5J8OA

Structure of human programmed cell death 1 ligand 1 (pd-l1) with low molecular mass inhibitor
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
publication title Structural basis for small molecule targeting of the programmed death ligand 1 (PD-L1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j8oA00
4X6FA 5CINH 4Y2DD 2IAMD 4X6BA 2HG5A 3L3HA 1P2CA 4JO3L 5IBUB 4E41D 1EXUA 4XNYL 4EI5C 4XX1E 3VGEA 2X4RA 3QUYA 3J8F7 3TT1H 4IIQA 5KVEH 4QKXB 4N8CH 5JPMA 2FHBA 3A0OA 1A1OA 1GIGH 2OL3B 3GBNH 2AS5M 2QTEA 5JPNB 5IB4A 3VXUE 1HINH 5F44A 1A6TA 1I4FB 2NTSP 3ILQC 5GGRY 5BS0D 2BVPA 3LRGA 3L5WA 3FO2B 5FM8A 3L9RA 3WNMA 4NWTL 2BVQB 3MBEC 2Q3AA 5E6IB 4G6JH 3PHSA 3GSNL 4GAFB 1G7LB 2R29H 1KGCD 2F74B 4AMKH 5DDHA 1SVCP 3CCHB 4C57C 2R0LL 4YFLI 4LMQE 4PB9H 3OKEB 4LGRB 1MREH 3HMWH 3F7RA 1WZLA 2XZCH 3MRKA 1LWRA 4PV9A 1QZ1A 3B9KA 5J56B 4P23B 4FG6D 4I0KA 5EU6B 3B2UC 4KI1A 3SKMB 1QR1A 3DSFL 2H32H 3TH2T 2VXSH 2OSLA 2YS4A 4EI5B 2UVEA 2OQJB 3GI8L 3B9VA 2EDXA 4HAGA 4OLXH 3VWKC 5BXFB 3RX8A 3OL2A 2QQLH 4LCWA 3BH8B 3KYKH 2ZNXA 2CLVA 1BWWA 1KJVA 1J0YA 1MF2L 1YJDC 3FFCA 4JGUA 4CW1A 3GSQA 3TPKA 1U8JA 2UVFA 4Z78A 2E3VA 4WTZG 5J12C 3QUXB 2JJTA 1SEBA 2WWKO 1FCGA 4LLYA 3BQUA 5GSVB 2EKSA 4LKXA 2BJMH 3MBEB 1ERNA 3KPNA 4N8PA 3HR6A 3MLVH 5EZLA 4NQDE 1SYSB 1HH9A 3WIIH 1MVFA 1T0MB 1ZTXL 4EN3D 1KENH 1A3RL 2I24N 3HNTL 5C9JB 4TTGA 3UTSE 1IAOB 3L3KB 5ESAB 3GMRB 4WEMB 5F7WC 1W72B 2B2XH 2LTQC 1Y0LB 4PJIE 3QIWD 4HLZH 4XCEA 4LEOB 3RY5A 4RFOH 3O3AB 5HGHB 1RIHL 1V3MA 4XC3L 4ZAKC 1C7TA 4HZLA 3VFNB 3ABZA 5E6YA 2VSCA 2AEPL 3MV9A 4BK4A 3QUML 1T21B 3VWKB 1U8IA 2IBZY 3QUYD 3PDGA 3I6GB 1WAAF 1TCRB 3RL1A 5HY9B 1RVFL 2H26B 4J3VA 4Z7WB 1L6XA 2XZAL 2IG2L 1T89A 2C1OA 3H6JA 3OJDA 4NQCB 4OZFA 3F7QA 3RWCB 3G5XB 5L2JA 1YMMA 2QL1A 4JZJC 5J12B 3KPRD 3R0MA 3RWEA 4XBEL 1K8DB 2QR0B 4MJIB 5EZJB 2CDGB 5FUZH 3VXSB 3CXDH 1P7QA 1DE4B 3MROA 2A77L 5BVJA 1Q8MA 2Z8RA 3QDGB 3BN9C 1R3LA 2CRYA 4F7CB 4GG6B 5CEXB 1EPFA 4B53A 5EBMB 4P2RB 1FNLA 1ED3A 3NA9L 3HUJE 5FYLH 2GFBA 3I2CH 2GK0B 4R7NA 5KSAA 1CLYL 1JIBA 3HR5B 4PJGE 3VXME 5GRUL 2NY6C 4D8PA 4DW2H 2LTQB 4L1DA 3Q6GH 2VR9A 2AJXL 3DXAD 4D94A 1ZLSH 4XNXH 2VXVL 4R7DA 5HPMB 1CZ8H 2G75A 4LCCC 3BKMH 2HFEB 2C3GA 5GHWL 3WYRA 3HTLX 2XPGA 1QFWI 1CD1A 4RAVA 4OGZA 1DBAH 3IDMA 3PXJA 5DJAA 4LEXH 1VPOL 1XR8A 3GKWL 4JHAH 1KJMB 4W4NA 5I30L 4D0BB 1A6ZA 3D87B 1F4YL 2YPLB 5IQ7H 3TNNA 5IVXB 3L5JA 4MWFB 5JTWA 2UY7A 1N59B 1CFQA 4XRCB 2XY1A 2CK0H 5FO8A 5ELIA 4GKZA 5E1AB 5IMMB 2DLGA 4JZNA 4XVJH 5F9JA 1ZGLA 3HLAA 4QRUA 2BSRB 2VN7A 2VDOL 4GW1A 2OL3L 3DYOA 2NY6B 5FA3B 2O26U 2V7NB 3BN3B 1T1YB 2VDPH 4RGND 5BVPL 5IB1B 2C3WA 4QRRE 2FJFA 3G9VA 3KNBA 2IEPA 1NDGB 3FMGH 2R1WA 3TPUB 3W11C 4NM8H 4PBXA 2EKJA 4OKVB 3V8CA 3BDBA 3C6LD 3HC4H 2K7PA 4LCCB 4LNVA 3TEUA 2NY5L 2Y07H 5D7LD 2PTVA 4EI6A 3LMJH 2VZOA 4K7PH 2P24A 4KK5C 4QRQA 3T77B 1XZ0A 3HB3D 1Z9SA 3E3QE 4JY4B 1Y18A 1KTDB 1LK3L 4I48A 1Q9KA 2Z91A 2BNQA 4O4YH 4HUVA 1BVLA 2YD7A 1GGCL 5IWLA 2GITA 3DV6A 3E8UH 4R96A 1AR1D 3GMNB 5HJ3A 2XICA 2WUCH 4MDJA 2WBJA 4E41E 1PG7L 4GMSH 4F37F 1AP2A 4GW4B 4OF8A 4ODVL 2E7LC 1KEGL 2P8MA 1LHZA 1T1WB 4YHPA 1CLOH 2OZ4H 4XPTL 2QHLA 5IBTH 3VFVA 4DKFL 5FEBA 4I3SL 4YHOH 3UJIL 5KSAD 1S5HB 3DMMC 1EX0A 1Q94B 4QXUL 4JKWA 4OZIA 5T33H 3IDJA 4ONGH 5BS0E 1GGIL 3KPSA 3WIHA 4YHKL 3MRDA 2Q6WA 1MHEB 1LEGA 1MFCH 5I1GL 3WSQH 1OAQH 4TTDC 3T0EA 1YEFL 4XVSH 5KZCB 4KROD 4FABH 5KSBE 1KC5L 1INQA 3Q0HA 3FRPG 3RL2A 3LKOA 3S88H 1NLBL 2J88L 2OR7A 2CUHA 4IDLA 3CUPB 4MD0B 1UKSA 4UT6H 5ISZB 1AD9A 1MQ8A 2BOCB 4LRIA 3H7BB 1ZVYA 3I02A 3QA3A 4MXQC 1UH3A 2E9BA 4KV5F 3V0WH 1TDQA 2ZZUT 4YWGL 1JF5A 1W72L 1FGNL 2UY6A 4C4KO 1B6DA 4YAQA 1G6RA 4L3ED 2NW3A 5L8JB 1FLTX 3RY6C 2CIKB 5T3ZH 4LBEA 1CR9H 3BP4A 3IDIA 1WITA 4P46D 4QXTA 5CHNB 1I9EA 5C92A 3DJ9A 3QDMD 2OCFD 3MLRL 1S7SA 1QLEL 1YJDL 3DMMB 3C60C 4HWBA 1YEDB 4U6VL 4Q9RH 3QBTB 4FS0A 4ZPTB 3OKKA 3OKLA 1R24B 3B9AA 3QYCA 1I1FB 1RUKL 1CWVA 1P4BL 4QHMB 4NYLA 4Z6AT 1H3WM 4J8RB 3JXAA 4YHZH 4FXGB 3D9AH 4JRYD 1IKFH 2B1HH 2GJ6B 4P3DB 3EYQD 4YDIH 3NIDF 4GT7A 2IADB 3ROLA 3QJFB 4EIZC 3BESR 4OLZL 1P84J 3V5DA 1I7UA 4E42B 2UZIL 4KTDL 4ACPA 4ORGB 2W0LA 3VA6A 4PRBB 2CGRL 2Q86A 5JXAL 1KCKA 5C0EB 2ENSA 2BNQD 1KJ3L 4F7EB 1CT8B 3HG1D 3G04A 2ICEB 3MNVA 1FVCA 3WDJA 1YDPA 1DL7L 2AK4B 2V2XB 3B9EA 4YIQB 2QSTA 2C4FT 4O2CA 1G7PB 3UMTA 4RCAA 1PBYA 3DROB 2FEEL 4RQQA 3RPIB 5F88B 5D71L 3BDYL 3IU4H 4WUUA 3O0RL 4ODWB 4UQ2A 1AGFB 3DHJA 3GIVB 3C60B 4OV5A 4S1DC 1T04A 2AJYL 3KPRE 3EO0B 4PRPA 3STZA 3MLYH 3DBXB 1RZ7H 3QO0A 4HMDA 1QQDA 4W6XB 4BUGA 1DN0B 1JYXA 3BZEB 4YDVB 3I3DA 3KPSD 3TJHD 1IC4L 1WEJH 4HQQH 5ITBH 5HPOA 4GS7C 4N8VB 2EIBA 3W5MA 5EWIH 2FO1A 3FO1A 3ARSA 4P59L 4YHML 3T0ED 4V2CB 1OW0A 3WFHA 3HPLA 5DR5L 1F3RB 2YD8A 4Z5RA 1A8JH 3BAEL 1C16A 2ARJA 1HHIA 1CFVH 5HGBA 5GGVL 5IBLC 1FFRA 3SGEI 4JQXA 4NZTH 4XCNB 3Q3GB 4MJ6B 3DXAE 3OF6A 4B7LA 1FNSH 1HSAA 5DC4B 2NTFB 3TLRA 3U2SB 5HXMA 4FFWC 3C08L 1UWXK 4KKBD 5HHQA 3FT2A 5BV7H 1AR2A 4L5FH 3MR9B 3R06B 4MSWB 3HAEH 1JWMB 5IGXH 4WVRA 3LEXA 3MRHA 1QFOA 5CMAB 1D6EA 4OQ1A 3WJJC 4D9LL 4Y1AA 1QACA 2VITB 3S36H 1MCWM 4NQUA 2DQJH 5TDPB 1KCVH 1KB5A 3F5WB 3TV3L 1LP9F 2HTLD 2J4WH 3GB7B 1GYAA 4F3FA 1TTGA 3LKPB 5EH1A 4GS7B 5IB3A 4KKAC 5IOPB 3FFDA 5IMKA 3S35L 3D1MC 3NACH 4DWHA 5T1LB 2Y36H 1EJ6A 4Z77B 3G9AB 4I8DA 3MOBL 5GGUA 1M05A 1J12A 5EN2B 4PJXF 4P5KB 1SJHB 5CIPA 3NFPA 2DD8H 1Q0YL 3RPKA 1K85A 5GRJL 2PTTB 2VZSA 3BKYH 4RGNE 3UDWA 1QSFD 4JDZA 4HFUL 1RHFA 4I0PC 1M6OA 3BHBB 3BH9B 1RU9L 1HWGB 2APXA 4R2GD 5DJ2B 5J3HD 1EDQA 5D7LE 4NC1E 1QO3A 4WY7L 3T65A 2HLFC 2OBGA 3ULSB 1DUYA 1ULVA 5T3XL 3QO1A 3GRWA 1QVOA 3HZKB 3JV5A 2HT3C 2HFFA 4K3GA 5FB8B 2H3NA 3CC5A 2O5ZH 3ZDZF 3TIEA 2Z92A 3C5JB 5DURB 1EUUA 1FLRL 4PTUB 1GAFH 4PJDE 4XI5C 4PRPD 5KVDL 4N1EA 3UTTA 1U8LA 1MNUL 5MERB 2OK0H 2YN5A 1RZGB 1VFOA 5KS9B 2VDLL 5J6GB 4TYUA 1A14L 1TZGH 3NIFE 3O4LA 2XXCB 3CFIC 3VXRD 2W0FA 3AS1A 2VAAA 1T3FB 2W9DH 5DRXA 1HWHB 4LCIL 2XNAB 3VFRA 4MXWH 1NCCL 2OP4L 2X70B 5F7NC 4NO2A 3CSYA 1TPXC 2JK5B 4I0PB 1JHTA 5GS2H 1IEAA 4ZFOA 2FEDC 2GJZA 3O6KH 5TDOB 3S34H 1IFHH 3G6AB 4LHUG 4MNQE 3H9SB 1C1EL 4BK5A 5CILL 12E8L 3HZYA 1PY9A 2IMMA 3G08A 4RZCA 1ADQL 2QHRL 4HKBA 4FP8H 3H9HB 4G80A 4FFYH 3LIZL 2C26A 5E00A 1X5AA 1KFAH 1KELH 3L3JB 5I2IA 1LE5B 2CKBH 5CGYC 4OCYH 2J8HA 1IL1A 1QA9A 5KAQF 3GSXA 2Q76B 5IESL 3OKOA 2J6EA 2E8ZA 3GM0A 5I75C 3SCMA 3O41A 1U91A 5CZVH 3TIDB 1YN7B 3ECBB 4L3EE 3VFPA 3FN3A 5F9OL 4UOW0 5ALCH 2GAZB 1S9WB 1F45A 2WBWB 1MIML 4L8SC 5J1AA 5TQ2H 5EIQA 3TNMA 3ZYZA 4TUOA 3QDME 4WCYL 1CE1H 2QQQA 1HN1A 5I1HH 1G7MA 4HDIB 5I8EB 4N9GA 5C0AD 5DUBA 4PTTA 3U0TA 3TO4C 1BBDH 1TPXB 3EYSL 4LSPL 3RVUD 4NKOB 1YC8A 1QBAA 2FX7L 4HXAH 5ICXA 2V2TA 4Q74A 3GSWB 4P2QA 4ZDHB 2ED7A 3VFGL 1CF8H 4JO2L 5A3IC 3DO7B 3TBYA 1F6AB 5C0GB 2F54E 4JRYE 5E5RB 5SWZD 4UNVA 1K5NB 1CQKA 5DEGA 2Y5TB 4ZOBA 1BOGA 4G6KL 4U3XA 4LSUH 3SE8L 3PGDA 5DMGC 1KIQA 1RK1B 1QKZH 3IU3B 1WT5A 5CINL 5BZDB 4R3SA 2F19H 1LDPH 3IAQA 2BNQE 4JDVA 5CGMA 5JHDA 1TJIH 3TT1L 5I75B 4CVZA 3CFCH 3HG1E 4Z76A 4N8CL 5KVEL 4U1IA 2VUOA 1RZ8B 1GIGL 3UTTD 1FZOB 3GBNL 1ZGLP 2H2PC 2HJKB 1JGDB 4E0RB 1N5AA 3IFPB 4DKEL 4L8SB 2XRAL 1MQKH 5HDQH 2EH8L 3MXVH 4LLQA 5ESVB 2C1PB 1HINL 4LOUD 4ELMF 4JR9H 1I9RH 4I1NB 2H6PA 3BPLC 2X9WA 1U0QA 3TO4B 1BVKB 3QXTA 4JY5H 2LE9A 1ZHBA 1T2XA 4GRWF 1A64A 5DJ8B 4Z95H 4G6JL 4XWGL 4KMTH 4C56E 3JWNC 3PWVB 4BZ2H 2R29L 2CDEB 3KPSE 4AMKL 4XZUA 1NJ9A 4Z7QF 5LGKA 3VFUA 4PB9L 4F9PA 5D1QC 3QCUL 3S96A 1MREL 1CK0H 2J8UF 3HMWL 4M7JH 2VABB 2XZCL 5C09A 1DEDA 3QWQB 3NFSH 5TE6H 4M6OH 2NNAB 1NC4D 5GGSB 5BW7A 3ULUF 1FZMB 1NGPH 4MA8H 3RWHA 2VIRB 3AM8C 2VXSL 5LXGH 2XY2A 2Q20A 2E5EA 3MZTA 1G7HB 4HX1A 5ANMB 2D0FA 4PGZA 5ACZB 3D2UD 4HWZA 1A3LH 3D0LB 4OLXL 1OPGH 4HF5H 2JJSA 5IIEB 1JRHI 1DQJA 2QQLL 3RGHA 3KYKL 4Y19A 2JELH 5C0JA 5EBWB 3N1GC 4S2SA 4PJ7B 5C71A 1F8TH 2C3VA 3FQXA 4JGMA 4I9WD 3D3VD 3GBLA 3ARXA 2IH1B 5I71C 2BX5A 3ARBC 5I66B 3LHPH 4WHYG 4ODTH 5L88H 1NFKA 1ZHLA 3TZVC 4YLQT 3IXTB 5CEZD 2BJML 3JWDH 3EHBC 2VLRB 2GI7A 1FVEA 1NFIA 3A6OA 5D7IB 1T0NB 3L7FA 4BFGA 3MLVL 4HGMA 2NR6C 3LKRB 2X44D 1NSNH 3C2SA 1PKQB 1RJZB 4JFXA 1RURH 1WAAA 3WIIL 1XGPB 1A7OH 2FGWH 1HYSD 1B3JA 1BQHB 4ZUWA 3RDTA 1JMZA 4QWWD 1KENL 4NT6B 1OTTC 1K4CB 2PCPB 4PR5B 5HHVH 3SDCD 5J6HB 3BOVA 3R1GH 2B2XL 1RI8A 2M2DA 5MENB 2G9HA 3GHBH 1JWSB 4RFOL 1DBBH 4Y88A 5HYSA 3BUYA 5E70A 3ZT5A 4J2XA 5CKAA 2VE6A 5BQ7B 5HHXH 4O9HH 1ITBB 1DLHB 1QSFE 5K9JH 4PJFF 1JGUH 2CLRA 2YD6A 3RX7A 5JHDD 5HDBF 1LQSR 1KG0A 1CVRA 4F15C 1R5WB 1CGWA 5EO0B 5FYKH 3DTXA 1L0QA 4ODUA 2M8XA 3H3PH 1VCAA 5DJXA 4PRIA 4YC2C 2B0SL 43CAA 1M7DA 1R3HB 4GRMA 5I71B 3ARBB 4NJAH 3EOTL 3PDOA 4DK3A 2PN5A 2COQA 3TZVB 1JYNA 1YQVH 1LO4H 2F53D 3F6IA 5FUZL 2IPTH 1JGVH 1WIUA 3CXDL 1IVLA 5EUOF 1ZLVH 4JZOB 4JPKH 3GI9H 4PRPE 3ARDA 2WQRA 1FRGH 4MJ4A 4QRTB 1IJ9A 3G5YB 1YY9D 3HCVB 4JFPB 4X7SH 5IW6A 1BFTA 3H42H 3VGGA 2C9AA 2XWJB 5GS3A 3P0VH 5EU4A 3GBMH 5FYLL 4FQXC 3I2CL 3K74B 3GJFA 2V9RA 3CDCA 5DJ0B 4F8QA 1IZKA 4D9RD 1QFWM 4DW2L 3VXRE 4JFFB 4PUBH 1MJ8H 2VMFA 5HI4D 3Q6GL 5C0CE 1ZLSL 2Z4QB 5C0NC 5HGAB 1J0KA 4XNXL 3F7VA 2ICWI 2WLZA 3RGVC 1L9MA 2Y06H 3BI9X 3V7AG 2C5DC 5BV7C 1CZ8L 5IVZA 5IFAH 2NXYC 4F33B 3BKML 4F15B 4Z8FH 5DJYB 3QIUC 2Y23A 1DBAL 3RU8H 4RGMC 5J9PB 2G5RA 4LEXL 2I27N 4Y19D 1RZKC 4YC2B 3TESA 2R69H 4L4VB 4JHAL 3NCBB 4OGYH 3DETC 4FQ2H 2X4QB 3QNXA 3ZE1E 3KWWB 1BJ8A 4JKKA 4U6XB 3D25B 4JKMA 2XQYK 5IQ7L 1I7RB 3KDMB 4JANA 1WBYB 2CK0L 4NGHL 3IVKB 4L8BB 2AXGA 4PJHF 2H9GB 3QWOB 3EYOB 4XVJL 4R90H 3A67H 3DVNB 5SX4I 4HPYH 3QEQB 4R4ND 3OB0K 1DBMH 2UWEA 4MQ7A 4FQXB 1IM3B 3F7YB 1QPPA 5FFLA 1CDUA 3MRFB 3RDTD 1EEZB 5EU3A 2NLJA 3RWGA 3LPGA 4FNLH 2VDPL 2YUXA 4M6MH 1P4IH 3FMGL 4OZ4B 5C0AE 1TZHB 3IDXH 1F11A 2DN7A 3RGVB 5FKAB 1L7IH 3WD5H 4X6DA 3LN9A 1LO3H 5BV7B 4P5TD 2NXYB 1SEQH 1FIGH 3HC4L 5F7DA 3HAEB 2X1QA 3E6FB 3VRIB 1BQLH 2Y07L 1F58H 3QPQC 3EOYG 5DRZA 2CKNA 5EIVA 2ZCKH 3LMJL 3QIUB 1CXFA 4K7PL 4RGMB 1ZA3A 1HSBB 3MV8A 4NO0B 2EICA 3WFEH 3DX8A 2Z93A 3QH3B 4LLAA 5SWZE 3S4SG 3G6JE 3O6FA 4F80A 3MRCB 5F6HJ 3F12B 2GY5A 4PRID 3P40A 2PW2A 2EIDA 4O4YL 2A83A 4KQ4H 1H8NA 1G7JB 1GL4B 5K9KB 2BMKB 1U8OA 2WUCL 3O3EB 5ETUB 2C7UA 4GMSL 1G6RH 3EJYD 3EDKA 3IDGB 1X4XA 3BGFC 1CLOL 3ARDD 2BSSA 3UTTE 2OZ4L 4IOFD 4OTXH 5KSUA 4Y5VC 1L0YA 5IBTL 3VW3H 3OG6B 3P0GB 4APQC 1SYVB 4Q6IA 4YHOL 4PP2A 1A22B 3LZFH 4OLVH 2ADFH 5SWQA 4EDXA 4NKQB 4NP4H 4U0RC 3P9MB 5T33L 1JGEA 4ONGL 5C6TH 5DJDA 1U8NB 5JXED 1MFCL 3WSQL 5D9SA 1OAQL 1S7XB 2Z9TA 3QULB 4XVSL 5IEKB 1A02N 3O3DA 3KYMA 3N1FC 3IETB 4J3UA 4JN1H 1QSZA 5F7UA 2AV1A 2FB4L 3S88L 4LDEB 5E8DH 2D2OA 5E0QA 2GQHA 4KK6D 3T0BA 4EVNA 1SY6H 3BZ4B 5KW9H 4PP1C 1I7TB 1DTUA 5A2LH 3V0WL 1CFSB 4PJAB 2GHWB 1U93B 5E8EA 4QCIA 2HT2C 3TO2B 3D69B 3BGFB 4QEGA 5TH2A 4ZUSA 3MRBB 3VFMA 4HS3B 5T3ZL 2IQ9H 4Y5VB 1ND0B 4APQB 3HRPA 1AKJA 4K07A 1T22A 5B22A 3PGFH 2ZOLA 5IW1A 4GW5A 2D7QA 1XF1A 1KPRA 2DWEB 2F58H 3D3VE 4I9WE 4G9FA 4J1UA 1N6UA 3LAFA 3CFEB 4U0RB 5JUEH 3EFFA 1Z2KA 1Q9WA 2VQ1A 3MMEB 4G42A 4XCYA 2QBWA 4Q9RL 2PKDA 1K2DA 5FK9A 2NY4D 5KG9B 2LU4A 1AJ7H 1AXSA 4UV4H 5CEZE 4P9HC 3ROOA 3EKCA 3TH3T 2CLZB 3QNYA 4LHUD 3LQAH 4S11A 4Z7WF 3U79A 4YHZL 3D9AL 1IKFL 1UKTA 2B1HL 1F5WA 4N0FB 4X6FB 4XPHH 3SPVB 4X6BB 2HG5B 4YDIL 4DQOH 2CKBB 3L3HB 3MV8D 1P2CB 4LU5H 1A4KA 1EXUB 1KT2A 3QEGL 5F1IA 2X4RB 1R5IB 1MJUH 3O6FD 4G8IB 5JPMB 5C0DB 5HYQB 4X6CA 2ZP0T 1A1OB 3RA7H 1JE6A 5F1OB 2D9QB 1XF2B 4OD1H 4GG6F 4I18A 4ODXA 3MRMA 1HOCA 2DDQH 4L9DA 5IB4B 4MVBD 2HFGH 3TYGL 1RZJC 1A6TB 5J7CC 3S5LA 5JHDE 4GRLC 1B0WA 5F9DC 2BVPB 5IF0A 3L5WB 4PGDA 1IAIM 3BQUC 4I2XA 4O2EA 1UCBH 3IU4L 1NEUA 4YR6B 3W5NA 1JTPA 4S1QH 3MLSH 3K7UA 5B38G 3GIZH 5DDHB 3MLYL 1S9YA 1RZ7L 5BZWA 5LGJB 1L6ZA 4QY8A 3SKUD 1YNTA 2F53E 5GZNC 5H35A 4K8RD 3IFOA 1WEJL 4HQQL 5ITBL 3MRKB 5EWIL 1ZWIA 4WHTA 2FWOA 3B9KB 2XWTA 1Y6KR 4OCWH 3ZYJA 3TVMA 2OR8A 1F42A 3BP6A 3OR6A 3IFLH 1D5BA 4NRZB 3HKFA 3GSUA 1CFVL 3C8KB 4O2FB 1QR1B 2RBLA 3OQ3B 2A9NH 1TITA 5TFSH 4ZFGH 2OSLB 5EIIB 4LVNC 3TFKD 5FGRA 2DLIA 4D9RE 4KI5C 4MCZB 4S0SD 5GS0H 4XP5H 3RP1A 2GTWA 1Q9OA 3CPLA 3D6GA 4LCWB 5IVXF 1ZS8B 2CLVB 1KJVB 1F13A 3FFCB 1FNSL 5FYJH 1EHNA 1LP9A 4PB0H 5K9QG 1T89C 5LQBH 1WFOA 4Z78B 5L2KA 4IS6A 1QBBA 4GRLB 3Q5OA 4ZO7A 5FGCB 5BV7L 1YY8B 1QTYT 1FO0A 2AK1L 4UBDD 4LLYB 4WI8A 4L5FL 3BQUB 4YHIB 5IGXL 4D9QD 4OZGE 2HJFB 3HC0A 4Y19E 3MUY1 3DUHA 5BCAA 3JWDC 3LKQA 5F93C 5DJCA 3PF2A 3W9EA 4PJXA 2X7LA 1RZKL 1EGJA 3S36L 5EZLB 5JA9A 2DQJL 1U9KA 4PRDB 1FL6B 3REVA 1KCVL 1HH9B 1BX2A 2QQKH 2J4WL 4B41A 2X89D 4O00A 4X80H 3VI3F 3PV7A 2X1WL 4RMSA 1S7UA 5GRVK 2R56H 1JNJA 2EXWD 1MOEA 3NACL 3W2DH 2Y36L 3FQUA 2ESVA 4XCEB 4N0CC 3JUYA 1JZ7A 1IM9A 1NGXA 5D2NA 4LVNB 4PJ9A 4HZLB 5DEFB 4KJWD 4IMKC 5FA4B 3MV9B 3DGGA 2DD8L 3PXHA 4JO4H 1A6VH 1U8IB 3V6ZA 4LPUA 3BKYL 4NQEA 2Q8BH 1E6OH 1QNZH 5FGBA 4B0MM 1T2QH 2C1OB 2G60H 4NBXB 3OJDB 1Z9MA 4OZFB 3QZWG 5C3LD 5L2JB 1YMMB 4P48A 3RWEB 1DANU 1P9MA 4OAWA 1GZQB 4Z7VE 5LGHL 1P7QB 2O5ZL 3MROB 4XMLH 4V1DB 5H8DA 5BVJB 3UZQA 4PRIE 4R4BA 1GAFL 2NXZC 3VGAB 2VH5H 4UDUA 3MFFB 1S7QB 2OK0L 4YBHA 4TQEH 5IBUG 2B1AH 2DLFL 4OB5H 4D8PB 4M1CC 3SDDC 1J1OH 2FEEI 3TVMD 5GJTH 4YHYB 1P7HL 3QNZA 4H25B 2DJSA 1F00I 2W9DL 2YXMA 2NX5A 5DFWH 4MXWL 1G1YA 4IRJC 1I1AC 3SGKC 4LAQH 2XPGB 3RTQA 2DQFA 4RAVB 3AS3A 3ZE0F 3IDMB 4PJEE 1YMHB 5DFTA 3CIQA 2Y6SC 1XR8B 3BVNA 1OGTA 3O6KL 3X12B 3S34L 1IFHL 3GZKA 4H0GA 5L2KD 2X6MA 1NC2B 5IWLC 1U8PA 5DHVH 5BMFH 4FP8L 3TNNB 3F7PC 2WBJC 4FFYL 2OTWA 1KFAL 1KELL 1CFQB 4HUUA 1H3PH 2XN9A 4GKZB 4GAGH 2CKBL 4JZNB 3MACH 1FCCA 2NXZB 3PUCA 1A9BB 4OCYL 5F9JB 3OMZA 3HLAB 4P5MA 4QRUB 3HI5L 2D31A 1KTKE 3Q6FB 2X10A 3HZMA 4KDVA 4CL7A 4G8EA 5DMYA 5CZVL 4NOBA 1AGEA 3OKDA 1ZE3C 4J4PD 3SQBA 4UILH 5D7JC 3JTTB 3VGBA 5ALCL 5JORA 3UJTL 1IEBB 1T2JA 2DLHA 2FJFB 5TQ2L 1Z0NA 2R1WB 3BUTA 1T03H 2ESVD 4KMQA 3FAWA 1S3KH 3WUWB 2FBJL 1IM9D 2DIAA 1I8IA 5I1HL 1ORSA 2P5EA 4Y8DC 4IRJB 2ITDA 3CZJA 5IW3A 4NSKA 2JF1A 1BBDL 5DD1H 5IR1B 2EZ0C 4NQED 3EO9H 4FQ1H 4HXAL 2GEEA 2ZUQC 3CSGA 1HDMA 2CH8A 4G6AC 1A6AA 1CF8L 1Y18B 2NY3D 3QJHA 4G3YH 4YGAB 4I48B 1N3NA 4P9HL 1Q9KB 1KLUA 2Z91B 4HUVB 1UXSA 4LRIC 1BVLB 3H0TA 2GITB 4R96B 4LSUL 4JRXD 4MDJB 3MV8E 2WBJB 4FXLA 4BUHA 1QKZL 4PJ8C 2X1OA 3GSRB 4MB5A 2F19L 2P8MB 2AEWA 1LDPL 4AH2A 5IROC 4YHPB 4JO1H 1KNOA 2WIMA 4KAQH 1HKLH 3CFCL 4R8WH 5IV2A 4TN9A 4NCC1 5FO9B 3QFJD 1NEZA 5D7JB 3TBTA 1C5DA 3OZ9H 4KKLD 5HDQL 1MQKL 4OZIB 3IDJB 1RZJL 2VLJA 2HMIC 3MRDB 1SJEA 3VXPB 1LEGB 2ICWA 1DN2A 4JR9L 1I9RL 4YE4H 5C70A 4X4XA 5EOCJ 3BO8B 3M8OH 2OI9C 4JY5L 1MHHA 3OKYA 2Y9RT 3HZVB 1FNGA 4BZYA 4Z95L 4KMTL 2ZUQB 3SDYH 3RTQD 4BZ2L 5I1EH 3D18A 2GSGA 4DFIA 1I7ZA 2W60A 2MQ0A 4WWKD 2GKIA 4KV5E 3MRNB 3NVQA 1TTFA 4GMTH 4P99A 3IJHA 1CK0L 4M7JL 1U8MA 4KPHH 2EYTA 1WBXA 1BQUA 2IALA 3J7HA 3NFSL 1RJCA 5TE6L 4M6OL 4PJ8B 1SQ2N 1JNNH 2X4PB 1QD0A 1JUFA 4YAQB 2H1PH 1G6RB 3PWPD 2NW3B 1AQDA 4MA8L 1JPGB 5JOFA 5DD6A 4LBEB 5E8PA 5LXGL 3BP4B 2VDMH 2YBRB 4QXTB 1ZHKA 1N7MH 4X7TA 5LCVH 1A3LL 1FYTD 4NHUB 1OPGL 1S7SB 5GGTH 2ZCLH 3GMLA 2EDDA 3TH4T 4W70A 2JELL 4GO6B 4P4KC 2XG5A 5T5NG 5HHMB 3BE1H 1F8TL 2BC4B 2EDLA 3GSOA 5D7SH 2ATPA 1U6AH 4KK8C 3BRGC 2XTLA 3CFJA 5JNYA 3OKLB 4D9QE 2A6KA 1JF1A 5E4IA 3LHPL 5L88L 3NIDE 5LWYH 3LQAC 3IJYA 3CXHK 3WHXA 3JWDL 2EYRA 2EXYC 1OAXH 2QSVA 4HIJB 1L7TH 4PJBA 4IDJH 1FL3B 4PJFA 2ICCA 3ROLB 2H2SC 1BQSA 1NSNL 1D5ZA 1VGEH 1RURL 2QJDA 2D7PA 2FGWL 3QUZA 2BRRH 1I7UB 4M8QA 1QUNA 2Q86B 1RK0A 5HHVL 5C0IB 1INEH 3R1GL 3H9YA 3G04B 4I5BA 2EDWA 1I85C 3MNVB 1OGAA 1K8IB 3GHBL 1YDPB 1CTNA 4Y2OA 1DBBL 4FTVA 4NRXA 4RNRB 4PIRF 2OJZH 4HJ0D 1TQBC 5HHXL 4O9HL 5K9JL 3UPRA 1JGUL 5KS9F 2HRLA 2A6DB 4WUUB 5HI3D 4GKSA 1QPXA 4B5EA 1AGCA 4UQ2B 4AIZA 4GBXA 4P4KB 5FYKL 4OV5B 2YHGA 4HLJA 1T04B 1FG2A 3H3PL 1OT1A 3STZB 3QO0B 3V0VB 1P53A 4M61A 1QQDB 4XPFH 3L3IA 4NJAL 4NDMB 4NO5A 5EOTB 5MEOA 4I2XE 2NZ9D 2JJVA 3ARZA 3FO1B 1YQVL 2BNUB 4KRPD 1LO4L 5CKGA 4ISVA 1RHHA 2IPTL 1JGVL 3ULUD 3WFHB 3HPLB 4BZ1H 4JPKL 3GI9L 4B50A 3BJLA 4Z5RB 1C16B 2ARJB 3QIBA 5HGBB 4LHQB 5C9KA 4X7SL 1HQRA 3I6KA 3VGFA 3H42L 1S7WA 1MCBA 4TVPH 4PPTA 4P9ML 4U2ZA 3DX6B 5GS0C 3P0VL 3MRRB 2AXJA 3GBML 5DFVD 4ZYKA 3HE7C 3X17A 1VSCA 4J3WA 4UOJA 1U8QA 1HSAB 4XBGA 1VFAA 4PUBL 3GNMH 4G8GD 4F7TA 1MJ8L 1CDGA 3OAYH 5TGBB 1A7NH 4OKDA 3JSSA 1TQBB 4M7LT 5HHQB 2Y06L 3FT2B 1KTRL 4HXBH 5AZ2H 1EJOH 4N5EC 3ZHDA 5IFAL 3LEXB 4JFQB 4PJHA 1D6EB 1LP9E 4UV7H 4Z8FL 2VKXA 4GXVH 4Y1AB 3RU8L 1KPVA 4DVBA 2FSEB 5LG1A 5L2KE 4XXDA 9CGTA 2OM5A 2R69L 4XBPA 1KB5B 1JTTA 2AJVH 1DCLA 2Q1EA 4OGYL 4G6FB 1S5IH 4YZFF 4FQ2L 4JJ5A 4F3FB 3DUUA 5IB3B 2XZQH 3FQNA 3FFDB 3DO3A 5IMKB 4PJXE 3SBWC 1W2KT 2V6HA 1SMOA 3TM6A 3VRLF 5B4MD 3FHQA 1M05B 2XQYG 4PV8A 4R90L 3A67L 1DVFD 3LQZB 4HPYL 5CIPB 1DBML 3NZHH 4XXCC 1T4KB 3HE7B 3AY4C 4ZG1A 3V6BR 4JDZB 1I4FA 4KKNA 5GZOD 4OD2B 5SWSD 1CBVH 4KTEH 4Z0BH 4FNLL 4YDKH 5FO7A 4M6ML 2KPNA 1CICD 3WE6B 1P4IL 3WIHL 1QRND 3V7AE 3ZDZE 1L7IL 4FTVD 4CVXB 5IEHA 3P4LA 3WD5L 1QO3B 1LO3L 4NQEE 1UG9A 3AXLB 1SEQL 1FIGL 5GS1A 3CCHA 1BQLL 1F58L 3K8KA 2HFFB 3OKEA 4ALAH 2H3NB 1IGMH 4FZ8H 3TIEB 5MEQA 4GUPB 3WHE1 3WDIA 3WFEL 5FM4A 3ULVD 5JIIA 4IOIA 5EU6A 4HJGA 2R0ZH 4D2NA 2IPUK 4UQ3B 2B39A 4JRXE 3GMMA 1U8LB 3LEYH 4LASH 5EA0H 4KQ4L 3EW3B 4D3CH 1I8KB 3VWJC 4UU9A 2PR4H 1S8DB 2OQJA 3SGJA 3LCYA 3O4LB 1T83A 1G6RL 3BH8A 2W0FB 2A73B 3QIBD 2VAAB 1MCIA 3QFJE 4OTXL 1EO7A 1KJ2H 5DRXB 1J0IA 3VW3L 3VFRB 2A38A 1CXEA 1NL0H 4MXVE 4NO2B 3CSYB 2P5WD 1JHTB 4G6MH 1OB1A 4UAOB 1IEAB 3LZFL 4OLVL 4ZFOB 2ADFL 4NP4L 2GJZB 3MXWH 4HKJA 5IMLB 5C6TL 1OARL 3MBEA 3OAZH 2DM2A 2DL2A 5HTSA 3CMOH 4YFEA 3HZYB 2W07A 3KXFD 3EUUA 4ZD3H 4HKBB 3M17A 4QGTA 4JN1L 4G80B 4PJ7F 5E00B 4ENEC 3TBVA 4G5ZH 4N8VG 5E8DL 3P3YA 5C9JA 2KKQA 1QA9B 4AL8H 4EZMA 3LV3A 1W72A 2P8LB 3GSXB 3OKOB 1SY6L 3EBAA 5KW9L 4GAJL 3SCMB 3O41B 1U91B 3VWJB 1T7ZA 3S98A 3PWPE 3VFNA 4XWOD 5D7IF 3VFPB 1XR9B 4X8XA 1T21A 5JZ7D 4XMPH 3TNMB 2D0HA 3WUZA 3I6GA 4GJTB 1TCRA 3FJTA 4TUOB 1KUMA 1FYTE 3VD3A 2IQ9L 4LVOC 2ZG1A 1G7MB 3RIAK 4N9GB 3K8MA 3MRQB 2Q7YB 4X83A 3U0TB 1OP5K 1ES0B 3G5XA 1MAKA 4NIKB 4O51B 5E9DB 2F58L 1Z6JT 5ICXB 4WHDA 1K8DA 4MJIA 5JUEL 5EZJA 4P2QB 1XGYH 2CDGA 3PHQB 1AJ7L 4UV4L 2A0LD 3B5GA 1T66C 3QDGA 3LQAL 5E6ID 5CEXA 5DSCB 1BOGB 3PGDB 1KIQB 3TBWA 3QHFH 2APWA 4XPHL 2GK0A 4UIKH 3HR5A 1V05A 4DQOL 2P7TB 2CJUH 4MB3A 4RX4A 2C3XA 4ZS6D 4LU5L 1FN4B 3VE0B 1UYWL 3KG5A 1AXTH 3I50H 2LFGA 4JDVB 2G5BB 4P23D 4WW1A 1MJUL 1NANH 4ZO8A 5I76A 4R26H 3QB7C 2DQCH 2JJSC 4XMKH 3RA7L 4ZAKA 4ELME 2B5IC 1PG7X 5AWNH 4PJCA 4OD1L 3ARFC 4EI5D 1HEZA 4IOSD 4Q58C 1MVUA 4WENB 2DDQL 2IANA 2P42B 2HFGL 4Y4HC 4PJ5A 1J10A 1GOGA 4GRWE 4LVOB 4KMLB 2DMKA 3ARPA 4LL9A 3CAFA 2H6PB 1FO0H 4PRAA 3C5SB 1MRDH 4Z7QE 5I1IL 3BPCB 1JYWA 4JZJA 1MLCB 1UCBL 1KJMA 1IBGL 4PBVC 2J8UE 4S1QL 1OY3B 5CBAB 3ILQD 1M7XA 3MLSL 4HSQA 3QUXD 5CJOH 4JKPH 4NJ9L 5DJ6B 1KB5L 2HTKC 3RJQB 3VFUB 5IVXA 4MWFA 3S96B 2EDBA 2DAVA 3MBED 3ULUE 1VACA 4LLVA 4MJ5A 1YNKH 5C09B 3FONA 4OCWL 5C2UB 5CSZA 3IFLL 4UIMA 1V7NL 3RWHB 1X5FA 1J5OH 2YUWA 2FIRT 4OI9A 1CDBA 2A9NL 5TE7H 4Z7NF 5TFSL 5FA3A 3UTSB 1GRWA 4RDQF 5GS0L 4QTHB 4HLZG 4HWZB 4XP5L 1I8LA 1CFNB 4G8GE 1UM4H 1X5KA 3TPUA 2B5IB 1XAUA 1FC1A 3LY6A 5D72H 5C0JB 5FYJL 5IFHH 2XT1B 4OKVA 5E5MA 3UYOD 3ARFB 4PB0L 4LCCA 5LQBL 2C3VB 2Z8WC 3FQXB 2YMXH 4Y4HB 3NA4A 3VWKD 2N1KA 3RQ3A 1W0YT 1FP5A 1ZHLB 4R97C 5J4MA 1KTDA 3AMLA 1KN2H 4NQCD 4OFVA 3NTCH 1A7BA 1NFIB 1ZLVK 1KF9B 1GZPB 3CFKB 3L7FB 3NCCB 3TGXA 4MJID 1DQQA 2IMNA 4JFXB 3ESVF 15C8H 3VXSD 2QQKL 1JVKA 3WFBH 2WWMC 1HHHB 1IRAY 1CL7H 4X80L 4N9OB 1WCQA 1T1WA 3QDGD 3RVWC 2R56L 5EC1A 2A1WH 4P2RD 4PJFE 3W2DL 2W9EH 1U8KB 5HDBE 5H94B 2N7BA 3BUYB 2EYSA 1U3HA 2B4CH 2VE6B 4LLWA 1DFBH 3D85A 4RX4D 1B4JH 4FMFA 2CLRB 5SWSE 4JO4L 1A6VL 3G6DH 1KG0B 4QHUB 1M1SA 1JPFA 1E6OL 1EVUA 1QNZL 1QRNE 1T2QL 4GG8B 4ODUB 2G60L 2BHUA 3I6LD 4RISL 4KHTH 1I1CA 1UZ6F 4U7SA 1ODAA 3E1F1 3IT8D 3MUZ1 4GRMB 5EUOE 4XP4H 4FRWA 4U1LB 1UWGH 4R97B 4DN3H 3PL6A 2FO4B 1NUNB 3ULVE 4XMLL 3V79C 4MD4B 3QXUA 2BVOA 1J7VR 1E0OB 5IW6B 4J7RA 3O4OC 2YPLD 3JZ7A 1A1MB 3GJFB 2GCYB 4LP4A 1WQVT 3ARTA 3BN9D 2CIKA 4FOMA 4TQEL 5C0BE 2B1AL 2F5AH 4OB5L 5ADOH 5CHNA 5I1AB 2EE2A 1J1OL 1CN4A 3VH8G 4HIEA 5B39A 4X4MA 1X4YA 1PEZA 5GJTL 3F7VB 3HE6C 2J12B 3ISWA 4GOSA 4F7PB 3K4DA 2NY6D 1I3RA 2P5WE 4EUPA 4NQXA 3BFOA 5IVZB 3F58L 4ZPTA 1ZSDA 4PJAF 1W0WA 1R24A 4LAQL 3NZ8A 1UM6H 2AKRB 4FQQA 1ADQA 4NUGH 5DQ9A 2RHEA 4FXGA 3KXFE 4M00A 5F9WC 2GJ6A 2WV3A 1NAMH 1D5IH 2I5YH 4P3DA 3QNXB 2R0WH 1OAYH 4PJHE 3QJFA 2J2ZA 1IGJB 1FAIH 1REIA 1XH3B 4JANB 3WXWH 1H3PL 4PRBA 5KANI 2AXGB 4GAGL 3WNKA 2I26N 4F7EA 1VGKA 3O4OB 2UWEB 1PDKA 2ICEA 2R4SH 4KJPC 3RY6A 1EH9A 3FRUA 4KRMB 3FB5A 2AK4A 3S35X 3DWTA 2R0KH 2NLJB 5AUMA 4UILL 3RWGB 5SV3A 4MQSB 5DC0A 2BVEA 1D7FA 5K59F 3RPIA 1F3JB 5F88A 3HE6B 1T03L 2BY0A 2YRLA 5I0ZA 4ODWA 1F11B 1S3KL 1AGFA 3UYRL 3DV4A 2ZG3A 3C60A 3TP4A 4X6DB 2DQIH 1AC6A 3EO0A 4Y16A 5F7DB 4MD5B 4YUEH 3ZYOA 4NN7C 1DN0A 3BZEA 4HUWB 5DD1L 4JFZH 3EO9L 4FQ1L 1ZA3B 3W11D 1NUDA 4FFZH 5CP3A 3DX8B 4MCYA 4CADB 1J88A 2Z93B 2I07A 5KZCD 5T3XD 4M3KB 4G3YL 4HIXH 5F9WB 5EC2B 1A4JB 4U2YA 4TNWK 1OD9A 3HHRB 2A83B 5HYFA 4KK5D 2FNBA 5D8JH 3BRDA 5I8OH 1U8OB 3JTSA 4X9GA 5FDWB 4P3WA 1MCOH 4OF6A 3SKJH 4LNRA 4XCNA 1BQHG 5C07B 2C7UB 1LNUA 3Q3GA 4MJ6A 4NC2B 5ISZD 1XEDA 2BSSB 2E6JA 4Y0GA 2A9MH 5KSUB 4JO1L 1U2CA 2NTFA 3K2MC 4WI5A 1H3XA 1HKLL 4KAQL 4OCLC 4R8WL 1A7QH 4JFHD 1EIBA 3IKKA 4PP2B 5BRZB 4EDXB 1JHKH 5I1KH 3R06A 4MSWA 1D6VH 5CMAA 1CGSH 1QFUH 4DJMA 5D9SB 5IM7A 3K4AA 5I1CH 3DMMD 4YE4L 4KDTA 5TDPA 4Z7UA 3F5WA 3M8OL 4JFDA 4NN7B 1IEHA 3GB7A 1A1NA 3LKPA 2AV1B 1RIVH 4P4RA 3SDYL 1T7YA 2WSKA 5I1EL 3CVHH 5IOPA 3UTQA 3O2WH 1BZ9B 3VCLB 4HEPG 4GMTL 4OFKA 3S3PA 1IAKA 4AEFA 2H32A 4KPHL 5EN2A 2Z8VC 3NCYP 4TOYL 4ZXBA 1FQ9C 2HRPH 4LSVL 1ROWA 2PF6A 1JNNL 5E8EB 3MGAA 2RFXA 4XAWH 2H1PL 3QFDB 5LBSH 3L7EB 3VFMB 4L3CB 4MXQD 2VDML 3BHBA 3BH9A 1FORH 1N7ML 5LCVL 1AKJB 3MV7B 5DJ2A 2ZOLB 2YZ1A 3FHAA 4WU5A 2ZCLL 4XP6H 3GHEH 4G9FB 4J1UB 2AK4D 2GSIA 3V6OA 5I8CB 1Q9WB 4G42B 3BE1L 3HZKA 3EZ8A 4Z7WE 5CUSH 5D7SL 1U6AL 4KI5F 5FB8A 1FL5A 3KLDA 5L7XH 4NQCE 4HK3N 3QNYB 3C60D 3MLWL 3OJVC 2MHAA 1SJXA 3D48R 4MJIE 1OAXL 1L7TL 5AG8A 1JZ8A 1Z9LA 4IDJL 3VXSE 2ZOKA 4XCFH 3JV6A 1RZGA 1A4KB 1VGEL 1J86A 3QDGE 2P44B 3L3OA 5F1IB 5TF1H 4GG6E 3AAZA 1LMKA 1NMAH 4RRPG 4P2RE 4X6CB 2L7JA 1BGXL 4KH2A 4RGOH 3P0YH 4BH7B 5KN5A 1IC5H 2DQHH 2NYYC 2ORBH 3T1FB 2YPKA 1INEL 4I18B 4U0QB 3V5KB 1OTSC 3HS0A 4Z0XA 1N8ZB 2PUQT 2JK5A 4YFDB 2OJZL 4RGNC 3KYAA 4N1CA 3MJGX 5IF0B 2DTSA 3RAJH 3X3GH 4O2EB 2HA1A 3I6LE 3EDFA 3V52H 3ZKSD 3ZTNH 3KS0J 3H9SA 3T2NH 2PETA 1YEGL 3VRJB 3HAEG 1KACB 1XT5A 1S9YB 5BZWB 3REWB 3IAPA 4XPFL 1YNTB 4G43A 1O7VA 5H35B 1KCLA 3HFMH 1BZ7A 1NCTA 1LE5A 3FT4A 4ONFH 5GRXG 3MRJA 4S1DD 4WHTB 1HE7A 2FWOB 5KJRH 4JG1H 3PWJA 1T7WA 2Q76A 4BZ1L 3QG6B 2D03H 4QOKA 4XVUC 3UJJH 2YPLE 5C3TA 3TIDA 4GQ9H 4YQXH 3ECBA 5EZOH 5D2NC 4M03A 4TVPL 1UVQA 5E2VH 1DJSA 1S9WA 4M6AA 5GGRA 2VDQH 4NO3B 3QSKB 5T1LD 1AGBA 1MY5A 1NBVH 2GTWB 3CPLB 4RWYH 4RBPK 2MWCA 2R1XA 5IBLD 2JCCA 2KDGA 4HDIA 2AI0H 1S9KC 5I8EA 1MCWW 3GNML 1A6UH 4LLDB 3N85H 2VDKH 4IS6B 1U42A 2ED9A 5D1XD 5AZ2L 4HXBL 1EJOL 1FO0B 5GSRB 5JW4N 3OX8A 4ZDHA 5HHOB 1MFBH 4I4WB 5E7BA 3DO7A 1MFEH 4JHZA 1FYHB 4MA1C 4UV7L 2JB5L 5C0GA 5DJCB 3O81A 4GXVL 1K5NA 2BVTA 4PD4K 4XCCH 5BOZG 2EEBA 2VJXA 4V2BA 3C9NB 1MFDH 3REVB 2AJVL 3HA0A 1S5IL 2VRAA 3IU3A 5BZDA 4WNQA 3KLHC 5DURD 4BSWA 2XZQL 4L8CA 1F3DJ 5FHBL 4GKOA 2QKIB 1RZ8A 4XTRC 1NGXB 5D2NB 2HJKA 4KKAD 3PGCB 4K2UH 4LLMA 1JWUA 2B4CC 4PJ9B 4E0RA 3IFPA 2OX5A 3DGGB 3NZHL 4NKDB 2C1PA 1ZHNB 3CH8A 1WIOA 3T2PA 3RNKB 2APTA 5EU7C 2CXGA 1CBVL 4Z0BL 4YDKL 4CNIA 4G9DB 3TO4A 4NHCH 2DRUA 4RWHA 2YWZA 3LKNB 4J3OC 1WC7B 3FB7B 3PWVA 2NZIA 4I0PD 1ZT4A 3T2OA 4YO0B 3FN0H 4Q0XH 4MA1B 3ZDYE 4ALAL 3BWAB 4OZIF 1IGML 5T3XE 4FZ8L 1FFOB 4MNQB 3H9SD 4GLRH 4R4BB 2HLFD 5SX5H 3EDEA 2HT3D 2NNAA 4LASL 3LEYL 4N0UA 5EA0L 2VIRA 1G9NC 4D3CL 3JV4B 2OZ4A 5ISZE 2PR4L 2IPUG 1G7HA 5ANMA 4HWEH 4QXWA 6FABH 3VD5A 4EDWH 1Q1JH 4YJZL 3PP4H 4JFHE 4OLUL 3ZE0E 2UZYB 5L8LB 1KJ2L 4PJ7A 2NX5B 2YRPA 5D1ZA 2DOCA 5DWUH 1WZKA 4XP9H 1I1RA 1NL0L 4FQPA 4YGVA 4WEBH 2VLKA 1CU4L 2DQFB 4G6ML 5I66A 1HIMH 3LRSA 4U7MA 1NCAH 3MPCA 5CP7A 4WIQA 4LGPB 1OGTB 4YK4C 3MXWL 1CGYA 4Q7DA 5D5MA 1T0NA 2ZWLT 3CMOL 4XGZA 2QLVB 1WWWX 2Y7QA 2FEDD 3LKRA 1F4WL 2IQAA 3RZCC 4LVEA 4ZD3L 4NBZB 3WNLA 5ID0A 1XGPA 4CN6A 1GC1H 1WICA 5D1QA 2OTWB 1J8HA 2XN9B 4G5ZL 2F54B 3BIAX 4KC3B 3QEHA 4HGWA 4P5MB 4X5XA 4AL8L 1S7VA 2FLRT 4OZHF 3S37H 2D31B 3HZMB 1F2XK 3AM8A 1TVBB 4G8EB 1K6QH 4DGYH 4AENB 5CGYD 4KU1A 1DLHA 2BXZA 1QLRA 5JORB 3IAGC 5JOEA 4XMPL 1SVZA 4JQVC 4M4RA 5A43C 4TNWF 3EIFA 1MCFA 2P5EB 3D0VA 3DURA 4UTBH 2AK4E 2ITDB 1R3HA 4NSKB 4OSUH 3UPAA 1RPQA 3VD9A 4M43H 3ZHLA 4C55A 4QO1A 5C7XH 3KPTA 1HDMB 4OF0A 1XGYL 1A6AB 4BSVA 3TO4D 3V4VH 1BM3H 1KLUB 1NAMB 1I3GH 3NH7H 4M3JA 4R0LA 4QRTA 2HJLB 4KGLA 3H0TB 3RZCB 4C56B 1MCQA 3HCVA 2HTLC 4HW6A 3QDJA 4K7PX 3PV6A 3I3BA 2XWJA 3QHFL 5A3ID 5TJWK 4ODHH 2KQMA 5DJ0A 5HD8C 2CJUL 2PYFB 3VXQA 1AXTL 3I50L 5F1NB 3MGOB 2UYLA 1KNOB 2Z4QA 5IV2B 4R26L 2DQCL 4XMKL 4CJ1A 4WTWA 1A5FH 1MCSA 3TBTB 5GJSH 3IYLW 1MUJA 2IH3A 4F33A 1F4XH 2VLJB 1SJEB 4UTAH 4QTIH 2ICWB 1CXLA 5J9PA 2H2PD 1FO0L 4R2GC 4OZFG 4X4XB 2HT4C 2HVJB 4ETQA 1L0XA 1MHHB 2DB8A 1RIUH 1NFDA 2X4QA 5FCSH 1FNGB 1N26A 3SHSA 3KWWA 3D18B 3KPOB 3Q1SH 1I7ZB 3D25A 4U6XA 4JKPL 5CJOL 3C6SA 3TWCH 1RULH 4JY6B 3S7GA 3QUZC 1KBGH 3BP5B 2VLRD 3IJHB 3HNVH 3GJFK 2ZJSH 4LF3A 5FUCE 3QWOA 4HJJH 1WBXB 1YNKL 3PP3H 3QEQA 3PG2A 4FQXA 3F7YA 5C0FA 1AQDB 5JOFB 1J5OL 5H2BB 1R3IH 5DD6B 5TE7L 4ZO9A 2FDBP 2WW8A 1GSMA 1ZHKB 1QBMH 2FHCA 5F7EH 4UZGA 3DX9B 5MEND 1UM4L 1TZHA 3RGVA 2PXYC 4FQCH 4MQXC 5D72L 5DK2A 4R6UA 5IFHL 5KVGH 4GQPH 2ED8A 3VRIA 3P9LB 2YMXL 5DZOA 3CFJB 2AJ3B 3QP3A 5JNYB 3RUGE 2FCBA 1JF1B 1XCQB 4NO0A 1EBPA 1SBSH 2OTPA 4OF7A 3VG9C 3IJYB 3WHXB 1QBLH 1GHFL 3F12A 1KN2L 3NTCL 1AC0A 5CZXC 1IARB 2D0GA 3TN0A 4A2MA 4PJBB 4EIGB 1Q9LB 3ARBD 1RJYA 1KCRH 5K9KA 3B3IA 3TZVD 1D5ZB 3WJLC 4NUJB 1IQDB 3O3EA 15C8L 5DD0H 3QUZB 5ETUA 2XKSA 3EHBD 4M8QB 3WFBL 1CL7L 3IDGA 1HKFA 4M9OA 5CCKH 3OR7B 2V7HB 3WNNA 3MCKA 2NR6D 3NN8B 4PLNC 2A1WL 1NCNA 2W9EL 4JM2C 4I5BB 4NNYA 4H8WC 3OAYK 1I1YB 5DGRA 5KS9E 1UXWA 2DKMA 4NRXB 1OTTD 4ZUVA 5CLTA 1OWWA 3QR2A 2B4CL 1DFBL 2MSPA 1B4JL 4GXUN 2VL4A 4JFFD 3P9MA 3G6DL 3U9PH 5C0CB 2RGSA 4KKCD 5D7KD 2PXYB 4GKSB 5F6IC 1AGCB 4GBXB 3WEXA 3BKJH 3HNSH 2O93L 5EPMB 4KHTL 1L4IA 2CUIA 3DIFA 4XP4L 4NO5B 4PLJC 4Q6YA 5MEOB 1UWGL 2VERN 2DQDH 1HYRC 3N0PB 4ISVB 3MOQA 4L4VD 4HK3J 4C59B 5FYKU 3T04D 4GKNA 4U1MA 3NPZB 1XGRA 1HQRB 1CLZL 1CFSA 1DP0A 3I6KB 4PJAA 1S7WB 1E4WH 1FZJA 1D3CA 1U93A 2X42A 3D69A 3MJ6A 1G9NL 4ZYKB 3LRHA 1H8OA 1U8QB 2F5AL 2R9HC 4Y5VA 3PDDA 4XBGB 4N0RA 3QHTC 1VFAB 4JM2B 4APQA 1MRFH 3IGAA 3MRGA 1JV5B 1CS6A 1WFUA 4YH6A 4U1HA 3GUTB 1IAIH 1EA9C 3UTOA 5IHZA 5K93A 3MMEA 2NY2C 5GS1C 4J3XA 4LOUC 3UAJC 5F6IB 5C0ND 5C8JB 4PYHA 1NBZB 1KXVC 3RGVD 4A6YA 3PABB 1UM6L 2MPAH 3BD4A 4XXDB 4OT1H 4NUGL 2NXYD 3WFDL 3EFDH 5LAXB 1CFTA 2KBGA 4N0FA 4JJ5B 3SPVA 1NAML 2I5YL 3VRLE 3DUUB 3QIUD 2R0WL 1OAYL 3CX5K 1MIEL 2CKBA 4NO0D 3PIQA 3FQNB 3T3PF 1SJVA 1FAIL 1R5IA 3S36X 4G8IA 1PGRB 3DETD 5C0DA 3SGJC 3WXWL 4Q9CA 5HYQA 4CDHA 1T83C 1VDGA 4HBQA 3I9GH 1G9EA 4PV8B 1XF2A 2V5MA 4MDIA 2KQNA 1JNHA 5CBEA 3RFZC 4N5UA 3STLA 5FKPA 2R4SL 5GISH 1OP9A 4PY8J 3CU1A 2R0KL 5FO7B 5EB9A 3T08A 3KGRA 3GO1H 3FO0H 4LPCA 4YR6A 3P77B 4J6RH 4QHKI 5IEHB 2DQIL 2NY2B 5GS1B 1LGVA 5LGJA 4EQ3A 3UZEA 3WN5A 4Y89A 1A6PA 4JFZL 3MJ7A 5F7FA 5MEQB 2FX9H 4FFZL 3CDFA 4IOIB 6CGTA 4HIXL 1ZKAA 4HJGB 3QPQD 5I73C 3GMMB 1HI6A 4NRZA 2WNGA 3C8KA 4O2FA 5D8JL 3QXAA 1TJHL 1FH5L 4UU9B 5EIIA 4WFFD 5T1DH 5F7LB 1MCOL 2FYYA 5AZEH 3SKJL 5HVWA 4MCZA 4FZEH 4ZSOB 2J1KA 1ZMYA 1UJ3C 2BHZA 1ZS8A 1NC4B 2NY1C 1SM3H 2A9ML 1AY1H 1CE6B 4AK1A 3L5IA 1A7QL 4WI9A 4GRLA 3HI6H 4H5SB 5ANME 1EAJA 1OB1B 3D2UB 1YY8A 1JHKL 3LS5H 5I1KL 4YBQD 3BXNA 3P11H 4YHIA 5EBGA 3LPWA 2HJFA 1VADB 4APQD 2BVUA 4HKJB 2C4XA 4MHHI 3GSVA 1QFUL 1ZEAL 4PJ7E 4XNUH 3K1DA 5I1CL 5GS2D 4OBSA 3FQRB 3KHQA 4PRDA 1FL6A 5JMOC 3M17B 4KK9C 2BFVH 1GC1C 3W0WA 1LE9B 1RIVL 3TBVB 2VLRE 4MS8C 2KL6A 3O2WL 5D7IE 3LV3B 4NN5C 1YQ2A 4N90D 5I73B 3IDNA 3B5HA 1PKQE 3UC0H 2V5RA 5DEFA 2HRPL 5FA4A 4BSJA 4JFEA 1UJ3B 1YYMH 4XAWL 4ZQKA 3OGCA 4PP1D 4QF1A 2NY1B 4MLSA 5MENE 4KY1H 4OUUA 5HI4C 3DYMA 5AAMA 2VZUA 4M62H 2HT2D 4JFOA 4MNGA 4XP6L 3GHEL 4L9LC 4I3RL 1MCHA 1GVIA 1GZQA 4JREC 3V8OA 5CUSL 5FOBB 4ODSH 1J8KA 4V1DA 3PQYA 5L7XL 4X9FA 2VO5A 5BOPA 1UGNA 3A6BH 2XKNA 2WUBH 4ZNEE 4JHBA 3TBWB 2XTJC 3MFFA 4IRSA 1S7QA 3V4PL 4XCFL 5CJQH 4LPTA 3VFSA 5C6WH 1F2QA 3B9KD 5CJ8A 3VDCA 4KFZC 4WW1B 5TF1L 3SJVA 1NMAL 5FM5M 5I76B 1I8LC 3QQ9C 4RGOL 3P0YL 4MX7A 2VZ1A 4H25A 4ZAKB 5HYIA 1IC5L 2DQHL 2ORBL 4IMKA 4PJCB 4P2YA 3KVQA 4H8WL 4DKAA 2HKFH 1HEZB 1BHGA 3OG4B 3WLBA 1MVUB 3C09C 2IANB 4DUVA 2AEIT 4JFFE 3GGWA 3S6CA 4PJ5B 1NKOA 2F8VA 4LCWD 1CGXA 5D7KE 3MLZH 1NMBH 1YMHA 4PRAB 1FGVL 3AROA 3FFCD 5TE4H 4D0CA 3X3GL 5ALBH 3X12A 4JZJB 1A7PH 4L9LB 5CJBA 3V52L 3ZTNL 1LK2A 5ITFA 1NC2A 4JREB 4WI4A 2VAJA 3BQUD 4OQTH 2AW2A 3VDAA 1UQSB 3HFML 4L4VE 1VACB 3S3SA 4LLVB 4MJ5B 4ONFL 1A9BA 1VENA 5KJRL 4Z7NE 3FONB 4JG1L 5CSZB 1FAKT 2IFFL 4W4OA 3Q6FA 2XTJB 1F6LL 2CMRH 4UIMB 2D03L 3FT3B 3UJJL 4GQ9L 4YQXL 3KLAA 3CU7A 3VFTB 3SDDA 1U3HC 3CDGB 3JTTA 2DLEA 5E2VL 4M48L 4KHXH 3EJYC 1IEBA 2VDQL 2VQTA 1U92A 4YBLC 1NBVL 1FSKC 4RWYL 3WUWA 4X9IA 4I77H 3VD4A 5E5MB 2AI0L 1A6UL 4I3GA 3C09B 3MV9D 4IRJA 1I1AA 3N85L 3SGKA 2VDKL 4EBQH 4XB7A 2UWEF 5IR1A 4U49A 3PHOA 5A2KH 1CGVA 4M4PA 1N6VA 4P2OC 2ADIA 2E27H 1X6LA 4P2CG 5JXEC 5T1KA 1MFBL 5D6CB 3PL6C 5DVMA 1MFEL 1UT9A 5FYJU 4FQIH 1YMMD 1O0VA 2MKWA 2X05A 4OF5A 2K1MA 2EECA 4XCCL 3DSNA 1DQQB 1MFDL 4U1SB 4X6DF 2EIZA 2YKLH 4Z7VB 4MHHG 1P7QD 3GSRA 4ZNCD 1ZA6A 1KPUB 4V1DD 2QV2A 4OCRH 5EC1B 2OXGA 1JPST 5A2IH 4DK6A 5EUKA 1C5CH 3QISA 1BJ1J 5FO9A 4UUJB 4OGAC 2EYSB 4X0KB 1U3HB 4LLWB 5D7JA 4K2UL 3D85B 3DLQR 4JPWL 4PS4H 3LB6D 4YBLB 2UV3A 3LSOA 4LKCB 2VXTL 3FOLA 1FSKB 4N0CD 5DGQA 3VXPA 1JPFB 3AUVA 5D2LA 2VL5B 4RA0C 5C0RH 4U1KB 1JNLH 4NHCL 1RUAH 2CIIA 3BO8A 1KGCE 3RVXC 1UADC 4FXKA 3HZVA 5F1SA 2V5TA 2R2BB 4P2OB 2NY4C 1MCJA 5FYKD 3FN0L 4PJEB 3PL6B 2YWYA 4Q0XL 3MRNA 3UXFA 2EH7H 4HHAA 1GOHA 5DK3A 1XCTA 2BVOB 4Q97A 1NC2D 2AGJH 4XHJC 5IJVB 1AO7B 5ENWA 4PJ8A 4WFFE 1FFPA 1OAZH 1QSEA 2X4PA 4K7FB 4U05A 3ZE2F 3CDYA 1JPGA 5IROA 2AAVA 1P6FA 5JIKA 4HV8B 5HYEA 2YBRA 2NXZD 4ZOAA 3Q5YA 4HIEB 5B39B 3OXSA 4HWEL 6FABL 4NHUA 4S0TD 4IM8A 4PJAE 2E8YA 3PP4L 1IE5A 1WFTA 3FB8A 1I3RB 4EUPB 4M1CD 4NQXB 1ZGLM 3FZUC 5DWUL 2BC4A 4Y16C 4XP9L 1V5JA 2DIBA 4TNVK 1ZSDB 2Y1VA 4WEBL 1I3UA 1W0WB 5JR1H 1HIML 3KYNB 2K9UA 1NCAL 1R3JB 1TVHA 3NZ8B 4OZHA 4JN2B 4FQQB 5DQ9B 3LN5B 2VC2H 3ALWA 1NKRA 2KZWA 1S7RA 3MQIA 5JW5A 4IRJD 1UB5A 4HIJA 4MA7H 2EEDA 1FL3A 2Y6SD 1GGYA 1GC1L 1SY6A 1BD2A 2NW2A 4RMWA 5FF6B 3BPNC 3ULUH 1ZXQA 1VGKB 2HN7B 5C0IA 2WANA 5L8KB 2P4AB 2WBJD 1K8IA 5EZIH 4JVWA 3FRUB 1K6QL 4WO4C 2P49B 3FB5B 4DGYL 4RNRA 1JTOA 5AUMB 4QNPF 2EDJA 2YPVH 4LGSB 4FN0A 2A6DA 1A0QH 4P4KA 3DV4B 3IXAA 4X6CF 2BNRB 3GI8H 4KDTC 4Y16B 4UTBL 1T5WB 3V0VA 1HNGA 4OSUL 4NDMA 5EOTA 2GYSA 4M43L 3T0DA 1VFMA 1NGZB 4OM0L 4MCYB 2BNUA 5C7XL 4RMTA 2I07B 4RIRA 5MEPA 1JYVA 2IGFH 4JFYA 5JW4M 3V4VL 1BM3L 3NH7L 1I3GL 5HSFA 3CX2A 3JTSB 4ZXBC 4G6AD 4LNRB 1VFBA 3DX6A 4HG4K 3EGSB 3MRRA 1PQZB 4FFVC 1LNUB 4LRNH 4NRYA 4ODHL 3DVGB 3T1WA 3BMWA 5J13C 2D9CA 5GRZA 2YA1A 4XNZC 4U31A 1I85A 5TGBA 4PJ8D 2V2WA 4WO4B 5HYSG 3HNTH 3OKMA 1CGTA 4U6YB 2X4TB 4KJWC 1A6WH 3T4YA 1A5FL 1KXQE 4CU8A 3WXVH 3QAZC 5DC9B 2YEZB 4LCWE 3V6OC 4MQTB 4JFQA 3FFCE 4UTAL 4NM4H 4QTIL 5IM7B 3SE3A 3QUMH 2FSEA 4B7IA 4Z7UB 3EYFA 1J05A 32C2B 5HHMD 4JFDB 1TENA 5FGCE 2XWBA 1RIUL 2HMID 2EDFA 1A1NB 1IGIH 2XZAH 1AI1H 4P4RB 4YXKH 4LDOB 3Q1SL 3UTQB 2O61B 1KLGA 1HHKA 1RULL 3TWCL 3AGVA 1KBGL 3ULVH 1IAKB 1TJGH 3JV0A 3HNVL 1A2YB 2ZJSL 2H32B 4HJJL 2EDTA 2GT9B 4ZXBB 3LQZA 1BF2A 4X6EB 5AYUH 2RFXB 3T0WA 1T4KA 5CJ5A 3HE7A 1GPOL 1X4ZA 5J13B 1R3IL 4OD2A 4XNZB 5E2UH 3WE6A 1J87A 3WFZA 1QOKA 4NPYB 5AD0A 2HWZH 1FV1A 2P43B 2R2HB 3W39A 4WU5B 3MV9E 4JAMA 4FQCL 4CVXA 5I1JH 3QAZB 4LPXA 2GSIB 5KVGL 3AXLA 5F7MC 3KPMB 1FL5B 1BMGA 4WUUD 1EHLH 4GUPA 4Q9BA 1SBSL 3P73A 1YMME 4LVHC 2MHAB 1QBLL 1N2RA 4QRPA 4KK8D 4UQ3A 2O5YH 3W9DB 3BGMA 4M9PA 2ZOKB 4N68A 1KCRL 3JV6B 5FOJA 1I8KA 1TNNA 3AMKA 4V1DE 3SBWA 2N7AA 3EJZC 1S8DA 1MFNA 3L3OB 3QI9A 4PG9B 3AAZB 2HVKB 3A6CH 2EXYD 3BYYA 3T3MF 1Y6MR 3O9WA 4BJLA 4MZ3A 5KN5B 2A73A 3U7YH 5JOPD 2H2SD 4JPVH 4KTYA 2YPKB 3N50A 4XXCA 4F57H 2EC9U 3AY4A 3HS0B 3O11A 3KAAA 4Z0XB 3G5VB 1H0DA 4ERSH 3OF6D 3TA3A 3O45B 4P49A 1V3JA 2VDOH 3RBSA 2G2RA 5LJYH 5IMLA 2HAZA 3U9PL 2RR3A 5I1DA 3L5XH 2EEAA 4AQ1B 4NCC2 3NAAH 4A6YH 4WTXA 1PZ5A 3BKJL 3HNSL 1CIUA 3UROR 5C86A 5D70H 4Z9KB 5FYKE 5ERWB 4G43B 3RWJA 2YD2A 5F70A 2XIDA 1BZ7B 4LSQH 1KXTB 3FT4B 2DQDL 3MRJB 4Y1AD 5F89B 4LVHB 2ZSVA 3PWJB 2P8LA 2DICA 2GW5A 1NANI 1UZ8B 1DLFL 1QYGH 1YPZA 3LVEA 4QOKB 4G6FD 2LU7A 3ZHKA 3P4MA 4C58B 2ITCA 3VWJA 3LH2H 2OLDA 3HC3H 1CTOA 3L6FA 4PBWD 2CRMA 2QSCH 1XR9A 4CJ0A 1X6NA 1UVQB 1E4WL 1YEKH 1G7QA 4Y8AA 5GGRB 4TSAH 1AGBB 1RY7B 4OIBA 1UB6B 3SOBH 1J1PH 2MMXA 4YXLL 2R1XB 1SMAA 2JCCB 1MRFL 2Q7YA 3MRQA 1ES0A 5GS0D 4O51A 3VXUA 3E6HA 3HE7D 3CD4A 5E9DA 5CD3A 1IAIL 2BHYA 1XF5A 3OX8B 5FYJD 1X5GA 5GGVY 3IJSB 2F9BT 2PTUA 3PHQA 1O7SA 3ZTJH 4CU7A 1AFVH 3DOSA 4H1LH 1B4RA 2OJEB 5EOCH 5DLML 1U3YA 1JBJA 1M7IA 4HH8A 5DSCA 4N5ED 4OT1L 1GGIH 1IGTA 3H2WA 5SX5K 5DHVA 3EFDL 5GXBB 2VTFA 4XHQA 4M5YH 1EO5A 2X4NA 4X9BA 4WNQB 3TF7C 4WWKC 2P7TA 4BSWB 4L8CB 2DQGH 1FN4A 3VE0A 2BOBB 4EJ1C 2G5BA 1KIRB 3SN6N 4X98B 1VEOA 1T6VN 5TPWH 2W91A 2PYEB 2D7NA 3I9GL 4MAYA 4LLMB 1JWUB 4AIXA 4O58H 4OCXH 5D1ZC 1G0YR 3DECA 5A2JH 1RZIA 5GISL 3O4LD 1CIDA 1UCTA 4HIIA 4AT6B 4CNIB 4DKDC 3C5SA 2FECL 2MQCA 3B83A 3GO1L 3BPCA 3FO0L 2KUTA 1MLCA 5H37H 1EZVY 5JDJA 2XZZA 4OZIE 4J6RL 1JPTH 3RNQB 5CBAA 1ZT4B 3W82A 1MCCA 1UENA 1OD7A 5DJ6A 3MLRH 1II4E 3T0EE 1CL7I 2XG4A 3KYOB 5A1AA 2FX9L 1R6VA 5C1MB 1JHLH 4MGXA 1DANT 5J1TC 3HRZB 4NQDA 4GAYB 4N0UB 1VB9A 1JL8A 4HBCH 3ZMRA 2QEJA 4TNVF 4WWKB 5JA8B 3PWUB 3RWIA 4Z18A 1RZFH 2BY3A 3UTSA 5AZEL 2W38A 2DIJA 1MCEA 4QTHA 2CPCA 1CFNA 3ALPA 5IVOA 3S9DB 4PJIA 5EG6C 2FIKB 3C8DA 3SCMD 2FJHA 2W59A 3O3BB 3VWJD 1SM3L 1GH7A 3ARFA 1JZ6A 3I3EA 4RAUA 5D1ZB 5E7FA 5TF0A 2CD0A 4NFDA 2CGRH 4YGVB 4Y4HA 5HI5C 3S5LG 2VLKB 2DBJA 3LRSB 3BPLB 3LS5L 5CP7B 3P11L 2FR4A 5HI3C 4FQHA 3O8XC 5F7YC 5D5MB 1HCFX 3GDBA 3I84A 1GZPA 3CFKA 4XNUL 4GXUM 4HAFA 3STBA 4XGZB 5E9DD 2Y7QB 4R0LC 3SDAC 1U8HA 3MREA 2IQAB 1LO2H 4P2QD 2HH0H 3VXOA 5ID0B 2BFVL 5D1QB 1FJ1A 1WBZB 1J8HB 1HHHA 35C8H 2AJYH 1IGYB 3ARGA 3MRPB 5IQ9B 3QEHB 4HGWB 3B5TA 3QXDB 4X5XB 1S7VB 2VXUH 3OKNA 4JHWH 1U8KA 3HUJA 5K9OA 5H94A 3UC0L 4PJGA 3VXMA 4PJBF 1QLRB 5DR5H 2K3TA 1YYML 2CRIA 1IQWH 4QHUA 5GGTA 5AAWA 4H26B 1NCBH 1OL0A 4GG8A 4KY1L 4S1SH 4KVNH 3D0VB 3CMGA 3DURB 4M62L 3WDHA 4DUWA 2J8OA 4U1LA 1EFXA 2VLMD 3SKNA 4WUUE 3Q2CA 4ETYA 2I60H 2FO4A 4BSVB 3O8XB 5GRYA 2PO6C 5L6YH 1FFNB 4ODSL 4MD4A 4EXPX 3A6BL 2H45A 4R0LB 3SDAB 1KTLB 2MFNA 4O5LH 3QDJB 4AQOA 3PP3K 2DM7A 3KPQA 3PV6B 1A1MA 1WGOA 3BJ91 3O2VH 2GCYA 5CJQL 3VXQB 3TV3H 5I1AA 3N1QC 5DMIH 5DI8B 5C09D 2J3SA 2UYLB 5JOPE 2DJ4A 3UPCA 4TSCH 4F7PA 5HGDB 1MUJB 2DWDB 2HKFL 2IH3B 1U3JA 3MOBH 1INDH 2HKHH 2XI9A 3LEVH 1CICC 2AKRA 1Q0YH 2LAGB 5TE4L 3ARFD 5ALBL 3MGTB 1CD8A 4ETQB 2OMBA 1QEWA 1AGDA 2RIKA 4JM2F 1NFDB 5F72S 1A7PL 2DLTA 4Y4HD 5DRNA 3TN0C 3K1KC 4KDWA 3UTZA 1EMTH 5J1SC 5E8OB 5ECJE 4HMEA 1IGJA 3IS1X 2PO6B 3UEZA 3C6SB 1XH3A 3N9GH 1U58A 4OQTL 4Y1AE 2DYPA 3ULVC 4LF3B 3WBDA 3UZVB 1TIUA 3OB8A 4Y2DA 2HTKD 3DX7B 2CMRL 2NY0C 1PEWA 4E41A 5C0FB 4X99A 1QRKA 5I0DA 5JIHA 3GMPA 4UOW1 3D39B 4EEEA 4KHXL 1P1ZA 1F3JA 3HE6A 1OAKH 5T1MA 2XA3A 3UX9B 1JGLH 3O3UN 1S9VB 4I77L 4NM8L 5DK2B 5M7QA 1MPAH 1NCUA 4MD5A 4YDJA 5ICZB 1HQ4A 1EERB 4EBQL 5FYJE 1IMHC 4HUWA 2CUMA 5BS0A 5KAQG 5IFJB 1YEIH 1XGUB 3OB0H 4G7YH 4LCIH 4CADA 1MJ7H 1QRNB 2E27L 1UC6A 4RMVA 4DOHB 1OTUD 1RV6X 4OUOA 4JRWA 5F7KC 2Y25A 5EC2A 1A4JA 3TN0B 2D4FA 3IDUA 1RJYB 4HH9A 4JVPA 3E8UL 3B3IB 5CS7A 5FDWA 3ORJA 5DD3H 5C07A 3VJ6A 2YKLL 1DDHA 2VKWA 4OCRL 3MCKB 1NGWB 4LQ1A 1NBYA 5JDSB 4NNYB 2NY0B 1C5CL 1H15B 1UXWB 3C5ZC 4ZUVB 4U6HB 5BRZA 3O4LE 3QEUB 3RVWD 5JW3H 5C0BB 2ADGB 4X9HA 4PS4L 4WGVB 3SE9H 4JQIH 4EKXA 5C08B 3WEXB 2L0DA 4NNXA 5C0RL 1C7SA 1JNLL 1RUAL 4FABL 5ILTH 2D7OA 3DIFB 4MYWB 4M93C 1MHPH 1MCDA 2FL5A 1MAMH 1BZ9A 1EAPA 1MCKA 3VCLA 1N0XH 4LSPH 2A0LC 3ARQA 4WV1C 2EH7L 4UT6L 2X09A 3RKPA 3BEVB 1E28B 4GKNB 3F8UB 4U1MB 4LIQE 1XGRB 2X1PA 4X8JA 4EN3A 2AGJL 2X4UA 4LPWA 1FZJB 4KRNA 4W6YB 1OAZL 2CSPA 2VWEC 3QFDA 4ZS6C 1MELA 3L7EA 4L3CA 1CR9L 3AVEA 4P23C 1KJ2A 1NH6A 3IGAB 4AYFA 4TVPD 3MV7A 3V5HA 1DSFH 5EORH 3MRGB 3C5ZB 5EFIA 1NEZG 1U95B 2HP4A 4U1HB 3QQNA 1WTGT 3DUSA 5IHZB 5KSVA 4CMMB 5I8CA 1YEJH 3SDXB 3R4DA 2M1KA 2W9LA 3WN5C 1YEEH 3HE6D 5JR1L 3IFNH 5L9DH 4A6YB 4DKEH 4RSVA 1UH4A 2XRAH 1WVZA 2EH8H 3CVIH 5E9DE 2VC2L 3T3PE 3KPRA 4M93B 1CFTB 3NCYS 5IG7B 5J06A 3AFLA 4P2QE 4MA7L 3QT2A 3QUXC 4ZPVA 3PIQB 4CUCA 1X5ZA 4WV1B 4XWGH 3HPJA 4OJFH 5F8QC 4BH7A 3ZKMC 3ULUL 2YD4A 2DQTH 3T1FA 2FATH 4G7VH 4MDIB 5FECB 5CBEB 1JNHB 3O2DH 1ZLUH 1BECA 3QCUH 4NZRH 5EO1A 4HFWA 3STLB 3V5KA 5HVGB 5C07D 5FKPB 5JMRA 5EZIL 3L1OH 1N8ZA 3ARRA 5IB2A 3DXAA 3ARWA 3B4NA 2YPVL 2R39A 1BIHA 4DZ8A 1A0QL 1TMCB 3ZYIA 1LILA 4KJPD 3KPLB 3VRJA 2WINB 3PWLA 3FAXA 5BRZD 2O5XH 2VLME 3REWA 2A6IA 2A74A 2DI7A 3FCTA 4PJCF 3WN5B 4H1LB 4Q2ZA 1T7VA 3MJ7B 1MRCH 1I9JH 3EOAA 2ICWJ 1DBJH 1LEIB 1T5XB 5IK3A 5E8NA 2A6JA 2IGFL 3QG6A 5HVHC 1HI6B 2EDRA 1HXMA 1DQTA 1JI2A 5DZLA 2YD9A 3PWNA 3QXAB 3K46A 5E95B 2AXFB 2FYYB 3ELAT 1G9MH 4NZTL 3GMOA 5JIPA 1M4KA 4NO3A 5IB5A 1H3TA 5C09E 1ZT7B 4LRNL 1ACYH 2FJGB 3KR3H 4OZGF 4ZTOH 4K7PY 2IPKB 4MJ2A 4YDLC 4LLDA 4NFBA 1ONQB 4FQLH 5FV1L 3QDAA 3WFCH 1A6WL 2AABH 4HC1A 5AEAA 1BEYH 4XPAH 3WXVL 3DPBA 1YC7A 5GSRA 2FBOJ 3BXNB 4X7EC 4AIOA 3MJ8B 2ATKA 5HHOA 4I4WA 2CR3A 1AKJD 2FZ3B 4RA3A 3MV7D 2JE8A 3GSVB 4NM4L 3C6LA 4GLRI 1IGFH 5GGSY 5D7LA 4G9FD 2APFA 1NDMB 5KVFH 3C9NA 3ILPA 4XNMA 4DGVH 2NCMA 3WS3A 4FHBD 1PAMA 3W0WB 1IGIL 5F96H 3MO1B 1AI1L 4IRSC 4YXKL 4BH8A 1P7KA 2L4OA 1WLHA 2B0SH 2VYRE 3VFOA 4OLYH 3EOTH 5HVHB 4PJDA 4XT1C 2QKIA 3IDNB 3ULVL 1TJGL 2P45B 1R0AH 1WAAE 3TCXA 3PGCA 2D7TH 5AYUL 1X7QA 4TVSa 2LAAA 4HUMB 4JFEB 4NKDA 2I9TA 3CFBA 2BY1A 1ZHNA 4ZQKB 5I15H 2E9WA 3OGCB 4QF1B 4Z7VF 3ZKXC 1HNFA 3RNKA 1UM5H 2YR3A 1P5UA 4OUUB 4BA8A 5E2UL 4YDLB 1ZVHA 4G9DA 1TLKA 5B21A 5MP6H 2HWZL 1B0GB 4DVRH 4JFOB 4HG4J 2RAMA 4MNGB 3U6RB 2YRZA 3LKNA 1WC7A 2WK2A 3FB7A 5I1JL 4HUXB 3AU1A 4WDIB 4YO0A 1LEKB 3QQ4B 2ILLA 5I16B 1UWEH 3BWAA 2GUOA 3PQYB 3WLWC 4NKMB 3K8LA 1EHLL 1FFOA 2R2EB 4MNQA 2XKNB 2RJMA 4W6WB 4WJ5A 1BP3B 1W0VA 3QQ3A 4LFHG 4W4OC 3P4NB 2O5YL 4IRSB 1FPTH 1T1XA 3BIBX 3JV4A 3VFSB 2X4SB 1XF4B 3UP1A 1TZGL 3SJVB 2BRQA 3A6CL 4PJEF 4HCRA 2YUVA 5JLZA 4MX7B 4FMKA 3U7YL 4JPVL 4NWUH 1Q38A 4L3EA 1YUHA 2LVCA 5E94A 5TQ0H 4F57L 3WLBB 4YHNB 2I9LA 4NGHH 3T4AB 1RFDH 1NUGA 4P46A 2F8OA 3GGWB 3ZKXB 4UT9H 4YNYA 3QDMA 4ERSL 3AREC 1NAKH 2NYYD 4MNHB 3E0GA 5ABDE 4D0CB 4NZJA 1OTSD 2Y5EA 3L5XL 3NAAL 2XYCA 3DRQA 1LK2B 3HMXH 5ITFB 3MNWB 4A6YL 5FAAA 3MUJA 1AIFB 1HHJA 5IJKC 5DD5H 1HILA 2VUYA 2CDFA 5D70L 5HHOD 4C83A 3X3FH 5IHUH 3Q48A 4LSQL 2F54A 4JRYA 2X4OA 1AQKH 4HIHB 2B20A 4RMQA 1QYGL 3SE4C 4K3JH 4M7LH 4XAKD 1TVBA 4AENA 3CSBA 3LH2L 3HC3L 3KLAB 5GPRA 2QSCL 3SDDB 4S1RH 3U0WH 1YEKL 2DI8A 4TSAL 1U92B 3LOWA 3RVTC 3SOBL 3HG1A 1J1PL 1PY4A 1CE1L 4TVPE 4XVUD 4BFIB 2UWEE 1RJLA 4M6NH 2OXHA 1QHOA 2YSSB 4KXZH 4OI8A 4PJ9D 8FABA 4ZFZA 1I1AB 5D93C 5E08H 1CVSC 1D5MA 2YN3A 1BIIA 5CLWA 2E7HA 2Z31C 3AREB 1E27B 3PHOB 4UB0H 5KOVC 1KOAA 2ADIB 5DUPH 1BVZA 1KN4H 5T1KB 1MFAH 5ADPH 1JF6A 1FNEA 4X6DE 1AFVL 2H8PA 5EU5B 5EOCL 1NAMA 2HJLA 3CZFB 43C9B 4WI3A 4C56A 3RZCA 4XB8A 1BFOB 4OM1H 4K9EH 2EIZB 4NQVB 4M5YL 3QG7H 2E7BA 4BYHA 3T8XB 1ZA6B 2OS7A 2PYFA 4RMRA 4MNQD 2DQGL 3BW9A 3IDYC 4DCQA 5F1NA 2P8PA 3MGOA 4OI7A 3MBXH 1TJIL 5EUKB 1NLDH 2FB4H 1NCWH 5TPWL 3BISA 3KLHD 5C07E 4O58L 4DZBA 4OCXL 3MRLA 3MXVL 3LSOB 1AHWC 4JQVA 3FOLB 5D2LB 4XTRD 4S10A 4X7DC 3WKNA 4UDTA 3QRGH 2HVJA 5D93B 2NX5D 2CIIB 5BRZE 1K3IA 2R23B 4FXKB 2Z31B 1GGTA 1JPTL 2JIXB 3KHOA 2HFTA 1JZ5A 3KPOA 1CI5A 1WWBX 1MHCB 4JY6A 3U9UB 3L95A 3BP5A 1TTUA 2D4DA 4HHAB 3ZE2E 2W0PA 1H3GA 1JHLL 1XCTB 2CRZA 5DO2C 5ENWB 1NPUA 1B0RB 1FFPB 1QSEB 1YECH 3N06B 4Z7UF 1NGPL 4HBCL 2ICES 5H2BA 2XN9D 3BPOC 3IDYB 1RZFL 3MRIA 2F54D 3EYVB 4LSDA 1XF3A 5CWSB 3BD5A 3OXSB 4L4TB 5EOQH 3RIFK 2ZCHH 4HF5L 3DX9A 4N0YH 1F4HA 4AEIH 1OWRM 1U2HA 4G8FB 3QEGH 3FB8B 2YC1B 5M94B 5IT2H 3SKOA 1QSFA 1ETZA 1AHWB 3P9LA 4POZC 2R4RH 4WW2C 2AJ3A 3EOBA 3QCTH 4PLKC 3FO9A 3JBG7 4CGTA 1XCQA