4Z7UB

S13 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
188
structure length
169
Chain Sequence
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWQEETTGVVSTPLIRNGDWTFQILVMLEMDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 169
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7uB01
15C8H 1HOCB 2EE2A 4H8WH 1CTNA 3CVHL 1EJOL 3TZVA 3DVFA 3LHPL 3CFKB 2IJ0C 1IAIM 2AV7B 5J11B 3WCYA 4JQIL 4NZRH 4JLRA 1DQJB 1AC0A 1W72L 5GSRA 3WXVL 3QNYB 2ZNWA 1QSFE 5EG6C 1RZKH 1HI6B 5F71A 1KLUA 2V2WA 2A77L 2DQTH 3CK0L 3NZHH 5C07D 1IMHC 3U4BL 2JF1A 1QA9A 2DM4A 4FXKB 4PGBA 3KAAA 4HAGA 1GGYA 2GITA 4LPTA 1RMFL 4CMHB 4I3GA 4X8JB 5LJYH 1KCSL 2UVEA 1KBGL 4HZLB 4P99A 2QEJA 2IFFH 3GKWL 2XZAH 3GSNB 3I6LE 4R0LA 1U92A 1OY3B 3X12B 3UJJL 1IQWH 3UDWC 2ICWJ 1IVLA 2R0WL 2XG5A 1QSZA 2FJHB 1ZEAH 3VFGL 1A2YB 3TZVC 1FNSL 1AQKH 1WTGT 4M3KB 4NOFA 1UFUA 3MYZA 43CAA 2QKIB 2OXGA 1K4DA 1YEKH 3DVGA 5IBUB 3RL2B 4KDWA 4YHYB 1I9JH 4BQ8A 5FO9A 4KKNA 1KLGA 3BZFB 5EU3A 3UO1L 5ILTL 4FTVD 3IDJA 2EYTA 1UM4L 1QFOA 3KS0J 1QBLL 2J8OA 5L7XL 3FO2B 1BLNA 4IRJB 4KWUA 4YX2H 5IVXA 2NY6D 1NC4B 1Y6KR 5MENB 1W0WA 3CX5J 2AJZA 4NZDA 4RAUB 2V5MA 5TF1H 4K3JL 3VGBA 2X4OA 4R0LC 4KRPC 1ZT4B 3MJ6A 5GRVK 3S34H 2J5LB 4IIQA 3PGFH 2LU7A 1OD7A 4K7FA 1MQKL 2VKWA 1CI5A 5C6TH 5DK0A 3NZ8B 2GFBB 3ZTJG 5J57B 2X1WL 1GRWA 3GBML 5IEKB 2H8PB 4R4FH 2GTZB 4QOKE 5I66A 4PG2A 5JHLL 2A6KB 4U1SB 1LO0H 1XGPA 3QUML 1N8ZB 2XKNA 4EQ2A 2ILLA 3HI5H 3EO1A 2CLVB 2L7JA 2OLDA 3O6MH 1FC2D 1NDMB 4HWEL 4HBQA 3VG0L 4JB9L 4AH2A 3F7RA 2HJFA 5JQ6L 4NBYB 1UXWB 4N9GA 5JDSA 2R29L 3WFZA 1QFUH 3B8YA 4P3DB 3DBXA 4ZTOH 4TRPH 2VKXA 4IIQC 2DDQL 2XQYK 1AR1D 4FZEL 4UIKL 2Y6SC 5FUOH 1VKXA 3UXFA 1R24A 2IALB 2J6EA 2ADGA 4R2GB 1OGAD 1H3UA 4XWGH 1EEZB 2BVEA 5E70A 5I0DA 3CIQA 1YECH 3S36L 1CDHA 3MLWL 1MJ7L 2P8LA 1G9NH 1CK0L 4PG2C 4HUMB 1AO7E 1I8KA 3HB3D 2M26A 3NTCH 1PX4A 3ZL4H 4I8DA 1A3RL 4LKXB 3DURB 3MRMA 3P3YA 4OFIA 2AXGA 2D4DA 2NW2B 5B39B 4MXWL 3CFBA 1Z0NA 5BV7B 1ZVSA 2GK0A 4F15C 1V7NL 5GISL 1T1XB 2ICEA 5HYSB 4FQXD 4LVOC 4F37F 1UJ3A 2ATPA 4F7PA 4JKPH 4L8DA 4ZUUA 4MXVF 5T3XH 5GGTH 3X3FL 2DJUA 4XNYH 5DJ2B 1TNNA 1MHHB 2FLBT 3KLHC 5CEYB 4H26B 2IBBA 5GGQL 4P2QD 1KEML 2ATKA 3H9HB 4XPFH 3OB8A 1MCOL 4FXGB 4JGJA 3RJDA 4PGCA 4ZO6A 3BD5A 4I18B 4MLIA 4JN2A 2F8OA 3IRZA 4HC1H 2MJWA 4NM4H 5AUMA 1PEZA 4ZUWA 1N4XH 4F8TA 4R7NB 1T2QH 1EFQA 4DQOH 1PVHA 1D9KB 3TFKD 1T03H 3SQOH 5JW4N 4GS7B 4LCYA 2BRQA 1UJ3C 1QKZH 1YJDC 4CADB 4PV8B 3ZDXE 4JKLA 2Z35A 3MJ7B 1CD1A 4KVNH 4OZFG 5GS1B 2HKHL 5HHPA 3ESVF 4GRWH 1DL7L 3P4OA 1HK6A 5E94A 1LO4L 1NFIB 3BO8A 2OI9C 1SJEB 4KK9C 2IQ9H 2XNAA 5FYLE 1AFVL 1BVLA 1WF5A 3LKPA 4RBPH 5CMAA 3VFSB 1HHGB 2HT4C 1OGAB 1PKQE 4HMEA 1BOYA 4EXKA 4R4BA 3WDJA 4JPVH 4ODWB 2EZ0D 4UUJA 4WUUA 4XXDA 1F90L 4HQQH 4M9OA 3GIVA 3KPNB 1ZGLM 3VWJA 3RQ3A 1X5AA 3LRSB 2XZQH 3S4SB 2DD8L 3PWPE 3IU3A 5LBSL 2B1AH 4R7DA 3CGTA 4TVSa 1U8LB 1U3JA 2QLVB 2Y06H 4ELMA 4OD3L 1B88A 1FZKB 1XCTB 3G6AA 4LSUL 3WHXA 5EZIH 1KT2B 2VLRA 4LLVA 1ITCA 4LSVH 1XGTA 1NMBL 2UYLA 4P2QB 4ZPTB 4XBPA 4JFHD 3HUJE 4BKLB 2VISB 3NIFE 3C6SB 5BZDA 1QPPA 1GAFL 3CDYA 4QGTA 4J6RH 1FO0H 2EDTA 1OAQH 5SX5K 4NNXB 2MOVA 3O6FA 3T4AA 3FMGH 3KR3H 4PR5B 5MHSD 3VWJC 5IR1A 5HHME 2ESVE 1YJDL 2MQCA 4OUUA 4XWOD 4XCFL 1IGML 3UBXA 4XPHH 1ROWA 1AQDB 3G5ZA 4FRWA 2R1XA 2VLLB 3MLVH 4GAFB 4KK8C 3EYFB 3R1GH 1MUJA 5CIPA 5CGYD 1JNLL 5LQBH 5ICZA 3GJFA 1MREH 3OL2A 3QCUH 1N64L 5DD0L 2NQCA 2ZCHL 3OX8B 2H9GB 4M8QA 2VXVL 4ACPA 2ZOLA 3QHFH 5DRWB 1S7VB 3FZUD 4JO2L 3IDGB 4M61B 3V6OA 1UACL 4XHJD 3BE1H 4CRPA 3CUPA 4LMQE 3QEUA 3D25B 4ZUSB 3O6FC 4ZUVA 3QUXD 4TQEL 1DEEA 2YPLA 3EYOB 3F5WA 4MJ5B 5E2WH 2NX5A 4LHQB 1E6JH 2XA8L 2HTLC 4OZHB 3U46B 1BWWA 2AK4D 3TT3H 3NCYS 2X9WA 1K8IA 2F54D 2KDGA 5D1XD 5KS9A 1NCBL 5CFHA 3BT2L 2KQNA 4UDUB 4O2EA 5EC1B 3HNTH 1G7QA 5DQJB 3V4VL 4Z7QE 1HHKB 4L3CA 3QEQE 3V6OC 3F6LA 4WFED 2HFFB 1U3YA 1J1PH 1B0RA 3M17B 2W38A 3L3KA 4Y5XB 1AKJD 4CVZA 4ZFOB 3HZYB 2F8XC 4KY1H 1F4AA 1INQB 1JUFA 4IMKA 3WUWA 1QBMH 1HDMB 3KPSA 3DGGB 1KELH 3L5WA 4OD2B 2XQBL 2IG2L 4UOJA 5DJ8B 3STBA 1BEYL 2P24B 1HHIB 1UA6H 3WV0A 3DRTB 2X1XR 3F58L 4POYA 4LSTH 1A7NH 5BMFL 3QZWB 1DN0B 4J8RA 1KC5L 1CLZH 3KYNA 3T4YA 4RSVA 2WK2A 1GIGH 3QPXL 4M1DL 3PHOA 3RNQB 3G6DL 5DD3H 4KTEL 3KLSA 3BESR 5ALBH 1U8MA 2EXWD 3RKDC 1IGYA 1A4KB 1KPUB 4K2UL 4HKJB 3KPPA 4HDIB 4BZ2H 4OJFH 3QXAB 1G7JB 1L7IH 5L2JB 4IMKC 2PO6B 4JZJB 3QUXB 1ND0B 1BBJB 5E03A 2Q20A 5FOBA 3RKPA 4LP5A 4JM2F 1J1XH 1JHTA 4FMFA 4EN3A 3T1WA 1IKFL 4PYHA 2K7PA 1KXVC 4X5WA 4X80H 1V7ML 3BIKB 1KIQB 2AK4B 1XF4B 5JORB 1ZLWK 1T5XA 3HG1D 3QFJD 5IWLA 4LAQH 3MRCB 5FHAL 1EJ6A 5D7IF 3ZKND 4NRZB 1IGFH 1X5IA 2D4FA 1WJ3A 1OSZA 4MJ4A 4K23H 2QADD 2X4PA 2GJ6E 2IANA 1MJ8L 5FA3B 3O2WH 1DBBH 4G6ML 4Z77B 3IDXH 2C4FT 3NCFB 4EDXB 1NCWL 2CIKA 5DK2B 2HJKA 2APXA 1AKJB 1L6ZA 3GBLA 1QD0A 2OJZL 2JELL 3T77A 4EI5A 2ZSVA 3LMJL 1IAKA 5JHDB 2R39A 4HS6A 1MWAA 1TDQA 3O9WD 4NWUL 3DX8A 5BVJA 3CPLA 2QJDA 3KHQA 4Y4HB 2Z91B 5MEOB 3RGHA 1BQHG 1RIHH 5IB3A 3OKNA 4PJHB 4NM8L 5CEZL 5IWLC 2Y5TA 4Q9BA 1C5DB 2AI0L 3SOBL 1C7TA 4K94C 2GT9A 3T04D 4QHMB 5IK3B 3QT2A 4B50A 4TSAH 2WINA 2OL3A 2B4CC 1D6EA 4N0CC 4LRNH 2V2XA 3FQNA 4JREC 1JPTL 2BNQE 3B43A 4C58B 1KLFA 2CMRH 5ETUA 4TSCL 4EI5C 5IKCB 1PZUB 3ZTNH 1FLTX 4UQ3B 5E4EC 3DROB 5IJVA 1EHXA 2DJ4A 4NQDE 3X3GH 3ULUD 1VFAA 3P9LB 3I2CL 4DZBA 1RJCA 4NQEA 2HFGH 1DANU 2UUDK 3DV4A 1ADQA 2WWMD 1RJLA 3RVWD 4MX7B 1EBAA 3HG1B 1GHFL 3QFJB 2JIXD 2CD0A 4MXVE 3RWGB 3EOYG 5ICYB 3ALPA 4PRBA 5IMLB 2ENYA 1KB5H 1P2CB 3LIZH 3MJ8B 4L4TD 5FO7A 4PRPD 2QADB 1I3GL 1A9EB 2R9HC 5D2NB 5J6HA 4LLMB 3SE8L 1H3GA 2WP3T 2ZWLT 3IXAA 2FIKA 3WE6B 5E24E 1GCFA 1SEQH 4XVJL 2ZKHL 2N4IA 3ARTA 3ARUA 3EDFA 3KWWA 4X9HA 3MRRB 1CF8L 1M4KA 3VDBA 5HY9B 2VERN 4UOW0 1CQYA 4LCCA 4TTDC 3O9WB 1EVTC 1QACA 1FNEB 2PYED 2UZIH 4K94L 1T7YA 4K3DH 5ENWA 4WO4D 4DFHA 3BEVA 5ID0A 2VLME 2XKSA 4NKDB 4MA7H 3MGAA 1G7HB 1IT9H 3RTQB 2B4CL 3VRLF 3IJYB 5IW6B 1DFBH 1S9XA 3PWUA 1MFNA 1TETL 4JCMA 5ACLA 1NLDH 1J8HD 3NACH 5CGMA 5T1MB 1JZ6A 2NY3C 1S78C 4XMKL 4PJ5A 5C0RH 5GS0L 1U93A 4RQQB 2C3HA 4ODXA 3M1BB 5HI4C 3FB7A 1KUMA 5ANMA 2F58H 3S5LB 4WEUD 4MCYB 2EO9A 4L8CA 1U91B 5IVXF 1P84K 4Y1AD 2EIZA 1T83A 4M4RA 3TH2T 2A0LC 2C4FU 1RFDL 3V4UH 3ARDD 4PRHE 5IV2B 1P4LB 3HC4L 4J3OC 4U1HA 2AVGA 4U3CA 1FSKC 3SN6N 3EZ8A 2OL3L 1S5IH 3HE7D 3MCG1 3RUGB 3B5GA 5KAQF 4HBCH 1F3JA 3S7GA 1IAOA 3L5JA 3TIEA 2OSLB 2CKBH 3FAWA 4N0UE 1I85A 3ROOB 2X41A 4KKAC 4PRPB 2V5RA 1JVKA 1Q94B 5E2VL 4KKCD 3LQMA 3JWOH 4U7SA 5EC2B 1YEDB 4PP2B 3M8OL 5CJ8A 1TTFA 5DRXA 3SCMD 2R69L 4OZIB 3BGMB 3KPLB 5D7LA 4POZC 3K46A 1EEUA 5FUCE 3E0GA 3C09C 1ADQL 1T83C 1OSPH 3WXWH 3QI9A 4ESKA 5DFVC 1ZHLA 4HH8A 3CLEH 3RWFA 2PYEB 4IDLA 3TBYB 1CXLA 4WO4B 3PG2A 1OAYH 5EU7E 5IHZB 2W0FA 5L8LB 3VI3F 2EYRA 1MCHA 1YPZA 3CSGA 5D6CA 5KVMC 3N9GL 1I85C 4ETQB 5LGJA 3UTPD 2H32H 3MV9E 5EN2A 1OVZA 3OBAA 5IIEA 1HQ4B 1J8HB 3Q3GA 3U36B 4G6AC 3QAZB 4QXTB 4PJDE 4L8BA 2VZTA 4YC2B 3QQ9C 2QQKL 4P57B 4QTHA 1Y18A 5KSBA 5CBEA 3RGVB 1KCRH 1S9YA 4C54A 3UZEA 4Y1AB 5M7QA 4KHTH 4M02A 1N5YH 2HAZA 2W91A 2BY3A 4FZ8H 3TF7C 4PRID 1T1WB 3VMNA 5HSFA 4QNPF 4MQ7B 4D9QE 1RULH 1FFOA 4GBXA 4O2CB 3HE7B 4G5ZH 5A40E 3JV0A 4PJ8A 1JJUA 4UAOC 5E6IB 4ENED 2H45A 3AS1A 2X4TB 4NCDA 3S35X 1MJJB 2VDOH 4OCRH 5IT2L 3ZE2F 1F4WH 4XCNA 4PGDA 2WUCL 4S2SB 1KEGL 3SKMB 3U2SA 3ZSTA 1KCLA 5DDHB 1BM3L 2DAVA 2DI8A 4Z7WA 3WFHA 2WP3O 3WYRA 3OR6A 4TOYH 4YFDB 1FL3A 2PW1B 1MH5A 4NHUB 4U1LB 3T0ED 4LQFL 3EAKA 4S1QH 1NKOA 2Y36L 1GGCL 3LS5H 4WHYG 5I1JH 4WFGE 5F8RC 4WU5A 1G9MC 5DRNB 3CXDL 3F65A 3QO1A 3LN4B 4P23A 4XPTH 4GBXC 3S35H 3TA3A 1IC5H 1D5IH 1PFCA 1KJ2B 1HH6B 2QSQA 4ZUTB 3GSXA 3MREB 2HVJB 1BBDL 4GKSA 1EERB 1CFTB 1EK3A 1LO3L 3MRJB 2RB8A 1KTDB 1P69B 4XNMB 3W39B 4FFYL 4MA1B 4PRAB 2Z31B 4NQCE 3PDGA 1V3JA 3QWOB 5GGRA 1ZVYA 2HKFH 4Z0BH 3F8UB 4NDMA 2RCSH 3FT4B 1OWRM 1DLHA 1I1FA 4XNZC 3GHEL 2CK0H 5F70A 2IAMD 4ZXBD 3LPFA 2GY5A 4PRDB 3BYYA 4ELMF 3VCLA 2C1PB 5BRZA 3HAEA 2F15A 4U6TA 4RMUA 4NGHH 1V3MA 1X4YA 1J5OH 5CP3A 1HHJA 1MY5A 4QT5B 3GRWL 4MD5A 4PRIB 5IVOA 4P23C 1CDGA 3RI5F 4CN1A 4ODUB 3ILQC 4MSWB 4Z7NF 5D7IE 3ALXA 2JB6A 1MIEL 4DGYH 2AJSL 2Y7QB 3MV8A 1FDLL 2FYYB 1WFOA 3QUYB 4OCSL 3Q6FB 4ELKA 2VLKE 1PJ9A 4UT7L 1KXTB 2NY4D 4U1NB 5GRYA 5JO5B 2EEBA 1EO8H 2YPVL 1AGBB 5ERWB 5EUOB 3V9FA 3VH8A 3LKOA 1L6XA 3C60C 1IKNC 4YZFE 4P2OB 5IB4B 1C5CL 5I8OH 1NAMH 1ACYH 3EJJX 4RGMB 1HOCA 3KNBB 4LASL 5DQ9B 3CFKA 2XN9E 2AV7A 4EOWL 3T0EB 1DQJA 1RZFL 1T80A 4POUB 3HNVL 3O6KL 2CDEB 3NPZB 3QNYA 2VN4A 1HI6A 4NUGH 4Z7VB 3FRPA 4PJEE 1JF1B 4WEMB 3EDJA 4FXKA 1TQBC 4O02L 5C0CB 1IC1A 2FGWL 5F9OL 5F7NC 2CLRB 5DLML 3EOAB 1LVEA 2UUDH 4X8JA 1LEIB 2AERT 4HZLA 1UB6B 2B1HL 3GSNA 1Q1JL 4R9HA 3P0VH 4APQD 1D6VH 3EOTL 5DVKA 2AAVA 3X12A 3V0AC 1J86A 5DMKB 2FJHA 4KJWD 3L5XH 1QVOB 1A2YA 2FX8H 5J11C 2QKIA 2YD9A 4OFKA 1LK3L 2OZ4A 4ZXBB 3T0VA 3BPCB 3RL2A 1ZANH 4PGEB 2EH8L 3ZT7A 2V6HA 4NYLA 4OCLC 2PR4H 3BZFA 3HPLB 2XY2A 4N8PA 4XVTL 3FO2A 2LE9A 4IRJA 1NEUA 3EGSB 1NC4A 5MENA 4JFXB 4RAUA 1I7TB 5KAQG 2NY4B 1WICA 4PJBB 4XPBL 2PTVA 3UJIH 5E7FA 4HXBH 3O4OB 1ZT4A 4JPIB 3VD5A 1K2DB 1FYHB 4OF8A 2WSKA 2XACC 1A0QH 2GFBA 3NZ8A 1FVEB 3RVTC 1CTOA 1ORQB 5IEKA 2H8PA 1QSVA 5DVNA 3AUVA 2GTZA 4A6YL 3QUZC 2A6KA 4U1SA 2J8UB 4QXUL 1OLZA 4YHYC 1N8ZA 3CSYB 2ZSWB 5B3JF 3N1QC 3HMXA 4PB9H 2YN3A 4TULL 2CLVA 1TCRB 1AHWC 5FK9A 2DQEH 3LEXB 3BUTA 1NDMA 4IRJC 3B83A 4RGOL 1S9WB 1T20B 1UXWA 4MHHG 4MS8C 2JJSA 5HGDB 3T2QA 4DKEH 2X5PA 1CD0A 4P3DA 2EEAA 4X7FC 2J5LC 3AMLA 4U7MA 3WFDL 2NY7L 4YHIA 4APQB 4BFBD 5IESH 2IALA 1WUNT 5E5UB 1H5BB 3LS4L 5FKAB 1EEZA 4QGYA 1RIVH 2HJLB 1Q9LB 1KOAA 3L3DB 4Q2ZB 1SY6A 5IVXE 1CD8A 2ED8A 5SX4I 5FFLA 4XC3L 3DSNA 1REIA 4ODVL 2VSCA 5IVNA 4LKXA 3DURA 1TIUA 3JUYA 4CN4A 2NW2A 4JKMA 2NXZD 1GC1L 5B39A 5E8NB 4LFHG 3RNKB 3VGFA 1T1XA 1ZGLP 3FQTB 4HFUH 4KVCH 3GSNL 4WUKH 4Y2OA 2Q87A 1M7XA 3OAUH 2JJSC 5D70L 4E41D 1RHHB 3ZKXB 4RISL 5DJ2A 2BY2A 4KJPD 1PX3A 1MHHA 1OM3L 1DSFH 5F7YC 5CEYA 4H26A 3QCVL 3H9HA 2MPAH 4FXGA 2P5WB 1YMHB 4FP8H 2K9UA 1RU9L 3DUUB 2J6EH 1CFBA 4OCYH 3WSQH 4JKKA 4QF1B 4TPRH 4RNRB 3QDHA 2GEEA 3HMWH 4R7NA 1U2HA 2HRPL 35C8H 1D9KA 4PJGB 5BV7C 4IDJL 2DYPB 3N1PC 3VI3E 4AEIH 1RVFH 2W9DH 4PV8A 4CADA 2ZOKB 5JOFB 5JDJA 2AJYH 2NY6C 3MJ7A 3QDGD 4LVNB 1C12B 5T3XD 2X40A 1JRHL 4YHOH 2EDKA 5GS1A 3C5JB 1MCRA 1NFIA 4HWUA 4XP9L 1DBAL 1SJEA 4XZUB 2DQHL 5AWNH 3VFSA 1X5XA 1HHGA 1OGAA 3MUJA 1F45A 1VB9A 4PLKD 3VWKD 4Y19D 3P0YH 3HMXL 4KAQH 2DQGL 4MNQB 4ODWA 3IRPX 5AZ2H 1LMKA 3HI6L 1D9KC 4WY7L 5FYJD 1JHKL 3KPNA 5HHOD 4XNQB 3OKOB 3LRSA 4GS7C 3S4SA 4ZPVB 5SX4H 4QNPE 5HGGS 5I2IB 4LAJH 1WVZA 4FQXA 1KCVL 1U8LA 4L4JA 1KYOK 1CL7L 1KTKE 5GS1C 1TJIH 2LAGB 1FZKA 1KNOB 4E41B 2VWEE 4OAWB 4WI5A 3NCYP 1ZMYA 4QRUB 5EORL 1IC4L 1KT2A 1MCFA 3H9ZA 1AR1C 3ZE2E 5HYFA 2P5EE 3IF1B 1AJ7L 4P2QA 3MACH 4ZPTA 4I0PB 1FNLA 3OGOE 4BKLA 4X98B 2VISA 3C6SA 4WW2B 5E8DL 3W9DB 2IADB 3HC0B 3HB3C 2DTMH 4NNXA 3HKFA 3UBXG 5BV7L 1HWHB 3BW9B 4PR5A 3OMZA 4H5SB 4UT9H 3EYVB 1ZHBB 4LVEA 3VG9B 5E1HB 4FQXC 2Q3ZA 3V7AG 5TQ2L 1AQDA 2DMCA 1DQQB 3P11H 2VLLA 4EI6B 3EYFA 3B6SB 1TPXB 1XGYL 5F7FA 4WUUE 2FD6H 4XCEB 3U4EB 1J0YA 1RUAH 4OV5B 1D5ZB 4GXUN 3OX8A 4PJAB 2H9GA 5JW3H 3QFDB 5DRWA 1S7VA 4X8XA 3IDGA 4M61A 4S0TD 1I7ZB 3IFLH 1ZOXA 3PP3K 2EH7L 3VWKB 3D25A 1D3CA 2FO4B 4IRZL 4Y19B 4ZUSA 3BMVA 4P5KB 4IM8A 3I9GL 1B2WH 3EYOA 4MD4B 4U1JB 4D9LL 2YMXL 2DLGA 3MSPA 4MJ5A 4GG6E 1C1EH 3TFKC 3VGGA 1GH7A 5JW5A 1H8OA 5HHOB 4OZHA 5CLTA 3U46A 4KDTA 3UYRH 4IJ3B 4Z7NE 2C5DC 2E5EA 2AQ1A 1MY7A 1YEHH 2VDML 4UDUA 1NL0H 4ONGL 5EC1A 3BH9B 4GRWB 3DYOA 2ERJB 4CVXB 5DQJA 1HHKA 5IB5B 2I60L 1Z9OA 1E4WL 1R3KB 4JFPB 3WUWG 2HFFA 3M17A 3KJ6H 1EPFA 2IFGA 4Y5XA 4PJCB 3QDMD 3O2DA 4ZFOA 3HZYA 4M6NL 4AEEA 2EZ0C 3GSQB 5EB9A 2C9AA 2JE8A 1INQA 2AGJH 1WFNA 2GI7A 1HDMA 2FSEB 3DGGA 5F96L 4ZD3L 1YPZF 4OD2A 2O26U 3R0MA 5DJ8A 1NFDB 1E4XI 1ZTXH 2P24A 4HS3B 1HHIA 3V6OE 5ALCL 5LXGL 1WZLA 1T7XA 4AEHH 3DRTA 1K8DB 3UC0H 5FCUL 5GRJL 1H3PL 1KN2L 3QZWA 1DN0A 1YMMD 2YPLE 3WIHL 1BVZA 1RUML 2IWGA 5KSBF 5TFSH 5GJSL 3RNQA 2NX5E 1NUDA 3L1OL 3BEWB 2FECL 3MXVH 1AI1L 5ESVB 2DQIL 1FQ9C 4Y5XC 1WAAA 5C09B 1A4KA 1KPUA 1MHPL 5KSVB 1EBPA 4HKJA 4HDIA 3S96B 5KS9E 1FO0B 3QXAA 1G7JA 3FFCE 5L2JA 1JGUL 4JZJA 2PO6A 3QUXA 1ND0A 3T0AA 3FB8B 5CEZE 4QRQB 1IZKA 3MNVB 5K9QG 3PHQB 5DZOA 3DECA 3OKEB 3BYTA 4NO0B 1EEQA 4XWOC 3BIKA 1KIQA 2AK4A 4MDIB 1XF4A 5JORA 3BIBX 2OP4L 5TPWH 3LKSB 5GRXG 2EC8A 1EO7A 1YUHB 1J0IA 1WEJH 2ZNXA 4OGYL 3MRCA 4N8CL 4S11A 3MLZL 4XH2B 4NRZA 2VN7A 4Z7WF 5C1MB 1ZV5A 1A14L 3L5HA 3MNZB 5ITFB 1WCBB 5EU6B 5FGCE 5FA3A 3IJSB 1BAFL 4Z77A 5JZ7D 3FZUC 3LEYL 3H42L 4XHJC 4EDXA 4G9DB 5DK2A 1NFKA 1LHZA 3GI9L 3DETD 1QSED 3DHJA 3QDMB 4JZJC 1AKJA 3QUXC 4JFQB 3H7LA 5JHDA 2YUZA 3W81A 2K1MA 3OPZH 3DNKA 2LABA 4Y4HA 5EWIH 4OT1H 2Z91A 9CGTA 5MEOA 5K9JH 4PJHA 2MCG1 2YA1A 2DQUL 3LQAL 1C5DA 2NYYD 4UILH 1OT1A 5D4QA 2VZOA 4QHMA 5IK3A 3SGDI 5K9OB 3P77B 1Z2KA 1SM3H 4PLJD 1NBVH 1E4XH 1LO2H 3A0OA 3O4LD 1RUKL 3VGEA 1YMMB 2R4SL 2VE6B 4OCNC 5GGSB 4OCWL 4NQXB 3ARPA 4BSVB 3L7EB 3KLDA 3O2DL 2AK1L 1NBYB 3H3PH 3VU2A 2YD8A 1AXTL 5IKCA 5DD1L 4UQ3A 1LGVA 4FQLH 2YKLL 3Q5OA 5D1ZB 3DROA 1J18A 4Y4HC 1MCEA 3VMOA 1YEEH 2IANE 3P9LA 2X05A 1A3LH 4UINL 4JR9H 5EOCH 2WAHA 3GZKA 1JPFB 3MXWH 5DUML 4Z9KB 4MX7A 1SJHB 3HG1A 3QFJA 4DOHB 5J3HD 2DQDL 3O6LH 2E6QA 3G6JE 3MRQB 3RWGA 1YEFH 2LVCA 4WENB 5B3NA 4JHAL 5F7UA 5IMLA 4GMSH 2N56A 1HINH 1P2CA 1WLHA 3MJ8A 5HD8D 2NTSP 4P9HC 5BQ7B 1A9EA 4OCXL 5D2NA 4LOUD 4WCYH 4LLMA 1M05B 3FO1B 4MZ3A 4LIQL 1RURL 2EXWC 2BOCA 4RRPA 3WE6A 4CMMB 2NW3B 3JVGC 5E6ZA 2AEPH 3MRRA 4O2FB 5HY9A 4KQ4H 4HIIB 3N1GC 3O9WA 4WI3A 1FNEA 3IFNH 4KHXL 1TZHB 2CH8A 4R26L 4NKDA 1OAZL 1A7BA 4RDQF 1TJGL 1G7HA 3RTQA 3ZKNC 4IOFD 3IJYA 5IW6A 2FEEI 3KG5A 2ZUXA 5CUSL 5EU4B 4C83B 3QCTL 4OLYL 3AFLA 2QBWA 3O4LB 2QADC 4WI4A 5D2NC 5I1HL 3MLYH 1FGVL 4OTXL 1O0VA 5T1MA 1RZ7H 3AB0B 1DLFL 4NQEE 5E08H 2WWKT 3SGDH 4FABH 1XEDA 3GMPB 3FN0L 3CH1B 4UB0H 4RQQA 2FX9H 2HLAB 3MRIB 3RWJB 3WFEH 4JN1H 4QHNB 2VDNL 3M1BA 3BKMH 1MSPA 3S5LA 5A2LH 4MCYA 3KPOB 1U91A 3O9WC 4Y16D 4NWTH 1YEGH 5IV2A 1MRCH 1P4LA 2AEQL 1NGQL 3LV3B 3OAZK 2OMBA 1YQ2A 3PQYD 2BSSB 4P9HL 3RUGA 5LVEA 1HZHH 2VZ3A 2OSLA 4Z8FH 2VXUH 1CE1L 3ROOA 1A9BB 4PRPA 1Q94A 2HT2D 1VADB 3HZVB 4HMCA 5TE7L 5EC2A 1YEDA 4PRHD 3QJFB 5CCKH 4PP2A 1JPST 1QNZL 4M03A 5EUKB 4OZIA 3BGMA 3KPLA 5EIVA 1YA5A 3MRFB 1PG7L 1SHMA 2FBOJ 2V17L 3NCJH 1KCKA 3MRHB 3ULUC 4GG8B 2D7NA 4X6CB 2PYEA 3E2HB 4OI9A 4MCZB 4OF5A 4PJ5E 3TBYA 2WWMC 3T2PA 4WO4A 3RVWC 5FCSH 4GW4B 4LSQH 5I8KL 1NCTA 4BFIB 5IHZA 4NO5B 3LD8B 1P4BH 5ANME 1KB5B 4ETQA 2VXTL 2Q7NA 5CD5D 1HQ4A 2BCKB 1J8HA 1N0LA 5IM7B 4E42B 4J4PD 1T6WA 3LEVL 3VD7A 1LDPL 4OV6F 5TJWK 4QXTA 3SE3A 4G8IB 4G9FD 5GRUH 5AYQA 4P57A 4P46D 4X83A 3DWTA 3RGVA 1BJMA 5F9AC 2FIRT 4Y1AA 4Y16B 3H7BB 5BS0D 5IMMB 5FOJA 3EUUA 4JM4L 4U2YA 4WO4C 4D9RD 5KW9H 1T1WA 4Z7UE 8CGTA 1CDBA 1MRDH 5HPOA 4MQ7A 4AENB 5TE6H 3PQYB 4O2CA 3HE7A 5D7LE 1R0AH 5C92A 5E6IA 5IW3A 5JXAH 2VMFA 2X4TA 3RU8H 2PUQT 1MJJA 4TUOB 1IM3B 4ALAL 3P9MB 5T5FL 3QAZC 1ACZA 4HSQA 4S2SA 3SKMA 1YC8A 4YC2C 4R90H 5D93B 1MNUH 5DDHA 1QFWL 3ULUL 3RGVC 3BD3A 1VEOA 1WTLA 4LK4A 2CJUL 2N1KA 2PW1A 4NHUA 1YPZE 4U1LA 1EHLL 5E5RB 4DUXA 2DIJA 2EYSB 2L0DA 2DL9A 1EUTA 2RJMA 4O4YL 4G42B 4HV8B 5EZLB 4RMTA 4V2CB 5DRNA 2I27N 1E4KA 1MCIA 5BCAA 2PCPB 3LN4A 4LEXH 3MLRL 1OP5H 2DQFA 2OR9H 3HE7C 1J1OL 1KJ2A 1N6VA 1HH6A 4RZCB 4ZUTA 3MREA 1G9MH 2HVJA 4W6YB 3V5DB 5KSBE 4B0MM 1CFTA 2CKBB 4L29B 3MRJA 3G08B 1KTDA 3QRGL 4XNMA 3W39A 1TQCB 3VI4E 2V5SA 3GHBL 1YNLH 4ONOA 4PRAA 4KKCC 4JO3H 2Z31A 4UZGA 3QWOA 1F58H 1NJ9A 1QBBA 3HAEG 3FT4A 4WNQB 1DBKL 1OARL 4XNUH 3SCMC 4G9FB 3KJ4B 2WWKO 2FEDC 1Z3GL 3MBXL 3FHAA 2Q8BH 3NFNB 4LQ1A 4PRDA 2C1PA 1PGRB 5IROA 4XX1E 2YD4A 4TN9A 1E4KC 4QT5A 4P3WA 1FV1B 2XXMB 2YA0A 4PRIA 4OCMC 3VH8G 4MSWA 4KMTL 4LCIH 2Y7QA 2FYYA 2QQLH 4Z7WE 1T0NB 3QUYA 4QRSB 4KZEL 3Q6FA 3PV6B 2PF6A 4U1NA 2H32B 3S97C 1BMGA 1NGWB 5JO5A 3UEZA 1AGBA 2R0LH 4MA1C 5ERWA 5EUOA 5IMOB 5DMGD 4U6HB 4P2OA 5IB4A 4OGXH 2XZCL 4LLDB 4M7JL 4YQXL 4X7EC 5A43C 3SJVD 1DCLA 1A5FL 4WFFD 3KNBA 4U49A 1BZ7B 5FGBA 3KDMB 5DQ9A 1OAKH 4M6AA 1IGCH 1A6TB 5IROC 3T0EA 1MIMH 3RY6A 2CDEA 1MCLA 4LHUD 2YK1L 4Z7VA 1UXSB 3AM8A 1JF1A 2HVKB 1HXYB 1FH5L 4IS6B 1S7TB 5BZWB 2QSCL 5CP3H 3TM6A 4DZ8B 4OIBA 5C0CA 5HDQH 3QUYC 4M9PA 2CLRA 3EOAA 4JAMB 5FO8B 5KBNC 1LEIA 4RDQG 3E6FB 5E1AB 4ENEC 1MFDH 1UB6A 5IB2B 1NCAL 3BGFB 5BRZE 1A8JH 1QPXA 1WWAX 4X6FB 4P2OC 5CJOL 2AJVL 4G6JH 5IBUG 2H1PH 3WFBL 1F4HA 4RGMC 3U9PL 4OZHF 5DMKA 1TENA 4HS8L 1N5AB 1QVOA 4LNRB 5FGBC 5MP6H 5TDOB 5KG9B 2JJWA 3PXJA 5GGVH 4P2RB 3VW3L 4O9HL 4YR6B 4ZXBA 4N9OB 3BPCA 3T0EC 4CL7A 3RY6C 3PWVB 4PGEA 4JPWL 3MV7D 3X13B 5DMYA 1KJ2L 1LD9B 1CDJA 3AM8C 2F53B 4C56D 2YSSB 5TQ0H 3HPLA 4XAWL 1RQ5A 1SEBB 2XRAH 3F7QA 3HNSH 4LPVA 1FGNL 3EGSA 3TYGH 4Z18A 4JFXA 1KFAL 1I7TA 4WDIB 4PJBA 1Z9LA 2CUMA 4JPIA 1H8SA 1PY9A 1K2DA 4L9DA 4WTZA 1W8NA 4YDLB 4AG4H 1RUQH 4ODSH 3SEPA 1MEXH 4U6VL 4XMPL 3SJVB 1FVEA 1ORQA 2IAMC 3PUCA 4ZXBC 1G6VK 2APVA 5JOPE 2J8UA 1S7RB 2NZ9C 3A6BL 5IFHH 3CSYA 2IGFH 2ZSWA 4QTIH 2ARWA 5E9DD 1JZ3A 1WZ1L 5I1CL 3MRBB 1TCRA 2OZ4H 4K3HA 5HHVH 2VZVA 5IFAL 1JIBA 1Q72H 3O2VL 4LHUB 3UPCA 4L3ED 2D7MA 3IU4L 3LEXA 1J88A 5KVFH 1HYRC 2Z8VC 1WAAF 1S9WA 4K7PX 4HW6A 1T20A 2AABL 1FYTD 2NY4C 4LU5H 1FNFA 3OAZH 5HGDA 2JCCB 3GMQB 4QRRD 2H2PD 3SDAD 3O4OC 2JJUA 4APQA 1MFBH 1NAMB 1H5BA 5FKAA 2B2XH 4K07A 5C0BE 1F6LL 4NJ9H 5I71B 3TP4A 2HJLA 4NQTA 5B39G 1Q9LA 2HWZL 1MAML 3L3DA 4Q2ZA 3FOMB 1GGBH 2F19L 3GMRB 5MENE 3BPNB 3JWDH 5D9SB 3QIUD 4U3HA 2R1YB 4W68A 1WIPA 4X4XB 3NABL 3DSFH 4K7PH 3MV7B 1UCBH 5E8NA 3CVHH 3D39B 1OP9A 3RNKA 4C56B 3FQTA 3H6JA 5DJZB 2EE3A 1U42A 1U58B 1W72H 4MGXA 1VENA 3ZMRA 1ZT7B 1RHHA 3PWNB 2BOBB 4APQC 4DCQB 4FQIH 4JO1H 2HLFC 2X4SB 1H5BC 2R2CA 1HKLH 3TT1L 4KJWC 4PJHF 1YMHA 4H8WC 5C07E 1U95B 4XVSL 1FAIL 1AD0B 3DUUA 1JMZA 2MKWA 4QF1A 2EDFA 4RNRA 1I8LA 1DQML 2WUBL 5ADOH 2R0WH 1JNNH 1SY6H 1U2CA 1RZKC 1JF5A 4PJGA 3MRKB 4KV5F 5E9DB 3TLRA 3C2AL 5EO9B 2DYPA 1CGSH 3FRUB 3RY5A 2CO6B 3EFDH 4HK3J 4L3EB 4ZS7H 4H0HB 1HE7A 2ZOKA 5JOFA 1N6QL 5CJ5A 3V5HB 1C12A 1AY1H 3WFCH 1H15B 3ZKXC 1FYTB 3C5JA 3TCXA 1IBGL 4QRRB 3SDAB 1XR8B 1RPQA 4G8EB 4XZUA 3U82B 1JPSH 3V95A 2EDJA 2G75B 3B4NA 5ELIA 2WV3A 3KLHD 1YDPB 4K3JH 5GQBA 4FTVE 1S3KH 1I8LC 4MNQA 1MVFA 3E1F1 3QIUB 1JGVL 5L9DL 3NIDF 3NN8B 2BVPB 4XNQA 3U79A 3OKOA 2XY1A 1EHNA 5L88H 4ZPVA 4LVHB 5I2IA 4I2XB 3SKNB 4N90D 4KZDL 1KTRL 3QUMH 4LVNC 4OQTL 4PYGA 5C7XL 1KNOA 4E41A 4OAWA 4NZTL 3V52H 3QXDB 4QRUA 3MRNB 3VFPB 4HKZB 3BXNB 1OCWH 2IPUG 4H8WL 1X6LA 3IF1A 4P59H 2BX5A 4EJ1C 4MJ6B 4I0PA 2VR5A 4X98A 4GW1B 4NZRL 4WW2A 1GOGA 2F74B 3W9DA 1RZKL 2IADA 3HC0A 2YBRB 1VGKB 2DQTL 3BW9A 1A7PH 1F4YH 1CLOH 1UZ8B 3TNNB 1F4XH 1KIUA 2HP4A 1NSNH 2NXZC 4PUBH 4H5SA 3EYVA 5DSCB 2HMID 1ZHBA 1MJ7H 3CX5K 4ZOEA 2QSTA 4P5MA 5GGVY 3LRHA 2VXSH 2Q8AH 3TIDB 3FT3B 2IFFL 1OGAE 1I7UB 2XZAL 1DQQA 4EI6A 2B0SH 3QDGA 5T1DH 3T65B 5GGTA 4MXWH 1IQWL 3IB4A 3K0WA 3CXHJ 4KJPC 4XCEA 3U4EA 3K8LA 4OV5A 1D5ZA 1ZEAL 2BNRD 1QHOA 4PJAA 3QFDA 4I0PC 4OB5H 4MQSB 3ULUF 5EBWB 4WW2C 1I7ZA 1YEKL 1FNGB 1ZXQA 3OV6A 1A22B 3VWKA 5GZOD 5D8JH 2M1KA 1I9JL 1I8IB 2FO4A 3HE6D 4HC1A 4Y19A 3K1KC 4P5KA 1X9QA 5GGQH 4D0DB 4MD4A 4U1JA 1UVQB 1U41A 3RUGF 3OHXB 2DBJA 1U8NB 3U7AA 5HHOA 4YX2L 3VG9C 4P2QE 1ZLSH 5K33A 1TVDA 1JYWA 1TPXC 3S34L 3VGHA 2VDLH 3PGFL 3F7VB 4PPTA 4OZIF 3BH9A 3EYUH 2EDXA 5C6TL 4QHUB 5JTWA 4CVXA 2YEZB 4YFEA 4LSDA 3MOQA 3BUYA 3WKML 5IB5A 3GDBA 4R4FL 1R3KA 4JFPA 5D7JD 1CXIA 2VLRD 2UY7A 1LO0L 4PLKC 3T0XA 3VWKC 4PJCA 3HI5L 4GAGH 3WNLA 4PJ7B 3X11B 3GSQA 1J11A 4JE4B 5F3HB 2FSEA 1NUGA 3QZWG 4U2ZA 3V8CA 4IJ3C 2I25N 2KPNA 2BHUA 1NFDA 5GS2H 3G5YB 2XA3A 4GT7A 4HS3A 1A7RH 1QFUL 3PL6B 4ZTOL 4TRPL 2DLEA 1K8DA 4NCC2 2WIIB 5CGTA 4K7PY 3GMLB 2OR7A 3QBTB 2X1QA 1GYAA 2ERJC 1OW0A 1A6PA 4XWGL 1IEHA 4JHWH 1YECL 2BNRB 4Q7DA 1G9NL 4OZHE 3BEWA 3BQUD 3NTCL 5ESVA 5DO2D 3ULVH 2EO1A 5C09A 3ZL4L 5KSVA 3L3OB 3ILPB 2NY5L 3S96A 1FO0A 3NCCB 3HE6B 3FB8A 4UU9B 4QRQA 3MNVA 3PHQA 1OOAA 4MZ2A 3OKEA 3QG6A 3BZ4B 4NO0A 1EEYB 4TUKH 3JTTB 5L8JB 1T0PB 5T3XL 5GGTL 4MDIA 4XNYL 2X4NB 4G43B 5J7CC 1MCWM 4JFHE 3LKSA 2WQRA 1YUHA 1QHPA 4XH2A 1QG3A 1OW0C 4XPFL 4QOKB 4OLVH 5EPMB 4NN6B 5B4MD 4XCFH 4OLXH 3UYOD 3MNZA 4TNWF 5ITFA 5MHSE 1WCBA 5EU6A 2P47B 3U7YH 3IJSA 4HC1L 3HHRB 5D7JB 4NM4L 3O8XD 4G3YH 5HJ3B 1N4XL 4YFLF 2OYPA 1T2QL 3SKJH 4G9DA 4DQOL 2Z4QB 2HG5B 4ZS6D 3QDMA 1PZ5B 1T2XA 4QXWA 2ORBH 5DD0H 3SQOL 3GI8H 4JFQA 2AEWA 4BELD 4ZOCA 1QKZL 1S9KC 2BSTB 5I15H 1I75A 3UTSB 2LU4A 5I17B 5DHYB 3KPSD 1P7QD 3CVIH 5DJ0B 1TTUA 1AIFB 4KVNL 1WAAE 4LSRH 1ED3B 4G6FD 5JR1H 2IQ9L 5K9OA 3P77A 1P1ZB 4WEBH 1QZ1A 3PGDB 1YMMA 4Z0XB 2VE6A 5GGSA 4NQXA 2H6PB 4MQXD 4BSVA 2XZZA 4J1UA 3L7EA 3ZYJA 4ZFGH 3SE9H 4JPVL 1NBYA 3CMGA 3WJLC 5JIHA 2AK4E 4HQQL 3MR9B 3BQUB 2FHBA 3V4VH 2F54E 4PP1D 1PYWB 2XZQL 5ESAB 5D1ZA 2ZJSH 4PJ9B 4F2MB 3BWUC 5T3ZD 2B1AL 3FB5B 4XGZB 2Y06L 4PS4L 5CBAB 4NC1C 5EUOF 1JPFA 4ZFFB 4EN3D 3OAYK 4WFEE 2Z8RA 1SJHA 1FBIH 4HEPG 4X7TB 5EZIL 1QYGH 3MRQA 1UM5H 2IG2H 1C7SA 3KLAB 4LSVL 5FDWB 4RRPG 4CW1B 3RA7H 3DVIA 4LBEB 5BQ7A 3GSRB 4M3JA 1BJ8A 1FO0L 3ES6B 1WK0A 1M05A 3FO1A 4GSDH 1OAQL 4PJHE 5BMFH 2P44B 1BVKB 1E4JA 3FMGL 3O8XB 4KPHH 3KR3L 3TV3L 2AXJA 2E7BA 4CMMA 3T2NH 2NW3A 4Z7VF 4R96B 5CP7B 3MX0A 5D1ZC 3I3BA 2IH3B 4O2FA 2OK0H 4HIIA 2W07A 4UIMB 4XPHL 4KV5E 4EI5D 3MLVL 5H94B 3R1GL 1PDKA 1P7QB 5T33H 5LQBL 1IC7H 1TZHA 1A6ZB 1MREL 2YN5A 2EEDA 4MDJB 5HVHC 4UNVA 3CFCH 4AM0B 4RMVA 4G6FB 3T0BA 3B2VH 4HCRH 3QHFL 5EU4A 4C83A 2A9NH 5KOVC 3O4LA 4U1IB 5FM5M 3BE1L 4KK6D 3S5LG 3U30B 5JZ7C 3ARGD 3GMPA 3PWPB 3CH1A 5LAXB 2HLAA 3MRIA 3RWJA 1QLRB 3DETC 3HG1E 1G7LB 3QFJE 5E2WL 3ZO0A 3TPKA 1E6JL 5L2KD 4FHBD 1MPAL 3KPOA 3NIDE 4M48H 3V79C 3QNXB 5D2NE 4PJBF 3F7YB 2I07B 3P73B 1R3LB 5D5MB 4P0DA 3LV3A 1AGFB 3HNTL 1MCCA 2NYYC 4IRSD 3PP4H 1GGIH 3HZMB 3CMOH 5C0EB 2QTEA 2BSSA 4PLJC 1RK0B 3D87B 5HVGB 3EHBD 1J1PL 1CBVH 1LDSA 1IQDB 3AB0C 3H3BC 3ZSSA 3F62A 3LH2H 1A9BA 2J8UF 4KY1L 1VADA 1F97A 3HZVA 3QJFA 4NO3B 1QBML 3W82A 5IW1B 4HJGB 5EUKA 1M6OB 2MCPH 3IXTB 3MRFA 4L8SB 3MRHA 4GG8A 3L95B 3MLXH 4FFWD 2YUWA 4NJAH 4NRYB 4X6CA 5A1AA 1WSST 2ID5A 4LSTL 4MCZA 4QLRA 1A7NL 1NCCH 1BOGA 4GW4A 1FFNA 5J3HC 5KANG 3TC9A 1T3FB 4BFIA 4LGSB 4X5XB 1GIGL 1BFOB 4NO5A 5F1OB 5L0QB 3UCRA 3RAJH 5DD3L 4GKNB 5ALBL 4XP5H 4FQ2H 1KB5A 1G6RH 2EXYC 3SPVB 4LOUC 2BCKA 5JOEA 5F9WB 3ULUE 4OJFL 5GRVL 5BO1H 1JN6B 4GFTB 1L7IL 4LP4A 5IM7A 4E42A 2C3XA 1FL6B 3N1FC 3ARGB 2H3NB 2Q76B 1J1XL 1YNKH 3AXLB 4G8IA 1OF2B 1C16B 1U9KA 3C5ZD 1FP5A 4X80L 1UCTA 4GAJH 5L2KB 4M5ZH 3B9VA 1IILE 5HTSA 1NMAH 2VSDA 3I85A 4Y16A 3H7BA 3JV6B 5IMMA 1RY7B 1ZKAA 3E2HC 4G80B 4L4TE 4LAQL 1JPGB 4POZD 2IQAB 4PRPE 2GQHA 5D7KD 2ZKHH 1IGFL 1YEIH 2DI9A 2W9EH 4OZ4B 4K23L 3L3JB 4IRSB 4AENA 5FHBH 3LD8C 3PQYA 1Z5LB 3MLPA 4IOFC 4OZIE 1DBBL 3C9NB 3IDXL 3SY0B 6CGTA 4U05A 4ZFZB 2BNUB 1P4IH 1ZLVK 4TUOA 1IM3A 3AC0A 1KTLB 2PYEE 3IETB 3MJGX 3ZKMC 3P9MA 2H2SD 4PJGF 4CU7A 1WQVT 1GZQB 4LDLB 4DWHA 2CXKA 4MAUH 1IE5A 1QO3B 4FQ1H 1RIHL 1Y6NR 3UZQA 4DAGH 4Y16C 1Q9KB 2CRIA 2EYSA 5BXFB 3MNWB 3SO3B 5EOQH 4J23A 4JHZA 1J8HE 4G42A 3QI9D 4HV8A 5EZLA 1JFQH 4TSAL 4N8VB 2PCPA 5I75B 4ZO7A 2X10A 4LRNL 3U48A 3UJTH 4RZCA 4G8FB 3V5DA 3FT2B 2CKBA 4HIJB 4L29A 3G08A 4Y1AE 1JCKA 4CU8A 2CMRL 2CR6A 2HT2C 3I6KB 1BJ1J 3ZTNL 5J1SC 4WV1A 5D93C 4J4PA 2GY7B 3NGBB 2WW8A 2VNCA 3X3GL 4WNQA 3IJHB 1HILB 2ICES 5I1LB 4G9FA 1N0XH 2HFGL 2I5YH 3C5ZB 1CXHA 3NFNA 2GIYA 1KENL 2W59A 4HJ0D 3UTTD 5BS0A 2GJ6B 3VXQB 5HYQB 1FV1A 1KB5L 2B39A 3LIZL 4M4PA 4Q6YA 2DQCH 2VZSA 4X9BA 4F7TB 3MZTA 3OJ2C 4OF6A 3UTZB 3VD4A 4YHZL 1T0NA 2B20A 4QRSA 4WW2F 3QYCA 3PV6A 2H32A 1NGWA 1TQCC 3KVQA 5CD5C 5HHQB 1B0WA 4PJ8D 4Q9RH 3WD5H 5IMOA 1SEQL 1IZJA 4WV1C 3OZ9H 2R2HB 3JWOC 1XGRB 5E5MB 4U6HA 4HIXH 4J4PC 1K5NB 4LLDA 1JBJA 3KJ4C 1ZA3B 1EX0A 4P46C 1CXFA 4CNIB 1S7UB 2UZIL 1BZ7A 4K3DL 4WI8A 1F2XK 3KDMA 3LPGA 4GH7B 1A6TA 1V3KA 4K9EH 1JYNA 4TNVF 4MA7L 3UTPE 4KI5C 1IT9L 3O0RH 2X09A 2Q86B 1I7RB 1UZ6F 1N59B 2E9BA 1UXSA 4PJAF 2HVKA 1HXYA 4IS6A 4JFED 1S7TA 5BZWA 1NLDL 4DZ8A 2CUHA 3NACL 3RIFK 5IQ7H 4MYWB 2GTWB 4K3EH 4JAMA 5FO8A 1EUUA 5C0RL 4EDWH 5F1NB 2C3WA 3TA3D 3E6FA 5E1AA 4HEME 5IB2A 1R5IB 2OS7A 3F12B 3RIAK 1CIUA 4X6FA 3HI1B 4LCWD 1KACB 2F58L 4NZJA 4PRIE 4KFZC 1N5AA 3V4UL 1H3VA 4LNRA 5TDOA 3SO5A 5HPMA 4M00A 5KG9A 1M71B 1YYLH 2F5AL 4HHAA 2E9JA 4P2RA 4YR6A 2VL5B 5C8JB 3NH7H 3PWVA 1S5IL 5EUOE 1MAJA 3UTTB 1ZLUH 4GRWF 5F8QC 3X13A 3WEXB 1LD9A 4HBCL 2F53A 2YSSA 2NZIA 3RWDB 1SEBA 2FNBA 5E2TL 1FORH 5INDB 4WTZG 4PJCF 1BQHB 3OKYA 3MV8D 3L9RB 4HKBB 4WDIA 5LGKA 1RIUH 1FCGA 5GZND 4AMKH 3T0EE 5C3LD 1X3DA 3RVUD 3T0DA 2ZCLH 1GZPA 5F7LB 3GEWB 4Z7VE 1OSPL 3WXWL 1X4XA 1LK2B 1NFDF 3SJVA 1G1CA 3CLEL 4FFYH 2E7LA 4WHTB 4OM1H 4URTB 1S7RA 4GXVH 1OAYL 3V6ZB 2SEBB 1CDIA 3MRBA 5HI3D 1RK1B 3VXRD 4LHUA 2Y25A 4JFEB 5CEXB 3BRDA 3V8OA 5FAAA 2PN5A 1UJTA 3JSSA 1IM9D 4L3AA 4LHJB 3GRWH 1N7MH 2Z92B 2HFEB 2JCCA 3GMQA 4WTWA 5DMGC 3OB0K 5FDYA 4X0KB 2KL6A 4MXQD 4YDLC 5DRZB 4U3XA 1ERNA 3MOAL 4LCWB 2PYFB 4YDIH 1NAMA 1KCRL 4ISVB 2D3VA 3PHSA 2BDNH 1K3IA 1R3IH 1AXIB 4KHTL 4P49A 2YPVH 5FXCH 2E7LC 4FZ8L 3FOMA 5JLZB 3GMRA 4EBQH 1EHAA 5B22A 1C5CH 5D9SA 1GGTA 4LSSH 2C1OA 4KTDH 2UVFA 2R1YA 3DPBA 4GW5B 1RULL 4N0UB 4X4XA 3BRFA 3OR7B 4G5ZL 3MV7A 4JEGB 3D39A 4C56A 1NAKH 5DJZA 3RHWK 3C5SB 1T0MB 2VDOL 4OCRL 1U58A 1SQ2N 3RVXD 1RZJC 1F4WL 1ZT7A 2C7UB 3PWNA 2FBJH 4ZYKB 1KIRB 1BZ9B 5EZOH 2BOBA 1G0XA 3MUY1 2APBA 2YRPA 4U1KB 5DJCB 4TOYL 2X4SA 5I71C 4N1EA 1EXUB 1FVDB 4OGAD 4S1QL 4OD1L 5I1JL 4RA0C 1AD0A 2PW2B 5CZVH 1CR9H 3BPLB 3H0TB 5HVFB 3J8F7 4Y5YB 4XPTL 3S35L 4B5EA 1IC5L 1D5IL 3MRKA 5E9DA 5KVEH 1R3JB 5J8OA 5EO9A 1UQSB 3FRUA 3VXRB 3EOBA 3IDYB 4L3EA 1QR1B 4PJDB 1EGJA 1KJVB 3GBNH 3V5HA 1HQRB 2WMPA 1U8JB 2IMNA 1H15A 2HKFL 4Z0BL 2OR8A 1FYTA 5E00B 4LGRB 1IM9B 2PKDA 4QRRA 1EAPB 3SDAA 2CK0L 4G8EA 5B8CB 5E99H 4JFDD 2VDRH 1I1AB 3ZDYF 3BN9D 1NBQA 2G75A 4KQ3H 5F1SA 1YDPA 1MJUH 1RD6A 3AU1B 1JZ7A 1CLYH 4P9MH 4R2GD 4NGHL 4JRXD 1ZLVH 3DO7B 1J5OL 5E8PB 4OI7A 3REVB 4PB0L 3F6IA 3RWIB 3WN5B 1MF2H 1P9MA 3QIUA 3P4NB 4M6MH 4NN7B 4L1HA 1XGUB 3NN8A 4DGYL 2BVPA 2W0LA 1HKFA 3NMEA 1MI5D 3QH3B 5DURD 3RPIB 1EO8L 3T09A 1KN4H 4I2XA 3SKNA 1J10A 3BHBB 4RFNB 3BP5B 2YRLA 5D72H 5I8OL 1NAML 5DFWH 1FFPB 1ACYL 2HTKD 3QXDA 2H2PC 3MRNA 3SDAC 2X9XA 3VFPA 4HKZA 3BXNA 5DC4B 3D48R 4PJGE 3JV5A 5C0AD 1CXKA 3U7WH 3EO0B 4MJ6A 2NTFB 1L0XA 4J3XA 4GW1A 1KJ3H 5LCVH 2F74A 1VFOA 4HUWB 1DN2A 3QDJD 4KJQD 5H37H 2YBRA 4NUGL 1VGKA 1P9MC 4JO4H 1FNAA 3QIUC 4NRXB 2AV1B 1UZ8A 3TNNA 1A6AB 5DSCA 1CZ8H 1U8IB 3CVHB 1OT2A 1D9KD 3TIDA 1IJ9A 3FT3A 5E2JA 1I7UA 3GMOB 1W72B 3P0VL 3K81A 3AROA 5DVMA 1D6VL 3T65A 1R5VB 1GC1H 4GMTH 5ISZD 3L5XL 5SWZD 3MJ9H 3GGWB 3ZYOA 2FX8L 3WHE0 4JFDB 5D70H 5EBWA 4TUJB 1FNGA 4OKVB 1OM3H 2RHEA 1I8IA 4JRXB 4JY5H 4ODHH 4Z76B 4D0DA 2PR4L 5JPNB 4OF7A 1UVQA 4E41E 3OHXA 4MA8H 3N1MC 2H41A 1U8NA 4L5FH 5E8OB 1TCMA 4XPAH 3GM8A 2WBKA 1A6UH 1MI5B 4CVUA 5DURB 3LDBB 3UJIL 2HRPH 1AP2B 2ZCKH 4HXBL 5DUBB 1UENA 3F7VA 2LTQB 2XN9B 2N7AA 4NFBA 4QHUA 2YEZA 1JTOA 1A0QL 1FE8H 2Y9RT 5C0AB 4X6CF 1JL8A 4PJEB 3OG6B 3TO4D 3PGCB 2DM2A 3UAJD 4UDTB 1AGEA 4PB9L 2Z0BA 4PJ7A 2DQEL 1N3NB 3QDGE 3BMWA 2BRRH 1OTUD 3QDJB 5T3XE 5F3HA 2A6JB 5IBLC 4YHMH 3QG7H 2X1OA 2YPKB 1O5DT 4WFHD 5J89A 5F6HJ 1UZ6E 4Q74A 5GSVB 4UNUA 1I3UA 4PJAE 2D2OA 4X9IA 3G5YA 5FYJH 3D1MC 5EOCJ 4DKEL 3PL6A 3QUMB 5DT1H 1MFCH 2UWEE 2WIIA 3VRJB 4Y19E 3GMLA 3S3PA 5IESL 3B9KB 1EMTH 3O3EB 3QHZL 4AQ1B 2AS5M 4QCIB 5ISZB 5LWYH 5FYJE 5SWZB 3DLQR 2BNRA 5HHOE 2DLIA 1II4E 4RGND 1XR9B 3L3OA 2YS4A 3ILPA 3QXTA 4ZQKB 3HLAB 3VJ6B 2VDQH 1T22B 4DN4H 1A1NB 4NNPL 4FQCL 3HE6A 1C5BH 1HSBB 5HGHB 4UU9A 2Q3AA 2DB8A 4GRWE 4HFUL 4KVCL 4WGVB 3BZ4A 2HMIC 4WUKL 2FX7L 3STZB 5GS2D 1EEYA 3GSOB 3OAUL 4NNYB 2FATH 3JTTA 5I30H 2NXYD 3ZYZA 2X4NA 4G43A 4YXHH 2NNAB 1DSFL 2P7TB 3VXMD 4PJCE 4LPYA 2ADFH 3QISA 3ARED 4QOKA 5EPMA 2MPAL 3GK8H 4F33B 5EDXA 4FP8L 4YH6A 3RL1B 1QEWB 2J6EL 3WSQL 4OCYL 4U1GB 5CSBA 4TPRL 5D7JA 5HJ3A 3BGAA 3ULVD 1NFDE 3HMWL 3S9DB 3LPWA 3TO4B 5GZOC 2Z4QA 2VDKH 2HG5A 4S1SH 3HE6C 1PZ5A 1AD9B 4X6DB 4AEIL 2BSTA 1RVFL 3MA9H 4RAHA 1Z0MA 3UTSA 3OTTA 5C6PB 5I17A 2K3TA 2AJYL 3Q48A 2EH7H 5DHYA 1SMOA 1WBYB 5DJ0A 2GJJA 1AIFA 4YHOL 5C0IB 4NFDA 3WLBB 4PBWD 1YYMH 1ED3A 12E8H 4HUVB 4NN6C 5AWNL 1P1ZA 2FLRT 2MTPA 4R97B 5C86A 1VGEL 1W0WB 3PGDA 3QB7C 3QXWA 4Z0XA 2BJML 3N85H 2H6PA 3ZE0F 1BQLH 3P0YL 4XAKD 4KAQL 5D7JC 1T1ZB 3C08H 5AZ2L 1ODAA 2EE9A 1I1YB 4I5BB 4RGNB 3MR9A 4KI5F 3WS3B 3BQUA 4M62H 1SVCP 2CRZA 1YN6B 1PYWA 3RFZC 5ESAA 4UTBH 4J12A 4F2MA 4PJ9A 2YD5A 2PO6D 3FB5A 4XGZA 3PJSB 1RV6X 1ZWIB 3OKDB 3V6BR 5CBAA 1TJIL 4WI6A 4ZFFA 4ZDHB 3S88H 4NKIH 1V5JA 1SVZA 2NXYB 1I9IH 4XTRD 4X7TA 1N26A 5F96H 4ETYA 3VXMB 4ZD3H 5I16B 4LVOB 2YZ8A 3QDME 3KLAA 2G2RB 5FDWA 3LCYA 4DVBB 3MACL 5GPRA 3AREB 4XP6H 1NMCB 4CW1A 1A02N 4FN0A 5F88B 4LBEA 3GSRA 3ES6A 3HRPA 4RA3A 1AGDB 2DTML 3BQUC 5DO2C 1BVKA 3O8XA 4NC1E 1G9EA 3MFFB 3S37X 2J88H 1RUMH 1YC7A 2FWOB 3R0NA 4R96A 5DQDH 4UT9L 5CP7A 5JW4R 3SDDD 2R2EB 2LQRA 3O11A 4YGVB 1DANT 2IH3A 4WWKD 1RZGB 3FJTA 3DARA 1YMME 4UIMA 4NBXB 5JHDD 5DJAB 3P11L 3FTGB 5H94A 1P7QA 4RX4A 3D0LB 5AG8A 4Y4HD 3LZFL 5E8EB 4J3VA 2FD6L 1A6ZA 5I9QB 1RUAL 3LRGA 4MDJA 4X7SH 2F9BT 4AM0A 3V0WH 5JW3L 2HH0H 3Q0HA 5B4MC 2J3SA 3S37H 4U1IA 1A6WH 2XQYG 3IFLL 3RY4A 1PKOA 2DBLH 4UV7H 4OF3A 3ZDYE 4XP1H 3D85D 4O58H 3O8XC 3PWPA 1B2WL 5LAXA 1C1EL 5I1EH 1QLRA 1G7LA 4ZS6C 2VC2H 4FQPA 3UYRL 3WDIA 1HCFX 4BZ1H 1JGLH 1YEHL 3QNXA 1OAUH 2P5EB 3F7YA 2I07A 3P73A 5AG9A 1XCQB 3MUZ1 1R3LA 5E7BA 5D5MA 1NL0L 2DKUA 1AGFA 3QDAA 2ZUSA 2V7NB 3HZMA 5C0EA 5DHVH 1QSEE 1RK0A 4MD0B 4JCLA 3KJ6L 3DIFB 3NOIA 2DQUH 1IQDA 1K9TA 2E6PA 4MQXC 3NFSH 3D9AH 5TE4H 3QQ4B 1CYGA 3U30C 1CGXA 6FABH 2HN7B 4CVWA 2AGJL 1FG9C 4NO3A 2W65B 5KJRH 3PABB 4PP1C 5IW1A 1F6AB 4HJGA 3VDCA 1M6OA 1RJZB 2Z8WC 5DD5H 5AD0B 3IXTA 4AZ8A 3SDDB 2EDEA 1ZTXL 4L8SA 4WWKB 5L6YH 3O4LE 1ES0A 5C08D 3L95A 3PE9A 4DGVH 4AEHL 3UC0L 4X9GA 4NRYA 2D0HA 2JCCF 2OBGA 1JYXA 2E3VA 4EN3C 1MCSA 5JIKA 1T3FA 1VDGA 1WV7T 4X5XA 4AIZB 1BFOA 5HGBB 1I1CA 5DWUH 4GKNA 1BX2B 4WHDA 3MXVL 3RTQD 4YPJA 1AH1A 5DUMH 5IHBA 3SPVA 4GG6B 3BI9X 1UYWH 2DQDH 1RZ8B 1JN6A 4M7ZB 3D85B 1FL6A 1CFQB 3ARGA 3UTQB 2H3NA 3H9YA 2Q76A 5F7EH 3G9VA 3AXLA 4TNWK 1OF2A 3D69B 4Y88A 4N68A 1C16A 25C8H 4L8SC 4R3SB 3RWHB 5L2KA 3C8DA 3OQ3B 1XMWA 4NHCL 4RWHA 1X5YA 5FIEA 5TPWL 3JV6A 1IL1B 2CO7B 4G80A 1JPGA 2IQAA 4AIOA 4OZ4A 1OPGH 4PTTB 4M1GL 5L0QC 5K9KB 3I75B 3L3JA 4LARH 4IRSA 1XF5B 2VDPH 1VACB 1Z5LA 4FQQB 5DZLA 5J06A 4PJIF 4JDVB 3C9NA 3SY0A 4KH2A 4KK6C 1CFSB 5F9WC 4ZFZA 2YUXA 2IBGA 3OGCB 2BNUA 5IUSA 1X44A 4OFPA 4X6CE 3BKYH 5JA8B 2ICWB 3ARGC 3NA9H 4M8VA 1KTLA 3IETA 3CH8A 3BD4A 5EU5B 3IDMB 5EBMB 1GZQA 3G5XB 3LVEA 4HG4J 5C0FB 1QO3A 5EWIL 4OT1L 2V9RA 5K9JL 2VAJA 1DLFH 4R8WH 1D5XB 1Q9KA 2CDGB 5BXFA 2BHYA 3BOVA 5C08B 1FRGL 3MNWA 4UILL 3NFPB 3IDNB 2D9QB 1SM3L 1NBVL 1E4XL 1LO2L 4ZTPH 3R06B 4N8VA 4ONFL 4IRSC 4FQJH 1DBJL 5DHXB 1J9CT 3FFCB 4FFVD 4G8FA 3H3PL 3EHBC 4NN5B 3FT2A 5J4MA 4UOW1 3DUSB 4HIJA 4KKLD 4X4MA 4PIRF 1X4ZA 4LKCB 3EJZD 1UGNA 3I6KA 4X4YB 5GRZA 4FQLL 2R4RH 2VIRB 4XVUD 4JDTL 5D1QD 3E8UH 5JNYB 3IJHA 1HILA 5I1LA 1YEEL 1CE1H 1A3LL 3PQYE 3HTLX 3C5ZA 4JR9L 5EOCL 1UM6L 1MWAL 1Q9WB 4J3SA 5TDPB 3MXWL 5GGSY 1XF3B 4FFWC 1FL5B 3IAQA 4PLOB 5TH2B 3O6LL 3RGVD 2GJ6A 1OP3K 4LCCC 4PJFB 3VXQA 4S1DD 5CSGA 1YEFL 3B3IB 1QRKA 1X7QB 5HYQA 5I75C 4QRPD 2PTTB 4GMSL 4H88H 1HINL 1NPUA 2AJXH 5SX5H 5CAYB 4WCYL 4JQXA 4F7TA 3UTZA 4UV4H 1G6RB 3EKCA 4NQVB 1ZHKB 2YC1B 3QO0B 5HHQA 3CFEB 4NQSB 5EIQA 2A83B 2R2HA 5E6ID 1MOEA 1XGRA 5E5MA 1DQDH 2AEPL 3DGCR 3BSZH 4N0RA 4PG9B 3FO0H 3NGBC 1K5NA 4EUPH 4KQ4L 1MCKA 5BOZG 1ZA3A 4G7VL 3C5ZC 3M07A 4CNIA 1S7UA 3IFNL 4UQ2B 4OSUH 3QR2A 3VRIB 1XZ0B 1A47A 3LEVH 3MLSH 2IC2A 3TPUB 2FEDD 2G5BB 5FYKU 3VGDA 4O5LL 2X44D 2Q86A 1Q0YH 1I7RA 1N59A 1CQKA 1KJMB 3BKJH 4JQXC 3MLYL 5J56B 1RZ7L 4G9FE 2GTWA 2MMXA 5E08L 4FABL 5F1NA 4UB0L 2FX9L 1MVUB 2KBGA 3WFEL 4JN1L 5MI0B 1R5IA 3F12A 5BS0E 3HI1A 3BKML 2H2SC 5I1AB 4D9RE 2DLFH 2NY2D 3QNZB 4LSPL 2Z31D 5D1QB 4JREB 4YWGH 1ZSDB 1YEGL 3BDYH 3G6JB 4I1NB 4NWTL 1CGVA 4YEEA 1M71A 1MRCL 5EA0H 5F89B 2VL5A 5T5FH 2ADJB 1S5HB 3QHTC 1CVRA 5C8JA 4BH8B 3UTTA 3QI9C 5KVDH 4HIHB 3WEXA 1RSFA 4OLUH 3TVMD 3BP7B 1OB1B 4YXKH 3RWDA 4QRPB 2CJUH 1HZHL 2EE6A 2DLHA 4Z8FL 2VXUL 5I73C 4M5YH 2VXQH 1A3QA 5INDA 1BZQK 5HDLA 3SGKA 2Y1VA 2BHZA 3TO2B 4PBXA 2ITDB 1BQHA 5BJTB 3CLFH 5CCKL 4PJ7F 4HKBA 3L9RA 3QUYD 1JHLH 2EIBA 2ENSA 2W9LA 1MFAL 5I74B 2X89D 3TBVB 4XCCH 3NCJL 2AP2A 4PD4J 1LK2A 4P2OD 4M93B 3WL9B 4OZGB 3QRGH 2VZ1A 3AS0A 3NVQA 4LHUG 5IF0B 1MLBB 4I3RH 4BFGA 4WHTA 4OUOA 2BMKB 4LSQL 1OGTB 2AJUH 4HJ0C 1JZ4A 2R0KH 3V6ZA 4X4ZA 3RWEB 1I9RH 1JP5A 2SEBA 3EO9H 1SBSH 1P4BL 1FIGH 2D7QA 3L3IB 1RK1A 1XIWD 2ADIB 1RZIB 4Y4FD 3SGEI 2UZXB 4JFEA 2APFA 2R0ZH 5CEXA 1GOHA 4AYFA 5IBTH 4O00A 4ZOAA 2HRLA 5C0CD 5F1KC 2FEEL 3MODH 2Z92A 2W60B 4PJ8C 2HFEA 5GRUL 1QP1A 3SGJA 4X0KA 4RMSA 1HXMB 2OTWB 1ZLWH 5DRZA 4NZUH 4LCWA 5EO0B 2PYFA 3KPRD 2O93L 4ISVA 1NLBH 2NY2B 3CC5B 1MHCB 1LILA 5EFIB 3AAZB 4YDKL 5DXWA 1FLRH 4ZG1A 2XI9A 4OFYD 2WLYA 4HLZH 3D3VD 5JLZA 4XRCB 4DUWA 1U8QB 4H25B 1MRDL 4N0UA 4GW5A 1KCUL 5B38A 5TE6L 3MOBH 3OR7A 4WRLA 2NZ9D 2EC9U 3EDKA 3TVMB 1TVHB 5JXAL 3RU8L 2Q6WB 2C3VB 3C5SA 3SJVE 3DTXB 1T0MA 2FHFA 3EYSL 5GJTH 3G5VB 3TA3C 4WFFE 4PJXB 1ZAGA 4F9LA 2C7UA 4I3SH 2DM7A 4U33A 2G5RA 2JKXA 1KIRA 1BZ9A 1U6AH 4R90L 4ZYKA 3SGJC 1FH5H 1MNUL 1ULVA 2EDOA 4U1KA 3NAAH 1RZJH 5DJCA 1KGCD 1X5FA 3O3UN 2F8VA 1DR9A 1ZS8B 3RVVD 1EXUA 3V0VB 1FVDA 1NCAH 2D03H 2WBJD 2PW2A 2QL1A 3OWEA 3H0TA 2A9MH 4LEXL 4Y5YA 2EDWA 2GSGB 1GGUA 2OR9L 4K8RC 2N7BA 4D0CB 4M43H 3Q6GH 1R3JA 1TZGH 1G9ML 1KB9J 1UQSA 3VXRA 4ZMAT 1BGXH 1SJXA 5A2FA 1XIWB 2X7LB 1QR1A 4Y5VB 4QEGA 4PJDA 4Y4FB 1KJVA 1YEJL 1YNLL 1HQRA 4JO3L 4F9LC 4HULB 1U8JA 2CUIA 5E00A 1F58L 4M7KH 1IM9A 5GZNC 4XAWH 3SGEH 1EAPA 4XNUL 3FL7A 3RVUC 1ZGLB 2R8SH 4F57H 4RMWA 1DQTA 1CFNB 1PQZB 5B8CA 2OJEB 2YD6A 3MV7E 5JIIA 5FB8B 5H35B 1I1AA 3KPRB 2Q8BL 3O45B 4XMLH 1IGJB 4Z7UB 1P6AB 4C56E 4QHLB 4GLRI 3AU1A 5K59F 2HLFD 3DO7A 3BPLC 2W0PA 5E8PA 3W2DH 3REVA 3D3VB 5D7LB 4Y5YC 3RWIA 3VD3A 3WN5A 3Q1SL 2BSRB 3BPOB 3P4NA 4NP4H 4F80A 1XGUA 4LCIL 5HI3C 5M94B 3VFNB 2QQLL 4PY8J 3ULSB 2E8ZA 3IDYC 3MCKB 3QH3A 3SDCD 4JZOB 3WBDA 4LDOB 1P5UA 3RPIA 5KVGH 4F7MB 5E2UH 2JB5H 3A6BH 1CDYA 3BHBA 4KUCD 4PV9B 2NPLX 3BP5A 5I1CH 1KPRB 3ZDXF 4OGXL 4CMHC 1G1YA 1FFPA 1EGJH 3IU4H 2BY1A 5CILH 4GKZB 5TF0A 2FL5B 4MXQC 5B8CC 5FYKH 1I1AC 1OHQA 2AXFB 4FFZL 5E9DE 1VEMA 1OAKL 3EO0A 3VGAB 1IGCL 3HN3A 4L3EE 1GOFA 5C71A 2P5WD 1RUPH 3UPAA 4HUWA 4JPKH 2WBJB 4TVPH 1FYTE 5H2BB 4NN7C 4NRXA 2AV1A 5KSAB 1A6AA 1A1OB 4QRRE 4H1LH 1DTUA 1P7HL 2XOTA 2G60L 1U8IA 3CVHA 4HPOH 4TSBH 3MRLB 5F1IB 5IOPB 4RFNC 2DYPD 2PTUA 3GMOA 4X6EB 1OP3H 1W72A 3NPSB 3DVNB 4L9LB 3RVXC 1XH3B 3KPQB 1R5VA 4G6JL 1FZJB 2H1PL 3VRLE 2BC4B 4RBPK 1WT5A 3TN0D 4GAYB 4HF5H 5MP6L 4JFOB 5DVLA 1ZK9A 3ZYIA 1NUFA 4HPYH 4JFDA 5GGVL 5GRWA 4N1CA 4TUJA 4OGAC 3MQIA 1C8PA 4OKVA 5D5MF 2FR4B 5JUEH 3A6CH 4U7KA 1X6NA 4JRXA 3JWDC 2CSPA 4Z76A 2IEPA 5EBLB 3GNMH 5JPNA 5TQ0L 5M95B 4XNXH 1SYVB 2XRAL 3HNSL 1U8OB 4GLRH 4MNQD 3U0PB 3VE0B 3NCMA 3IAPA 3U6RB 1QRND 5E8OA 5DUPH 3ARRA 1MI5A 3SDCB 2DI7A 3DI2B 3KYAA 1ZHNB 1AP2A 5DUBA 3L7FB 5HYSA 3QIWD 4JDZB 4AG4L 1WT5C 2XN9A 2MQ3A 5BVPH 4W6WB 1MEXL 3FOLB 3ARSA 2KUTA 3JXAA 4LLWB 1KV3A 5J1AB 1MCNA 5T1KB 5I18H 3VFOB 3BN9C 5C0AA 2DIBA 4PJEA 4C55A 1WISA 3C60B 3D2UD 3PGCA 5IFHL 2IGFL 2VQTA 4QTIL 4R2GC 4I0PD 4UDTA 5TDNB 2APTA 2OZ4L 4Y7MA 5HHVL 1N3NA 1Q72L 5IGXL 3QDJA 4I18A 2A6JA 4IEFB 3V5KB 5JXED 2YPKA 1SMAA 1BPVA 5KTEH 3EDEA 3IKCB 3DX6B 5GSVA 3GIZH 1KULA 3VFMB 4LU5L 2NR6D 4XBEH 4A6YB 5C0JB 1QLEH 3QUMA 1CCZA 5DMIH 3CFJB 5DJDB 3VRJA 2LTQC 3INUH 4GKOA 1WGOA 3P30L 4DTGH 1X5GA 3B9KA 2HTKC 5HHXH 3WIFB 4N5EC 4P4KD 1BP3B 3O3EA 2B2XL 3IS1X 4BK5A 3IFPB 4NJ9L 4QCIA 2A6DB 4FQHB 2XPGB 5ISZA 3TN0B 4BYHA 5SWZA 4RWYH 4HUNB 4OQTH 4Z7QF 4NPYB 3JWDL 1CXEA 4YLQT 1VERA 1XR9A 2ZUQB 1E28B 4ZQKA 4DKFH 3HLAA 4JRYD 4N90E 4NKOB 3VJ6A 1T22A 1A1NA 3F7PC 4K7PL 4I18C 4KJQC 1UCBL 4OLWH 1HSBA 5HGHA 2J12B 4MLSA 4OIIH 3IKKA 4LPXA 3TJHD 1QRNB 2GAZB 2R2BB 3STZA 3GSOA 4NNYA 3GSWB 3GSUB 4YPGB 4KUZH 4B41A 3HC3H 2NNAA 2V9QA 2K7QA 2P7TA 4KGLA 3VXOB 4FQIL 1BIHA 3B9KC 3HFMH 3BIAX 4JO1L 4PJ7E 4OM0H 3QIWB 3IVKB 3S6CA 1HKLL 3WO4B 4F33A 1CFVH 1L7TL 3RL1A 4C57C 2J4WH 4NKMB 1QEWA 3KXFD 1XCTA 2VTFA 2XICA 4R4ND 1VESA 5F6IB 5I6XB 1YY9D 5HYJD 5ADOL 3CSPA 1JNNL 3TO4A 1BD2D 1SY6L 1WWBX 1HYSD 3D2UB 3E3QC 3ZDZF 4HJJH 1AD9A 2NCMA 1G0YR 1M7IB 3B5HA 1CGSL 5SV3A 3DX7B 1N2RB 4XI5D 3EFDL 1RJYB 4ZS7L 2P1YA 4X6DA 3W0WD 3K2UH 3QUZB 2A6IB 1OTSD 3MRGB 4DVRH 1WBYA 2BNRE 4M7LH 1AY1L 3WFCL 1HIMH 4NYLB 5C0IA 4G6KL 2FHCA 1AHWB 4KMQA 4UBDD 3WLBA 5C0BB 4BSWB 1KIPB 4FG6D 4JKWA 1T21B 4HUVA 4FNLL 5L8KB 1JPSL 1UWEH 3W5MA 4P4KB 1DVFB 1CU4H 1S3KL 4LCUB 4U1GC 1T1ZA 4DEPB 1D5BB 1CGYA 3L5IA 5EIIB 1I1YA 4I5BA 4YXLH 3TO4C 3WS3A 2LU3A 3UAJC 5JPMB 5DJXB 1YN6A 3PIQB 4JRYB 5C09D 3WKMH 1OTUC 5E6YA 5L88L 2OCFD 4CDGC 4HUUB 2OMNA 2AEIT 4ELME 3PJSA 1ZWIA 3OKDA 3BP6B 4KI1A 1B6DA 2GSIB 5FK9B 7FABH 3BJ91 3CXHK 4ZDHA 3W5NA 2VLRE 4NO0D 3V52L 1A6VH 5C07B 2X70B 2O5YH 5I16A 2R56L 3VXMA 1OCWL 4R97C 4P59L 4JG0H 2G2RA 3LKQB 4DVBA 1JK8B 5D96B 3AREA 1TJHH 4U6YB 5HI5D 3UP1A 1A7QH 5F88A 1F13A 5B21A 3UTSE 5J9PB 3KXFB 1AGDA 4RGNC 4YHIB 5EU6D 1TLKA 3SKUD 3HR6A 1A7PL 1F4YL 3MFFA 4JY4B 3VMPA 5HYJB 1CLOL 4YE4H 2FWOA 1F4XL 1BD2B 4V1DD 1NSNL 4PUBL 3AGVA 1UC6A 2R2EA 3I50L 4YGVA 1RZGA 2VXSL 3IGAB 2Q8AL 2WBWB 3I02B 3W0WB 3B2UD 5ADPH 4NSKB 3KHOA 5DJAA 3FTGA 2NY5H 2B0SL 5T1DL 3B9AA 4G7YH 5KZCD 3EBAA 3D0LA 2NXYC 5E8EA 3BKCL 3K3QA 4KDTC 4IOSD 4HKXB 4Y4KD 5F7MC 2CKNA 4FTVB 2DOCA 4YBQD 3W11D 3ZTJH 3A6OA 3AREC 4OB5L 1B4JH 5I1GH 1NMCC 2NY6B 1R3HB 4WI9A 1BF2A 3WKNA 3TJEH 3EIFA 2XWJB 4UTAH 4OKDA 1GJIA 5D8JL 4KKBD 2VAAB 4F37K 3ULVC 2MHAB 2BVYA 3BZEB 3EW3B 4HLJA 4XHQA 5K59E 1P5VA 4YHLH 1EAJA 1X5LA 4AL8H 3TWCH 3TGXA 1ZLSL 1B4RA 5D1ZD 1BBJA 3ETBF 2P5EA 1NH6A 2VDLL 1XCQA 2E8YA 4M6OL 2MQ0A 3HR5B 5D71H 3SBWA 5I9QC 5IQ9B 4LMQI 3EYUL 3SE4A 1YNTB 2V7NA 4EKXA 5FYLH 3JUZA 2FZ3B 4MD0A 3DXAD 1L0QA 1CICD 3B5TA 3BRGC 2Z9TA 3DIFA 2YD7A 3QQ4A 5E56A 4KJYB 4GAGL 4JFZH 2HN7A 4I0CC 5F44A 3QXUA 3K80A 1MFEH 1IFHH 1S7XB 3KPSE 3GKZA 2W65A 3PABA 5C70A 2NLJB 4AIXA 1F6AA 5DEGB 4V1DB 1RJZA 5AD0A 4ERSH 3SDDA 2VWEC 4OLZH 1E27B 5DJYB 4WWKA 4IMLB 2PO6C 1A7RL 1BFVH 4KRLB 4YGAB 4AJ0A 2E27H 3MUGB 5B3JE 3SBWC 5KZCB 1EV2E 3SE4C 5T3ZH 4I77H 4JHWL 4XTRC 5GIRB 4Y4KB 1IGTB 3O3BB 4FQXB 4QY8B 4AIZA 5HGBA 5CLWA 4GO6B 1MCPL 3QWQB 2VOTA 2ZZUT 4PS4H 1BX2A 5CJBA 4DGIH 3FQUB 3ULVL 2YXMA 4U4BA 4GG6A 3UX9B 4BQCA 4X6BB 5T3ZE 1RZ8A 5BW7A 3D85A 2AJ3B 3DYPA 1CFQA 3UTQA 5D5ME 1NEZB 4ZFOL 3IDIB 2P45B 3D69A 3SDDC 3FCTB 5GGUB 4TUKL 4R3SA 4WWKC 5T1LD 3HRZB 1Q8MA 5DC0A 3RWHA 4YDJB 4OZFH 2YD3A 2BK8A 3TV3H 1IL1A 3Q5TA 1NDGB 1FZMB 4G8GD 4OLVL 4PTTA 4OLXL 5K9KA 3I75A 4QRTB 1XF5A 5EOTB 1VACA 4FQQA 3U7YL 4HCRA 4JDVA 5LGHH 4G3YL 3DXAB 3SKJL 1CICB 5C0GB 1CFSA 1IGIH 3OGCA 4GQPH 2BVTA 4M7ZC 3K7UA 5ICYA 5BW7C 4LDEB 2ORBL 2ICWA 5CHNB 3GI8L 5CINH 3VFTB 2E6JA 2EXYD 5EU5A 3IDMA 5EBMA 3G5XA 2QQNH 2F5BH 5I15L 2VLJD 5T5NF 5C0FA 1PW3A 3U1SH 3CVIL 5I1KH 1NGPL 4PJDF 4N8VG 1G0DA 5FV2A 3BP4B 1D5XA 1K6QH 2CDGA 3VA2C 4J3WA 5C08A 2O5XH 4WGWB 3TCLB 4LSRL 3NFPA 3IDNA 3CAFA 5JW5B 4YO0B 5JR1L 4YK4B 1EA9C 4WEBL 3R06A 1MPAH 2DWEB 1MRFL 2Y07H 5DHVB 3TEUA 5ID1B 4ZFGL 2DJSA 3SE9L 3FFCA 1S7SB 4RFEB 5L2KE 2VYRE 3JBG7 3DUSA 5DI8B 4LKCA 1G84A 3NA4A 3GMMB 4X4YA 1OQOA 2EDRA 2ZJSL 2VIRA 5JNYA 1U8PB 2PNDA 3ZKMD 1CGUA 4HXAH 4Y8DC 2X4UB 3WNKA 1Q9WA 5T1LB 5TDPA 5FGSA 1XF3A 1S7QB 1CWVA 5TH2A 1FL5A 1FBIL 3VXPB 1QYGL 1UWGH 1UM5L 4PJFA 3B3IA 3MZGB 4G8GB 1X7QA 5MEPB 1BIIB 1FPTH 2PTTA 3MCLH 3PV7A 2P8PB 3RA7L 2VR9A 1F3DH 1INDH 3THMH 4NN5C 1JF6A 4D0BB 4GSDL 3RTQC 1G6RA 4KPHL 3PXHA 3FQRB 5JMRA 1NUNB 2GJZB 4NQVA 1ZHKA 2YC1A 3QO0A 1HEZB 1UKTA 3CFEA 4NQSA 1P53A 1PSKH 3T2NL 2EKJA 4Q6IB 2A83A 2B7DT 3BWAB 4HT1H 1PG7W 1XT5A 5AZEH 2XTJD 4PG9A 5ITBH 1BFSA 2UV3A 2OK0L 2ED7A 3ZDZE 4ODTH 4S1RH 2VLJB 4QWWD 3WLWD 2X6MA 4UQ2A 2J2ZA 5T33L 3VRIA 1XZ0A 2O5ZH 1IC7L 2DF3A 2FB4H 4ONHB 4CBPA 4P3CL 4EZMA 5DJ6B 3TPUA 4X4ME 2VH5H 2G5BA 4LEOB 3CFCL 2JJVA 1VPOH 3B2VL 4HCRL 3PP3H 4JFYB 2A9NL 4I9WD 1KJMA 1A64A 5IEHB 3FO9B 2F54B 5D1XB 4H0GA 2VUYA 2NY1D 4D3CH 5GHWH 1JWSB 3CSBA 1MVUA 3ZT6A 1B3JA 3BDBA 2P46B 2APWA 4Z6AT 3VFRB 2RFXB 2X2YA 2YD1A 4Z95H 4OFVA 5D7KE 5I1AA 3QNZA 4M48L 3ZKSD 32C2B 4YZFF 5D1QA 1VFMA 5F7WC 3U36A 1ZSDA 3G6JA 3VXSD 4F58H 3OKKB 1J0KA 3ELAT 1F8TH 4GUPB 5F89A 4MA3B 2ADJA 1S5HA 3PP4L 3FQWB