1RU9H

Crystal structure (a) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected in-house.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 44
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9H01
1S7SB 3F7VA 5GRUL 5ESAB 2DQIL 1ZS8A 3D2UD 4XX1G 2NY3C 4BM7A 3JWDH 5E2TH 3K7UA 1IVLA 1VGEL 3BFOA 4ACPA 2AJVL 4PR5A 2BRRH 3FRPG 1OLLA 4Z7UE 3WNNA 1S9VB 4FFVC 4U1KB 4I5BA 5D71L 2BZDA 5A2FA 4PRBA 35C8H 4FQLL 5EOCJ 3RPIA 1DQDL 1LDPH 4Q6IA 1MJ8L 4ERSH 4Q9QL 3NCYP 4XVSH 1X5GA 3VG9B 5HHQA 1WTGT 1FVCA 3L1OH 4HXBL 4MJ5A 1UWGH 1IL1B 1KCVH 1B6UA 2C3WA 1W0VB 4PJGE 2HJFB 1RUMH 3V5HB 5DJZA 4M48L 3VH8B 3B9KD 4LVHB 2H2SC 5F1IB 3GSXB 3PP4H 4HGWA 2J8UB 4IHOA 4Z7OE 5GGQH 4HUXA 1YNTA 2DTMH 1G6VK 4JRYD 1T83C 1OD7A 1ZAGA 3MLVH 5MEND 3QH3B 3ZKMD 4BFEA 2YRPA 1R0AL 2DLFL 3FFCA 4TUKL 5B3NA 2I07B 1LQSR 2VDML 1KLUA 1NFDA 4K9EC 2FCBA 3VXSB 2YN5A 1QSEB 2YUWA 2HFEB 2F54B 3MR9A 2VRAA 4TNVK 2A1WL 1OTSD 5EZLB 3ROOB 4HUXB 2EIEA 5JR1H 1G0YR 5B3JE 3FAWA 2R0WH 3WIFA 3FQWB 1AGEA 2HJFA 4U0RC 5CJXC 4F7EA 3P9LB 4I18B 1UKTA 3GB7A 3ES6A 3UJTH 3B5HA 3SKOB 4K8RC 3RJQB 2XZQH 1BQUA 1MFEH 4OKVB 2BDNH 3LKPA 3SKNA 2CKBB 4QRUA 1CFNB 4WFED 4TVPH 1TVDA 4P99A 1JGUL 5IEHA 5BMFH 5I75C 5FGBC 1FLRL 3QEQD 1CDGA 3AROA 3FO2B 1MY7A 2V5SA 5SV4A 3SE8L 2A2QT 3O81A 3VU2A 2L0DA 1NJ9B 3IJHA 1EXUB 5I1HL 1MJUL 1IKNA 4Z7NF 4ZPVB 5FHBL 3R0NA 4MCYA 1VDGA 2D2OA 5DRXA 1MCLA 4KPHL 5DQ9B 2NNAA 2R2CA 2OL3L 1L0XA 2W0PA 1W0WA 3DURB 3MJ9A 4D8PA 3ARTA 2CUHA 1Z3GH 2OLDA 3QUXD 3S5LA 3D3VD 3OGCB 5AYUH 2X5PA 3HC3L 1JMZA 5TDPA 4OUUB 2HLAA 3WSQL 1EJOL 5DEGA 3EO1A 3HZYB 2FO4B 5T1DH 4H88L 1U8JA 4GQ9L 2UYLB 1KIRB 2OM5A 5HVWA 1FH5L 1AGBB 2R4SL 2QQQA 3C09B 3CSBA 5IFJB 3QG7L 2FRGP 5HGAB 4E41A 5GHWH 3ARQA 5JIIA 4EVNA 4JN2A 4P4RB 1NGXA 2C7UB 2GJJA 3TZVB 3IDIB 3MJ9H 4KTYA 1ZA3A 5IB2B 2VZUA 3CDCA 2OJEA 2CLVB 3EOBA 3KXFA 2XTJE 4UAOB 1KUMA 1OAQH 1GYAA 4KHXL 1XEDA 4EUPG 4FMFA 2HVKB 1E6JH 4NN6C 4FRWA 4NQED 1C12B 5LGKA 3LKSB 3BZEB 4WUKH 3N06B 3VXPA 3F58H 1RHHA 1BVLA 4L4VE 4ZFZA 4JPIB 4NZTL 5TQ0H 1IARB 2KQNA 4XX1E 4YHIB 3P73B 4AEHH 3MLYH 1LHZA 1M1SA 4JPWH 5F88B 1UYWH 1KNOA 3OKNA 4JM2B 1CD8A 1F8TH 3J7HA 4G9DB 4A6YA 1G9NC 2JLLA 5AZ2H 4OUOA 2HYMA 2X4QB 4HKZB 1CDUA 1IM3B 4X6BA 2IH3B 5FO9B 5EFIB 4LGPB 4BQ8A 3IJYB 4TQEL 1IE5A 1ORSB 1Z9MA 3LD8B 1KOAA 4V2CB 1WBXB 3PXJA 1EO8L 1WZ1H 3ZYOA 4L4VA 5C3TA 4P23B 2XFXA 4PLOB 3T65B 1YPZA 4DCQA 1PDKA 2M26A 3DYOA 3QUZC 4FQHB 4DUXA 1Q9KA 2FGWH 4IOFD 3C6LB 4XNZB 2AV1A 2VKXA 4OGYH 4X4XA 4YHNB 1NDMB 1FZOB 1Z5LA 5DWUL 5BRZB 3QYCA 4FTVE 4MWFA 2FO1A 3VGHA 1XF2A 4ZQKB 5MEPB 3QPQC 4L3EB 5FKAA 1AR1D 4BZ1L 2WQ8A 3H3BC 4HLZH 2AJSH 2GTZA 4P4KD 5C0RH 3BH9B 3QFJA 5DJ2A 3Q6GL 5FYKL 5GS2D 4KDTA 4D94A 4L29B 3ARBD 4MHHG 4P0DA 4F15B 3TJEL 4ZNEA 3JTTA 1U3HD 4WUUA 4Z7OF 5ABDE 1NCAL 3FHQA 4UTAL 4IMKA 4G6AD 2O5ZL 4ODTL 3CUPB 4WWID 5C08D 4DQOL 1BAFH 5EOCL 1AP2B 2E27H 4S1DD 1N7MH 4HDIA 3C60C 4XCEA 3SCMA 3VGFA 2Q8AL 4O02L 3OZ9H 4RBPH 3CSGA 4HFUH 1IGFL 2XA8H 4OCRL 4XNUH 1EFXD 4RAVB 3LEVL 2EYRA 3SKJL 1ZMYA 4DZBA 3LSOB 4UT6H 2AI0H 1FVEB 3QIUC 1WFOA 3NZ8B 4F7PB 4HZAA 2ICCA 1U58A 2F5AL 4YHKH 2NY2B 4CVWA 5K59E 1UVQB 1EHXA 4EDWH 4XP9H 1QA9B 3DMMD 4HX1B 5JW3H 1WICA 1QSED 5I8EB 1AGDB 3BRDA 3OR7A 3VXSD 1G1CA 4XMLH 4MJIE 4MJ6B 6FABL 1T1WB 5J89A 4ZQKA 4TSAL 4WY7L 4M7JL 4Z7VE 5D1QC 2P5EA 5BRZD 4QYOA 3MROB 3ZMRA 5MENB 2EXWD 4F37K 3O11A 4M5YH 3B9EA 3VXMD 4JRYB 1B0WA 2DBLH 1CQKA 3GSQA 4UT9H 3WN5C 1BD2E 4EXPX 5I1CL 1RULH 4OCXL 2ZG3A 4QKXB 3T8XA 1YYMH 4R7DA 5AYUL 3GBNH 1FVEA 3F7QA 1NMAL 3IAQA 1CDIA 4QRSB 3LS4L 1DQJB 2FEEI 1C7TA 4M9PA 4JM2D 4XAKD 3ARPA 3ARBA 1N4XL 3TWCH 2RR3A 1MELA 1HDMA 4XH2A 3O4LA 5C09A 1W72B 5DFTA 2P48B 1ZLVK 1V5JA 1UA6L 3D2UB 5D5MF 5E94A 4U3HA 2Q6WB 5DEZA 4YDIL 1HHJA 4F3FA 3C5SA 4ZFOB 5I8CA 1OSZA 2ZUSA 2XY1A 3KHQA 2N1KA 4LSUH 4OZGF 3VDBA 1B3JA 4MQXC 3QNYA 2X09A 1T6VN 3UC0H 1RU9L 4MXWH 4RX4D 4P9HH 2X4QA 1MUJB 5IW6A 4RGOH 2NW3A 1A1NB 2EE3A 5KN5A 3OPZH 2EIBA 3K8KA 2H32B 2NW2B 1JYNA 3QEGL 1WFTA 1MQ8A 3BYYA 4PG2C 3T3MF 1G9EA 4B0MM 4GG8B 4UDUA 2XQBH 4F37F 5BOZG 4NPYA 5GGUA 4ODHL 4LDOB 2X4PB 1LE9B 4NO3B 1JHKH 3TA3C 5KSAA 2HH0H 4M9OA 4X6EB 4PJ8C 3OAUH 5IHBA 4CVZB 4HHAB 3I02B 3V95A 1OT1A 4ONOA 4RAUA 5HI3D 3D18A 4O9HH 1A1OA 4JHAL 3CNKA 5T5FH 3LRSB 2Q7NA 1P7KB 4Z8FL 5AAWA 3RWEA 3JXAA 4KUCD 1INDH 3PWUB 3UJJL 4K7PH 5DI8B 4TUJB 3OKLA 1U2CA 3MMEA 1F4WH 4YHOL 1OB1B 1FZMB 1CF8H 4UIKL 3EZJB 1BM3H 1NCCL 1KCLA 4MNGE 2H1PH 5E8DL 3TJEH 3VWJD 2N56A 2HA1A 4RNRA 3NVQA 3SDCA 4DW2L 4J8RB 1MHCA 3EJYD 2YPVH 3FOMB 2GJZB 4YFLF 1HOCA 2FR4A 2E6JA 5CZXD 3K1KC 1UM4L 4EN3C 3K46A 3GSUA 5F1KC 5HDQL 2BVPB 1NBVL 4JKLA 2D0FA 4OZIE 2H6PB 1BJMA 2J8UF 5F9JA 2XA8L 4OCSH 1XIWA 5GGTA 3W39B 5DEGB 1D6EB 2VDOH 1BFVH 3DUHA 2APXA 2A77L 3C6SA 4UU9A 5TDPB 4ZUUB 5E08L 2OI9B 3LMJL 1IGTB 2DLEA 3ULVL 4YBQC 2LTQC 4Y5VC 1GH7A 2ZUYA 3ZYIA 2XTJC 4QRRE 3GSNA 3SO3B 3B4NA 3O2WH 3QDGD 2YD9A 2VXVH 4GRWE 4M03A 2APFA 4KMTH 3KYNA 4JPVH 2APBA 4MLIA 4JRYA 1ZVSB 2XWBA 2BJML 5AEAA 1QFPA 4WWKC 1Y6NR 2VC2H 4F57L 5LQBH 4Y5XA 5F7DA 3MV8A 1ZWIA 1PJ9A 3D87B 5EBLA 4LLAA 3BKCH 3BSZH 1WZKA 4KVCH 3DX8A 4LPWA 3GK8H 2XQYG 3QFDA 2DQCL 1T4KB 4Y16C 3KAAA 3A6BH 5J13C 1DEDA 3MRFB 3O8XC 4FA8A 4MDJA 5I1CH 1AHWA 5H94B 2NY4C 1BF2A 3SOBL 3MPCA 1SVCP 3QXTA 1NDGA 5KW9L 1MFCH 1B4JL 4HK0B 4NRZA 3P11L 5FM5O 4DGYH 5C2BL 3MLXH 3OKMB 1BMGA 1PY9A 3V0VB 3HPJB 1HH6B 3L3IA 1CLOL 3BVNB 1CGSL 4E41D 2XWJA 1S7XB 3GJEA 1LP9F 3D39D 3RP1A 1D5IL 1IEAA 1WBYB 1ZGLA 1I1AC 4GT7A 4J1UB 1SEQL 4TNVF 2HT4C 3MRLA 1X5HA 2O93L 3H9SB 4POUB 5KVEH 3S35X 5IBUG 3MODL 4MA1C 3IS0X 4BK4A 5KTEL 3GKZA 2ZKHL 5IW3A 4HK0A 3PWPA 1F58H 4ZS7H 2VJXA 2PW1A 4JANA 2BSTB 4U1LA 3KYNB 1RFDH 4Z7VF 3C2SA 2WUBH 5EN2A 4RFEB 4X5XB 1RJCA 5F7EH 5L6YH 4WV1B 3HUJE 2R0KH 3FJTA 1HHGA 1R5VB 5TQ2H 1M7IB 1LEIA 2BHUA 2MQ3A 3MBXL 3PWPE 4NN5C 5I1DB 5IB3B 1UXSA 1DSFH 1S78D 1PEWA 1YEFH 2UYLA 2UVEA 4Q9CA 4N9GA 4OD3H 1RMFH 3T2OA 5A16B 4GSDL 5FB8A 1T3FA 3BUYB 2XKNA 3ETBF 1ZT1A 5IMOB 1KLGA 5JW5A 1N5YL 1JTOA 3G6DL 1BX2B 4LCIL 2FHCA 4FFWC 3QHTC 4PGCB 3GUTB 3WUZA 3DGCR 1U8NB 1F90L 2P24A 1NLDL 1DE4A 5HYEA 3P77B 4QRRB 5HDBE 3ULUC 4HUWB 4AIZB 3FN0H 4EZMA 3X14A 3UYRL 4NQCD 5JO5B 3RWJB 1RUKL 4WNQB 2ITCA 3VXRD 4EQ3A 3VXUA 4WO4C 4ENED 3UTPD 4IS6A 4LCYB 3V6FA 1I7RB 1KTDA 2NMSA 4R4NC 1EHLL 3RQ3A 3OKDB 1CXKA 3H7BB 2GY7B 4LU5H 4LSDA 3ZDZE 5TF0A 2R0WL 3K4AA 4ZFFB 1FFRA 3TO4A 4OKVA 2HT2C 2NY0D 3DARA 3DRTA 5E9DD 1JNLL 2IBBA 4ZUSB 4MNGB 1I7ZA 4HUKB 3MUY1 4R97C 5CP3A 1UT9A 3LQAL 3FTGA 4TUOB 1OP9A 4CDHA 3EO0A 1OSPH 3H2WA 3ILQC 3VRJA 5JHDA 3MRRB 4H1LH 5F72S 5GRUH 5HHOB 4LVHC 2DQIH 3P77A 4U6YA 4QRRA 1WWCA 3W0WA 3LMJH 2E7MA 3MV01 4R90L 2JB6B 3UJIL 1FSKC 4YXHL 1BX2A 3ARGD 4RQQB 5FHBH 4U1JB 4KMTL 4AEIH 4NO3A 1KF9B 3BUYA 1D5BB 4Z5RA 5JXEC 4FQQB 4YO0A 4YHNA 5DZLA 5F7FA 1WEJH 4HS6A 2WWMC 3D2UA 5E94B 2ZCHH 3BSZL 2W92A 5HGGS 2C5DC 1QSZA 3A67H 5KN5B 3MLTB 5I30H 5GJTL 2Y6SD 4HGWB 5D2NB 1YZZA 2R9HD 1BFTA 2JK5A 3SE8H 4JZNA 4G9FB 4XPTH 2A73A 1P6AB 3ZHDA 2VSCA 1FORL 5FUCC 2YRLA 3LZFL 5D4QA 4XWOD 3MLSL 4M7KL 4PRPA 4ZNCD 1EJ6A 4RDQF 1A6UH 4IIQB 2O61B 4Q9BA 2RQ8A 1GZPB 3ZDYF 4S1QL 4ZS6C 3CCHB 3D1MC 4ZOAA 3F12A 3UBXB 2W9LA 4GRLC 2Y07L 4UILH 4EXKA 1YY9D 3VDAA 3RWHA 2XRAL 1U8MA 2XNAA 3BH8B 1A7PL 1QNZH 1C12A 2VLRA 3H9ZA 4ZAKC 2BC4A 1XZ0B 1FZKB 1Z6JT 4L9LB 4ALAL 3O6MH 2XWTA 1QEWB 3MV8D 2GSGB 2OJEB 1Q9LA 1MRCL 3I85A 5TPWL 4OD1H 4OTXH 1AGDA 3ZE0F 3RVTD 1JHLL 3T2QA 2C9AA 1DL7L 1WWAX 3WXWL 1FFOB 2PW2A 5IM7B 4DN3L 3IU4H 2BVQA 3L9RB 4UV4L 1IT9L 1JNNH 4XMKH 4M7LH 4ZNEE 1KCKA 1AD9A 4KK9C 4G8EB 5E99L 1F6FB 2DQTL 5D93B 1JTTA 1AO7A 5GS1B 1MHHA 3UTTA 2OTWA 1ITCA 1NUDA 3QEQB 5C0FA 4L4VD 1DVFD 4LKXA 4K94C 2AJXH 5T33H 1RIUH 4Z7VB 1UXWB 2FIRT 1R3HA 1CR9H 2ADGA 4LFHG 1OP3H 3QDME 4JZJA 2NTSP 2YKLH 1E4KA 4U6HA 5D6DC 2AXFA 5FOJA 1QBLH 2H2SD 5C0CE 1ZS8B 3ME0A 4MAYC 4HAGA 1NUNB 1JZ4A 3RFZC 4DFHA 1E27B 3OKEA 3FQXB 5JA9A 4PJDB 5L8KB 1J8HA 2E9BA 1U8MB 1MLCB 1ZHBA 1JYVA 5FECB 3QIBB 3HNTH 2EZ0D 1BOYA 3QULA 5IEHB 3Q0HA 1GZQA 1DFBH 4G7VH 4OKDA 4N1CA 5GGSB 5IVNA 5ILTH 4PS4L 2R1XB 3KS0J 5DXWA 5IWLA 3C8KA 5GISL 4KKLD 1EHNA 4P57A 5CWSA 2R0ZL 4GOSA 3P0VH 5KAQG 3QUXB 1V7ML 1BVKA 4MMZC 1F00I 1DN0B 3LQAH 5BXFB 1CFTA 3VXUD 1FN4A 3RUGA 1TVBA 2BVYA 2EEDA 4L8SB 1JYXA 3PDDA 2ESVB 4H20H 5ID1B 4XP1L 1F5WA 5DS8A 3ZKXB 2GQHA 4HPOH 3CFKB 5L2KE 3HPJA 1ZOXA 5HYSB 1FL5B 2DIBA 2VL4A 4YHIA 4HS6B 4KKAC 4NRZB 1Z9LA 3EFDH 5F9WB 2E7LA 2GAZA 2HFFA 2BNUA 3DRQA 3FZUC 3HRPA 3KLAB 4QXGL 2VXSL 3OQ3B 1X7QB 4P3CH 4Q0XL 1BD2D 4HKZA 1UWXH 1J0KA 2P47B 3SGJC 1I3GL 4JREC 2JJSC 4JM2A 3L5HA 2EDHA 4QHKJ 3WUWG 3ZKXC 1TJIH 2H3NA 4HS8H 4IRJC 1KACB 1AGCA 1A14H 3FT3B 4NUGH 1S8DA 2O5XH 4OCLC 5DVMA 4X4XB 4ZTOL 3PGCA 2EDOA 1KXVC 4OGXL 1A6WL 1KCSH 2I25N 2VQUA 1TVBB 1K8DA 5T5NF 4BZ1H 1I85C 4JY5H 1DN0A 3BP7A 4OF3A 4C4KT 4JDVA 5E95B 4I0PD 1QSFE 2WWKT 3LN5B 3TVMC 2D4DA 4GG6B 1AXSB 1FNFA 1RIVL 2YOCA 4HZLB 1A6UL 2HWZL 2W0KA 2Z4QB 1IM3A 3QWOA 5GRVL 1JUFA 4PJIB 1RZJL 2R1XA 4EIGB 4FQJH 4A6YB 5IVXF 4X80H 3IGAA 1FIEA 2JTDA 1QBBA 3QEQE 1D6EA 4PREA 5GPRA 2A9NH 1WZLA 1MAKA 2VZSA 4Y0GA 4NNPL 3VFNB 4BSWA 4U1GC 2AEPH 1KCUL 1G6RL 3VXMA 3OHXB 4JDTH 2CRIA 5EO9A 15C8L 1PQZA 4AIZA 4YIQA 1T66C 2IAMA 3QIUB 1YEEH 4Q6YA 2DQDL 4ZYKA 3CAFA 5AZEL 3ULVC 1FG2B 1OTUD 3D6GA 4PJCF 3HLAA 5L2JB 4JO1L 1RPQA 5C9JB 4NUJB 1JPFB 4S1RL 4P5TC 3OKDA 5J8OA 3WBDA 1MCIA 4HJJL 2GFBB 4WU5A 1S5HA 5GZNC 4NKDA 4LCYA 5E2UH 1QQDB 4FOMA 4LPUA 4IDJH 1A9EA 4JRXD 3TNMA 1TCRB 1GGYA 1AO7B 2LU7A 4QNPE 3DX7B 3S3SA 1AQDB 3CVHA 5J12C 4I0PA 5SWSB 4QOKD 4JHZA 1RZ7H 4U7MA 3BMWA 1OTTC 3RNKA 3VI4E 4JFFE 4X6DE 4CVXA 3SKMB 1PKQB 4UQ2B 1G7PB 1L7IH 2ZOKA 4G8GE 4PJBF 1RZ8A 1WWWX 2IMMA 3QEUB 3EDJA 1INDL 5CMAB 3P9WB 1KLUB 1NFDB 3T3PF 1HI6B 1L6XA 4WRLA 2PCPA 3GB7B 2BVEA 2FJHB 4NQDD 5HGDA 1OD9A 4YLQT 5E4IA 4XGZB 4JFZH 1IAMA 5ALCL 4TPRL 4P4KC 1AXTL 4Y4FB 4NQVB 5GGQL 3DGGA 3WIIH 4DK6A 3IRZA 1JK8B 2CMRL 4WV1A 1OGTA 2DICA 3C87A 3ECBA 3PE9A 5T5FL 4PGZA 4AM0B 4LRIC 4PJXA 2GEEA 5GISH 43C9B 4XNYH 3MRGA 4M4PA 3MJGX 3W11C 4Z78B 5IBTH 2YPLB 4EBQL 1IAOB 3QXAB 3WUWB 4M61A 2C3HA 2A0LC 4HT1H 1RY7B 4IRSD 4Z76A 3QCVH 5FGRA 1M7DB 3E1F1 1P1ZB 4FQLH 1A7BA 3WO4B 4Q2ZA 4NO2B 3ROLA 3MLZH 4UIMB 4LOUD 2C3GA 1UQSA 3SGJA 4TTDC 3VWJB 4G7YH 5KSBE 5HHQB 3D0LA 3MRKA 1U93B 2V5MA 2CDFA 3DRQB 1UH4A 3U0WH 5C0BB 5F7HA 1OARL 3O9WD 2APVA 3NCJH 5CJXA 2IBZX 5I2IB 3WFCH 5DA0B 3VCLA 1MCRA 3VI3F 2OP4L 4ODWA 5HHXL 1NGYB 4MVBD 4O9HL 4WGWB 2HFGL 3KLHC 5INCA 5DRNA 5D72L 4U6YB 3PHQB 3T1WA 1R3LB 4WTZG 3DX8B 5C8JA 5CIPB 5EZJB 4HIXL 4ONGH 2FHFA 4HIEB 1A1MA 1AIFB 3M45A 1U6AH 5EOTB 1FVCB 1KV3A 4HPYH 2JJTA 2HVKA 3BEVA 4TOYL 1N59A 4ZFFA 1CF8L 1ZANH 1MCSA 5IK3A 5K9QI 1WIOA 2QL1A 1U91B 4ZOBA 3ARED 5F70A 4OLEA 4OGZA 5CLWA 1YA5A 1U92A 4X80L 2C7UA 5SWZD 1A6AA 2BX5A 4HC1L 4PRAB 32C2B 5ENWA 2H8PB 5TGBB 5ITBH 2AEPL 3O4LD 3S6CA 4R97B 4G8GB 4NQSA 3VRIB 3BWAB 2OZ4A 4PP2A 5L7XL 3LRSA 1UWEL 1YDPA 1P5VA 5DQJB 1JGUH 4QEGA 1BBDH 3UCRA 4LNRA 2ICEB 3D18B 2PUQT 5E8OB 3QEHA 1MH5B 3T1FB 1D5IH 2YHGA 1ACYH 3TPUB 1QYGH 2APWA 1DQQB 1ND0A 2B2XL 5GSRB 1DVFB 3QRFM 3H9YA 1YEFL 1SEBB 1T2XA 1S7RB 3WFHB 5A16A 3QRGH 2YEZB 3MUJA 3MMEB 1HWGB 5DJCB 4Z77B 4KKBC 3WKNA 3FT4B 5D2NA 1N0XH 2ICWB 1FL5A 1I8KA 3QJFA 5A43C 2DI7A 5K33A 1NBZB 5FUOH 3GMRA 2QSTA 3TA3D 1VFAB 5J0BA 5BMFL 4RFEA 5GZOD 2JIXA 1I1RA 1CFTB 2UZIL 3GRWA 5C0JB 1RUAH 2D7TL 1L0YA 4UB0H 2CKBA 1FH5H 4NDMA 4FXKA 1U0QA 1QSFB 4JY4B 2ITDB 3L7EB 3OX8A 4MX7A 2H2PC 3VFUB 4IOIA 1QACA 4ZAKA 1J7VR 1XCTB 5JUEH 2IPUK 4JKKA 2Q86B 1HILA 2JELH 1N5YH 5HYJB 1YY8B 2B5IC 4Y16A 2IGFH 1F4HA 3RWFB 5JTWA 1FJ1B 1VEOA 3U9PH 1JK8A 4BQ9A 1F90H 3OJDB 5DO2C 4P59L 4QF1B 3CMOL 3AY4C 4ZUSA 1ERNA 1NFDF 4BKLB 1DUYB 1PSKH 1C5CH 3T09A 3D48R 3EJYC 2WSKA 1BFOB 2WANA 4G8IA 4GO6B 2DQHL 3OKMA 1BQHG 5E4EC 3MXWL 2J8OA 3KLAA 4K8RL 4JZJC 4ZS7L 1INQB 5JHDD 4G9FD 3MLYL 3U2SA 3Q5TA 1OGAB 3V4UL 2YUVA 4P4KA 4IRJB 4GAJH 4H8WH 5EDXA 1ORQB 5IGXH 5AZ2L 1Q94B 3HZVB 2ICWA 43CAB 7FABL 3RWCB 3MROA 1A2YA 2PN5A 3V5HA 4YBQD 3CK0L 4UI2A 1U3HB 4J3WA 4UT6L 4IMLA 3U36A 1TCRA 3S3JA 4PJGF 1FFQA 5E6ID 1CQYA 5CBAB 5FYJE 1OARH 2F5AH 3T0DA 3B6SB 1MCPL 4WU5B 1NGPL 3LEXA 5I30L 1QA9A 2X89A 1MCQA 3BPNC 5ADOH 4O2FA 5GGSA 3ZL4H 2RCSH 3PHSA 1TQCC 4YHPA 1UYWL 5TDNA 5HHXH 3D25B 1UKQA 2XXCB 2FZ3B 3ARWA 4K55A 5KSVA 1ZHBB 1JHTB 1HINL 2Z93B 4H1LB 3GKWH 4ZSOA 4WFEE 1PEZA 3NCFB 3HAEB 4WHCA 2C1PB 3DMMA 2YD2A 1F45A 1K3IA 1TIUA 3U30B 3VWKB 4ODTH 1KBGH 5HHPA 2CPCA 4XI5D 3UTZB 1R3IL 2NXZC 1LO3L 4ZDHB 4NQEA 5HDOA 1Q94A 43CAA 1RZKC 2BNRE 3WKMH 2XRAH 1PYWA 4MD5A 3SKOA 4IRJA 4RZCB 1QKZL 4IIQA 4PJDE 4F2MB 4PJ8A 2XZAH 3FCTB 3O0RL 4PJAB 1RZFL 4HC1H 5KSAC 5C0CB 2GTZB 4OZHF 4AMKH 5JHLH 3DUSA 1JZ3A 4Y2DB 4Y5YB 4G8EA 5JDSA 3EOYG 4OZFH 1K8DB 4GAYB 1GGTA 5BRZA 1E28B 1BLNB 4HKBB 1S7VB 4N0FB 5DURD 3EYFB 3F65A 4U1SA 3RUGF 3BPCB 3QFJD 2BFVL 4HQQL 3OAZH 5FHAH 3VMPA 4C83A 1MHPL 1DZBA 2VYRE 5E99H 2D7PA 3BXNB 2K7PA 1X5IA 2BOBB 2LV4A 5DHYA 1DQML 5E00A 5EUKB 5ICYB 5JPNA 5HYJD 1MIEL 5CIPH 3CFCH 5IB1B 3JVGC 5K9OA 4Q2ZB 3F7YA 3CIQA 1J8HD 4GUPB 4NYLB 5TPWH 4OD1L 3OR6B 4OTXL 5C0NC 1SJEA 1T5XB 1Y0LA 4KZEL 3T0EB 5IWLC 3GRWH 1VB9A 5BQ7A 3BKML 3SN6N 2AEQL 4JM2F 5K9QG 4M5ZH 5IT2L 1PX4A 2AJZA 2C26A 5BVJA 5HPMB 4PRIB 4FZ8L 1F3RB 2HN7A 3HUJF 3TA3B 4Y1AD 4PRPB 2Z8VC 2OZ4H 3MLRH 2CIKA 3FMGH 4PJXE 3WEXA 4MZ2A 4LDLB 1YEGH 2OJZL 1RIUL 4OLWL 5TDOA 4HV8B 3BT2L 2EDKA 3MRQA 4YQXL 4PD4J 4LLYB 3OJMB 4ZOEA 3TF7C 3OKNB 5I73C 4H25A 4YDLC 3NA4A 1B6DA 1EMTL 3HAEH 3W39A 4ORGB 3WYRA 4RGMB 1Q1JH 4O2EA 4LSQL 1LNUA 1DEEA 2M8XA 2N7BA 3HC0A 1IC4H 1GAFL 4X9FA 3DIFA 4P2RD 3OKYA 2Y06L 2VLKB 4LVOC 2LU3A 5HSFA 3LDBC 3GSNH 5TGBA 3BOVA 5TFSH 1OP5H 2P46B 4PRAA 3RZCD 4F9PA 4PY8J 2LQRA 4XNZC 2V5TA 3ILQD 1FAIH 3ARFC 4JY6B 1KLGB 5EBLB 1P7QA 2WBKA 4PGJA 3DX7A 4YDKL 1J5OL 1IT9H 1DLHA 3MRBB 3QIWA 1C5BH 5HHOE 2EDQA 2YUZA 5JOEA 4IS6B 1QFUH 5D1QB 2XWBB 4GXUM 5IFJA 2V2TB 4RMVA 3PL6C 4ONHA 1EXUA 3QUMB 1L7TL 1FC1A 1BEYL 3HC4H 5T3XL 3PWNB 4Y7MA 4L8SC 4NO0A 1GGUA 3NCYS 3BKYH 2UV3A 3HCVA 5SWQA 5TE6L 4B7LA 2XYCA 1I9EA 3ARDD 4J7RA 2RCSL 3V0WH 4JPVL 5HGBB 3PJSA 4JE4B 4LVNB 1NLBL 3EKCA 5H37H 3UJJH 4PGBA 3RZCB 5JXAL 2DKMA 4GRWH 1K3ZA 4DZBB 4MD0A 4Y2DC 3LCYA 2H1PL 4R96B 3MOBH 3ZSTA 2Q7YB 1K9TA 4Y4FC 3CC5A 5CZKA 2BHZA 3CPLB 5GJSL 4G6MH 4PBVC 3SDXB 4XBGA 3DPBA 2EKSB 1TJGL 3LN5A 1JWMB 1MCBA 5BS0D 1W72L 3LQZA 4MNQA 4XXDB 3TFKC 3HC0B 3W2DH 3V5KA 3L5XH 1WUNT 4W4OA 1JVKA 3RWEB 3T2NL 4PP1D 2DQEL 1CLOH 1YY9C 2OMBA 4O5LL 5JXEA 4XZUA 2YC1B 3EYUL 4KRNA 4P5MA 3VFTA 3BYTA 3L3GA 3MNZB 1MVUB 3DECA 5C0EB 1NFIA 5C0DA 4L8BA 4EEEA 5IB1A 5ERWA 2BFVH 5DD6A 3RVTC 4AT6A 2B4CL 5FHAL 5IQ9A 1CE1H 2GW5A 2WQRA 1D5XB 3IF1A 1JPGB 4FNLH 3RDTC 5FXCH 2P5WD 4TVPL 2ED8A 3HTLX 1BFVL 1XF3B 4FFYL 5I6XB 3WD5L 2WUBL 4CU7A 5FIEA 7CGTA 4V1DE 5ITFA 2VLRE 2DLTA 1A64A 3B3IB 4PRHA 1J8KA 1G7PA 4XPGH 5EO0B 3VFWA 4LHJB 4K9EH 3UBXG 4J3SA 2P42B 4XRCA 3BKMH 1MFAH 4WW2A 2AQ2A 2AEQH 3WJJC 1N3NA 1MF2H 4BQCA 3P4OA 4HJJH 4NN5B 2HLFD 2DI9A 2Y5EA 4ODVL 5DVOA 4PB9L 4KAQH 4EN3A 1FGVH 3V0VA 5D70L 4C58B 3MRCA 2BSSB 4L9DA 2DMBA 4JJ5B 5DVLA 4JKMA 4LCIH 2FH6A 1UVQA 4AY0A 5AUMA 4JRXB 4KVCL 2HRPL 1IQDB 5C0CD 2PTTA 1GGIH 3KYKL 5L88H 4P3DA 1RZJH 1DANT 3OAYK 3RVUD 1CN4A 3RX7A 3H6JA 2EZ0C 1L7IL 3TO2B 4H88H 1U2HA 4ZD3L 3SEPA 2F53B 4HG4J 1J0YA 1F3JA 3MRIA 3EDFA 1YEKL 5CP7B 2AK1L 1JHTA 3MLPA 1WWBX 3SCMB 3GHEH 5IOPA 1MCCA 3AB0C 3MFGB 1ROWA 2DQDH 2ZUQC 2Q76B 1HYRC 1GGCL 3S96B 4LDEB 1A02N 4K3EL 4L4JA 3NPSB 1FNSL 3QDMD 2VXTH 1ULVA 1HXMA 4MA3B 3OG6B 1S7UB 3C8HA 3O3BA 4J3UA 4L3CA 3PWVA 1RMFL 3HB3C 5DI8A 5JHDE 2NY6D 2RAMA 2H26B 1LGVA 2MCPH 4JFDD 3ARVA 3LPGA 5CSBA 1IQDA 1DBAL 1BEYH 1B2WH 2R8SH 2J12B 1VFOA 3VXSE 5HDBF 3QUYA 4FQ2L 4YXHH 3EYSH 2VKWA 5DYOB 1K5NB 5TJWK 4PLJD 5E1HB 1OSZB 1K2DA 4GKNA 1F11A 3B43A 4BFBD 4IRJD 5FO7B 1WZ1L 1SVZA 1DSFL 3W81A 5CP3H 3D0VA 5IROC 3U0WL 2E9WA 3MACH 4F7EB 4NM4H 3AXLB 1TQBB 3PV7A 1EHLH 1F3DH 1ZHNB 3EYQD 4OZGA 2NZ9D 5DRZA 2Z35B 4GBXD 3WJLA 5SX5H 1ZSDA 4PJGB 1YECH 3IAGC 5GS0C 2P7TA 2PYEA 3STLB 4DOHE 4X4MA 1IBGL 4Z7UF 4ORZC 4BH8B 4U1MA 2E7CA 4X6EA 1G7JA 2VL5B 3W9EA 3RDTB 1IKFL 5I19H 1OY3B 2BOBA 3RVWD 3KYAA 1NCAH 2X41A 4HJ0C 3E6FB 4EDXA 3MYJB 1ACYL 1JJUA 1QLEH 2ZG1A 3QI9D 3W9DB 3T0VA 2V5RA 3OZ9L 3M1BB 2X1PA 1PG7W 4Z77A 1U8JB 2PTUA 4MXQD 1A0QH 4K3DH 3N1MC 1IEBA 2PXYD 2HLAB 1VERA 2B7DT 4IJ3C 3N50A 2EKJA 3C5SB 4ZFOA 5I8CB 5ITBL 1JNHA 4PJDA 2R23A 5I8OL 2F53E 4NHUA 3U30C 4Z9KB 5MI0C 3GMRB 1TLKA 4P2QD 1A7NL 2X42A 1OF2B 4PJGA 4PRBB 4K94H 1WAAF 4DN3H 3WIHA 4EJ1C 1XF5B 5ID0A 3WS6A 1VACA 1RIHL 1QBAA 2ZZUT 5CILH 2QSCH 3QULB 5FM5M 4WEUD 3QHFH 3O41B 3E2HB 3I6GB 1OTTD 3OXRA 5CBEA 5C0FB 3FQXA 3BDBA 4JR9L 4RWYH 1WC7B 4FQ1H 1DR9A 2ID5A 3T0XA 2WV3A 4QRTA 3WS6C 3OBAA 3TVMB 2FJGB 3QDAA 4MJ6A 4U6HB 4KI5D 3TNNA 5DLMH 4NT6A 1I8LC 1S7TA 1II4E 3O3AB 3PWNA 1T20B 2CRMA 1U8IA 2G5BB 4WGVB 4I3RH 4DGIH 4KKCD 4V1DB 4ZTPH 5C6PB 3E6HA 4XPTL 5M7QA 1OB1A 1JGLL 4OIIH 4O4YH 4KVNL 3MLSH 5EOQL 1YEKH 3FN3A 2NX5B 3V6OE 3BZDA 1CT8B 2VLRB 4K7PY 2MJWA 4TVPD 4JRYE 3U4EB 3PABA 5E2WH 3BZ4A 4HKXA 3JV6A 4S1SH 1J18A 1EEUA 4KMLB 2CDEA 1RK0B 4OLUL 4Z7NE 5EZJA 5J1SC 1IAII 4MJIB 1YUHB 4IOSD 4M7ZC 4IJ3B 4E0RA 2IG2L 2WWKO 3HNSL 2VLMD 2BNQB 1NGPH 1CICC 4TTDD 4DN4H 3O41A 5ITFB 2NQCA 3SDAB 3GJFH 4OF8A 3MV9A 5IW1A 3BRGC 2HRLA 1XF3A 5DUBB 3QT2A 5DJ0B 4OBRA 3RTQA 1AFVL 4PJEF 4NC2B 3OG4B 1WT5A 1XH3B 3BN3B 1DP0A 4Z0BH 4GS7C 1CL7L 3BGAA 3VD4A 4LCWB 3JVGA 3WHXB 2FDBP 4NP4H 5JZ7D 3AS3A 3NIFE 5DD6B 4AT6B 3IFPA 4ZOCA 4JQXC 5C0DB 3P4OB 1N6QL 1J0HA 4QHMA 4DFIA 2ESVE 3L3GB 3MNZA 4U1JA 3MNVA 2OI9C 4JG1H 4KROD 1S7WB 2NY2C 1KC5H 1I8MA 5EO0A 1IEAB 1WBYA 3VFWB 4Q7DA 2DQJL 1HHKA 5ECJE 3UO1L 3VI4F 1UEYA 2KQMA 1JZ2A 3GIZH 1YQ2A 2DWEA 1E4XL 3P0VL 1LD9B 2V7HA 4EDXB 1AGBA 2A6IB 1EGJL 5HVGB 2IADB 1MJ7L 4PJCA 1G7LB 3X11A 3O6KL 4MXVF 5JOPE 4LCUA 1G9MC 1DQJA 2CXKA 3RDTA 4G43B 5K9JL 5D5MA 4U1SB 1N2RA 3MJ7A 5T3XD 2FX7H 5A2KH 5IVZB 3U4EA 4LQFH 1OVZA 1CVSC 2IH1A 5EPMB 3T8XB 4PJ9C 4KJYB 1LO3H 4RIRA 1I9IL 4S0TD 5JQHC 4GAJL 4LNVA 5DD1H 3UMTA 3B9KB 1YYLH 3JTSB 1HCFX 3HRZA 3TC9A 5HDLA 4FHBD 5I9QB 5HI4C 5IHUH 2VSDA 1A0QL 4K3DL 2F58H 5DGRA 4TNWK 1KENH 5FOBB 1S5HB 2A77H 1ODAA 4R4FL 1U8HA 4YXLL 3QIBC 1URLA 5CGYC 5EU6A 3THMH 5FYJU 3ULVF 4JO2H 5CCKH 3OXSA 4K07A 4XHQA 1G7IB 5KS9E 2VLKE 2EXYC 3TNMB 5JW4M 4JN1L 2ZJSL 4WFFE 4PV8A 5EU4B 3PWJB 2QQLH 2Z8SA 5BJTB 2Z93A 4H1LA 1H3PL 1FPTH 3RWGB 4XAWL 4QXGH 3FMGL 3K74B 3ZHKA 4AH2B 4K7PX 1MAMH 3BX7C 1Z9SA 2X4UA 3MGOB 4R2GC 1IFHH 3O4OC 3SDAC 3GMPB 5F7KC 3KJ4B 4XCEB 2CGRH 4TULH 2E6QA 1TJIL 2XICA 2WINA 4D9RE 3L3OA 3R8BB 5JPMB 4M6OH 5EIQA 3B8YA 4NNPH 2IALB 2P5WB 4P2CG 5LCVL 2ARJB 3WSQH 4BSVB 4NN6B 5CLTA 4PJHA 1FNGA 4RFNB 4KKNA 5C09D 2BMKB 2CQVA 3U4BH 5IFHH 1S8DB 1KPRA 4OM0H 3UTOA 2F8OA 5ERWB 5DJAB 4QHNA 1YEGL 4JHWL 2Z4QA 4J3OC 2P5WE 1A9BA 4HHAA 5IBUB 5C07D 1BZ9A 4APQD 3KR3L 1W0VA 5AUMB 1I3UA 4WEBL 1A6PA 2QEJA 5I9QC 1JF1A 3C5JA 3OGOE 4PUBL 3DV4B 2PW1B 5KOVC 4OM1H 1L4IA 3KLDA 1RFDL 5CINH 5T3XH 5A3ID 1UZ8A 3ZO0A 3LKRA 4XPBH 4YR6B 3LEYH 3EYFA 2PO6D 3QUZB 2RJMA 5I8KL 3KYMA 4I0CC 2Q7YA 3OJVC 1CFSA 3IDGA 4Y2DA 5ELIA 3BEWA 1F2QA 4AEFA 3RVVC 3VXSA 5D7LD 2NYYC 4PRDB 4PJAE 1HHJB 2IMNA 2IQ9H 3RBSA 1FAKT 5B8CB 2ESVD 4JVPA 3SGDI 5J6GB 1AJ7L 1IAKA 2R69H 5J12B 4JFFA 4X6DA 3WLBA 2NXYB 3WIIL 4PRNA 1S7VA 4N0FA 1HYSC 4N5EC 4XP5L 1QSEE 1CIUA 3P3YA 5J6HA 5FO8B 1HDMB 1O5DT 4NFCA 4PTTA 4F33B 1UADC 4GRLB 4IRZL 4X6CF 3SDDB 5HPOA 5KSBB 4MNQD 1IGTA 5T5NG 1EMTH 3V0WL 2NXZD 1QHOA 4ODXA 2DKUA 1J05B 2ARWA 3V6BR 1E4XH 4BK5A 1SEBA 4OZ4A 1U6AL 1WTLA 2YD8A 2I9LA 1MCHA 2Y72A 3U7WH 3MRPA 4OSUH 2FX8L 2OSLB 5T3ZH 1T2JA 2FO4A 3HMXL 5DJ8A 4Z0XB 1H3GA 4NT6B 5E5RB 3UTTD 3FB8B 5B39G 5FEBA 3EFFA 2JKXA 5I17A 3OGCA 4I5BB 1GOHA 5FCUH 3O2DA 4G6JH 1FDLL 2I27N 1T89C 3BWAA 4NBZB 1QRKA 3VFOA 1RUQL 1NC2D 2Z8RA 5CKAA 3H42H 3C5ZA 1KJ2B 1MWAA 4BYHA 1QFUL 4U1IA 2B20A 4TUJA 5BZWA 1MOEA 4KZDH 1ZHKB 3VI3E 2VUYA 4RZCA 4Z7UB 3L7FA 1VEPA 1I4FA 1T21A 5JQ6H 3OF6A 1XIWD 4YDJA 3IXTB 3O3AA 3IDNA 4HT1L 4OFIA 4X6DF 4HUVA 2FEDC 2BCKA 4MNHA 4RBPK 3UTZA 2G75A 5GS1A 5HYJE 1E4WL 2WBJB 1U41A 2CDGA 3O3EB 4EN3B 3QISA 1HQ4B 1AD9B 1IKNC 3OKLB 3BO8A 2BNQE 3D85D 4M6AA 4HK3J 1MEXL 1N0XL 4TSAH 4WY7H 2CK0H 1XGRA 3GIVB 4M3KB 5MERA 3BP5B 3S4SA 2WIIA 4LHUG 4HFWB 3AAZA 3MYJA 4K71C 1NCNA 3WD5H 4FQXD 5IMLA 4S0SD 5DJ6A 3VCLB 4G8FB 2GSIA 1HQRB 4JQVA 4P49A 3KPOA 4PD4K 1CLYH 3BIKB 4KXZI 4JRXE 2VDNH 1JGDA 3KWWB 4JFHE 3IKCA 4N1EA 1JE6A 5K9OB 2QKIB 3HA0A 1DUYA 1J1PH 1JYWA 3TH3T 2I26N 5FDYA 1TZHA 3TM6A 4X7SL 5D70H 5GS1C 3U6RA 2IPTL 5B22A 5HYJA 3HZVA 3AC0A 2ZUXA 3TYGL 1NFKA 4FN0A 4QXWA 3HI6L 3WN5A 3LVEA 3WCYA 3WFZA 3LKNB 2WLYA 4MNQE 4YGVB 4KJPD 3QSKB 4HWEL 3ULSB 1F42A 2HMID 3H7LA 3QDHA 3KR3H 5IJVB 1C1EH 1YEIL 2NY1D 4N0CD 3SJVA 4JFOA 2CDGB 1IM9D 1K5NA 3O6FC 4M43L 1IEHA 1BVKB 3QZWG 3ARFD 3N1FC 3HFML 4F3FB 4HUVB 3IDUA 4DWHA 5LKNA 3QUYB 5DJXB 3EJZD 2NXYC 2VERN 1KJMB 3BW9B 3CC5B 5E9DE 5DR5H 1SMAA 5IGXL 3AS2A 1WFNA 4N0UA 4ONFL 5HD8C 3DHJA 2F74A 5EZOL 1FO0A 5DQJA 4NNXB 4JZOA 3VRJB 2J1KA 2WIIB 1NEUA 2DQUH 4E42A 1YC7A 3FTGB 1OL0A 4TSBL 1NCWH 4YH6A 1S7UA 1ADQL 1EZVY 2F8XC 4ODHH 1J1OL 4W4OC 3VFGL 1MCOL 4PB9H 2QKIA 3UEZA 3O6FA 5D2LF 1FVDA 2IQAA 3F5WB 1FYTA 1T1WA 4NSKA 1E0OB 3D25A 1YEJH 4HS3A 3KXFE 1T7VA 3DV6B 3TZVA 5HHOA 2ZG2A 1JWSB 5MHSE 1CL7I 2P5ED 4N5UA 4U1HA 5GRZA 1M7XA 5TH2B 2DIJA 5FDWA 3VA2C 5SX4I 2UZIH 3FT4A 1ZVHA 2A6DB 4DUVA 1CDCA 4KK5C 3MXWH 4Z8FH 2X89D 2IAMC 2EE2A 1P4IH 1NGQH 2QSQA 5L2KB 2MTPA 3MRNB 2AGJH 4K7PL 4GBXB 1JV5A 4JEGB 4HH9B 2FJFA 5E5UB 4NUJA 3HMXH 4HWZA 2BY0A 4PJ7B 4H8WL 4NM4L 2WLZA 4W68A 4QRPA 4PP1C 4LEXH 5GS0L 1PYWB 5F93C 4KK6D 4D2NA 4ZYKB 4Y4HA 4UOW1 4KGJA 4YIQB 2VR5A 1ETZB 4NBYB 5EUOB 5C8JB 4NSKB 2HJKA 4WI6A 1IBGH 1UM5H 4MSWB 3VA6A 4OI8A 5C08B 3HR5A 2CO7B 1K4CA 4XNXH 4DVBB 1XZ0A 4OCSL 4P46B 4P5TA 1BQHB 2P24B 4F9LC 3LQAC 3I6GA 1A7NH 5L9DL 5HI5D 3BP6A 1D7FA 3U1SH 3V4PL 1I8MB 3VD3A 2AJVH 4GAFB 3L5WA 4MA8H 4NNXA 4EUPA 3LY6A 4LSRH 5TDNB 4D0DB 4HQQH 1NDMA 1Z5LB 1ZKAA 3CCHA 4DZ8B 1SM3L 2YPLE 1QD0A 4TSCL 3LKPB 3SKNB 4XWGL 2P4AB 4DCQB 4QT5B 4X99B 4U2ZA 4NWTL 2PTVA 1UJ3C 4JR9H 3CK0H 1CDYA 1OTSC 3K2UL 5E4EB 3V6OC 4UDTA 3HZMB 4X6FB 3QDMB 2EYSB 2X4NB 3GJFK 3BESR 4R26H 1U3HA 2CK0L 4JFDA 1JZ5A 1AH1A 1EEZA 1R24A 3D85B 3AU1A 5BCAA 1KPRB 4YC2B 3QJHA 4NQVA 1LK2B 3OV6A 4K94L 5JMRA 4JFFB 4X6DB 1N26A 4B41A 3IU3A 3O8XB 1UZ8B 3NH7L 3S5LG 5CILL 2CKBH 5SWSE 3DO3A 1MCNA 3DUUB 1SQ2N 1NFDE 4PJXB 5F3BB 1D5BA 4Z5RB 3TBSB 3DV4A 1T1ZA 3QQ9C 3K80A 1AQKH 1MCEA 3JV6B 4X7SH 3SDCD 3HI1A 4R8WH 1VGKB 4U1MB 3I75A 3KYMB 2Z31B 4HIHB 3H9HB 1M7DA 4FS0A 4N8VB 2AK4D 3RIFF 2CLVA 5C71A 4PJFE 2G9HB 5DJZB 1NAML 1AO7E 4Y5YA 3T0EE 1LK3H 4Y4KC 3MLWH 3V4VL 5EU6E 1QOKA 3SGKC 4JPIA 1NANI 3PWJA 4UBDD 2CRZA 1C1EL 5DGQA 1GAFH 4PJAA 3E6HB 1P4LA 5FFLA 1RHHB 1BZ7A 3QO0A 4CW1B 3FB5A 2FBJL 3HNSH 3BQUD 3C2AH 3IB4A 1XMWA 4ZO7A 4OV5B 5TFSL 3HCVB 5CD5D 4WHTA 2FGZA 4XCFH 5C9JA 2EECA 3IRPX 1MFBH 3SQOL 1H3UA 1TTFA 4A6YH 5IR1B 1J5OH 3TT1H 3T77B 5J56B 1NAMA 5D7LA 4JB9H 1QQDA 4GS7B 2JCCA 4Y19B 1ZVSA 4TQEH 4OF0A 2XIDA 5F9JB 1X5KA 3D3VB 3LV3A 1ADQA 4GW4B 3V8CA 1TCMA 1HNGA 3BE1L 1J1OH 3VFGH 5D1XB 3G5YA 2NY3B 3GO1H 3CGTA 4HWBH 1IGIH 4QHKI 1RZ7L 4PLJC 3WS3B 1CICB 2ADIB 3IDMA 1KJ3H 5JLZA 3WNPA 1X6LA 1ND0B 5DC9B 4GG6E 4ODWB 5J13B 4JKWA 4HH8A 5CBAA 4DK3A 3T1FA 1NMBL 2Q1EA 2HVJB 4GBXA 4I3RL 1JL8A 1OQOA 5J1AA 5C0RL 2IADA 4PJCB 1SYVA 5T3XE 2EYTA 2DJSA 3FB5B 4NKOA 5E8PB 1K4DB 3FQTA 5MEOB 4R4BB 4MCYB 2C1OB 4HIJA 5BS0B 5H2BA 2GYSA 1PY4A 2L7JA 4NQSB 3VRIA 4KVNH 3O9WA 3BJ91 4X7TA 5ENWB 1GPOH 3T2PA 5B39B 1S5IL 3O2DL 1Q0YL 1O0VA 3IJSB 4GRMB 5KVDL 1A6AB 4R3SA 4HZLA 1TETL 1I9RH 1CXEA 4NZRH 1T04B 4KDVA 5IKCB 5IHUL 2NCMA 3ULUF 4HW6A 1TVHA 3L5XL 5HGHA 1MRDH 4PV9A 4OFPA 3IFLL 1E6JL 2MPAH 4OV6F 1OAUL 3PGCB 1SYSB 4NNYA 4OZHB 2BHYA 2JCCB 5CHNA 2H45A 2D7QA 3IT8D 3QPQD 2NXZB 2QHRH 5JW3L 1IGJB 3BGFC 5D9SB 2QHLA 2VXQH 3QWOB 4PJHF 1BAFL 1ZGLB 4IOIB 4OLZL 2J5LB 3MA9L 4LCWE 2BRQA 4Z0BL 1D3CA 4G3YL 3ZE0E 1H3PH 5EIVA 4YHLL 2FH8A 3KGRA 3BIBX 3CFDA 4O2CA 3Q3GB 4YWGH 4EQ2A 3PIQB 2FEEL 1S9WA 1CYGA 3QH3A 1I85A 4D0BA 1KN2L 4GMSL 3VWJA 1XH3A 2OP4H 1P4BH 2YK1L 4P9MH 4W6XB 2V9RA 2A38A 2DS4A 4WFHE 4LLWA 1QFWI 1NMAH 4MCZA 3GGWA 3SDDC 3TN0D 1T0PB 2OXHA 4KI5C 3I75B 2G2RB 1HSBA 3MRJB 4NZJA 4PBWD 2Z31D 4X5WA 2DWDB 3HG1E 3DSFL 4QY8B 3QUXC 5DHYB 5EUKA 5ICYA 3MCKB 3X12B 4YK4C 1JMXA 3TN0B 4I48B 5JIPA 1ONQB 3DBXA 3FB7B 1PFCA 4HEPG 2YD5A 2BSED 1AI1L 1CU4H 3WMSA 3L6FB 5E6IA 2Y7QA 3MV9B 5C6TL 1GGIL 3CFKA 5EZIH 3QQNA 3GMNA 1KCRH 1S9VA 3CSYB 4CNIB 4DQOH 2ESVA 5F8RC 3NAAH 2VISB 3KPLA 4M6OL 5IOPB 4OIBA 2EXWC 5CEZH 3FFDA 5DUML 1F3JB 4XCCL 2GIYA 2AK1H 2E8ZA 4WIQA 3NFPB 4PJEE 1H8NA 5CINL 1TNNA 4QRPD 4ALAH 4DGVH 3O6ML 4AEEA 5DMKA 5FGCE 4Z7QF 5DMYA 4N8VG 2NLJB 4PRIE 3N9GL 4Y19A 4JM4H 1MPAH 4XPGL 5CCKL 5DDHB 1GSMA 3KPSD 4NHCL 3NACH 3SQOH 4LASH 2QQNH 1EBPA 3U36B 3NIGF 2I9TB 4K23H 3QPXH 1V8HA 4YXKL 3DMMB 4Z7WA 3NIDE 3NFPA 2MHAB 3NZHH 5E70A 6FABH 5EU6D 4DVBA 2BY2A 2WUCL 4QCIB 2JF1A 5KSVB 1SY6L 1XR9A 2CSPA 1D5ZA 5IESH 3GMQA 4HUMB 2VH5H 1TZIA 3CFEB 2D7OA 3TIDB 4O2FB 5C86A 1P69B 3N1QC 3L3KB 5ISZD 2XKUA 1ONQA 4YGAB 4DAGH 1F3DJ 2V5YA 3MCKA 3X12A 2EC8A 4QRQB 2P8PB 1IGCH 1P84K 1HHGB 1R5VA 3MSPA 4YFDB 1Y18B 1T80A 4KMQA 3GM0A 1AR1C 5LWYH 2VLME 3MLTA 5D96C 5LVEA 3WNMA 1OF2A 1S5IH 3O2DH 4MJID 4PREB 2X7LB 4LLUB 1CE6B 4CBPA 3VFUA 3WFDL 1BQLL 1RUQH 2NY3D 4XCYB 2C4XA 4YPGB 4ZO6A 4HS3B 5HDQH 2ATKA 4HBCL 4KI1A 4NC0B 1U3YA 4DOHB 3C6LD 1IEBB 1T0MA 1CBVL 1WAAA 3O6FB 3QUXA 1JWMA 1R5IA 5C08E 2V7NA 2HN7B 5HI4D 5JIKA 4LEOB 5D96B 2W60A 3GMPA 3H3PL 4XPHH 2ORBL 4D3CH 3O2VH 3H0TA 4J12A 4D0CB 3DROA 2VXQL 5DD3H 3QIBD 1KYOK 4ZUTA 3V52H 4MD0B 5I76B 4OZIA 2CJUL 4F9LA 3BQUB 4GUPA 4NYLA 1ZLWK 2WMPA 3V7MA 3DMMC 1RZ8B 2XZQL 5CMAA 4P2OB 5KOMC 3IKCB 3NCEB 5HYFA 5GGRB 3WL9B 3BIKA 1MH5A 2JCCF 3ZKMC 2NTFB 2Z35A 1HQRA 5FUCE 3ZZ1A 4XP6L 3PWPD 3ILPB 2YXMA 3SJVD 2AP2A 5JHDB 1XR8B 4JKPL 4NQUA 2W59A 5F7DB 2EH8L 1CXFA 5HVFB 5JW4Q 5F8QC 4Z7VA 1J1PL 4XPFL 3SDAD 1A6WH 2E7BA 4W70A 2IPKA 1IKFH 4MDIB 1G7MB 5I19L 1MHHB 2E9IA 4ZODA 1MCWW 3PV6B 3RL1A 1S7RA 3JTSA 4FQ1L 1CGSH 3U0PB 5JORB 1B9ZA 2ZOLB 1OP5K 1JZ6A 5I8EA 3DXAA 4LLMB 1TJHL 4GXVH 3EHBC 3RIAF 3PF2A 3IDMB 4PRHE 4WWKD 1GC1C 5DMKB 4WWKA 1S7QB 1QVOB 3G5YB 4FG6D 5MEQB 1JGLH 4O58L 3MRPB 3R1GH 4DKDC 5IMMB 4ELKB 4FQXA 3CFBA 1DANU 4Y16D 4JDTL 5I8OH 1R0AH 1EUTA 2YMXL 3PGFH 3FOMA 4FQCH 1FNLA 2NY4D 2DM3A 5CUSL 4J8RA 5D7IB 4K2UL 2PTTB 1DBMH 4OLVH 1U3JA 4H26B 2QSCL 4KK8D 3MGTB 5I1HH 4D9RD 1J11A 5SX4H 4RGMC 3GSRB 4P46D 4Z95H 4ZPVA 1J12A 1C7SA 3PWUA 2KUTA 1A6TB 1HZHL 3P9LA 4YXKH 4GSDH 2F15A 1S9YA 4OFDA 5DJ2B 3VJ6B 1ZGLP 2AXGA 5CIPA 4NZTH 3RI5F 3WIFB 1WCBB 3RVVD 1HCVA 4OGAD 1EAJA 4U2YA 2BDNL 3K1DA 2A74A 4JZNB 1DE4B 1A2YB 4MWFB 4KZEH 5MENE 3RWCA 1FHGA 5EPMA 3RIAK 2UWEA 3MO1B 3B9VA 3A6BL 4FQHA 1X44A 5KS9F 1HIMH 4PJIE 4RFOL 2NZIA 1BOGA 3PGDA 3GNML 1CFQB 4FQIL 2DM4A 3QHFL 3V5KB 1NGQL 2OCFD 1BBJA 4EI5A 5IEKB 1NCWL 4OLXH 1FGNL 4N0UE 5C2BH 1OWRM 5EIIA 1SHMA 3CPLA 5FYKD 3CX2A 3MUGB 1FFPB 4LLQB 1NFIB 2YZ1A 3G6JE 4L8SA 4HLJA 1KB5L 5IHZA 1NGZB 2UVFA 5DUPL 2ADFH 4YUEL 4Y5XB 1IAOA 4NRXB 3MRRA 2GTWA 3TH2T 1BVLB 5J9PA 5H94A 3QQ3B 1A6VL 1Q72L 3SDXE 1FL3A 2BK8A 3DOSA 2R4SH 3LDBB 4JFXB 5IBTL 3HE7D 2AJ3A 4PRDA 1OAKL 2FIKA 2B1HH 3BPNB 3M07A 2DOCA 2VABA 5C0JA 3MXVL 1AR2A 4I4WA 1KPUB 3KPMB 3G04A 1AFVH 1N7ML 1CDJA 1K8IB 3IDIA 2FNBA 3Q2CA 3O9WB 2ZUUA 4KQ4L 4MJ5B 3QUYD 4ENEC 3QUZD 2XZCL 4XVJH 1OAQL 1ZTXL 3SKJH 4TSBH 2HJKB 1MLBB 1J0IA 1UJ3A 2FEDD 5EBMB 4PV8B 2CDEB 4D9LL 4QRRD 4XNXL 1OSPL 1WAAE 4PV9B 4M1CD 1N5AB 4X7FC 4WCYH 5TQ0L 1MFDH 2HT2D 2NY0C 5A2IH 5DWUH 1RZIB 2DYPA 2LTQB 4Y5VB 3O11B 2Y36L 4NO5B 1RZKL 2X4UB 3MGOA 2X9XA 2YPLD 5F3HA 4LSRL 4MXVE 1NLBH 1NANH 3OHXA 5DJAA 4BZYA 5CKGA 4M7JH 1Y6KR 2X6MA 4LIQE 5F97E 2X2YA 3C60D 2R2BA 4PJHB 3WFBL 3ESUF 3RZWA 3PJSB 3NN8B 4BSVA 3BPLB 4F8TA 3KHOA 4Q9RL 5C9KA 4UT9L 1R5WB 2IALA 1KB9K 2GY5A 2R56L 2XV6B 3PNWB 4YEFA 2UUDK 3S37H 4FP8L 3GBNL 4TNWF 5TE7H 5GS0H 3GJFB 1PG7X 1LO4H 1HHIA 3R06B 4HF5L 4QRUB 4JG0L 4RAVA 5HTSA 1T7ZA 1BZ7B 3QO0B 3T2NH 3QA3A 2OL3A 5IUSA 2P44B 2HT4D 1I8IB 2DF3A 2AJSL 2ERJC 3X13A 4WNQA 5CGMA 1I1YA 1YMME 3VD7A 3GSOB 1LD9A 3EYUH 3RAJH 5I1LA 5CJ8A 3SGEH 4N0CC 4XP9L 5DK3A 4NO5A 4LQFL 2IH1B 4XXCA 1YMHB 4HV8A 5D7JC 1NCBL 2GCYB 3NFSL 1BFSA 1PD6A 2CXGA 3EYOA 3QUZA 4P5KB 5I1IH 1H8SA 1UJ3B 1YN6B 4C55A 5FCSH 2MQ0A 4LVEA 5HD8D 3HI5L 3QG6B 3C09C 4OLYL 5CJOL 3AB0B 3QIWC 1T5WB 1IFHL 2YPKA 5I74C 4ODSH 3CVIL 5EU3A 3I6KA 1JPST 3ARFA 5IG7B 4C54A 3RU8L 4IHOB 3ELAT 2CIIB 4KJQC 4MYWB 5GJTH 1QBLL 3DETC 3WFEL 1MIMH 4DUWA 3QDJD 1JNNL 4M61B 5E2VL 3UX9B 5J11C 5E00B 5JPNB 2BMKA 4UUJA 3DYPA 4M7KH 1JGVL 4EI5B 2R2HB 3HNTL 4BH7A 3UROR 3QDGB 3N85L 1NCUA 4M02A 5KVDH 2ARJA 1VESA 2GT9A 2IAMD 3B2VL 1UENA 1T22A 1QRNE 2VZTA 4HKBA 1RZJC 5KS9B 4X8JA 1DVFC 2YKLL 5C0GA 4Y8AA 5BXFA 3IFLH 1CGYA 2EDLA 4KROB 1FL6B 2H8PA 3MRHA 1I3RA 3GMLB 2PKDA 2MHAA 3PXHA 3L3HA 1A7QL 4UMGA 4KRMB 3AFLA 2BVPA 4UIKH 2WBJA 5DZOA 2F19H 4RGOL 2ED7A 2AQ3A 3RHWF 3UPAA 1Q9OA 3QCTL 2G5BA 1GPOL 5BO1L 3UTSB 2GJZA 5B38B 3BEVB 2YN3A 3OAZK 1RAMA 1FDLH 1PLGL 4JQVC 2Q20A 1PG7H 5DQDL 2OTUA 5JO5A 1TDQA 5BVPL 3BMVA 2HH0L 4CMHC 3OXRB 5EC2A 2HTLD 1LO0H 2FX9L 2FZ3A 1VENA 2J88L 1BJ1H 4D9LH 3UC0L 1RU9H 1IC5L 5EO1B 3NOIA 1TNMA 2QJDA 4TN9A 5BRZE 1MFDL 3B8SA 2QHRL 1P2CA 1SJVA 4JFQA 5F6HJ 1QEWA 4JO4H 4ERSL 4J4PA 2NR6D 1JPGA 5FGSA 4L8DB 4UUJB 2ZCKL 3LD8C 3EFDL 5EORL 3IFOA 1CI5A 5IQ9B 2NX5A 2Y6SC 2VLKA 5CZXC 2R9HC 1BP3B 1H5BA 5KS9A 2WP3O 1AP2A 1AJ7H 4L8CB 1MCWM 1XF4A 2UY7A 1EVUA 3NIFF 1M71A 1QO3B 1MHEA 1I3GH 4Z7WF 5FCUL 5ICXA 3VG0H 2V9QA 4JANB 4U1LB 3WLBB 5DJXA 4MX7B 2RFXA 5FM4A 2ICES 5CEZL 2EIDA 4MQ7B 3ARGA 5AD0B 4LIQH 4XPAL 5J6GA 2BSSA 2VQTA 1B0RA 4TUKH 2B0SL 4JG0H 4LP5A 1X3DA 1Q9WB 2LABA 3HG1A 4UTBH 4BKLA 4RISL 4Y4KD 3H9SA 3ULSA 5I74B 3CXHJ 3WLWD 2D03L 5EZLA 1RIVH 1UCBH 2Z8WC 4EIZC 2XTJB 5D7LE 5KVEL 3HUJB 3IYLW 3TLRA 5I1GL 3C60A 3KJ4C 4J3VA 4DTGL 4L4VB 5DUBA 1YEIH 1EO7A 4X7EC 5ACLA 2YSSB 3NAAL 1LO2L 4ZAKB 4NNYB 3UJTL 2CLZB 3NZHL 5H35B 4YHLH 1KCUH 3UAJD 2FB4H 3O8XD 1X7QA 5ESVA 3VFVA 3OJDA 1LDSA 4FQPA 4PRID 3RWFA 3P73A 4OCYL 4XP4L 1FZOA 3RWDA 5F7EL 5L6YL 2PXYA 4JO1H 4Y4HC 2FYYA 3FOLA 3MV8B 4HKJB 4OT1L 2VQ1B 5FYJL 2NW3B 1RJYA 4P23A 3EDKA 1MIML 1I1AD 4KDWA 5FUZL 1HQ4A 5E2UL 5CEXA 1ORSA 2LVEA 4KPHH 1B0RB 3IETB 4M7ZB 4ZXBC 2J6EL 3U46A 3IDNB 4M1GL 4NZDA 1RZIA 5FA4A 1CD1B 1CU4L 1GIGL 3NGBC 3CSPA 4E9LA 2DQCH 1JZ8A 2VDPH 5ESAA 1X5XA 1OAYL 4XHJC 2NNAB 4M3JA 3DNKA 4X6CB 4HULB 1YDPB 4Y5XC 3X14B 1CGWA 5TF1H 3MFFA 4PJIF 1J0ZA 1F58L 4JJHA 3PWVB 5D7SL 3ZKND 3D0VB 5FKPB 5F7MC 4CUCA 5EU4A 1VHPA 1NC4A 1F2XK 1NAMB 5L0QC 2C1PA 2Q8BL 4CNIA 5LGHL 3TBTB 1CFVL 3VW3H 2B39A 2HG5B 2AXFB 5E2WL 1A21A 4LPCA 2YD7A 5HHME 4LGSB 4GG6A 4MS8D 3DBXB 1U9KA 3FB7A 5KBNC 1Z9OA 2BNQD 3A6CH 5GXBB 5D6CA 5D2NE 5BV7B 2F54E 1U8LB 4FFWD 4L1HA 4G7YL 3MODH 1UXSB 4K23L 3P40A 3MRCB 3F58L 2JIXD 2Y5TB 2D7MA 4NFBA 1CBVH 1P1ZA 2P5EB 1H15B 1JNJA 3Q6FB 4KKAD 2ZWLT 3ULUD 5JDJA 4JREB 5IQ7L 5KAQF 3JBG7 5HHVH 3OR6A 4F80A 1ZLUK 5DDHA 1IC5H 2BSTA 3B5GA 3RVXD 3G5XA 4WO4D 5I73B 2P8LA 4NJAH 5EZOH 1ZT1B 5IMOA 4P23D 5DD3L 3NBNA 1NSNL 4R4ND 5DJ8B 1LE5B 2GTWB 1EGJA 3QZWA 1WBXA 2CO6B 3MBXH 4KHTL 4I3SL 4IRSC 1IGCL 1BHGA 3BPLC 3BPCA 3GMMB 2COQA 3IJHB 1BGXH 3WDJA 4QF1A 4JFZL 1KXTB 4YFLI 1G84A 4L4TB 1DJSA 4W6WB 4HMEA 3LKRB 3UO1H 3P4NB 5ACMA 2CMRH 1HNFA 3TVMD 3ARFB 1IAIL 3O9WC 1T1ZB 4JKPH 3LZFH 3QUKA 1P53A 1LEGA 1F6AA 3RTQD 5EUOF 5D72H 3EYVB 4XPAH 3TGXA 3TA3A 3U9UB 4YJZL 5C0IA 4MDJB 4X7DC 4F7TA 1P4IL 5ICZB 4RA3A 4CVXB 2IFFL 3G5XB 3OAYH 4WDIB 3UZVB 4ETQB 5AYQA 5JOPD 5M94B 4HPYL 4HBQA 3ECBB 4U1KA 1FRGH 3NIDF 4G8GD 4EUPB 3O4LB 1D6VL 3PWLA 3O4OB 4P5MB 2J8HA 3C5ZD 3I6KB 2VDRL 2XN9E 3QXAA 2J5LC 5D7JB 2R29L 1A7PH 3W5NA 3L95A 3KPRE 3UYPA 4XNUL 2IFGA 2XA3A 4ZSOB 3QJFB 3K2UH 4NKMA 1WCQA 1KLFA 1YEDB 3KPSE 4PG9B 5L7XH 4JZJB 4FZEL 5CSZA 3MCG1 3V6ZA 12E8L 3MO1A 1UXWA 1J88A 2I24N 3WS3A 5CEYB 5F1IA 3LPWA 3GBMH 1DBML 4OLVL 2W0FA 1K4CB 2HFGH 1V7NH 4TSCH 2H6PA 1F4YL 3RY6C 3CDGB 2DMKA 3DX9B 3MV7B 2I5YH 1FGNH 1I8IA 3GMOA 3MBED 1XGUB 4MJ2A 4XBPA 4RDQG 1TPXC 2V6HA 3H9SD 4QHLA 4Y89A 4BELD 4MD5B 2DDQL 1KJ3L 2HVJA 3EOAA 2OR9L 4NRYB 4OFVA 1KIPB 4XBGB 1CLCA 3ZKSD 5IB2A 5B4MC 2PF6A 3RKPA 1TQCB 4NJ9L 5B39A 2W9DH 1FG2A 3O6LH 4I3GA 4RMRA 5GGRA 1RI8A 1V3MA 4R96A 1K6QL 1ZK9A 3ZDYE 5EA0L 2HT3D 3V5DA 5JOFB 3GMOB 4EI6A 3M8OL 4JFPB 4ELKA 1M05B 1T89A 4YHZL 1JGEA 3FO0L 3RZCA 1GL4B 1HWHB 1XR8A 2B1HL 5IMMA 1M6OA 1Q0YH 1KJ2H 4KQ3H 5JUEL 3S97C 5E56A 1BBDL 2Y4SA 1HILB 3FT2A 2NY5C 1MHCB 4S1QH 4UV4H 5BW7A 1VGKA 1JZ7A 4XMKL 4L29A 3QUMH 1AY1L 4NHUB 4G43A 1FVDB 4X0KB 2C3VA 1KEMH 2FIKB 1NMCC 2GAZB 3E3QE 4D8PB 1MLBA 3E2HC 4L3EA 4PIRF 5FKAB 1FBIH 5DQ9A 4NO0D 2YSSA 4HAFA 1SBBA 2AJXL 4O00A 4ORGA 2AK4A 1VEMA 4ODBD 1ZLVH 1D5XA 3IF1B 1U8QB 3CDFA 5EWIH 3DHMA 3ZL4L 1AE6H 4XC1L 3V4UH 3RX5A 1GCFA 1AKJA 3QNYB 1CGUA 5DFVD 3ZLQC 3IU4L 5HHMD 2YEZA 5F9OL 4RWHA 1MY5A 4UV7H 1VPOL 5F6IB 4NQXB 4RFOH 5JA8B 4GKZB 1J8HE 3IVKA 3TIEB 4KWUA 1P7HL 1BBJB 4LLDB 1KIQB 1QLFA 2AK4E 3SJVE 1JGDB 5F96H 3BN9C 1W0YT 2Y25A 3R4DA 4L3EE 3GO1L 4OZIB 1A4JA 4GKSB 2H3NB 4P9ML 3ULUE 4LARH 4FTVB 5DJ6B 4JAMA 4PS4H 1CWVA 1JF5A 3T0EC 1YECL 1EEZB 2R0ZH 1QSEA 3DSFH 5HBBA 3ZE1E 2MPAL 2EDEA 4Z7WB 3L3DA 1F4WL 4APQB 1GRWA 1TENA 3DVGB 3PGDB 2I9TA 3WFBH 4FABL 3CZFB 4FG6C 4K8RH 4FMKA 3V9FA 1I8LA 1C5DB 3X3FL 1NGWA 1MJJA 3ULVE 5F7NC 5KZCB 3E0GA 1U8QA 1NCDL 3TZVC 1NCBH 5FYLL 4ZDHA 5C09B 1QLEL 3VFMB 1CIDA 4QTHA 4ELMB 1MWAL 2X4NA 4U6XB 1J8HB 4U1IB 4KI5E 3O0RH 3HKFA 4OLYH 3REWA 4C56D 3SQBA 4DGVL 2V9TA 5INCB 5LAXB 5DTFA 3GFUA 3RNQA 3FONB 4CADA 3DSNA 2IC2A 3T3PE 3ET9F 4Y4HB 5KSAD 2QQNL 3TIDA 4XP1H 1Q9LB 4OZFB 5HVHC 4OGXH 1TZIB 3CFEA 1FFNB 2H9GB 2QADD 3CU7A 4N0YL 4YPJA 4CVUA 1X5ZA 3RL2B 3VGDA 2J6EA 5SWSD 4AENA 1HXYA 2EH7H 4G42A 5GZOC 4PRPE 2VITA 3PL6B 4MCZB 2IANB 4LSVL 3E8UH 4JAMB 4QTHB 4JFEE 2CK2A 4J4PC 1ZEAH 1UM6H 4XC3H 2GK0B 3SDXF 2H2PD 1U8KA 1T20A 3GRWL 1J0JA 3TN0A 2R2HA 1QLRA 5BZDA 1A22B 4LSQH 1FSKB 2FJFB 4RGNE 1PZ5A 1OTUC 3STBA 1GVIA 4KUZH 3CFDB 1T7WA 3REVA 4U33A 1O7VA 4DGYL 43C9A 3LSOA 3MLXL 3MRJA 2F5BH 1F4XL 3FRUA 2YA0A 4LF3B 4S10A 2YR3A 2F19L 5DO2D 4JQXA 3QWQB 3VFSA 3M8OH 5D1ZC 5GZND 5LWYL 1CD0A 1AXTH 2J2ZA 1FYTD 3HE7A 4HDIB 3KPPB 3P2TA 4LASL 3ILPA 4KXZH 5IROA 4YO0B 3CX5K 3LOWA 2YD3A 2QQKH 4MGXA 4HBCH 3U6RB 2I07A 1G7HA 4TRPL 1RSFA 3AMKA 3UTTE 4RA0C 5ACZA 1T1XB 1QHPA 1WIUA 4PJ5D 4WENB 4RMSA 3EYOB 5C0AB 4EI5C 1TTUA 3Q5OA 1FBIL 2AEWA 3QUYC 1GXEA 5IF0B 2A73B 1V3KA 1EAPB 5I76A 1EBAA 2V2WA 4Z76B 2GITB 3ARZA 4PJDF 5E6IC 5IG7A 4XC1H 2O61A 2VO5A 4HK3N 4GLRI 1H5BC 3T65A 2FWOA 2P1YA 1ZT4A 3E6FA 5EORH 3SDYH 1X5FA 1F6AB 1RJLA 3QG6A 1RURL 3DUSB 4KJWC 4RMWA 1DQLH 4IDJL 4KU1A 1G7JB 2ENYA 2BCKB 1EO8H 3DXAE 2WUCH 1SBSL 4P5KA 1A9BB 4K3HA 2X7LA 2XZZA 2FHBA 5ICXB 3L5JA 1YMHA 3QEHB 5GGRY 4KRPD 3C6SB 2ATPB 5EU5B 5TE6H 4L8CA 1VA9A 3G08A 3AM8A 2AERT 1IMHC 1RK1A 2OYPA 2VE6A 3ESVF 2EDBA 1RUKH 4O5LH 4QRQA 5D8JL 2LU4A 3S88L 3BO8B 32C2A 4Q6IC 1FLTX 2EO9A 4LOUC 2NY5L 2BNRD 4FABH 1PKQA 4L4TE 2P45B 3MV11 3L3KA 5E8EA 3CLEL 1JIBA 1IC7L 4UTAH 5I1GH 5DT1L 4DTGH 5D2LB 2NX5D 3CVHL 3WO4C 1KELH 4G6ML 1JPTH 1OGAE 3QB7C 3KJ6H 4YDVA 2JJUA 3D39E 2X4SA 5BVPH 3K0WA 4HFUL 4EI6B 4QOKE 4MVBC 5D7JD 4ZO8A 5I1EL 2B0SH 5D7KD 3MV7A 4KRPB 3KLHD 3T77A 4NKOB 1BWWA 2OQJA 5E8PA 4F33A 4XVTL 1NUGA 4EBQH 3KYOB 4P2RA 5J1AB 3UXFA 2BERA 1IJ9A 3JWNC 3K8LA 3T04D 2PW2B 5IM7A 3M17A 2FD6L 3PP3K 5DK0A 4QGYA 3LB6C 4C59B 2NLJA 3V79C 3PWPB 2AVGA 4Y4KB 4Z0XA 2B1AH 4ESKA 2VXUH 3I3BA 4LFHD 3AREC 4KFZC 3PQYB 1IQWL 4X6CA 4BFIB 3D0LB 1M4KA 2VDQH 4M93B 4AENB 1A7RL 1G0XA 1N64L 1UQSB 1G7QA 3O45B 5FUOL 5C7XL 4OB5L 1YEHL 3O3DA 1FFPA 3S98A 3KYKH 1EH9A 1RUPH 2VIRB 5IB5A 5L88L 4AG4L 1FNHA 1FJ1A 4JQIL 4LLVB 3QAZC 2GUOA 1L9MA 1YY8A 2D7TH 1FC2D 2BVOA 4NWUL 5C0BA 4M1DH 5KVGH 4WDIA 1W72H 5D7SH 3OF6D 3TJHC 3TO4D 4HUUA 4JFXA 2VDKL 4ETQA 4G6KH 1XCTA 3IFPB 1RJYB 5CD3B 3KPNA 1AQKL 3LS4H 4X6CE 4KAQL 4LCWA 5J9PB 1TZGH 3H9SE 4GKZA 3RKDD 4WO4B 1D9KC 3SE4A 1V3JA 4POYA 1B90A 2JELL 1QRND 5D7JA 4RISH 4AYFA 5T1KD 4GW5A 1X9QA 5GGVL 5HY9B 1GZQB 5DRNB 4TOYH 2G9HA 5BW7C 1LMKA 4QHNB 3VFTB 5JMOC 2NY0B 2QSVA 3A6CL 4GAGL 3D9AL 1TJHH 4GXVL 3SDAA 1IGJA 3VXRE 5JW4R 4XZUB 3C6LA 3CMOH 3NCMA 4Z95L 2VDPL 1VADA 1HHHB 3RBGA 3QXVA 2AV7A 4JLRA 4TRPH 1IGYA 2DQHH 4WEBH 2B8OT 5CD3A 4GKOA 4XNQA 3RPIB 4APQA 1Q8MA 4XXDA 3BEWB 4LLVA 3LS5H 1PZUB 4JDZA 4UT7H 5SV3A 2YMXH 2Q87A 3BP4B 3ZE1F 4OZIF 3OTTA 3TBTA 3BP6B 3PL6D 4Z7QE 3O3DB 3B83A 1Q9WA 2DMCA 4JB9L 2BY1A 3CFBB 2FBOJ 3HR5B 2A9ML 1T0NB 4OJFL 3EIFA 4M8QA 2YC1A 4XVSL 4GRWB 4NCDA 4QTIL 2E7LC 2D4FA 2EEAA 3I2CL 3OR7B 1QZ1A 4UOW0 1AHWB 4F2MA 2CD0A 1BGXL 3QNXB 4HUUB 1FIGL 3GJFA 3SE9L 4AM0A 3MTRA 5C0AD 3DVNB 4F7PA 2GUOB 1F13A 1ZA6B 1OCWL 2IANA 3MX0A 1EO5A 1JI1A 3RWIB 1I1AA 2KH2B 3QHZH 2X44D 1U8HB 2EYRB 4Y4FD 2PR4H 3V6OA 5HHOD 3GNMH 4HG4K 4UB0L 2VDMH 2W65A 5C0BE 3FQRA 5D1XC 5KSUA 3GHEL 3EDDA 5M95B 3S88H 3WIHL 3MXVH 5T1KA 1TETH 3MACL 3DV6A 1U3ZA 5DD0L 4LBEA 4DEPB 1ES0B 4MQTB 4CAGA 4K3JH 1XGQA 1MVFA 4KTDL 4POZC 2FECI 4HF5H 1KELL 3JUZA 1N8ZA 1ZTXH 2J8UE 3MV9D 2VMFA 4G6JL 4KV5E 5DSCB 1NC4B 5AG9A 3TBYA 4PY7A 1JF6A 4AH2A 5FKPA 3S36H 2AJUH 5I1KH 5D6DA 1P4LB 4QLRA 3GSWB 2OMNA 4WCYL 5I71B 3NTCH 5TH2A 3I9GH 3K2MC 3ZKQD 1OAKH 1T83A 5K93A 4WUUD 4H0IA 3LN4A 1FRGL 3F62A 3VGEA 2OTPA 3KPMA 1KB9J 4D9QD 1J9CT 2KBGA 4J3XA 3QAZB 3RVWC 2HTKD 5GRVK 2Z31A 3H9HA 2WBJC 4HJ0D 2CUIA 9CGTA 1T0MB 2VXSH 3HI5H 5HPMA 5KSAB 5CSGA 5IVOA 3BPOC 4Y4HD 3D39A 2BJMH 4YWGL 3UDWA 4MQ7A 3QI9C 2UWEF 4BJLA 4X9BA 3CXHK 3P0YH 1NBYB 2FATH 3I50L 1T5XA 1Y0LB 2GT9B 4M48H 4ODUB 4RAUB 3S37L 4KJYA 3RGVC 4C56B 1BD2A 1PKQE 4L4TA 4PJBE 5T3ZE 2W9DL 3O6LL 2AJYL 5I18L 3WFEH 3DVIA 1RZFH 4LEOA 4NQDE 4PBXA 2JJWA 4Y4FA 5D5MB 1I7ZB 4NZUH 1EK3A 4NWUH 1LE9A 1F4YH 2FECL 4XGZA 5FO7A 3FO0H 5GGTH 5DK2A 3CD4A 3HG1D 1RJLB 1U42A 3IDJB 3P9MB 4JFED 4X4ME 1TQBC 2H32A 3B2VH 1ZT4B 1KBGL 2X40A 4YQXH 3D69A 3DLQR 5E2JA 1EEYA 1F02I 1TMCB 5I1IL 1MSPA 2VDRH 3ZTJG 4TTGA 5JR1L 1WCBA 1QKZH 4UAOC 2OBGA 3DX6A 4N9OB 3W5MA 2VWEC 4UDTB 1KJ2A 1MWAB 4OF6A 4AK1A 2IBZY 3IFNL 2D31B 4HX1A 2VUOA 4KKCC 1WF5A 4EKXA 3AMLA 3RRQA 3AS1A 1GOGA 5JW4N 5DQDH 2NY6C 2JB5L 5IBLC 3NCCB 1T3FB 3MBEB 4UV7L 3QI9A 4OF5A 2OR8A 3HE7B 4WI4A 1H5BB 4KY1H 3C9NA 4FZ8H 5TQ2L 4JFEB 3FO1A 4G8GA 4ZXBA 4OBSA 5JDSB 3MRDA 1MJUH 3IFOB 2VAAA 3RVXC 1J05A 1YUHA 5CZVL 1NJ9A 1L7TH 4OD3L 3OKKB 2WAHA 1H3XA 5CJOH 4P23C 5ETUA 3BDYH 5FDWB 1H9VA 3BKYL 4S2SA 1ITBB 3KPQB 3BT2H 3G5ZB 3UBXI 3MLUH 4ZG1A 1FFOA 1MRFH 3BGMA 1U8OB 2DM2A 4B53A 1MJJB 3QDJA 3TNNB 3GI8H 4HCRL 1OW0C 2C4FU 1WC7A 2XWTB 3RHWK 2ERJB 1A7QH 3TBWA 3C5ZB 4U6XA 4QXTA 5CEYA 4LLWB 3BP7B 4R0LC 3DO7A 5MI0B 5C0GB 1UB5B 1TTGA 3V7AE 2OJZH 2X4TB 1QFWL 5E9DA 5SWZE 1U8IB 3RA7L 3MBEA 4I9WE 5ID0B 1HH9B 3PIQA 5J3HC 1PKOA 3ZYJA 1NKRA 3CZFA 3JTTB 4WUUB 1QSVA 4L9LA 2F58L 3FONA 2OS7A 1GOFA 2DQEH 3QEQA 5HXMA 3C5ZC 4L5FL 5LAXA 2MMXA 1NPUA 2BXYA 1IZJA 3MRFA 4P2QA 2G2RA 3HAEG 3MQIA 3H3PH 1XGPB 4XPHL 5K9JH 2ORBH 5HY9A 3JV4A 2ZSWA 4RAHA 2BVQB 4XAKE 4LAQL 2Q86A 4ZFZB 5D2NC 3MV7D 5LGJB 1OP3K 3BWUC 4PRPD 4XMLL 2NY4B 2B4CH 2X9YA 2ICWI 3IXAB 3KPNB 1U3HC 4O02H 5I1JH 5J11B 4G6AC 4U3XA 2E3VA 3VXOA 5DZNA 3IVKB 2OK0H 3HE6D 4U7SA 4M6NH 3S34H 1MAML 3GI9L 3ZDZF 2Y1VA 4X6BB 2JK5B 5DJYB 2AI0L 1N6QH 4V2BA 1AKJB 4RRPA 3NA9L 4X9IA 2KZWA 3MUGA 5GJSH 5FF6A 4X5LA 2ZCHL 5F88A 5D9SA 4BQBA 3LKQB 5EIIB 1MFAL 4C56A 3B9DA 1T5WA 1OAZH 2AABL 5L8LB 3WXVH 3VFRB 4IMKC 4R4BA 5KJRL 1P84J 5C70A 2HFTA 3IJYA 1FORH 1SYSA 2ZCKH 4PFEA 4Y8DC 4LLDA 5JXAH 3VDCA 3MCLL 3C5JB 3TIEA 1TVHB 1ZANL 1KN4L 2X9WA 5SWQB 4LSVH 4JFQB 2VWEE 4R8WL 3E8UL 4NQXA 4P2QE 2DBLL 2DLIA 2DQGH 3H7BA 2BOCA 1OAYH 2CKNA 3KDMA 3IXTA 3Q6FA 4GLRH 3JV0A 4TULL 5HVHB 1I7RA 3JWOC 1D9KA 3CXDH 5DD1L 5GRYA 3SE4C 5GRJH 2LAAA 3ZYZA 1TJGH 4QHLB 1G6RB 1LILA 3KPSA 3MRIB 1LP9B 4H5SA 4NN7C 5E7FA 2LFGA 3EUUA 4DKAA 1S3KH 3PGFL 1AHWC 4FQCL 5T1LA 2ZSVA 5IR1A 3WJJA 4L3CB 4JVUA 3FFCD 4YHMH 4OCYH 3MJ8B 3VE0A 3VFPB 4BUHA 5DSCA 1RVFH 3ARGB 3HN3A 4BSJA 4LSPL 5IIEB 1DQQA 4ZO9A 2VLJB 3STZA 3VXUB 1N5AA 3TT1L 3JSSA 2EE6A 5DMGD 1HZHH 5T1KB 5A2JH 3BAEH 3QDJE 4KY1L 3HMXA 3VXMB 3VFRA 2DLGA 3L3HB 3EO0B 2FLRT 3G6AB 5IJKC 5DFVC 1FPTL 2VAAB 5IB4B 2FB4L 5IQ7H 2Q3AA 4NGHL 1DBAH 1C16A 4H25B 3DJ9A 1B2WL 2IJ0C 2VISA 2XY2A 5F3HB 5FA4B 2R8SL 2HRPH 3TO4B 4WI8A 4P9HL 1FFNA 3CSYA 5FYLE 3EYSL 1JWUB 2VN7A 5E6IB 3OPZL 3FB8A 3PQYE 3BN9D 5F6HI 3FFCB 3DIFB 1EHAA 4ZD3H 5A3IC 1EERB 4NQEE 2OSLA 2NY2D 5E8NB 1MF2L 4YX2H 4LRIA 2ILLA 5JIHA 5FO