1RU9H

Crystal structure (a) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected in-house.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9H01
3HB3C 3TLRA 3VGEA 1Y6KR 4CAGA 5IBLC 4M43L 1LO3L 4FQIH 4WHCA 1MI5B 4IRSA 5KVEH 3Q3GB 5ETUA 4RFNB 2Y5TB 4LVNC 5J89A 3HNTL 5F89A 5EZLA 4FZEH 3GO1L 1QBLL 4WO4C 3F58H 4Y2OA 4P23B 1A7QL 1G7MB 1EAJA 1N5YH 1NAKL 4M6OL 3I84A 5J7CC 2L7UA 1IC5L 1R5WB 1KIRA 3L7EA 3VFGH 5DR5L 5T1KB 4AL8L 3H7LA 1L0YA 1AHWC 2XNAA 3H9YA 1ZT4B 1RFDL 2FGZA 12E8L 3SDXB 3AMKA 5J6HA 4OZFB 4HJJL 3GSQB 5K9OB 5IMMA 3OHXA 1VACB 4ENED 2I9LB 3L3DB 5KSBF 2AAVA 4F33B 3MLUL 1PZ5A 3QB7C 4KHXL 1U95B 1MVUB 1JCKA 5HVGB 2CLRB 3RY6C 3WFHB 2NY2D 4PJHB 5CIPH 3FTGA 4XCEA 5T5NG 4NFDA 3UYPA 5IVXA 1U8NA 1UH4A 3IU4H 3NACH 1ZLUK 1QSEE 4L8SC 2NXZD 5EO0A 4POYA 1BFSA 5HI5C 1KPRA 5JXEC 3VXUA 3S88L 3RP1A 4CJ0A 4Y4HC 2AXFA 3CLEH 2XWBA 1AGFB 4GW1A 5KTEL 1MHCB 1S8DA 1FN4B 4DAGL 5F7NC 5C2BL 2AJSL 3PWUB 3QDGE 4PGCB 5I16B 1G7QB 5BV7H 3MRGA 1DFBH 1KB5H 3ZTNH 1TQCB 3P40A 4WDIA 1IC7L 2J8UB 2E9BA 3J7HA 4NN5B 5FB8A 2W9DH 1UYWH 5TE7H 3G9AB 2D7PA 2MQ3A 1SMAA 2VZ3A 4OGZA 1XR9A 5DFWH 3QDAA 2L0DA 5KJRH 2JJVA 1D9KC 1JWSB 2NY6D 1QQDA 5C0GA 1I7RA 2LQRA 1SYVB 3OGCA 5A16A 3LPFA 4LDEB 3BPNB 1JGDB 3MACL 4GAYA 5KVGH 1WBXB 1KLFA 3CFJA 3WSQL 4XPBL 1HOCB 4F57H 4PJCE 2P5WA 1MCNA 1FYTE 3GIZH 4QOKA 1HHJA 2B1HL 5FO9B 1BM3L 2A9NH 3QNXA 4M1GL 4W4OA 4Y4FA 2X1WL 1EH9A 4PJIE 3QPQC 5CGTA 4JQXC 3GNML 4JPWL 5ICZB 4AIOA 3TO4D 3DV4B 4X7TB 5CJOL 3P4OA 3NMEA 3IAQA 1RIHH 4NN6B 4XBPA 4K3DH 5J8OA 4XRCA 1EO7A 3MO1A 1HQRB 4WIQA 4LGRB 4N0YL 1I8IB 4LCUB 3TP4A 1T03H 4NP4L 3X17A 3BQUC 2MPAH 4W70A 1C5CL 2NMSA 1J8HD 5E2VH 1VKXA 3PGCA 1N59A 4XTRC 3BD3A 3FB5A 3VFRA 4XGZA 3F7VA 4IHOB 4LAQH 2XKNB 5CHNB 1SHMA 3UYRH 5KSBA 1M7XA 4EBQL 1I9RL 1S7SA 4YXKL 4Z7WF 4AEIL 4U1NA 1HNFA 4PBWD 1K2DA 4LSSL 3V79C 1NCBH 4ELME 1N3NB 5IGXL 1RD6A 2CK0H 5D93B 1S7VB 3WS6A 1FFNA 1MCLA 3ARFA 3C60B 3UZVB 2CXGA 2YBRB 5IHUL 1K85A 1LEIA 3T0EE 4W6YB 1FBIH 2GEEA 2NR6C 3K1KC 4KK9C 1JWUA 2CRYA 2IPUK 5DS8A 3BUYB 3KYKL 4CMHB 3CAFA 2FNBA 2FWOB 1A6PA 3U46A 1FZKB 5K93A 4UV4H 2J8OA 3MRMA 4NNXA 1QLRB 2AGJL 4UQ2B 2M1KA 1MJUH 4XZUA 4ZPVB 1WFTA 1ES0A 4NN7B 4PD4K 3TO2A 4PS4L 1I8KB 4HKXB 4C4KO 2H9GB 3VXUD 3W2DH 1F97A 2NNAB 4LLWB 2BNQA 4U7KA 4YEEA 5SWZE 4XCCL 4P46B 2DLHA 3ARWA 1R3LB 2DQJH 1QNZL 3R0NA 2I5YH 5DVKA 1BLNB 3PGDA 2V5TA 5DHYB 2YPVL 4D0CB 2V2XB 1NLDL 4NZUH 3VE0B 2O5ZH 1SM3L 5GHWL 4JRYB 4PJ9A 4U6VH 1GHFL 5HY9B 3DVGB 3LH2H 5T33H 1EMTL 1DLHA 4OCWL 1TENA 2PO6B 1NUNB 1KLGB 5DHVH 1G9MH 1CZ8L 1UXSA 4MS8D 4PJAE 2Y06L 2ZUQC 4PLKC 3WNOA 3H7BB 5IFHL 5KW9L 3IU3B 3KPNB 3QUXB 3MYZA 4X4MA 5C0IA 2VDNH 1CN4A 3QIWB 4X9FA 5KS9B 4G9FA 4DVRL 3KLHC 3GI8H 2PNDA 1Q72L 3O45B 3IDJB 3QZWA 3LEVL 2EDEA 3U7YH 5EBMA 1DUZA 1O0VA 2ICES 3WNNA 1AR1D 4RAUB 4QOKD 5B39G 4G3YH 1DDHA 4LRIC 4Y4FD 3U79A 4TSCH 4NOFA 1I1CA 3PF2A 5H35A 4OLYL 3QPXL 5DC0A 3NN8A 4NO5A 2XZZA 3QSKB 2X4TB 4YHYC 3EYVA 1EEZB 2XZQH 4Y19A 1MY5A 2OR7A 3VXMB 3HLAB 4WUUB 1WT5C 1H3TA 1IGFH 1TETL 5F1IB 1S3KL 4YXHH 4M93B 4LCWB 2HT4C 4U1GB 4UINL 1F13A 3W0WA 4DN4L 4MB3A 1FNLA 3GSXA 4Z7WA 3VFVB 2E27L 3QCVH 4OD3H 3QIBA 5HYQA 1JZ4A 4HWBH 4FXKA 1QG3A 4Z7OE 3AS3A 3LQAC 4ZFZB 3MFFB 1JF1A 1FNSH 1T83C 2V5YA 1XGRA 2JE8A 2VERN 2BY1A 2VISB 1YMMB 4OT1H 3O8XA 4N0UE 1VADB 2FX8H 1NAML 3CC5A 4OLUH 5B4MC 2Y36H 2ADJB 2WAHA 3NPZB 4MJ5B 4PFEA 1IQDB 4NC1C 4PG2A 3M1BB 1IGYA 1NGZA 4CGTA 4U1HA 3O6KH 3GSRB 4E41B 1YN7A 2FEEL 2DLGA 2IEPA 1BPVA 1HINH 3S37L 4V1DE 3WUZA 3ARFD 5DJCB 4QF1B 5EOCJ 4N8VG 4AMKH 1H3VA 3PNWA 2R39A 4NQTA 4I3RH 3PJSA 4XNYH 3CK0L 3W39A 5KZCD 1INEL 2A1WL 5DWUL 3UJJH 3V4UL 3WLWD 3VCLB 3P4MA 3VRLF 2VE6A 3BPLC 2P8LA 1ZT7A 4BSVA 1BJMA 4NRYB 3HR5B 2CRMA 1LO4L 3WUWG 1LO0L 2CDFB 1U0QA 4I3SH 4HPYL 5JW3L 2IQ9L 4HW6A 2ZG3A 2BNQD 3RWEA 3MROB 5GSRB 1BFOB 2DQDL 4AIZB 2AJUH 5GRJL 4YHIB 2MCPH 3QAZB 3U2SB 1MCPL 3OKLB 5JNYA 4LOUC 3QWRA 3VGBA 4X99A 1YY9D 4DKFH 5L2JB 4JM2C 1BREA 2O5XL 4PJ9D 4HULB 4ZSOB 1ZWIB 4HIXH 3QFDB 1MFAL 4LSTL 3VXTB 4OFYD 3LMJL 5F7UA 3RGVC 5D2LA 2NY2B 5I8EB 4P5MB 4HF5L 4PGEB 1BECA 4GAJL 4ZDHB 2Q6WA 4L8BA 1DE4A 3GHBH 5DD3L 5BJTA 3GSNL 2D03L 1XIWD 3HC4L 2XWTB 2NXZB 2EDBA 4P2RE 2OL3A 3RWDB 1MCEA 1MJ7L 2VDKH 4M1DL 5D9SA 5IFJA 2R69H 3G08B 3VFSA 3BZEB 1F58L 5D5MF 2GTZA 4MJ2A 3BQUA 3IJSA 4WNQA 2DWDA 3GSWB 4MVBD 1E6JL 4TUOA 5BOZG 4ORZC 2CK2A 2XKSA 4HCRH 2FO4A 5D1ZA 1RZ7H 4C58B 4YHNB 4Y19D 5EU3B 3PWJA 5B8CC 3PP4L 3TBTA 4XMKH 3RKDC 4GAFB 3ARZA 4RMUA 3AB0C 4U1SA 2CLVB 2P24A 3DUSA 1FV1A 3QIBD 2GITB 4MYWB 1R5VA 1FE8H 2C4FT 3QT2A 2NY6B 1FO0L 4U05A 1WFNA 2DJUA 4LFHD 1H9VA 1IC4L 3MJ8B 3HA0A 3ULVF 5D7KE 2ZUUA 3MA9H 3O8XD 4NKOB 3EOBA 3TA3C 2R8SL 4J1UA 1ZLSL 5T1DL 3CZJA 3EKCA 4ZTPL 4AEHH 4HLZH 2VR5A 4X7DC 5F9DC 3ZE1F 3B83A 2M8XA 3MNVA 1TJHL 3G5YA 3SPVB 5K9JL 5E99L 4LNVA 4YQXH 4N1EA 4NKDA 4WV1A 4ONOA 4QHLA 5IWLC 1LGVA 1XCQA 3BKJH 4PB9H 3LEXB 4PJDB 4MXWH 3QG6A 1MRCL 4B7IA 2AVGA 3OAUL 2YXFA 3GI9H 4XNXH 2APTA 4LLMB 4P4KB 1H3UA 4BFBD 4GLRH 5GS0L 3EO1B 2EDKA 4YWGH 1JHKL 4UILL 1J8HB 5ETUB 3REVA 4FFWD 1KN2L 1UKSA 5DRXB 5EZLB 2W0KA 1YUHB 3UO1H 1ULVA 4DW2H 2M26A 1OT1A 2DLIA 3BPOC 3T3MF 5I1DA 5JLZA 3BUTA 4EOWL 1HZHL 4QRUB 3QISA 2WUCH 4R4FH 4Z7VF 5F8QC 4JGUA 5FO7A 3L7EB 1P4BH 2VZOA 2DQCH 1CD0A 2JJTA 3QWRD 2K3TA 4BKLA 5D2NB 3HPLA 5J6HB 5D7JA 3O41A 5IMMB 3OHXB 2FL5A 4FFVC 1VA9A 4O00A 4N5UA 1YZZA 3DGGA 1TIUA 3TV3H 1PZ5B 1BWMA 4YBQC 4S0TD 3DECA 3MC0A 3ARVA 2EC9U 1YJDL 3VXNA 5KVDH 4Y5VC 4GH7B 2EECA 1ND0A 3B3IB 4X6DF 3S6CA 1Q9WA 3CMGA 4HT1L 5D5MA 5GGTA 4ONGH 3FTGB 4XCEB 1AY1L 3S4SG 1LP9F 3I3EA 5IVXB 3VH8A 2ZCHL 4FN0A 4R0LC 5MEQA 2AV7A 4U6XA 1QBML 4S1DC 5F7KC 4MB5A 4FQ2L 5EO0B 4P0DA 1DANT 1T7YA 3HRZA 3REWB 3BKML 1J12A 4ZUTB 3VXUB 4GUPA 1IEHA 2HG5B 2X41A 3FHQA 3KPPA 3TEUA 4E42B 2AXFB 1RUML 2XWBB 3O81A 4L8CA 1MIMH 2DQTL 3BQUD 4GW1B 5FV1L 5TE4L 4NQDA 1YQVH 4OZ4B 4G5ZL 3C9NA 2Y23A 1NGWB 3Q2CA 3HNVH 5D1ZD 3RDTB 5KN5B 1U36A 3VXPB 2I07B 1KOAA 3TGXA 5ADOH 4WDIB 1YNKL 1I1FA 2YA0A 2NY4C 4OZGF 4LKXA 4O51A 5FB8B 4NO2A 1MCOL 1DBBH 4HZAA 2C9AA 1B90A 4XPAL 5T5FL 4F9PA 5HDBE 3N85L 4PTUA 1TCRB 3GHEL 2R23A 3KWWA 3WCYA 1CD9B 1QQDB 5C0GB 3KPLA 4AYFA 2BFVH 1I7RB 4HV8A 1DQJA 1IGML 3RPIA 2UY6A 2JTDA 4V2BA 1U8PA 4JG0H 5LAXA 2EE9A 4GAYB 2WLZA 2R2CA 2FSEA 3CFJB 4FFYH 3SE4C 4KK9D 4KMTH 4Q0XH 5IEKA 3BZ4A 2FH8A 2DI8A 1RZGA 4O4YL 4F7CA 3ZYOA 4QOKB 4DGYH 2JIXD 3SY0A 4Y4FB 3NZHL 4S1QH 5J1SC 1EFQA 1V7ML 3JTSB 3MODL 2F58L 3OKMB 4QGTA 3NAAL 5AZEH 3NFSH 1PBYA 2QR0A 3DSFH 4U1MA 2H32H 3MO1B 1NCCH 3T1WA 4MNQA 1XF1A 4Z7VA 5DHXB 4D9LL 5F9OL 3CFCL 4ZS6D 2P43B 3LKNA 4IDJH 4OD1L 2FBJL 3HFML 1VKXB 4WI4A 3RL1A 3PGCB 1N59B 5C6WH 2GK2A 4IS6B 3IKKA 1Q0YL 1UCTA 2P5WE 4EKXA 1RJZA 4TTDC 3VFRB 5KBNC 2R4RH 4XGZB 5D1QC 4HUKB 1KYOJ 1XF2A 5KSBB 5CSBA 3IJYA 3RWHA 1QEWB 4QTIH 4RCAA 3LB6D 4F9LA 1ZTXL 5I74B 3RGVA 1K2DB 4Y5YC 2HTLD 5F21B 4X6DA 1BVLA 4DKDC 5BVPL 3P77B 4KXZH 3C6LC 1V7NH 4JB9H 3D3VA 3ARFB 5D7JD 1LP9A 3DBXA 5DMGC 1HKLH 2VZVA 5L6YH 3LEYH 1UJ3C 4QHUA 3GSOB 1DBKH 3FB7A 4OUUA 1LEIB 2MQCA 3AM8C 2Y07L 1JWUB 5F3HA 2VITB 3NCMA 3ZKND 2XFXA 2NY0D 5KZCB 5DC9B 4OBRA 4XP1H 2EYSA 5KVMC 1D3CA 4AQOA 2C4XA 3U46B 3U7AA 5B22A 3MRMB 4NNXB 4YE4L 1AXSA 2XXCB 3CVHL 4D9RD 1JYWA 3VFPA 4XZUB 1MVFA 2VQ1B 1ES0B 5DVLA 1S9KC 3TO2B 1GYAA 3ULUE 3VGHA 2B4CH 3LPGA 4HK3N 4JPVH 2HJFA 3ZKMD 4RNRA 2BNQB 3MA7A 1MJ8L 1D6EB 1J9CT 4CVXA 4LKCA 1J18A 1B2WH 3EYSL 4NQDD 1JPGA 3IRPX 3K2MC 2YWYA 4C4KT 1HSAA 1RIUL 2C1PB 3C2SA 4KAQH 5JHLH 1YEHH 3CDCA 3MJ9L 3MRRA 3H8NA 1DLHB 3B5GA 4UZGA 4XNUL 3EJYC 4P57A 3OZ9L 3UPCA 4U1KA 4AIXA 2EDXA 2W59A 4O58H 1UXSB 1JHLH 5AZ2H 1FVCB 4LDLB 1CE1H 3OJ2C 1DQLL 4MDJA 1QOKA 1EGJA 1I3VA 4WWID 5EFIA 1AGDB 1MPAL 2ERJB 1ZOXA 5BMFH 1XIWB 4M7LT 4OCLC 5C0IB 5J13B 4R8WL 5KSVA 2OZ4A 2PYEE 2KPNA 5ESQA 2OBGA 4D0DB 3QZWB 1NCNA 5EBLB 1X5GA 5EBMB 5TE6H 1DUZB 1VGEL 4JHZA 3VRJB 1YDPA 3P0YH 1FFOB 4ZODA 1DDHB 2RR3A 2DJ4A 3EYUH 3BKYH 5H35B 2P7TB 3QQ3A 4C59B 1JTPA 3JUZA 4QHMA 4WI9A 3V8OA 4BQ9A 3NN8B 4NO5B 1KLUA 4M03A 3EYVB 5C0FB 4Y19B 5ITFA 3B8SA 3CZFA 4U3XA 5GS3A 1I1AA 1ED3A 1AD9A 4MNQD 2YXMA 5DI8A 4JN1L 5F6HJ 5EC2A 3GSXB 5D6CA 4G9FE 1V3LA 5HVHB 5HYQB 3VGAB 3DI3B 2ARJA 4FXKB 1JFQH 3S98A 4LOUD 2I9TA 5CUSH 1GGIH 2YKLL 5EU7E 3CUPA 5HHMD 1XGRB 3ORJA 5FCUH 4HKJA 5C92A 2XV6B 2DM7A 3O8XB 5HI3C 1CG9A 3T09A 3LRHA 2PXYA 4S1SL 4KK6D 2VIRA 1LO5B 2Y25A 3ILPA 3ZDYF 4ERSH 5AWNL 3TM6A 1RURL 4U1HB 1B88A 2UYLA 1GL4B 4RFOL 3IAPA 1LK3L 3RGVD 3UCRA 2FD6L 1YN7B 4ZQKA 3C08L 3IFLH 4K8RL 4G6JL 3T2PA 1R3HA 2YD3A 3C5ZC 3D3VD 1BIHA 3OR6B 5K9QG 1FL6B 2IG2L 3W0WE 1B0GA 1RUAH 4Z7WE 2IBZY 3ZTJG 1GSMA 2Z35A 1ZLWH 1J0JA 3G5ZA 4C57C 3ARXA 3PJSB 4BH8B 1NLBH 3QXDA 4LBEA 4CN6A 3QXWA 1UB6B 1G6RH 1MAKA 3LN9A 4JDVA 3OMZA 3SDAC 3P4MB 2ITCA 1DL7L 1VGKA 3VXOA 2VE6B 3LN5A 2P8LB 4XAWL 1ZT7B 4BSVB 3S3PA 2X9XA 3BGAA 2DB8A 5I71C 2HMIC 2QSQA 4OQ1A 4HUUA 5LGJB 1NEZB 5JOPD 3FOMB 3I6LD 4AG4H 3HE6A 3QCTL 3QUMA 1QYGH 2RBLA 3V6BR 5I1LB 2DF3A 5F44A 5ISZE 4M8VA 1JPTL 1D9KB 5EORH 2VABB 4X99B 4RAVA 3MYJA 2YR3A 2WK2A 5T3XH 1DUYA 1I7ZA 5D7LE 4FQ1L 4DJMA 1LDPH 1OL0A 2XPGA 4YPJA 4TPRH 3MRIA 4HKZA 5DMYA 1EZVX 4GAGH 5D2LB 2GJ6B 3AREC 4MD0A 1XF3A 2BC4A 4XVTL 2GY5A 2PTVA 2F54B 5DJ0A 4L8BB 2Q6WB 3O2VL 5BJTB 2VL5A 3QRGL 5BW7C 3MCKA 5HHNA 1UG9A 3WXWL 2X40A 3UJIL 5C7XH 1U9KA 1NFIA 2A77L 3R06B 4ZG1A 2AXGB 4KTDH 3MLRL 1F4HA 5D9SB 4FQPA 5IFJB 2XQBL 4GW5A 3VFSB 3IDUA 1MOEA 3ARPA 1W72H 5HHVH 3ZT7A 5B38G 5FHAH 1ITBB 3WL9A 3AVEA 3GM0A 3BWUC 5E6YA 5A3ID 1T66D 2AABL 1A4KB 3TJHD 3BQUB 3W5MA 4WNQB 2DWDB 4KRNA 1DBAL 4CKVX 5J57B 2FO4B 2OP4L 3CSYB 5F7DA 3NABL 3DRQB 3INUH 3LKOA 3AAZA 3TBTB 2V2WA 4JZJC 4M6ML 3QFJA 1NL0H 4FABL 4MAYA 5E5UB 1I1AD 1CBVH 4YIQB 2VXTH 1PW3A 2DAVA 4U1SB 4H0HB 1UENA 4ODUA 4YBHA 2IJ0C 3KJ4B 1RZIA 2XZAH 2V9RA 5CP7A 5EIIB 2EH7L 3QHFL 2CO6B 4G7YH 2P46B 4YHML 3V5KA 3EOBB 1OW0A 1PEWA 2XI9A 3QQ9C 2AEPL 2WNGA 2YPKA 4XXCC 2Q8AH 3A0OA 4YBQD 2A73A 5I1CH 1KJ2L 1UZ6F 3GK8H 3IETA 5B21A 1YJDC 3MV9A 1WTLA 1SEQH 1K9TA 2JIXB 1UWXH 3LIZL 2BJML 4FG6C 3I3BA 5JIPA 3BDXA 1JGEA 4NKDB 3HI5L 4WV1B 3RWCB 4QHLB 1E6OL 1EJOH 5IESH 3S3SA 4OGXL 1NEZG 3EYFA 3QG6B 2BVPA 5JOEA 3C09B 2PR4L 2AEQH 3EJZC 4NHCL 4XB8A 1JZ8A 1IBGH 2EC8A 2H1PH 3BEWA 3IDYC 3GMLA 5IUSA 1DZBA 1XCTA 1H8OA 4HX1B 4WTWA 5JHDA 4XPFL 4ALAL 4Y2DC 4M62H 1EX0A 5EO9A 1BFTA 2P5EB 3PV6A 3O6ML 4NZRH 3ARUA 5DGRA 3PWNB 4XNQA 1MCWM 5JW4Q 3S96A 2IANA 1A3RH 1A6ZB 1MEXH 3I85A 2EDHA 4OIIL 3HI6L 2HN7A 4JY5H 1I85C 3MOAH 3K2UH 3QH3A 5J56B 4XMPL 5FO7B 1NAMA 1CGYA 3WHXA 3HE6D 3T77A 1CD1B 4BKLB 3HPLB 5F1NA 3ARQA 2FJGA 3O41B 1FVDA 2HP4A 2G5BA 5I1AA 3B5TA 4RX4A 3SGKC 1MJJA 3BJLA 2BVUA 1P7HL 3DGGB 5EOQL 1FNFA 3VXNB 3ARTA 4PJXE 2NY0B 1ND0B 43CAB 4I0PC 4Z7QE 1Q9WB 3OAYK 2P49B 2IPTL 3MV7E 5D5MB 2YN5A 5HI4D 3A67H 5DUMH 1JVKA 1H0DA 3WN5A 1YC7A 4NWUL 3EYQD 2UV3A 5MEQB 1SY6H 4NKMA 2AV7B 1RULL 1DQDH 3FFCA 4XC3H 2ZCKH 4O02H 3AXLA 4QRPB 1HE7A 4J6RH 1F3DH 1DFBL 1KB5L 3KPPB 1L7IL 3KPQA 5DRZA 5FCSH 4Q74A 4L8CB 3ZL4H 1QR4A 4NCDA 3MOBH 4NQDB 2AJZA 4N0CC 3C9NB 3WFBH 5I19L 3QWOA 4S1RL 4HBCH 5HHXL 1BFVL 1GRWA 3SE3C 3BIBX 5EOCL 4LQFH 5LKNA 1I3RB 1UWXK 5L0QC 3EHBC 1I1FB 2ZKHH 5IG7A 3QFJD 4MAYD 1JPSL 3RU8H 5ICYA 2C3WA 2AXHA 4YAQA 4PTUB 1KIUA 2B0SH 5CILL 4J3TA 5KVGL 2R23B 3KWWB 2CH8A 4LHUG 3KPLB 1QBBA 4KTEH 3SDXE 5J0BA 1CXEA 4HV8B 1DQJB 4M48H 1OGTB 2EDQA 3H9SA 3MBEA 5F7MC 3RPIB 5HHOA 2K1MA 3W11D 1A4JA 1U8PB 1QBAA 5LAXB 1N6QL 2KQMA 3SGEI 3B8YA 3N1GC 3AFLA 4MCZB 2YS4A 3BZ4B 2P42B 3PUCA 4LLYA 4U31A 2OTWB 3P9LA 1RZGB 4F15B 4F7CB 3ULUH 3IXTA 3ULVE 1D6VH 3SY0B 2XTJE 5KG9A 2VUYA 3JVGC 4X9GA 3SCMC 1RUPH 2OXGA 3J8F7 4HS8L 3HAEA 1YN6A 5IEHA 5CEXA 2HT3D 3OKEB 3OKYA 4XB7A 1V8HA 2QR0B 5EOTA 3IVKA 4U1MB 1IAIH 5EZOH 3IS0X 4WTZA 4BUGA 5DEFA 2QQNL 3T08A 5E8DH 4U3CA 3VI3E 5IROA 4GG8A 3QEUA 3P9WB 1C5DA 1AXTH 3C8KA 4Z7VB 3T0DA 5JHDD 4DZBA 3LKNB 4DK6A 5DTFA 3DMMA 1H8SA 3RL1B 5FGCB 5J9PA 3JV5A 2IAND 3GSVA 3FRPA 2OX5A 1FO0A 2FATH 1IM3A 5L8LB 1XF2B 2F19L 1AGCA 4HJ0C 3EJYD 4NZJA 3RWHB 3FL7A 3PV7A 1RIVL 5HDOA 5HYJE 4F8TA 3RGVB 5FYKH 1BVLB 1MCJA 2OM5A 2C3VA 1FG2A 5ALBL 5F7EH 4NM8L 3D3VB 4GRMA 3G6DL 1LP9B 1QLEH 3DBXB 3KPMB 1OD9A 3Q6GL 1T3FA 4QHUB 4XP6H 4RX4D 1S7WB 1TMCB 5ADPL 1B4JL 4OUUB 1AGBB 5FGBC 5LWYH 1K8DB 5F3HB 1NCWL 3FFDB 3DJ9A 4LSUH 4GXUN 5LCVH 3EOAA 5HHME 3VXSE 3I50H 1N7ML 2EYSB 4DVBB 1QPXA 4KI5C 5IR1B 2JJSA 1J0HA 4TSAL 4P2QA 5MEPA 3NCCB 4LLQB 4X7EC 2FEEI 4W68A 5CINH 3TYFA 4JCMA 3FFCD 4X6DE 3MRHB 2VR9A 4OAWA 2IAMA 4Z7UF 2C7UA 3C2AH 3BIKA 4NZUL 4RNRB 1U8MA 3FRUA 1FZJA 1MHPL 4OV5B 4J7RA 5I1HL 1BGXH 4W6XB 4R3SA 1CFBA 2DQUL 3WDIA 2R2EA 2CD0A 3LH2L 4HGMA 4LKCB 5T33L 1C1EH 3HZMA 2EEBA 1JPGB 1PY4A 2X5PA 1HSAB 4H1LG 3IDIA 1M7IA 4PRHA 5JW5B 5TF0A 4JAMB 1F6LL 4KZEH 3MRRB 3MLVH 3HE7C 3V6OA 4P57B 1CT8A 1X7QB 4K71C 2OJZH 4U1KB 4EIGB 4IOSD 1H5BC 1FNHA 4CVUA 4QRRA 1B0RA 1RUKH 5D1XA 3CX5J 4IRJC 3GRWL 3WNPA 1YA5A 4OCRH 5EDXA 5DYOB 3PWPA 4NRXA 1ACYL 1EO8H 4K8RC 4K7FA 3U7WL 3MV01 5EFIB 4OZGE 3FO0L 25C8H 2VDQH 3H9SD 3MBED 5HHOD 5DA0B 5JR1H 5KSVB 3O6LL 2AK4B 1R3IH 2K7PA 3T4AA 5J4MA 4NQEA 4IRZH 3T0VA 3GEWB 2BZDA 4JR9L 1C16A 4NUGH 3PP3H 1TZIB 1YC8A 2HVKA 2VTFA 1RZ8A 4ZD3L 4YXHL 3QULA 4QHMB 2GJZB 3ISWA 1WZLA 1KLUB 5HDQH 5JQ6H 5D71L 3BPOB 5ITFB 2E6PA 4PV9B 3WIIL 5CEZD 3QXVA 3BHBA 4ZO8A 5D7SH 3VMPA 3CZFB 4OUOA 4L5FH 1I1AB 3SKJL 1AD9B 1GCFA 3UC0H 4M4RA 5DI8B 5EC2B 2Y6SD 4QT5B 3L3IA 5D6CB 5I18H 4YHKL 4PRIA 3IDGA 3D85A 2ARJB 1N8ZA 1OSPL 2I9TB 3CUPB 4KJYA 5JMOC 4NT6B 1CG9B 4OCXH 1I9IL 5KOVC 5D72H 4WU7A 3CXDH 2VXUH 4DKEH 1CQYA 3ESUF 4GMSH 2UYLB 4Y5VB 4KKCD 3CH1A 3ET9F 3L5JA 1S9XA 2DQEH 3DYMA 1DLFH 4ZQKB 5D8JH 3ILQD 3D0LB 5JO5A 4Q9BA 2XIDA 3SGDH 3BT2H 4P59L 4CBPA 1B0GB 3QEQA 1EXUA 2VXQL 2WIIA 2IFFH 3UJJL 3G5ZB 1EO5A 4HIJA 2A6DA 4ZO7A 3E2HC 1ZANH 3LVEA 4Z7UA 3RNQB 1KCRH 1P1ZA 3QXDB 4LBEB 5HYSB 3E1F1 4RRPG 5GS0D 1IGCL 4XMLL 4G9DA 3RTQA 2ITCB 2IPUG 3FT4A 1VGKB 3VXOB 1WAAE 3LN5B 4G80A 4YUEL 3MLYL 1G7PB 5FV2A 4PLJC 2WM0A 4EZMA 1I8LA 2AJUL 2NY7H 3VI4E 4TYUA 4ELKB 2IAMD 5IBUG 1P7KA 5C07E 2GJJA 4HUUB 3RY4A 4M5YL 3QHTC 2IWGA 5K33A 1XH3B 4FTVA 4PGJA 2W07A 1BZ7A 1TVBA 2ZPKH 4O2CA 4X80H 1PLGH 3QDMD 4UTAH 1EFXA 2Y5EA 4RAVB 3MYJB 4PRHD 3P2TA 1KFAL 3UTOA 2HJKA 3OR7A 2BRQA 1A1OA 3PP3K 3NZ8A 4GRWH 4K94L 5ID1A 4Q6YA 3AGVA 5GJSL 4BQBA 5L9DL 2F5AL 1VEMA 2XPGB 1F02I 3QQ9D 5IJKA 3MRIB 5BO1H 4QRRD 1EBAA 1XGPB 4PJFB 5D1XD 3LS5H 1BQLH 2FX7L 4L4TA 4E41E 4OSUH 4MD0B 3PWPD 1XF3B 3OF6A 2VDKL 3RFZC 5DJ0B 5LGHL 1OTTC 3HS0A 2B8OT 2Q1EA 2VL5B 1IAKB 3T8XA 5HHNB 3MRLB 5ICXA 3C5SB 1NFIB 3WFCH 4RZCA 5DJ6A 4NQED 5JPNB 4GW5B 4HCRL 4OF0A 5CP3A 2GSIA 2IH1A 1QHPA 4B5EA 1RZ7L 2HFFA 4HWEH 4U0RB 2CSPA 3CXHK 2YD9A 3VFUB 4JDTH 1PAMA 4OFKA 1LO2L 2VDOL 2WBJA 4HK0A 5GJTH 3MRJA 1LHZA 3UBXA 5F7DB 3ZZ1A 5FYLH 3LKOB 3T1FA 2VN7A 5D1QB 1DTUA 2GQHA 2V2WB 4HPOL 2FZ3A 3QFJB 3T4YA 1T1YB 3W9EA 4F80A 2EDLA 5IIEA 1NFDE 3TT3H 2W9EL 3WO3B 3MA9L 4PP1D 1RZIB 4PRID 4Y5YB 3D85D 3IRZA 1HYSC 4H20H 3CFBB 1AIFA 3K8KA 5L8KB 3O2WH 3GMQB 1CXIA 4XWGH 4QWWC 4PPTA 1UJ3B 1IKFL 3EUUA 1F4AA 3V5KB 3B5HA 2YPKB 4O5LH 4WEBH 5HYSG 3UDWC 4HH8A 4KRPC 2FIRT 2WZPD 4E9LA 1P2CA 1U3YA 1S7QA 4YX2L 2KZWA 3SN6N 5H37G 4KKLC 3T65B 4HZLA 1NGXA 3HNSL 3P0GB 5GS1C 1JGEB 1YYLH 4D3CL 3NA9L 5HHQA 3QEQD 2BVPB 1PYWA 4KV5F 4TUKH 4NWTH 4U1IA 3O9WC 2DM3A 1I9JL 4OKDA 5C0AB 1XCTB 4UB0L 5JHDB 3BP5B 5E2JA 2W0LA 2QHRL 4XVJH 3T0WA 3RTQD 3KVQA 3DURA 2X6MA 2NX5A 5EO9B 3BI9X 3Q5YA 4K07A 4XNQB 5IVOA 1F45A 2IANB 4JFHE 1AJ7H 3MV9E 3L3JA 3BVNA 4PJ8A 1SJVA 2HN7B 1ZXQA 2VDML 4OZFH 4CJ1A 3QH3B 1CICC 5A2JH 2K9UA 3PG2A 3A6BH 4FTVD 2VLME 3DX8A 4IM8A 1NAMB 5CJXC 4HXBL 4MQ7A 3WHXB 2ORBH 5EC1A 1HILA 3T77B 4D9QE 3ARGA 1A47A 3QXUA 1EFXD 2FIKA 1WBYA 5EU6A 1CL7L 1FVDB 4TULH 2DQGL 4ODVL 3BE1H 1MJJB 5GIRB 1G1YA 3X11B 5GZOC 4M5ZH 3KLSA 1NGQL 4GS7C 1A14H 1D5IL 4NPYA 4XWOC 1IEAA 5E9DD 3GMNB 3DROA 3KXFA 3BYYA 2FHCA 43C9A 2NY1C 4D2NA 1LNUB 3BFOA 1TDQA 1TJIL 4RIRA 1H0DB 3WN5B 2DTML 4PP2A 4HUXB 4OCSH 4Z8FH 3Q0HA 4PV8A 1MIML 5HPMA 3FFCB 3OKKA 3TNMB 1WWWX 1Z6JT 4Y16A 1DSFH 3AXLB 2UVFA 3WIFA 2QBWA 3BMVA 2DN7A 1L6ZA 4ZFGL 4LIQE 3SE9H 5DRZB 3U4BH 1BD2E 5ADOL 4J8RB 4KKBD 4WFED 5KSUB 1KYOK 2AJZB 2WBJD 3G5XA 5ABDE 1MCSA 1BVKA 3ZDZF 1RMFL 3F12B 1EVTC 1UJTA 1BF2A 3KYAA 4JQIL 4EI5C 3O3AA 2BSTB 4AT6B 4JRXA 1MNUH 4YAQB 4JZOA 1C08A 1RUQL 2FRGP 1D7FA 1MRDL 4MD4A 1F4WH 5I2IA 4KMTL 1R5IA 3H9SB 2VDLL 3MBEB 1CR9H 5HHOB 4R2GD 4LCYB 1A4JB 3BGMA 5HGBA 4S1QL 3LD8B 4EN3A 5I1EL 1BZ9A 4WUKL 1DR9A 3C6SA 3P9LB 3RZCA 5AZEL 3IXTB 2NW3A 3O4OB 3V5HA 2EYTA 4ETQA 3H42L 2B5IC 4KJPD 5D4QA 5KG9B 4M6NL 2V9QA 4M61A 4Y5XC 2G60H 1Z2KA 2VUOA 1UZ6E 3DRTB 1YN6B 3H3PL 5CEXB 3N1PC 1RPQA 3IVKB 5GGQL 5I71B 4PY7A 1H3XA 4NO3A 2R0KL 1A21A 1FJ1A 4GG8B 1KBGH 2G2RB 3QEUB 3C8KB 4XCNA 4MA1C 1Q9KA 1NCAH 4L3AA 3GGWA 4NZTL 2R4SH 2NX5D 2YUXA 4MDIA 2YWZA 2EEAA 3MV8E 2W91A 3MJGX 4WHYG 5J9PB 5EUKB 5DDHB 1YYML 5E24E 2CJUL 4PJ8D 1FO0B 3VXRA 2DJSA 4WY7H 3RAJH 5FOJA 5IT2H 4RISH 4MLIA 1HKLL 1QKZL 1DBKL 2E9WA 1JBJA 5JA9A 4NKIH 2C3VB 4Z6AT 1CDYA 3AREB 4AH2A 1B3JA 1YPZF 3ARGD 4NQCA 4NJ9L 2OR8A 5FGSA 4N90E 1MCDA 2DLFH 2NZIA 5EU6D 3U6RA 1P9MC 1OAKH 4XP1L 5JUEL 1FAKT 4ODWA 2CGRL 2GUOA 1EHAA 3MJ7B 4TNVK 4GSDL 1EAPA 5GSVA 1T22A 1MAMH 4UV7H 4KJQD 5TGBB 1CDJA 3EOAB 5CBAA 3GMOA 3KXFD 4DQOL 3E8UH 4IMLA 1IZKA 1T89C 4L4VA 3P73A 3QJFB 1ZVHA 1MH5B 3BH8B 3K8MA 5IB1A 5TQ0H 1U2CA 2OMNA 7FABL 3MUJA 4R6UA 1YEGL 4K3GA 5GGRA 4OAWB 1WSST 2C7UB 4Y16D 4BZYA 1TJGH 2OI9C 5DUPL 1I7TA 1C12A 1U8MB 1FZJB 3FRUB 4WWKA 3VJ6B 1JTOA 2EDJA 2R2EB 1CFQA 1XT5A 1H3WM 1T04A 2JKXA 5I0DA 3QDMB 3PL6C 2Z91A 5F1KC 3MUY1 1QSFE 3MUGA 3UROR 3NCEB 5IMLA 4O58L 3IFPA 5AZ2L 3EFDH 3L5XH 4P2QE 5I75C 2J4WL 2B2XL 2IQAA 3P4NA 1Z0MA 2GW5A 5CIPA 3RVXD 2RIKA 4KK5D 4QRRB 1UKQA 3P30L 5D1XB 4X7SL 3KYOB 4JRXD 1OAXL 3O4LD 3PWPB 4OLXL 4NRXB 1SJEA 2VXVL 4K7FB 3H9ZA 3MMEA 1ZS8A 1S78C 2HLFC 4MXVF 5HJ3B 4KWUA 5DJAB 4YFEA 4RGMB 5ACMA 1NMCB 5KOMC 4EN3D 3W5NA 3IDYB 1K4CA 2J6EH 3RZCD 1C16B 3VGDA 3ZKXC 5INDB 1AKJA 1KB5A 5ANMA 1JNLL 2D0HA 5CJ5A 5TDNA 3QULB 4QTHB 3V6ZB 1HN1A 4PJ5A 4YLQT 5I1GL 3KHQA 1NCDH 3PE9A 4HK3J 3FMGL 1MUJA 4OLZH 4PR5A 4FQLH 3TIDA 1P4IH 3WEXA 4LSVL 2PCPA 1QFWI 3MLTB 3SKOB 2N1KA 3K7UA 1MF2L 3TZVA 4X7CC 4GBXA 3IDGB 4WW2F 1N8ZB 5DC4B 5E8EA 2F8OA 4OI7A 1D5BA 2ADIB 2V5SA 1YPZA 1T2JA 4KJYB 4XX1G 5J12C 3VXRD 2E6JA 1OWRM 4WU7B 1T0PB 4K94C 4XBEL 5E2WH 3FT2A 2OMBA 3LKRB 4LU5H 3O6FC 1AQDA 2ZUYA 4U0QB 1Q9OB 3HCVA 3G04A 2YSSA 3LHPH 1CGSL 1OP3H 2EDDA 4JHAH 5E8PA 4NQCD 1JMXA 1GGCH 1XZ0B 2CR6A 3H3KA 2F5BH 2O26U 4TTGA 5FF6A 3QEQB 3NCJL 4PRIE 1G6RL 2EDYA 4WEMB 3L5WB 4HIJB 5B3JF 5TF1L 4RDQG 1W8NA 1HHGA 4CVZB 4JO1H 3LN4A 4G9DB 3RTQB 2P8PA 1ZEAH 4L4VD 1FL3B 1FORH 3FT4B 3G6JE 4WFHD 4LCIL 5TDOA 1P53A 4G6MH 1HNGA 4W4NA 5LGKA 5F93C 4PB0H 5L0QB 1NMAH 4QXUH 1P7KB 4Z78A 1A7BA 3ALPA 5EORL 1OPGH 3E6FA 2APXA 4WWKD 3CVIL 5K59E 1YEKH 5BS0E 2R2BB 3RRQA 4H88L 1JZ2A 5KANI 1BZ7B 5ERWA 1TVBB 3BP7A 3DTXA 4DGIH 4O2CB 5I73C 1GGBL 3ABZA 4TPRL 4XHJC 4UT6H 4Z7UE 4ODXA 2YD2A 1D5ZA 3I02A 1EHLH 3OR7B 2QQKL 1A1OB 3NZ8B 5ID1B 5CD5D 1UM5H 4YHZL 5T3ZE 1RK0A 4G7VH 5IFAL 5E6ZA 4CU7A 2P44B 2ED7A 3L5HA 5GISL 1LEKA 3F7RA 4GFTB 4NHUB 3FT3A 1CDCA 4JFYA 5E9DB 4JEGB 1U8LB 2XICA 4J3UA 4KTDL 4KKLD 1J1XL 3SCMB 3HS0B 2R1XA 5CZVH 4DN3L 1E4JA 2GI7A 3HPJA 3MLXL 2FGWH 4OQTH 3CVHB 4RZCB 2XN9B 5DJ6B 3MLWH 3BX7C 4LSRH 1FGVH 4YDIH 2GSIB 2IH1B 3BH9A 3INUL 4KPHH 3T2OA 4ACPA 4M7KH 3WYRA 4JFEB 5HYFA 1AKJD 1JNJA 1KT2B 5BVJA 5MEOA 2VLKE 2WBJB 1E4XL 4WW2A 1PDKA 4EI6A 3MRJB 4RMTA 1CXLA 5JW4R 4L4TE 1MY7A 3GBNL 1YEFH 5J1AB 1OCWH 3RWFB 2PKDA 2FZ3B 1FIGH 3T4YB 1TFHA 1VCAA 3HTLX 3KPSD 3TVMC 4DZ8B 4Z76A 1CICD 4LLDB 2V6HA 3BEVA 5GRUL 2Q8BH 3TZVD 4L1DA 2DBLL 5EU4A 1I4FA 4LARH 2YUVA 2Q8AL 2A6KA 3I6GA 2PUQT 1PSKL 3GRWA 4LEOA 2ICEA 5C09A 1T1WB 5AEAA 4X4YB 4R2GB 1ZHBA 4W6WB 1SEQL 5C0CE 3OV6A 1FRGL 1HH9A 1UWEH 3DO3A 3L1OL 3RHWK 1P4LA 3N1FC 4YDLC 2QQLH 2HWZL 1A64A 4OTXL 1S7QB 2WQ8A 3BPNC 3KJ6H 2NY1D 4DUWA 1MFEH 2BOCB 4HZLB 4LIQH 3HMXH 1CDUA 3TWCH 2F54E 4P4RA 2JLLA 4EUPG 1MQKH 2VNCA 2ZNXA 2ARJQ 1PYWB 3ZO0A 2GSGA 3MXVH 5T1MA 4U6YB 2SEBA 3QCUH 2HH0L 1AFVL 2EYRB 4HWBA 5IB4B 1U3JA 2FH6A 3MRPA 4NN6C 2Z92A 4FNLL 3V0AC 4JY5L 3SKNA 2NX5B 5LQBL 3FQRB 2VDPH 5I15H 1ZVYA 2KQNA 3IGAA 1WVZA 2H2SC 4MJ4A 4PJ8B 5C70A 1PVHA 3T0EC 2FBOJ 1CLYL 3WD5H 5ILTL 4E5XA 1A6UL 1FPTH 3DX8B 3GZKA 4EIZC 1KCVL 1U92A 4EI5D 4MQ7B 1H3PH 3GMRA 1MFDH 4F7TB 3BZDA 2FIKB 2EXWC 3FOLA 1WBYB 3THML 2IGFL 5EU6B 5GGRY 2XA8H 4JG1H 4JREC 1RZKH 2EZ0D 3VWKC 1NCUA 3VXQA 3TT1L 4JJ5B 1EIBA 1VDGA 4XHQA 5TFSH 1RVFH 2OR9H 3TFKC 2AK1L 1QP1A 4ZS7H 3C60C 4ODTL 5T1LA 4NPYB 2D7TL 1IEAB 5J3HC 3DROB 4FQJL 4KRMB 4LF3B 5E7FA 1KIQA 3V6FA 2YEZA 3S34L 4PP2B 4WFFD 3NCYS 5DD1H 4P3DA 4RSVA 4PV8B 5HPMB 3AUVA 3OAZK 4JGJA 3OKKB 3DXAA 3MOBL 5DO2C 1ADQL 4LPVA 5FKPA 2CMRH 2UUDH 1S9WA 2BVQA 4Y16B 5GPRA 3WFBL 2PW1B 1KTDA 4IMKA 3WIFB 1CCZA 2OK0H 4K3EH 3NH7L 1U6AL 1IM9B 2F74A 2YK1H 4NN7C 3OB0H 1J5OH 5AYUL 4PRPE 4PJGE 2P5EE 5TPWL 4WFGD 4L9LC 3MLSL 4PRDA 1ZGLM 4XVSH 3KXFE 1NMBH 4ZNEA 5FUOL 4ZXBA 1GVIA 4BZ2H 3MRBB 3U9UA 4R96A 3UTPE 2R0ZH 5GRVL 1WLHA 4PJCF 3WBDA 1BJ1H 3O3AB 4JRXB 5IQ9A 1K5NA 1UH3A 3O4LB 1SMOA 4Q7DA 5E4EC 1C08B 1R0AL 3D0VA 4MD4B 5C09D 3OKOA 4I1NB 3KLAA 4DOHE 1JRHL 1UZ8B 1D6VL 4NJAL 3C8DA 3GDBA 1PX4A 2EDTA 5HGBB 3V4PL 4TVPE 2F53E 3G6AA 2Z8WC 3RWJA 2W92A 5ENWB 4EN3B 3LKQB 1BZ9B 2XWJB 4QXTB 3RZCB 2Q87A 1UFUA 1GIGL 1IILE 3QIWC 4HCRA 1IAIL 3KR3L 3TBYA 1U8HA 2WANA 2VC2H 1T0MA 5LBSH 4XP9H 1AQKH 4PY7B 1MREH 3KPRE 1UB5B 3AU1A 5C8JB 2JB5H 3JV6A 4XCNB 1YEEL 4ELMF 3GGWB 2AI0L 3LKPA 1P6AB 2VN4A 4RFEA 4Z5RA 1JNNH 4KV5E 3MGAA 4M93C 5ELIA 4U1GC 4PGBA 2YMXL 1W0WB 4WI3A 3VXRB 3RIAF 3S35H 1D5XA 5J6GB 1D5MA 3CU7A 5IP4A 5E70A 2ENYA 4NC1E 5DURD 5TQ2L 3OPZL 4WENB 2CO7B 2QSCH 5L7XH 2UUDK 4FXLA 2M2DA 5DJDA 4AH2B 4NQCB 5LWYL 3QI9A 5IVZA 4GKZA 1KENH 3QDGA 4NC2B 1S78D 4FZ8H 1AD0A 4ODWB 3QG7L 4NBXB 5SX5K 7CGTA 5E5RB 3NA4A 4HEME 5GSVB 2NY3D 5JZ7D 4HC1H 4FQXA 1JGUH 1N2RA 4UIKH 5BZWB 5F1OB 4M3JA 5T1LD 5CINL 1HHIB 1WISA 1KCSL 4L3CA 1L6XA 3QIUC 5JXAH 1MELA 3BD5A 4L4VB 1F4YL 5IB1B 1RJYA 3ZTJH 1BQUA 3W82A 3GMPB 5ESAA 3ROOA 1KEGH 1C1EL 2RCSH 3DXAD 4G43A 4KU1A 2L4OA 5GGRB 2QJDA 3X13A 3EFFA 3SBWA 2OTUA 1CFVL 2BMKA 5C0JA 1DQML 3DHMA 4ZYKA 1C12B 4DGVL 4PJEE 1OTSD 3WFEL 2JELH 4PJCA 4PJAF 4GQPH 1CFQB 1FYTA 2LE9A 1KACB 1SJXA 1AXIB 3CMOL 1VPOL 5IMLB 1E4KC 4K7PH 2EH8L 4KQ4H 3QAZC 1FG9C 2BNRE 1FH5L 2IQAB 3EAKA 1EO8L 5GZND 4ZXBD 4G6AD 5I8KL 4KZDH 3MBXH 5CIPB 1X5LA 25C8L 4KRPB 4JFFE 3JWOH 3BMWA 3WO4B 4OFVA 3MXWH 2DMCA 5AAMA 2ADFH 5GRVK 3MMEB 5GGSA 2ESVE 3IF1A 2NY2C 4OZIF 1I3GH 4WI6A 3HI1A 3RJQB 1QFUL 4AENA 3VG9B 4ZFFA 1AC6A 4XP5H 1CE6A 1PY9A 3VFMA 1U3HA 3MGOA 3I6KB 2ED9A 1M05B 2NXZC 3SEPA 2ZCLH 4JQVC 3BRFA 1KB5B 2WWMD 4Z7OF 3AS0A 5ANMB 4Z9KB 4S2SA 4ELMA 2AS5M 1FQ9C 2BP3A 4KY1L 5TDNB 4L5FL 4S0SD 2ZOKA 5C6PB 5I18L 2BDNH 4M1CD 3QR2A 4TSBH 5SWSE 1OARH 1YNTA 3VW3H 5F97E 2CXKA 1II4E 3TIDB 3ULSB 3KPSB 4R97C 2PCPB 1CICB 4OD2A 1OP9A 4XP4H 5HYEA 1WIUA 5FKAA 3P11H 3CXDL 2YA2A 5E8EB 1A7PL 2KZ1B 4GMSL 1D5BB 1YPZB 1PKQE 1QVOA 3L6FA 3MV11 2EIBA 2VKWA 1QSED 5EZIL 3IYLW 3LDBB 5SX4H 4YH6A 4QO1A 1GAFH 3DO7A 2VLRE 4HQQH 1TTGA 1K6QH 4HS3A 4K3JH 1AQDB 2NY6C 1QA9A 3TH4T 3G04B 2YSSB 4PJ5E 5CSGA 4GS7B 1RZJL 1Z0NA 1JUFA 2Z8VC 2FB4H 5SWZA 3O3EA 1TNMA 4XPGH 2X1QA 2IFFL 4FFZH 4X6CE 5I30H 2BY0A 2NY1B 4X4XA 3QI9D 1G9NL 2HA1A 3QDGD 1B6DA 2H32A 4XAKE 1DVFA 2R29H 1T6VN 2X4SA 2CR3A 2AK4E 3EDFA 3CPLA 4FQXD 1T7XA 3F62A 2OL3L 4R26H 2IBZX 3TO4C 4K23H 1HHGB 3U82B 1EEYA 4YEFA 2NTFA 4PJAA 4CDHA 3EYOB 5TDOB 3ZHDA 3K1DA 1AI1H 5DJZB 3ZT5A 3BJ91 3C87A 3RL2A 4GLRI 4OM1L 2ZPKL 3KDMA 4X80L 4IRSC 3FQWA 1VFOA 5KSAA 5I1JH 2ZUWA 4R90H 4UT9H 1XF4B 4EI5B 1ONQA 4BJLA 1FYTD 3DTXB 3L5IA 3D18A 3WIHL 1MCBA 1MHHA 5BO1L 4YDJA 1HSBA 1F90H 2LV4A 1BQHG 3IFOA 1OAUH 2FX9L 1WCBA 4U1LA 4JPKH 3MSPA 1RK0B 1MRFH 1FVEA 1KELH 3EDDA 2DOCA 4OZIA 1E4WL 2QKIA 4R4ND 2DDQH 5KAQF 2C3GA 4JFYB 2YD7A 1FLTX 4ZAKA 3SOBH 1UA6L 1PJ9A 3JTTA 4FMKA 1FGNL 3MLZH 3F8UB 4HGWB 5HVWA 3BSZH 4Y5XB 2R1XB 3HPJB 1N64H 3OQ3B 4CL7A 3B9KA 4Q9RH 4F7PA 5GJTL 2G75A 1YMHA 3KNBA 1FZOA 3FQXA 1EPFA 3ZE2E 1U3HD 3DARA 4POUB 2OCFD 5ALCL 2VYRE 3RZWA 4MA1B 3VRIA 2EDWA 4UUJA 4P3CH 5BXFA 2APWA 1S5IL 3PDGA 5F6HI 4V1DA 1GC1L 4ZUUA 3RA7H 4LDOB 1BOGB 5F3BA 2DM4A 3QWQB 1KC5H 4FQQA 1AP2A 4H20L 5EU5B 1AO7B 2R0WL 1BBDL 1X6LA 1GOHA 2NLJA 4Z76B 1A7NH 2OSLA 2Q76A 4AQ1B 3PQYE 3BEVB 2D7NA 1I1YB 1T0NA 3OJDA 4XH2B 3L95A 4KVNL 3DVIA 1CDHA 4RQQA 1KN4L 3I6GB 3HMWL 2CUMA 2JB6A 4KMLB 4LEOB 2ICEB 5C09B 2LVCA 4YO0A 3CSGA 2J88H 3VFOB 1ZHBB 4MS8C 4LPYA 4HIEB 1INDH 4MA8H 5DD0L 5IM7A 4JFDB 1IT9H 1P4LB 1OHQA 5SWZD 4HJGA 1FLRL 1A5FH 3QNZA 1LWRA 2ILLA 2X9WA 1KCUH 5GGTL 1DVFD 4G6KL 4N8PA 1AR1C 3EO9H 5D96B 4PUBL 4GG6F 4EDXA 5HGDA 4W4OC 5T1MB 4Y4FC 5D7IE 1CGXA 1LK2A 2SEBB 4A6YL 3BRDA 3PDDA 1XEDA 3JWDH 3QP3A 5EIVA 35C8L 3JBG7 3ZHKA 4IOIA 4JN2A 3MRPB 1L9MA 2DD8L 3A6BL 1X4XA 4K9EL 1SBSL 4TQEH 3V52L 2VSCA 5EB9A 4L29A 4BSWA 5I1KH 4P2RA 2ZP0T 4Z18A 3TH3T 5KSAD 3KLDA 1GJIA 4QXWA 4LK4A 4E5XB 1K3IA 1LQSR 2A9ML 3ULVL 1U92B 3O11B 1FZMB 4U6TA 1OTUD 5DJYA 3RIFF 3GIVA 2C26A 4KROC 1PD6A 1MCFA 3FOLB 3LOWA 3CFDB 3I2CL 4KDVA 3QUKB 4P9ML 5FYJE 1A14L 3OL2A 5DD6B 2QSTA 4OCYH 3A6OA 4L3EB 4NM4L 2X42A 3CDFA 1JZ7A 1CXKA 2IFGA 1NBVH 1N0XL 3CLFH 3WS6C 4MNGE 1HK6A 1G6RA 3ARFC 2GK0A 4AM0A 2R0LH 1EEQA 5L88H 3X3FH 5T1LB 4KXZI 4ZAKD 1T5WA 4UTBH 1KIQB 4H25A 1A7RH 3V6FB 4X5WA 3VFWA 3VG0L 4NKQB 1F8TL 3NFNA 2D9CA 3V0WL 3GB7A 4LSQH 4P3DB 5CCKH 2JCCE 2A0LD 4KUZH 3B9KD 2BXYA 1IKNA 1GOGA 1N4XH 3WLWC 5HGGS 1S9WB 3LQAH 4Y1AE 4HG4K 1AC0A 3PWVA 3LZFH 5H94A 2N56A 2DL2A 1IC1A 5HDBF 2F74B 5IB3B 5AYQA 3DNKA 2Y9RT 2C1OA 4V1DD 1R3JA 4B50A 4RBPK 3GKWH 4FXGA 3GJEB 3X14A 2X70A 3PDOA 1U91A 1YY8A 2AJVH 3V4VL 4ZXBB 3WV0A 1EERB 4KFZC 1LD9A 1YY9C 5JIKA 1WQVT 2Z31A 4PJ9C 4H1LH 3OKDA 1SYSA 4LEXL 2VL4A 5IBTL 3D0VB 1T2QH 4G42A 4R4BB 1VEPA 3NFPA 3KLAB 4OI8A 3TYGH 3HKFA 1W72A 4AK1A 2DMBA 1V5JA 4FS0A 4YHOH 3G6AB 2A74A 2YPLE 1K4DB 3RWJB 4I2XE 3T2NL 2G60L 4GG6A 5JDSA 3VD3A 1HH6B 3HC0A 3IFNL 4JM4L 1QR1A 1ORQA 1U8OA 5HGAA 3D25A 3QIUD 5E5MB 3TBYB 1U8HB 4K2UH 2ZUXA 5EU7C 3ETBF 4YXLH 2DQHH 3L3GB 4QEGA 4Y4KA 1JIBA 1NSNH 5ESVA 4MVBC 1Q8MA 5SV4A 5E94B 2RAMA 3JV6B 3IKCA 1DJSA 4PG9B 5D70L 1ZHNA 5CFHA 1ITCA 2RHEA 2V17L 4RFEB 5I73B 4QNPE 4I48A 3DX9A 2P45B 4JY4B 5FHBL 4PGBB 4XPHH 1QSEB 4HUMB 2A6JA 2D31B 4P5KB 4P2RD 3FO2B 1BAFH 5HVHC 3QIBC 3VGAC 1D5MB 3S36X 1XGYH 1YEIH 1VESA 5FUZL 4LASL 4XC1L 3MRNB 4KGJA 3O8XC 2EICA 3U0WL 4HFUH 5DJDB 2P47B 4PG2C 4GKZB 4P9HL 3QDGB 4PRAA 2OS7A 3LRSA 4ODHH 1AD0B 3S8WA 1PG7W 3ULUF 3DYPA 1EGJL 4WCYH 2DL9A 1OSZA 4FQXB 5HYIA 1N2RB 1LO3H 2OZ4L 2YUZA 3HNTH 4QRTA 2H45A 1K3ZA 3IDXL 3KS0J 1IGIH 1QBLH 2PTTA 3GO1H 3D1MC 1HCVA 1RJYB 1A7QH 2VSDA 3BXNA 1NAKH 4ZUVA 2Q3AA 4M6OH 4GXVH 4FHBD 4P2OA 4M7JL 1A2YB 5C3LD 1IC5H 5ESAB 1J87A 3ROOB 5D7KD 2WQRA 4G43B 1EV2E 3OWEA 5MERA 4AL8H 4P5TA 3EFFB 4FFWC 4ZUWB 1OB1A 2OTUB 5C0JB 3TVMB 4ZYKB 2BX5A 5F72S 1RFDH 12E8H 4JCLA 2AW2A 4PJCB 4H8WL 1FYTB 4U49A 1JGVL 15C8L 2FR4A 3MLUH 3UTSE 4PJIB 3M45A 1BWWA 3NIDE 1MFCH 4EDWL 5E08L 4IIQA 1X5HA 4HXAL 1KTLA 3SDDA 3WXVL 1P5UA 2Z31D 4YDLB 4HUVA 1ZT1A 4HIHA 1KEML 4KHTL 3SHSA 4MNHA 1RZJC 5FO8B 5JPMB 2HFEB 4X9BA 3STLA 4JVUA 4LP4A 3IF1B 1F2XK 2VB5A 3HI1B 4AENB 2UZYB 4XX1E 5KTEH 1K8IA 2MWCA 1CE6B 3VFMB 1KGCE 2CIKA 4DAGH 1ADQA 1U3HB 2AJSH 3ELAT 3MGOB 3S36L 3N50A 4ZUSA 5C2BH 5IB2B 4NQSB 1M1SA 4D0BB 5MI0C 8FABA 4S2SB 4ELMB 1ORSB 3D69B 1EHNA 1SVZA 3KYMA 2ZOKB 2HRLA 2EXYC 1UXWA 4LLVA 4Y4KD 4OZFG 1KPUA 5IHZA 1YNTB 4IRSD 3T0EB 3UJTL 5FA4B 5D1ZC 4UT7L 3ZT6A 2AEIT 5FKAB 3UTTB 1CGVA 5CGYC 2FCBA 3MFGB 2MMXA 1BQHA 2IALA 3F5WA 1QVOB 2VKXA 3L6FB 3WSQH 3NPSB 3QUML 1ZA6A 4JREB 1RI8A 4OCNC 4XPBH 1E4XI 3KJ4C 4JKMA 5HGHA 4BM7A 3VWKB 4JHAL 4NCC2 3DO7B 5DQDL 4HS3B 2B1HH 1FDLL 2F5BL 2VRAA 1BM3H 4M1GH 1QA9B 3S5LA 4CN4A 4ODSL 1JUFB 5SWZB 3GNMH 4JPWH 3O3EB 2XRAH 4I5BA 2D2OA 4KDWA 4X4XB 3KPOA 3PABA 2H32B 1T80A 3MGTA 4N0YH 2LAAA 4NP4H 4RGOL 4LCCA 3CPLB 5ACZB 1C5CH 3DX7A 1AE6L 5DRNA 4WV1C 5H37H 1MLBB 4GOSA 1EEYB 2CLZB 3C09C 3FB8A 2NTFB 4NUJB 4PJAB 3R8QA 4GRLA 2EO9A 1CWVA 1QSVA 4P2OD 4L9LB 5IB5B 1I9RH 4EBQH 3RL2B 1GC1C 3S37X 4ZS6C 4AEIH 1O7VA 2BOBA 2PYEA 4S10A 3FQWB 4P5TD 4LSSH 1Z9OA 4WJ5B 3U36A 3VFNA 3WKNA 5I66A 2EEDA 5IGXH 2YUWA 3JWDC 4MXQD 4Z77A 1ONQB 1E27A 1CYGA 1FNEA 3WS3A 1YNLL 3D18B 4F7MA 5E4EB 3VWJC 1MHHB 1MCCA 4YDJB 1A7OL 2KH2B 5IHUH 1J86A 2X4OB 3MRQA 4G8FA 3IFOB 3VGFA 3LB6C 1WCBB 4MQXD 5FUCE 4MHHG 3HG1B 2B39A 2HTLC 3R4DA 4N0FA 3KYKH 2JJTC 5BQ7A 1LVEA 3U0PA 3SDDD 5D7JC 4HDIB 1CFNA 3D9AL 1A6AA 2AGJH 4ZAKB 1OAZL 2NZ9C 4KTYA 4QHNA 3JTTB 4PREA 4PS4H 1OM3L 3RVWD 4LSRL 3CDGA 2BVOB 3MJ6A 3ZKNC 2Q7YB 2NY0C 1IQWL 2P5WD 4M7KL 1U93A 5F9JA 4XCCH 2Z9TA 4N0UB 3T2QA 1QNZH 1FZOB 2GCYB 3FQXB 2BHYA 2YPVH 2H26B 3WJLA 1NLDH 4KKNA 3VRIB 4LMQE 1SM3H 4NYLB 4UUJB 1HEZA 3WFDH 1U3ZA 4EJ1C 2UZIL 4OZIE 3L9RA 3B2VL 1GHFH 1CLCA 4OV6F 4V1DB 1EMTH 4ZUUB 4OCWH 3ZKMC 32C2B 4OGAD 5F3BB 4KDTA 1DP0A 1UVQA 2GY7B 4K9EC 3DIFA 3VFTA 1GZPA 1TXKA 1CZ8H 4FQQB 1AP2B 3PHQA 4Y7MA 2QEJA 5FYJH 2OSLB 1J1PH 4N5ED 2Y06H 3HRPA 1MFBL 5IFHH 5KW9H 1T0NB 2H3NA 4GRWF 4RQQB 3ULVC 4YDKL 1QFOA 5CSZA 4HS6A 2XTJC 5MENA 4P3WA 2JB6B 4KROD 4DVRH 3BO8A 1YEDB 3K4AA 1Q72H 5BCAA 4YO0B 2R1WA 3LEVH 5FK9A 4F9PC 4I9WE 4UDTB 2YOCA 4C83A 3KJ6L 4UOW1 3WJJA 3ULUD 4MWFA 3WKML 4PBXA 1A0QL 1MQKL 5E03A 3QUYA 4OLYH 3QPXH 2WWKT 2HKFL 3QNZB 3QIUB 2EDFA 4APQA 2R56L 4MA7L 1OLLA 5ISZA 3HUJE 5CLWA 1MWAH 3D39A 1TETH 5T5NF 1S3KH 2BSRA 4FQCL 4F15C 4DN4H 4MCYB 4XNMA 5HGDB 5D7LA 3UTZB 2XN9E 1JRHI 2E27H 3OKNA 4POZD 2VDPL 4G8GE 2DMKA 3SJVE 2A6IA 4RWYL 4IOIB 4MMXC 4FP8L 2LVEA 3Q1SL 3OB8A 3D87B 4HH9A 3TN0A 1A1NA 4NOBA 4GRLD 2O93L 5IMOA 4HFWA 1RHHB 3B6SA 1SEBA 1IEBA 1NAMH 3ARBA 4Q2ZA 4EVNA 1IAII 4R7DA 4JKWA 1NC2A 3EOTL 4KJWC 4LNRA 4P2RB 4BSJA 2PYED 2ATKA 4TRPL 3ES6A 4PJXF 4U6HB 1EVUA 1A6WL 1TZHA 4LRNL 3GSUB 4Z7QF 3MREA 2NXYD 4Z0XA 4WHYH 1XGQB 3GIVB 5TFSL 4KK6C 3NCYP 4WHTB 1RVFL 5FXCH 3QUZA 2W65A 3H9HA 3DV6B 4F9LC 5SWQA 4CNIA 3CK0H 3WNLA 1VFMA 4JHWL 5AAWA 4H5SB 2NYYC 4PJBF 1INEH 2A1WH 1G6RB 5DWUH 3V4UH 2GK0B 3HZKA 4AM0B 4UDUA 3RI5F 4TUJB 1ZGLP 1T5WB 4JHBA 4Y8AA 4G9FD 3U9PH 4X5WB 4KI5E 3VFWB 3ZSTA 1LO4H 4UU9A 1LO0H 2OK0L 3NFNB 4HPYH 4K3EL 5JW3H 2ADGB 2IQ9H 1Z3GL 5J11B 1CF8L 5F96L 2DQDH 1W0VB 1Z5LB 1CU4L 5GRJH 1QFPA 5JTWA 1MCPH 3PWVB 2DLTA 2ZSWB 4R97B 2J2ZA 3K3QA 5CEZL 2VH5L 3ROLB 4XVSL 3VD4A 1XFPA 5EULV 4NQXB 2O5XH 2DKSA 4ZPTA 3RVTD 5DJ2A 1R3JB 3SDXF 3V8CA 1CS6A 3TCXA 1MFAH 4LSTH 4FXGB 3WIHA 3S7GA 3LMJH 3EDEA 3W0WD 3X14B 2X70B 5I8CA 3PDOB 1U91B 4JO2L 4JPIA 2CDGB 2CKBH 2D0GA 3KYNA 5AG9A 4HF5H 4MJ6A 1EHXA 5DXWA 4GAJH 1NKOA 1SYSB 2BVYA 2DWEA 2D03H 3GSNH 3HC4H 4PJHF 2XT1B 4X98B 6FABL 2X05A 4G42B 2ZUTA 1MJ7H 4RGND 1KTRL 3NFPB 2W60A 4P48A 1NBQA 2LU3A 4P9HC 1W72B 1F58H 2A74B 1S7RB 5T3XE 4KC3B 2V7NB 3VI3F 1JZ3A 1E6JH 5JDSB 3UTQB 1QR1B 3QUYD 1KJVA 2BVTA 1ORQB 3TO4B 1Y6NR 1QRNA 4XP9L 1AQKL 5HGAB 3WE6A 1JN6A 3D25B 4NQVA 4APQD 1BJ8A 1MAJA 5ISZD 5FM5O 2GIYA 4ONFL 3D39D 3PP4H 1NKRA 3WHE1 3O3BA 1T66C 5A3IC 3TJHC 4DFHA 2AJXH 5ESVB 3SDYL 5D7LD 5EWIL 4IRSB 1NDGA 2VZSA 3QQ4A 3VDAA 5F89B 3LCYA 4PJXA 1FO0H 2X9YA 4XPTL 1IC4H 4B0MM 3MV7A 5I17A 1A1MA 4GG6E 4BK4A 4H8WC 3VWJA 1ZLSH 3IB4A 1I1AC 5DF0A 5IJVA 5HSFA 1NC2D 5T1DH 4CU8A 1KIRB 1NGPL 4ZTPH 2A6JB 5L7XL 2QSCL 4OB5L 3O2DL 4XCFH 1S7XA 2XNAB 5BRZA 2QADC 1TJHH 1KENL 5E99H 5K9JH 4M4PA 4FZ8L 3R8BB 5JDJA 2PF6A 2PXYC 4JKPL 4OZHE 2Q7NA 2H2PD 4XXDA 4G8EA 1GH7A 1MRCH 4PJ7E 3QUZD 2ZG2A 5DK3A 1LMKA 2Y5TA 4Z0BL 3OG4B 3LRSB 4U4BA 5EH1A 1BEYL 5GS0H 5IK3A 5EIQA 1JHKH 4I77L 4V2CB 4UILH 4P23A 2AKRA 1U8NB 4LHJB 1KN2H 4A6YA 1R5WA 3SGDI 1J10A 1KEGL 2RCSL 5T1KA 1P84K 5DD5L 3PGFL 2D4FA 1KPRB 1LE5A 1UCBL 3BXNB 1G1CA 4ZUVB 1HZHH 4EOWH 3SDXA 1U8JA 2EXYD 5K9OA 1X9QA 5A1AA 3U30B 5MERB 2I9LA 2VLJE 3L3DA 4F33A 1S8DB 3E3QE 4L4JA 5L2KE 2PN5A 4Z7NF 3MRGB 2DICA 3CFEA 1Z9MA 2CLRA 3PHOA 3WFHA 4PJHA 5CGYD 1QO3A 2FR4B 4WU5A 3ME0A 4JZNA 3SQOL 2ED8A 4NNYA 3QBTB 1JZ6A 1YJDH 2BK8A 1F5WA 3B2UC 4KK8D 2DIJA 3HE6C 3I75A 1XR9B 4HT1H 4QY8A 1KTLB 2E7BA 3SDDB 4PRBA 4UI2A 3BKCL 4HUVB 2ZCHH 4KMQA 3H2WA 3OGCB 5A16B 1UACL 2EO1A 1ZSDA 4OLVL 5EN2A 1QBMH 4O2EA 4FQ2H 1I3UA 3VD5A 2D7QA 5F7LB 1MHCA 1ZVSA 3BKMH 1JWMA 2DQIL 3STLB 3QEHA 1G7QA 3UEZA 2P5WB 1TTFA 1HQ4A 1HHJB 5HI4C 4C55A 2VXSH 3ZKSD 3DUHA 3QNXB 2DQTH 3WFZA 1WCQA 1K8IB 1RU9L 5TE4H 2JF1A 3EYQC 3QYCA 4G5ZH 2CIKB 4ZUSB 4OGYH 4MJIE 4M7LH 1QRND 2DQFA 3P4OB 3FN0L 1F3RB 2C5DC 3NIFF 4XBPB 5HYJA 1FNAA 8FABB 4I18A 5FYLD 5I1IL 4XRCB 1YNKH 2FECI 4Q9QL 2QLVB 1RHFA 1KJ3L 1KXTB 5T3ZL 5ITBL 1MIEL 1MCOH 1SYVA 2MQ0A 4U0RC 4XPAH 4LSPL 5T5FH 1KTKE 4YK4B 1KPUB 4XT1C 3N85H 1WICA 2AP2A 3VXSA 3FB5B 4JVWA 3F7VB 3MV7D 3HR6A 1BQSA 1K6QL 2ARWA 4KROB 3VWJD 2IALB 4MAYC 3STBA 3F5WB 1S7SB 5IF0A 2AJYL 5DT1L 1ZA6B 1KUMA 4U1NB 5ICZA 5C08E 5KS9F 5CJQL 5I30L 4X7TA 4X83A 4O4YH 5BRZD 4NGHH 1FFNB 3NZHH 1WTGT 1G6VK 3QO1A 2X4UA 1I7UA 1V7MH 3JV0A 4YHLL 3MODH 1I8IA 3BDYL 2F58H 3W11C 1V3MA 1OW0C 3PXJA 3R1GL 4YFLF 1TTUA 2HVJA 2NZ9D 4WEUD 1WAAF 5DS8B 5MP6H 2CPCA 3MGTB 4K23L 5B39A 3TPKA 1A6VL 3VI4F 4OM0L 4UAOB 5F9OH 5K9KA 3CFCH 3NCBB 4IHOA 4LCCB 5DUBA 1V05A 2FBJH 3HFMH 5F6IC 2NY5L 1NUFA 4YR6A 1Q0YH 2HT3C 4EUPH 2EKSA 2CKNA 3FB8B 3FJTA 3C5JA 5T1KD 1WEJL 2ZG1A 2I27N 3MR9A 1YEJH 4OZGA 4B7LA 1EUUA 5C0EA 4HD9A 5E6IA 1ZTXH 2BOBB 5F1SA 4CRPA 1XMWA 3PGDB 3U36B 2E8ZA 3VFNB 5I66B 2BHUA 4NQUA 2UWEE 1FNEB 2NXYB 3WS3B 1I8MA 4PJ9B 1MRFL 5LXGL 3ULVD 2HJLA 4F7MB 1M71A 2XTJD 4C56E 3MRQB 2BNUA 1J0YA 1ZA3A 2Y07H 1QLRA 4P49A 3NTCH 4A2LA 3QDJE 4UQ2A 4PRNA 4ZPVA 4N0FB 2O61A 5DLML 5BQ7B 1KULA 1OQXA 1CFNB 1A6AB 3B9DA 4YE4H 4N8VA 3CVHH 3NIGF 4P46A 4G9FB 3K0WA 4QHNB 1CFSA 1BLNA 3BAEL 5FYKE 3SGJA 2XZCL 5DHYA 1L7TL 4D0CA 2YHGA 3K80A 1MJ8H 4NBYB 5F9JB 1P69B 5DA4A 4Y8DC 3WN5C 1NFDF 1ZLVH 1R3KA 1RIUH 3RUGE 3WUWA 2GAZA 1KNOA 5HYJD 4IOFD 3P0VL 3MJ9H 1A7NL 4XNUH 4BZ1L 3OZ9H 5MHSE 2GYSA 3IU3A 3KPNA 3W0WB 1UVQB 3DIFB 1WJ3A 3VFTB 3QUXA 1GZPB 4OF7A 4Z7WB 3GMMA 4KJWD 3PHQB 3QIBB 5KS9A 4LSDA 2WBKA 2E7LA 3O45A 4DCQA 1T7WA 3IDJA 3S9DB 1JF1B 3VXSD 4J3VA 3O3DA 1MPAH 5CSZB 4HS6B 4R8WH 3ESVF 3BO8B 3CC5B 4OJFH 5C6TL 4GKSA 5C0RL 3A6CH 1QLFA 2R1WB 1IGYB 1NGZB 1WAAA 2R1YA 1MCQA 4OIBA 4OF8A 3OJMB 1B0WA 1VGEH 4C83B 1Z9SA 2N7AA 1A5FL 2J6EA 2NYYD 3X3GL 1UWGL 1EEZA 1WITA 4MWFB 5C07A 1JGLL 2ZJSL 1JE6A 3QHZL 2Z8RA 3MBEC 3EO9L 1OP5K 4ONHA 2V5MA 3DVFA 3N0PB 3PNWB 4APQB 3LD8C 5ISZB 1UT9A 3UP1A 2HRPL 3W39B 3I3DA 2E7CA 3O4OC 4JDZA 4JN1H 4XNMB 2VISA 1YMMA 5MENE 3B9VA 5D7LB 5E00A 1VADA 3OKNB 4CW1A 4F37F 5DSCA 4RGNE 3AROA 4MJ5A 2YKLH 3NGBB 5I1KL 5IQ7L 1NPUA 4HH9B 3GSRA 5E2TH 4E41A 1DQQA 4MGXA 5FGRA 4JO4H 5DQJA 4F7EA 5IMOB 4S1SH 4UNUA 4BELD 5IMKA 3B6SB 1SEBB 1IEBB 5IROC 4Q2ZB 5DJCA 3RWEB 5C9JA 5AWNH 1F11A 4QF1A 4TVPL 1PQZA 2Y6SC 1RURH 4NNPL 4FRWA 4DFIA 2B1AH 5E6ID 4RFOH 1LK3H 3DMMC 1X5KA 1AO7E 2FD6H 4TOYL 2ATKB 3LPWA 3C08H 4K8RH 3ES6B 5JNYB 4G6JH 3D39E 4XNZB 3QZWG 1PG7L 2X2YA 1BHGA 2IG2H 4Z0XB 1A8JH 4GMTL 4K55A 4KVCL 1VENA 2ENSA 1NBVL 2X4PA 4Q6IA 1RJLA 3QUZB 1ZLVK 2W65B 5L88L 3H9HB 4KKCC 2HFGH 4PJDF 4CNIB 4WW1A 4P2CG 4X5XA 3ILQC 2YD8A 2HKHL 4YFDB 2CDFA 1QUNA 4JFDE 3HZKB 3VA6A 1DL7H 1DE4B 5CCKL 1DBJL 1NFDA 4Y89A 5GSRA 2JK5A 4AIZA 2OL3B 3W9DA 4MAUL 1QFWL 5MI0B 5JORA 4MD5A 5CGMA 3LQAL 3LSOA 3U2SA 4PTTA 1JYXA 2XXMB 2LABA 1C7SA 3QEGH 5GS0C 2GTZB 4QCIA 2JJSC 3TH2T 2IBBA 4LFHG 3IJSB 3SE8L 2FDBP 1ZWIA 1EK3A 3QCTH 4JY6A 4TUOB 3RX8A 3QFDA 3WLBA 4O9HL 3GKWL 1JPTH 4RMSA 5D1ZB 1TZGL 5C0BE 3L3OA 4QXGL 3T04D 4MSWA 5DFTA 4ZPTB 2IAMC 3OAYH 1G7LA 3PWJB 5I8EA 1YECL 1UM6L 5EA0L 5M94B 5I8CB 2P24B 4KKAD 3DUSB 1FV1B 1IFHH 4JPIB 1R5VB 2ZOLA 3V7AE 3KYNB 2QADD 3ZHLA 4XVTH 1LE9A 3G08A 2WUBL 3BZEA 3O2VH 2DWEB 3QRGH 2PXYD 2E8YA 3V6OC 3WXWH 2K7QA 4J1UB 3UJIH 2A77H 2W60B 3MLRH 5TDPA 5I8OH 4J3WA 2XQBH 5D1XC 3BD4A 3MCG1 4OI9A 3S4SA 4L3EE 4YHNA 4GRWE 3T3PE 5EU3A 3MNVB 5D6DA 3G5YB 5C07D 1FHGA 1KJVB 1DBAH 1XCQB 5GS2H 2OP4H 3N9GH 4RGMC 2CLVA 3WE6B 4ZO9A 3IXAA 5KVEL 4FQIL 3LQZA 4UQ3A 5GRYA 1NMCC 1P7QA 4YFLI 1T7ZA 4M6MH 4FZEL 3O3BB 3F58L 3MJ8A 1B9ZA 2Y72A 3M8OH 2MTPA 1N5YL 3REVB 5CKGA 2EH7H 3QHFH 3VFGL 4JFQA 5I1DB 5JLZB 4E41D 3MV7B 4YHMH 3VWJB 2AEPH 1KJ2H 1QRNE 4PP1C 1MFNA 3B2UD 2VLLA 5FDWA 4PJDA 5FYLE 1WFUA 3LIZH 4LLMA 4P4KA 5D7JB 2BJMH 5I6XC 3CFIC 2FL5B 3UYOD 3HI5H 4W81A 3HMXA 1E6OH 2AQ2A 5IW3A 4WCYL 1BD2A 4XXDB 4OGXH 3TESA 4G8EB 4H26A 2CUIA 3U1SH 4XVUD 2PR4H 1J8HA 4NHCH 3IU4L 3NACL 5EUOE 4N9GA 5DGQA 4OF5A 5DRXA 5IK3B 1F2QA 1YUHA 1IGIL 3WDJA 4XPFH 2GKIA 2E9JA 4ALAH 2AKRB 2EE2A 3VH8B 1OGAE 4QRUA 4GXVL 4A6YB 1ZKAA 4U6XB 3O6MH 3CLEL 4N0RA 5E95B 3ARDA 4D8PA 5BRZE 2RGSA 1KPVA 3HRZB 1W0YT 4OIIH 4PJBE 4IBLT 1LE5B 2Y4SA 3HI6H 4GUPB 4IJ3B 1W8OA 5D2NA 5BV7L 5DEZA 1U8JB 3AS2A 1IMHC 4XMPH 3ZTNL 3M17A 3K4DA 3RTQC 3ZE0E 3HZVA 1MI5E 4U2ZA 4UNVA 2W9DL 2FEDD 1UYWL 5TE7L 1JI1A 1I8LC 5F7YC 1MFCL 3CFEB 2QHLA 3PHOB 3B3IA 4RA0C 2Z93A 5KJRL 1QO3B 2XTJB 4WU5B 4JZNB 5EOQH 4LKXB 4O51B 3G9VA 2VOTA 3MQIA 4NNYB 1FFQA 4NO2B 2CDEA 1A9EA 5HTSA 3RNKA 3I75B 2YD1A 2H6PA 2IPTH 4QY8B 3IDMA 4NRZA 3REWA 4PRBB 2HT2D 4ZUTA 4F57L 4NWUH 3D5OF 2HG5A 1ZSDB 1ZHKA 2DRUA 5EN2B 3GIZL 4O2EB 5CMAA 4E42A 3RVVD 1RULH 1IVLA 2A9NL 1TCMA 5IJKC 2FSEB 4N68A 1ZVSB 2YA1A 4OZ4A 1JWMB 5IEKB 3MV8A 1NGWA 3QEHB 3RDTA 4JFHD 3MV9D 2AV1A 1ZGLA 1RIHL 3VXPA 1L7IH 1HQ4B 4K3DL 4N8CH 5KN5A 2I07A 4PJHE 3SDCA 1HWHB 2MKWA 5I19H 2VLMD 4Z95H 1T03L 4S1RH 2DQFB 5HHXH 1BFVH 5HYJB 2MPAL 4I18B 2NY5C 5EOCH 4D9QD 2WBWB 4LL9A 1P7QD 1TCRA 5E2VL 4TNWF 1MCWW 4MNQB 1JPSH 2Z4QA 3UPAA 1N26A 2O5YH 4PYGA 4KKBC 5E56A 4LAQL 3OJVC 3UYRL 2WBJC 5CILH 5F9AC 4NFBA 1IARB 1FAIH 5HHMB 3VXSB 1RJZB 1NCBL 1N6QH 2J8UE 2CK0L 3IJYB 2IMNA 5IF0B 3JTSA 3D6GA 3VH8G 3OKMA 3ARYA 2R9HD 1ROWA 2XRAL 5GGVH 4X6DB 2X44D 4I8DA 4NC0B 1FBIL 5CLTA 4P4KD 2IH3A 3QO1B 2X4UB 1I7UB 4R2GC 4HS8H 1O5DT 3RKPA 3FB7B 1BD2D 4J4PA 2HVJB 3CD4A 1ACZA 3G6JF 4UV4L 4AY0A 4QHKJ 1Q38A 2QQNH 2XFXB 1QSFA 1MJUL 4KGLA 5B39B 1PKOA 4IS6A 1WC7A 5K9KB 4KJPC 5DUBB 3W2DL 1AXSB 5K59F 5DK0A 1VFBA 1C5BH 3VFPB 1QEWA 4YR6B 3KAAA 2DQJL 2EKSB 2I5YL 3ARDD 3C5JB 3X12A 3BN3B 3AY4A 4DTGH 4BQ6A 4Y0GA 3P77A 4X6FA 4ZOCA 5DFVD 2F19H 2HJFB 3MR9B 4OZGB 3MA7B 2O5ZL 4XI5D 4U6VL 5C0EB 5E6IB 1RIVH 4CVXB 3GSOA 3MNWA 1OAYH 5ALBH 3O2DA 5SV3A 1AR2A 1XGTA 4NM8H 3G6DH 4LPWA 2VITA 1G9ML 3Q6GH 4M9OA 4PJ8C 1I8MB 5DZLA 3UTTE 3ZMRA 2HJLB 1M71B 5ADPH 1B4JH 2BNUB 1QD0A 1ZA3B 4Q58C 1NCWH 4LAJH 4HC1A 3VDBA 4PRNB 2VDNL 2VQ1A 4Z7NE 2OYPA 3GI8L 4OCMC 1N7MH 2O61B 3ARGC 3B9AA 4MDJB 4TSAH 3FHAA 3U7YL 1UGNA 4DUVA 4N8VB 4KRLB 2J5LC 5IW1A 4G3YL 1M6OA 1CFSB 1D6EA 5ESQB 1WBZA 4TSCL 4HAGA 5CZXD 1OF2A 4KJQC 3MV8D 3GJFA 5ID0A 1QHOA 1YDPB 3RDTD 1JPST 2C1PA 1MHPH 3WFDL 2XZQL 5I1HH 2DQUH 3SDCD 4YNYA 1G0DA 1IGFL 3QQ3B 1KG0A 4LVOB 1R3KB 1NGYA 4OFYA 3WUWB 2GAZB 1KNOB 4L9DA 3QCVL 4OD3L 3B43A 1FVCA 4HWBL 5BZDA 1RV6X 5FYJL 4Y16C 1J1PL 4N90D 1ED3B 1FNSL 1AGDA 4OT1L 3GMMB 1XIWA 2FX8L 5CJ8A 3NIFE 1BIIA 3DMMD 3GRWH 4OLUL 1UM4H 5A2KH 2KBGA 2Y36L 3FN3A 4D0DA 1MSPA 2QADB 4DCQB 5EBLA 1F3DJ 3RPKA 1ACYH 3U7WH 1BMGA 3O6KL 5D2LF 3FO0H 3O3DB 4HKJB 3VRJA 4JRYE 2PXYB 1FFOA 3O6LH 1HINL 2VIRB 3ILPB 3OG6B 4GKSB 3G6JA 1QLFB 3RVXC 4KK5C 2P7TA 2APVA 2R1YB 5JMRA 4X8XA 4JR9H 4AMKL 2E7HA 3HG1E 4WO4A 5C0FA 1FCCA 4I3RL 1CDIA 1R3HB 3UX9B 5C07B 1MWAL 4XNYL 2VQTA 4ZD3H 3BW9A 3DWTA 1OVZA 4ONHB 5BS0A 4J4PD 5KS9E 5D71H 2Z35B 4G8IA 3WIIH 3TBVA 3IAGC 4EN3C 1AHWA 4LVHB 5B38A 1L9NA 2E5EA 1I75A 1QSFD 3RZCC 3SKJH 4JDZB 2RFXA 1Y0LA 4JDVB 4P2QD 4I3SL 5E00B 4YHKH 4CW1B 1LO5A 1OSPH 5DSCB 1HWGB 3OXRA 2WLYA 2F8VA 4PY8J 5DJ8A 2MCPL 1DQQB 3RY6A 3F6LA 1X5IA 5DQJB 4F7EB 1I9IH 3VXME 5IMKB 4WUUE 4LPUA 3BDBA 5C9JB 4LCWE 3OR6A 1F11B 4DKFL 1DN2A 1FL6A 1PQZB 5EG6C 4L8SA 1OOAA 3HE6B 2CQVA 3QUMB 4HIXL 2A83A 4RA3A 2VO5A 5JXEA 3FZUD 4BH8A 4P59H 5DRWA 5I0ZA 3ALWA 4AZ8A 1YMME 1DUYB 1I7ZB 4Y4HA 2PTUA 2X4PB 4Q6IB 3LKSA 1UB6A 1RJLB 2VXQH 2VWEC 2VLKA 5GQBA 3GHBL 4HKZB 1IGTA 1Q94A 1JL8A 5HDLA 1ZHLA 4WW1B 4X5XB 3U9PL 2BC4B 3GUTA 1IGCH 4XMLH 2R69L 5LGJA 1NEZA 1E0OB 1NFDB 4YUEH 3FOMA 3MLYH 3MCKB 2HTKD 2VZUA 1G7HA 2JK5B 3W9DB 1PZUB 5JORB 1MLCA 4PJGF 4MD5B 3LSOB 4PTTB 5I1LA 1ZK9A 1D9KA 2VABA 2DS4A 4M5YH 3WL9B 1EJ6A 3RWGA 4QCIB 5C0ND 3SKMA 4M7ZC 1KV3A 3FQTA 5C0CA 3PXHA 3NIGE 4JY6B 4XMKL 5K9QI 3WLBB 1CVRA 2I24N 3EW3B 2AJ3A 3L3OB 1KFAH 1NFKA 3AAZB 4MSWB 5BOPA 4K94H 3LV3A 1G7LB 2CKBL 1FE8L 5GJSH 2GJ6A 1UC6A 5L9DH 2F5AH 4NSKA 2VJXA 4MAYB 4WWKC 2F54A 4ODUB