4Z7UB

S13 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
188
structure length
169
Chain Sequence
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWQEETTGVVSTPLIRNGDWTFQILVMLEMDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 169
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7uB01
1UA6H 1KIPB 4XWOC 3W0WA 1QFOA 5FO8A 4M3KB 1T2QH 3UBXG 3U7AA 1FNLA 4DFHA 1YC8A 5C07D 5DUPL 4IMKC 3U0TA 5C08E 1KIQA 3OGCB 2F5BH 1KSRA 2XG5A 4BH8A 2QQQA 4HGWB 4PJ5D 2E9BA 3X14A 4AMKL 1DBML 3SGDI 3Q3GB 2PYFA 4P2RD 3O2VH 5DA4A 3LH2H 1QSEA 3MROA 4NQDD 4BH7B 1AI1L 1K85A 4ODVL 2XOTA 5EOCL 5TFSH 1OARH 3WIHH 3IDGA 4P2OB 2A74A 1A6VL 3D39B 3WD5H 4XNXL 1LO3L 4PJGE 1DEEB 5T5FH 4FQ1H 5I9QB 4D9QE 5A2JH 2YR3A 1OSZB 1U3HA 1A14H 4X6CB 4NQEB 4K9EH 4WI9A 2ZWLT 2YD8A 3ELAT 2OYPA 4I2XA 1OPGH 5DS8B 1V3KA 2BVOB 4FXGB 2CKNA 1WBZB 3GSVB 4KK8C 4F57L 4OIIL 3ZE1F 3PQYE 2A2QT 1KJ2A 1BQLL 1JVKA 1TCRA 3CJJA 5D93B 3HNVH 3MRFA 3QDJD 4DAGH 4RMQA 2BY1A 5ESQA 5FKPB 4GRMA 2Q8AH 5CZKA 1NGWB 2X9XA 2XKSA 5KW9H 1QBBA 1YEHL 2EZ0D 4D2NA 2NY6D 3A6CH 3MJ8A 1MFEH 1NUFA 2E3VA 4Q6IA 4EVNB 5TGBA 3BT2L 3RGVD 2H32H 3QYCA 3MJ6A 5DTFA 4PJDA 5FA3A 4I77H 1RJYB 4AM0B 4FQLH 4XC3H 3OPZH 4HK3J 3QFJA 1JNHA 4JDVA 5C2BL 3V7MA 4XCCH 5T3ZL 3NGBB 3OXSA 4X80H 4D9LH 1R5WB 4HQQH 4OGYH 2NX5E 2NY5H 2C3HA 2CMRL 4JY4A 3CZJA 1OGAA 1LO2L 4YZFF 1H3XA 3A6OA 3LKNB 3W5MA 5ESAA 2FBJL 1CLZH 1JGDA 5CZXD 3PJSA 3VXRA 4PJIB 4BQBA 4OGZA 2CJUL 1KENL 1JRHH 2F54E 5L7XH 3WIIL 3DUHA 4TNVF 3PWVB 1N8ZB 2H6PA 3C9NB 2YMXH 4LLMA 1GGUA 4H1LG 1ZLWK 1U42A 4GKNB 4D9RD 4ZDHB 4LGPB 4X6DB 4H20L 1E4JA 3IJSB 3KNBB 3F58H 3Q3GA 4P5KB 3VDAA 1Z5LA 1X5KA 4YR6B 3S37X 3WFBL 3B8SA 2X1OA 3IDIA 4Z7QF 5DEFB 4G6AC 2XRAH 4HZAA 4LHUA 2V5MA 2FD6H 4ZUWA 4YWGL 4Y2DD 1MFNA 4WTZG 2DQEH 5IB1B 3BOVA 1VGKA 1ED3B 3VCLA 3FJTA 5C08A 2MNUA 2IALA 2FR4A 2W9DH 4IHOA 2P5WE 2YOCA 2JTDA 4XP9L 3GSVA 2NXZD 5DRZA 4EUPA 2EYSA 4NGHH 1GSMA 2H3NA 3KXFB 5C9JA 5GSRB 1YZZA 3HFMH 4JVWA 1MELA 4ZXBB 3KPMA 2VXSH 4Y8DC 1I8IA 3KPOA 3SOBH 3MOBH 1DVFD 1GZQB 4OCSH 3MRHA 2CIIA 4M7LH 4PJGA 3TA3D 4HPYL 2E7CA 5E1HB 1S9VA 1S7UA 4WRLA 3P4LA 5A1AA 1ZS8A 2VLRD 3ALWA 4ZFGH 4DGVH 4WI2A 4J2XA 3VXTB 2H8PB 3FN0H 1YQVH 4PRPD 4LSQH 4XC1L 1KPRA 3QWRD 4KKCD 3GI8H 1AGFB 3EO1B 4R2GD 1M05A 4G8IA 3HZYB 3K2MC 4NQUA 1UXWA 1CG9B 3CVHA 4C83A 2JK5A 2DQCL 3OGOE 3OKOA 5GGVY 4X98A 5TQ0L 1I1AB 3SDYH 1GHFH 4OZGE 4FQXA 3KPRB 4MQ7B 5D2NE 4HF5L 1Q0YH 1WK0A 4K8RD 4MJ6B 1YEGL 3OF6D 2QQNH 1NCWH 4QRPE 3LKNA 3GSOA 3RIFK 1OAUL 2DMKA 3BIKA 4XVJH 3VFOB 1DTUA 1E28A 4YX2H 5SV3A 1G9MC 5CKGA 2DQJL 2VQTA 3HE6B 1LO4H 3C9NA 4LAJH 4N8VA 2XTJC 3BDYL 3S4SB 5DJZB 3ESUF 1HNFA 4HS3A 1G7MB 3JV6B 1CZ8H 4XZUB 4JKPH 5DVKA 4GG6B 3KPPA 2A83B 3DETD 4E41D 1NANI 3PHSA 3O6FA 3ET9F 3BQUD 4XXCA 3C87A 5ADOH 1V3JA 2PTTA 2RCSL 4LOUC 1NGPL 1IGIH 5ERWB 1NGQH 5IF0B 2Y23A 1VERA 3EUUA 2A73A 2G2RA 4KUZL 4LLDA 1FZMA 3IU3B 1A7QL 4FP8L 1CTNA 1ND0B 4WHTB 1C5DA 2D7TL 3Q5YA 2F54A 4FQJL 2CSPA 1KYOK 4U3HA 5H94A 4ELME 3GMOB 3S9DB 2OZ4L 4FQHA 4QTHA 4TSCH 1XIWB 3OKDA 1Q9OB 2NXYC 4QO1A 4WV1B 4JZNB 3FO1A 1XGUA 2MQ3A 3AY4A 3E2HC 3TO2A 5F7FA 1AFVH 2A6JA 4XPFL 1R3KA 4WHYH 1NAMB 4HFWB 2E6PA 5FIEA 4YFDB 4QRRE 3ARTA 1F90L 2RB8A 3NABL 2R0KL 4IRJB 1VFOA 1OAYH 3G5ZB 4C56E 3PWNA 4N9GA 4RFOL 1F4YH 1YYLL 5FFLA 4RZCB 4DQOH 5HHMD 1VACB 3FT3B 4PBWD 4P2YA 2P5WA 4JHBA 5FDYA 2WWKT 3MR9A 4QY8B 1EIBA 4UILL 3DVIA 5HD8D 4OV5A 4OTXL 1JPSH 2HRPL 3G04A 3RAJH 3ARVA 4XNZC 1INDL 2J6EL 2N56A 4MQ7A 1F00I 4YDIH 3H9SB 2X5PA 3HKFA 4Y19B 2ZCHH 1T7WA 1JHLL 2YD2A 5ILTL 2EDWA 3G6DH 2Q6WB 1RZ7H 5T3ZD 4JFXA 3V5DB 1KIRB 1I1YB 5D7JD 1RZGB 4YHNA 5MEPB 1CGYA 1S9WB 5IBTH 4JN2A 1ZHBA 2IFFL 3CZFA 3EOBA 5GRWA 4MDJB 2B8OT 4HH9A 2E9JA 3F5WA 4OFPA 1HI6B 4OZGA 3HMWL 3GBML 4MA8H 5D2NA 5GGTH 3TBSA 1XF5A 1LEIA 1EEQA 5HVGB 3QHFL 4KROD 4OF7A 1CD1B 1RJZB 4NRYB 4PG2A 4QRPA 4P57A 3PE9A 4JZJA 4JPWL 1IAKA 3PL6C 2Y5TA 4X7CC 1EVUA 5BXFB 1G6VK 1AGEA 2K1MA 3FB5B 2BNRD 2KQMA 4YHIB 5C9KA 3O6KL 4OFIA 2VLMD 1G7PA 4GFTB 4LL9A 3RVWD 3U0WH 4O51A 4OZFB 4E0RB 1FIGL 4G43B 3MLXL 4HBCH 2X4SA 5FYJL 3WL9A 4K7FB 4IOFC 4KC3B 4Z7VF 1B2WL 3KR3L 2KH2B 1NFKA 2BNQD 4P23B 1U8NA 4BQ6A 1JGVL 1G9MH 3VE0B 4PJAE 1MJ8H 4WCYH 1EHNA 4NSKA 3SE3C 4WO4C 1TJHH 1RZFH 3WKNA 1UWXH 2ITDB 1ZGLB 4R0LA 1F3JB 2XV6B 3FAXA 3IXAA 4PTTA 4XCYB 1WLHA 1CCZA 2P5ED 2O5YH 3NPZB 1MRFL 4WTWA 5C8JA 4RAUB 3MBED 5EPMA 4ELMA 1JZ2A 4K71C 3EO9H 3VXPA 1QFWI 2DLHA 3BFOA 2EDTA 1MEXL 2APVA 4RAVA 3RWIA 3QUMH 1D5ZB 3EYOA 5TF1L 4RGOL 1RFDL 1VGEL 1Z0MA 2PW1A 4V2BA 1BBDH 5B39A 5LKNA 1KJ3L 5J11C 5C86A 4CN6A 3ARYA 5C6TL 2AK1L 2EIDA 2MWCA 3H9SA 4HEPG 2LABA 5IG7B 3HCVB 4QRRA 3EHBC 3CFJA 5I18L 4HAFA 1C16A 2OR8A 1J11A 4NKQB 4C56A 3ARBD 3GMNB 1D5BA 2HFGH 4KAQL 3UJJL 4KXZI 5MEPA 1BX2A 5KVEH 1MHHB 5CBEB 1CFNA 3H2WA 1Z9LA 2OTUA 5DQ9B 1Q72L 4PGZA 3WXWH 5L0QB 2ZKHH 4EQ2A 1TVDA 3JXAA 1HYSC 3T2PA 5B38G 5DJAB 4FTVB 3VA2C 3MLWH 4JM2C 4AIZA 4S0TD 3ZSTA 1CGSL 3RWJA 3L3KB 3C60B 1ZHKB 2C4FU 3U9PL 2Z92A 4X8XA 1RV6X 5EOCJ 1FH5L 5J6HB 2NZIA 3NCMA 3PABB 1R0AH 1T5WB 3RUGB 1RZKL 5BQ7A 3UJIH 2A6KA 5GGUA 4YEEA 4PYHA 3H42L 5IEKA 2HJLB 4G43A 2FX7L 3REWB 4F37F 3BIAX 5FYLH 2V7NB 2V17H 3C6LA 4PJCB 3PWLB 4JJ5B 2UWEB 3PP3K 4JFZH 3CCHB 5INDA 2X1PA 1JJUA 4LSRL 2QBWA 2BHYA 3V6FA 1MJUL 5HDBF 5I1AA 2DDQL 1A9BB 1S8DA 4XVUC 5I30L 1F3JA 1QUNA 1DE4A 2Y72A 1P7QB 3FRPG 4XMPH 1BZ9B 4QXUH 3QQ3B 5KS9B 5I15L 4ZOAA 1MNUL 1S7SA 2A1WL 2YBRB 4HJ0C 3L3GB 3QB7C 1BVLA 1UVQA 4QYOA 2CKBL 2FDBP 4LPWA 3MRJA 4DN4L 4Z7OE 4BQCA 3SE4A 3VFNB 2DQTH 3I2CH 5E2UH 5I8OL 1X5IA 2A0LD 4BZ2H 4PJAA 5C0BD 4IIQB 4BUGA 3GK8L 5IJKC 1MCPL 2X41A 3QUZA 2YK1H 1GIGL 1MCKA 2ZUXA 3LEVL 5TQ2H 4XBEL 5K9KA 3IAPA 4XPHH 1C5CL 3QXDB 4YHYC 1N7ML 2D31B 4Y4FC 4TTDC 3T0WA 1FFNA 5IMOA 4JFFB 3MZTA 2XTJE 4MDIB 1EERB 2XWBA 4MJID 3FO9B 2Z31C 4NKOA 5DQJA 2YHGA 5I1JL 4NFDA 5F7UA 3Q5TA 3V2AR 4JQVC 1KTRL 1J0IA 4WY7H 1RZIB 4GRLA 3T77A 4UUJA 1AKJD 4KKLD 2HG5A 2VXTL 1INQA 1CL7I 3WV0A 1KCVH 5DHXB 3K46A 2XZQL 1DANU 3MCG1 2OBGA 3UTTD 1LDPH 2VE6B 4KK5C 5BV7C 5F1SA 2BJMH 5ADPH 1T5WA 3AAZB 4FHBD 4HLJA 3U48A 4BA8A 4D0DB 2DI9A 3SCMC 3OWEA 4Z7WF 4LBEA 3W39A 2HJLA 5CEXB 5ENWB 2JJTC 4PJCA 3QNZB 5D5MB 1PY9A 3OR6B 4BQ8A 1N0LA 5L2JA 2EDYA 1KJMA 1JP5A 3CXHJ 5MERB 2W91A 5FYJD 3K80A 1FN4B 1NUDA 4ONFH 1XR9B 3FB7B 4U1GC 4WW1B 4POYA 1TQCC 5GIRB 1INEH 2IFGA 2D03H 3T0BA 3GFUA 3X3FH 1CDGA 4JPKL 4XVTL 5EO9A 7CGTA 5I76B 3ARGC 4P5TC 1H8OA 1P4LA 1RQ5A 2YSSB 1P7QA 5D7LB 1BZ9A 3TCLB 2YC1B 3RWCB 3DVNB 5KS9A 4NRXA 3RZCD 1FAIL 3HG1B 3IVKA 3V4VH 1KLFA 1AO7D 2GAZA 4MD5A 4V2CB 1K5NA 1F8TL 5EU6B 3S35L 3AMLA 5FB8B 2V6HA 3U4BL 3C5ZB 3O3BB 2DBJA 1YNTB 1ETZB 2CGRH 1W8NA 4YHLH 3MUY1 1YN6A 4NFBA 1KF9B 1NBYB 1H3PH 4HMCA 2QKIB 1D5MA 2ZCKL 3GSNH 3QUKB 3ZKNC 1IC4H 3QIUC 3BKJL 5CHNB 4XH2B 5L88H 2E7HA 1MLBB 3P9MB 2EKSB 4XP1L 4XWGH 5F44A 2YWYA 4Z77B 2D31A 1QVOB 3I50H 4QEGA 1KB5B 4KRPB 1JNJA 2DQDL 4HX1A 1DBAL 1DJSA 2VZSA 5TPWH 5KSAD 5MP6H 4AQ1B 1Z2KA 2DLFL 3FO9A 3TN0D 1W72L 4F7TB 2AV1A 2ZNXA 5SWZE 2GCYB 4OGAD 2YZ1A 1WUNT 2VITB 3VWKB 2X7LB 1B0RB 5F88A 4UQ2A 4KPHL 4RWYH 4OQTL 1F6LL 2FECL 1G7IA 3GDBA 4JG1L 4JRXD 2VLJE 1EPFA 1KOAA 5IFHH 1GGIL 1FZKB 2ZZUT 5I17A 2NY2D 3RVTD 1AR1D 4CRPA 1UJ3C 2ED9A 1WCBA 4BQ9A 2JIXD 3LN4B 4JB9H 3P0YL 1FFRA 3FRUB 5ENWA 2PXYD 5HYSG 1VFBA 1JGLH 5DI8A 3U2SA 3VMNA 4YC2B 5DVOA 4O02L 2EE6A 2EYRA 3LQAC 3VU2A 4BELD 5A40E 1IC7H 2QADC 3KLAA 5HHVH 3IJYB 4BK5A 1TZGH 3GJEB 4YUEH 5BJTB 2YSSA 4ZOBA 2KPNA 4JHAH 4QRUA 1KPUB 1WWBX 1ZSDB 1QO3B 4U31A 4K3EH 4LLYB 2WINB 2HKFL 3ZDYE 2EE3A 1NLDH 4J4PD 3V5KA 4B7IA 3QWOB 5BV7H 5CJ5A 4I0PD 2AJYH 5AZ2H 3EOAA 3ZKSD 2R69H 1TTUA 4DGYL 2SEBA 3VXOB 1TQBC 4QHUA 4OZIB 4NWUH 1NC2B 5DJ0B 1X4XA 3K74B 3SDCB 2WIIB 2QKIA 4XBGA 3JWOL 4JO1H 1E6OH 1T1YB 1T21B 2NY4B 4L4VE 2VSDA 3SE8L 2YS4A 3KHQA 1IAMA 1BAFH 5EU4B 4M9PA 3QUYC 5ID1B 3T0EB 1OAKL 1LP9B 4XPAL 3P0GB 3RY5A 3SO3C 2XY2A 2VYRE 3O4OB 4RWHA 3BPNC 3RGVC 4NQTA 1DQDL 5BOPA 2VITA 1S9XB 4LP5A 1HHIA 4PYGA 4L8CB 1ZVHA 2VAAB 2GK0A 3QH3A 3GRWH 1X3DA 2W0PA 3P11H 2Z4QA 2X05A 3B3IB 4MWFA 2FCBA 3BRDA 1K8DB 4Z78A 1I9RH 4R6UA 5DRXA 1ZWIB 3GIVA 1CXEA 3RWFB 1IFHL 4P9HC 4YDLC 5GRXG 1FVEA 2FX8L 1JUFA 1J1XH 4QHKJ 1BLNA 5AYQA 1CBVL 5SWZA 1JWSA 5CZXC 3RNKA 4B7LA 3CFCH 4DUWA 2CIKA 1EUUA 5CP7B 2XFXB 2EH8H 3E6FB 3HE7A 4OCMC 12E8H 3MA7B 5INCB 1YEFH 2VLJA 2A38A 2AK4D 2EDBA 4YDVA 1SJHA 3LS5H 4ZO6A 4Y5VB 4WEUD 1J5OH 3C6SB 3O8XA 1L7TL 3IJYA 4OLUL 4MNQE 2HN7B 2MPAH 3WSQH 3U7WL 1QEWB 3RI5F 5CD5C 1F4WH 1A7NL 3GB7A 4LU5H 5JHLH 5TE6L 3D2UB 2UVEA 4LARH 4RAHA 3BKCL 4MB4A 3FMGH 4NKDB 4LVOC 1FNAA 4W6YB 4KI5E 3JV0A 3PDGA 5F93C 1D9KC 2Z91B 4X7SL 1CT8B 3I02B 1UQSA 4M43H 2MQ0A 1S78D 4ZSOB 2X4OB 2LFGA 2OK0H 4JFDA 3WNOA 4F7MA 4Z7UF 1FCCA 3ARDD 1OB1B 4F7EA 4L8SB 5EO1A 4W70A 3WFEL 1RMFH 4PBVC 3TA3C 3QDGE 4R90H 3MOAH 3LQAH 3IAGC 3ILPB 1LP9A 1M71B 2X4PB 5T1KA 3DV6B 3GMPA 5CUSH 5F6HJ 3BHBB 1KN2L 6CGTA 1RPQA 3QXAB 2Z93B 1L6XA 3HZMA 4N5ED 5EUKB 1T1ZB 1G0YR 4GS7B 5GGRB 1S9XA 4R2GC 5T3XL 5D6DC 4QKXB 3WUWB 5JPNA 4PJ8C 5AWNH 5F89B 2R4RH 2UZIL 4OD3L 3NA4A 3NFSL 3L3JA 4MXVE 4QHLB 1QSVA 4OI9A 1H3UA 2DQUH 1G84A 4G9DA 1P4IH 1K8DA 4P9MH 2FEEL 3VG0L 1NC4A 3FCTB 1EVTC 4L4VA 4PRIE 2ATPA 5E6IC 4D0BB 4KZEH 4PJHE 4M8QB 4YHZL 3G6JE 4JDZA 3QI9D 4GXUN 4K8RC 4WUUB 3N1MC 3LOWA 3QG6A 3W2DH 4A2LA 4PJBE 2IQ9H 4CN1A 3WEXB 3Q6FA 1YMHB 3QCVL 3VXUB 5DMKB 1ZVYA 3T3ME 5GXBB 4BFIA 1MWAL 2CLVA 4QRQA 1HEZB 1J7VR 1I75A 1S3KH 3L9RB 1NGYB 2ESVB 2GJ6B 3GSQB 1BOGA 4WWKA 2BOCA 1PKQE 3SBWC 3ZE0E 2QHLA 3QDMD 4LIQE 2FJHA 1BREA 3DETC 4DFIA 4RISL 1F42A 3PGFL 4KK6D 4Z8FH 1JPFB 4FFYH 3RPIA 5DSCB 3GSUB 1ULVA 4PJ9C 4J8RA 3EAKA 5C0IB 1I85A 3MRRB 4NQCD 3PGCA 4PY8J 5A3IC 4MD4B 4UT7L 1MAML 4U1MB 5MEOB 2EIZA 4Y4KB 1MIEH 3VGHA 4QHMA 4LRIA 3MUGA 3G6AA 1JNNH 1LDSA 2ZUYA 2IH1A 4GMSL 4I9WD 1TENA 1UM5L 3VXSD 3PG2A 1N3NB 3DV4A 4HJJH 1CK0H 2R0LH 4WFHD 2EDHA 5DK0A 3WNNA 1NEZB 4TUKL 3TVMA 1MLCB 2AJVH 4XP4L 5GZOC 4V1DD 4MNQA 5CINL 2VC2L 3ARFB 3LKPA 1I7RB 3FQUB 5E8DH 1NCAL 4P5MB 3O2DA 3P0VL 1F58H 3M1BB 4LDOB 4XX1G 2ZP0T 4TNWK 1I8KA 5E7FA 4DKEL 1IAIM 2VLKE 4K3JL 5E2WH 4WFGE 4IRSC 1HSBA 4N0UE 5JLZA 1DCLA 5IBLC 4Q9RH 5BVPH 1PQZA 3Q1SL 1OY3B 4U0RC 3QXAA 1A8JH 3OG4B 4PGCB 3KYKH 1Z3GL 3HAEA 3NN8B 3DUUA 4WTZA 4WDIA 4A6YA 1I7UB 4JFEB 3ULVF 1U6AL 1A1MA 4G6FD 3H9HA 5HD8C 1FGNH 1FBIH 3MNWB 2AERT 4PTUA 4J3XA 5IW1B 1I8MA 4QRTB 3NIGE 4CAGA 5DHVH 3P4OB 1MPAH 1GVIA 2J8HA 3N85H 5CJOL 1MJ7L 1YMME 2X44D 3QDGA 5L9DL 1X5XA 5JHDD 4D3CL 3KS0J 5J3HD 4U1HB 5JDSA 1H3WM 2HFFA 4HS8H 5F3BB 2FL5B 3GJFH 5IBUG 3P73B 5J13C 3T2QA 4RSVA 4Q6YA 1HOCB 4LLAA 4LCUA 1NGYA 3OKKB 4I18B 4X4XB 1OD9A 1IBGL 1T3FB 4M6ML 4G7VL 2WBJC 4PJ5E 5DR5H 4TUJA 3JTSA 1MUJA 9CGTA 5EC1A 1FORH 3N1FC 2BY3A 3RJDA 2CH8A 5H35B 4PRIA 4Q0XL 1A1NB 4NQDE 4PJHA 5IFJB 3G6JA 4KY1H 1VESA 4KROC 1CDBA 1FNSL 1UZ6F 4U49A 4PJBA 2NY0C 4LLWA 4LSPL 2BNUB 2BX5A 2XI9A 3FFDA 8FABB 3EYVB 5CJXC 1RUQH 3MLZH 2GK2A 3UPAA 4U1SA 1HYRC 4LSTH 3RVWC 2PR4L 4EOWL 1PKQA 2DJ4A 5HDOA 5JA9A 4JQIL 1OAXL 5HYFA 4S1SL 1WVZA 2CLZB 5FF6B 4BZYA 3WO4C 3NIDE 2NR6C 3QDJE 4NN5B 3V6OE 5AZEH 1DLHA 4QNPE 4Z5RA 5T1MA 2H45A 5BVJA 4MS8D 4ZFOA 3OR7B 4GBXB 4O58L 1JN6A 3T4YB 5ITFA 3ULVL 4ZNEE 4N5UA 4DUXA 3BWUC 2Z0BA 4L9LA 4LSSH 1MRDH 1FL3B 4ORGB 3QIWB 4DZBA 5LQBL 4HUVB 1RULH 4XMLH 4JPIB 4L3AA 3PHOA 1QP1A 4GRWB 4KMTL 2IAMB 3OKNA 4GUPA 2G75A 5F7DB 4MX7A 1FCGA 3FOLB 1PYWA 1UCTA 4PLOB 2CDGA 1I9JH 3TYFA 5BS0B 2EYTA 3S34H 4HUXA 3HNSL 3X13B 2VISA 1ZT1B 5IWLC 2E8YA 5T3XD 5CGTA 4JQXA 2ICWB 1TETL 1RURH 1EHAA 4Z76A 3NCEB 2VLKA 1P84K 5DJDB 3BO8A 2F53D 3MNZA 43C9A 1LE9A 2FJGA 4O2CB 5C0NC 1IGMH 1QFHA 1ZVSB 4N0UA 1BIHA 2J1KA 5F9AC 2JB6B 2DQHH 1R3IL 3MRIB 1V05A 2EC8A 2HP4A 4X8JB 4LCCB 3LS4H 2AXHA 4XTRD 1UJTA 3L7FB 4BKLA 4ZTOH 1OGTA 2NW3B 5FEBA 4KQ4H 3GO1L 1AE6H 5I8KL 1LEGB 1YY8B 2VDRL 1M7IA 2Q76A 3PF2A 4D9RE 5BRZD 3IDMA 4O9HH 4ERSL 3RTQC 2FH8A 2BCKA 1AIFB 4MCZA 4L5FL 5T5NF 3EYFA 1TMCB 1ACYH 3B83A 5H35A 1ZAGA 3MYZA 3V0VA 5IFJA 3GIZH 1WEJH 5GRVK 3S97C 5C09D 1YMMA 4M03A 2FGZA 4LGSB 2BNUA 4EXKA 5HVHC 4XB7A 3HB3C 4ALAL 4XXDA 4PD4J 1A6AA 2PETA 4BYHA 1E4XL 5SWSB 3SDDD 5IT2H 3DECA 2YRZA 4I48A 2FZ3A 3MV8D 5B8CA 2XQYG 2W9LA 1B4JL 4K94L 3ZTNH 3NACL 1RZJH 4PJ5A 4XPBH 1H5BC 4YK4C 5A2FA 1TVBA 1N59B 4YPGA 4F33A 1IQDA 4HKJB 3QNYB 4P4RA 2V5SA 1YEKL 4NQDA 2AGJH 1B0GB 3VFPB 2P46B 1BZQK 5E2TL 4P3DA 1UM6H 3DSFH 4ODHL 1LO0L 2ADJB 3E3QC 3LPGA 4LHQB 4Z95L 3PNWB 3WIIH 2V2WA 2VLRE 3QXUA 5IKCB 2X1WL 5GGVL 5DMIH 2O5ZH 4RGNB 2XQBL 3NCYP 3EOTL 4ZAKB 3EO0B 5F21B 5EZLA 2YD3A 4KKBD 4QXTB 1MFAH 2IAMA 1RHHA 1KCRH 1A3LL 1BFVH 2D3VA 5MEQA 3PWPD 4OLZL 3WUZA 1GGCH 3MFFA 3DMMD 4H0IA 3IFLL 3QDJA 3V6OA 4LKXA 4P3CL 4UDUB 4CVZA 2WQRA 2XKNA 3O3EA 3UCRA 5DLML 4CDGC 2ARJA 3AFLA 4W6WB 1ZK9A 5GZNC 2DTMH 2ATKA 3OL2A 7FABL 3H3KA 4X6BB 3CSBA 3O4LD 2J5LC 1EO8H 5HHPB 1DBJL 4HIXL 5DRWA 1DQML 3MFGB 4EI6A 1P5VA 4E42A 1DSFL 4M6OL 3BXNB 3P77A 3NVQA 3MREB 4PREA 4AT6A 2GY7B 2IADA 1XGPA 1FLRH 5JNYB 1TZIB 4GJTB 1BFTA 1G9NL 2IPUG 3D85B 4K7PH 1VEPA 4G6ML 1A6WH 4DEPB 4E41E 4X6CF 4HIEB 5IIEA 1JE6A 1JTPA 4OJFL 3QO0B 2GY5A 1U8MB 3RQ3A 2VZUA 2VN4A 3GI9L 1Q1JH 4FZEH 1VADB 2QV2A 4JM4H 2G60L 5EO0B 4Q9BA 2DTSA 3IU4H 5DD3L 5IB2A 2YUVA 5EG6C 5IB5A 4CNIA 3O3DA 5HGAB 2HVKA 3RX5A 3WHXA 5FECB 3U1SL 5I1IL 2GITA 2NY7H 4HCRA 5IMKA 4NNPL 3MBXH 4TQEL 3SJVD 5HXMA 2H32B 4PUBH 1DLFH 3LV3A 3SKJL 2AEPL 5IHUH 1GGBH 2MHAA 1OM3L 5KANI 1B0GA 2OJZH 1A02N 4KVCH 4D94A 4WEMB 1J12A 3O6MH 4RCAA 1IAIL 2DLEA 4Y2DA 5D72L 4UTAH 1FO0H 4M00A 4RFEB 3ECBB 4XPTL 4HWBL 5HHME 4WW2A 3VFTA 5I1KH 2AKRB 1FNFA 4P59L 1K4CB 3ULVD 3D6GA 2YKLH 5ALCH 3OKEB 4UZGA 5JQHC 3WHE0 4MHHI 1HXYB 1F4AA 3VRJA 3ES6B 5IHLB 1HINL 1NL0L 4AL8L 1IILE 5IW3A 2WW8A 3GHEH 3QO1A 2G5RA 4PJIF 1W0YT 5DT1H 4YIQB 5A2KH 1U2HA 1DVFA 3CH1B 3I9GL 3RL1A 5FK9B 3MXWL 5IB3A 3DXAB 1L7IH 2JJSA 3IDNB 3X3GL 5H2BA 5T3ZE 2PO6B 3KYMB 1RD6A 5HHOB 4U1NB 4X6DF 4XP6H 4LCYA 3JUYA 3MREA 3O3AB 3RRQA 1CFQA 4Y4HD 1DN0B 3WIHA 4PJFB 1BQHA 1XGRB 2BOBA 5EORH 5CBAA 5KSAC 1Z6JT 2R1WB 3WNKA 4OFYD 3D25A 1CLYH 3D5OF 3IDXH 4J23A 2F19H 4M61B 5EU3A 4AYFA 5I1DB 4NHCL 5B21A 2W9EL 4J1UA 4X9HA 4K3DL 5ELIA 5DJCB 3O11A 3NABH 2W59A 3OF6A 5LGHL 3SGJC 2UY6A 2FGWH 2VR9A 3O41B 4MNHA 4F9LC 3UROR 1ZGLM 4NUGL 3V0WH 3RVXD 4OBSA 4TRPL 3RVTC 1J05B 3OAZH 2BNRE 2GUOB 5C0FB 5HI4D 5D70L 1QRNB 4YHML 2VLME 2HFEA 1WBYB 3V6ZB 3ZE1E 3VWJD 1MI5D 1RZKC 4YHKL 1EEZA 1KNOA 4X6FB 4E41A 2PXYC 2BNQE 3VFVB 3BQUA 3LKSA 2WK2A 2C9AA 3FQNA 3OKMB 2BY2A 1A22B 1DP0A 2HT4D 3I6GB 4NQVB 4Y5XC 2Q87A 4NQSA 1NCDL 3H3PL 2ADIA 3K8MA 2EH7L 1ZEAH 3GM8A 5E9DD 4YQXH 3QZWG 1EAPB 3VJ6A 4OFVA 4JDTL 3VGBA 1A7RL 1D7FA 3ECBA 1WJ3A 2AEQL 1PGRB 4NPYB 4F80A 3CC5B 2HKHH 3CFEB 4U1LB 3KLHC 2XXMB 4R26L 4KHTH 4J4PC 4DVBB 4Q9QH 1YEEH 4ODTL 4TSAL 3NCJL 2YA1A 4LEOB 2R8SL 4LRNH 2COQA 3FB6A 4I0PC 4CVUA 4AH2B 3V4UH 2PYEB 3LD8C 4OGXL 4KDTC 4UQ3B 5IVNA 4YZFE 1JRHI 1HH6B 4U1IB 4LSUH 1OOAA 1OP3H 2YD7A 3MYJA 4GG6F 3O6KH 1Y18A 4NYLB 5GRUL 1EUTA 1FIGH 2ZJSL 1FYTD 5EUOB 4L3CB 3KAAA 1R24A 1DN0A 4ZO9A 3S5LB 4G8GD 2FSEA 4ZOCA 4KJPD 3VW3L 1T03L 1PKOA 1JK8A 2F58L 3FN3A 1JGVH 2FB4L 1K2DA 4NN6B 1XCTB 3QHZL 4HMDA 4R96B 1RVFL 3G08A 3RKDC 4FQIH 5K9QG 1A9EA 5DJCA 3H0TA 3ZT7A 3AGVA 5C0RH 5GJSL 3KJ4C 5J6GB 1JZ7A 1QPPA 2NLJA 4KDVA 5D7JA 4JO3L 3RBGA 1BD2D 2C7UA 5DDHA 1A1OA 1NSNH 4LNRB 1YQ2A 5C0FA 3BP6A 1YYML 1PJ9A 4YHPB 1C12B 2R4SH 2F9BT 5E00A 4ZS6C 3FFCD 1QSFD 2X4QB 1FPTH 4LPXA 3SN6N 1EEYA 1O7VA 1IAOB 3ZKMD 4JZOA 4QOKB 3RDTD 4NZTL 5IGXL 3HC3H 2DBLL 3VH8G 3GSRA 2I5YH 2XWTB 1MIML 5F3HB 1DBBH 2OXHA 2XN9D 2ZCLL 2Y36L 4GAGL 4FG6D 4GXUM 1O5DT 4NQVA 4JR9H 1Q9KA 3CVIL 4APQB 1OW0A 3E6HB 4QRSB 1BEYL 1YN7B 3HZKB 2C3WA 2EE2A 3SHSA 4DK6A 5C3LD 3ULUC 4Z0BH 4IDLA 2BNRA 1MVUA 2GSIA 4XPGL 1KLUB 4HFUL 4O5LL 4G9FB 5FGCE 3TZVC 2VJXA 5IK3A 3R8QA 2XNAA 1W0WA 4EDWH 5GGSB 1UM4L 2Q86A 5LJYH 3VXQB 3IF1B 2BNQA 4S2SA 3EIFA 1SHMA 3TJHD 1RJLA 5J0BA 2VL5A 3THML 2B2XH 2PYEA 5C0BE 4TPRL 1MFBL 4C54A 1TVHB 1B4RA 3SKNA 4YLQT 4N8CL 5DJXB 3RWEA 1L4IA 1NBZB 2WANA 2XACC 1S78C 1K6QL 1J0KA 1XF3B 4H8WH 1U95B 1PG7X 4Y1AB 3FQWB 2FEDD 1A2YB 3MBEA 4NYLA 3ARDC 3BMVA 1WWWX 1I7TA 5D1QC 4P2OD 1A0QL 1U8JA 3D39D 5F7EL 3H6JA 2FATL 4MJIE 4FNLL 2WNGA 2X4UA 2EDKA 5KSVB 1T04A 4NQED 2BERA 1FFPB 3O45A 4N5EC 5ICYB 5T33L 4M5ZH 4HKXB 3UO1L 2OS7A 4GAYA 5FCUL 4NNXA 1NAML 4PV9A 3T0XA 1IGFH 5D1ZC 3ARBA 4S11A 4XP5H 3UTTE 3MCLL 4TOYH 4R4FH 4DW2H 2WBWB 5DYOA 1G7LB 1EH9A 3FTGB 5FGRA 4ZS7L 5F7WC 2A6DB 2HWZL 2XTJB 3KPQA 4NC1C 1KT2B 2J2ZA 1MRCL 32C2B 4O2FB 3MUHL 5I8EA 4LKCB 4WUKH 1IE5A 4D9QD 2X70B 3VRIA 1I7ZA 4F8TA 2E7MA 5LXGL 3O0RL 5F1KC 1SJEA 2B1AL 4ZUSA 3M8OL 3LB6D 4KZDH 3LEYL 1L0YA 1ORSB 1XR8B 1ADQL 1BFOB 2F8XC 5F3HA 1JF1B 4L29A 1AGCB 3ARPA 4Y5YA 1FZJB 1AY1H 2C1OB 3I75A 2CUIA 1UZ8A 1ES0A 1JWMB 1T5XA 4APQA 1QBMH 4IOIB 3BISA 5F8RC 1YA5A 5AAMA 3HZKA 4ESKA 2B0SH 3S88L 3FQXA 2VLLA 2AQ1A 2NXYB 5HGDA 4OM0L 1AO7E 15C8H 1CR9H 4X6EA 1FGVH 1RAMA 4FABL 3DRQB 5IUSA 2P42B 3LMJL 3QCUH 3E2HB 1OTUD 1WBXA 3STZA 5JZ7C 3CPLA 1RIUL 1P1ZA 5E8EB 3TIDB 5DGRA 4M62H 3TJEL 2DWDB 3DOSA 2OQJA 4XNUL 5HVWA 2YD1A 2E27H 3HRPA 1KBGH 2HTKC 4UBDD 3O9WB 4LSVL 3P9LB 3AREC 4QTIH 4EBQH 4JAMB 3DHMA 3UMTA 1MCFA 4K23L 3OAYK 3UX9B 1NBVL 4AEIL 1FRGH 1ZT4B 4JGMA 3DGCR 3JWOC 4HPOL 5I0ZA 5EOTA 5AYUH 4GXVL 3ZKXC 2BDNH 3BN3B 5FV2A 4NM4L 1T80A 4HLZG 4XNZB 3U0PB 3KDMA 3IAQA 5GSVB 5JIKA 3ULUH 5C0BA 1I3GH 3UYRH 3V6BR 2B4CC 1T2XA 3NFNA 1E4KA 1DN2A 1YNLL 4JRXE 4DGIH 5FGBA 1IEAB 3E0GA 3KXFD 5MENB 4PJCF 1KXTB 4ZXBD 3VFMB 2UWEF 3G5XB 1OLLA 5F7MC 4DOHB 4JFPB 2J8UB 3L3IB 3V7AG 3ROOB 1KT2A 3VI4F 1C1EL 4MJIA 3T65A 4LKCA 4Z7VE 3V95A 2AV7B 4RRPG 2FWOA 4PRHB 3MRPB 2MFNA 4YEFA 4OSUH 2A77H 1J1OL 2JCCB 1M6OA 3MQIA 1AKJA 2CDEA 4NM8L 1WZLA 3AXLB 3RIAK 5KS9F 4K2UH 2J4WL 2EXYD 4XAWL 5JW4R 4JG0H 1WF5A 4QWWD 2ZCKH 1BZ7B 2AI0H 1RK0B 1S5HA 1BOYA 3QUMA 1AGCA 3PL6B 5FM5O 3UTTA 5AAWA 1FZJA 1MCEA 1X7QB 4NHUB 3RY6A 2CLRA 1GOFA 3V0AC 3KPRD 35C8L 4P49A 1N5AA 1IC5H 2HLAA 2XA8L 4ZYKB 3B2UC 1FL5B 5I71C 4J3WA 4OZFH 4WI6A 4M8VA 4KFZC 4U6YB 3QQ9D 1XAUA 3RU8L 2KZWA 3DROA 5DJ2A 3DRQA 1F4XH 4HJGA 2GJZA 4WEBH 1T0MA 4UIMB 5I1CH 5TDNB 4QHKI 5K59F 2DB8A 3HE6D 3MX0A 4FZ8H 3TV3L 3QISA 4WO4B 4OCYL 1HHGA 3UBXB 3RWGB 4YGVB 3ZYIA 2P24A 1WFNA 4HHAA 4HSQA 3BEWB 4MAUL 1Q38A 3MV9B 3O9WA 5KAQG 1BF2A 5E6ZA 4AY0A 3EGSA 3OJ2C 4L8DB 1RHFA 3LRSA 2FLRT 2LU7A 4K71B 1SBSH 1CE1L 3RZCA 3MJ9H 2M26A 4QRPD 1AO7A 4HDIB 4X9IA 2EXWD 1TITA 3CDCA 1B6UA 4C4KO 4XBPB 1GAFH 4EIGB 4LPVA 5KVGH 5F9JB 5J11B 4BZ1L 1C8PA 1BGXL 2YPVL 1XGYH 1U8QB 2QR0B 4QT5B 5F96H 2NNAA 3EBAA 3NFPA 1UWEH 5D7IB 2ZUWA 1XIWD 5FO7A 4FRWA 5CJQH 3HI1B 4WWID 5T1DL 1NLBH 3FO2B 5DURB 4M1CC 4L3EB 1UB6B 5I66A 1EAJA 2AJ3A 4PB9H 2QSVA 5DZOA 3VI3F 5D5MF 4P4KA 5K9OA 1UWGH 5I1LA 3CFBA 1QLFA 4J6RH 4XRCA 4OKVA 1X44A 4OUOA 3SGKA 3HNTL 3SY0B 1FL6A 3TNMA 5DJYA 1TZHB 4IRJD 5C71A 3TN0A 5LGJA 2VKWA 5GJTH 4R7NB 3UDWC 1KN4H 3F12A 1CE6A 4JM2B 1TJGH 1IKNA 3OAUH 4P2QB 5I1EL 5TDPA 5HDBE 3JZ7A 3QG7L 3DIFB 2NY3C 2AK4E 4G42B 1PZ5A 5C0CB 3L95B 3HUJB 1F45A 2N7BA 1NMBH 1G7JA 1CFSA 2ZUQC 4NO0B 2CD0A 3H9SD 4N1CA 4B41A 1GZPA 3KJ6H 4MVBC 4Y19D 1R3HB 2B4CH 1J18A 2FIRT 5A2IH 3F7YA 4Z7VA 1MCJA 1QBLL 5HVFB 3GSNB 4M7KL 2X4TB 1CDJA 4JHZA 3BH8B 4PJEB 3LN5B 4N0FB 4PP2B 5JORA 3DLQR 1DQQB 4HV8A 1HHHB 4G6KL 4LHUG 2JELH 4MNGE 5FM4A 4U6XB 3X17A 1IM3A 4YNYB 4H1LB 2EDLA 3MRQA 1UH3A 1KC5H 1AR2A 1U3JA 5CIPA 4YXLL 1FNGB 3MRGB 3CLEH 3LY6A 2ICCA 4NJAL 5ICXA 2XWJA 2VDKH 1UACL 1A3RH 3CX5J 4P46C 3EFDL 1G6RH 5JW3L 2ZSWB 1TJIL 4KWUA 1W0VA 1S9KC 2HYMA 1IGCH 4FQQA 1ZLWH 4IS6A 4EUPG 2BSRB 3TIEB 4LCIH 4PY8I 4PV8B 2CKBA 2I27N 3BVNB 3AM8C 3CFDA 3QPQD 4LQFL 4KKBC 3C5JA 2YPLB 5IMMB 3CFKA 2OTWA 2V2TB 1L7TH 3N0PB 1N0XL 5K33A 4R8WH 5GRJL 3VFGL 2GTWB 3NZ8A 4P23D 5F9DC 3LSOA 4Y4FB 3BRFA 3SDAB 2Y7QB 2P8LA 5HYQA 2M2DA 4H25B 4DKFH 4NC1E 4M4RA 1IQWL 3UPCA 4Z7WE 4LLUA 4X7TA 4PLJC 2IH3B 4DVRL 4I3GA 1R3LB 1UCBH 2Y06H 1JV5B 3BEVA 3GMRB 4QLRA 4UI2A 1DFBH 3FHAA 1F11B 2Q3AA 1YECH 4M7LT 4Y7MA 5E8PB 2PCPA 2R2EB 3QDME 1N2RB 5JR1H 2MCPL 5BV7B 1JMXA 3RY4A 4IRZL 3MJ7B 2CRIA 4GOSA 5D1XC 3UTPD 4DTGH 4F7PB 2XA3A 3TWCH 5TE4H 3T04D 3BKYH 3QUZD 1Q9WA 2CDFA 1VFAA 2OXGA 1R3HA 2DN7A 5FUZH 1MSPA 3SCMB 5JXED 4NQCE 3D0LB 1HK6A 4N8VG 1KB5L 3WJLA 3OXRB 4OZIF 2YPKB 5B3JF 3MGOA 2OR9H 5I8CA 4I9WE 4PG9A 3TPUA 3VXSE 4G80A 4U1GB 4WFHE 2V2XA 4CJ0A 4MXQD 1TQCB 1D6VH 3C5SA 3P30L 4UINH 5FUOL 4G6JL 3DWTA 3MLSL 2AK4A 3RKPA 3MTRA 5FGSA 1LP9F 3PDOB 4GRLD 4P5TB 4V1DE 4E9LA 5HHQA 3K4ZA 1H0DB 3WDIA 4YXKL 3V5HB 1IM9B 4KVNH 2R0WL 3OX8B 1T1WB 4NO5A 2BC4B 2Z8VC 3O81A 5DVMA 5F7KC 4XNQB 2VR5A 2V7HA 3C08L 3C60D 4X99B 3EDEA 2R2CA 5J1AB 3C8KA 1JF6A 2I9TA 4U2ZA 4UIKL 4KJQC 3TIEA 5HI3D 3WXVL 1QQDB 4JHWL 3REVB 2VMFA 2VABA 1HDMA 1PBYA 1H3GA 1U9KA 2DQFB 2YPLA 3X11B 4MNGA 1D6EA 2ZNWA 5TDOA 3QIUB 4PBXA 1AJ7L 3MLPA 1J8HE 3UEZA 4ZNCD 3SDAA 5KVDL 4MA3A 2WV3A 4POUB 1WWAX 3IKCA 5JHDE 1M4KA 3BKMH 3GBLA 1YEDB 1FG2B 1P7QD 4WU5A 1JGUL 3HMXH 4PJXB 2AQ3A 3FT2B 5DHYA 3TBVA 5ETUB 1MREL 2D7NA 4X83A 4L8BB 2IGFL 1FDLL 1S5IH 4NKMB 3ALXA 1YPZB 3B9KC 4U1JA 3MRKA 3S35X 3QIBC 4L9DA 5DD6A 3RHWK 5F1OB 5JO5B 2R2EA 4AJ0A 3MLTB 4X5XB 4KJYA 4N90D 1OF2B 1UJ3B 1I1RA 2EDXA 5C0DB 3QI9A 3CGTA 5GS1C 4NZRH 4AENA 2LAAA 2VDLL 4Z7WA 2EDQA 2FECI 3QRFM 2VRAA 3T2OA 2LVEA 1FZOB 1MF2H 2PW2A 1JPST 1FNEA 5C07B 1CICC 1NMAL 3HPJA 4EIZC 2HMID 2R2BB 4I3SL 2IQAB 4NUJB 1H8NA 1MCOL 5IEHB 2VWEC 3HS0A 4U4BA 2QADB 5KSUA 5DD5H 3QDMA 4MZ2A 2VQ1B 2G5BA 4P2RB 3SDXE 1CWVA 2BSED 1DUZB 4PS4L 3QJHB 5EN2A 2RFXA 2W65A 5I74C 4PB0H 2R2HB 3I85A 4M6AA 4GW4A 3T0DA 3OSKA 1UENA 1NGZA 2WUBH 4AQOA 1NFIA 3GRWA 4NQCA 2Q7YB 4NKIL 1RK1B 2ZSVA 4U05A 4UTBH 3U36A 3DX6B 4W68A 3ESVF 3E8UH 3N50A 5GISH 4F3FB 1K8IB 3VXSA 5IESH 1B3JA 5H8DA 1F3DJ 2NY1D 4X4YA 4FFVD 3REVA 5I19L 1GPOL 1TQBB 4UDTB 1LO5A 1HIML 3GGWA 3FOMA 1HKLL 4V1DA 3BRGC 3HRZB 1WTLA 3L3OA 5DZNA 4XHJD 1FJ1B 2F8OA 5T3XE 4CUCA 1LHZA 2PTVA 4FFWC 1DQTA 1F6AA 1T7XA 3QUYB 2ZG2A 1VENA 5EU7C 1MY5A 2F53E 1NGXA 5CILH 1I1FA 5FHBH 5HGBA 3IKKA 4I4WA 2BRRH 1A4JA 3SO3B 3H8NA 3BE1H 1EHLL 1S7VB 4N9OB 1MFCL 2YA0A 3BPNB 4GLRH 4OF6A 5HDLA 3RGVB 5HYJE 4UOW1 4JFQB 1KEGL 5IJVA 3L3HA 1QYGH 3MLYL 1BBJA 2W0KA 4IMLB 3HG1D 4UT6H 1OHQA 1EBAA 5CWSA 4PY7B 1NCCL 5DJ6B 1WAAF 2AVGA 1U3HC 4WFFD 5EU6D 1T7ZA 4D0CB 3GHBL 4EDXA 3C5ZD 1J8HA 3DRTB 4PRDA 2CK0L 3BZ4B 3M17B 1G9NC 4RMUA 1EFQA 4POZD 4YDLB 4R7DA 2YUXA 4R3SA 4JKLA 5C09E 4CL7A 5JHDA 3UJTH 2BFVL 4HS6A 4PGBA 2AS5M 3U46A 4NDMB 4G7YH 3GKWH 4QXGL 1PX4A 4KTEH 4KUCF 5FO9A 3QAZC 3JWDH 3RJQB 1WZ1L 1VDGA 1JPGA 4OCRL 3U6RA 2G9HB 4OD1H 5KJRH 5JW5B 3MV8E 4KRPD 5EIQA 3OAZK 5BMFL 4HXBL 1JZ8A 1FVDA 2ZOKA 4X7FC 4A6YL 4Q6IC 3KLSA 1DQLL 4KRLB 5TF0A 5F9OL 4BSVB 3W11C 3ZKMC 4Z7UE 3EJYD 3VWKD 3W9DA 1YJDC 3B9EA 5CEYA 1UXSA 4JY5H 4GG8A 1SEBA 2EDOA 2R1YA 5EWIL 5EFIB 3HPLA 5B38B 4YDKL 5HBBA 1AD0A 2DWEA 2DYPB 3NIFF 5E99L 5FYKU 3STLA 3G5YA 2F8VA 1KCUH 1T4KB 3RWDA 4LVNC 4LVOB 5DHVB 4DZ8A 1HSAB 1D9KB 1K8IA 5GS0H 3JV4A 1V5JA 5GHWH 4HKZB 2QSQA 3TT1L 2BK8A 3MZGB 3PWPE 3SDXA 3LIZH 3NCBB 4F7CB 1CYGA 3SPVB 3GJFB 3TNNA 1AC0A 4ODUA 4G8FB 1JNLL 5E4EB 5LAXA 2QJDA 4XCFH 1GC1H 1LQSR 4XB8A 2YEZA 1SYSA 3WFCH 3MMEB 4ZQKB 2GT9B 43CAA 1EMTL 3HC0B 3VFRB 4S1QL 3FL7A 3O8XD 3O4LE 1OTSC 1JFQL 2W60B 3U7YH 4PRPB 1OP3K 4M1DL 5CGYD 1HH9B 4R2GB 1LD9B 5FA4B 4PJ8B 1J86A 1E27B 3QZWA 4PP1C 2R29H 2VUOA 1H15B 1ZTXH 3QA3B 1QR1B 3OZ9L 1SBBA 1S7XB 5E6IB 3S36L 4ODBD 5C6PB 3BZ4A 2I07A 4RIRB 2F53A 3RL2B 1MHCB 2CPCA 3PIQA 1A6ZA 1NC2D 3RA7H 5E08H 3BP4B 3SDCD 4H26A 4JFDD 5HYJA 1KCSL 4LSDA 2O5XL 4NOFA 4TUOA 1U8OB 3MLUH 2NY4D 2FEEI 3BP5A 3Q6GH 5IVXB 4WJ5A 1N4XH 3WLBA 5DVNA 4AEHH 5FUCC 1NDMA 3T0ED 5EIIB 3MRMB 6FABH 5LBSH 3WLWD 1BVZA 4PGDA 4KKAD 3SJVE 5D6CA 4JY6A 5EZOH 3L7EA 3FZUD 2VDNH 4R4ND 1P4BH 1K4DA 4JO4H 4PJ9B 4E5XB 4HK3N 4BSWB 3D3VE 3MLRL 5IROA 4GRWF 2JLLA 5C09A 4XGZA 2DMBA 4IDJH 1R6VA 4ZUVB 5DQDL 3EYSH 5E5MB 2VTFA 3LRHA 4FQXC 2DYPA 3VGDA 4OM1H 1J1PL 4ZO7A 1NC4D 4L4VD 1P2CB 3SDDA 2FX9H 3MV8A 5K9QI 1MAJA 3D0VB 2ORBH 1FVCA 3S3PA 3ULVE 2Q20A 3EJZC 1KJ2H 4ONHB 3I6KB 5KG9A 2HTLD 2AJUH 4HC1H 2FJFA 4N0CD 2P8PB 4HKBA 4OJFH 1LWRA 4KTDH 5E94B 1E6JL 2BSTB 5L8KB 1M7DB 4XT1C 1U91B 3EZ8A 1HILB 3AS2A 4IRSB 3JTTA 3VGGA 4Y2OA 5HPMA 2Q8BH 4EZMA 3EYUL 2YRLA 1KJVB 4Z7NF 1HXMB 3O6FC 3LKRA 1ZA3B 4XXCC 3WKML 4U0RB 2R23B 4PGEA 1YJDH 3QQ4A 1XZ0B 2DQGH 1EJOL 4QCIA 5HI5C 4YBHA 3MODL 3F6IA 5C7XH 3DMMA 3LEXA 2MMXA 1U8IB 1OM3H 1XCQA 1MH5A 1QKZL 4Z0XB 3S37H 3ULSB 2XXCB 1S7XA 3VFWB 5JOFA 4OCXH 1UZ6E 2BMKB 2C1PB 4ODWA 5C0EB 3KPNA 3BZFA 3OJDB 3O4LA 2IWGA 1VEOA 3AY4C 4MNQD 5EBMA 1OAQL 5E70A 3EDDA 2AJXL 3QXVA 5E8NB 5J13B 4RDQG 4KMQA 4WTXA 2NMSA 1T0PB 4OZHB 1EA9C 2P7TB 3CDGB 2WBJB 4Z6AT 2DD8H 1KYOJ 1MI5E 3FT4B 1AD9A 3MRLB 1BWWA 1K3ZA 1R5IA 4J3SA 3LQZA 5BZDB 5CSZB 5EBWB 4KROB 3T2NH 1JI2A 5EZIL 4E5XA 5EZJA 2NY0B 2DLTA 3WS6A 1AHWA 2VDPL 3X12B 3HC4H 4QWWC 4YE4H 2EDJA 3VD4A 1AGDA 4G3YL 4GKZA 4HUUB 1CDIA 4ZUVA 5DD0H 2QTEA 3H7BB 4QHNA 4ISVB 4MYWB 5FYKL 1IGJB 5E9DE 4UT9L 2HJFB 3DX7A 2X4RB 4PRNA 1KLGB 1X4YA 2A9NL 3RVVD 4CVXA 1KG0B 2H1PL 1NUGA 4XI5C 4LAQL 3WO4B 4W4NA 3SJVA 3SQOH 2XZCL 4ODXA 4LCWB 4MSWA 2C3GA 2D7OA 3D3VA 2ESVD 3DX8A 2GJ6D 1M7DA 1Q94A 4MA7L 3TO4B 1U91A 3UXFA 2F5AL 3UZVB 2LV4A 1K9TA 2H2SC 1JGEA 4C55A 4G5ZL 4NQXB 1MCCA 5EU5A 1IGTB 3LDBC 2P5EB 4PRBA 5D2NC 3DBXA 2AXGB 4GAJL 5E2JA 4F37K 3CUPA 5L8LB 1A4KA 4JPVH 1S7TB 1S9YA 3K3QA 4CU6A 2V9TA 3WN5A 3ZMRA 1VKXB 1FYTE 4JO2L 4HIIB 3CVHH 4G8EA 4PG2C 4M1GL 3C09C 4AG4H 4JZJC 5HDQL 2J7LA 4G8GE 1XF2A 3BDXA 1EFXA 4LF3A 4Y4KD 3L3DB 3D18A 1SY6L 3IFNH 1D5XA 4I2XE 3VFSB 2BSSB 2GTZA 4LASL 4L1HA 3QEGH 4OLYL 4JANB 4OUUB 1RUMH 3KPSB 3K2UL 3INUH 5IVOA 4EN3B 5SV4A 3OKYA 3DX9A 2XPGA 1LNUA 5AG9A 1RUKH 2C3VB 3DARA 4ZFFB 5K9JL 3ARFD 3U4EA 4KUCD 4TVPL 5D7KD 3LCYA 1P53A 1BD2E 1I3RA 4ZFZA 1K3IA 1U8KB 4GKSB 1ACZA 3KHOA 4NC2B 1D5IH 5C0JB 1KPVB 4Y4HA 5IQ7H 4U6HB 3IDJA 4UU9B 3L5HA 3UPRA 4R26H 2C4FT 1A7OL 3KPLB 5I75C 1SM3L 4R0LC 5IM7A 1L0XA 3CFIC 3NTCH 4OFYA 5J12C 3BP7B 3FFCE 4LFHD 5KSBB 1QSFE 4W4OA 1UA6L 3RGHA 3RTQB 4D8PB 1N6QH 5IOPB 1MHPH 1QBAA 1T2QL 5AEAA 5FOJA 4OV6F 3DURB 4GAFB 2XQYK 4XMKH 2ITCB 3MO1B 2WWKO 2XN9E 4JFED 5ESVB 3SE9H 2YD6A 2F5BL 5HVHB 3V79C 2BVPB 3GMQB 4HW6A 2NW2A 2VZVA 4HK0A 1DUYB 3MGTB 4NN7C 3O2VL 1HHJB 3LH2L 1S7QB 3MRBA 4R97C 3T1FB 5D2LB 1RZ8B 3WBDA 4MZ3A 5TFSL 1OARL 2YZ8A 3WIHL 4KJWC 2HLFD 1NCBH 3VG9C 4YK4B 3VWJA 1H5BB 3WD5L 1IEHA 1MI5A 1CFVH 5T5FL 4X9GA 4FQ1L 4DKDC 1A14L 4K9EL 3C2AH 5D71H 1E4XI 1YEIH 1OPGL 3TO4A 4PJFF 1ZA6B 3QNXA 3EKCA 1MCNA 3I3DA 2XTLA 2UZXB 3HNVL 4MGXA 3UP1A 4DAGL 4ZMAT 4HWEH 2JJUA 3D39E 2Q8AL 1AXSB 4DCQB 3IYLW 3F7VB 1C5BH 3QJFB 2FYYB 5KW9L 5E95B 5DWUH 1EO5A 4X6CE 4NQEE 2O93L 3BJLA 3L3DA 3ZLQC 5CLWA 3A6CL 4TNWF 1MFEL 4BJLA 3QPQC 2YXFA 3DI2B 5IFAH 1QLRB 4M02A 5F1NA 4JLRB 4C59B 2IPUK 4FQLL 4XC3L 1WZKA 5A16B 3C6LC 2J5LB 3OPZL 4EN3A 3KYNB 1EXUB 4QXWA 3OQ3B 3UAJD 5ACZB 1WIOA 4HIHB 2ICEA 3MACH 3U83A 1NJ9A 4XCCL 3LRGA 1FYTA 1BIIA 4PD4K 4D9LL 3TFKD 4F2MB 1CGXA 1DANT 1UEMA 2OP4H 4HQQL 4OGYL 4ZUTB 3DGGA 4BFBD 2NY5L 1ZT7A 4G8GA 2NZ9D 5FUCE 1T83C 1DDHA 3KPLA 5E1AA 4OF5A 4YHOH 3BSZH 4YO0A 1CLZL 3P3YA 1FO0A 3QIWD 4TPRH 3MRCB 1KB9J 1BMGA 4FXLA 5L7XL 1JRHL 3OHXB 4YAQA 2IAMD 3QULB 2YMXL 3AUVA 3B9VA 1SYVB 3SE4C 5HGHB 5I1HH 3RZWA 4XCNB 1PLGH 1BD2A 3GMQA 4ELKB 2BHZA 3F58L 2LU3A 3QUZC 2AXFA 3UTZB 5JXEC 1IL1B 3GSWA 1EHXA 5FYKD 2XRAL 4U7KA 3FFCA 1QSFA 2FD6L 3BPCB 1DQJB 1ZHLB 4R4BB 3RDTA 1NDGB 4CMMB 4PJIE 1QA9B 2DQEL 1NEUA 4Y16A 1X5GA 5F6IC 4NO2B 4CJ1A 5KZCB 4U1KA 4MXQC 3VDBA 5EUOF 3M45A 2XN9A 3I6LD 2GHWB 3UTQB 2DICA 2W9DL 4GRLC 4WNQB 2MKWA 3BUYA 4X6DE 1I4FB 1QFWH 2I9LA 4H5SB 1QPXA 4NGHL 4JCLA 4JFHD 3HFML 1KTKE 2P44B 3PV6B 4OFKA 2MCG1 1PD6A 2GSGA 5BCAA 1T22B 5DK2A 1FG9C 1XEDA 2VXSL 3MOBL 4OCSL 4M7LL 1KIPA 4HBQA 2X1XR 1IAII 4HWBA 4MCYB 4ZFGL 4DGVL 2X6MA 2X9WA 3FN0L 5SWSD 1R5VB 3EFFB 1OTTD 4LSQL 2N4IA 3K4DA 1JTTA 3OGCA 1YEJH 3GI8L 4GSDH 2DQIH 3UYOD 2VL4A 3TLRA 4HGWA 4KXZH 1X5ZA 1WT5A 5I2IB 3KXFE 4M6NH 5JUEH 3SDYL 1GHFL 4N0YH 4BH7A 3L5XH 4XNMB 5E03A 1PG7L 3WJJA 3HI5H 1Q0YL 1QZ1A 4P2OA 1CGTA 3D39A 8CGTA 5KSAB 2Q7NA 4LPYA 4ZUTA 4UV4H 4TVPD 3HAEG 1DEEA 2Y07H 5DMYA 4I3RH 1T6VN 2QQNL 1GYAA 1OSZA 5I73C 4X6CA 4NQEA 4YDJB 4RGND 4FQCH 4ZAKD 4NBZB 2B7DT 4KH2A 4XVJL 5DS8A 2IMNA 2BVOA 2RHEA 4FXGA 4YX2L 4HT1H 5CMAB 3HI6L 2IANB 4JRXB 1WBZA 5KN5B 1LO4L 1JTOA 1HCFX 4KK9D 3BWAB 3F7RA 3WFHB 5DVLA 1CZ8L 4CN4A 2AJSH 4JKPL 5HGHA 3CXDH 3KPRE 4CU7A 1U41A 5FKPA 3PDDA 1QLEH 2DL9A 5ADOL 1IGIL 2DF3A 4GT7A 2IPTH 1NGWA 2JIXB 2NYYC 1NGQL 3UTZA 1NMCC 4RMVA 2MSPA 1QTYT 4K7PY 4BFEA 3IJHB 2PXYB 5HY9B 1I3UA 3TBTB 1XGTB 4EVNA 1DQJA 2Y25A 4EI5B 1T89A 3V8CA 4OB5H 1RJYA 1W8OA 1YNLH 3DHJA 5HJ3B 5DUMH 4AM0A 5JPMB 5LWYH 2CRZA 4Y5XB 3IDYC 4TSCL 3D85D 3EDKA 4GG6E 3O6LH 3VXNB 3K8KA 4WNQA 1AFVL 5ISZB 3V4PH 1R5WA 4QF1B 5BZWB 4X5WB 1UB5B 4OF0A 1IEBB 1UFUA 2EEBA 3MV7B 2APFA 2BXYA 1T0NB 2D0GA 1Z0NA 1UKQA 3MRDB 1OAYL 4PJIA 4I0PB 4O4YH 3LD8B 3C8DA 2FO4B 3PWVA 1N8ZA 1HQ4B 1F4YL 4FMKA 4JVUA 2NY1C 4DQOL 1OCWH 3QPXH 4GKNA 4HG4K 2B1HH 4ZDHA 2QQLH 2P8MB 4X6DA 1DZBA 4JN1H 3IJSA 3JSSA 3KNBA 3MOQA 2VUYA 4P5KA 3CSGA 5E24E 1JPSL 1AGBB 5HHXH 4YR6A 3RAJL 3A6BH 3RPKA 5BW7A 4EJ1C 1EX0A 5DEFA 3WS3B 4YDIL 4OLVH 5DGQA 5I16B 4OLEA 5IHBA 3AVEA 1P7KB 1JMZA 3RNQB 1MFDH 1CL7H 2ZCHL 4JCMA 3G6DL 1RZ7L 5IB1A 3FQTB 4YDJA 4DUVA 1ED3A 5MI0B 1CFTB 3IDUA 3KJ4B 5IBTL 3R1GH 1L9NA 5DO2C 3B5HA 3KXFA 5DD1H 5GSRA 3WHE1 1CE1H 4W81A 4F58H 2ICWJ 4MAYB 4ZXBA 4MA8L 5GGTL 2O61B 4BK4A 4OIAA 3H9SE 3N1PC 3AROA 1GZQA 4Y19E 2VXQH 1MCWM 1ONQB 3DXAD 5DA0B 2PO6D 3LKOB 5HHOD 3VXTA 2H8PA 4XCEB 3LHPH 5LG1A 1Q9LB 25C8H 1C08B 3KLDA 5BO1H 1AGFA 1YUHB 1A6UH 3EO1A 3HZYA 5HJ3A 1XMWA 5FOBB 1CG9A 3RX7A 3U0WL 3AS0A 5IVZB 3HN3A 1I1AA 4HBCL 1JHKH 2R9HD 3KPRA 2WP3O 3IFOB 4U6VH 1MJJB 2VQUA 3EJYC 4GQ9H 5E5UB 3TBYB 4C58B 1FV1B 1DBKH 2Z8RA 3QEUB 4MJ6A 3MNVB 1G9ML 3TZVB 1HHKB 1UEYA 1MJ8L 4WCYL 1LMKA 4XWOD 1WITA 1TJHL 1RZFL 3BZEB 1JZ3A 3VFOA 2Z35B 2O5YL 1U93B 4ONOA 5M94B 3ISWA 2FO4A 1QRND 3Q0HA 3HE6A 5HHNB 4TULH 4NRZB 3S4SA 5DJZA 3MLVH 1U8LB 1G7MA 2J8UF 3EO9L 3JV6A 4FXKB 5L2KB 5ANMB 1S7WB 4XZUA 4GG6A 5GGQH 2A83A 3AU1B 3QUML 2XZAH 4HWZB 1BBDL 3L5WB 2W92A 5D1QB 2JCCF 4WU7B 1AGBA 2FLBT 1IVLA 1HQRB 3HE7C 5ERWA 5DEGB 4KTYA 2KDGA 1ITBB 5IF0A 4MJ5B 2IBZX 5C70A 2GYSA 3BDBA 3IU3A 3GNMH 3O8XC 1MCWW 1S7RB 2DLIA 1ND0A 4WHTA 4K3HA 1RUAH 4OD2B 4I5BB 3GMOA 1JYXA 2HFGL 3T4AB 1W72B 1XIWA 1Q9OA 4WV1A 5KVEL 5D1ZB 4K3GA 5BOZG 3GBNH 2W0FB 3BMWA 4JZNA 3WDHA 5D9SB 3E1F1 3WXWL 2ZKHL 2NPLX 4B50A 2PYED 1IC1A 3UTPE 4MAYA 1NAMA 2PF6A 4PPTA 4HFWA 2O61A 3MLWL 5ID0B 3CLFH 1ONQA 4IRJA 4NJ9H 5DJ8B 1PX3A 3G5ZA 3ARUA 3B2VH 4RNRB 4RZCA 1UC6A 4X9FA 4LLVB 1VACA 3FT3A 3MCKB 5DC9B 3UJIL 2RR3A 3B6SB 3WYRA 3V52H 4QY8A 3VXMB 1NKRA 5FYLL 1CIDA 2Z9TA 5KVFH 1ADQA 2WSKA 1DL7H 5F1IB 3QHTC 3FHQA 1JWUB 4FTVE 4YJZL 5F9WC 4JFZL 4Y19A 1KELH 1PDKA 1XH3B 5D7IF 1EGJA 5CD3B 2E8ZA 1HHKA 2Q6WA 3WE6B 4S1DC 4KRNA 3V5DA 1R3JB 1KIRA 1I1YA 1CF8H 1RIVH 2PUQT 1BVKB 2W0LA 4PIRF 1RZGA 1ZHNB 4HWNA 3SKOB 3QSKB 4FN0A 2E6QA 5KANG 4XMPL 4QXUL 1S9WA 2JF1A 1CGUA 2IG2H 1V7NH 4MDJA 3FQRB 4KGJA 4JRYB 2FHCA 5L2KA 3AREB 4PJCE 1HI6A 1QFUH 2X4NB 5C0AB 4QOKD 5CJ8A 2UWEE 2DQTL 2OL3H 3I2CL 4WWKC 5E2UL 4JM2F 4G6AD 1MY7A 4BZ2L 4MHHG 1CD1A 1RJZA 4FQ2H 5F70A 3VI4E 5B3NA 4NRYA 2YK1L 4APQD 1ZLVH 1CN4A 3HUJF 5TQ2L 5BXFA 1WICA 3FB5A 5KS9E 4XPHL 4YHIA 1ZLSH 4LQ1A 1I85C 4MD0B 3ZZ1A 4YXHH 4G9FD 4OZFA 4E0RA 2AEIT 1NCTA 5FHAH 4K7FA 3GMMB 4S1RH 4LRIC 5I0DA 3P4MB 1CU4H 1FIEA 1LK2B 4P23A 4WY7L 4N90E 1FFQA 1L9MA 3VE0A 4KGLA 5GQBA 4PJEF 3WFDH 3WMSA 5DUBB 5JA8B 3TVMC 3SGEI 1T83A 1F4HA 2ITDA 1ZGLA 1BQHG 1KCVL 2A9MH 3N1QC 5KTEH 1KTDB 4XCYA 2HT3C 4HUWB 4MA1C 1Q0XH 1U3YA 1LDPL 3BW9B 4RAUA 4Y1AD 3PWUB 5K59E 1Y0LB 2BJML 5EA0H 1YDPB 5ADPL 3PWJB 3A0OA 4JFFE 3HHRB 1U36A 1G6RB 3BUTA 2IBZY 1D5ZA 1AJ7H 1UT9A 3QEHB 1OQOA 3L1OH 1IGYB 3P4NB 2VZ3A 4KI5C 2NTFB 4GH7B 5I71B 5IG7A 3HCVA 5JXEA 3EYQC 4ONFL 1INEL 3BAEH 2D03L 3GMNA 5CJBA 3X3FL 1BJ1H 1ZHNA 2VKXA 3DO7B 4PR5B 3P2TA 3RVVC 5TH2B 1MHHA 5EBLB 5CBEA 1CVRA 3V4VL 5DQ9A 2L0DA 1WC7B 3VI3E 4I1NB 5D5ME 2D9QB 2X4NA 5DJAA 4FTVA 4NFCA 4OZ4B 2VDLH 4NP4H 4ZPTB 1U92B 1O7SA 3LZFH 2CGRL 4YHLL 3L3KA 4C4KT 3C60A 1ZHKA 3QEQB 1H3PL 5J6HA 2E7LA 3PABA 1BM3H 3GSNL 3ZT6A 3RUGA 5D7LE 2UYLB 1IC4L 2AABH 4BSJA 1LEKB 5L88L 3R06B 3HG1E 2NXYD 4DWHA 1OD7A 1CXFA 3I50L 3N1GC 4MXWH 5D8JH 3REWA 2V7NA 5TPWL 5LVEA 4WFFE 5EU6E 5MP6L 5IB4B 3VD7A 3IGAB 2VH5H 2ADGB 3PWLA 4JJ5A 2UWEA 3CCHA 4RQQB 3T3PF 1KEMH 4RWYL 3D9AH 3OJVC 1KUMA 1A9BA 4JKWA 1ERNA 3O9WD 1Z9SA 4JJHA 3MSPA 1QHPA 3GUTB 1X5HA 5IFHL 5L6YH 3WCYA 3QQ3A 5T1LB 1MCRA 2J3SA 4LVHC 2YBRA 4M7JH 4NNYB 3L3GA 1UYWL 1MWAB 2NY3B 1XGQB 1UG9A 3PUCA 5JQ6H 3DVGB 5BRZB 4L9LC 1F6FB 5DRNB 4JB9L 3VFNA 1J8KA 2YRPA 1QHOA 2ZUQB 3PGDB 4IIQA 1JGLL 3U79A 2CXKA 4LEXH 5FYLD 5ICZB 3DJ9A 1NAKH 1AP2B 5HSFA 5MEND 5CSBA 1IC7L 5HHVL 4P4KD 4JQXC 3QXDA 1TZGL 2J88H 2LTQB 4YUEL 2OJEB 4KHXH 5DMJB 4JHAL 1JPTH 3BPOC 3OJMB 4JFFA 3OV6A 3IS1X 3B5GA 2R56H 4MDIA 3CMOH 3MA9H 4PLKD 4K3EL 1ZKAA 3D1MC 3TYGH 5I1GH 5C92A 2ZUUA 4H1LH 1RZIA 3PHQB 1NLDL 3O2DH 1AXTH 1I9IL 4PJXF 5BV7L 1B6DA 1LE5B 3QFDB 2AJYL 4P46B 1V7MH 2DKUA 5AZ2L 2R69L 4UV7H 4L4TB 3PL6D 1YPZF 4Q2ZB 3VH8B 2VE6A 4NWUL 2E7BA 3AAZA 3BH9B 4JO1L 3NAAH 1E6OL 1OT2A 2BVTA 5CEZH 4D0DA 5LGKA 1O0VA 4HMEA 3PWPB 4IOFD 1KXQE 1BAFL 5ALBH 3TEUA 1HN1A 5CEXA 2O26U 3ROLB 1CXIA 3QNZA 4XAKD 5D5MA 3OR6A 3JUZA 4YH6A 5E7BA 5MERA 5B8CC 3PP4H 1FN4A 4WO4D 1XR9A 2ZPKH 3FB7A 4WW1A 5GIRA 4JKKA 1QG3A 2D7MA 4OZIE 3GRWL 5B3JE 3MV9D 2ID5A 3P11L 3UAJC 5I76A 4JFDE 5D7LA 4EXPX 5EC2B 3TCLA 1I9RL 2YC1A 2YD4A 3FB8B 3RWCA 5T1LA 3DVNA 3HG1A 3G5VB 3T0EE 1LP9E 5EU6A 2Z8WC 1ZANH 3IXTB 5CZVH 1J1XL 2R1XB 3D69B 1X6LA 3U9UB 1CS6A 5FB8A 5D1XB 3C5ZA 3CFCL 3O3BA 2W38A 5C2UB 1YNTA 1ETZA 2D7QA 4ONGH 2W1NA 2IAMC 3EHBD 1ODAA 1FFOB 1NBYA 2EH8L 3FO0H 12E8L 5EOQH 5DURD 1YEFL 2DM3A 2WUCH 3HLAB 4L3ED 3SDXF 4O2EB 3V6OC 3QUKA 3CX5K 2R0ZH 3LS5L 5JXAH 4ZD3H 5HYIA 1J5OL 5CHNA 4XH2A 5M7QA 1MLBA 2HJKB 1MVFA 1XF4B 2MPAL 2VDMH 2EKSA 3P9MA 4NWTH 3WSQL 4Z77A 1QVOA 1YNKL 1KB5A 1OLZA 5SWQB 2EZ0C 4LIQH 1F4WL 2NY6C 1MHEB 2P45B 5KVMC 3UTSB 1FNHA 4F7TA 4LU5L 3DTXB 1HYSD 5JHLL 2GCYA 5DZLA 2L7JA 3VWKA 4LARL 2X7LA 3NCFB 4JM2D 3NZHH 1B0RA 2A6IB 3FMGL 4P2QD 3EZJB 2N7AA 1CQKA 4B53A 5C0CD 3WIFB 4M5YH 4M43L 3TH2T 1SEQH 1FZKA 5KOMC 3UYPA 1ORQB 5IMLB 2OK0L 2F74B 3GM0A 4NO0D 3BJ91 4UB0H 3ZL4H 4J3VA 1JL8A 3LN4A 2DJUA 1RMFL 1AQDB 1KFAH 4HXAH 3MOAL 3LQAL 3FRUA 4ETQB 4ORZC 5CUSL 2AJZB 4PJ7B 1RIHL 1OTTC 1A7PH 3HZVB 3KWWB 1IKFH 3QRGH 4XVUD 3TGXA 4OT1H 1KIUA 3UZQA 3BGMB 5AWNL 2R4RL 4ZSOE 2FO1A 1CDHA 3GJEA 5CCKH 2DQUL 5BJTA 1NH6A 5GS2H 1P4IL 5E8OB 1KPUA 4P9ML 4ODSH 4HJ0D 1ZSDA 3DUSB 1QO3A 3FONB 4KZEL 3TBWB 2GFBB 4LLYA 3B9KB 2FIKB 4PFEA 2WINA 3QIBB 3W2DL 1NPUA 4Y2DC 5FKAB 5FDWB 2IQ9L 3NCYS 3KYOB 3CX2A 3QWOA 3RWHB 4WW2C 1NFDB 3CDYA 2FBOJ 5GS1B 3KG5A 1S3KL 4IJ3C 5CEZD 1HKFA 2YPLD 3VXOA 2EO1A 3A67H 1VPOH 2NXZC 4OZIA 4KK9C 3TT3H 4WI7A 1NC2A 5DJ0A 4JRWA 3OAYH 3SDCA 2WIIA 3IETB 4GW1B 1CLOH 5FAAA 1CICB 1T1YA 4Y4FD 1T21A 3CK0H 3MXVH 3MRNB 4TTDD 3SDAD 4Z8FL 4FFYL 1DVFC 5EDXA 1U8HB 1CD0A 1UH4A 4WUUE 4F9PA 2JJSC 5EU4A 5ID1A 3T0EA 3ZO0A 3IFPB 3VXUE 4M93C 2N1KA 5I74B 1UKSA 1MIEL 4KKCC 2VDQH 4CADB 1JNNL 4L8CA 2HT2D 3LQMA 5GRYA 2ESVE 2GJ6E 4HJJL 2VAAA 1CK0L 2R0LL 2CXGA 4CU8A 4NT6B 1P7HL 3B3IA 4KK5D 2AJVL 4NZUH 4OI7A 1ZWIA 5FM8A 2HH0H 4JFOB 3RWFA 5E8DL 3HR5B 2F74A 1F58L 2ILLA 1X5JA 3W0WB 5D4QA 3SCMD 1WAAE 1N6UA 5FO8B 1E4WH 2JB5H 5E2WL 2VN7A 4Q9RL 3H7LA 3U0TB 5BVPL 1KIQB 1QNZH 5LCVH 5CP7A 1HWGB 1TNMA 2XFXA 5IVXF 4BH8B 3E6FA 3MA7A 3O2WH 3QCTH 5INCA 1LK3H 3X14B 3KYKL 2PYFB 4HH8A 2QHRH 2OM5A 4Y5VA 4P5TD 1QSEB 3C6SA 3MROB 2HN7A 2P4AB 1FGNL 1FBIL 3BQUC 1IM9D 5D7KE 3IDGB 1QEWA 1BFSA 2A74B 1MPAL 3R8BB 4JREC 5FM5M 3N85L 2WIMA 5ECJE 1FE8H 1U3HB 4XNYH 5A43C 4H88H 4YFEA 3D2UA 1AQKH 4NKDA 4CW1B 1I8LA 2C3XA 2NY5C 4HS8L 4P9HH 2VXUH 2I60H 2Z91A 1CT8A 1KJ2B 3I02A 3KYAA 1TCRB 4GQPH 4JFEE 1SVZA 3MRFB 3NIFE 4ZSOA 3ZKND 3QIUD 1OSPH 2X4OA 1N5YH 5ESQB 4GRMB 1A5FH 5DR5L 1X6NA 4N68A 1FORL 2QQKH 4KQ3H 1MCQA 1OB1A 4Q58C 5HDQH 4L8SA 1PSKH 2UY7A 3RVUD 4KY1L 5F8QC 4I0CC 3G9VA 4HCRH 3K0WA 4P99A 3MJ8B 3N9GH 4Q6IB 3ILPA 5TGBB 1M71A 2X4PA 2NQCA 3DV6A 3W5NA 5DTFB 4PJDB 3BHBA 4UAOC 5FA3B 4OLXH 1N64H 3I3BA 2Z93A 5EUKA 1T1ZA 1FYHB 5GGRA 1RUQL 3MLZL 1FP5A 3QFJB 1JNHB 3HA0A 3WUWA 4JDVB 1MQKH 4LSTL 5F89A 4QHLA 3L5JA 3QUXB 3OXSB 1RU9H 1J8HD 1G7QB 3VA6A 3FCTA 4D0BA 4JY4B 4M8QA 1OGAB 4WUUA 5AZEL 1AC6A 5ESAB 2ADFH 1JGDB 4J3TA 2IF7A 5DMKA 3WEXA 3PJSB 1YMHA 3VXUA 3VXRB 5CGMA 5D7JC 5IQ9B 2LU4A 2H6PB 1HEZA 5ITBH 4LLMB 4LSSL 3L9RA 1MRDL 1HZHH 2ARWA 2ESVA 3WNMA 2GJ6A 3QQNA 1RULL 3GSQA 4XMLL 2P1YA 2QSCH 1RUPH 5CP3H 4OZHF 5D7SH 2QADD 4X7DC 1Z5LB 1I9JL 5GS3A 5IHZB 1JPFA 3S34L 4UNUA 1H9VA 3IDIB 3GSUA 5DSCA 3H3BC 4RFNC 3ZDZF 2YWZA 2VB5A 4LHUB 5C0IA 1RURL 2VDOH 4ZUWB 3MRRA 1WAAA 2PN5A 4OCNC 2HFTA 4MD4A 1OW0C 4U1MA 5EBGA 5MEOA 4Y4KA 1IGML 1VGKB 2DQHL 3VCLB 1X9QA 2DLGA 2EDEA 4WHDA 5C08B 3LS4L 2FR4B 1N3NA 2IALB 3WO3B 4CW1A 4K8RH 4GRWE 5SX4I 4IHOB 4OFDA 2VR4A 1NEZA 4OLWH 4ZTOL 4KQ4L 5DRZB 4EUPB 2EYSB 1MLCA 2BVEA 1AE6L 4BFGA 2H3NB 5C9JB 3JV5A 4HC1A 5BS0E 3ARFA 3KPMB 1I7RA 4WENB 4O9HL 1GOHA 3FQUA 4P5MA 1WV7T 1I8IB 3KPOB 3M1BA 2X1QA 3MRHB 2CIIB 4PJGB 1ACYL 1I3VA 1S9VB 1S7UB 3QUYD 1SVCP 4WI8A 1TPXC 3RHWF 2X2YA 1EZVX 3GIZL 1WEJL 1ZS8B 2V5TA 4OAWB 5FYKE 5DUPH 1KPRB 3ARWA 3MBEC 3VGAC 1M05B 4G8IB 1UXWB 4PGCA 3CVHB 3U30C 4C83B 3PQYB 4AMKH 1DBMH 2JK5B 3NN8A 1OL0A 5IT2L 3OKOB 4X98B 1I7UA 3I6LE 4JFEA 1AI1H 4FQXB 4ODVH 3ZTNL 4Z7NE 3MNWA 5EOCH 4RMSA 1ZLUK 3S36X 4ZG1A 1RZJL 2L4OA 4NN6C 3QUXA 4XPBL 1A6VH 1PVHA 5IW1A 1TTFA 4XNXH 4QRTA 5DK3A 1LO3H 4JFHE 1G7QA 3P4OA 1P9MC 2AGJL 3GSOB 5B4MD 4P3WA 3S3SA 3ARBC 1UM6L 3DSFL 4U1HA 4NCC1 3BIKB 5HYJD 1E28B 4HUKB 5IQ9A 2WMPA 5J8OA 5F3BA 2FL5A 3P73A 5DMIL 2O5ZL 4OIIH 4F57H 4N8VB 1HOCA 5SWSE 1A47A 4HS3B 1BQLH 4Z18A 1CFBA 3OKKA 4I18A 2OMBA 4X4XA 4DK3A 3KPPB 1T3FA 1MFAL 1KCRL 1BFVL 3O6FB 2PTTB 5KSBF 2V9RA 1GGCL 2NX5B 3NPSC 5IHZA 1A1NA 1YEHH 5CD5D 2A73B 2G2RB 4LLDB 4FA8A 1FZMB 4Y5YC 3BT2H 4ZTPL 2ZUTA 2DTML 4TVPE 1C5DB 2DYPD 2F54B 4APQC 8FABA 3EYVA 1EO8L 5H94B 4RGNE 4FQHB 4QTHB 4PGJA 1D9KD 3OKDB 5C2BH 5FYJU 2OSLB 5D2LF 1FLRL 3FO1B 1XGUB 5T3ZH 5E6YA 3TO2B 2A6JB 2CLZA 2CMRH 5FF6A 1R3KB 4JEGB 4K7PL 1TFHA 1A6WL 1LO2H 3ORJA 4F15C 5GGRY 2FBJH 2FHBA 3GSXB 3ZT5A 1ITCA 3OR7A 3PWNB 4GBXA 2CJUH 1KENH 4RX4D 5E2VL 4N9GB 3SKUD 3T4YA 1Q1JL 4FZEL 4OAWA 3TM6A 3PV7A 5HYEA 1FL3A 4ORGA 3QIWA 4JM4L 4HUVA 4JPIA 3IU4L 2P5WB 2YUZA 2ICES 3MR9B 5F7DA 4H20H 4PJ8D 4U7MA 3LPWA 2HA1A 3PQYA 3FOLA 4OV5B 3G04B 4AEEA 5F72S 3WFBH 5BS0A 1WCQA 3X13A 2NY7L 1PG7H 1ZT1A 2A0LC 5E6ID 3MBXL 2ICWA 4YWGH 4PUBL 1DLFL 2UUDH 1E4KC 5DJDA 5IHUL 1GGBL 5H37G 1KXVC 4O2CA 5FGBC 2ICWI 4JFXB 2OJZL 1ZVSA 2VXVL 2JB6A 4KVCL 3MRIA 3O6ML 4X8JA 4LCCA 4YHNB 2WZPD 4UTAL 4JN2B 3HI6H 1FO0L 3L7FA 3T08A 1ZHBB 3CZFB 3EOBB 4XP9H 2WM0A 2NW3A 1Z9MA 1EZVY 2EE9A 5I1KL 1LEGA 4HH9B 1YY8A 3F5WB 4OZGB 2YKLL 5ALCL 3LDBB 5D2NB 3TBSB 5J9PB 1XF5B 1LEIB 3PXHA 1PZUB 1AIFA 1XFPA 4KKLC 1A21A 4HPYH 4PJ9D 2NX5A 5F71A 3GHEL 3UTOA 4QRPB 3C09B 4P57B 4JZJB 1T6WA 5DT1L 1IAKB 2CR6A 2Y5TB 5A3ID 4XC1H 3RY6C 2LE9A 1L7IL 1AGEB 3MGAA 1ZLVK 1G7PB 4O51B 5SWSA 2RJMA 2DQCH 4XP6L 1JZ5A 5TQ0H 3BZDA 2V9QA 2X4SB 3BGFC 3WL9B 5CS7A 1TCMA 2OSLA 4HF5H 5GZOD 5EORL 1SY6A 1N59A 1U8NB 1CLYL 4HKJA 3IDXL 3QNYA 2F19L 1YEGH 3D3VD 4NSKB 4BUHA 3VFPA 1A3QA 1G9EA 5DFWH 5I75B 4R0LB 1NQBA 1OAUH 3IXAB 3GSXA 4IRSD 3DXAE 4PTTB 5J12B 2ADJA 1NCUA 5IBLD 3O9WC 3PNWA 2FGWL 2DQJH 5C8JB 5IKCA 1BQSA 2BY0A 5EPMB 4M9OA 4ELMB 5HHOE 3V0WL 3BDYH 1H8SA 4ZAKA 3RZCC 3VXPB 3EO0A 4RAVB 4QXTA 3RWIB 3RFZC 3EYOB 4PJFE 2JJVA 2PW1B 1EFXD 5B39B 3B9AA 2RCSH 1NGPH 1WSST 1EO7A 4MLIA 1CXHA 1ZMYA 2GJJA 4NN7B 4UDUA 4KUZH 4QRRB 4R97B 1VEMA 2Y6SD 4MB5A 3CFJB 1C16B 1A7QH 4FP8H 2MOVA 3VG9B 4C56B 2D7TH 3BD5A 1D5BB 2Y5EA 4X6BA 4FQJH 5HHPA 2Q3ZA 2OZ4H 4U33A 4P4KC 1ZEAL 3BXNA 1BX2B 3IT8D 4YQXL 3SGKC 2GQHA 2X42A 1CFNB 3S8WA 1QRNE 4HGKC 5JNYA 2OTUB 1TZIA 2DI8A 4GMTL 4PLKC 4XPFH 3TN0C 2WBJD 3ZE2F 2HKHL 3D85A 3GZKA 4OGAC 3V8OA 4KHTL 5J9PA 1VFUA 2UVFA 4HIEA 4Q9QL 4AIZB 1YEEL 1IKNC 1F90H 3QO0A 2R0KH 4LRNL 3RWJB 3V4UL 1U8MA 2NY0D 2Z92B 1VADA 4RFOH 1YYLH 4LSUL 2NY2C 5BQ7B 1PW3A 2A6KB 5EO0A 5GGUB 1II4E 1AR1C 4YGAB 5HGAA 3TCXA 4UILH 5IEKB 4OTXH 5FECA 2HRPH 3C6LB 1HCVA 1INDH 2J6EH 3TH3T 3ZDXF 4CMHC 2NR6D 2H32A 5INDB 4LCWD 4WGVB 3V6FB 3OKLB 1JHLH 5ILTH 2PYEE 3MV11 5DEZA 3TO4D 5I1AB 4OI8A 1S8DB 4FQIL 5C0RL 1DE4B 4DN3L 3UZEA 2IFFH 4RFEA 1S7SB 1BVLB 1UVQB 4QYOB 2AKRA 5EUOE