB 2XQYG 2YA1A 3WEXB 2PN5A 4J4PD 1T20B 1WLHA 2P8MB 3IU3A 3N1GC 2WWMD 4HX1B 3UO1L 1KTDB 5GGSY 4GAFB 2ADGB 4JG0L 5F7DB 3V6OC 2HT4C 3WXVL 2DIBA 3D87B 3X14B 4YE4H 3S4SA 2FDBP 2X4PB 3WUWG 2GYSA 4HEPG 2VO5A 2AS5M 4X4ME 3L3KA 4JO3H 5CUSL 3GUTA 5LGKA 1L0QA 4KAQL 1YY8A 4YDJB 3ALPA 2B5IC 4UQ2A 1YECH 4U6HB 4JFZH 3T65B 2CR3A 3RL2A 3IFPB 4O5LH 3WKNA 1IEHA 2CMRL 2ARWA 4MXQC 1NUNB 5IOPA 3INUH 4XP5L 3W0WE 3ARFA 1IC4L 3QWOB 1FE8L 1W0YT 4JN1H 4XC1L 1IFHH 1A0QH 1UZ6E 4UT6H 4LLUB 5KZCD 3ES6B 2AJ3B 5DI8A 1NCDL 4JHBA 4HHAA 5C07A 1QR4A 1W72B 5AUMB 3X3GH 3SCMC 4RMSA 4XHJD 5I2IB 5H37H 4C54A 2G5BA 4PV9B 1HI6A 2C3VB 3C8HA 4Z0XA 2Z91A 1DQML 3MA7B 1B9ZA 2Y7QA 4HUVB 4LIQL 2AGJH 3OKYA 2I07A 1KCLA 2AABL 4ZNEA 1GHFL 4O9HL 3NTCL 3P4OB 4OZFG 4DQOL 3RWIA 1QRNA 1DCLA 1FIGL 4RAUA 3LPWA 2XWTB 5GRUL 1HWHB 1KJMA 2ERJC 1U8LB 1VGEL 4PRAB 4WWKA 5IK3B 5I74B 4NJ9L 3DRQA 4M4PA 4RRPA 2W9DH 4ZS7L 15C8L 2DM2A 5DHYA 3CD4A 5KAQG 3UP1A 3GI8L 1CICA 4AIZA 1FNGA 1RJZA 3IRZA 4QCIB 4LHUD 5DQDL 4LVEA 1TMCB 5H8DA 5CSZB 2N4IA 2HH0H 1NGXB 3O9WA 4FFYH 4XPTL 1S9VB 4CDGC 1YN6A 4M6ML 5IFJA 1KEML 2W9EL 1RJYB 5IHLB 4G6JH 4R90H 5F6HI 2QEJA 1DUYB 3M17A 5D9SA 4CUCA 5IF0B 5I1AA 2IC2A 3RNQB 2X1QA 4HKZB 3EYQC 2CLZA 4NFCA 2IANB 4XNQA 5DTFB 1YQVH 1UCBH 4QHMA 4ZUWA 2AK4B 3HB3D 4KK9D 5DJXA 2A73B 4Y4HC 3P4MA 3HRZA 5HHXH 1FZJA 3BEVB 4ZTPL 5FO7B 5CJ5A 2XTJD 4JQVC 3UJJL 1OAZH 2MWCA 2QQQA 2YK1L 4BFIA 1F3JB 3HLAA 5D1QC 2VN4A 3D5OF 5FA3B 4Z7NE 1CXFA 1G7MA 1NAMH 2EDWA 4P57A 2VAAB 4NHUA 2EIBA 4X9BA 2CIIB 1MRCL 1OAXL 4PJGF 4JHAH 5EOCJ 1ZT1B 3HE7B 3G5XB 3NGBC 3VDBA 3ME0A 4U3XA 1TVHB 2C1OB 4Y0GA 5BRZD 5K9OB 2EO9A 4PB0H 3ARRA 5EWIL 3ZTNL 4DVRL 5CKGA 3RWCA 5E03A 3MV9A 4OFDA 2LE9A 1NBZB 2XG4A 4YBQC 4WJ5A 1AQKL 4JEGB 5CBAA 1I9IH 1IC7H 2NY0B 3S35X 3VFUB 2NY4C 1T1YB 1YDPB 2F53A 5D6CA 2Y07L 1ZGLA 1WAAA 2DIJA 1WBYA 2EIZA 1K6QH 1QUNA 2GITB 2Y9RT 3TFKC 2IWGA 5I1LA 3PGDA 3VFTA 3ZKSD 5J6GA 1FFRA 5MERB 4POZD 5KVGL 3GHEL 1JTTA 3RTQC 2JELL 4OM0H 1XZ0A 2XRAL 3P11H 3QUXA 2F54A 4Q2ZB 4JFXA 4N9OB 2FIKB 1FYTB 4M6NL 2V5TA 3SEPA 1IBGH 2EYTA 1P5UA 4Y2DA 1H3GA 2Y23A 3EDEA 4PRDB 3T0EA 1MVUA 5FO9A 1T83A 3NABL 1CD0A 4ZXBB 2OI9B 1ORQB 1NGZB 3IDUA 4KKAD 2RJMA 4NM8L 1FE8H 3CLEL 5HHVL 3RWGA 3KXFA 2P5WA 1EO8H 3HI6H 4HZAA 4NN6B 1L6ZA 3ZKQD 1I1CA 3QEUB 4HAGA 4ISVA 3CVHH 3TBWA 1EEQA 3O6FC 4JPVH 4QXUL 4OI7A 3D39A 5IB1B 3TBVA 4P5KB 5LBSL 3CVHA 4AH2A 3W2DH 2ZZUT 3QFJD 3SDXF 3NIDF 5D7LA 3MMEB 5JHDB 2RAMA 4P9HH 1EAJA 4JFQA 2EECA 3EYFA 3WFHB 2XN9B 3HPLB 3D3VD 4JM4L 4DQOH 1MSPA 4P5MA 4EKXA 1I9JL 4WWKD 4DWHA 4JY5L 1H0DA 1KN2L 4QTIL 1DQLL 4YC2B 5D5MB 4E5XA 3FQNA 4G9FA 5E2TH 1A02N 4PGEA 1U92A 4LNVA 4OD2A 1W72L 2UZXB 2ZUYA 5GISL 2D0FA 4OZHB 1XIWD 4NQUA 4BQ6A 2VQTA 5ISZA 4H25A 3MLSL 1FVEB 3IKCA 4OCSL 2R9HD 2C26A 4O2FA 1GRWA 4F57H 3WO4C 1CQYA 3UTTB 3O9WD 5HI4C 5EZIH 4UNUA 3KGRA 3UTSE 5DQDH 2V17L 1R5WB 3VXRD 3CX2A 5TPWH 2JTDA 1JGVL 4LRIC 2NXZC 5DGQA 1J88A 4CADB 4J23A 3EOYG 4MXWH 5E00A 3MGTB 4BELD 4PJAA 2W9EH 3HNSL 2JCCB 4HIHB 4NQXB 4TSCH 1JZ3A 1QPXA 3TZVB 3QRFM 1JV5A 3SDDD 1P6FA 4NQEE 5FGBA 3QCVL 1K2DA 1A7NH 3VG0H 1S7SB 2ICWJ 3LEYL 3H6JA 4NNPH 4P4RA 3JWOH 1QO3A 1KPUB 4HUUB 4Y88A 3GIVB 3MGOA 5TDOB 2DWDA 2PR4H 3I6GA 5C0IA 3E6HB 1JNHA 2BCKB 2FD6H 2HTLD 3EAKA 4I4WA 4RIRB 2Q87A 2QR0B 4P23A 3U46A 3OKNA 1YYMH 1T4KA 3IFNL 2DQTL 2IQ9H 3QUKA 5GGRY 5F96H 1MCWM 4M93B 4J3SA 4I3SH 4LEOB 1C12B 1KIPB 4KRMB 3DURA 1WGOA 1Z3GH 5D2LA 1M05B 3GEWB 4UIKH 1OAXH 2WUCL 4IRSA 4RX4D 5F1OB 1KTLB 2VXSL 5GQBA 1PDKA 4YDKH 4GXUM 4JB9L 3KYNB 4TRPH 3GB7A 3ZTNH 5JUEH 4QWWC 5E94A 2H8PB 2P8PA 5BXFA 1LE5A 5CEZL 4OCXH 3QWQB 3DBXA 3BPNC 3QWRA 1DDHB 1EO5A 4MX7A 1ZLSL 4X6DF 4U49A 1TJIL 5C7XL 4AYFA 1EHNA 1A14H 1D6VH 4UUJB 2VKWA 2OK0H 2Z93B 1J05A 5HPOA 3F5WA 3WNNA 1U6AH 5DYOB 4KJYB 2ATKB 2JB6A 3WNKA 1G9MC 3LQAH 4MNHA 4YAQB 5T3XL 5HVHC 2B5IB 5BS0A 1MF2L 1QSFA 1RUPL 3L95A 2YMXL 4XNUH 4XT1C 2LU7A 4Y2DD 2P7TB 2CIKB 4OF0A 3GSNH 2APFA 4DKAA 1OSPL 4NP4L 5JNYA 4FG6C 4R7NB 5FGCE 1DQTA 1XGTA 2VDMH 4M5ZL 4C59B 1AXSB 1EGJH 5E1AA 1YPZB 1QZ1A 2WBWB 3VXSA 1NGWA 3D9AL 3VXTB 3NABH 1I7TB 2KZWA 1UJ3A 1EGJA 3OAUH 1A2YA 1R5VB 1F58L 2IPUG 4DVBA 1YMME 4KKLC 2NNAB 3D69B 3S34H 3CLEH 5EU6E 4DEPC 1D5BA 3BIAX 4MD5A 1GSMA 2AJZA 1IQDA 4GKNB 4JM2B 4K9EL 3KLHC 5CHNA 3D39D 3HUJE 3RJDA 5JW3H 2QHRH 4YXHL 3KPTA 1KYOJ 2H26A 5J3HC 4DUXA 1YQ2A 5D70L 4GG8B 4JQIL 1L9NA 5D8JL 4CVZA 4M1GH 2ERJB 1OSZA 5LWYL 2BJML 4ONHA 1F3DH 4FXKA 3S5LG 5F7FA 2HJLB 3BQUB 1P4LB 3V4PH 3HG1D 4RZCA 3N50A 4K94H 4G9FD 2P5EA 5ALCH 4NQVB 1W8OA 1FO0A 2GAZB 4G7YH 1WT5C 4LK4A 1J9CT 4Y4KC 2VZVA 5B38B 3MV7E 3NIGF 2EZ0C 1GYAA 3W0WB 2JK5A 2H6PB 1SJVA 3BHBA 4XPAH 1IEBB 1YMHA 3VGFA 3JWDC 5DRZB 1IM3B 3LKOB 5ADOH 5DEFB 1RVFH 2OZ4A 1KTKE 3SKNB 2Q3ZA 3BOVA 1CFSB 3UPRA 1CL7H 5I1JL 1DE4B 4OCSH 2X70A 5CJXC 2HFEB 2FR4A 1ETZA 2D9QB 2HJKB 2VWEE 4M5YL 5HD8C 2DDQH 5DRXA 5I30H 4TNVK 4K2UL 3QH3A 4L9LA 2Q86A 2GTWB 4OGXL 3H0TB 4FQ2L 3GDBA 4RISL 4ZS6C 1J1PH 4LCIH 1QHPA 2F5BH 2HJFA 1N8ZA 1IAOA 1G6RH 2X6MA 4ZQKA 4ETQA 2EEDA 3ARBA 4FABH 3C60D 3QJHA 2HVKB 1WICA 3MTRA 4A2MA 3FJTA 4WUUA 5FKPB 4WEUD 1ZA6A 3K4AA 2NX5E 1CS6A 5E6IC 1G6RA 5FK9B 3RL1A 4UI2A 2EDQA 5AYQA 3WLWC 4OB5L 1OTTC 4YXKH 4RFNC 1HILB 1DANT 3OF6A 1H3UA 3RI5K 3RVXD 4TPRL 4YZFE 2B4CC 4X8JB 3MRGB 4P3CL 2FLRT 3JZ7A 12E8L 5HPMB 1TPXC 3DUUA 1H8OA 4PJ5A 3O6KL 3AAZB 3FT2B 2APTA 1NUFA 4IRSD 4M8QB 4WCYH 2NQCA 1JTOA 1DTUA 4QRRD 1D5MB 1TJGL 2HT3D 3QHZL 4O58H 4RRPG 4KI1A 5IJVA 3BVNA 5DJYB 4L3EA 3I6KA 2D0GA 5T1LD 1CE1L 2NY4B 5F9WC 3O2DL 3O11A 5IGXH 3FN3A 3IFLH 5J1AB 3QWRD 3TO2B 5TE6L 4NQTA 4U1MA 1BBDH 1F6FB 1I7ZB 1LWRA 5JIIA 1RV6X 1EV2E 2NLJB 5CMAB 1I8MB 3FO0H 4XP9L 3BAEL 3L3DA 3S88H 4KPHL 4OBRA 3RVVD 2D7PA 4KH2A 3AU1A 1WIOA 4XPFL 3RTQB 4IBLT 4NNXA 1LEIA 5IVXA 2KBGA 3G08B 4Y8AA 4ZNCD 1IILE 1QSFD 4JZOB 1AGDB 4UMGA 2G2RB 2AEPH 4R2GD 5E8DL 5HI3D 2VLME 1GAFL 2JIXD 2IH3B 2P8LB 3PP3H 3JTSA 4UBDD 5T3XH 3BZFA 5CEXA 5M7QA 4KI5F 4PJIE 3MRQB 3PHOA 5LGHL 3LKNA 3LIZL 1JUFA 4GRLB 2BNRE 3L3OB 3NCYP 2DQFA 1HQ4A 4JG1H 1KLUA 4XI5D 4X98A 1U41A 3UJTL 1A1OB 5FUCC 3U9UA 3TJHD 4H1LH 1DEDA 1NBYA 1A6TB 1SYSB 1HCFX 4OLUL 1AE6H 3EO0A 5I8EA 1ZS8A 3KYKH 5AD0A 4KDTA 3BZ4A 3V5KA 4Z6AT 4MNQA 4UB0H 2DQJH 3R8BB 3D9AH 4H1LA 2DD8H 1NCWL 2RFXB 3GJFH 3V5HA 3SE4C 4OJFH 4KKBD 5ID0A 3OKKA 4R4FL 3O6FB 4EUPB 5HYSA 1BJ8A 2AJYL 5J1TC 3GJFA 3V95A 4UQ3B 4PV8B 2BY0A 1OAQH 2HRPH 2B1AH 1YEJL 5GGRA 5D70H 2BHUA 4GSDH 2XA8L 3B5TA 3BP7A 1KSRA 2MQCA 3TNMB 5FKAB 1MLCA 2XI9A 5EUOA 3KLDA 1XF3A 2EYRB 3IGAA 1G6VK 1K8IB 3FQRB 3GMOB 4M9OA 2OQJB 3OZ9L 1QFWH 1IKNA 5I17A 1O5DT