1RU9H

Crystal structure (a) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected in-house.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
221
Chain Sequence
b'RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
molecule tags Immune system
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
total genus 44
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9H01
4BELD 4YXKL 1HEZA 1ZLVH 3MV8B 4G9FD 1EMTL 3C60A 3BQUD 4KJYB 4V1DD 2X4PA 1LE9A 2AJYH 3HNSL 4ZFZA 2ZJSL 3W2DL 1HK6A 4X8JB 5GSVA 3TLRA 4P2QE 4CVXB 3HAEA 1TIUA 1ZS8A 3D0VA 3LSOB 3PF2A 5J1TC 3RWHB 3RA7L 2YD8A 5GGRY 4HWBH 3BSZH 2G2RA 3VD4A 3LRHA 1IKFH 3QQ9D 4LRNL 3QWRA 2GTZB 2PTVA 1A9BB 4UZGA 2H2SC 3OGCB 2FX8H 2NY0D 3BH9B 2ADGA 2AGJL 3R8BB 4M1CD 4K9EC 1GOFA 1OVZA 4YO0A 4YBQD 5I6XC 1LO3L 4D9RE 4KK6D 3GSRA 4FQLL 4HLJA 4MCZA 4OF7A 4NUJB 1EHLL 5BZDB 4NWTH 1MHPL 5E2TH 4X6FA 3LKQB 1A4KA 3PWUA 4MCYA 3VGAB 3CFEB 4HKJB 2A77L 4OT1H 4PJFB 4XVUC 1MWAA 2VABA 4LCIH 3ZTNH 1PZ5B 2OL3H 2HVJA 2V7HA 5E24E 1VKXA 1A3LL 1G7MA 3MV01 5IMKA 1JRHH 3SHSA 2R69H 4G9DA 2XT1B 3O2DH 5IKCA 4U1NB 5CIPA 2Y6SD 1RMFH 4KH2A 1K4CA 1KG0A 4WGWB 1WBXB 3G08B 1J11A 2P5WB 4GMTL 2F74A 2DMBA 3D3VD 4ZAKB 4E0RA 2XYCA 3KLAA 5I1HL 1WFNA 4A2LA 3GGWA 4PRIE 5FUZH 5LJYH 1KT2A 3SGKA 1P6AB 1MPAL 1B4RA 5FK9B 4ZFGH 4Y16D 5EZIH 4Z6AT 5GS2D 4JO2H 2R0KH 2ZCLL 3F5WB 4LNRA 5C92A 4YXLL 4PJ8A 3BP7A 3GDBA 3NZHH 3SDYL 4C4KT 1UKTA 3MMEB 5A3ID 1XGTA 4J4PC 4PYHA 2NY3D 3IDMB 4XAWH 1WEJL 1IILE 5C3LD 2IH3A 3HPJA 1OAUH 5KOMC 1BFOB 1A4JA 5BXFA 2WP3T 4E42A 4E9LA 5L2KE 1G7IA 1UB6B 5FYLH 4JEGB 1WV7T 4UT7L 2VC2L 1ODAA 4OM1L 2UZXB 4FQIH 4UILH 3PGDB 1JNLH 4WTWA 5HSFA 3MLWH 1L9MA 4X6FB 4L3CA 4I0PB 3KR3L 3TJHC 2GJ6E 2ADFL 3H8NA 2VSDA 1CCZA 1JGEA 3TA3C 2E6PA 1F11A 4PLNC 2X1OA 4KJWC 4Y1AD 3QULB 3NGBC 4XCCL 2IFGA 3C6LA 3OG6B 4PGBA 1F00I 1M1SA 1ZOXA 3LV3B 4WI6A 4DKFH 1IKNC 4DEPB 3VXRB 4HWNA 1RJZB 3G6DH 4XC3H 1RSFA 5D9SA 4GAJL 3OZ9H 3THML 5F89A 3SE3A 1TENA 3MV7A 1MJ7H 4YHLL 1B3JA 2ZOKA 2F53B 5FEBA 5A2FA 1I1YB 2D2OA 4HT1H 3K74B 4RDQG 3GMMB 43CAB 4MMZC 1JGUH 1KPRA 1T03L 3Q6GH 4LGRB 2QQKL 4D9LH 1EVTC 3VGDA 1FO0A 5DR5L 4D0DB 1KFAH 3C60B 1RV6X 3AB0C 4A6YL 3FFCB 4TN9A 2H26A 1HXMA 5ALCL 2W0KA 4LCYB 3U7WL 4HIEB 3OJ2C 4TVSa 4FABL 3U9PL 2VLKA 4OI8A 3OKKA 2AJYL 3HNSH 3W2DH 1TTFA 4WEBL 2PO6A 2OCFD 4U1LA 3QUXA 3OKDA 5KTEH 3FB5B 1LP9B 3BKJH 2J3SA 1V3MA 1BAFH 1BZ7A 5E03A 4JN1H 2FX9H 2HKHH 3QHFL 4HUWA 1XT5A 2OLDA 1A2YB 3LB6D 2ZKHL 4LU5L 5F9OL 4QKXB 4F8TA 3BRFA 4NHUB 4ESKA 4X6DF 3EOAA 2GK0A 4JKPH 3O3DB 1DVFB 1L7IH 3JTSB 1U2HA 3AREA 4MA8H 5EU5A 1X4XA 4TPRL 3KVQA 3PP4L 4WCYH 4JCMA 5BOPA 5KS9F 3NIFF 4HSQA 3S35X 2NXZD 3SBWC 1UXWB 1D9KB 1RJLB 1QSFA 2HAZA 3L3GB 5FO7B 4ZS7H 1L4IA 3DVFA 4Y19D 2YUXA 5KVDL 4HXBH 4TSCL 5JNYB 3BUYA 5DVKA 1AD9A 5DJZA 4NDMA 1J05A 2EH8L 4FTVB 4XVSL 4YBLB 4J6RL 5TFSH 1CDIA 2VXSL 1UJ3C 2GSIB 1L0YA 4B41A 5FUCC 1IGCL 4W6WB 1P53A 1VGEL 4Y4KD 5JXEA 1A9BA 3WN5A 4ERSH 3H0TB 4HKBA 3DV6A 4M9OA 4QRPB 1NPUA 4R0LA 4U49A 3STZB 2R39A 5TQ0L 4J1UA 1MQKL 4Y16C 5KJRL 1BZQK 3V2AR 3BPNB 3LKSA 3ZKXB 1YEFH 5D1XC 3G5ZA 3RNKA 4Y4FA 1ADQH 2BVOB 3T2PA 1FG9C 1GGUA 1KCUL 4R7NA 3TCLB 5HGAB 2XRAL 5FIEA 4HIHA 3O3BA 1RZ8B 1QTYT 5F1OB 2EO9A 1EEZB 4IHOA 2A2QT 4MXQC 3EYFB 4IOSD 1FZMB 3SGDH 3RY6C 8CGTA 4HJJH 1JIBA 5DS8B 5BVJB 4ZD3L 1F97A 4P2YA 1JV5A 1MELA 5HHME 1I7ZB 3BPCB 5EN2B 4GAFB 4U6XB 3ULVL 2OR9H 2ICWB 1F3DJ 2E9JA 1CR9L 4NQCA 4G8FA 3BIBX 3CDYA 1QA9A 4JPIA 4O4YH 1BD2E 1RUPL 1T3FB 1RZGB 3QDMA 2A0LD 1J1OH 3O6LH 3QDJD 4D3CL 2BOBB 4WI4A 5EUOB 1QFWM 4KRPB 1HXYB 3RVVD 3QUZB 4G8EA 1RMFL 3SDXF 1ORQB 1TTGA 5SWSE 3QXVA 5ESVA 2P42B 3QIUD 3U4EB 5FYKD 1KPVA 3W11C 3RAJL 2BERA 3C09C 2R23B 4XAKE 2Z93B 4TSBL 4OM1H 4WO4D 2H1PH 3QUKA 4Q6IB 2NW2B 3AROA 2FH8A 4JHWH 1FZKB 3MLTA 3NIGE 4M4RA 1SBSL 4IOFD 2P48B 1FDLH 4PB9H 1M6OB 3PDGA 2EYSA 1EFXA 1KIUA 5C08A 4J2XA 1ZANH 5C0BD 4P57A 1OWWA 4O2EA 5IWLC 4OD1L 1MCOH 4HEME 5FO9A 3TC9A 1REIA 1IQDB 1WZMA 3DO7B 4LHUG 3H3KA 1QFWL 3P4MB 1EH9A 3PWPA 3WFEH 1QSZA 4MNQB 1WTLA 5IOPB 1AGDB 5L2JA 1TQCC 3NIGF 2IG2H 5AWNL 1NCBL 3O9WC 3G5ZB 3G6DL 4XC3L 5FFLA 4LRNH 3ARBA 2K3TA 1I8IB 4JM2D 3H42L 4KC3B 5I30H 5FYJE 1U2CA 4MXWH 1P2CA 4I77H 2PF6A 3BT2L 3QSKB 2NY5L 1INQA 5F70A 3EYSH 1A4JB 4X0KA 1H5BC 4QTIH 4HULB 3RGVB 3MXWL 3NFSH 4PB0H 3VMNA 2WQRA 1JE6A 1XAUA 4WU7B 3RWFA 1JWUA 3WKNA 4ZS6C 1QSFB 3K81A 4M7LT 2PETA 2CLZA 2J6EA 3PWPE 5IBLD 4MNHB 1YECH 3C09B 3FT4B 3H3BC 3LDBC 3MJ7A 1JWUB 4Q2ZB 5FM4A 4NGHH 4JY4B 4A6YH 2NZIA 1ZLWK 3QIWA 5J06A 1Y0LB 3EZ8A 5E08L 1KN4L 1YY9D 1DVFA 1Z2KA 4XVJL 4MA1B 3J8F7 3HC4L 1PLGL 5FGBA 5H35B 5KS9E 4AENA 2JIXA 3FFDA 1YMME 3RX7A 1KF9B 5D1QD 1HE7A 3SBWA 4PJ9A 1FORL 5DJ6A 4GW4B 1CLZH 1CLYL 1SVZA 3VFTA 1I7UA 4NC1C 2YD7A 4OD2B 1NFIB 2IPTL 4NFDA 4YHLH 5DVOA 2KDGA 3KWWB 1SM3H 4OGXH 1T1ZA 5CIPB 3BGAA 1M4KA 4U1JB 4S0TD 4Z7VE 3UC0L 2P8PA 3DARA 4ODSH 3OKDB 3IDIB 4N9OB 4F9LA 1VFOA 1DBML 3OKEB 3GSNA 4GJTB 5C07E 4BQCA 2YWZA 3T65A 1WCBB 3IFOB 4OV6F 3DYOA 1UWEH 5DR5H 4QHMA 3BRDA 4NQED 1KFAL 3MRPB 4W4NA 1J12A 3AAZA 3GSVA 1G0YR 4I3GA 4JJ5A 1XGYH 5LG1A 5C09E 1DLFL 5L6YL 1I1YA 4RX4D 2CLVA 3AS0A 4KJPC 1YDPB 4BFIB 1W8NA 3RWCB 5IW1A 4RZCB 3EJYC 3HNVH 5EO9A 4JFEA 3NBNA 3BD3A 2WWKT 1HQ4B 1MSPA 4JFQB 5F7EL 5I71C 3VDBA 1NC4D 1IEHA 4KQ4L 5F6HI 5DJXA 3TVMD 1S7SA 5T33H 5E2VH 4PJEF 3UZVB 2GEEA 5TQ0H 4NRYB 3T3PF 5HGDA 3BYYA 5BRZB 1JV5B 5DRXB 5EU7C 3VRLE 3BHBA 1JHTA 4APQD 5E4IA 1JZ2A 1BEYL 3QXUA 4XX1G 1IC7H 2FRGP 1E4KC 4UIMB 1JN6A 1K8IA 2IPKA 5HGAA 1CGTA 1IGML 4WFHE 1YJDL 4NKDB 1QBAA 1ZT1A 1I85A 3WO4B 4GG6B 1FFOB 1LK2A 4FMFA 3ZDYF 1E27A 4NQVB 1FV1A 3RBGA 3MV8A 3ZDXE 3DV4A 3Q0HA 4HXBL 4MQSB 4TSCH 1WISA 5JMRA 3KNBA 3SDCD 4WHYG 3I6KB 4NO2A 3CK0H 4O4YL 3GMPA 2N1KA 3B43A 3JVGC 4GAGL 4X99A 4TUOA 2X5PA 2AQ3A 3D39E 3MGOA 4J8RB 1W8OA 1JF1B 4QF1A 3FO1A 4HDIB 4QRQA 3K1DA 3TBTB 2FJGA 4RAVB 5E2UH 1QLEH 2EYRB 2D03L 1WT5C 1C7SA 3SN6N 1XMWA 3O6MH 1PQZB 4X7TB 5L2KB 4MAUL 1EV2E 2G75B 4K8RH 2P5EE 3SOBH 4C83A 3VXNA 5HYSG 4Q74A 1ZHNA 4TQEH 4M3JA 5CINL 1MJJA 4WFFE 4JG1L 2VXTH 4N0FA 2EZ0C 1FFPA 2LU4A 4PJBE 3DROA 5AAWA 3EO1A 4P99A 4NQDA 1CLOL 4P5KB 3MACL 2CGRL 1DQML 4Z5RB 2VDPH 3LKOA 4WNQA 4Y88A 5GIRB 4HG4K 3U30C 4L4TD 1N6QH 1T89A 2VR4A 3MOBH 3WNMA 1F6FB 4J3WA 1FNGA 3QUXB 1G7MB 1AP2B 5GGTA 1RY7B 4Z78A 2WV3A 1S8DA 1PEZA 3HFML 2DL9A 4L3EE 5DA0B 3LS4L 2YA1A 2JB6B 4MCYB 2H3NA 5C0FA 4XNQA 5GHWL 3JV0A 1FO0H 5D8JL 1MWAB 1YNLL 5GRWA 1X44A 2YN5A 3FB7B 1PKQA 4JHWL 5KG9A 1FGNL 2ZG1A 1G84A 4RFNC 3HMWL 4Q9BA 4CMMB 4AG4L 1DBKH 1N3NA 5D7LE 2CO6B 3OV6A 4MYWB 1C5DB 4KUZL 2A9MH 2I25N 5E08H 5I9QB 3VH8A 5EH1A 1VFAA 2ZUSA 1MRFL 4UUJA 5FOJA 3B9KA 4N8VB 1BX2A 2P44B 5SWZA 2MKLC 4LLUA 3T2NL 2GTZA 1KLGB 4EUPG 1FNHA 1C5BH 3MJ9A 2BHUA 2OTWB 3U30B 5IESH 4P4KC 2FWOB 1G9MH 4NKMB 5E1HB 5EBMA 5K33A 3SQOL 5ICZB 1JWSB 5H94A 1KACB 3BT2H 4JRWA 1V3KA 3SDDC 3C6LB 4ELMF 3EYSL 1D5ZA 2CLVB 4J3XA 5JUEL 3VI3F 2B7DT 1IGFH 4AIZB 2C1OB 4EBQL 1MCJA 3BMWA 4ZYKA 5D7IE 5MP6L 3N1FC 4X8JA 5GSVB 3N06B 1FAIH 3FO2B 2ICEA 2EE6A 1D5XA 3CIQA 4WWID 4ISVA 4NT6B 3ULVH 1X3DA 4H1LH 4HV8A 1RIVH 4S11A 4YNYB 1IAMA 1S7RA 4P9HC 4X6DA 3NZ8B 1LO4L 4HJGA 4QRRB 4YHNB 1OLLA 3ILPA 4JKKA 3ARBD 1CXFA 3MX0A 3VU2A 2DJSA 1YY8B 4MJ4A 4QOKE 1PY9A 2HJLB 3QRGH 4K71B 3REWB 3BE1H 4QXUL 4ZSOB 5GZND 2D3VA 4NJ9L 1ZGLM 2XWTA 3T0EA 1OP5K 5KN5A 4GW4A 3VFTB 5E6YA 1NGXB 4AK1A 4KRPC 5DHXB 3K46A 4X6CF 4QRPE 4GW5A 3IFLH 1WWWX 2IAMB 1JHKH 1XZ0A 3SDAB 2OJEB 3A6CL 1M7DB 1FL3A 4YHIA 3IDXL 1X5YA 2XWJA 2YMXL 4KKLD 4PV9B 1KT2B 1TVHB 3P4NB 1F4XL 4FG6D 4YHYC 1TCRA 2F74B 3O0RL 1U8IB 4YGVB 4LCUA 1X7QB 1J0JA 3WEXB 4BQBA 1IGIL 4U6VL 4DCQA 3D25A 1D6VH 1T7WA 3MLZH 3SQBA 3S37X 4D94A 5J6HB 3DBXB 1NEZG 4K7PX 2XN9D 3GHBL 4CUCA 1YEEL 3TYGL 3S5LA 1S9XA 1A8JH 1IGYA 5HVGB 4LHUA 5HD8C 2EZ0D 3W82A 1JI1A 4BQ9A 4I8DA 4RQQA 1HI6B 1LK3H 1CN4A 4ODXA 1H9VA 5AG8A 5F21B 4KTEH 2PNDA 1R5WA 4NQEA 1EBPA 5E00A 3QIUC 1D5MA 1H8NA 1EFXB 5C08B 2NY2B 1FG2A 3CPLB 4KHXH 4MD4B 2BY1A 2V5SA 4N0UB 4Y2DC 2WQ8A 1S5HA 3U7YL 1NGWB 3TBWB 3QUKB 3JZ7A 4KZDL 3GSUB 2NY4D 1CGYA 1F4YH 1I1AA 3ARGC 5GGTL 1M71A 2B4CL 4WW1A 4C57C 1QSEA 4LF3A 3GUTB 1OPGH 5TQ2H 5CP7B 2ZUUA 3QUML 5CMAA 3CZFA 5F71A 4JFXA 1W0YT 4QRUB 5DWUH 4M8QB 4JZNA 3QEUA 4XNZC 5CKGA 1INDH 4NC1E 5C8JB 3TP4A 4O02L 3D39A 3CSYB 2A73A 4XPAL 4EI5C 2OI9C 3SY0A 5DJ2B 3L5JA 3NTCH 5GISH 1AGCA 3TBYA 2DD8L 5KW9L 3TIEB 1HHIA 4FZ8H 3MV9D 4ZUUB 4NZUL 5I19L 4HH9B 1AY1L 3X12A 3VXTB 1WFOA 3FN0H 2APWA 3VFRA 2ZSWB 5E7BA 1DBJL 3O3BB 4G3YL 2NLJB 1KB9J 3DUUB 3DTXB 4R7NB 3KLDA 3WKML 4WHDA 1N59B 3MQIA 3QZWA 2XY1A 4TVPD 1TXKA 4TUJB 4DEPC 2WUBH 1MIEL 5I6XB 2EDRA 2ARJQ 3T2NH 5KSUA 3KPRD 2CSPA 5KS9B 5HGHA 1HILA 4M48L 2EYTB 1KXVC 2X7LA 2IH1A 5HYJB 4LASL 3OWEA 1GL4B 2LVEA 3SGKC 1A7RH 1K4DB 3BMVA 4O2CB 5HBBA 2FEDD 3N85L 4B0MM 2GFBA 5KSBB 1OGAB 3KYNA 5C3TA 1TLKA 3TFKC 1O7VA 4HWEL 4OI7A 1KYOJ 4OSUH 2RFXB 3K4ZA 3CSYA 3UTPE 4XMPL 2A1WH 3I75A 3LKPB 4I48B 4ZXBB 3TN0D 4IOIB 3IGAA 3VWJB 4HKZB 1OTSD 2DQIL 2GITA 4XNMB 2EEDA 3PGFL 2P5WE 3O3DA 2WUCL 5E94B 3V0VA 2DQJL 1ITCA 1M71B 2R4RH 3WJLA 5LAXB 3EDFA 1A22B 1YC8A 2O26U 3VWKA 4WFED 3LEVL 2LAAA 1AJ7L 2N7BA 1UWXH 1RK1A 1YC7A 2CIIA 2E6JA 3BKCH 4L8DB 4NM8H 1C5BL 2EKSA 4KJPD 5JW4M 4OBSA 1OAQL 5DQ9B 4PG9B 3VW3L 4Z76A 4U1LB 2HH0H 1FLTX 3RGHA 4UTAL 4FG6C 5FM5M 4YJZL 3CFJB 1T0PB 1B0RA 3IJHA 2M8XA 5FKAA 1CYGA 4P57B 1YMMA 2V7NA 5FDWB 4MA3A 1N5AA 5HY9B 3W0WA 3H9SB 2G60L 3IRPX 4JM4L 5I16B 5IM7A 2EH7H 2OM5A 4L8SC 4ZOBA 2UWEA 3NFPA 4JFFE 2VDLL 2HFFB 5ID0A 1PG7L 3LKRB 2R9HD 3CMOL 4OZ4A 4N9GB 1LILA 4DGIH 1BQLH 1IGTB 2W0PA 2NX5B 3E2HC 1MFAH 4PJ7A 3IKCB 1T7XA 4JPWL 4K3GA 2KZ1B 2ZUVA 3SDCC 1TZIA 2FO4B 1EHAA 2Z91B 5BW7A 1NCWH 5TDPB 5GS0H 5JQ6H 2P1YA 4OZGE 3IFPB 3VXRA 4FQ2L 3VGBA 2DKMA 3S98A 3SDAA 1DFBH 5A40E 4QHNB 3QULA 4C4KO 1ES0B 4JG0L 4KV5E 1NSNH 2UZYB 4JRYA 1YPZA 4PJBA 4QYOB 3Q5TA 4JKMA 1DUYB 2A9ML 3DX9A 1CE1H 3R06B 4GQ9H 1LWRA 3EYFA 4PRBA 2KKQA 1VPOL 4YQXL 1CE6B 5C0AA 3V7MA 4YC2B 4ZUVA 4WU5A 1KIRB 5D1ZD 4D9QD 2FR4A 2W59A 5JHLH 3PGDA 1HH9B 5F1IB 5B38A 2DQUH 2V17H 1VEOA 4GAJH 5EU6A 2EDNA 3TCXA 3NCFB 4EI5D 4XPTL 1YY8A 2H9GB 4H25B 2AEIT 3P0GB 3ZT5A 5GGUB 4FXKB 4XCEB 4M5ZH 4JPKL 4X9BA 4OCRH 3G6JF 2JIXD 1GAFH 2XTJB 1FVEB 4MS8D 2CIKB 1TJGH 1AI1H 3KPOA 1U8OB 1NAMH 2CH8A 1D7FA 2D9CA 5ITBL 3RL1A 5E99L 2H41A 4MJ5A 5IVNA 4MZ3A 4JRXB 1UEYA 5AD0A 2W65A 1S7TB 2VYRE 5HDOA 4CN4A 1A6PA 3KLHD 1MVUB 2WMPA 1BHGA 5HGBB 2YA0A 1FC2D 2R2BB 3BWAB 4I3SL 1T83A 3RVTC 2A6JA 5D7LA 4LOUC 4P2QB 5FCUH 3BE1L 4QXUH 1UWGH 2WBJC 3EFFA 4YK4C 2W9EH 4N8VA 4OBRA 2P7TB 4TYUA 3ARTA 2YC1A 1N5YL 2ED7A 3IAGC 1PKQE 4UUJB 5A1AA 1AGBA 3KS0H 2VL5A 1NL0L 2FHCA 1T0NA 4P3DA 5T5NG 3SDCA 2D0FA 4HIJB 1HCFX 3LN4A 3LEXA 4LU5H 3MNWB 3CVHL 3EGSB 2Q3ZA 2YOCA 2HYMA 4ZFGL 1GGIH 3DURA 3SCMC 1E4XI 3HE7A 3TN0C 1HWGB 1T1YA 3ORJA 3GMRA 2IPUG 3OAZK 1P7QB 3K1KC 2VLKB 4P23C 3OB0K 1MRDL 3ELAT 5IJVB 4R4FH 1QKZH 4JQIH 2EE3A 1K5NA 1OARL 4OAWB 1UJ3B 3VFVB 1T22A 4BM7A 4HZAA 5BZDA 4MDJB 1UA6H 2DQTH 5I1EH 3ZO0A 3DYMA 1BBJA 2CRYA 1BIIA 5ACZA 5DSCB 2VDMH 4JO1L 5HHMB 5JXAH 4G3YH 4PTTB 4PJFF 3GSQB 4UT9L 5E7FA 1WCQA 4Z7VA 1R5VA 4FQPA 3OX8A 5D1XB 3UJIL 1AIFB 3ULUE 5DO2C 4KK6C 4KVCH 3VMOA 4UT7H 3O6FB 2ZG2A 4KDWA 2YA2A 1AGBB 4L4TE 3QXAA 3T0WA 4G7YL 4PRPE 5JORA 5TJWK 4HS8L 2YXFA 5K9KA 2BSTB 4TNVK 2APVA 5IB3B 2NTSP 1BF2A 4MQ7A 32C2A 1MFCL 3QIWD 4GG6F 5EWIH 1A7QH 5KOVC 5EU7E 2OR8A 1Z9OA 4KI5E 3LN5A 4GG8B 1WAAF 2Z92A 3JTTB 2HRLA 2X89D 2DI9A 3WL9B 3T3ME 1A02N 4NO3A 1HYRC 3PHQB 5FA3B 1FNSL 35C8H 5KVFL 1S7VA 1F4YL 1LE5B 2C3WA 4LSSH 2JJTA 2DLIA 1KIPA 1OM3L 3QCTH 1TZHA 2IMNA 3UTSA 3VXQA 3GMPB 4RSVA 1P5UA 3SKUD 1WBYB 3QPXH 3RPIB 1MCHA 2Z35B 5T3ZD 1RUPH 1TPXB 4XCEA 4ZUWB 3UTZB 1I1AC 3SKMA 2QQLH 1MEXL 3O2WH 4CNIB 1X5AA 2ZSVA 1T5WA 2MKWA 1RU9H 4FQHB 5J57B 3KXFD 5ISZB 5JIKA 2W9LA 2FECI 4IMKA 1BFOA 2QQKH 2X70B 4NSKB 5GISL 3N9GH 4HD9A 4CU7A 5C6WH 1W2KT 4GRLB 3IDMA 3MYZA 1X5FA 3X3GL 2WWMC 4I18C 3DUSA 3VFMA 1U3HD 3O6KL 3DGGB 3RKDD 1IBGL 2JJTC 2IQ9L 4GH7B 4OIBA 4PJ8B 3QO0A 5HDLA 5HHOA 1C16B 3GRWL 3O3EA 4XMKH 3W0WE 3O3AB 3TT1H 2EH7L 3IS0X 5TDPA 1XF3A 1NGQL 4DZ8A 2HKHL 3X13A 2WUBL 5LGJA 4N0UE 2YRZA 5C9KA 3ULVC 5AEAA 3P0YL 3FN9A 1BJ8A 1ND0B 3FQUA 2R1XA 3ESVF 3BEVA 5IHZA 3WHE1 4JO4L 4KFZC 1A6AA 2OJZH 5IROC 4R96B 2R4SH 1OTTC 4DK3A 3P73A 3FB8A 3MRPA 4JKWA 5IHLB 3L3OB 5IGXL 1BREA 1PGRB 4FQ1H 4EKXA 1G9MC 5M95B 1UB5A 1YYMH 3PDDA 2EC9T 3MV8D 1CS6A 4HKJA 4DN3H 1ZGLA 2X4UB 3BQUB 2WBJD 4XMPH 4UT6H 3PQYA 2VLME 4KKCD 1NCDL 2V7NB 4PJ7E 4DVBA 4HHAA 2CDFB 2XACC 1QFOA 4J3TA 1N26A 3I6LD 3TV3L 4EN3C 3QNXB 2JF1A 5TE7H 3WFDH 5DTFB 3KWWA 1RUAL 1EUTA 4JVWA 4HMEA 5MEQB 5IVXE 4RMTA 5GZOD 1PLGH 4R3SB 1QG3A 1CICD 3V4PH 1DBAH 3QDGA 3BO8B 4H8WH 1GYAA 2FLRT 5JHLL 4NQSB 2F19L 2R1YB 1H3XA 3MR9B 4R90L 2AGJH 4P23D 1ADQL 5DMGD 5C0EA 1L6XA 2BRQA 3U83A 4YHOH 1RIUH 1KCUH 2PXYD 3PDOA 3QG6B 4OLWL 4WV1A 5J12B 4OZFA 2SEBA 4JB9H 2CMRH 2X09A 2PUQT 4Q2ZA 4AT6A 5JW4N 1UM6L 1I4FA 3OXRB 4KQ3H 3LMJL 1KJ3L 4Y4HD 3PV7A 3SE4A 3DIFB 1KBGH 3S37H 3S34L 1MNUH 1B4JH 4ODHL 2FYYB 1DEEA 4LARH 3MUHL 3QIBD 5INDB 3HUJB 4TUKH 4KMTH 1NLDH 5IJKC 4JQVC 3MFGB 5EU4B 4CW1B 1BP3B 5MEOA 4M7LL 1J1OL 4YDIL 5BZWA 2CD0A 3LIZH 3TFKD 4OCYH 5J9PB 5C6PB 3S88L 3ZT7A 1FFNB 1NBVH 2VWEC 5F93C 5KSVB 1HKLL 5IOPA 3HNVL 1ZA3A 2DWEB 3CDFA 2NY7H 3O8XA 4G80A 4GSDH 5F7EH 4G8GD 5KSBF 2Y5TB 4NBZB 1TJHH 2H6PA 4ZAKD 2KL6A 5JW5A 4P2RD 2BVEA 4PRID 5F7MC 3ZT6A 1T66D 3ECBB 4IIQB 3HZKB 4NZRH 2V6HA 2WAHA 4OLXH 5DJ8A 4JFHE 2R0KL 2ZCLH 1A6WH 5T1KD 3VFRB 4OF6A 3NAAH 4G42A 4M8VA 3AM8A 2VE6B 1QVOB 3EO0A 2Z8RA 1N2RB 4IRZL 1KIQA 3SE9L 5D2NE 3K4DA 4CKVX 2NY3B 5I30L 3QEQA 4W68A 3BZEB 5TDNA 1GIGL 4M6ML 4OKVA 4I77L 4OF3A 1LDPL 2EDFA 2VC2H 4BZ1L 1C12A 2PCPA 1CL7I 2XA3A 4NQCB 2EDQA 3O9WB 4P3CL 4I5BB 3MJ6A 2P8MB 3RKDC 2R0WH 4Y5VB 5E5UB 3HKFA 4KMQA 5J1AB 3MO1B 5D5MA 3IT8D 2CJUH 5CSGA 2D03H 1KB5B 4Z7QE 4UMGA 1KELH 2ORBH 4OGAD 5ANMA 1G7JB 5IVXF 2ESVE 3BN3B 3CPLA 3SPVB 4HG4J 1U8QA 1G1CA 3B6SA 4PG9A 4ZPTA 2NPLX 2CPCA 4KRNA 1NFDB 4X6EB 5EBLA 4PJDE 3DI3B 4U05A 2E27H 4AZ8A 3F62A 5JHDD 4GRWE 4QT5A 3VG9B 4XBGB 1MI5E 5E6IB 3UMTA 1F5WA 3R1GH 2R1YA 5C0CD 3G5YA 3QFDB 1JTOA 5D96B 1MCFA 3RIAF 1CL7L 4OV5A 4YE4H 5E94A 4HC1A 4Z7UF 2EIBA 4OGXL 1H3VA 4P2RE 4MNGB 4OZIA 4U1SB 4PGCA 5C0IB 4G8GE 5C07A 3QXDA 2RBLA 4ODSL 4OFYA 5DTFA 5I8EB 1TTUA 5I18L 1IM9D 1QFWI 2X4TB 2LFGA 4G6JH 4LLMB 5DZLA 5A2IH 5K9JL 4D9QE 3BKMH 3FQWA 5DK0A 3X3FH 4BZ2H 1NAMA 5ERWA 3Q5YA 3AXLA 3VRJA 2AQ2A 2A9NL 4OTXH 2Q86A 4YPGB 5D8JH 1OLZA 1ZKAA 1JZ3A 3G04B 2K1MA 5HTSA 2XNAB 4N5EC 4JM2C 4IS6A 4R96A 4OLYH 5I15L 2YPVL 2WZPD 1LEKB 4W70A 4X6BB 5C1MB 2FX9L 1ED3A 3OAYK 3L3DB 1C08B 3DHMA 2BVTA 2RGSA 4GG6E 1OWRM 1ZA3B 4S1SH 3S35L 2AV1B 2J8HA 3CMGA 4K3DL 4PJHB 4LIQE 1S9VB 4QXGL 1CBVH 1MQ8A 2MOVA 3MV8E 5BO1H 4Y2DA 3WNKA 3PWVB 3D85D 4F7MA 5CAYB 3L3IA 4IDJL 3UDWC 3OKLA 4UNTA 1DSFL 1G1YA 2Z4QA 3HUJA 4K9EL 2DLFH 3HS0A 4OCSL 3MRRB 2GAZA 3B4NA 3KLSA 5DJ2A 1MFBH 3SJVA 3HE6D 5IB1A 1BWWA 2ICEB 3SCMD 3CX5K 3QEUB 4YHPA 3B5GA 3Q1SH 5CJQH 5GGSA 4KMTL 1WAAA 3BYTA 1FCGA 1R24B 4GAGH 3WBDA 4NKMA 5EBMB 3EKCA 3VFNA 3UJJH 3MR9A 1GHFH 2EE2A 1KLGA 1T80A 4XI5D 1RZJC 4Z95L 2CDGB 2NY6B 3PHQA 1X5XA 4N8CH 4PGBB 4CVWA 3BAEH 3TN0A 5EIQA 1FG2B 4MD4A 2EXYD 2QKIB 5IFJA 2J6EL 3ILQC 3UCRA 4CAGA 3F6IA 4OLUL 5I2IA 4K7FB 4KQ3L 4JHBA 3ULUD 4Z7OF 5CD3A 3NAAL 2G9HA 4PGDA 3ZKNC 1S7XB 3T1FB 1OHQA 2ITDB 4G6ML 4MX7B 1H3UA 2A74B 4OLEA 4KI5C 1CD0A 4NRXB 1XF5B 3MJ9H 1NLBL 4WJ5B 3H7LA 1WEJH 4JFDA 4X8XA 1U8JA 2Z0BA 3WEXA 3SKOA 1VENA 2AABH 5F72S 4E41E 1FC1A 2FBJL 3UTSD 5TE6L 1TCRB 4BZ1H 2R0ZL 3VG0H 5E8PB 4ZTOH 1LNUA 2H1PL 2BNQE 1KGCD 2FATH 4AJ0A 4N0YH 3KPSB 3GMOB 4LLYA 1DP0A 4YDVB 4XCFH 4WO4B 4MXVE 4LAJH 2DQGL 1NDGB 1W0VA 2VNCA 2G9HB 1NBZA 4PGDB 4WENB 5EOTB 3PL6A 4URTB 5ADOL 3KYMA 3PWNA 3MLRH 2X05A 3UTOA 4KK5D 1A1OA 1UH3A 3CVIL 3UPRA 3UO1L 2NY5C 3HTLX 4HWBL 5CZVH 3H42H 3GSXA 2OQJB 2KUTA 3VDAA 3REWA 2FJGB 4P46C 3ARDB 2UUDH 1I9IH 3KPPA 4CDGC 2JJVA 3MGAA 1XGUB 3L6FA 3TA3A 4BH7B 1VKXB 2Z35A 1DN0A 1HH6B 2HT4C 4XNUL 4PGJA 1JGVH 2VABB 3I6KA 4WFGD 2AEPL 4DGVH 2EIEA 1RHFA 4N5ED 2ATPA 3CXDL 5E56A 2L7UA 1R3LB 3FHAA 1WIPA 3W9EA 3EUUA 5E4EC 4G6JL 3E2HB 4MJID 3ROLB 3L3HA 2PYEE 3NCBB 3FMGH 1A6TB 5I1LA 3LH2H 2P5EB 2VAAB 5D6CA 3DX8A 4YFDB 2BCKA 2YPLD 4HUMB 4IRJB 2Q76B 3O4LB 4H8WC 2W1NA 3UTTA 43C9A 5DFTA 2MQ3A 5JPNB 1FNAA 3MOAH 5LVEA 3ULSA 2UY6A 4BH7A 3U9PH 1QFUL 1F6LL 4GBXC 5HGDB 5GRJL 4BUGA 4XZUB 4YDJA 3DUHA 3WXVL 1NMCC 3T0BA 1AKJA 5F1IA 3VXUB 1SM3L 5IB5B 1E4XL 3HAEB 3O4OB 4R4BB 3HN3A 2KBGA 2COQA 3UPRB 4E41A 3P11L 1XGQA 1P4LB 2XKNA 5IVXB 3R06A 4YZFE 5D2NB 2ZUQB 1A6WL 3DSFL 3CU1A 3ZL4L 5KZCD 1NBZB 3INUL 3PGCA 2BNUA 4PBXA 4POZC 4U7KA 2XNAA 3VFUA 1HEZB 3LEYL 3S96B 4H5SA 1F4XH 3IXTA 5F7HA 4HWEH 2NQCA 4P9HH 3FO9B 4X9FA 4OIIL 1QNZL 4G9FA 4ZODA 1LDPH 3MNWA 1KSRA 5TFSL 1P69B 2X4QA 3ROOB 1IFHH 4PJIF 3HZMA 4NM4L 4OFIA 1NMBL 1HKFA 4OZ4B 3MA7B 4Z0BH 3C5SA 5TH2B 1WZ1L 2O5YL 3SO3C 4WEMB 4S1SL 3S35H 4RNRA 3V9FA 4OZIF 3FT2B 4LSPL 5I75B 1DDHB 1Z0NA 4NQTA 4NUGL 5F7WC 5HHQB 3V5HB 4DW2H 4JFYA 1J0ZA 3HR5B 4GLRH 3L5HA 5DUPH 1IZKA 5BV7H 2IBZX 4YR6B 3GSNH 5I9QC 4F9PA 5E8NB 1S7QA 1PVHA 2HN7A 3OKMB 4DKFL 1IC1A 2E3VA 4UAOC 3QEHB 1ZEAL 4UINL 5DT1L 4MNHA 2VXVH 1T66C 4X4XB 2CDGA 1G7JA 3L1OL 2A77H 4WI3A 4GBXA 2B1HH 4J8RA 4NNYA 5D72L 5MEPB 3VWKB 3TPKA 5E8DL 3GBML 1EIBA 3JUZA 1VDGA 3MJ9L 4MWFA 2G5BA 2FNBA 1INQB 4GW1B 4X80H 1S78D 2BSSB 7CGTA 1B0GA 1BOGA 3WHXA 2Q7YB 5GJSH 4YHPB 4HKZA 5HPMB 1GC1C 1N6VA 2M1KA 5SWSA 3LKPA 1KEGH 1E27B 1T89C 1FYTA 5CWSB 2BK8A 2LTQB 1F8TL 2F5BL 1EHXA 4OF5A 3TYFA 5I1HH 1DVFD 2YPKB 3P4MA 1BD2A 4ZOAA 2V5MA 4LVNC 3UYRH 4PP2B 1J10A 1AY1H 1Y6NR 2J6EH 3GMLA 4QHUA 1YPZB 3FN0L 4K3JL 4UQ2A 4JFPB 1H3WM 4P46D 3FQNA 4CVZB 4WFEE 1CDBA 2CGRH 3DVIA 3QYCA 3ZHLA 1HN1A 4I3RH 1GOHA 3FRPA 4JREB 4LDEB 4YPJA 3GB7A 2ZWLT 4L1DA 1HIML 4HFWB 5FB8A 4WW2B 4YQXH 4HUVA 5HD8D 4OD3L 4XAWL 3KPLA 1NCCH 3SGJA 5C0JB 5IW1B 3RWCA 3MBEA 4DZBA 1CT8A 4KDTA 4CADB 1YN6A 2V17L 3EDKA 3M07A 2R8SL 1LEKA 5ESAA 4LLQA 1RI8A 5HGGS 4Y4KB 4AEHH 3L7EA 1T2QH 5HDQL 2QHRH 5HJ3B 1CU4L 3C8KA 3BZ4B 5JPMA 1MI5B 3EYUH 2VUYA 1RZGA 3AAZB 4IDJH 3O2VL 1MFDL 3B9DA 3SKNA 3S36L 4UILL 3MRJB 5C2BL 4ZUUA 4UBDD 4OCSH 3DX6A 4PTUA 4PRNB 3UROR 2VRAA 4PJEB 5SWQB 1XIWD 1TJGL 2GJ6A 3K8MA 5ADPH 4HLZG 1SMAA 1BGXH 1YECL 1XGRA 3FMGL 3SJVD 2O61B 3D9AH 1S3KH 3BEWB 4XVSH 4NN5B 5MHSD 2Z9TA 2AXFA 3RZCC 2X4OB 4QRUA 3BSZL 2B0SL 1GGTA 4NZTH 1TDQA 2HA1A 4BK4A 4JLRB 4UB0H 2OSLA 1E4JA 4LIQH 4AIOA 4YIQA 3VMPA 1CGSL 1F6AA 5EC1B 1KV3A 2VLJB 1YEFL 5I66A 3QEQD 4U1GC 1JYVA 3HG1A 3KPRE 1KTKE 1SEQH 5IHBA 2X41A 1QR1B 3N0PB 4DWHA 1DQQB 4PBWD 5GGRB 3B6SB 1G7PB 2E5EA 4FTVA 5EORH 1TITA 5HHOD 4NWTL 3FT4A 1AD9B 4K07A 3QHZL 1JNHA 1VACA 1MAML 2XN9E 4YHKL 1KN2H 1C5CH 3LQAH 4G8GA 4C56B 1MLBA 4PRIA 5C0BB 2ZNWA 4IMLA 4X4YA 3NH7L 3PHOB 3S7GA 4Z7WF 5I1EL 5F6IC 2PXYA 3M1BB 3IJSB 5DQDH 1MI5A 2VDML 2EYTA 3ARBB 1R5IB 1T2JA 5HJ3A 4LRIA 2PYEA 5TE6H 3NA9L 3UBXB 2W0FA 3QDJA 4PJDA 5SV3A 5IMMB 2YBRA 5CHNA 1MCBA 4JY6B 4QLRA 1YEHL 2DLEA 4ZTOL 1TQCB 2DQEH 2AK1L 1DL7H 1JPGA 2XWBB 5F88A 1BM3L 3FN3A 1KCSH 1CF8H 1RZ7H 4MB5A 1D6EA 1L7IL 4PRAB 3I2CL 3OR7B 1H5BB 5IFAH 3ZL4H 3ZE2E 4MGXA 4XI5C 2V2WA 2NW2A 5EWIL 5DXWA 2ZUWA 4GQ9L 4GXVL 4GQPH 1OCWL 2X4NA 2FSEB 1MREH 3GSNL 2VSCA 4GKSB 2C3HA 2EIZB 1AO7A 2FGWH 4R97B 2VUOA 1IGIH 3I3DA 3QUMB 5DEGB 4L9DA 4DKDC 3D39B 4LSRL 5T1LD 4NN7B 4XXCA 3P30L 1AR2A 5IROA 3K2UH 4DN4L 4JM2A 3MCG1 3BOVA 5IBTH 3KPNB 3CK0L 4PLJC 4R6UA 3WD5H 5JTWA 2D7PA 4FZEL 2F54B 3KYOA 3NFSL 1NMBH 4U1HB 3BXNA 4X80L 1GAFL 4ONOA 2ICWA 2VR9A 4Z0BL 1LK3L 1SJHB 4L8BA 3CLEL 3E8UH 4HK0B 3VXQB 3ULUL 4AYFA 3DXAB 1CIDA 1YQ2A 2I60H 4PG2C 4HUNB 3LH2L 5FA3A 4JFDE 3QEHA 1U92A 2DM4A 4K8RL 4EQ2A 3UBXG 4PJ5B 1CDHA 1U8KA 2WLYA 1E4WL 2VXTL 2ARWA 3Q6FB 5F1KC 4L3CB 1ZVHA 4M7JH 3V4UH 3TPUB 2ZOLB 4R97C 5IT2H 1RUMH 4H26B 4HBCH 3K80A 1AKJD 4JQXC 4O00A 1G6VK 4E42B 4OB5L 1NC4B 1UC6A 1RAMA 3QA3A 5DQJB 4LSVH 3G6AB 4LLWB 4Z7UE 4G9FB 3HB3D 4DOHB 5T3ZH 3PABB 1I8MA 3O2VH 4K23H 1BBJB 1MFDH 4OCMC 3VE0A 5D1ZC 3G6JB 1OARH 3OR6A 1UGNA 1MY7A 3RUGB 1YYLH 2IBGA 3MA9L 5DUBA 5T1MA 4X6CB 3MRDB 5ENWA 4M9PA 1S8DB 2GK0B 3HMWH 4NKOB 1MCLA 1ZANL 4QCIA 1YEDA 3WFDL 1J9CT 4HUWB 3HNTL 3WIFB 1IM3B 4P4KB 2XKNB 2PO6C 5IVXA 2R0LL 2YSSA 3QUZD 3SDCB 1NQBA 2VDOH 1T20A 5SWSD 5GIRA 5IB5A 4X5LA 3REVA 2UY7A 2FD6H 2Y36L 3QEQE 2FO1A 4JFFB 1DQLH 5IESL 1T7YA 2NTFA 3ZYIA 3KLHC 4F33B 1X4ZA 2OTUB 4LBEB 1AR1C 3PNWB 5HYJD 1NCAL 4LSUH 4KROD 1QSVA 4IRJA 2Y4SA 5IG7B 3N1GC 4JZOA 1OGAD 3RZCA 3S34H 2CRMA 4ELMA 3BPLC 2EH8H 1V7ML 3B3IB 5I1DB 1AE6L 2UVEA 4KY1H 4PREA 1FP5A 3EIFA 5C0DA 4ODWA 3A6BH 4WI2A 1D9KC 3RIFF 3AMLA 2WUCH 3CH1B 3FO0H 1JZ6A 1AGEA 3HI6L 1QHOA 2C9AA 2X2YA 4B7LA 4P0DA 2ZOKB 1E6JH 4XPBL 1FIEA 2Z31A 2FWOA 4KJQC 1J88A 2OTWA 3GK8L 1XCQA 3D3VB 2WINA 3HZVB 4RMQA 5EBWB 1CGSH 4KKNA 5HHOE 5MEND 4HX1B 3IDJA 2J1KA 2A6KB 3IS1X 1HOCB 5J8OA 2ARJA 3EYQD 1XGPA 3BP6B 2H2SD 1ZT1B 4PJXE 2YHGA 2NY0C 2VOTA 4Y16B 4PUBL 5C0AB 1RZIA 2BNRA 4RISH 3BJ91 1A1NA 1CFSA 2J4WH 4JRYB 5CILH 4LKCA 3WJJA 4L4VB 2QSCL 2VN4A 3MLPA 1IC5H 5EZIL 4AEFA 4KJYA 3MLSL 5E1AA 3RTQB 1WWAX 1CR9H 4NNPH 1MREL 3BFOA 3TBSB 1PFCA 3SE9H 5DMIL 3IDYB 4WFFD 1G7IB 1NJ9A 5BQ7B 1SJEB 4DK6A 5FYLE 1JGLL 3O8XC 5KVEL 1RUKL 4JRXE 5FYKL 5DK2B 2CKBA 1WITA 3M8OH 3V5DB 1EEYB 1IAIH 5D5ME 2ATKA 3QCUH 1K3ZA 3TYGH 4LL9A 5J13C 4KTDL 2MPAL 1T4KA 4RAUA 1JZ8A 1YNTA 1MHEA 1JZ5A 1PJ9A 5JW4Q 4PB9L 1ZVYA 1EBAA 4P5KA 4DN3L 1OTUD 2J8OA 1NUGA 2ZUXA 4X5XA 5E70A 1MJUH 4W81A 1S3KL 1CE1L 3DROB 5IFAL 1UACH 2C3VB 2VZOA 4NYLB 1N6UA 3LEXB 3KLAB 2G75A 5E8EB 1CDYA 4NHCL 5DEFB 2RR3A 5F9AC 4QRRD 4JANA 5FA4A 3OKNA 1U9KA 5D7IF 5LQBL 1SY6H 3L3JB 5CJ5A 1IEBA 1BJ1J 4LSRH 4R90H 2IADB 1BQHA 1A3RL 1CL7H 5CFHA 2WIMA 1MFEH 4QOKB 2I9LB 3VFWB 1F58L 4XHQA 4QCIB 4FTVE 5BS0E 2OK0H 4HWUA 4ORZC 4C59B 4O51A 4FNLH 5B39G 4Q7DA 4QY8B 5E2UL 4QXTB 3DV4B 3KDMA 5DUMH 5F8RC 3ZDXF 1RHHB 2HG5A 1CK0L 3BKML 3LS5L 4R7DA 3EFDL 1BVKA 2NX5E 4BZ2L 3GSWB 3SOBL 4XVJH 2UYLA 1EXUB 3ULVD 1YYLL 3MA9H 1LO2H 3QA3B 3RWEB 2CRIA 3MRGA 2O5ZH 3HG1B 1JHTB 4UBDC 1MUJB 3LIZL 3Q2CA 5IF0A 1FIGH 4RBPK 4EOWL 1FZOA 1XIWC 5HHPB 4IBLT 4ZFOA 1N5YH 2IH1B 1LVEA 4H26A 1J8HD 3TH2T 5TF0A 4X9IA 4RMRA 5DJAB 3RWHA 4HS6B 3TO4D 5HVHC 3NPSC 3D0LA 2WBKA 3CDCA 4YXHL 4RGMC 5DI8A 4L8CA 1FL5A 2D7NA 1ED3B 5JA8B 2AJXH 1CBVL 2YEZB 3DRQB 1QBBA 1XCTB 3JV6A 5JOFB 5C7XH 1OF2B 1QKZL 2X6MA 3V95A 3RY4A 5E6ZA 1EMTH 5J56B 2QQQA 1X5GA 2Z93A 1KLUB 1EFXD 5C08D 1FGNH 1ADQA 2XTJE 5LGKA 1IJ9A 5DK0B 3LRSB 2CKBH 3MJ8B 1AFVH 3TIDB 3V6FA 1ZWIA 4LLMA 2NY2C 4L4TB 2H2PC 3B8YA 2DIAA 5D7JA 1R3HB 5HHMD 1YNKL 5C0JA 1E6JL 4OZIB 5DEGA 5C0CE 5JLZA 4LQFH 5JMOC 1IKFL 3UJTL 1DLHA 3O6FD 4XP1L 3WFHA 1A1MB 4GKSA 1F3DH 3IETA 4PRPB 3TBVA 3BKCL 5I16A 2FX8L 2DQHH 2X4NB 5HVHB 3GI9L 3KYKL 4GS7B 2X4SB 3AS2A 4U3HA 3V4VH 3MRGB 5JUEH 4RGMB 1NDMB 4YFEA 4QHKI 5F1SA 1YJDH 1S5HB 4HGMA 5FYKE 4NIKB 2HFEA 3ZDYE 3VXPB 4YEFA 5D7IB 1BVKB 4X7CC 3CDGA 1CD1B 1TNMA 2HLAB 3LD8C 3X14A 4PJGE 1HDMA 4WI7A 3QDHA 3R1GL 4R26H 2VQTA 1II4E 4KRMB 1BD2D 2OR9L 5D5MB 1JZ7A 4MD0B 1A3LH 3QDJB 2YPLE 2G5BB 4WWKC 3RI5K 3IXAB 3CFDA 2CDEA 2VITB 2OZ4L 2AV7B 3PWPD 5B38G 1F2QA 1JK8A 1OT2A 4V2CB 3BN9C 1U91A 1P84K 1I8IA 2IGFL 4XHJC 4PGEB 1JYXA 2D4DA 3BUYB 4PLKD 4KKLC 3T0DA 5JOPE 3TEUA 3VXMA 3G5VB 2EDBA 4U3CA 1JGDB 4PP1D 4F3FB 1OGAA 1NCWL 5JQ6L 1B88A 1MPAH 2ADIA 3I6LE 5GRZA 3WMSA 4IDLA 1OB1A 1CGVA 1DFBL 1Q9WB 4JFHD 3R4DA 1OT1A 5IFHL 3QZWG 4PJ8D 2YPVH 1QR1A 4MNQD 1UADC 4X7SL 1BZ9A 3SDXA 5BJTB 2E7HA 4LDOB 5E5MB 2LQRA 4MQXD 3LD8B 2HKFL 1EEYA 1N59A 2XTJC 3V5DA 2DQUL 2DQCL 1FN4A 4KVNH 4OGAC 1DQLL 1MJ8H 1N0XH 3OAZH 1H0DA 1FFNA 2PO6B 2APTA 4ZOEA 3FQXB 3U0WH 3W39B 2D0HA 5GHWH 3SDAC 3GIZL 5CZXD 3NABL 3VXTA 4H5SB 1JGVL 5BZWB 5J3HC 1HXMB 5E9DE 4S1DD 3W0WD 4BSJA 1J1XL 5FKPA 1I3RB 1ZA6B 3SGEH 5FUOL 4JVUA 1U58B 1Y18B 2BX5A 2NY3C 3GEWB 3H9SD 1QZ1A 3EJZD 2E9BA 4Y16A 4L9LB 4PY8J 4M5YL 1OSZB 5L9DL 2HFGH 5J11C 4Y1AE 3RNKB 2AXGA 4Z7VF 1SHMA 2NYYD 2XN9B 5I76A 4Y5VC 2AI0L 2BZDA 3L7FB 1INEH 3WXVH 2VQ1B 4IM8A 1MH5B 1RIUL 1RJZA 3QQ3B 4LCWA 3QFJE 4LVOB 2Y07H 2WBWB 9CGTA 1NL0H 3O11B 1EUUA 5C9JA 2PTTB 2M2DA 2ED8A 5LGHH 2Q76A 3QI9B 3RUGF 4XCYA 3IF1A 3QUZC 3E6HB 1LO0L 4LSTL 4FFWD 4N5UA 5GSRB 1OB1B 3SEPA 3Q6GL 3NCJL 4PJXA 4NQEB 1TZGH 3C6LC 2I07A 2UYLB 2DMCA 3KJ4B 4JM4H 4G6MH 3DNKA 5JO5B 3MRFB 5D5MF 4TUKL 5IBUG 2VERN 2OTPA 2E8ZA 2NW3B 2JCCE 4J3OC 1ACYL 2QTEA 3LEYH 3V5KB 5DMIH 4F8QA 4YDIH 1RD6A 3ES6A 3QIBB 4W6YB 3TWCH 5EOCL 3WHXB 3FOLA 1TETL 3JTSA 3QNZB 1SYVA 5KVEH 4UNUA 4WVRA 1OAYH 5JXAL 2A38A 4DUVA 5LBSL 1RFDH 1GSMA 2D31A 4U6HB 5GRUH 1I1FA 1Q1JL 2HTKC 4ONHA 1X7QA 1FNGB 4NKIH 1X6LA 2R1WB 3STLA 1U95B 1BFVH 3ARFD 1EDQA 2N56A 5IP4A 3L3JA 4FQ2H 1YMHB 4M00A 5GRVK 1LDSA 3CH8A 4HH8A 4F37F 2BP3A 1ZK9A 3OKOB 2APBA 2YD3A 4Z5RA 3D3VE 3UTTE 2V2TA 4U33A 4MA8L 2B1AH 4NN6C 4WHTA 1U3YA 2HWZH 2F8OA 3HPLA 3DVNB 1PSKL 1NDMA 1Y6MR 3H9ZA 4YDVA 1SEBB 2EDXA 2RQ8A 2C3VA 3HI5L 5KVGL 1MHEB 1FFPB 2YS4A 5TE4H 2DKSA 2BNRD 1T04B 3OHXB 4XH2B 1NEZA 3P0VL 5F7DB 5D93B 4ONGH 3ABZA 3ZE2F 2A1WL 4ENED 4P9MH 2DBLH 5TH2A 1KJ2B 1K4CB 2AXJA 3TO4A 3SE3C 3RY5A 5BQ7A 1F58H 4P3CH 3G9VA 1P84J 5EFIB 5MERA 5FAAA 3NFNB 4JQVA 4P2OB 3QIBA 2OK0L 3EO9L 1XH3A 2QADB 1MQKH 1QQDB 4Y5XB 5L2KD 2W91A 4NT6A 4XWOD 1XF2A 2F5BH 3DYPA 4KI5D 3D1MC 5JOFA 4TOYL 4MAUH 4RGOH 4BJLA 2FX7H 3E6HA 2H8PA 1BMGA 3GI8L 1U92B 1JN6B 1K8IB 2IPKB 1UXSA 4XPFH 4ZXBD 3TN0B 1I9RL 3MRIB 1UM5L 1YQVL 2ADGB 1RPQA 1UKSA 4L8CB 3OZ9L 4LGPB 3O4LE 3CGTA 3MREA 2KH2B 4M6NL 4HK0A 5CZXC 1Q0YH 4OD3H 3KYAA 4F7CB 5E2WL 5IW6B 3P11H 5D1XD 3D18B 1XF4A 1XCQB 1D5IL 3N1QC 1IAOA 4NQUA 2CKNA 4I2XB 5K9JH 1AC6A 3SE4C 1EGJL 2XA8H 1XR8A 4Z8FL 4HUKB 1NUNB 5DYOA 2K7QA 4PJHF 2I24N 4UOW1 5HDBE 3LS4H 4ODUA 5CJBA 3O41A 4WTZA 3U7WH 2Z4QB 4NCC1 2UUDK 5AZ2H 4YFLF 4Y5XC 1W72B 3PNWA 3X11B 4HGWA 4ZFFB 3H6JA 2FIKB 1SEBA 5F44A 5ICXB 2B2XH 1BGXL 1KJMA 4I0CC 5H37G 3C60C 3NACH 3WLBB 1DN0B 2PW2A 4K55A 2NXYC 5FM8A 2Y7QB 2IADA 2VN7A 4XNYL 5F88B 2V5TA 4XXDB 4NWUL 3RWDA 1CXLA 1NCBH 4HAGA 3HI1B 2VL5B 2AJ3A 5HHXL 3RU8H 1VA9A 4HS8H 3DXAE 1J8HA 1BZ9B 4UQ3B 1H3TA 2PYEB 1ETZA 3C6LD 3LCYA 4YAQB 5D1ZA 1GZQA 4NUGH 2MQCA 1N64H 3WIFA 2A6IB 4JDVB 1JTPA 5ISZD 2BMKB 4X6CA 1GVIA 5TDOB 1S9KC 3OB8A 3D85B 5BV7L 3UX9B 3D69A 1R3KB 3CUPA 3SJVE 5T3XL 2BVYA 4LSTH 1MVUA 4C56A 1Q38A 2LV4A 4V1DA 2FIKA 2ZG3A 3KPSA 5I1IL 1VADA 1P9MA 4N1HB 3B9EA 3HE6B 4L8SA 5E8PA 4ODHH 2WANA 4QRSA 1ONQB 5ID1A 5H2BB 3TVMA 4UAOB 1A7BA 3NH7H 2VDNL 4F57L 4JN2B 3WFBL 2C7UA 2QQLL 2I5YL 4QNPE 4UU9A 1T21B 1S7WB 1OAYL 2VZ1A 4JFOB 1NJ9B 4YEEA 3S6CA 2DBJA 1A47A 1MRCH 3RWIA 1QBLH 4DTGL 2A74A 2J2ZA 1Q1JH 4IRSB 2IPTH 2ZOLA 4XMLL 2VZ3A 3DX7B 3KJ6H 4AH2B 5JDSB 3T1FA 3VFPA 1V3LA 2JJSA 1TCMA 3WNNA 1L0XA 3O6KH 2B5IC 4ZDHB 5EG6C 3ZYJA 4YBQC 5HPOA 4MVBD 4GUPA 3OJVC 3QO1B 1HHHB 2DJUA 2EDLA 4ETQB 3QJHA 5F3HA 5GJTH 5IEKB 1ES0A 3MO1A 3LHPL 2NCMA 1CWVA 4FQQA 3JWOH 2WLZA 4PRPA 3TBVB 1PG7X 4PJEA 4CMHC 3E3QE 2WSKA 5DJXB 5EBWA 3FQRB 3HMXL 4OFYD 5I17A 3MRQA 2HJFB 3UZQA 5CIPH 1O7SA 1UWXK 1VGKB 1XH3B 1JZ4A 2QEJA 1J1PL 3GZKA 3U4EA 4AQOA 1U6AL 4PJ7B 1AHWA 4U1HA 1BJMA 2XTLA 2RCSH 1JP5A 5D7JB 5ESAB 4DQOH 4RCAA 3DLQR 5AUMA 4ZNEA 3T77B 2R4SL 3ZE0E 5GRUL 4TVPE 3KXFE 1YEEH 5I1DA 1BFVL 3C08L 3P9MA 4WWKD 4JPIB 4BKLA 2OMNA 3BI9X 1EO8L 4NQDD 3NPZB 3B2UC 2VLKD 1DTUA 2D7TH 4PGZA 2DQGH 2CK2A 4Q9CA 1FLRH 1FGVH 1RZKL 3VXMD 4KTEL 1EVUA 1T04A 3OKLB 4HAFA 4ODTH 2OTUA 2J12B 2YRPA 3DVGB 4LBEA 5ANME 4M1GH 5TE7L 5FKAB 3O45B 5JXEC 5KVGH 6FABL 2V2XB 4RGNB 4U1KB 4I2XE 4JY5L 4I9WD 3EYOA 4K94H 5A3IC 5DQ9A 5FHAL 4JY6A 4F7EA 3K0WA 3F7YB 5EULV 5DJAA 4HWBA 1CFVH 4D0CB 1MOEA 3IDGA 3ARDD 4QRPA 4U7MA 3IB4A 3MYJB 1WVZA 3BGMA 1CQYA 4M02A 2CDEB 4JGUA 5HYIA 4OLZH 4S1RH 1DQDH 2R29L 8FABA 2JCCF 1LEGA 3EOBB 5DD0H 4ZMAT 3QNZA 3QIWB 4G8GB 5GGQH 3EO9H 1Q9OA 2GY7B 4G5ZH 3G04A 3SCMA 1KB5H 1W0WB 1EGJH 2XA8L 4IMLB 5IB2A 5ISZE 5HI3C 1KN2L 1NMAH 4MJIB 5DD1L 2XZCH 1W0WA 1LMKA 1J7VR 4ZOCA 4NZUH 1IBGH 2P43B 5ACLA 3OPZH 3O4LD 3JV4A 4XMKL 2JJSC 1T7ZA 1CLYH 2AP2A 2Y06L 4PRDA 4YWGL 5KS9A 3IU4H 5EO1A 3TPUA 1UZ8A 2LTQC 1WWCA 2NY7L 3EZJB 2AAVA 2HP4A 4Q9RH 1CF8L 1IKNA 1RZ7L 3TT3L 1QRND 5EZLB 3VFSB 3BEWA 1U41A 2UV3A 4PR5A 3O2DA 1ZWIB 4RWYL 4RFNB 5EOQH 3MODL 5DJCA 1AXIB 4HEPG 4O58H 4LSQL 3BUTA 1BLNB 1I7TA 1DBBL 1U8PA 3LRGA 1Q9LA 2EXWD 4JREC 3X12B 3FT3B 4K3EH 1I1CA 1LP9E 4RIRA 3RVWC 1YNTB 1OGTB 4Y4HA 5FKPB 5FYJH 4FFWC 5CSZB 1K6QH 1ZLSL 5FHBL 4EUPH 3SY0B 4LLQB 3CFCH 1KPRB 3GO1L 2VXUH 5HI5D 1NKOA 1JPST 4I2XA 1A0QH 1UYWL 4HWZA 3V4PL 4AQ1B 5DMJB 5IQ7L 1YEIH 3LQAC 5ALBH 2QQNH 2W07A 3FQRA 4G8IA 2XQYG 5CMAB 3GK8H 4JE4B 4LSPH 5HHXH 5C0ND 3T0EC 1T7VA 5E1AB 1I7ZA 3BPCA 3QO0B 3BQUC 5E5MA 5F3HB 2FJHA 4P59H 2FLBT 4P2OC 2Q8AH 3SGEI 3TNNB 4QHUB 1H3PH 4ORGB 2ERJB 3ARFC 4PRAA 1KBGL 3DX8B 2L7JA 3S37L 3AM8C 5I1IH 1X5JA 2E7BA 4HX1A 1CTOA 5AUMB 3DV6B 4R0LB 3STZA 4FQXA 5E2WH 4YH6A 5C0CA 4OZHE 1VGKA 2E7MA 1FJ1A 2NX5D 2CXGA 3O2DL 4FXGB 1UQSA 1I3GH 4OCXL 2OP4L 5EFIA 5MERB 2VDQH 1QACA 2AV7A 4DGIL 1LE5A 4WTXA 2E8YA 2O5XL 1OP5H 3NCCB 3SGJC 5J4MA 1MAKA 2YD5A 4H88L 3QCUL 3UTTD 4BFEA 4NZJA 1Q8MA 3QFJD 1RZJH 2QSVA 4K3JH 3FL7A 4XRCA 1XGTB 2D7TL 3CUPB 4B53A 3WV0A 4CJ1A 4DAGH 3FFCE 3MZTA 2DQDH 4LP4A 4AH2A 1RUQL 2BSTA 4P46B 3ARBC 2OL3B 5D1ZB 1P6FA 3WE6B 4XNYH 4GKNA 4Y0GA 4OZGA 3VXRE 5C0GB 3V0WH 5L8JB 2FZ3B 1V05A 4RNRB 4N1CA 3FZUC 3OX8B 2X4QB 2Y9RT 2OSLB 1DLHB 3QDGB 5B8CB 1OAUL 2MHAA 3C87A 2A0LC 3CFBB 1ONQA 1YEDB 4PS4L 4LEOB 3IDNA 2X9WA 3E0GA 4OI9A 1OQXA 4WJ5A 4MDJA 4M62H 5C2BH 4Y5YB 4GRMA 4OCRL 2ZNXA 4FQIL 2AEPH 4LEXL 2X4UA 3S97C 3RUGA 4YHNA 3VFUB 3FFCA 5FGSA 5IV2A 1UH2A 2YPLA 2F58H 2F9BT 4JFEE 4D0DA 1RJYA 4JRXD 5F9JA 1VFMA 3PABA 5FO8A 3TV3H 1FLRL 1DBKL 1KNOB 5JDJA 4CU6A 1BJ1H 1CFQB 5F1NB 1H3GA 5C09A 1TQBB 5LKNA 4ODTL 5JPMB 4XCCH 3GSRB 1QOKA 4H8WL 2X40A 4LIQL 4U1MB 3RJQB 2I5YH 1GPOH 2EDWA 4F7CA 3CXHJ 3WUWB 2X4RB 3PIQA 1P4LA 2X1QA 4XXDA 2VXQH 3GJFK 3O9WD 2GQHA 2IC2A 4JRYE 1N4XH 4OLWH 3RY6A 3BAEL 4WUUD 2PW2B 2VLJD 5EC2A 3QDME 1E6OH 4K2UL 5ABDE 3AB0B 3CZJA 2WM0A 2VH5H 4YUEH 3PL6C 2F8XC 3CH1A 1PDKA 1RULL 4H0HB 3RP1A 1MHPH 4G5ZL 5EUOE 4YHKH 5INCA 4HCRH 4ZS6D 3MLSH 4Y5YC 3CLFH 3D48R 1RQ5A 2A9NH 4OTXL 1FYTB 5CWSA 4FQJH 2DAVA 4L3ED 4C56D 5I0ZA 1IAOB 3ZTJG 5BS0B 4O51B 3S88H 4F33A 3QQNA 4PJ9D 4JFFA 3ARDA 1HSBA 1YEKL 3CFCL 2F5AL 5F7FA 5ACMA 1HH9A 2DQEL 5JIIA 2DYPA 2MSPA 4JN1L 4PJGF 1G9NH 5B8CA 2JB5H 1GJIA 4OZFG 1Z5LB 4PV8A 2FEEI 1FBIH 1NEZB 3NIDF 1WZ1H 5AYUL 2GI7A 4QXGH 4XCNB 4XBPB 5JHDE 3IVKA 5J7CC 5CJXA 1HCVA 2AJVH 4PJAB 3HUJE 4TTDD 2DQHL 5E8EA 3VD9A 4RWYH 3WUWG 5F1NA 4WHTB 1CXHA 4OUUA 5HHQA 1A21A 5DRZA 2Z91A 1DBBH 4EUPB 4KJQD 5F9JB 1OQOA 1YMHA 3IDUA 3OR6B 1QEWB 3G6JA 2YPLB 3G5XB 1GGCH 4XRCB 5L2KA 1TJIL 5FHAH 1U3HA 2Q3AA 3T0VA 4YDLC 2R1WA 2P5WA 1FNSH 5C6TL 1T4KB 3MV7D 2FB4H 2VZUA 2BVUA 4LCWD 2GT9A 4JFDB 1LEIA 1J8HE 5EIIB 3MV9E 2DB8A 5SX4I 3MGOB 3UAJD 1NGYB 3SKOB 3C2SA 1WBZA 3VXUD 1Q94A 4NP4L 4U6TA 2ZZUT 1PZ5A 5BOZG 4MX7A 3BH8B 4FNLL 2Y23A 3ULVE 4PJBF 3GSOA 2FHBA 3V6OE 4PY7A 2MQ0A 4XBGA 2ADFH 3TVMC 1U8NB 1CK0H 1F8TH 5EU3A 1JPFB 3ARUA 3BJLA 1JNHB 1VACB 1GRWA 4M6OL 3HZYB 4FABH 5TPWH 2XFXB 4LKCB 3IF1B 4YO0B 3L95B 3MC0A 4KAQL 3CFIC 4E5XB 3Q48A 1AXTH 2YZ8A 3I02A 1FSKB 1U3ZA 3AGVA 1KB5A 1IAII 2FJFB 2CK0H 5DJYA 3BVNB 4U6HA 4HBCL 2DI7A 3E1F1 3UYPA 4FFYH 5KSAA 1NGQH 1ZLUK 4Q9RL 5DMKB 3CAFA 4HC1L 3TH4T 1OTUC 1OP3K 5BVPL 4F80A 1CFNB 1BQLL 3QWQB 5D96C 3DSFH 4U0RB 4ZXBA 4EDWH 2A83B 4F15B 2EDJA 2R0ZH 5BMFL 1AGEB 5C7XL 4PJFE 4KK9D 1KXTB 5JIPA 2P45B 4TSBH 4PRNA 3OJMB 1EGJA 1FAKT 2BSRA 1OGTA 2F58L 2VE6A 3U0PA 4LCWE 4AMKL 1ZLSH 3FRUB 1QBML 2YN3A 5FHBH 4EI6A 4J6RH 4Z9KB 1WIUA 2FJHB 5ADOH 1G7LA 2YKLL 5CUSH 3HHRB 2OZ4A 4TVPH 3W81A 1VERA 4I18A 1FNEA 4M61B 4G6AD 4K8RC 3V0WL 1GC1L 3VRLF 2HFGL 4G8IB 1S9YA 4HUVB 3HC0B 4JKPL 4NO0D 2GJZA 4UNVA 2F19H 4LMQE 1FCCA 3E6FA 4ZPVA 1I8LC 4WO4C 1C08A 4TNVF 4ZUTA 4TPRH 4P59L 4MAYA 1SEQL 2JKXA 2GTWA 4KKBD 4QHKJ 1C1EL 1X5LA 3L5WB 1PD6A 4ZD3H 1T0MB 5EORL 4TTGA 3BRGC 4M93C 4KROB 1ZEAH 4UINH 5DT1H 4EVNB 4RIRB 3GIVB 1TZGL 4P5TB 3C6SB 4G43B 4Z18A 3HCVA 4R26L 4YK4B 2FL5B 4N1EA 1BIHA 3FO0L 4N90E 3V6ZB 3FQXA 3HI6H 1KENH 5IB2B 5I8EA 4Z7UB 4LARL 1KN4H 1IL1A 3MROA 4WU7A 1IGCH 3MBED 1WZLA 5DMKA 4GFTB 4D3CH 1HHKA 3QPQC 3GFUA 4OZFH 1KYOK 1QYGL 3CFDB 4OV5B 1DN2A 5SWZD 3DWTA 3ULVF 1P4IL 2AKRA 2P24A 2HFFA 5FXCH 5ID0B 3IDGB 1NAKL 1KEGL 5DDHB 4J3SA 3BP5B 2XQYK 5SX4H 4GRWH 5SV4A 1HDMB 3EDJA 2XI9A 5CEYB 5D6DA 4X4XA 1CVSC 3VGGA 5HI5C 4RISL 1T1WA 4JANB 5FA4B 5T1KB 2YK1L 1XIWA 3CVHH 3MRCA 4MA3B 2HFEB 2ZCKH 3HZYA 2J4WL 4HIIA 4C56E 3VXME 5ANMB 1R6VA 4P5MB 4F3FA 4RA0C 1AO7D 5C0NC 1XIWB 3MRCB 4HCRA 3SPVA 1MRDH 3RVTD 1W72L 4F9PC 5D1QC 5T3XE 4Y5VA 4S2SB 3CLFL 4IJ3B 4PBVC 2IG2L 3GM0A 3S4SA 4P9HL 1NCCL 1WBZB 2HKFH 1Q72H 4KDTC 1DLFH 3DBXA 4EN3B 4NCDA 2V9RA 5D2NC 1GIGH 3T77A 3ZLQC 1ND0A 4JDZA 5CBAB 3UJIH 2XG5A 3QAZB 5B4MC 1WJ3A 3TIDA 1IT9L 2GHWB 3V6FB 4XP4L 1H8OA 4D0CA 3WD5L 2VDRL 3QEQB 3MRMB 1N2RA 1GZPB 3QNYB 3C6SA 1D5BA 4G43A 5D7IA 3EYOB 3GB7B 4Z7WA 1CDUA 1V7NH 2YD1A 4OUUB 5FV1L 4S10A 1CG9B 2AJVL 5BV7B 1WK0A 1UVQB 5HHOB 1A7OL 2W0LA 1KELL 2ORBL 3DVGA 4Q9QH 4PJEE 4F7MB 2D7QA 3WNLA 4XCNA 5JW5B 1MLCB 5DHVA 1WC7A 3OF6D 5I8KL 4ZPVB 4LCCB 4L1HA 5JLZB 1D5BB 1FORH 4WUKL 1OAZL 5KSVA 2KZWA 1DANU 2J5LC 1CDJA 4MXVF 2HJLA 3V6OC 4G80B 4J1UB 1BQUA 4PP1C 3D3VA 4FFYL 5IHUH 3DTXA 1X5HA 3C9NA 5LGHL 1U8MA 25C8L 4J4PA 1FRGL 3BKYL 1RU9L 3QXWA 4NPYB 3SDXE 3WO3B 3VRIB 3U0PB 1MCPH 2IFFH 1WF5A 2J7LA 4ZO9A 4LSVL 5I1LB 2Q20A 4PJ5E 4H20L 5E99H 1CFTA 3EAKA 4UDTB 1V5JA 2XOTA 1MLBB 2KQMA 4RFEB 4X98A 4OIAA 4ETQA 5E8NA 2SEBB 3MOAL 3BD4A 3PHSA 3PWLA 3WFCH 5DLMH 1RIHH 4HXAL 2VZVA 2GJ6D 3VWKD 4PGCB 4P49A 4LPTA 1S9WA 5C0IA 1S7UA 1C7TA 2C4FU 4R2GD 3V8CA 3WJLC 4EDXA 1MCKA 4IRJC 3LQMA 5LXGH 3RKPA 2IQAB 2YD9A 5T1LB 1SY6A 4PRDB 4X6CE 3GUTA 1J8HB 1Q0XL 2JB5L 1FZJA 1J86A 4FQXD 1QRNE 1PKOA 3ROOA 4Z7VB 1ERNA 1T2QL 3BWUC 1VFBB 1A5FL 3RNQA 1JRHI 4EDWL 2XFXA 3OG4B 1BIIB 3U9UB 3GMNA 3RZCD 1KJMB 4C54A 1KPUA 1JPFA 4LLAA 4EZMA 2O61A 3RL2A 1DSFH 4HIEA 3DJ9A 3SCMB 2H26B 4H1LA 1TJIH 1XGYL 3PL6D 2I27N 2ICWI 4PJ5D 3P2TA 5DVLA 2VQUA 1PW3A 2ATKB 4LEOA 3DMMC 3HE7B 3MFFA 2GTWB 2I9LA 4FFZL 3VFWA 5CEZL 5I1GH 3CXHK 2DDQL 1PG7W 4NM4H 4DN4H 1IGJB 4MJIE 1JRHL 1MRFH 4DFHA 2OXHA 2DTML 2GJZB 5IMOA 1WFUA 2O93L 5CEZE 1MI5D 1AKJB 2NY6D 2X1PA 3VXUA 4PY8I 1T6WA 3C2AL 3K3QA 2IANB 4HPYL 1JPSH 4PJ9C 4EUPA 5CD3B 4X7FC 3LPGA 4G42B 2WNGA 1QFPA 3VFMB 4EI6B 1EAPA 1I3UA 3O4LA 4L9LC 3GMQA 5DJ8B 4HFUL 2VXVL 4I4WB 3MRHB 2BSRB 4UQ2B 3B2VL 4K7PH 1SVCP 4YXLH 4PP2A 1RIVL 2ARJB 5ECJE 1B4JL 5IR1B 4BYHA 3QPXL 3TM6A 4NPYA 1NLDL 5B3JF 1X6NA 1C8PA 1JUFB 1R3IH 3MLVL 3LPWA 3BDBA 3RGVC 4P4KD 1FSKC 5J13B 3DMMB 3UTSB 3LQZA 5B3NA 3D18A 2PXYC 3UBXI 3HMXA 3EOTL 1CICA 4NJ9H 1G0XA 5DRWA 3RPKA 2QR0A 5HHVH 4GSDL 4JFFD 4NKDA 2VDRH 5B3JE 3V79C 4WUUE 2ADJB 1EZVY 2FATL 1EAPB 5F7DA 1WC7B 2HVKB 4D0BB 4Y19A 1OAKL 1G0DA 3ILQD 3P77B 4R9HA 4RGNC 4PIRF 5F9WC 3VCLB 1JYNA 1FGVL 32C2B 4ZSOE 4EQ3A 3GMQB 4JO2L 3WLWC 3CSPA 4M1GL 5L7XH 2YD2A 4PG2A 4OJFH 3OSKA 5C0EB 4OGYL 3C5ZB 3BW9B 3FT2A 4NWUH 3IYLW 3UO1H 3O0RH 2DWDB 3CSBA 4NQSA 2DQCH 1R5VB 3IKCA 4J12A 3THMH 5CZKA 1U95A 5CHNB 4OZHA 1CXIA 3TZVA 1EERB 4NO0A 1AIFA 2VLKE 1I7RA 1RVFL 3MRKB 5FYLL 2L0DA 4G9DB 4XP4H 4FQ1L 3GJEA 5F96L 5T1MB 1UKQA 4N0CC 5GRXG 5KG9B 2HTLD 3ES6B 4N90D 1F4HA 5HHNB 1JL8A 3GBLA 3G5XA 1JTTA 4XH2A 5GGVL 3VE0B 3WNOA 5A2JH 3ZTJH 1OGAE 4QWWD 1UJ3A 3VFVA 4IRJD 1E28A 1ZT7B 2RB8A 4Z77B 2JB6A 2DI8A 5DRZB 3RNQB 3EFDH 4JRYD 3ZTNL 4L4VD 5DQJA 5HYJE 4KK8C 1OW0A 2DF3A 3QXDB 1E4WH 4M93B 4FQXC 3D39D 3OKOA 3SKJL 3MPCA 3L5XL 1UZ8B 5C9JB 2EKSB 1XGQB 1OAZH 4JAMA 2IF7A 2DWDA 1QBLL 4DTGH 4QTHA 4JKLA 2F54D 1OPGL 1HZHL 4OZGB 5TQ2L 1FZJB 1I1FB 1OY3B 3AREC 3QUMH 5FECB 4PJDF 3QHFH 4RA3A 5K93A 2VAJA 2GSGA 1QLFB 5ICXA 4JFED 4N8VG 1SYVB 3PWLB 3NCJH 2APFA 4WFHD 1U8QB 2HT4D 3QI9D 5DD6A 2IPUK 2VLMD 1MJJB 2IANE 4RFEA 4X98B 4HW6A 4U1GB 2W9DL 3BDXA 2R2BA 4D9LL 2JJWA 3MODH 4K23L 3JWOL 3DETD 5GRYA 4WW2F 5AYQA 5ALCH 1QSFE 5BRZE 2X70A 4NSKA 2I26N 1HSAA 1IQWL 1RK0B 3HMXH 1Q72L 5EUOF 3JWNC 1XF1A 4GT7A 4KJWD 1JF6A 5EZJB 2FGZA 1H15A 1XF4B 5C71A 2HFTA 1NBVL 1P2CB 4ZUWA 3W39A 1HILB 3HNTH 3I84A 5D7SH 1IAIL 4PJHA 4GKZA 3PJSA 4GBXD 4L5FL 3MREB 2VQ1A 1A0QL 1UYWH 2FR4B 2YRLA 1TVBA 3C08H 1A7PL 4KTDH 1CE6A 2MPAH 1EO8H 1FV1B 3MLYL 4I18B 3VXSE 2J88L 2ERJC 3ARFB 3QPQD 4MD5A 3EO0B 1PY4A 2B1AL 4XBEL 5HVFB 1N7MH 3MRHA 3B8SA 5EZOH 1G7LB 2ZP0T 1MAJA 2NLJA 3DUUA 1ZV5A 4LASH 1UVQA 3HI5H 4X83A 4ELME 1KJVA 2YMXH 3VWJC 1KXQE 1IEAA 1JMZA 3V4VL 3M17B 4ZO8A 1KNOA 1L7TL 2Z8WC 2JLLA 3KPQB 4XP9L 4Y5XA 5E4EB 2H6PB 4KZDH 1VHPA 4YX2L 4L8BB 3ZZ1A 4WI5A 1CDCA 4JCLA 5LQBH 4S0SD 1KTDB 1K3IA 4K94C 5F7KC 3GBNH 1ORQA 3L9RB 3P4LA 3QNYA 2PTUA 3NGBB 3K2UL 1G9NC 3VFGL 4X4ME 5SWSB 4JZNB 3GBMH 4HT1L 3I9GH 4WI9A 25C8H 4KKAC 1JGUL 3CZFB 1ORSA 2OZ4H 2XICA 3UJJL 1GHFL 2EKJA 4X4YB 5CSZA 1CI5A 1Z6JT 1NKRA 5INDA 2AW2A 5EN2A 4M7ZB 3I6GA 4EXPX 1PYWA 1A14H 3WLWD 2DD8H 5KW9H 2FJFA 4XNXH 5DJYB 3H9SA 1JPSL 3NPSB 3TNMB 1X4YA 5HHVL 5IJKA 1U8PB 1EO7A 3F65A 3HE6C 5B4MD 3VW3H 3DIFA 3CFJA 4XPFL 1AXSB 3TCLA 4OLUH 5FDWA 1T1WB 2C3XA 3OPZL 1A7NH 2NXZC 3O8XD 3V7AE 5AG9A 1R5WB 2QSCH 2EO1A 1EEQA 2X4SA 4JFYB 2CIIB 2VO5A 1KCKA 4Z7NF 4Z76B 5I8CA 4FQCL 1L6ZA 4BSWB 4PJDB 4UU9B 3STBA 5CEYA 1IC4H 2NZ9D 1J0KA 5MENB 3F7PC 1AH1A 1IL1B 3FOMB 4QWWC 3VFNB 2R8SH 4OCWL 3V0VB 4Z8FH 5I74B 3A0OA 2NY5H 4Z7OE 5HDQH 5HDBF 1SYSA 5C0AD 4HK3J 3GIVA 4FZ8L 2EC9U 3RDTD 3VWJA 3NABH 3MLXH 4KRLB 2VIRA 5I1KH 2ITCB 4N0YL 4MZ2A 1DVFC 1BBDH 3SJVB 4HPOL 1SBSH 3MXVH 3VGEA 1BQSA 4GS7C 4JDVA 2X42A 2DQFA 1T0MA 2CKBL 1NSNL 5HGHB 3MBXL 3ARED 4QGTA 3HZKA 4IIQA 3GO1H 3MYJA 4MD5B 3WDHA 1VGEH 2DLGA 1UM4L 3RJDA 3KPLB 1AJ7H 5E0QA 3OAUH 3V7AG 3VWKC 5F7NC 4YGAB 4LCCA 3PWPB 3ZKMD 3JSSA 3RHWK 1OAQH 2IAMC 3VXOB 1FYHB 3JWDC 2AXHA 5IMLB 4ZG1A 3S5LG 1KGCE 2PYED 2WW8A 1MVFA 3MJ8A 3UC0H 1W72A 1I3RA 1ZA6A 4HFUH 1OSPH 5FF6A 5I74C 2Y25A 1JI2A 3DX6B 2ZPKH 3VI4F 4K7PL 3I3EA 4ALAL 1GZPA 3ME0A 1XR8B 2XZAL 1WQVT 3FO2A 1NAMB 1NMCB 4O9HL 3DOSA 2X44D 4OLVL 1T5WB 3HA0A 4XT1C 5CBAA 3VXSB 2X4TA 2XZZA 4PFEA 1UJTA 1FPTH 5EC2B 5KSAB 3SKJH 2VDQL 3QP3A 5FECA 4NZDA 2G5RA 2H45A 3ARQA 4M7KL 4MS8C 3WNPA 4S2SA 4LF3B 4U6XA 2HH0L 2Q7NA 2DM3A 4UTAH 5I1JH 1KOAA 5DMGC 5B22A 3F7RA 4CVZA 3RWGB 1F3JA 3A67L 2C4FT 5MEQA 5AYUH 1HHHA 2EE9A 2X1WL 3QO1A 5IF0B 2OXGA 5CILL 4XPGL 2P47B 5EBLB 2XQBH 5D93C 4MHHG 2NY6C 4CMMA 1DBMH 1YZZA 3FCTB 4HIHB 1IAIM 3VG9C 3GSWA 1BEYH 1CD8A 2P4AB 3FB7A 1QFWH 5T1DH 1UWEL 1GGBH 3T1WA 1UB5B 3KDMB 1ULVA 3EOYG 3TNMA 2GCYA 4ODXB 1BOGB 3HLAA 1T21A 2BSSA 3T0ED 3HZMB 2FDBP 4P9ML 3RTQC 5C6TH 3IXAA 4KVNL 3TO4B 1Q94B 4Z7NE 1MJ8L 1N0XL 3BGMB 2OI9B 1KJ2A 4OZHB 1ZLUH 1CLCA 5JOPD 1K9TA 1BQHB 3U82B 4ZNCD 1B6UA 2FL5A 3F7YA 1KULA 2FZ3A 3QXTA 1G9EA 5GGVH 1U8IA 4YGVA 4BFGA 4XTRC 2ZUYA 4GOSA 1QPPA 3T2QA 1RURL 5D4QA 2ITDA 3S3JA 2BSED 2XWJB 3MLRL 3VCLA 3WIIH 2YD4A 4RGOL 5TPWL 1A1MA 2OS7A 4M5YH 1F4WL 4X5XB 4XP9H 4LPVA 1SY6L 3DO3A 4MNQE 4P3DB 4GRLA 1ZHBB 5I73C 3K4AA 1NC2D 2DYPB 1DQMH 4XPTH 1YEJH 1BF8A 1NFDF 4RGND 4LSSL 4FQCH 1U93A 4M7JL 3D87B 4M61A 5KN5B 3QZWB 3ESUF 4DGYL 2Z31D 5CJXC 3FB5A 1Q0YL 4NBYB 3SKMB 3PJSB 1ZAGA 3GKWH 3KHOA 4KU1A 4PRPD 2HVJB 2V7HB 3ZYZA 2D9QB 1JUFA 3MNZB 4WHCA 3DECA 1FE8H 5GGSB 3C8HA 5B21A 5C09D 4JQXA 3QAZC 1S5IH 3ILPB 2P5EA 2VAAA 2DIJA 3V52L 4PJHE 3ALXA 4LFHG 3J7HA 5JW3L 5I1KL 3DRQA 4APQC 4FQJL 4I4WA 4S1QL 4I3SH 1IQWH 5D2NA 2AJUL 4ORGA 4JO1H 5KVMC 3VI4E 4U3XA 3BHBB 2C1OA 1MH5A 1GOGA 3HRZA 5BRZA 3NACL 4RRPA 3WDIA 5JDSA 3BP6A 4JPVH 4Y2DB 1FL6A 2GSGB 5ICZA 3DI2B 4OFDA 3HUJF 2XN9A 5I76B 4UV4L 5JZ7C 1QSEB 5F89B 5J0BA 1J5OL 4KK8D 1PZUB 1FBIL 4S1DC 5CP3H 4ZFOL 1M05B 3ARGB 4POUB 5KANI 3OAUL 1GGIL 1N3NB 1N7ML 1XR9A 4E5XA 4P4KA 4JO4H 4PTTA 5JIHA 2EDOA 1UXSB 4D2NA 4H1LG 2L4OA 3BZDA 5I71B 4P5TC 4QRTB 1C5DA 4QRSB 4U0QB 2D4FA 4JJ5B 3LZFL 1JF5A 2BY2A 3QWOB 3HE6A 4L8SB 2PW1B 5TE4L 3HB3C 3GMOA 4LLYB 3IFPA 4R4ND 4XNQB 2B20A 5CJ8A 3G6JE 1ZGLB 1R3LA 3RL2B 4Y5YA 4U2YA 1QQDA 4OFKA 5E2TL 2MMXA 4UT6L 4ALAH 1P7QA 1IGYB 2FB4L 1H0DB 5D2LE 3CFBA 4O9HH 5CCKH 3A6BL 3T4AA 4LGSB 4QHLB 1HHGB 3CFKA 3MRKA 1LEIB 5EDXA 2E7CA 2IH3B 5JR1H 4HMCA 1QO3B 2H32B 2PO6D 1M7XA 1P4IH 1I7UB 2B5IB 3ARYA 2IQAA 4RGNE 2OL3A 2IEPA 3GI9H 3KYKH 4NYLA 2GIYA 4P2QA 1JNNH 3BW9A 4HLZH 1FVDB 4YHOL 1S7UB 3W0WB 1S9WB 1Q9WA 5AAMA 4LNRB 4M6OH 4K7FA 1ZHNB 4JB9L 3BWAA 3QDGE 3DVNA 3O3EB 2XIDA 2DS4A 4ZFFA 3ZDZF 3RTQD 3IVKB 4U7SA 4JM2F 4JR9L 2HVKA 4FS0A 4LAQL 3VXNB 2HTKD 1W72H 4HDIA 4QRQB 3DPBA 4U6YA 3RWFB 4F58L 3PWJA 4XAKD 2NR6C 1WBXA 3G08A 3L3KB 2BRRL 4ZSOA 1SJHA 5GGVY 4X0KB 5IB4B 3U0TB 2N7AA 2YUVA 2ILLA 3BXNB 2NXYB 4TUOB 1C12B 2PCPB 2O5XH 2VDKH 3LQZB 4PJIA 1CZ8L 4DQOL