4AM0Q

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
91
Chain Sequence
TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
total genus 14
structure length 91
sequence length 94
chains with identical sequence R, S, T
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4am0Q00
5H37A 5IREA 1Z3RA 1OKEA 4L5FE 3VTTA 3N43F 5KVGE 1ZTXE 5AAMC 2ALAA 3N42F 1OANA 2HG0A 5B1CA 4GT0A 1PJWA 3C6EA 3N41F 5LBSA 3N44F 2V33A 4UT9A 5KVEE 3WE1A 1TG8A 1RERA 2JSFA 4GSXA 4FFZA 4BZ1A 3UZQB 5KVDE 4UT6A 3N40F 3C5XA 1S6NA 2JQMA 1OK8A 4FFYA 4UTBA 2R69A 4AM0Q 3MUUA 2H0PA 3G7TA 5LBVA 5LCVA 2P5PA 3J27A 5JHLA 3UYPB 2JV6A 5AAWC 3J2PA 1URZA 3P54A 4FG0A 2I69A 4UTCA 1UZGA 4ALAC 5KVFE 4AL8C 5JHMA 4BZ2A 3UAJA 1SVBA 2R29A 5IZ7A 2GG1A 3UZVA 1Z66A 4UTAA 4X42A 5GZNA 5GZOA 3IRCA 3UZEC
chains in the Genus database with same CATH superfamily
3PDOA 1I9JL 3BP7B 1JUFA 4GG6B 5B4MD 4KK9D 1DQQB 1XF1A 2F74B 4MAYD 3LNEA 2R2HB 2D03H 4CN4A 2EQDA 4RAVA 7PAZA 1OWRM 2R0LL 3II1A 1CFQA 5AZEH 3AS0A 3CDCA 2ZYIA 4LCUA 4NKQB 4U7SA 2NX5A 3ARBD 1LEKB 3NABL 2VLRE 1W9XA 1FVCB 1FDLL 3CPUA 3ZZ1A 2I5YH 1P69B 1S78C 4IYKA 5EN2B 3FTZA 5CJBA 2NY1B 5EOTB 3ZKNC 5HDQH 2XHNA 3CX2A 1EA9C 3N42F 1BQUA 1P2CB 3R4DA 2VZOA 3OGCB 1J8HA 2IXQA 5A6LA 4OFQA 3UG5A 5DJ8A 1Y6MR 3IJ9A 3D18B 3O45B 5JPNB 4HFUL 3RWDB 2XOTA 4NYLB 3IMVA 3KL0A 1T5WA 3WNOA 5AUMA 2DEYX 1CU4L 3BAJA 4HUUB 2WVTA 1YO4A 3TX4A 4AI7A 3LOWA 5I6KA 1V8HA 1EJ6A 4I4WA 1RIHH 3JWNG 1CFMA 1LDSA 3M45A 1FZOB 3BKJH 3IKCA 3IJYB 3VI4B 3MV9B 3VWJA 1I82A 1A4KB 3FOLA 1JS4A 1M56B 3Q2WA 1QBLL 2ZAHA 4JY5H 2UYLB 1IAKB 2MOGA 1XF3B 4UM8A 2EE3A 1OK8A 3H9YA 3F83A 5F8RC 2R0WH 2J1KA 3AREC 3M46A 5IBTL 1RUMH 3CX5J 3JV5A 3O9WC 1P5VB 5MERA 2K78A 2BP0B 4X8GA 1MFCL 1RVFL 3OKMA 3SDDC 1ML0A 3H42H 4KFMA 4XXWA 1V7MH 4AUJA 3D52A 4X8XA 3RDTB 4PJXF 2WCGA 2EINB 3T3MF 1AS7A 5AAWC 3KWXA 1HCFX 3BFOA 3GKWH 5D9SB 2N1KA 3RU8L 5KVDL 4M4PA 4QUOA 1UXMA 4HKXB 1E90A 1UXLA 2K3TA 4MMXB 4BCZA 2ZX9A 2W80C 3VXSE 3BIKB 2YXFA 2IADB 3N1QC 3R1GL 2X4RA 4JPIB 3KYOA 4LSVH 3TYGL 2FLRT 5ETUA 1JZGA 5EZLB 2OXHA 5BPPA 2J2ZB 5I1CH 3NIGF 1IGFL 4HIHB 4XB7A 4Z7UA 3SIKA 3ZKXC 5D7JC 3TN0A 1HJBC 3UTTD 3U36A 1J86A 1F90L 3V8CA 5HYQA 1X9UA 1J05B 1AXTH 2LU7A 4NUPA 3AG2B 5TE4H 1WWAX 3HKFA 3MUGB 5I17A 1KFAH 4GW1B 1EXGA 5I75B 1LK2A 5FYKL 4FQCL 4LNRA 3ZHNA 2EDLA 2VZ1A 3G04B 4OZ4A 4MXQC 4WZ9A 1D6VH 5ES4B 4F57L 4H20H 2OMTA 2VSCA 2F7QA 1IZKA 4AH2B 1R5VA 3NJKA 4LOUC 5CMAA 1TTAA 4OD1H 1Z0NA 4HK3J 2EXTA 3GSOB 4B9FA 1Y0LB 2E75C 5I1JH 3DJZA 4PJAE 3DUUA 2ICWB 5D7IB 2Z93B 5BNXD 1UD6A 3MA7B 4HS3B 5E2VH 1XB6A 4PSRA 4HCRH 4LSQL 4X80L 4ODTL 1H8SA 4B9PA 2PKDA 2IDUA 2VAJA 3W5NA 3EJCA 3ECVA 4GKSA 4GRMA 2FJHB 3QS2A 4JHAL 2V2XA 1HH9B 1L9SA 2BS9A 2H2SC 4WEMB 4XVSL 2F1BA 3ZO0A 4F5CE 2NY5C 3IVKA 5DEFA 3MYJB 1WBXA 1ZT7B 4P5TA 4X6DE 2I9TB 1CWVA 1H8OA 4FXLA 3BH4A 1A02N 4NC0B 2ERJB 2FWSA 1Y7VA 5FGSA 3LNFA 3OKLA 4JQIA 3UDWA 3GMOA 2JIXB 1Z6JT 1JYNA 1R5WB 4KXBA 1FNLA 3QISA 4NZTH 2OMNA 2DQIH 5GJTL 2C7UA 3T77B 1P4BL 4N9GB 1FYTB 1ZGLM 1W91A 1D9KB 3AS1A 3K6DA 4G8GD 3CXHJ 4JM2C 4M8UA 5AVWB 5AYUL 3ZL4L 3U82B 2J4WL 5DUBA 2Y5TB 4QY8A 4DN3H 1P5UB 1LO5B 4TVPL 3WTSA 1C7SA 2HT3D 1DEEB 1YEIH 3L9RA 4GKNA 5IW6A 1RZ8A 2VM4A 1M6OA 1KIUB 1V3KA 4KTDL 4OLUH 3KBFA 1P7KA 4PJGE 5L4MA 3AUWB 2ZAIA 5EBLA 4PR5A 3FQ4A 1AG0A 5KVFE 2CBTA 3D3VB 1CDUA 2W9EL 2EUVA 2DWYA 2XWTB 2YFNA 1PKQA 3O4LA 2BC4B 2IQAB 1OGTA 1OE3A 4XMPH 1MZYA 4XPTL 3V6ZA 1FLRL 3BP7A 3FFDB 5HVGB 3T4AB 4BKTC 1AO7A 1DCLA 5FEBA 5SWZE 2VZ3A 1E3ZA 1KXTB 3QEHB 4DP5X 2K9UA 5EUOE 3QFJE 2XPGA 2PP7A 1CCZA 1GYCA 1IV8A 1TJMA 3EO1B 4JFEA 1OD7A 3MRPB 4AMWA 1U93A 3APNA 4HK0A 5CEZE 5H2BB 2QL1A 2H2PD 4DEPC 3BGFC 5EN2A 4W6YB 3BH8B 5DWUL 3KYKL 1KCWA 3WBDA 5EOTA 3A3YB 1D5ZA 1K8DA 3BVUA 2ZNWA 2DQTH 2O5ZL 3H9SE 3RPKA 1NBZA 5DFAA 1P2CA 4OV6F 3OGCA 5D93C 3OZLA 2VDKH 3L45A 3VJ6B 3IKKA 3O45A 1QI5A 2ATPB 4P2CG 5D6CB 1ZA3B 1YUHB 3PE9A 4JZNB 3UFIA 5DU7A 4L5FE 5B1BB 4IU2B 1CL7I 4NJAH 2X2YA 2G3XA 2NY4D 1N7ML 1MIML 3PUUA 2OSYA 4Q89A 2CBMA 4PJHB 2NXZC 1A6AA 1F4WL 2Q7NA 4NZRL 1T0NA 5LWYL 3U9WA 1A4KA 5C08A 1NEPA 2NYKA 4PP1D 3BAYA 5CLXA 3HMXH 1K4DB 4DGIH 4JVPA 1IBFA 1F3JB 1XWVA 5B3SB 4HBQA 3FRPB 2NQDA 4J39A 3PAUA 1OAJA 4PJ5E 3VI3E 4G1MB 3NCYS 3U7AA 5I8KL 4GKOA 2OMZB 3QA3A 5J7CC 5JHAA 3DUSB 4A39A 3KWUA 3RDTA 4GQPH 3WN6A 1M05B 1RMFL 2LFGA 5BRZB 3NSXA 1RULH 5CGYD 4A2LA 4RMQA 4U1HB 4G83A 4WAFA 5CUSH 5C0BD 4HKXA 2QADD 3BIKA 3FQNB 2IADA 3V52L 4JPIA 1HSAB 1JYWA 3OD3A 3EFDL 2H45A 4ORZC 5EZLA 4HJ0C 4JMXA 2J2ZA 4XPBH 4RWHA 4G8EA 1F18A 2BXZA 2FEEI 3G6DL 4ZOEA 1QBAA 2VERA 4S1QL 1EEYB 3CZKA 5JHLA 2B5IC 3B5TA 4KUZL 5BZXA 2HX8A 1JV2B 1R3HB 3QE5A 4PJAF 2EZ0D 2ZSWA 3CMOH 1OTTC 3TWCH 4XP6L 2CA4A 3MUGA 4KKCC 3I3DA 1EMTH 1OARH 4GW1A 5HY9B 5ILTL 4ZQKB 5DUML 4G7YH 3OXSA 5J3HD 3G04A 3THMH 5GGSY 2I26N 1PD0A 3US1A 3QEQA 5IZ7A 1DL7L 1WD8A 4K3GA 2NYYC 5C07E 4HX1A 2WXJA 2G4EA 4AH2A 1XEUA 5D70H 4WNSA 4X5QA 3MHZA 1Y0LA 5D1ZD 2C1OB 4IEFA 2Z93A 3OMNB 5I6XB 1ZT1B 4CU7A 3I6LE 2IWKA 4FFWD 1SYVA 4X6DF 3MREB 1YEHH 2VZUA 2Y1VA 5I30L 3QS3A 3X13B 5K1VA 2Q86A 3D9AH 3FTYA 2ZUQC 1TCMA 1SHSA 2EABA 5IREA 1HH9A 3MJ7B 2D31A 2Y1YA 1W72A 3SPGA 1CVSC 1F6AB 3MYJA 4FEIA 1ZA6B 1KJVB 1ZT7A 3DKHA 2ZCZA 4FTVD 2ENQA 5DJXB 2CUHA 1XD0A 2BOBA 3ZDXF 2AQSA 4RIRA 4JGJA 1LXMA 1KB5H 2H1PL 2KL6A 4HKZB 3UAEA 4PMEA 2QQLH 4WU7A 2JIXA 2Q3XA 4DAGH 3JV4A 2IBBA 2XN9B 3BPOB 1SHXA 2CAKA 3RX7A 2A9CA 1D9KA 4Y8AA 1CL7H 1U41A 12E8H 1F58H 3U1SL 4AT6B 1IARB 4QXVA 1H6TA 1A1NA 1KIPB 2EYSA 1P5UA 5LXVA 5FYLL 1X7QB 2BSEA 3SKUD 2YK1L 3MV7B 2HJFB 1UA6H 4ZZFA 3S0PA 2ZCKL 3MRKB 2NY6B 1S4IA 4NQCE 1KIUA 4BUGA 4TYUA 2VWEE 2VC2H 3FQRA 2TSAA 3GBNL 4GINA 5DDHB 2WXLA 4I3SH 3UJTH 1OPGL 2YXVA 4ZBJA 4KRLB 1K2DB 4F9PC 5I1KH 1F5WA 4U1KB 2XWTA 3P1VA 2IQAA 3QWRD 2NX5E 1ET5A 2BWQA 3FFDA 3VGBA 1H15B 5LGYA 1NWPA 5E6UB 5KJRL 1PX4A 1INDH 1MFBH 7FABH 1AHWA 2AK1H 4EI6B 2QTEA 4P46C 3EO1A 3C5ZC 1U8CA 1DJWA 1TETH 1MHPL 3ATEA 4MMYB 4W9FC 5GGSB 3B7YA 5I5MA 1ONQB 3BH8A 3O8XD 5HI3C 2UY7B 1K9TA 4EO5A 1DJGA 1E4JA 1AFVL 2QFRA 1S7VA 3NACL 4KTEH 3V6FB 2R2EB 2M1KA 3HNTL 3GSQA 5C6WH 3NEEA 4IRSA 2HPTA 3REVB 4TTDD 3VJ6A 2ZKHL 3SZKC 5JUEH 4WWKA 1O9VA 1LO4L 4DTGL 3OKOA 2KLSA 4FRWA 4PG9A 3U0TB 3KEHA 4WQOA 5GZOA 4NQCA 1MFAL 2APBA 1EHAA 4QHLB 4ZFZB 3VDBA 4I9WD 1JZDC 4I3RL 5K9JL 1Z9PA 5I8CB 2XXGA 1KNOB 4GMSL 3WTTA 2PW2A 1EO7A 2D0GA 3CZFB 1P6AB 4XP1L 2YQBA 5HXMA 4F8TA 1KCLA 2C1PB 1P4LB 1NLDH 4U33A 3IU4H 3MBEC 4PS3A 5CLWA 3F62A 3WXWL 1PBYA 1HINL 3CDYA 4LFHD 4O2CB 3DO7B 3UBXG 1GTNA 3S37L 1BZ8A 1RXLA 1LO2L 3BPNC 4PFEA 1M05A 3HG3A 1U42A 1DHKA 4LSRH 4AUUA 4XR8C 4P59L 5TQ2H 4E5XB 4LEBA 1I85A 3PY9A 4CN6A 3CQFA 2GBUA 4EOWL 3NDYE 1KXHA 2Q76B 2Y7QB 3FO9B 4ANVA 3QQ3B 2QHLA 4UOJA 4FABH 3LZQA 5I1EH 1HSAA 4Y5YA 1HL8A 2B3IA 4JO2H 4KKLC 4XAWL 3QORB 4K9EH 3Q2NA 3SPVA 5IM7A 4D2NA 2B1AL 2RBLA 2XA8L 1CQYA 1EEYA 2PXYC 3L4UA 2OMWA 4PG2C 4PRHB 2XRAL 4U6YB 1JV2A 1GY1A 1TJHL 5GGQH 1Z9LA 3KH3A 5CGTA 2OYMA 5HY9A 5HHXL 4NNYB 4ZXBB 3VRIB 3L54A 4WI6A 3V7AE 2OJZL 3GPEA 2PNDA 3CGTA 4YH6A 5IBUG 4KDTA 1YG9A 5I18H 2VM9A 5DEZA 3B5GA 1D7DA 4L4VB 1RLBA 3EYUH 5DZLA 2KYIA 1DJYA 3T8VA 5C0NC 1MI5D 1OAQL 1TO4A 1ZT1A 4QTIH 3BQVA 2HLFC 2YD5A 3TONA 4HC1L 1U8HB 4CW1B 5BRQA 4B95C 1OOWA 1KPRA 5I0VA 3H6AA 5ALCL 1XB3A 5C71A 1DVTA 2AKRA 1B0RB 3AM8A 1VACB 2VLLB 4KBPA 2V17L 2FJUB 3HMWL 1YN7B 3NSYA 1VF5C 2F7RA 4K3JL 3UO8B 3NVQA 3V4PL 1F6AA 4S2SA 4F1SA 2BRRL 5D1QD 3O6LL 1VFAA 3OGOE 4R7NB 1INEH 2AK4B 3H1ZA 5D7KE 5EFIA 3ZOAA 4N2EA 1R4XA 1WIOA 2E74C 4OZIB 2H32B 4PJDF 1W0VB 4HKZA 1EGJA 2VQTA 2DKSA 2F54E 3DMMB 4ZJ9A 2MNUA 4HLZH 4YWGL 5ERWB 2TRHA 1G7JB 3DI3B 3M7FB 3NZ8A 2FECI 4HIEB 3VXUA 3X12A 2XN9A 5ICZB 4Y7MA 4UDTB 1OT1A 2NY7H 1A6WH 2Z0UA 1DFXA 2WLKA 2V2TB 3FFCB 3CD4A 3Q8FA 2F1AA 5FF6B 3HUJE 3QJUB 3FQ2A 3QQ4A 4MS6A 2DYPA 4X5WB 4Y5XA 1ZLSL 2HJFA 4KY1H 4M3JA 5HHOB 3GBMH 1F6LL 1PKQE 3O4LE 4ZDHB 3NCXA 1N6UA 2PYEA 1HWHB 4WWNA 5ELIA 4P5MA 5SX4I 1H6FA 2NW2A 4IGBC 5IEHA 4NUQA 1AO7E 3S4SB 2XWXA 4XCEB 4QRSB 4C59B 5IB1A 1KMGA 4NFCA 4U1KA 3LS4H 2K0RA 4OCNC 3U79A 4JFEE 3FB7B 4XI5D 5DD1H 2VYRE 5DLML 5ICYB 2A0LC 1FLTX 3ZE1B 1KC5L 4DOHE 5JA8B 5FX3A 3A6CL 2J5LC 4P49A 3MJ8A 3RWEB 3W0WA 1J8RA 4DPRA 1KZYA 1J9RA 2CHXA 4IKKA 4X50A 2BSSB 5F88A 3GI8H 4KKNA 1F8TL 2VMJA 3ARFB 4XWGL 5DFTA 5J6GB 1NKRA 2FWLB 3WU1A 3HE7B 1ONQA 5IGXL 3RWJA 2UY7A 3NZSA 2QTVA 1MCJA 1E65A 4LU5H 3FO2A 3VX1A 4D0DA 5IT2L 1RAMA 4OV5B 2FQGA 3V6FA 3R18A 2CJTA 4QOKB 1XGUB 3FYIB 3L7EB 3P9LB 1T0MB 2R2BB 2BP3A 2SODB 3REVA 4KI5C 5EU4B 4GAYB 3ENEA 4K7FB 5GS3A 5GS1C 4KZDL 4M61B 1XX9C 5C08E 4B6ZA 5J5EA 3GNML 4BBWA 1FE8H 3FUMA 3AT8A 3SOBL 3V7MA 2DQCH 4QHLA 1SMDA 5E99H 4HPOH 4X4XB 3WKPA 4H26A 4GLRI 1KEML 5I8CA 1KBGH 4G80A 3BVDB 3EYVB 3Q8AA 3MNMA 1I1YA 1KNOA 3LZRA 4DESA 4M56A 3WIHA 4EIGB 4JM4H 1XSJA 4MJ2A 3CZFA 3FBKA 4FOMA 4IRJD 1BXVA 4ENEC 4N25A 1P4LA 3QUYC 1T6VN 3BSZH 3WXVH 2AEQH 5SX5K 4C4KT 1MF2L 3FQTB 3DO7A 1MUJB 1P53A 4WNJA 4G5ZH 1DQIA 4WW2C 4UM9A 3UC0H 2XZQL 3RAJH 1JZHA 4OIAA 3PYCA 3RBSA 1K3ZA 3RZCC 3BISA 3B7UX 1X4YA 3NJVA 5FYKU 5GISH 5AWNH 5B39B 4RGOL 1KY7A 3DPBA 2WTPA 3OZKA 5CJQL 4MMZC 5IESL 3VRLE 1HIML 2Q76A 5A43C 1DBJL 3FZUD 4RRPA 4TNFA 3QQ3A 4FLQA 1H3WM 3DO3A 4OGZA 2SEBA 4X8JB 1RZJC 1T5KA 3GMNA 1KGCD 1NFKA 3BAXA 2FEDC 3GXUB 3I6KB 5C92A 2BSBA 4OAWB 4L4TB 1X5HA 2BVTA 4PRHA 4AQ8A 4ZNEA 4U6YA 1CUOA 3N1MC 2KQMA 4F7CA 4V2CB 1GPOL 3MLUH 3LEVL 5FB8A 1VGKB 2IMMA 3QEQE 2EVFA 1ROWA 4BUHA 2X12A 2KPWA 3DTDA 4N8CL 1BZ9A 5LHDA 4L8CA 2DW5A 2NCEA 2ZSVB 3DI2B 4RX4A 3H9ZA 3BGMB 3OMAB 1HT6A 4FQXA 3STZB 4ZXBA 3VRIA 1TJIL 2J55A 3AWFA 5DD0H 3BRFA 1BZDA 3L9BA 4GEJA 4NP4H 4YSTA 5C70A 5GXBB 1KFGA 4HCRA 3L4XA 4HGKC 4FKKA 1KELH 4J3OF 2MNWA 4JY6B 5SX4H 4TF4A 4MBRA 4EIBA 1T89C 1A7BA 5J9PB 3CMGA 3RQ3A 4G9FD 3FB6A 1S78D 3RX8A 1Q9KB 1DEDA 2G5RA 4MXVE 3KVQA 4UYPA 5T1LB 3GZKA 1X3DA 5IB3A 1GGIH 5HGAB 3F58H 5E1GA 4KMTH 3WFDL 2IC2A 3GD1C 1IE4A 4I18B 4PRPB 3X3GH 2X89A 1NKGA 2ATAA 1KJ2H 1U92B 5JR1L 4G7SB 3TA3C 2GBTA 4A7QA 4ZFFB 1JFQH 2CKBH 3Q48A 3QO0B 1NCAH 2IALA 3IXTB 5DC9B 4JW3A 3VRJA 1WZ1L 3NJLA 3ZKSD 4GG8B 5CJXA 1E30A 3VD7A 4FXGB 4AL8C 3HJ0A 5IJVA 3HUJF 4P23C 2AVFA 4OZIA 4R0LB 1BX2B 1SLUA 2J6EL 4AZ8B 4R96B 1TQWA 4A2DA 4G6FB 5D96B 3HTLX 3DMMA 1R47A 1SBSH 1OAKH 3QCTL 5I71C 4R4ND 4ZX3A 5EDSA 1BW8A 5B1JC 3ARED 1YCSA 3SKJL 4HAGA 4PREA 3O9WD 3K2MC 3BDYL 4UDTA 3MBWB 1ZXQA 5IHZB 3ZDXB 3GYRA 2V2TA 1G7PB 2VC2B 3FFCA 3LN5B 2R15A 3WSQH 2WXIA 2WXNA 2J56A 4GLRH 3QI9B 2VB5A 5F6IC 3ZHKA 3WAJA 1T7ZA 1JCKA 3MCYA 4F92B 1IBGH 1DYZA 4PP2B 5T1KB 1IGIH 5F7LB 1HH6B 5I0DA 5L8JB 3CSGA 2NDGA 4EZLA 3ETBF 1QRNB 5BV7B 5C9JA 2E7LC 3S4SA 4XCEA 5FHBH 1B88A 5F7HA 1SOSA 1I8KB 3QB7C 4NM8H 2E27L 2WB1A 2XYBA 3B2VH 1CFBA 4ZUTB 3I50L 4HS6A 5D7JD 4WU5B 1R34A 1WWWX 3T0ED 5E0FA 4WSGA 4S11A 3IB4A 4XN2A 1FL3B 4FFYL 3RLSA 4X5LA 3RWEA 4HDIB 4K5LA 3WIIL 1N9PA 2DQFA 1J0HA 3OAUL 1ZLWK 2OV0A 3DROA 2A4CA 4FNSA 4MXQD 1EAPA 5IQLA 3KAAA 5EDXA 5F89A 3N85L 3HE7A 3M6DA 3MV8B 1HHJB 5ACMA 2OYPA 2X6BA 4LOUD 4Y2DB 1PLAA 4BFKA 4XBEL 1HNFA 1HKFA 1BG9A 3MA9H 4BFEA 1NGPL 3DVGB 5DHMC 3C60A 1YRKA 2CDEB 4OZGF 2Z7YA 4KNUA 2OMXB 2VDOL 3CWGA 3FN9A 3L7EA 3L13A 1T0MA 1VGEL 2R2BA 3P9LA 4O5LL 5DZJA 4BRJA 4GB9A 4GBXC 5EU4A 1BVOA 3OC8A 4K7FA 3HMXA 3K74B 3NFPB 4M61A 3TBSB 4Y1AB 3ZHFA 1QEXA 2EE0A 1Y1DA 2VN6A 2VDNH 5E4EC 5C0AD 3VFOB 4J3XA 2R0ZL 2DWEB 1GA2A 1A2YA 4X4XA 3OKNB 1ZTXH 3I2CL 3QCVL 4NXKA 2H2SD 4BFNA 4ODSL 3VWKA 1MKFA 2GY7B 1N18A 4JANB 4W9EC 1OCWL 3VFRA 3EGSB 5E8DL 2EDDA 3EZJB 3MOQA 1PF3A 2CQVA 1CDGA 3DV4B 2FX7L 3WUWG 3X14B 1GYVA 3CVHH 3GS4A 5GRVK 3FCSB 2QGBA 3VRLF 2BWDA 3HAEG 2QVMA 2XBTA 4PTTB 4TRPL 4NN6B 4BQBA 1MUJA 3WTYA 1BIHA 1U8IB 3KJ6L 1AZBA 2VLJB 3BZ5A 3L3JB 1HEZB 1EJFA 3BPCB 3K6NA 3W2DL 4GO8A 2MH4A 4EXKA 2L7UA 2VKWA 2VSMB 4YK4C 4JE4B 3MRDB 4LCIH 2EH8H 1ZWIB 4LSPL 3RA7L 4TNVF 4E9RA 2R4RL 1JDAA 1M71B 2J88H 3Q1SH 3OPUA 3EO0B 4OJDH 4I48B 1MVYA 3DVIA 3HHSA 1NCWL 3I6KA 4U7MA 5JPMB 5CZXC 1HKLL 2GW5A 2MCPH 1WBZA 4Z3EA 2W8CA 3FN0L 2D9QB 3UZQA 2NMSA 5MEQB 1XH1A 3CFMA 4ZFOB 2W9DL 4FJZA 3QAZB 2ZX7A 1VGKA 4HGWB 1A7QL 2Z65C 3UTSD 3DETC 1JMXA 5D72H 2XVKA 3F01A 4E9LA 3STZA 4FCAA 2ISDA 3H53A 2WQRA 1OAUL 4MB1A 4WFFE 4D7BA 2BNQB 4PD4K 4JR9L 3PJNA 1JGUL 5JW3L 2ZCLL 3O11B 3L3DA 4IDJL 2G2PA 4PI0A 4FI8A 1YEDB 1S3RA 4JJ5A 2OZ4L 4XZUA 2NY2B 1TQBC 3T1FB 5FCUH 1UD2A 1Q9KA 3H7LA 1MJ8L 4Y16C 4Y9BA 1RPKA 2JXMB 2VXTH 3QEGH 2EDWA 3N6YA 1NMAL 3NCBB 4P4RB 2WBWB 4A2EA 2HLAA 5JZ7D 1LK3L 4QHMB 3L5IA 3OR7B 4Q6IB 5K1NA 3NCMA 2E76C 5K5YA 4GRLB 2X0WA 3S35L 5GS0L 4WNQB 1KCVL 1U92A 4Z7QB 1CXEA 2ORBL 1KB5A 3MJ6A 4N2DA 3B1UA 1E40A 1J88A 3ECWA 1P4IH 3V4VL 1PEWA 2HUEA 4PCKA 5IOPB 3CZNA 4J2QA 3SBWA 3PL6D 5J57B 2KLTA 3IXTA 1UJTA 2OSLB 3IJEB 5D7LB 3E9UA 3IFNL 5T1MB 4ZAKD 4AMKL 4GG8A 4JPWL 4ILDA 4KK5D 2W07A 3A4AA 3H85A 3VXUE 5T3ZE 4GXUN 4JG0L 3DGCR 4AZ8A 4K3DH 3LSOB 3AB0C 5FGBA 1MCEA 1I8MA 2HJKA 1ZEAL 4M4RB 1JGLL 1A0QH 3MODL 3LH2L 3P3TA 4I1NB 5LCVA 1DE4B 1JNLL 3DRQB 5JOPE 3T0AA 5IHZA 2FSEA 4W93A 5CEYB 1MFMA 1BOYA 3D69A 4PJDB 4EBQL 2PYEE 4FQQB 1MFNA 1DQML 4MASA 4BHUI 1B4RA 1DVFC 3KPMB 3MRQB 4ERSL 4WTXA 5K69A 4B60A 1FO0L 1E9PB 3KLAA 2IAMD 2NR6C 3KWTA 3HLAA 3O4OB 2G5BB 4PP2A 1EZSA 4HA1A 5T1KA 2NY1D 2X0UA 5DVPA 3O2DL 1LO0H 3CSFA 3LRLA 3T09A 3FO0H 3KPQB 2Z92B 3GZQA 3O0RL 4YEEA 4HJ0D 5EZIH 1I8KA 5DA0B 3W0WE 3M8OH 43C9B 3DXAB 4XBPB 2PO6B 3EH4B 5L4FA 3EHBC 2WQ8A 2BERA 4XNYH 4MFHA 3Q6GL 4NNPH 1EVUA 1YEWA 2X70B 1A5FL 3JBG7 4TM9A 4BFFA 3ISRA 5E08L 5F6HJ 3LRGA 4CDHA 1M57B 4KKCD 5DUJA 1BBDH 1FFOB 2EICA 3UBFA 2A9NL 2WHVA 3MV9D 2F7OA 2ODHA 1L7TL 1IC5H 2OJ1A 2HMIC 4N8VG 3DX1A 2EJ1A 5TQ0H 1UA3A 1H3GA 3H9HB 1HHJA 1KJ3H 4Y2DA 1IKFH 3FO1A 4HU8A 2V9RA 4DP0X 1OB1B 4L0YA 2MCMA 4W9HC 4UDUA 1OTSD 1W6WA 1LL1A 3SKMB 4LCVA 1CFSB 3MOBL 1IQWH 3MOAL 1ZJAA 4OGQC 3TBSA 1KPUB 5CLYA 4XBGA 1JAEA 3MLXL 3I75A 3C6EA 1JK9B 4M62H 4Z76B 5DMYA 4KH2A 4R3SB 4UT6H 3OKYA 1JHLL 4X98A 2EO7A 1G5AA 4OZFA 2ZCHL 4WWOA 4YHKL 2D8KA 1E5BA 1LO3L 1S3KH 4K8RD 4TQEL 5IJCC 1J1OH 3FU8A 4PRIB 4PJ7E 4OLVH 3X14A 2Y7OA 3AG4B 2FQFA 3AACA 4RGNB 4D9RD 3FCSA 1WT5C 1MCKA 4GQZA 1L9OA 5I1LB 3BLKA 4DHLA 1D2PA 4ISVB 3QUML 4EN3A 3F3HA 4P9HH 4XX1G 2EILB 2BOCA 3LEYH 2EDOA 3L3JA 1PD6A 5EEXA 3BPCA 2X4PA 3DX6B 4M1GH 5I73B 5IB4B 4Z5RB 1J0JA 1X5MA 2Z8WC 4F7PB 3PPSA 2J1XA 3MRDA 4UT7H 3QYNA 4PRHE 3IDMB 5KTEH 1QFWI 2NCMA 2DI9A 2WTOA 3CHRA 5IKCB 2WNWA 1C9SA 3BD4A 3EO0A 5JHMA 2CHWA 2AQ1A 2FB4L 1CXFA 3B2DC 3BUYB 1M3IA 1R24B 4P99A 2A9BA 3EF4A 4OJYA 4TPRL 1F41A 4I77L 2FQEA 1BQSA 1Q0YL 2OMYB 4ZFOA 5JQ6H 2A3TA 1ETA1 3GXDA 2M26A 3QPXL 4MBOA 2H41A 3TTSA 4CC4C 3QEUB 2D7TL 4U1LB 3PGCA 4OZHA 3KJ4C 4HF5L 1ZE3H 3WYRA 4FL4C 3SPIA 3ZYIA 3BUPA 2Q9OA 3S37X 2BNQA 2OTWB 4GH7B 1GZHA 1COBA 3O11A 3DUHA 3LIZA 4P46D 4F2EA 5LG1A 3EXJA 3O6FA 4Z7VA 2E9JA 2WBJA 1A3LH 4EI0A 2ZJSH 2XQYA 1AY1L 3JWDC 4YHZL 2CKBB 2JXMA 2BCKB 1E7UA 2PF6A 1XCXA 2GSGB 2F58L 2HFEB 2RB8A 4FYTA 1NL0L 1KBKA 2ESVD 4ODHL 1U8NA 4Q6IA 3KBHE 4QHMA 3KPSA 2O5YH 4TOYL 1BWWA 2FATH 1K85A 5I66B 4WNQA 3MLRL 4F7EB 4BZ1L 3FSWA 4ZMXA 1YN6B 1HZHL 1UOVA 3MLYH 4HD5A 3MRHA 1LEIB 4GY4A 4X5PA 5E1IA 4K71B 5HYJB 3W9DB 3FT3A 5IOPA 2YPLB 3MXVL 3BAIA 1CT8B 5A1AA 1MCOL 5A3IC 4LRNL 5D7LA 1NSNL 2CJUH 2PCPA 2AQRA 3T6VA 5D55A 4YUEL 4BWUA 3QQNA 4LIQH 1WVZA 1BMGA 3MJ9L 4KROB 3QYCA 3BT2H 3F04A 4MA7L 3FU7B 1RH8A 3GBEA 3D3VD 3LSOA 4WLCA 4CC0A 1FBIH 3D6GA 5HHPB 3FFCE 3U0WL 4OFKA 1VKXB 1FAIL 4UTBH 5LNEA 1T0PB 1KY6A 2VR7A 3NJMA 4E36A 4RAUA 5AYTA 5IFHH 3OMZA 5F6HI 1X5XA 1DE4A 5D7SL 2V5MA 3ATBA 2Z8RA 4XMVA 2AV1A 2Z35B 5CEYA 4NUJA 1ET7A 4JKNA 2VMDA 4GSXA 1ZGLA 4WI7A 1RUQL 1KCRL 4X9GA 1SM3H 3KPMA 3LRHA 3E8UL 4AIXA 5I1HL 3AWEA 1YNTA 3PJLA 1P1ZB 4DW2H 4YIQB 5CN2A 2XPZA 3CFUA 2QDVA 2QKIC 4K7PX 3N43B 5DJ0A 4HCGA 1MQKH 3ZE1E 1T1XA 2X4NB 1VZIA 1IBZA 4XMTA 4Y4KC 4UV4H 1TF4A 43C9A 1G4RA 3HG1B 6PAZA 2WWMC 2FO4B 1BJMA 1XTMA 1NGQL 2PO6A 4XHJD 1GZQA 1NPJA 3DOSB 2HB0A 2I85A 4L8DB 1RZJL 5BS0B 1KXVA 1RURH 3WHE1 3CFBA 4ZUVB 1AIZA 1ZAGA 5IFJB 4M03A 1HOCA 4U1GB 5E2UL 1YNKH 3VFNB 1BM7A 4HJJH 4LKXA 4H0LC 1PY9A 4KVPA 1B3JA 1MRDH 1JZEA 2WQSA 2OR9L 3OF6A 5AZ2L 4L8SC 1A6TB 4PLNC 3C9NB 2NNFA 1A6ZA 2FL5B 5B38A 4YNYA 2Z4QB 4MA8H 4MDIB 1CXHA 2X4OA 3BRDA 4V1DB 2VR6A 5ESAB 4NAMA 4HP5A 1OB1A 4KX8A 5C0ND 4HT1H 4N0YH 1ET8A 2DICA 4PJ9B 3SKMA 1CFSA 4PJ7F 3LQZA 1AZVA 2IH1B 5BRZD 2Q8BL 1J8SA 1U9KA 1Z3RA 3CVHB 1WITA 2AEWA 2VWEC 5H4YA 3BSZA 1EUTA 4R3SA 4OZGB 2Y9RT 4PLOB 4CSZA 5CCGE 4A1RA 5IIEB 1XZWA 3CJJA 3G08A 5G4OA 1NFIB 4FNUA 1NFDF 5TE6L 1IAMA 4PRIA 5KANG 4P3DA 5DZAA 2XKNA 4X2UA 1NGXB 2YAEA 1NMCB 4GXFA 3IMRA 3BEWA 2R83A 1RUAL 1TTFA 4OUUA 2RJMA 5CGBA 1NJ9B 1VESA 2JCCF 1CK0H 3U30C 3UJJL 1LD9B 2H0FA 4AEFA 1CLYL 1IT9H 4PY7A 1UKSA 5E5LA 4HIIB 2Z31D 3U7WL 4ZOAA 2AMUA 3SGEH 1X9QA 2QHRL 4WGWB 4Y0GA 4TLKA 3S2AA 2YAPA 1XGQB 1XGRA 1J5DA 1QI3A 4N6RA 5DRNA 5IKCA 4P2RB 3GSXB 4G3YH 3U2SB 1SJHA 3R7QA 2P5WD 3VWJC 3ZQWA 1SYSA 1BVLA 3HZYB 2HXAA 3PP4L 3BUYA 3RWFA 4ZMYA 1R24A 1YECH 1FVEB 1E2WA 1JK8B 3NOIA 5E8NB 3SGKA 4P06A 5I19L 1F45A 1MCLA 1Q9LB 1CGSL 3I85A 3ULVH 2VUKA 1GMIA 2OMYA 1BYOA 1NANI 2O4EA 2Z8VC 1EJOL 2DTSA 4GS7C 4IM8A 1A7PL 4KMQA 4XNZB 4PJEF 3GMLB 5JTWA 4R4FL 4UNIA 2JTYA 3CQQA 3P3YA 3D4GA 4J1UB 3ESPA 3JTTB 4YHML 1FNAA 1NGZB 3WNNA 1TEFA 2WGNB 5EV7A 4N2LA 1CD0A 4XXWC 4C58B 4HWEH 2Q87A 1IC0A 1SOKA 2OTWA 2IANB 2HPOA 3QIWB 3Q3GB 3BESR 3NCFB 3HRZB 1NC4D 1KJ2A 3LVTA 1MJUL 4EE2A 1L9TA 3VGDA 1NAKH 4O9HH 2DQDH 3UZVA 3QUKB 1MJ7L 5DQJA 2CNYA 4WV1A 1WO2A 4U3XA 5E2WL 2BCKA 1JI2A 1X5JA 3RHWF 4C4KO 2DRUA 5ECGA 5EPMB 3EDDA 2NT1A 4MZIA 2DIEA 5GGTL 3NGBC 2IBZX 3AAZB 3WE6A 4CUCA 1YDPA 1HL5A 3TN0C 4CDGC 4F7EA 1T2XA 3U46A 3B1TA 3TH2T 3ULUH 2EDJA 1LEIA 5FECB 3MV7D 3W9DA 2WZPA 2YPLA 3UH8A 5AW2B 2F18A 1G1YA 5E8EB 4PB0H 2GT9A 2WKOF 3L3HB 3REWA 2VXVH 3GXPA 5K9OB 3PPEA 3KCPB 4OM0L 1N0LA 2YAMA 3HZ3A 2AJUH 3IDGB 4H0HB 3LMJH 5E9AA 2Y3AA 3QJSB 5BQDA 1F4YH 3HC0A 2CGZA 4JUTA 5HHPA 3BZDA 1X9LA 4UWQB 4L2YA 2AJ3A 4ENED 3IJSB 1IFRA 3QUYD 1UWGH 2EO1A 3D48R 2IOOA 2BNRB 4IMLB 4JO1L 1JPGA 3KPRB 3QAQA 4FG2A 5JIQA 4YXHH 2HJLB 4FJYA 3GJEA 3I02A 1IJ9A 5AD0A 1XDTT 2Z35A 3KG5A 2WXRA 3AVEA 2VDQH 5HD8D 3Q7JA 3VFTB 1AYOA 2DLEA 2LV4A 3NIDE 3W56A 2VN3A 5E2JA 2AITA 3QJFB 4DZ8B 3WJMB 3U4BH 1XMWA 2YD9A 4KVCH 4U6HA 4FDWA 3UG3A 1FIGH 1PFOA 4O02H 1BFVH 1JMZA 2CO4A 4C56A 2XZAL 4GAGL 1WAAA 2X2JA 4P5TC 1RUKL 3ARRA 2NXYB 1A7NL 2C9AA 5KSBA 3QG6A 4OQTL 4L29B 3AADB 4Q74A 1A1OB 1I31A 3N5AA 1KCSH 4UQAA 3WIFB 4PJIB 4D0CB 1YMMB 3SGJA 2FO4A 1QHPA 3UDWC 1A8ZA 2PWEA 3EAKA 4JFSA 3KGTA 3EDKA 4L8DA 1OSZB 4FI7A 4K5MA 3K80A 1FRGH 2ZX6A 4HZ1A 4LLYB 5EO9A 5IFJA 1XIWB 2H0PA 4GI9A 1G9MC 2DLHA 4P4KB 5I9QC 2ZP9A 3PXJA 4D9LH 1DQLH 1JJUA 2VE6A 3OB0K 3GXIA 5T5FH 3GLAA 2DQGH 1BFOA 3MLTA 1EAJA 5E4OA 5GSVB 3C9NA 3LRSB 2D4FA 4JFDB 3BWSA 5LVEA 5EU6A 5EU5B 5ABZA 3AUVA 2N4IA 5ESAA 1S7SA 1WDAA 1NANH 4O2FB 2YUWA 5DHYB 1U8PB 4M1CC 3PHQB 1A3RH 4PJ9A 1VFMA 2WXGA 1Q0EA 1EHLH 3VG0L 2X1WL 5MHSD 1KWGA 3S3BB 1I3RB 4I0KA 2RH0A 4DN4H 3CVHA 4Y19E 3AG3B 3HPJB 4BCXA 2YEQA 4M7ZB 2WYIA 3H8NA 1L7IH 5JIKA 3BUDA 4HS8H 1WA0X 4LSUH 2WZ0A 4QGTA 4TKWA 4TUKH 1KN2L 4NQXB 4ZFQA 1NFIA 3QORD 2VJ0A 1BPLB 3ZR5A 2OTUA 2A77L 4P23D 5CGMA 1NGXA 2AGJL 3P11H 3RB5A 1N4XL 1CGUA 1CS6A 1DJSA 1M7DB 2IPTH 4MRCA 2XNAA 2X6CA 2DH2A 4ZS7L 2VDMH 5AW4B 5B8CB 3EJSA 1NJ9A 2WIIB 3VH8A 3IPFA 2EDTA 1LD9A 5F96L 3TF7C 4FQLH 2AQ2A 3BUQA 2UXFA 4JO8A 3VTTA 5EOQH 5LBGA 3H3KA 1RKRA 4K2UL 4LT7A 4HBCL 2GKIA 3H56A 4PS7A 3CC5A 3OHXB 1MHCA 3ECUA 4GI8A 1I7ZB 4PJ8A 3ISYA 3IBEA 4L4VD 1GAFL 1XGQA 4GMTL 1BOGA 2BIPA 2EYTA 1XEDA 2F61A 4G6MH 3GI9H 3UGUA 4P2RA 2L3BA 3PWJB 1TTRA 3U2SA 1V3LA 1RIUH 3BFQG 1QBMH 3LY6A 3QVAA 2I60L 1FL6B 3RTQB 2JLLA 5DR5L 1FVEA 5H94A 4OZHE 3VTAA 1E4WL 4N0FB 4AIZB 4FLHA 2J1WA 1ZMYA 5GRWA 2BNQE 4YSUA 3KYAA 1L5GB 4FKHA 1D5XB 3TT3H 2GTQA 5DMKA 3WNKA 4CBPA 4LAQL 3JTTA 4Z7VE 1NGZA 4XWOC 3DHPA 4JFQB 3TZVD 3PWNB 3RDTC 2E47A 5DZPA 2IANA 3QIWA 2AK4D 4R7XA 3HRZA 4IRZH 3KPSE 4KK6C 4LSSH 4X5RA 4E9XA 4HUVB 5BO0D 4WJ5B 3BQUB 1KDIA 3H55A 3A5VA 2MIZA 5AOLA 1HSBB 3QUKA 4MQSB 3NJNA 4P2QB 5C2UB 3ASOB 3S96B 3ARWA 5EPMA 4KOCA 1C16B 4JGNA 3DIFB 2E4TA 3AAZA 4JX0A 2G0KA 5D7LE 2OM5A 2BVQB 1LMIA 5F1NB 3B9KB 3SN6N 1F4HA 4QJ5B 2ITDA 4NM4H 2VDLH 3KPLB 5FECA 4AXWA 3ZYOA 4MJIA 3SDXF 3G9VA 5HHOD 3FUJA 1IGML 4MQTB 1C7TA 3L3HA 3HZMB 2HUHA 1AACA 5CN3A 3KCPA 4MDJB 3FTGA 4ZOBA 3NIDF 4PRDB 1H0DB 1V05A 5M7QA 4RZCA 2X05A 2WLJA 2E3VA 5KVFL 2FGWL 1OQOA 5KBKA 1Q72L 2DQHL 1JZ6A 3KPRA 5CSGA 5D8JH 1EDHA 2YN3A 2HJLA 5GGRA 4UANA 1AR1B 1DLHB 3CVIL 1D2OA 1I4FA 3KR3H 1UM6H 2OMVB 1CZ8H 1KT2B 1BP3B 2G30A 1XGTA 1GW6A 1ZDSA 3VFTA 4G71B 3OL2A 1WQVT 3VW3L 1MWAH 5E4AA 4NUMA 4PGZA 4NI6A 1KJMA 3V8OA 2XWJA 1ADQH 3MNDA 2VH5H 1FNGB 3IMWA 4IBUA 1OZTG 4YPGA 1UT1A 3U1QA 4OSUH 5EIQA 5CEZL 3L5XH 3EDEA 5IWLC 3EH2A 1IGCH 4JZOA 4QOKD 5F3BB 5DC0A 1CLCA 3EH5B 4DP8X 1H5BB 4XP4H 3B2MA 1EEQA 1GIGH 4B27A 2O6FA 3UTOA 4G6KH 2BSTB 4D0CA 2OK0H 4PJIA 1M9WA 3C6LB 5GRVL 4F8QA 4OVVA 4KQ3H 4YBQD 4QCIB 4ZO8A 1E28A 3HNVL 3SKNB 1CDBA 3DETD 4PVNA 4KJPC 4L5FL 1LMKA 4YDJA 3RL1B 3RVXD 1TLMA 1G1OA 3DSFH 3HAEH 4HETA 4TNEA 4P4KA 3MLVL 4BFRA 1P5UC 4OGXH 5ENWA 3BUBA 4POYA 1ITBB 1QP1A 1MREH 3FUNA 3FUDA 2ICEB 3P3UA 1CBJA 4OIIL 3O3EB 4A38A 2QBWA 2JELH 4UT6A 5DJCA 4PRBB 3P4OB 1OLLA 1PAZA 3FMGL 1WFIA 2DM2A 2FJFA 3JWOC 4O2FA 1E8YA 1U8PA 25C8L 2AXGA 1D3CA 3PHQA 3MROA 4GKZB 3FKUS 4U49A 4Y2NA 1R17A 5TH2B 2D7OA 4E68A 1J48A 3JWDL 3ARDB 4RGNE 3L3GA 3DVFA 3R4RA 1MW0A 1UH4A 4KQ4H 3L3IB 2XPYA 5ALBL 2A7BA 3STLA 3V0DA 3QULA 4P2YA 3WY3A 1B4JL 3RNQB 1AHWC 2CIIB 3PWPD 4JN2B 4GRWH 1TPXB 1GY2A 2AXFB 5T33H 4DP6X 4L4TD 2V5YA 4AZUA 5I1AB 1A14H 2X3BA 4N2AA 4Y9EA 5IQ7L 4A7GA 5F9WC 4X42A 4A68A 1Q1JL 3P0GB 1M2OA 3F6IA 3KL5A 2WIIA 5E1HB 1NFDB 3QARA 1DVUA 4TSAH 4IRSC 1X7TA 4X99A 2ZOUA 2HX7A 3SPCA 4S1SL 4JRXB 4WWKC 5JHBA 1DVFD 4XHQA 5GZOC 3ARZA 3CDGA 3EYOB 4M6OL 3WGVB 4W6XB 2NR6D 1WEJL 1BIIA 4NKDA 1R5IB 4BHUA 2FZ3B 3P77B 3BE1L 4QF1B 5GPRA 1D5MB 4ATTA 2V37A 5T1LD 3ZK0A 4CBZA 4QXUL 4JDVA 3D85D 4BQ9A 2OMBA 1ZSHA 4N0FA 5K9QG 4ONOA 1LWJA 2E56A 2MTAA 1LDPL 2K4AA 1S7TB 4MCNA 3WN5B 3RL2B 3MRLB 1Z9MA 1FORL 4X6CB 4X4YA 3QDGB 1PFCA 1DJXA 2XQBL 5DUPH 2NZIA 4Z1PA 4NC2B 1EO5A 1SVZA 5CF3A 4JFQA 5MENA 5DVMA 2CR3A 3PWNA 2CKNA 1BM3H 1UGNA 3DTXA 3KBPA 1G6RH 2LW3A 3BX7C 3FSVA 5FV1L 5DHDA 1J1PH 8FABA 3X17A 5CFAA 4B0MB 3F84A 1BVNP 4IU3B 5CKGA 5IVXA 2HWZL 3MGOB 3BW9B 4HUVA 3BQUA 3ZE0E 2K9FB 3DX3A 2E7HA 1HSBA 1MRFH 1K8IA 1JSYA 1XH0A 2ZWSA 1Z9SB 4OGAD 4P2QA 1LNUB 4TULL 4Y5YC 1BZEA 1LP9B 2Y6SC 3PG2A 1SRDA 1IC4L 2ITCB 1R0AH 4AGQA 2PN5A 3L3OB 1XHHA 4BZYA 1H8LA 5ICXB 2XWCA 1TLKA 4LLQA 1XSKA 5JW4N 5FYKE 3JV0A 5FWRA 4UTAL 1EHXA 2BVQA 4MD5A 5F1NA 3B9KA 3T5WA 3V5HB 4S1RH 3QI9D 4UTBA 1NAML 1J8KA 4H8UA 3RVUC 1BAFH 1RU9H 4D0BA 2OAAA 3EJZC 3DLQR 2WUBL 4GXUM 3HZMA 4MCZA 1PYWA 2WWKO 3TNMB 1QRND 2H8PA 4FP8H 4KDTC 1TZGL 1CTMA 1XAKA 3Q8CA 5DTFB 1WZAA 3MRCB 3TEXA 3EO9L 2OCFD 1EFXD 1ETZB 3ZKMD 1A6VL 3VAEA 1MSPA 2OMUA 4FCHA 2X1XR 3WY2A 3RTLA 1YPZB 4O02B 5FKAA 3V0VB 3QFJD 4XNUL 4C56E 1I7TA 2DLIA 1TQCB 5DS8B 1WAAE 3EUUA 1SF3A 1B4LA 2XLLA 3CU1A 3FNKA 3AM8C 5KSBE 2XX0A 5TE7H 1FNGA 3NA9H 3MV8D 5LXGH 3NSCA 5B3JE 3WFBL 2GAZA 1J0ZA 2R1YB 1VEPA 2QZ5A 1NCBL 5F3HB 3TCLA 5I0ZA 4KZCA 5GZND 3PRZA 5AW6B 2F19L 1H5BA 2YEZA 1PW3A 4PJBF 3ZTNL 2BSTA 3LD8C 2ADJB 2Q8AH 3RP1A 3UYOD 1KGIA 4Y1AD 3GJFK 4BEIA 1PNDA 4WUUB 1ACXA 1HHGB 4QCIA 2MHAA 3R0NA 3BPOC 1DBMH 2XTJE 1M7XA 3T3PE 3O3BB 2QSQA 2C3VB 2AANA 5EU6E 5D2LE 2TRYA 3FAXA 2JKNA 4G59C 4CVXB 1ZTXE 4GFTB 1NA8A 4HV8B 2CRZA 4Y5XC 1Z3GL 4PJ5D 4Q56A 2DLGA 3L4TA 1LVEA 3P4NB 4NQSA 4W68A 4JNXA 5I1GH 1CGTA 2ICEA 4PUBH 5FYJU 4J7RA 3SDAB 4E41A 2AXJA 3BP4B 1T2JA 3G6JA 2NY6C 4FHBD 4QXTB 4UUJA 2X38A 2ZKWA 3FAWA 1DZ0A 4X9IA 3V5KA 4UQCA 5JHDD 4C57C 1IGYA 4JHVA 2AXHA 1OP9A 4G7VH 2VLJD 1WHPA 4UV7H 1F86A 4EDWL 2DDQH 1P84J 3G5XB 3F64A 4S0TD 4DEWA 5TH2A 1KIQB 2X41A 1IGJB 5C7XH 1MPAL 3BP6A 3MRNB 4KJYB 5IJBC 3KWWA 5D1ZI 4PCYA 1TU2B 5IW3A 3L3IA 5CZVH 3Q44A 3OLDA 2EH7L 3P40A 5EHFA 2DLTA 2H5UA 3DGDA 5CSBA 1UENA 2CIIA 1XBRA 1U6AL 1B0WA 1UVQB 1RUPH 2AXFA 5DLLA 4OD3L 2EDYA 4AM0Q 4KJQC 5GRJL 2MQ3A 4YXKL 1W8OA 1I1AA 1JPTL 3L1FA 1C5DB 3OZ9L 4J23A 4O51B 3R0MA 2BY1A 5AW0B 1IVTA 5DZVA 4IK6A 4JY4B 1T1ZA 4QHUB 2NY3B 4YO0B 4YC2C 4L1LA 4LK4A 5IBLD 3QIUC 3WTVA 4WFEE 5EIIA 2ARJQ 4NX0A 3PV7A 3DX8B 4UIKL 2A38A 4HFUH 1FH2A 2NZ9D 3VD5A 2B59A 2A1WH 5L7XL 4JRXA 3CFCH 4H8WC 1UB5B 1CU4H 4AJVA 4PGBB 1WC7B 2IDFA 1SVBA 3T2QA 2NY2D 5MEPA 1TJGH 3I6LD 3O0LA 4GAFB 4W9JC 5EO1A 2JKSA 4G43B 4IBVA 1GXEA 5GQBA 3V0AC 2FZ3A 4LCCA 4QF1A 4CMMB 1D5MA 1N6QL 4JCWA 1AI1L 3SYOA 5BRPA 2GTZB 2G3ZA 2ZUVA 2YQ2A 2V6HA 1ZLUH 1OVZA 1P7BA 4Y4FA 1MEXL 2Z64C 1I1RA 2NZ1A 3MACH 4ZQTA 4JLRB 1I9IL 1OGAB 4HW6A 1HNYA 4KKAC 1BEXA 1U3JA 1W16A 2WWMD 3FULA 3GM0A 3MRLA 4U0QB 2IBGA 4X6CA 3GHEH 3TBYB 1JI1A 1YNLL 3GSWA 2IDQA 1GGBH 1MNUH 4JKPL 4RWYL 2DKUA 3MR9B 1N2RB 1FFPA 3EYSL 1OP3H 3HZKA 3SD5A 3UMTA 4DERA 1X6LA 1Z5YD 1BQLL 1JZ3A 1EUUA 3KLHC 3AY2A 5KVDH 5D1XA 1QLFA 2V5SA 3RURA 3L48A 4RMUA 1T1YA 3SY0A 2NT0A 1DBKL 4F2MB 1RZIB 3NBNA 1FSKB 5IMOA 1LNUA 3MLZH 3LKQA 2APFA 1LP9A 3LN4B 4LVHB 2V4LA 4MCMA 4OCSL 1G9ML 1IILE 1U3HD 3CUPB 2VCOA 4FEMA 4MJIE 1WWCA 3ZY7A 4JL2A 4OR1A 1MFUA 4NCDA 5ICXA 4AQ8C 1ANUA 1AJ7L 1PZAA 3V5HA 2JK5A 4HIQA 2Y36L 3F7VB 3T65B 1ORSB 3MJGX 4JGMA 2P8MB 2CK0H 2HLEB 3BXNB 5IEKB 1F56A 3Q43A 2BXYA 4FQXC 3ERXA 4IS6A 4FQCH 2OCCB 2P7TA 2P46B 5AL8A 4UQBA 3SZ6A 1WTLA 1DLFL 1KIRB 5EC2B 3BAEL 3QZBA 3ZL1A 5TDNA 1HXMB 5DTFA 1ZD6A 5KSBF 3SDXB 1MWAB 1IE5A 4ZT1A 4Z23A 3CXDL 3DXAD 4DETA 3NCEB 2Z7UA 1ETZA 2N56A 4WO4C 5E8OB 4KO9A 3ME0B 1JRHI 2P45B 5BUGA 1YPZA 1DO5A 4O02A 2UWEF 3IMTA 4IW4C 1CD8A 2J25A 3N0PB 4BYHA 4N2IA 3SE3A 5AOIA 1A1MB 2B4CH 4PGCB 4X80H 4R2GC 4R9HA 3TT1L 3D33A 1PLGL 1EEUA 2XG4B 2ZXAA 1GR7A 4ES8A 1SLVA 4NQDA 1UYWL 2I69A 1YLBB 2CR6A 3EXLA 3KNBB 1ROCA 2Z4TA 2ZXCA 4U1IA 4CU6A 2JF1A 1P6WA 5D2LF 5F3HA 5CJXC 1NCDH 3B9VA 4KITB 3DHJA 5KVGH 1I7UB 1H3PH 3W11D 5HGDA 1QSZA 5IQ9B 1GGYA 2ZKMX 4HIXH 1L4IA 2ADJA 3DMMC 2BVEA 2RQEA 5GGVL 5T5FA 1OTUD 4QYOA 1IZJA 1QLRB 2OCJA 1HHGA 3Q13A 5BOJA 3IAQA 3QIBB 3CIAA 1MG2C 5F7NC 5GJTH 1P4BH 1RZKH 3GUTB 1MCRA 1PY0A 3KXFB 1QHQA 4PVMA 2CM5A 3UP1A 3U6XA 3P4NA 5DD3H 4MD0B 2YQ3A 4OJAA 3SDAA 3QPKA 2PPCA 3BWAB 4QXTA 4MNQB 1R3LB 3HE6D 1A7RH 3RX5A 4FZEL 3NJGA 2X42A 2AJYL 1JZIA 5F0LB 2P28B 3CVDA 3G5ZA 3K7UA 2R0KL 2W9EH 3IFOB 1JGEB 4NCC2 3G5XA 3A21A 3QPQC 4GRWB 4MAYB 1KIQA 4WI4A 4AYFB 1GHFL 4KVNL 1IGJA 4MDRA 1T5XB 3DRTB 5C9KA 1BEYL 2CRYA 1OL0A 3C5JA 4QHNB 1SHWA 4E9WA 1TU2A 4F24A 1CDIA 2JJSA 4WI5A 5JHLL 2VABB 3V0JA 1JVOA 1U91B 1NLBL 2CGRL 2WPGA 5DURD 1U8LB 4LLWB 5IF0B 3Q5TA 3CFJA 3EOBB 3JVFC 4UT9A 4O51A 1DANT 3KYKH 5F1IA 3FQXA 3SDYH 1AYRA 4YO0A 2O5ZH 3RRQA 1S9XB 2JB5H 2DQJH 4HG4J 3C60C 5ABDE 2AI0H 4JFPA 3WGUB 2Y07L 3PDDA 4DWHA 1XZ0B 1JE6A 1D5BA 1WICA 5ADPH 5JIIA 1YHPA 2WO4A 4N1CA 3VTMA 3VSQA 3BRGC 3CDFA 1UB5A 5AW7B 4HVBA 5J06A 4PGBA 2IH9A 1WC7A 2YAQA 4Q6YA 3RPBA 1I7RB 3GMPB 3PGFL 4G8IB 2QPSA 5EEVA 2Q5BA 5FUZH 1WFUA 5I82A 4KRPD 2BZCA 2PWGA 2UZIL 4NZRH 4CMMA 4L3CB 3A24A 1FC1A 4AE0A 3VWKC 5F7EH 1JXGA 3KDMB 2A6DB 3BAWA 5ACLA 4ZUSB 3PIQB 1IAIM 1JRHH 1UZGA 5MENE 4J3OD 5FA4B 4W4NA 4IRZA 4F7TB 2MPAH 1PGRB 4U1NB 4ZFGH 1W72L 1N5YL 5M95B 3ARGB 3TBYA 4HLJA 5HYJD 5IVXE 4L3EE 4XPHH 4MS8D 4CMHB 4GUCA 4Z95L 3RIKA 1ZANH 4BGDA 5KBNC 1N2RA 5IHHA 4QXGL 4P2QE 1OAXL 2CDFB 2F54D 4KROD 3TJHD 3QWNA 5KOMC 3WY1A 3U6RB 1NOLA 4F2MA 4XP9H 2ZICA 4DK3A 4HHAB 1J7VR 4JDZB 3X1FA 3QDJD 5IB5B 2ZG3A 4GXVL 1B0GB 3FRPG 3PHAA 3LN4A 3B34A 4P5RA 4P2OC 1RK1A 3UTTB 4K0OA 4NJ9H 5J0BA 3UPRB 2DS4A 4M1CD 1BYNA 2A6IB 3AXHA 4TLSA 3KLQA 2XQYK 1VEMA 1VERA 1UXSA 1KCUL 2DQ6A 3RBGA 2P8MA 3JWOL 5ILTH 3BXNA 4NAQA 5IEKA 1FL5B 4GIPD 2OLDA 3AXIA 3OBAA 1QLEH 4PJCA 1HCZA 2OL3H 4J4PA 5AEAA 5EC2A 1GCFA 4I1RA 1Y6NR 5EF3A 4JFED 5CP7B 1MWAA 4LGSB 2G3MA 3FUEA 3HG1D 1LYQA 1KTDB 1ADQA 2FYYA 3GIVB 3N91A 2FT7A 3QXDA 3VXRD 1W2KT 3BN9C 3UTZB 5BS0D 2P43B 2LLLA 4X5XA 3UBHA 4JO3L 1HI6B 4XNXH 1KACB 3M1OA 1U95A 2RCSL 2RQ8A 4ZTPL 4EI5D 1JPST 2ALWA 4R5XA 2H3KA 1I1FB 2CO3A 4KMLB 5DO2C 4YHPB 1CO1A 3P30L 3RIAK 5L4IA 4JM0A 2CO6B 3KNBA 3SBWC 3LB6D 1S6NA 4OCMC 3VXMD 4V1DD 1BJ1J 3WUWA 5EU3A 4TSCL 4IK7A 5C0FB 3QNFA 5IR1A 3V0WL 4BSVA 2F53B 2ADFL 4CJ1A 3HAEA 1YEEL 1U8MA 2CO7A 4KU1A 5IQ9A 3TO4B 1ASQA 1JHTB 1RSYA 1NIAA 3DOIA 3NSDA 4Q0XH 4WGVB 3HB3B 1FGVL 1C5CH 1S7UB 4MLSA 3HS8A 4R83A 1CICC 3QIBA 3T0XA 3OJ2C 2RACA 3UPCA 4BK5A 3RUGA 4E41E 4PJBB 3G6JE 3GUTA 3OLGA 4OH2A 3FU5A 4DKFL 5E8PB 1GYWA 5FYLH 3CSBA 1S5HB 4JFXA 1YYLL 3EIFA 3TS8A 3ARVA 1ZDQA 1K4CB 1FJ1A 4X6BB 4DSYA 3E1F1 2XI9A 3RI5K 1OPGH 1BGXL 5CR8A 4M8QB 2OJEB 5TDOB 1OB0A 2O5XL 3IFOA 2FEJA 4Z0XB 4UAHA 5FC9A 1UXWB 4MAYA 2CLRB 3EFFA 4AYFA 4WFGE 3IDYB 2H6UA 3PQYE 1U58A 2WJ5A 3HNSL 1T5XA 3DRTA 2A5UA 4NBZB 4KX7A 3VFVA 3OQ3B 1QFPA 2XV6B 4N86A 2YGPA 3ARBA 3SGDH 2R4SL 2IH8A 3BZEB 1Q4NX 2VABA 1U91A 4QI3A 5J1AA 2VLKB 2D73A 3EJYD 4QRPE 4AKPA 1KENL 1U8LA 4LLWA 4QKXB 5T3XD 2V7NA 4LF3A 1MFEH 2Z1PA 4KKQA 3U48A 3EOBA 4QRRE 1SXBA 2Z7ZA 2XCMC 4HUNB 1I3VA 4QIRA 3QJVB 3MX0B 4Y2DC 4JRXE 4YHOL 4N5EC 2CMRL 3MCLL 1KTBA 3LXBA 1EO8L 3ATAA 4NRYB 2YD6A 3TPUB 4NWUH 3CBRA 1H9DA 1I53A 1JWMA 2WZ5A 4PS4L 4FFZH 4LLMA 2IV8A 4CGTA 2VUOA 3B3IB 4DTGH 4IOFC 3ZE2F 1WWBX 1B2YA 2F8OA 3GMPA 1MFAH 1EBAA 3QXUA 4AGLA 3TFBA 4G8IA 4H0IA 4KAQL 3PCYA 2BLFA 4I3RH 1MCPL 3X2QB 1E8WA 3FU0A 2Y24A 5IVNA 4K23H 1E9OB 2BRQA 4L3CA 4PIRF 1RD6A 4JRWA 5DRWB 4GMSH 1SLWA 2JSFA 4X6CE 2EVIA 5FHAL 4POZC 3POHA 3GS0A 1G6RA 3WG7B 4NPYB 4XP1H 1FQ9C 1O6VA 3PIQA 1PSKL 5I8EB 5SWQA 4ZUSA 2YN5A 3ABLB 1X5KA 3JYCA 4FZ8H 1MAJA 2MOQA 3KE0A 4LCWE 2GSMB 5JIDA 4NN6C 5D1XE 2AW2A 3O3DB 4EN3C 3S37H 3QJHB 5DHVA 1CFNB 2EE2A 4Y5VB 3ULUE 1CURA 2BCMA 1LO2H 1MCDA 4TTGA 1WBYB 1GS7A 1QFUH 4L9LB 4K9EC 4AENB 2C4FU 4PAZA 3RWIA 4KV5E 1EGJL 1LP9E 5C0BB 3BPLC 4IIQB 6FABL 3W5MA 1E4HA 2F5BL 3JT2A 2BPBA 4EOWH 5JW4Q 5HVHC 4YDIL 5T3ZL 1IEAA 1ZLDA 4JDZA 1QASA 4NRZB 5IB5A 4W9KC 1B0GA 4PLKC 2BNRD 4GUPA 5EULV 5BMFL 3LZOA 4TV3A 1SMAA 1P1VA 2B1AH 3UTTA 3OG6B 1RZ7L 3UPRA 3QZPA 1TKWB 3VGFA 5JW5A 4L2LA 2DQUH 1X5AA 2A6IA 2O5NA 2AXWA 2KUTA 3ILQC 4N2HA 1THAA 3FB8A 4G7RB 2P8PA 2R7EA 4LMQE 3WL9B 2D03L 3HEIB 4E5XG 1WJ3A 4PLJC 2FWOA 1TR7A 1GVIA 2J73A 3NZHH 4R97B 3IF1A 1KOAA 5HPMB 5AZEL 2OJZH 4RRPG 4NBXB 3VMPA 1GZHC 4Z7OE 4GUQA 1YPZE 5IK3B 2NXYD 3SJVA 4RH4A 2I5YL 3MU3A 5D1ZB 3O6FC 2RFXB 3KWVA 2P4AB 3VQMA 5T1JA 2WBJC 5D5MA 2XVBA 4H8VA 5HHNA 1YMMD 4PMFA 3BSGA 5HDQL 1KTDA 3GIVA 1TSHA 2JLPA 3D0VB 1KULA 4NNXA 1AD9B 4M6MH 4NQDE 3UTZA 3IJHB 4Q6IC 2JJTA 3VNYA 4HJTA 1CD1A 3IFPB 1REIA 1T7XA 3NP4A 4CSSA 1XIWD 2HVBA 4IRSD 2Q7YB 2OSWA 2WC7A 4M6NH 1NCIA 3IMBA 1DN0A 3TBVA 4ZX5A 4UDUB 4KNTA 5HJDA 1Z32X 1NCGA 1RIHL 4YHPA 5GZOD 2VDPH 2UWEB 3UYRH 4JFDD 5L6YH 4K7PH 2CO6A 3NJFA 2EIBA 1FH5H 3LN9A 3ULSA 4FTVB 2HCZX 3BKJL 3RVTD 2GK0A 4FQJH 5F7UA 1QUNB 3CLEH 4MA3A 5KOVC 5TGBA 2GBAA 5FGCB 2V3DA 1RZGB 4OLYH 4H8WL 3S3SA 2Q6WA 4B5EA 3HZVB 4JY5L 1UM5H 4JFHE 4U0RB 2R0WL 4ZYKB 2AERT 1LQSR 4ODUB 1GW0A 1RUML 3PFUA 1S7UA 3BKMH 4MNGB 2FIRT 3H42L 2ZXWB 4AKOA 1V7ML 2DMKA 2Y22A 2O6CA 3BGAA 4G8GA 3L17A 3WIHL 4IHBA 1AGBA 1AH1A 4XMWA 4AYID 2FQDA 1I9RH 4RGMC 3GKWL 4RMSA 5DYOA 5E8PA 4JJHA 1R19A 3BEVA 4FTDA 3VB9A 1S5HA 3B9EA 2ZF8A 2YZ1A 3J27A 3LRMA 5E1QA 5J8OA 1CG9B 2PR4H 4NENB 3QUZB 1KCBA 5L0QC 5EORH 2CD0A 4XNQA 5I1CL 4QAMB 1GJIA 4M8QA 4PPTA 3NYKA 4Z0BH 1QUPA 3WHXB 3ELQA 5DRZB 5GIRA 4AQ1A 1UACL 2PO6C 3BDBA 5IG7B 1B2WL 1G94A 4L8BB 2HA1A 5MP6H 1AXTL 5TE4L 2VQ4A 1KFAL 2JCWA 5D7HA 4UOZA 1KXVC 2R1XB 1TVBB 5E6IB 5DJ2B 3PABB 4TL4A 3BZEA 2ICWJ 3IDIA 4BQ8A 2V7HA 5C0RH 4H20L 1JERA 2CE6A 4JHWH 3WFHA 4JREB 3O8XB 3FH5A 2X4UB 3J07A 4LPYA 4XWGH 4BWTA 5EEYA 4PWIA 4OD1L 3S4SG 1JWUB 3D0AA 5JIHA 3D34A 2XXFA 3UADA 5AW1B 4AC2A 5I1JL 8PAZA 1UJ3B 3L7FA 3C08H 1W0YT 2CLZB 3OKKB 4GSQA 1QA9B 4RFNC 2Y4SA 4GYBA 5E2VL 1MCNA 2WBXA 1HDMA 3GK8H 4HCRL 1T20A 4ZMLA 2WK2A 5IJDC 1PZSA 5DJDB 3B3IA 3MUJA 4ELMF 2X4SB 1BJ1H 5HDOA 1OT4A 2OP4H 3GNMH 4DQOH 2BW4A 1P7QB 1KGXA 4FXKB 4U2ZA 4FQHA 4XMUA 4IBTA 4DP1X 1N26A 2P80D 1BXAA 1E9OA 2CBQA 4UB0L 4ZPTB 4YHLH 3HFMH 3O3UN 4K5PA 4UBDD 2EIZB 4U3SB 2WCSA 2LVCA 5J13B 4NPYA 1G7QB 4GT0A 4JM2F 5CIPH 2B1HL 2KS0A 4RGNC 4YBLC 4OCRH 3KYNB 4HOXA 1QNIA 4XO3A 5CD5D 4LHQB 2ZOLB 4HJGB 3VE0A 2NY5H 4NZTL 3TOPA 4AYSA 3WD5H 2YJLA 2COQA 2WN3A 3MRBA 2QR0A 3O3DA 1IRAY 2YC1A 3GM8A 1A6UH 4MJHA 4Y5VA 5I8OH 2XFGB 1MH5A 5T3ZD 3PAVA 4L9LA 4KRMB 2DIBA 4AEIH 5C0BA 3UXFA 4RGOH 3KYMB 3QZWB 4LE8A 2HT2D 1X44A 5AVTB 2Q3AA 5IESH 1KB3A 2DYPD 1YEIL 5CBEA 1AAJA 1OGSA 2WSPA 3PP3K 1A21A 4NO5A 4NRZA 2RAMA 4OLUL 5E95B 5HDBE 1HHKB 4O2EA 4ZO9A 2A83B 2VSKB 4HIPA 1ZS8B 2HYMA 4N2BA 3WS6A 1YMHB 5HHQB 2WB7A 4FA7B 2IQ9L 4Z7OF 1QLEB 4CA4A 3QUHA 3SGKC 4WW1B 4PJCE 5AW8B 2YMOA 2CPUA 4XMPL 4L1HA 1OW0A 2F8XC 3C5SA 5B39G 3HI6H 4M5YH 4QAWA 5JXEC 5MEOA 1UWEL 5KVEH 3I6GA 1PLCA 5L2KD 3MQIA 1CE6A 4MLIA 15C8H 2W65B 4AW4A 4BIKA 5F7DB 4FJ6A 5L8KB 2CJSA 3ARPA 5D1ZA 4ZMZA 4BK4A 2RFXA 2FCBA 1MI5B 3T04D 4KJQD 5JIMA 2DQTL 3C6LD 4IJTA 3D0VA 5EOCJ 4WV1C 4PGDB 3TPKA 1AD9A 1TIUA 1IGTB 3VYOA 1FN4B 1RPUA 2VDKL 3QIUD 4R90H 4F8OA 2BMKB 5FO9B 3CDZA 4A2HA 1UWFA 2Q7YA 4W1TA 1VA9A 3S3DB 5A2FA 2FH6A 4X8CA 5EUKB 4ZUWB 1PDKB 4I0PD 1AKJD 1UFUA 1FZKB 4NJAL 5K1JA 1F2QA 5D1QB 2AEOA 3SQBB 3FTWA 1QUNA 2C9RA 2NDFA 5LGJA 3FU3A 3HMXL 4DGIL 5I23A 2J6EH 3HZVA 4BFJA 5BVPH 2P3YA 1KBWA 4D8PB 1ZSDA 3RUGE 4DVBA 3C2SA 4ZYKA 4H88H 1JWSA 5KG9A 1S7RB 2RA1A 2C9SA 1G9NC 3SKJH 4NC1E 1KYOK 4MNGA 3UTPE 3ARDD 3OSKA 4J8RB 2E8ZA 3ZLQC 3ECQA 3WFCH 2HFTA 1I9EA 3BOVA 5AOZA 1O5DT 3RY6C 5IW1A 3F05A 3N1PC 4KPHH 1MXGA 2DWTA 5AVRB 3M7OA 3JV6B 2IIJA 5CUSL 3P73B 3KM1A 1Q38A 3VYPA 2QPUA 1V27A 2G3NA 1YAZA 4AYEC 4LEEA 1HOEA 2Y3NA 2I7OA 4GRWE 3MBXH 1INQA 4KHXH 2WXPA 4JFFD 3LH9A 4NENA 5HDLA 4ABQA 4DKEH 4XPBL 2KMWA 2HN7B 3VA6A 1DQTA 1T21B 3BKCH 3QWRA 4XRCB 5EBWA 3IYLW 4M7JH 5DRZA 2IPKB 1TVHB 2JQMA 1R3KB 3SGJC 1KTKE 3EJRA 2VZSA 3HI1B 5AVUB 1J5HA 3CMOL 4MJ5B 3TWCL 5IB2A 2C3HA 4XVOA 1EMTL 1OARL 1A4AA 2VITB 2J57A 2DKMA 4G7YL 2ZYHA 1TVBA 4HKJA 4MQXC 4F8PA 1JTPA 2X53A 3THML 4LEOB 3NP3A 5DC2A 1HX0A 3PNWB 1QQDA 2VXSH 1UOWA 1BZQK 3LKPB 2K7QA 4CC1A 5DSCA 3N85H 1JWUA 3ZMNA 2XTJC 3LS5H 1E5UI 3T2NH 1UJ3A 2RHEA 4FFVC 4WO4D 3ZDYB 3OKKA 1QA9A 1YEHL 1AMYA 4YSQA 4O5LH 3VFSB 3C2AH 1KB9J 2H1XA 2RTTA 4IJ3B 1S7QB 1RIVH 3EYQC 5DJDA 2X4SA 4RRPM 1SNRA 4CRPA 1JVKA 4FXKA 1SJXA 3U4EA 5DJ6A 4PIBA 1RQ5A 2HKHH 5TD4A 2O6DA 43CAA 4L0PB 3P0YH 1PQZA 3QO1A 2EEFA 2E9IA 4IRJB 4U3SA 3ZE2B 3B8SA 1KB5L 1YY8B 1SGKA 3HBGA 3QC5X 5I6PA 1NMCC 4XCFH 4DAGL 2NUTA 2ZOLA 1QO3B 3LKNB 3Q05A 4K8RH 5HYSB 4QD2E 2GSIA 3R06B 3DVNB 4NERA 3PREA 4XNDA 1CL7L 4LVEA 3GTNA 12E8L 1F58L 1BVKA 3R7RA 3J7HA 4G7QB 4XC3H 3FS9A 5LDSA 4YDKH 5BOPA 1S5IL 1UA6L 2X6VA 1O6TA 5LCVL 4K94H 2OQJB 4PJ8C 1XD1A 2EDRA 1WFJA 2QT6A 1T2QH 3ZMEA 4DO4A 4AVKA 1IM3B 4ODVH 4M93B 1NC2B 2VC2L 1W6LA 3QZOA 1QYGH 1ZS8A 2A74B 4I3SL 3UJTL 3V4UL 3ZIMA 3VVVA 1YMHA 1XGPB 5I1KL 2YLHA 5EC1B 2OL3A 4YSCA 1T3FB 1YA5A 5JO5A 1XVSA 1T03H 4KX9A 2G9HB 4LVNC 1ITCA 4UU9A 4WHTA 3L4YA 2UY6B 3SJVE 3VFUB 5IROC 5MI0C 2Y0SA 3AG1B 3P9MB 3ZT6A 2IDSA 5SWSB 4HHWA 5D5ME 5A2AA 3QXAB 2XN1A 1INDL 3S48A 4HPYL 7FABL 1JPSH 4LLAA 2HVJA 4DK5A 4M29A 1JXJA 4JR9H 5AG9A 3FN3A 5DEJA 3JYBA 2ZCLH 4ICXA 5F7FA 4DPCX 4ZW5A 1TETL 2C7FA 2N3JA 5F7DA 3HRZC 1KGJA 5DZ9A 1UT2A 1JOIA 3BAKA 1MI5A 2FEEL 3BCFA 3U9PL 3OLIA 4PW9A 2CHZA 2YMXH 4GPVA 3MPCA 3MV11 5GRUH 2IFFH 2LT9A 4U1SB 2AJSH 3LHAA 3MAWA 4WUUD 4F7KA 3VFMB 2XVLA 3V4PB 5G4MA 2ZOTA 5JUEL 4NQTA 4OIFA 1J5OL 1PG7X 4GKLA 4OF3A 4ORGA 4JO4H 2YPKA 1Y18B 3UBXB 5EUKA 2CWRA 4X7TA 2EECA 5H4ZA 1XMEB 1FZKA 4IOSD 4AE1A 1HHHB 4PWKA 5D1QA 4BXSV 3FW6A 2XIIA 3FU6A 1BYPA 2PYFB 2C34A 1S7XB 4FE9A 1BQHB 3GLDA 4JG0H 5AL0A 3CFNA 4G8GE 1MCWW 3TTYA 3MFGB 1ZHNA 3IU4L 3AREB 3QUXC 1KLUB 1MIEH 3O9WB 1JGLH 1S7RA 2J8UA 1E43A 4YDVB 1AE6H 1AS6A 2DWDB 2EXYC 4YQXH 1R9FA 2WVVA 1NPNA 3FCBA 3VXQA 4DNLA 4HLZG 1S46A 4MVBC 1OSYA 1MCIA 2AZUA 4LSRL 1TZIB 2B0SH 4ERSH 1S7WB 4XN4A 2GJJA 5TQ2L 2BSRA 3D08A 4PU2A 1BAWA 3JV6A 4GNKB 2OYLA 2ZUYA 1M9SA 3TIEB 3W81A 4KK8C 4X6EB 3A6BH 3BO8A 2K4WA 4ABVA 2X0VA 4OF5A 3QDMB 1QSEB 3STBA 4FABL 1DUZB 5I1EL 4GFXA 4GAJH 5I16A 3FCTB 1JGIA 3KHQA 4K9EL 5A2BA 4KXDA 2HFGH 2HN7A 3IGLA 3ZKXB 4OKVA 5D7JB 4P2OD 4XRCA 2P24B 2EUWA 1I8UA 4Z78B 4UQ3B 4XVTH 1R3KA 3KMDA 3P2DA 3FSOA 2XA3A 3WJLA 4MJ5A 1QI4A 5INCA 5KSUB 4ODWA 2PPAA 4DFHA 3FT0A 2W88A 4O58L 5CBAA 4ONGL 3G5VA 5CHNB 4A7TA 4DPBX 3PNWA 5I18L 4P4KC 4X9YA 1QSFD 5EOCH 4ZFOL 4FFZA 1TOXA 3MRIA 3ZL2A 3O81A 1AGCB 2KT6A 5KS9A 4QNPE 3C5XA 5G5DB 2F2HA 3EYUL 3OKEB 4PV9A 2BSDA 1NTDA 5JNYB 3NFSH 5DMIH 1OGAD 4S1DC 3VGHA 3ARQA 4H8HA 4QTIL 1F97A 2C9PA 4JHUA 2HP4A 4NT6B 1CXIA 2ZOOA 3VFSA 5FO8B 2E6PA 1FHGA 3LIZL 4AM0B 4LEXH 2EYRB 4MQ7B 3LEXA 3S7GA 4ZZKA 4FYQA 3G6AA 3QFDA 2M83A 1N10A 2F8VA 1BQ5A 3COOA 3DDFA 3MLXH 5CIPB 4H40A 1AD0B 3VMNA 4NO0D 4LL1A 2ARJB 5FYJE 1KGUA 5DO2D 4BSJA 4Z6AT 1RI8A 3IN0A 5KWYC 5FM8A 1INEL 3OAZH 3CSYB 4M48H 3VO0A 2ZUUA 1MELA 1XF4A 4N8UA 2GC7C 1MHHB 2EEXA 2YBRA 1HXYB 1ZCRA 3DX4A 4B7IA 3P9WB 3V0IA 3VDAA 4KKZA 4ZMTA 1QO3A 3B9DA 4TQPA 3NIFE 5F9JA 3LKNA 1U4FA 1NMBH 2WCPA 4Y8DC 1C8PA 2Y72A 1VENA 4RNRB 2NY7L 1A6WL 1CYXA 4N22A 1CICD 4QO1B 1N8ZB 3FT1A 4JM2B 4YHNA 2HKFL 2YGVA 3IGAA 2ADIB 3WEAA 3FU9A 2AZAA 2V8LA 1VFBB 2BY3A 3GBML 5INDB 2OQJA 3L6FA 4TLTA 2BVUA 1K6QH 3APDA 4DP4X 2OI9B 1CFTA 5CEXA 1M1SA 2Y5EA 4APQD 4WEBH 1FHNA 2FB4H 2WLIB 1M1XB 4ZW8A 1OIOA 3HG0A 5EC1A 4KH9A 3H3PH 3LS4L 4XB8A 1T3FA 3TNNA 1Q0YH 4I13B 3UTSB 3ZDZB 1V3MA 3FYEB 2I07A 1CJYA 3CBJB 3QPXH 4Q58C 1SDDA 1ILUA 2ZOKB 5GJSH 5I5RA 5CD3B 4E0RB 4NGHH 4UMGA 1UUSA 3TU6A 1SEBB 1EERB 5I28A 2BVOB 3GI8L 3P4MA 2YRBA 2IPUG 1XF5B 4KI5F 5CCHE 4G9FA 5L88H 1DBBH 3G5YB 1WISA 4WJKB 2J8HA 2PABA 4LU5L 2DTML 1NDMB 5D93B 1R3IH 1UM4H 2X28A 4I8DA 5DT1H 4F91B 2F58H 4PWJA 1E27B 3VFMA 1A47A 1JL8A 2BO0A 3RJDA 3WEXB 1DDHB 1JG9A 5AOMA 4ZO6A 2XICA 1Y18A 2WP3O 3KXFD 3Q0HA 3MNWB 1FE8L 3B9KC 3H2WA 1JPEA 2DQCL 4LPXA 1ODUA 4G42A 4HPOL 4Y2OB 2O6PA 4O4YH 2NXZB 4FNPA 3LKSA 3BMWA 2W91A 1KBGL 4MNQD 3P02A 1AGEB 1MCHA 1MCCA 1TTBA 3MNZA 2WW8A 5LQBH 3M17B 2K8QA 4MNGE 3MJ9H 4JM4L 5IVZA 3K2UH 3IFLH 4C83A 1BPVA 3PWVA 3K8LA 4Y19D 1DVXA 3SO3B 4F7MA 3BSZL 3AREA 4NIKB 1G7HB 3WXVL 4J3OG 1NEZA 3O9WA 3ES6A 1BWMA 5FLUA 3LKOB 3TCTA 2HAZA 2EXWD 4FGMA 4GQRA 4JO5A 3UC0L 4G5ZL 3DJ9A 3NQKA 3RAJL 1AR1C 5LB1A 3AU1A 3UAJD 2WNGA 4EN3D 4PH8A 5EEZA 3ZW3A 4YSRA 5GISL 5AWNL 2IAMB 3GGWB 1TZIA 2N0MA 4OJFH 3BP5B 3E8UH 3ZMRA 5ADOH 1G5GA 3MRMA 5AYQA 4X6EA 3LH8A 3HR6A 4CGUB 3OJVC 2I9LB 4OLZH 3FCTA 3BVNA 1A9BA 3FFOA 5C3IA 4S10A 1T4KB 3DV6A 4LSDA 5D7JA 3IN2A 2H0EA 5AKTA 1H5BC 3T0EA 3WFZA 2FECL 1PZBA 4JS7A 4BUQA 4QNPF 4W81A 3UERA 3A47A 4Z78A 1KG0A 3MLUL 4YE4H 2TAAA 4BDVB 4HZAA 4I88A 2CA3A 4PSPA 5KSUA 3AY4A 2Z9TA 1RZJH 2HRGA 1LTXA 4FNRA 5CHNA 4YDLC 4OFVA 1MHEA 5E2UH 3CTTA 4BFBD 1X5ZA 2HVKB 2VDOB 3PGDB 1AQKH 2HKAA 3ESMA 4Z7NF 3NFNA 4FQ2H 1KELL 1AGCA 5CSZB 2V9TA 2R8SH 2ODIA 2BFVH 2PTTB 5G5DA 5C8JB 3Q8EA 2ICEC 4LSTH 4HWZA 5JNYA 1J5CA 1L0YA 3SE8H 4N2MA 3ARGD 1AXSA 1GGIL 1XCQB 4PY8I 5IV2B 4HQQL 1FG2B 1ZT4B 5FO8A 4LPTA 1UH2A 4PJFA 1KJ2L 2EYRA 4MQ7A 5C0AA 1EZLA 2ZUQB 5C0IA 3GZPA 5CIPA 3NH7H 2XSKA 3QZMA 5G4NA 1EZVY 4JG9A 1NCAL 4W4OA 5DA4A 5DI8B 1ZK9A 3I74A 1ED3B 4Q14A 5C0DA 2DMBA 4BKLB 3GTVA 2NW3A 3WEOA 2FVNA 3DC0A 1E4KC 5EZJB 1XH3A 2YUZA 4Z7WF 3VGAB 3BVVA 1MHHA 3TVMD 4ETQA 1Z9OA 2Q1EA 1ZHKB 1KEGH 3T0VA 2XTLA 1I1AC 5E9DA 3WLWC 1OAKL 1KGYE 3FONA 3J2PA 3BZFB 1HU8A 1MLBB 1IEBB 2DV6A 5A2KH 5ESVA 1W8NA 3TP4A 4AL8H 4NRXB 4QO1A 1N8ZA 3GLEA 3WSQL 1HE8A 1MQ8A 3IJ8A 4IBLT 3U2JA 4DUVA 4NKIH 3U7WH 2ZWKA 1E2ZA 1G9NL 1BFSA 4QJ4B 3N0AA 2KZKA 1IX2A 3SE4A 3PAZA 4AQAB 1IGIL 1ID5I 2H9GB 1FG9C 4LCCC 5CXPA 4TUJA 2FWUA 3L9YA 5FHBL 1EVTC 2XX1A 3QXVA 2ZUXA 4NM8L 3VH8G 1CIUA 4N2NA 5I19H 3B2VL 1OE2A 1CGSH 4ONHB 4Y4FC 3S34H 3UTSA 1Q94B 2GJZA 2OBGA 5KW9H 4LPVA 5A2IH 2G2RB 5EO0A 4MCYB 1AP2B 4R4FH 5HYIA 4L37A 4YHMH 2ZOKA 4E0RA 1MI5E 3CN2A 4H8QA 5FLVA 4PJ6A 5DZNA 2B3RA 2HT4C 2PCXA 4P46B 1SEBA 4G70B 3TC9A 4UINH 3C09B 2F53D 4ZW7A 5F97E 2GY5A 5D1XC 1LLAA 1MJUH 3D05A 4HAFA 3TO4D 1KPVB 3RILA 3ULUC 4DF9A 4WKZB 2ESVB 3MA9L 1NDMA 3HB3D 4H1LH 1FVDB 2X10A 3UTQB 4ANWA 5A16A 3TV3H 2H32H 4RFEB 3QWOA 2QGDA 4WUKH 2E6QA 5C2BH 1CFVH 1U8KA 1ZVNA 4XGZA 1E50A 4NHCH 1TMQA 2VR3A 2VDNL 5C86A 5DGRA 4C4BA 3PL6A 3NRQA 4WCYH 4L1BA 4LCYB 1NOAA 3WLBA 5K9KA 3K6SB 4Y2OA 1ZTXL 1NGYB 4NUGH 4ZAKA 1EXHA 3OWRA 3VSVA 2E5EA 2J8UE 4C47A 1HHIB 1U3NA 5HDRA 3SYQA 1AGEA 3APCA 1HYSC 3M17A 4OM0H 3IEAA 1CLOH 1CR9H 1I75A 2HTKD 2ZOWA 3CVHL 4OM1H 3V5DB 2W92A 4H44C 3OHMB 4XCNB 3MBEB 4JRLA 4GG6A 3FRUB 1DQQA 5I0XA 2F74A 5D4QA 2R2HA 1TEGA 3KGRA 1CC3A 4JO1H 4WI9A 1E9QB 1C5BH 3SB3A 3FOMB 4KJWC 4XMXA 1Q9WB 3TCXA 1UEMA 2ZWZA