4AM0Q

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
91
Chain Sequence
TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
molecule keywords FAB 2H12, HEAVY CHAIN
total genus 14
structure length 91
sequence length 94
chains with identical sequence R, S, T
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4am0Q00
3MUUA 5JHLA 3UZEC 3IRCA 4FG0A 3N42F 3J2PA 4L5FE 4X42A 1PJWA 2R69A 3N43F 4UT6A 5AAWC 1OK8A 1OANA 1SVBA 2H0PA 4BZ2A 4FFYA 3P54A 3C6EA 3N40F 3C5XA 4UTBA 2R29A 2GG1A 3G7TA 3UYPB 5AAMC 1ZTXE 2JSFA 4UTCA 2V33A 1S6NA 1UZGA 1URZA 4GT0A 3J27A 3UZQB 5KVDE 1Z3RA 3WE1A 2P5PA 1RERA 3N44F 4ALAC 4UTAA 5KVEE 3N41F 1TG8A 3UZVA 1OKEA 2HG0A 5KVFE 4BZ1A 1Z66A 2JV6A 5B1CA 5GZOA 2I69A 4FFZA 5JHMA 5IREA 3UAJA 4GSXA 5H37A 4UT9A 5LBSA 2JQMA 5LBVA 5IZ7A 3VTTA 5KVGE 4AL8C 4AM0Q 5LCVA 2ALAA 5GZNA
chains in the Genus database with same CATH superfamily
2PCYA 2PUQT 4NPKA 3LQZA 4CGTA 3X3GH 5I8OL 3MJ9H 3SE8L 4DP2X 5IIEA 4L05A 3QDJA 4JQVC 4QXUL 5C07A 2IO5A 3AB0C 2AQRA 4UTCA 4UTAL 2E7HA 1EDQA 2ED6A 2W9LA 1Q9OA 4G9DA 4FKHA 3RA7H 5CCGE 2NXZB 2UYLA 5K59E 1NGXB 3KH4A 2BNQB 5DGRA 4U1GB 4KRMB 2UV3A 4QNPF 1BZEA 2V2WA 1IC4H 3ZL2A 4BH7B 4ANKA 1CE1H 4NQCB 4H1LG 4L4VE 4HJSA 4GAAA 3C6LA 1XF1A 2B4CH 2HKFL 5ADOL 2I24N 1VEOA 2F1EA 3A67H 3GJFB 5JOFB 3FFOA 5DUBB 3PGFL 5AL8A 3B83A 4FHJA 4LSUL 3MGOB 1EJ6A 1OB1A 3G6AB 3S97C 4KVPA 1JPTL 4B9YA 2WYZA 4KI5C 3BW9A 3TM6A 4AGQA 3V4PA 4ZXBC 3ZUNC 2J73A 3Q48A 1MCDA 4J3OC 1BDYA 1I8KA 5G55A 5AVVB 5T5NF 4DHLA 4ORZC 1LXMA 4ZDHA 2GJ6E 1N68A 5DYFA 4YDKL 3FTSA 5TE7H 3TURA 1NIBA 1A64A 1OGSA 2EC8A 4F7KA 5ITBL 3FTYA 4NJ9H 1C5DB 1AO7B 4RMTA 5DQ9A 1IBHA 4YVUA 1KNOA 2WY3B 7PAZA 3ATDA 1FVDA 2BRRL 1X3DA 2ICES 3QDJE 1ORQA 4YE0A 5EO1A 2DQGH 3UAJA 4EKJA 1ZS2A 5KSAD 1CICB 5DJ6A 2HRGA 3VM7A 1GOFA 5L7XH 1QLRA 5HGDB 2WC7A 5I0VA 1R5WA 3GZOA 3K1DA 2VGLM 3IGFA 3K81A 1CIDA 4CC0A 5JPMC 5KZCD 5MP6L 1QLEL 4L8CB 3MJ7A 1C1EL 1E50A 3DHPA 1QR4A 2EVHA 2Z4TA 5D7KD 1E4KA 3IDJB 5GS2D 4I18C 4XBPB 2MPAL 5D7LE 1QI4A 2O30A 4QRPD 1VGEL 1B6UA 3GJFK 1H6EA 5AW2B 2WVVA 4HWBA 1KGWA 2KZKA 2WVTA 1C1EH 1TZ8A 4JHUA 4OIIH 1CGYA 1S9WA 2BVPB 4JFVA 1TVBA 4OQ1A 4XP5H 2XTJD 1QO3A 2QLYA 3MJGX 4WUUA 4QOKE 4QY8B 3RKDD 3WEBA 5E1IA 3IGLA 2YARA 4OZIF 3J27A 5B38A 2QHRH 4MNGE 3F00A 4OW6A 4Z0XA 2AXJA 2ZUWA 3Q2VA 2VDMB 1NBZA 3BSZL 2H26B 5GGVY 2HPOA 5DZAA 5CHNA 1G6RA 3UEZA 3VB9A 4GG6F 4U1HB 3TO4A 3O0LA 4K5NA 3VH8B 5LBSA 5ISZE 3WOVA 4JFZL 4PRHD 1FCCA 4R8WL 4LCYB 4OZFG 5E1AA 3S5LG 2H0JA 3WKMH 2K3TA 2DQDL 3ZXAC 4P2OD 4BINA 3OHMB 4L9LC 1MRDL 3MRPB 1YEDB 3A22A 1RY7B 1T6WA 4OGAD 1RJYA 1E90A 2JTYA 1YAIA 3LIZA 1KEMH 4MTMA 4M6NH 4JM0A 3BAWA 3HB3D 1WZKA 1T1XA 4WSGA 3A47A 1GKOA 2V7HA 5SWZD 2H6PA 3OAZH 3QAQA 4HIXL 5TK2A 2ZQKA 1NUNB 5I75C 3KJ4C 3O9WC 5JYMA 1RZ7L 4E5XG 1QPPA 1ET8A 3WEXB 3H53A 3K80A 2AJSH 1RL1A 4X6DE 2OULB 3TJEH 3MLVH 3ROLA 3D3VB 2E56A 2E9IA 3DX8B 2VDNH 2ATKA 2IAND 5CCHE 1UB6B 2APFA 1SJHA 4JN2A 3CSBA 5ILTL 4PRPA 3OLGA 4R5VA 4LPXA 5DVOA 3O3AA 1TZIB 4FQXC 5FV1L 4EQ3A 2E46A 2FJFA 3F01A 3CPUA 1AQMA 2Y1VA 4Q97A 4HDIB 1U8HB 2Q8AH 1AOZA 3OXSB 4N24A 5DCCA 3RYMA 5ADPL 2VCOA 1RZGA 3M7FB 5E1GA 3O9WA 4FKEA 2RFXA 3VFNB 1YEGL 2D2OA 4RFNC 4D9RE 1EBPA 1VKXA 4MJJA 2EIKB 1T83C 3HE6A 3EO1B 1IB5A 4HKZB 4MNGA 1ZHKB 1C08B 4ACTA 3QEQB 1YY8B 4MAUH 5DVPA 3ULUE 2A9NH 4OGQC 4R7NA 1O6SB 2A9ML 2FX7H 1YEGH 4HJGB 1TJGH 4KY2A 4U1KB 1OM9A 2FECI 4P2OC 1JIBA 1JHTA 1G7JB 4WFED 3GLAA 1XCXA 4KROB 4DKEH 1QHPA 2WTRA 1MHHB 4KQ3H 3T65B 3F7LA 2Z34A 3S35X 1RJZA 1WCBA 4H1LH 1G7MA 4O2FB 4O9HL 3UL4A 5FM4A 3NP3A 1MFAH 3UG3A 1BJ1J 4ZK8A 3QXDA 2CUAA 3OZ9L 3D2UD 2R2BB 3P73A 2VO5A 3GMOA 3Q8BA 1LDSA 3L5WB 4S10A 4R3SA 5IHLB 2DMKA 3SDXF 4V1DA 5HI3C 3ZDYE 1JZ7A 3ZL4L 2H1PL 3RBSA 4MQ7B 3F7RA 4TUKL 1LVEA 2X3CA 4GNKB 2QSCL 3BO8B 2B39A 1LEKA 2H6UA 5JW5B 3D8MA 4WI4A 1KIPA 1XMEB 3NSXA 1OT1A 1V54B 3NCEB 4U1JA 4Y4FC 4AW4A 3CFJA 3EFFB 1HZHL 1WBZB 4WTZG 4FFWD 4A39A 3LB6C 4LIQE 4X8GA 2R1XB 2XQYA 4J7RA 5EOCH 2XQBL 3WD5H 3IBEA 1LEIB 3PGDB 3D05A 2ALAA 3V5DA 4P49A 5DK2A 4JW3A 4XOAA 2NYYC 3INUL 2Y2TA 1J8KA 4G83A 4N0FA 3BPOB 4G8EA 5TJWK 1ZLVK 2DPKA 3OC5A 4QXGL 2X4RB 5TTRA 4ZG1A 4JZOB 4CNIA 1SYVA 1SZNA 1HNFA 1TQTA 1CXIA 1EEQA 3B2UC 1BZ9B 4R83A 4JDZA 3QORB 3B43A 4KZDL 3IDUA 3IPEA 1IFHH 3ARGD 2E6QA 4K07A 3TVMC 1BBDH 3BJ91 3CMOL 3QNXA 4AE1A 4UQ9A 1BMWA 4YHPA 1DBJH 3MDJA 3BVNA 1I4FB 4ZFQA 3FRUA 5D1XC 5FO7A 3VQ2C 5T33H 4JG1L 3VXUD 1XR8A 2J6EL 1DO5A 1IFHL 3OHXA 3QIWC 4PJHF 4GAYB 4AMKL 1NOFA 4BSVA 4QHKJ 2GC4C 3HHRB 3QQ9D 2JCCA 1KJMB 2YLKA 2LVEA 3GHBH 4LAQH 4D8PB 1IGIL 2X4UA 2YK1L 4TUJB 3DX6A 3M17B 1W9XA 3D25A 5DHVA 1DJXA 3JV6A 1MVYA 4GKSB 1PSKH 2EDOA 4GRWE 4GAGL 3FDWA 2XRAL 3PG2A 3VI3F 5I1HL 4X7SL 3EJJX 4NQXB 4WKZB 1MY7A 2HUHA 2H3NB 1DQJB 4HS6A 5EZPA 4UQ3A 3U1QA 3OHXC 3OX8A 4GIPD 2A73B 3MLXH 5IT2H 3G5XB 3WXVH 1YSOA 4FXGB 3GB7A 4N68A 3IKCB 4JPSA 4NN7C 2F68X 3D69A 5DD6B 1RURH 2EH7L 1X7QB 2YEQA 1JMXA 4DP0X 1X4XA 4LBEB 3WN5B 5LCVL 5BRZB 4UNTA 1IGMH 5H94A 2EIBA 4JRYA 3CIAA 5MI0B 2XU9A 1YNLH 4C58B 1HXMB 4O4YL 4Q6IA 2FNBA 4Q9RL 3LIUA 3V5KB 1GCFA 3K91A 2BIHA 4YR6B 4DJMA 4BGDA 5DMJB 1PQZA 1FFPB 1KXHA 2G5BA 1QSVA 4ZUTA 1FNGA 1N10A 3B9KC 4Z3GA 1PDKA 2C9AA 4DPCX 3AS1A 3CPLA 4GT7A 3S35L 3MI6A 2AK1H 3F12B 4O02H 4PI0A 2HFTA 5FF6A 4EI5D 2B16A 5C08E 3W11C 4R9HA 5KG9B 2IPUG 1HHJB 3PNRB 4GO8A 4IU3A 1PTZA 2EABA 3LN5B 5SWSA 1OOAA 2DYSB 3DX4A 2D9CA 3AACA 4OF6A 3E7JA 4Y19E 4PGCB 5IMKA 2JQAA 4KQ4H 1N8ZA 1KTBA 4XP6H 4NNXB 4HGMA 5SX5H 4PR5A 3WBDA 1GOGA 2M1KA 4AV4A 3VO0A 4YDLB 3S9DB 2P5EE 4MQXC 3RX7A 1D9KC 2Y5TB 1NBVH 2QFRA 3MRFA 4XTRC 5HI5C 4GSQA 4KUCF 5G4MA 1QVOA 1NFDE 3GF8A 3U7AA 2VYRE 3CFBB 3UAAA 1GHFH 1WA0X 4ZFZA 1NFIA 1W16A 4XP1H 5DRZA 1QFOA 4L8DB 3X14A 1NDGB 1RZIB 4PJGE 3HPJB 1ZS8B 4XCYB 5DS8A 4FRWA 3RL2A 3RVUD 4UM9D 3OKKB 1P4IH 4A37A 5AW3B 2RCSL 5L6YL 1I7UB 1NKRA 2X6UA 2MWCA 1D9KA 1SFHA 2GJRA 4DKFH 5TFSL 4U6XB 5EU4B 4D7BA 5IKCB 5E9DB 4PS3A 4HMEA 4OLZH 5CFAA 2FEJA 2HG5A 2V5YA 3ARDD 4NQVB 5FHBH 3VTAA 4B60A 4Z8FH 3I6GB 1P4IL 1BX2B 1URLA 3S3DB 4ZNCD 2PO6D 3GXMA 4IRJA 1KN4H 5GGUB 2G5UA 4YBLB 4CVZA 3U1SL 4DZBA 5B8CB 4XXCA 1UACH 3EJSA 2Z93A 2G2PA 2BO0A 2AV1B 2WO3B 4HCRA 4I9XA 4P99A 1MCOL 2YLHA 2VDOB 2PP9A 4GSXA 5T1LD 3RNKA 3T4AA 4Z8FL 2K70A 4QCIB 3D06A 3SGJA 5DRWB 2HN7A 4NAQA 4TNWK 1LEGB 3BP4B 5C70A 4MAYA 1JD7A 1FNFA 1I8LA 2YXVA 5I19H 4X4XB 4BYHA 1KCSL 2KPNA 1RHFA 5JW3H 1EGJA 4WW2F 5IB2B 4U0RB 4JO1L 5FV2A 3X12B 3UYPB 4B53A 3VWKB 3DMMA 3RVTD 3PYCA 3IXAB 4NQEB 2V0AA 3D3VD 3EHBD 1ITCA 2R8SL 3T8XB 2AV7B 1F00I 1KV3A 5DS1A 2X4TA 3PABA 5GS1C 3W2DL 4JO1H 3RUGB 2NX5D 3VX1A 4UINH 2AJXH 3S2AA 4JFEE 4PW4A 1AXTH 3MUY1 5DS2A 3MXWH 3LD8B 2EIEA 3LHAA 4Q56A 5IGXL 3A3YB 4ATTA 4U1SA 3MO1A 4UV7L 3TZVD 1QP1A 1HIMH 2ZOKA 2CH8A 1VZIA 3AAZB 4D0DA 5DD5H 2E8YA 4WVRA 3QFJA 2MCG1 3FN9A 3TNNA 1U3NA 3HRZA 5AAPA 1IKFH 5IVXE 3TEWA 2ZYIA 1FVEB 4YUEH 3GZKA 2KMWA 4BSWA 3WYRA 5CGYD 2PO6C 1HH9A 2RIKA 3L5IA 1OTUC 2V2XA 3BQUC 3HZYB 1BLIA 3B7YA 5IB4A 1KC5L 1T21A 3TBYA 2DYPD 5AWNH 4N2IA 1X9QA 2FSEB 5H8DA 2I32A 4Y2DD 3UP1A 2YC1B 4DWHA 2ODIA 3AU0A 3LSOA 3F62A 3B2UD 1A1NB 4N90E 3AMKA 5GGVH 5TDPB 3JV5A 4ONGH 5JHDB 1HQ4A 3O2DA 4B3VA 2P5ED 3MYZA 1CXEA 4IOSA 2JKNA 3OKEA 4ZYKA 2AK4E 2XWBB 1G87A 1WIOA 1B3IA 1H0DA 43CAA 3FU7A 3GPSA 4P0DA 5DJYA 3CSPA 4XHQA 4RWYL 2IG2L 2HH0L 2YQBA 1KPUB 2CPUA 2VR4A 1KPVB 1ZT7B 2YPVA 4MA1C 1U92B 4NC1C 5DA0B 3ZDYF 1BFSA 3SGJC 1TSRA 1MFDH 4L2LA 3ZE2B 4U7MA 4EXKA 3SBWC 2BDNL 3LH2L 4D3CH 3LKOB 1SYSA 2YOCA 2O26U 5K39B 4O02A 4LVHB 4RA3A 4TUUA 2RBLA 2IPTH 4XNXL 4KXZI 5CILL 2OTUA 2PTTB 2WXKA 4M8UA 4IRSA 1F4XL 1EDHA 1JI2A 2CO6A 1N3NB 3LVTA 4XNUH 4L1BA 5HI3D 2F58L 4LDLB 1NJ9A 5LAPA 5A6LA 4P4KC 1ASPA 1V7ML 4FXKA 1AZNA 3GSXB 5L9DL 5F7HA 2CKBL 5CLYA 3N44B 1XSKA 2Q76A 4LSVL 2OJZH 4PVLA 3RWHA 2XNAB 3BP7A 5H2BA 1IVTA 3L16A 3GTVA 4NRYA 1S78C 2ZKMX 2VLRE 2N01B 4IIQB 1TTBA 5EEWA 4GXVL 1ESOA 3HPLB 1QWUA 4OCXL 4OF5A 2WB7A 3CZUB 4Z76A 4NP4H 1DANU 3HI1B 4K94H 5F0LB 2YRLA 5CJQH 1NAML 1W8OA 3FQXB 1P6FA 1CC3A 4I5BA 5DEJA 1BQ5A 5T33L 4I77L 3GD1C 3QJUB 2V17L 1UKQA 5F8RC 1UWFA 2X4SA 4FHKA 3B9KD 2VLMD 2JKSA 4NP4L 4PJXE 3FTGA 1A4KB 2B1HL 3BAXA 1JZEA 2Y3AA 1RZ8A 2XVGA 2HT3D 1ZLWK 1A6TB 3QIUB 2W0FA 4LHUB 2V2TA 1FA4A 4OY9A 1NGYB 4AVKA 3GPEA 2Y72A 3EYUH 3KPTA 3X1NA 1NCOA 3A6BL 4K8RC 4ANWA 1FLRL 3MHZA 4ZS6D 4F37K 3QZPA 3UBHA 4N9GB 1A4BA 3D6GA 2WV3A 5DJXB 3FUIA 4BXSV 1LK3L 5CP7A 3WXVL 5F6IC 2ZP0T 3UBXG 3CU7A 1HQRB 1VFOA 3BSZA 1PY0A 2AKRA 2D4FA 2DLTA 3CXDH 4HLZH 5LAXB 3SHSA 1Q0XH 1QZNA 5HVWA 2EH7H 4HK3N 2ZOWA 3CGTA 4HU2A 4PJ6A 3VAEA 4OGZA 5GRWA 3V9EA 4C4KO 5E6UB 3KL0A 4WTWA 4DPAX 1THCA 4IHOA 2WSDA 4PGJA 4ERSL 4NJ9L 5DFAA 2XACC 3X17A 3FFCB 3MYJA 1QW9A 1ZGLP 1LO5B 3PQYB 4X5PA 1AVAA 4P07A 4JFYB 1NCWH 2CRYA 3WFBL 1BV8A 3BXNB 2CGRL 2ZX8A 5F7FA 5DQJB 5DF0A 1DO6A 3ES6B 3ZTCC 3IVKA 4UWQB 5EFIB 3IEAA 4M02A 5GXBB 2Q7YB 1JTOA 4X50A 3WLWD 4MS8D 3BN9D 4UNIA 3P2BA 2EADA 5T1KA 3ETBJ 3OR7A 4L0PB 1GYVA 5EU7C 3QEGH 2WUBL 2C7UA 2K1MA 4B96A 1Q1JH 2IFFL 2OQJA 4B9ZA 4R26L 3LKSA 3PQYD 3S88L 4RDBA 4MQTB 1XCTA 2N56A 4XNQB 4NQSA 4WGVB 3ZHDA 4G7YH 2L7EA 3VSVA 1Q9WB 4M62L 3KLHC 1G1KA 5IMLB 4OUUA 3ESNA 3QEHA 3F6LA 5I30L 2ZYRA 4QD2E 4FF9A 3V52H 2WXGA 4KV5F 5IBTH 4EN3C 1DLFL 2P8MA 1F6AA 1UD4A 3L3GB 4ETQA 2XG4B 1BZ8A 5CJOH 1UVQB 5GGRB 2NUPA 43C9B 4FYQA 4XNMA 3UJJL 4QXTA 3V52L 1QBAA 4FZ8H 3VNYA 4FNSA 3ZK0A 3C8HA 1D7BA 1ZIBA 4NM8L 4WTQA 5E6IC 2PP7A 3NFPA 4OZGF 3D0LB 4YXKL 1EHXA 4LVOB 2F08A 4Q0XH 4N2OA 1TQCB 2PYFA 4OFPA 5LGHL 1RULL 3H9SB 5KSBA 1LO2L 3GFUA 3QULA 4U1NB 2DLGA 5DDHA 4OZIE 4NO0D 3MRKA 4JRLA 3ARQA 5EU3A 2BS71 1XBDA 2H3KA 2MEJB 3QSKB 2X4PB 4K7PH 4OLZL 3AU1A 5BOPA 3U9UB 1JNNL 3W37A 4YFDB 5T1JA 5GIRB 4Q0XL 3ZE1B 2C3VB 2N0MA 3NFSL 1Z3GH 3KAAA 3QH3B 2GG1A 3FN0L 4HAKA 1ZWIA 2YUXA 3DARA 2YD9A 1WZAA 3MODH 1ILUA 4MCZA 5C0IA 4FMKA 3FT2B 5I6KA 1WHOA 5IW6B 1VDGA 4XRCA 5DUPL 3DETC 1VLXA 3P0GB 2AJ3A 2BPBA 5D72H 3STLA 5JHMA 4MD0A 1IGFH 4PRHB 3MR9B 3S96A 3D0VB 3IFOB 4GKZB 1E43A 3HZVA 1SLUA 4F8QA 4N5UA 3W38A 3N1GC 1F2QA 4KJQC 5CLZA 3O45B 1P2CB 1PD6A 1HSAB 1QBMH 4J8QA 5T5FH 5FW7A 2GSIA 4NWTH 2C3XA 4LOEA 1CFTB 1UA3A 2QVKA 3GBEA 4LLUA 3GLEA 3O6LH 3LX9A 5AUMA 2VR7A 1CICC 4LEEA 1MCFA 1R24A 2J8UA 2QQNL 3FT9A 1MFVA 3MOQA 2EP6A 2ADJB 3T8VA 3LKNB 4Y8DC 1S7TA 3EUUA 4RGMC 3UTZA 1MSPA 1Q4NX 3P0YH 4EIBA 1JXKA 3CZSA 4XBGB 4OGAC 4AQAA 5DMKA 5EN2B 4JM2B 2YSSA 3LN9A 2AJSL 1JHLL 4PTUB 1E6OL 1WBYB 4QTHA 4U1LA 5C8JA 1HH6A 1FCGA 4IIZA 3EYOB 1RIHL 3QCUH 5J7CC 3OQ3B 5ABDE 4Q9CA 4G8GE 1VB9A 1MKFA 4OZIA 1JTTA 3FRPA 3MA9L 1OGTA 5F0MB 2FNWA 2XKNB 3OMAB 3P9LA 5AKSA 3UZVA 5JQIB 4LVEA 4Z3JA 1MFUA 5IVOA 3NUKA 1R5IB 5C07E 5TGBA 3TU6A 2TSBA 3DURB 4LKCA 5IREA 4KI5F 1CF8H 3O41A 3QPXL 3K6NA 2HX7A 1TYRA 3STBA 2E7BA 3DVNB 5ALBL 1MWAL 3L7EB 3QISA 3QNYB 4ONHA 2R0ZH 5FA3B 3ZTDC 3SCMD 5MEOB 1MG2C 1EJFA 2LAAA 1I82A 2YMXH 4G8IB 2BSED 2Z64C 4HUXB 2MJWA 4KZCA 2BOBA 1A4AA 3DVIA 3COOA 4O51A 4N2EA 3ABZA 3PV6A 3R4DA 4FD0A 4XO4A 3RX5A 1TQVA 5DVKA 4CA4A 2NW3B 1KELH 2NW2A 1VJSA 2J57A 1J5IA 4N5EC 2LAGB 3QFDA 1AFVL 3VQ1C 1LDPL 3VI4E 4IJTA 1S5IL 3CC5B 3H3PH 4LCCB 3AREB 3CFQA 5FR3A 2DQFB 5T8IA 3VFSB 1A9EA 2IPTL 4QLWA 4WTZA 3VXPA 3VFTA 4UDUB 1RD6A 1T1WA 2EDFA 2E75C 2UY6B 3U7WH 4PJFB 1YUKB 2P26A 2XPZA 4PBDA 4ZMLA 2F54D 3U6XA 3U0TB 4YIQA 4O2EA 2I07A 1IBBA 5I1JH 1U91A 5F3FA 1MCHA 3ARTA 5L9DH 4M6OL 4WWNA 2OL3A 1MPAL 3LNEA 2ZX6A 4BEIA 1JERA 2EINB 4NO5A 2OJZL 4CBPA 1Y6NR 2K7QA 1TTAA 3F7VB 2ADIA 3MJWA 3KPNA 4JJ5A 1R3LA 3WSQL 3MCYA 1A7RH 4NO0A 4AEIL 3QDMD 4UQCA 1DDTA 1XL4A 3HNVH 3OZ9H 2VMCA 2N0KA 5I24A 5IJCC 3TTYA 2MQCA 3SKNA 4QGYA 3SSGA 2NZ1A 1E9QB 2HX9A 1FNLA 3BD3A 2ADFH 5I0ZA 1NUGA 4IOIB 3V6OE 3C8DA 5I73B 3ZBMA 1NZRA 5EWIH 5SWQB 3ZVVA 4KZDH 1R3IL 1BBDL 1CLCA 4TKWA 5CR1A 3NJFA 1SXAA 1ORSA 4AK1A 2MHAB 5DHXB 4PP2A 1D7CA 3MJ6A 2OSWA 5KBKA 3D12B 1HYSD 4U1GC 1FO0L 5D7LA 2ERJB 4YDMA 3IBOA 2IWEA 4LRIC 3DX9A 1AZRA 5C0AE 3D33A 3ZE0F 2K45A 3SDCC 3BLKA 4MNQD 4AENA 3GHBL 3SBPA 3ABLB 2F5AH 3W1ZA 1OCRB 4XMPH 1DQML 3RY6A 4KKQA 4M61A 4W9LC 4XC3H 2NDFA 2X2JA 3EH1A 4I3SH 5GZNC 2OMUA 1M4KA 2ID5A 4M5TA 2VQ1A 3QR2A 4KUZH 1QUNB 4NJAH 3MMEB 3CH8A 1IAKB 3ALWA 4Y2DA 3BGFC 2WXRA 1IC5L 4PLKD 3I84A 4OKVA 3QQXA 5DQDL 4G6KL 3BH9B 4YDKH 2HLFD 3T2NL 3BDYL 3N6YA 2BJML 1LP9F 1P7QB 1I85A 2CJ3A 4NZJA 5ESQA 1E4XH 2AEWA 4P2AA 4OLEA 4ORGB 4H25B 5IUSA 3GIVB 4Y16D 1ET7A 4MVBC 4F37F 1AKJB 3QHFL 4XGZB 4NZRH 1W2KT 5D7IE 4Y5YC 2ATAA 5F96L 2BJMH 4N6RA 3IETB 12E8L 4WU7B 1ZTXE 3GBNH 2G75A 3EADA 3DOIA 4MZIA 1M05A 3LV3B 1AQ8A 3SD5A 3MNZB 4MXWL 5HHPA 1OARH 4KDTC 1JPGB 3MA7A 3BPNB 1DJSA 2BS8A 2R0KL 3L2LA 1A6AB 1OL0A 4NZTH 1SLVA 5EU6B 4OGXH 1KGYE 4QO1A 2DJMA 3KLSA 1S2EA 3S7GA 3U36B 2JIXD 5FLUA 4HS3B 5GRJL 4QAWA 2PR9A 2IDFA 3F7PC 2VKXA 3DJSA 3OAYK 5GZND 3WIFB 5HGGS 3ARFC 1PX4A 4B7IA 2JVUA 4KJWD 4GXFA 5GRJH 3T8MA 2Z0BA 3CQPA 3KLHD 4G6MH 4L4TA 3LQZB 4CC1A 1UGNA 2VXTL 4NN6B 4KKCC 4DEPC 3CN0A 4AL8L 1PLAA 2FO8A 4JHVA 3MXVL 3RJDA 3ZX1A 4Q4EA 4LO9A 4BQ6A 1N26A 1T04A 1TZAA 4I2XB 4OZHE 5L6YH 3W0WB 2CU9A 2NY4D 3KDMB 3ZKNC 4ENED 1M1XB 1PKQA 2CO7A 1OAZH 2LW3A 2AVGA 3D39A 3RWEA 2DDQH 4LLWA 4L48A 3E8UL 4Z9KB 3G04B 1MRCL 3SGKC 4ABQA 3FB5A 1UASA 2DQDH 4HIEA 4QF1B 2B59B 5ACMA 3WNNA 4F7CA 1I8MA 5D7IA 2YXWA 2WTPA 1EZLA 2FATH 1ZGLB 4KH2A 4IRSC 1BWMA 4PGDA 5GRXG 3AVEA 4TRPL 2J20A 4WW2A 4PTTB 2HT4C 1ICTA 2D7PA 3MGOA 4WFGE 2NCEA 5L2KD 1MY5A 1AXTL 3IDXH 4WI0B 3VM5A 3FHQA 5CCKL 3LZQA 3L1OH 5DVMA 1FV1A 2E3VA 1U0QA 2XWZA 3B9KA 1LQSR 4QLRA 2EXYC 3QCVH 3PY9A 3MRLA 3RB5A 1CL7L 1KFAL 2JE8A 2Y36H 2JI1A 4PJ5D 2DQTH 4RFOH 4WW1A 4ZDHB 3WE1A 3IMWA 1CR9L 2R4RL 2NX5B 4P23C 1U8CA 2XYCA 1O75A 1P69B 3TWYA 4E2OA 3K6SA 2CDGA 3VYPA 3HCVA 3L4CA 4S1RH 2OM5A 3DTXA 4JDTH 5JUEL 1EUUA 4AVIA 2E9GA 4F57H 4MAYC 4Y88A 2GFBA 4M6ML 5K93A 1X7TA 3HOGA 4Y4KA 2R4RH 4YNYB 4IBVA 1GGTA 1KNOB 3KJ6L 3MXWL 1CS6A 3CG8A 1BJ8A 4TSBL 2WQ8A 4QYOA 5D1ZI 4P5MA 3U2SA 1GGBH 3U83A 3IFPA 3QRLA 3P11L 4U2ZA 3QIWD 4GRLC 2MCMA 2GT9B 4S2SA 3UO8B 3RIAK 5JZ7D 5HJGA 1JV2A 5DK0A 4N25A 5DJ2B 2BNQE 4YK4B 1QLRB 3SPJA 4BUQA 2LLNA 2R7EB 2NNXA 2Q87A 2DJ4A 1Z9NA 2O5YH 3K6FA 1M2VA 2ZSVA 4AQEA 5DO2C 2GSGB 3NEEA 3MJ7B 3FOMB 5GGSY 6CGTA 4J1UB 3SPHA 4DN4H 2OYLA 3PNWA 4C83B 1ZT4A 3W9DB 3N06B 3WFDL 2EDQA 1Q9LA 4KQ0A 1BCIA 4GUPB 2XXGA 3MRJA 4MJ5A 4NN5C 3UYRL 2MQ3A 1B2WH 3S8GB 5AEAA 1A7OH 2F2HA 1S9WB 3HR5B 2CK0L 5F7UA 3FUEA 3SGKA 3WFDH 5JPMB 4K23L 1CLVA 1A4CA 3KBPA 1U8JA 5E8PB 4PW9A 1SUJA 1DQLH 3G08B 4X8JA 1IBGH 2BRQA 2VB5A 1S5IH 3ARRA 4HQQL 1X9LA 5J9PA 3O3UN 4PPTA 1DN2A 1SHXA 2NXYD 2WBJB 1FL6A 4Y5XC 1LO3H 2F61A 3GKWL 3HN3A 1SHMA 3CXHK 3IF1A 4UM8A 1RMFH 4P3WA 1CDGA 1PX8A 4PWEA 1UFUA 4LB8A 3WEAA 2P7TB 1H8NA 2EDEA 5I8EA 2ZSWB 1J5HA 1BVKA 2QSTA 5E2VH 3FO2A 1MPAH 2FO4A 2H1LM 1T1ZB 2X38A 3ZE0E 1G0YR 5JOEA 3VTMA 4XNUL 2EEXA 1RFDH 3CFKB 4GKLA 4XVJL 25C8L 5D1QE 4DCQB 4HUWB 1UADC 1FSKC 1T5XB 4PREB 3V4LA 2APVA 2QQQA 2NCMA 3R7QA 4FG0A 1FGNL 4ALAC 1PJWA 2V7HB 1ZTMA 1KJVA 4G72B 4WCYH 4PQXA 1T66C 4KKLC 2D0HA 3QXWA 5I9QC 1XGRA 4BCZA 3K2KA 4JZJB 2VSDA 1KGUA 1R3IH 3DX8A 3HHSA 3L2NA 4AMKH 5I74B 3BDBA 4OLUH 4S1DC 4PVMA 1NCCL 4QWWD 4H2AA 4NKMB 3VRJA 4ZMPA 4X5WA 5ELIA 2YK1H 2EYRA 2GUOB 3OKOA 3CNKA 3SN6N 4IDLA 1ES0A 4P4RB 5IROA 4D9LH 1RZGB 1MCRA 1IGJB 3SJVD 2GK0A 3ATBA 1PSKL 1AGBA 5AOKA 3TH2T 1TSHA 1F1GA 3PIQA 1J1OH 4IRZL 3MX0A 3RX9A 2DMCA 3BZDA 3DOSA 4MNGB 3EBIA 1IBZA 4U4IA 2YA1A 3RWFA 1FFRA 1FI8C 1U9KA 4NKIH 5AVUB 2IQ9L 2Y25A 4U1KA 1N5AA 5ID0A 1HX0A 1N6QL 2B4CL 5ADOH 1CU4L 1HNYA 5IEKA 5ISZB 3GIZL 1YQVH 1JWSA 3GBML 5D9SA 1MHHA 3T65A 1AXIB 3QIBD 2XY2A 3SJVB 3L5HA 5T3ZE 3T0DA 4CU7A 5D70L 5DVNA 5GGTL 4I0CC 2CCVA 3IJHA 4QRQA 5HDRA 1QEXA 1EHLH 1JZFA 3D1MC 3QXDB 5AAMC 4DP5X 5D1QA 1AGCA 4TQIA 2Y1ZA 3CFMA 3VXRE 3WTTA 1OP4A 1FNHA 4JG9A 3FB7B 4OFYA 2DEXX 2J5LC 2PWEA 4ESKA 1EO5A 4ZMYA 5CWSB 4O2CB 5T5FA 4HUUA 4F7PA 3I9GL 4NZRL 1J1PL 1UJ3C 3DUUA 3AGWA 2VDQH 3IJEB 4V1DD 4X6DB 2Z4QB 3QJSB 5HGBA 4F91B 4ZUVB 2NNFA 4J3WA 2VN5A 3L9BA 3GEFA 3U0WL 1VCBC 1TMCB 2HCZX 1DLFH 4PJDE 3ARGA 1RHHA 2BRRH 2OP4L 2Y4SA 4W9JC 3KPLB 4IJ3B 1TVDA 2XFXB 1AHMA 4HJTA 4C4UA 3QEGL 3JTBA 2UVEA 1OF2A 1Q0EA 1S8DA 3NJMA 4Y0GA 5C0DB 1ND0A 3KWTA 3UJJH 1MI5D 2JK5B 1VAHA 1CUOA 2E0PA 3WL9B 3EDFA 3H7LA 4XWOC 1S9YB 2J6EA 1AZCA 1MHPH 4I3RL 4LNVA 1J8HE 5D7JA 4JZOA 3VYOA 1SYVB 4CNIB 5FECB 3EJTA 1KF9B 5L88L 4Z3TA 2NZ9D 3QEQE 3RVXD 1EX0A 3STZA 4JDZB 3VXNA 2MOQA 2BHZA 5FUZH 2RB8A 1N64L 4YC2B 1VCAA 3P0VH 4ZO6A 3CN3A 5I6PA 4QYAA 2YD0A 1KLUB 3MROB 4LSSL 4B9GA 3KLAB 4YSRA 5IV2B 1LE9B 1I31A 1DLHB 1XTMA 4N2GA 4FAAB 1HJBC 2E4FA 3RGVB 5BVPL 3RHWF 3O8XC 1HZKA 4FG4A 5G4NA 3VGDA 1JDCA 5LGHH 3BPCB 3NZ8B 3FAWA 3KLKA 4GW5A 1VZGA 2X4UB 2BH0A 2YKLL 1WZMA 1OAZL 4XCEB 5FO9A 4M56A 4L4VD 4CKQA 2AK4A 3KHOA 3SYOA 4LLQB 3C60B 4ZD3L 1HILB 1KPRA 2WVSA 4X5QA 5KVGH 3BEVB 1VFUA 4GT0A 2W95A 2OMTB 4LSQH 4UQ3B 1JAEA 4L37A 3NTCL 3G6DH 2UZYA 5JIMA 1N6UA 1NCDH 4UMSA 1VHPA 1IQDA 4N8VA 3EW3B 4DP7X 4CC4A 2FYYA 2VXUL 1TJIL 2AZUA 4F7TB 4F15B 3M45A 5IMOA 1IEBA 1OPGL 1UKTA 4LBEA 3IDGA 3VG0H 1BZ7B 2JH2A 1UYWL 2EC9T 4P4KD 3MCKA 2A4ZA 1BECA 4EBQH 3FYIB 1EA9C 1CYXA 4YHLH 1IV8A 1OLLA 1W0VA 1CK0H 1WC7A 3MLSH 5DZNA 1ETA1 4JRYD 1PQZB 2G5BB 4ZUTB 4JHBA 2YMTA 2VE6B 2VABA 2V7NB 1HIML 3U0PB 3H2WA 5DD0H 3ECBA 3PJSB 5KJRL 4X4KA 3PWPB 2J72A 2VL5A 1F4WL 4M93B 4AYID 4N2MA 1DBMH 2R1YA 5ILTH 2QLVB 1GGBL 1ZLUH 4DPRA 1P5VB 2FJUB 2PO6B 1KJ3H 3Q01A 1L7IL 3WS6C 2ZUUA 3VFUB 5IMKB 2I5YH 3F64A 1HOCB 4OTXH 1VENA 1IEHA 1FNSH 3IMVA 4MSWB 1J12A 3DJTA 1TETL 2KZ1B 5BUGA 2FHBA 2FUTA 2C1OA 2V4LA 3L7FB 2QADC 3AB0B 4HPOH 4OD3L 4IBSA 5DJZB 2I5YL 2OW6A 1RIUL 3ULVD 2WB1A 4X9HA 1MCEA 3PDOA 3CFBA 1TZOA 2QGCA 1RUQH 3OGCA 5IFJA 2VXVL 1NFIB 1FVCB 1RQ5A 3FB6B 4UQAA 2W0PA 5EZJA 3B1UA 3CK0L 4RRPG 1AIZA 1GZHC 5B39B 2A4EA 3Q5YA 1QW8A 3RDJA 4AZUA 4DW2H 2OMZB 4CSTA 1QYGH 5B1AB 3NIFF 5C08D 3ULVH 3DVFA 3VDBA 1RUQL 4EVNB 2VRAA 1O9VA 3NSFA 1CQYA 1NEZA 5E8NA 4K71B 2FQDA 4C47A 3R1GH 4DAGL 2FIRT 1H5BB 1I7RA 2P8PA 1MLBA 3A4AA 1TQWA 3AG2B 4CW1B 1CTNA 4Y9BA 1BX2A 1TJXA 3G5ZB 4JRXB 3FW6A 2JKLA 2NSQA 1GPOH 4DZBB 1PCSA 1XH3A 2I26N 3DIFB 3OF6A 3V0FA 3SGEH 4XMLH 5EUOF 2DH2A 3BP6B 4HJEA 2EILB 2VLKD 2IBZX 1U93A 1UJ3B 3G6JB 1IGTB 3Q9PA 4HZAA 4BBWA 2JJTC 4C4KT 1RERA 4KNSA 4AEIH 1BG1A 1IGCH 15C8H 1G7IA 2HG0A 1KXQE 3DX1A 2OMYA 1NIEA 1RZFL 4LSVH 4E0RB 25C8H 3WEOA 4APQA 5BCAA 5LXGH 1HHGB 5IQ7L 4DGVH 4CDGC 4B50A 4QRUB 4GXVH 4E41E 5JDJA 3DXAE 1NPJA 4PRPD 3HS0C 4RX4D 2HLAB 4HJJH 1HFUA 1IGCL 3US9A 1UTDA 3MGAA 2VR3A 2EIZB 2P5EB 4Z7VF 4ZOBA 4FYSA 5E9NA 5L2KA 4I77H 2VLKB 3NIDE 2JJTA 5B3JF 3Q7JA 2VNCA 4PYHA 1MZZA 3WS3A 2WCGA 3RG1C 2D0GA 1KCVH 4L18A 4YSUA 3UTOA 2XX0A 1R3KA 4OZHF 2DQIH 3VXMD 2OMXB 3C60C 2WLZA 3I02A 2AJUH 5D7SH 2YD1A 3CXFA 3FKUS 1N0LB 4K7PY 3IGAB 4JHWH 4ZTPH 2CKBB 2YZ8A 3HRZB 3NCWA 4L5FH 3DRTB 4ZFFB 4LEOA 2WWOA 3GJFH 5KS9B 4DGYH 3KYOB 4ODHH 4E9VA 4J23A 1GGUA 5I8CB 5IB3A 1GW6A 3OSVA 4N1CA 1BAFL 4U33A 1IC5H 3ARZA 1IC0A 1JPFA 2MTPA 4XWOD 3ILQC 5F1OB 4CGUB 1JPTH 1XSIA 4ODUB 2A9DA 2WXFA 3II3A 4POUB 2OCCB 1YG9A 2ZONA 3IRPX 3CVHL 3IMTA 3PP3H 3GK8L 3GWJA 5HHOE 4EZKA 1RUKH 5CU5A 3OKEB 4ZYKB 3ETBF 4FTVD 4DEPB 2WBWB 5PAZA 3SDXA 1H0DB 43CAB 5HY9B 3VYNA 3QDGD 3FTUA 3ZTJH 4U31A 1XGUA 1QABA 3B8SA 4NQEE 1OTUD 1UUNA 2V8MA 1FNEB 3P4LA 4PWIA 3BMWA 5FGCB 2GSMB 3MOBL 3RUGE 4BIKA 4HJ0D 2G5RA 1X5YA 1ZHLB 4KMTH 5FO2A 4JFEB 1FRGL 4A6YH 2W65B 3GXPA 4OV5A 4HJIA 5FCSH 2ZCKL 4RMQA 2FJGA 2PTTA 2VW7A 2OTUB 3A6CH 4PJ8B 2GY5A 5CZRA 2DD8H 4RRPM 4UM9B 2QGBA 2DOCA 4HIQA 3TFBA 5HHQB 2YQ3A 1FPTH 5L8KB 1I1AC 3SY6A 3AQZA 3H2QA 1PD1A 4LSRL 1RIVH 5FYKU 2UY7A 3GSXA 3T1FA 2AJZB 4KQ4L 1EO8H 4AT6A 5CIPH 3NRFA 4BH8A 2XTSA 3KM1A 3EYSH 5T1MA 1OCZB 2ED7A 3BP7B 1YYLL 2VXSH 5H2BB 3ZQ9A 1MG3C 5IB5B 3MVSA 1DDHA 3UGUA 2WXMA 2RGSA 1AH1A 5GHWL 1E27A 3NPZB 4N8UA 1EO8L 4ZPVA 3VFRB 4P23B 3JZ7A 4PJ8D 1OO2A 2F1BA 4OIAA 3WN6A 5CD3A 2BY0A 3EJZD 1N5YL 4I13B 4AJ0A 3FQXA 1AR1C 3AADB 3AT0A 1J05B 3IM1A 4ODXA 3MLUL 4KKAC 1HESA 2NY6D 2X4SB 3I74A 2B5IB 3LHPH 2XY1A 1RUAL 4TSCL 1HSBB 4H0GA 4AIXA 3V4PH 2DEWX 1DSYA 2A7BA 4N2NA 3MLUH 1J8HD 3MODL 2V2TB 3VD2A 3TIEA 2JI3A 1NDMB 5FHBL 4N2BA 3LEXA 1FZKB 4EIUA 4OJFL 4H2CA 5FXCH 5AVRB 4NENB 5IROD 4DF9A 1DN0B 4IRZA 3VI3B 5HDBF 5JORB 3K74B 3TV8A 4UYPA 1MCBA 1ITBB 1KEML 1R0AL 2Y5EA 1MRCH 1JNHB 4LMQE 1A9BA 5IK3A 1CL7H 4LGSB 4XOCA 4N2LA 1O0VA 4Z3IA 5EPMA 1AZVA 5KUMA 3MPCA 4R84A 3NQKA 3HVDA 3ILPB 2HFGH 1DEEA 1U8PB 4RNRA 5I1CL 4FLOA 4MZ3A 2NY1C 2VLME 4XO9A 5JIIA 5KVEH 2VDNB 1J88A 3RWGA 4YHLL 3MCLH 3QIBA 3V0GA 1BFTA 1S7XB 2D31A 4ZTOH 3C08H 2OJEA 4L1HA 4MMZB 3T3MB 5ID1B 2NY0C 4DTGL 3CLFH 3D4ZA 3BT0A 3ET9F 1JHLH 3P11H 4NKOB 4NGHL 4GMTL 1H3UA 3X1FA 1RIHH 2RJMA 4NT6A 4Y16A 3M1OA 3PHOB 1QFUH 4ODWA 3BWZA 1EBAA 1XEUA 1FGVH 5F0PB 2CJTA 1MH5B 2N59A 2PCFB 4CU8A 5GISL 3MBED 5FGBC 3KMDA 3L45A 4PJXB 1EVTC 1ANUA 2JXMB 4EOWL 5ETUB 1CXHA 4XNQA 1WFOA 5AW8B 5I26A 3V7AE 2BXYA 1BQRA 4P46D 4N2KA 5DD1L 5E5RB 2FWSA 2EO7A 3H6JA 1TETH 1DSFH 1UA7A 1K8DB 1OHZA 1FO0A 1KJ2B 4NRZA 4Z7OB 4R97C 3IDYC 3MRQB 1LD9B 4N22A 5HVFB 1SOXA 4JKMA 2ZUQB 1FH5H 2BX5A 3Q6GH 2PCPB 3QPQD 2JIXA 4YSAA 2J4WL 4JFTA 1Z6JT 4NBXB 4JGNA 2J1ZA 4GRLD 1EAQA 2DWSA 3MBXH 5FYJU 4A2FA 5K9QI 1ZPLA 3T0EA 4P2YA 5AW9B 3ZL4H 4L2YA 2JB6A 3VXSE 4KO6A 1GC1H 1B2WL 4HWEL 2X4PA 4ES8A 1KTCA 3QFGA 4QHKI 5GIRA 5B1CA 2YMOA 4ZO9A 1YMMD 4FL4C 2P44B 4D9RD 1TZGH 1IEAB 3MV11 4DVRL 4UT9H 1IBYA 3I3EA 1GPOL 2I27N 3IYLW 3OMIB 4MLSA 1TQSA 2P3YA 2X6BA 3LH2H 4D3CL 5CBAA 2B14A 4XMLL 5IW6A 2VN3A 2ILLA 1BAGA 4P57B 3EH2A 4P5TA 1SXZA 2IPUK 4Z0BL 2FLBT 3SBWA 4M6OH 2ICWI 1KIQB 1JZ6A 1JGEB 1DVYA 2DM3A 4GRWF 3T71A 4ELME 1QA9A 3BAEL 5EN3A 1DYZA 3MACL 4YFLF 4L3CA 3SPVA 1AMXA 3ARVA 1HHHB 3HNSH 5HD8D 3PWLA 1JE6A 3P4OB 1CFTA 1PAZA 3OPZH 1FHNA 2O6FA 2VMFA 4M6AA 4QHPA 3FYEB 3CV5A 3DHJA 2QTEA 5D4JA 2OR9L 5D7JC 3DVGB 3AQXA 4ZI8A 1DVTA 1N12A 5I73C 2ADJA 5J1TC 3MKKA 4OLYL 4PV1C 5TPWH 1JGLH 1S7TB 3L5XH 3FQWA 2EDRA 3QNFA 2VZOA 3C5ZA 4KUCD 2E7LC 1J0IA 3BPLC 4HIPA 3QA3B 4G3YH 3EOTL 1NGZA 2OMVA 3MLZL 3VXQA 1N2RB 1UH3A 1WWCA 2DYPA 3AXLB 3ECUA 2NMSA 4P9ML 4KJWC 2MCAA 2CKNA 5EIIA 1KYDA 4BXVA 3MRGA 2CMRL 4Y8AA 1E42A 3D5OF 3PE9A 4BFKA 4OZIB 3VXSA 3LZNA 5D7EA 5CEXA 1T03H 3LN4B 2BFVH 4CVXB 1E2WA 2XKNA 2G0LA 3P9LB 5KYYB 3FSZA 4LEBA 2WTOA 3VXTA 4X4YB 4OI7A 3GYRA 4P2CG 2ZOTA 1QLFA 3QEUB 1R5IA 5TGBB 1QX1A 4UIKL 4Y5VA 1J0JA 2W91A 3AWFA 4OZHA 5I1DA 1R47A 3UIZA 1LP9E 5HI5D 3DK0A 1JNJA 3EFOA 4K9EH 4R96A 3Q44A 2R23A 4YAQA 5JIQA 5E2UH 3QDGB 4KKRA 4ELMA 2VUOA 1LK2A 4J6IA 1ILSA 2EDDA 3TJHC 1T0MA 2Z7UA 1AGEA 5D93C 1JRHL 4ADIA 5DZJA 5L4JA 4Y5VC 2NY5C 3R06B 1OV8A 4UU9A 1B4JL 5HDWA 1P7HL 4XWGL 4G82A 1AZZC 3QHFH 2A77L 1WBXA 1XTLA 4TUOA 1U6AH 3MOBH 1IGYB 2CK2A 4CN6A 1ETB1 3RGBA 1G0XA 5HYJD 2B9AA 3TPUB 5DJ8A 1OGPA 1OOWA 4WO0A 4EUPG 3LQAC 4GMSH 4LCCA 3EGSB 4AK2A 3VFSA 1UCBL 1JVLA 1CBVH 4JFDE 1EHNA 1NH6A 2Z8SA 3GT6A 4JL1A 2GJ6B 2D8KA 5A40E 1R3JB 1L9MA 2FEDC 3OD3A 5A2KH 4I1PA 1FPTL 2C34A 3IJYA 4N8CL 2NNAB 4A2LA 5I1KH 4FQ2L 1W0WA 4NO3B 5CD5D 1WISA 1MI5B 1VFAA 2VDKL 2OZ4H 3KPNB 4JJ5B 1R3LB 5IIEB 4HX1A 5AZEL 3MV7B 1I3UA 5C07B 4F7EB 1B6DA 4YE4L 4UNUA 2G2NA 3N1QC 5K9JL 3OKLB 4QWWC 3BVXA 5AZEH 5JO5A 4BQBA 2BNQA 1I9IH 4IOIA 5KSAC 1JNLH 1IAII 3FU0A 3MXVH 1MJUH 4DP8X 3NA9H 5JDSB 1E4HA 5I1EH 4FG2A 1HAWA 1M7UA 2W81C 3F7KA 2X7LA 3VG9C 4JJHA 1IAIM 3APMA 5JOPD 5HGHA 4PJHE 4BFEA 4BFFA 1ZLWH 4G11A 4BWWA 3TBBA 3ARUA 1RP8A 1V7NL 4WHYH 3RIKA 2YGOA 2FLMA 3TEUA 3U4KA 4AGMA 1RZJC 2WK2A 1MW1A 4KKAD 1E5AA 4P2QB 2JB5L 4UAOC 4AYGA 3SDAB 2WVUA 4M8RA 4NM4L 4OD1L 2WXQA 4I0PD 2WINA 1J5DA 3ESPA 4JFZH 1KCSH 3QO1B 5JW3L 3NIFB 1YA5A 3QNZB 5DUPH 2LOEA 2A0LD 4M7KL 1YEEH 3TTSA 5ABAA 2F7PA 1FJ1A 5AAMA 1WH0A 4PJFE 4AGNA 5KSBF 2CLZA 4KTDL 1KB9K 1Y1UA 1YJDC 1W80A 2Q6WB 3L1GA 3REVB 1ACZA 1E8XA 1U8OB 4RAHA 3K72A 3C5JB 4AH2B 3C5ZD 3IN2A 3CJJA 1KFAH 2GBVA 1E8WA 4FFZL 5ACZA 3UZQA 3S3JA 3VXMA 3O6LL 4L29B 2WM0A 3SDCD 1MCIA 1ZPUA 1UYWH 1NTDA 3LPWA 1PIGA 1XR9B 5ESQB 2ZOUA 3DBXA 4ORGA 4ZFOB 4H25A 4TNWF 4QJ3B 1P5UA 1L7IH 2VSCA 2Y1YA 4AUYA 1L7TL 4G7SB 1CICA 4JGJA 3RFZC 3QAZB 4WNSA 4ZSOA 4QHMA 5BUAA 4JFWA 3LPFA 3VU1A 4YUEL 2H2PC 2XDHA 1NL0L 1AP2A 4PY7B 1UJTA 2F8VA 1A6VH 3BUPA 4NHCL 1V10A 2XWTB 1KTRL 1PKOA 2P8LB 2YJLA 5C0AB 2O5YL 5EHFA 3WXWH 1NMAH 4TQPA 3CFDB 4DP6X 4M5ZL 1BLNA 4JZNB 1X5XA 1UOWA 2NYKA 2VITB 1TVBB 4BDVB 3EJPA 3TN0D 4A7TA 3GO1L 1XB3A 4QY8A 5EBMB 5F71A 1C5BH 5JOFA 1K3ZA 1NMBL 1X5GA 3FZUC 2Y6SC 3MBXL 5K9KA 3S48A 1OB1B 2G60L 5IBLC 3G6AA 4A2EA 2JMRA 4J6RH 1E3XA 3BW9B 1S7RB 2LVCA 1TPXB 3ML9A 1PL3A 2X1OA 3QGVA 4EZMA 3FQNB 3SYPA 1GAFH 4OM0H 4PWGA 5FW8A 5EUKB 1ZDQA 1F4AA 5ITFB 5I0XA 4I2XA 1BGXL 1YUHA 3QXAB 4GAFB 1AQKL 4YDJA 3KDMA 3LCYA 2Y1AA 1C12B 1GAFL 4OM0L 3V6ZA 2DMGA 3EGDB 5E51A 2H9GA 1WWAX 3FTVA 4XX5A 5EU7E 1N18A 3D9AL 2B59A 3FONB 4QOKD 5JIDA 1C9SA 2X1PA 1FVDB 4POZC 3U4BH 2VL4A 3BLBA 2IANE 5C0BE 2Y22A 1U33A 4PGDB 3TWCL 5AYTA 4WW2B 1TEFA 2VQ4A 3QI9D 1PZUB 3IFNH 5DJ6B 1FG2A 5KVEE 5C0CE 4WI0A 1BM3L 3QWOA 5DHEA 4Y4FA 5E4EB 3VNZA 1RZFH 2AJVL 5HBBA 1R5WB 2DWTA 1M6OA 3AT9A 5AOMA 3TWCH 1CE6A 3FOLA 3NCCB 4PAZA 1MFNA 4UTAH 5CLWA 3OXSA 4NWUH 5AW0B 2NX5A 2BHFA 1KGIA 1U8CB 1G84A 4KDVA 1OLZA 3BD5A 3O2VH 1DCEA 3K6SB 2OLDA 4PJBB 3VFNA 4HC1L 2WVVB 5EF0A 1M71A 4TOYH 2FBRA 2QPUA 3I9PA 3RUGF 4HKZA 4Y4KB 4YNYA 1AHKA 4EN3B 2BVPA 1H19A 3TBWB 1AS7A 1SMAA 4AQ8C 5GGRY 1J1OL 1UD3A 1VFBB 3QQ4B 4AJVA 4U0QB 3VXRD 5IOPB 4YHML 3VA2C 2ZNWA 3HMWL 4Z18A 1IJ9A 1SXBA 4PFEA 3S2CA 2C9QA 2DJSA 3WN5C 4BFIA 2Q9OA 5B38B 4JVUA 3QQ3B 1NLDL 1ZA3A 3W0WE 5JPNC 2H26A 4WDIB 1S9VA 1RPKA 2L8AA 1EIBA 3QIWA 1CIUA 2FWLB 3VH8A 2YN3A 3BIBX 4EN3D 3P73B 3DV4A 4R3SB 1WA1X 4ODSH 3PL6A 5J3HC 1G9MC 3MUZ1 3TPKA 1ZT4B 2FGZA 4QRBA 5E4IA 4FA8A 4UT9A 2VW6A 4GUPA 3BO8A 2P4AB 3FPXA 1FE8H 3MRJB 5F7DA 5AYUH 4YFLI 2FDBP 5TE7L 3ULAB 5IUCA 1PPIA 2VDQB 3HR5A 2I7OA 4MD5B 3UERA 4WJ5A 5JHAA 3ZKSD 2WBKA 1BOGA 3EDKA 4GS7C 4R4BA 2W88A 4GI8A 4LOFA 5EBWB 1TQBC 4GI9A 1BEYL 1WYJA 1AD9B 2AC0A 1A7QL 2GAZB 3ROLB 3HE7A 3BI9X 4WZ9A 4OJYA 5D6DC 5DK2B 3NDYE 4XNYL 4OAWA 4P48A 1H3PH 2ZAIA 4XBEH 4JFDD 1OD9A 3B5TA 4WFGD 3WDIA 4UOW0 3IF1B 1QTYT 1ZAGA 4X5XA 2IV8A 4GP4B 3DJZA 5FC9A 5I8EB 2ZSWA 1BPLB 4PG2C 4AKPA 4FQXD 4CUCA 4JHAL 2FO4B 2OYMA 2RFXB 1KFGA 1XH2A 4PJXF 3QNXB 1NCGA 4DP1X 4EJ1C 3BKYH 4MA3A 3CFKA 4TLKA 4PVBA 4G9FA 1VKXB 3AQDA 4HUWA 1T5XA 4PREA 2PYED 3EO1A 3HR6A 3BVVA 4APQD 2CUMA 3WFEH 4Y19B 4FXGC 3EYSL 3GUTB 4AKOA 2CWRA 1G7JA 1X5IA 3C9NA 3HB3B 3MLYL 5BQ7B 3QUYA 1HC1A 1JK8A 4S0TD 2R1WA 1G7MB 4O2FA 4RRPA 3VA6A 3POCA 5AL0A 1T80A 4GKSA 4Q58C 4M7ZB 2NSXA 4NKMA 2EDTA 4ZW7A 4NQXA 4FQLL 4WKZA 3ZZ1A 2DLFH 4XMZA 4P5TD 3L5WA 3KYKH 3DUHA 3G5XA 4H5SB 4P4RA 5CS7A 3DGGB 4FXGA 4YZFE 1G7PA 4PJGB 3G5WA 3NFNA 3KXFB 3LZPA 4JKWA 4K73A 4KVNL 4X7CC 3UO1L 3V4PL 5I76B 5D71H 4KKNA 4JCLA 3OB8A 3WV0A 1AR1D 4PMFA 1OAKH 2BVOA 3NTCH 1E8YA 3RVWC 1HHIA 1UWEH 2YD7A 3T6QC 3O0RL 3QG6B 5ENWB 1X5LA 5EF1A 1BBJA 2ITEA 3B3BA 1L4IA 4UIMA 4YHOL 1TOXA 3KNBA 4Q6IB 3KVQA 3B9EA 3CTTA 2Q3ZA 4YR6A 4BKLA 1FFPA 1A0QH 5E7BA 5D6CA 2N7SA 3OC8A 3PLYA 3QIUC 1NMCB 1GTNA 5BXFB 2BS9A 1PDKB 5AKTA 2CM6A 1RJCA 4IBYA 4YEEA 3FJTA 3ZE0B 3CPLB 2OR8A 4LESA 1TTGA 5C7XH 1F3JB 2CUIA 5CCKH 2X4RA 3IFLL 3F12A 1GS7A 4I9WD 4QIRA 1YECH 5E00A 4BZ2H 1BZ9A 2LLLA 4X9YA 5GISH 2E4TA 5CWSA 3TFKD 4JE0A 3VFVB 4FTVA 4EOWH 4OBRA 1SJXA 5DSCA 5TDNA 1I4FA 1SLWA 4XMWA 3RQ3A 1DBML 3CSTA 2VN6A 1H6FA 4LP5A 5IESL 5HGBB 4MB5A 4UV7H 3FUFA 3RVTC 4GRMA 4K3DH 4RZKA 3IXTA 3FFDB 3NCFB 1WCQA 4X6CB 4FTDA 3SDDD 4KTEH 2ZX9A 1QVOB 3KPLA 4J3SA 1KJMA 1WPCA 3HMXH 5E0QA 4KX7A 4EKXA 2AEOA 3ZKMC 3EIFA 3QC5X 2Q5BA 4ZFZB 3BKJH 4WHTB 3DX6B 4AVJA 1INEH 5DRZB 3X14B 4L8DA 5DHVH 2UVFA 4OD3H 3JV6B 2JK5A 3S3SA 2R0ZL 3QI9C 4M93C 4XB3A 1VACB 4ZMZA 3KYNA 2IQAB 3Q6FB 1S9YA 1L9OA 3N85H 2DWDB 5B7MA 2OCJA 1XXDC 4KMQA 4Y16C 1A1MA 1SDDB 2VN4A 3BOVA 3OAYH 4PRID 3OMZA 1CGXA 1C16A 3PV7A 3GB7B 4HETA 3WHE1 1UEYA 1PG7X 4RFEB 1YC8A 1D5XA 4XE0A 5JXED 5KVGE 1RK1A 3O4OB 1MFCL 3OKMA 2FGWL 4A7SA 5IV2A 5B8CA 2ZCHL 2L7JA 5TH2B 4K71C 4HCRL 4XCFL 2AV1A 3WIHL 3GSUA 1RI8A 4WWKA 2FB4L 4OSUH 4W9GC 4XZUB 3U6RB 4RA0C 3T4AB 5T1DL 1HXMA 5JHDE 2AJYL 5DRWA 2KZWA 1LEGA 2B3IA 4JPKL 1U8MA 4ENZA 3G3LA 4OFVA 3BP4A 5FO9B 1FNGB 2V3FA 1XCQA 4RGND 1ZSHA 4M5SA 4A2HA 1VERA 3ARDA 4PI2A 2A0LC 3X3FL 4C56B 2PETA 1KB3A 4HZLA 5T1DH 4JRXD 3D9AH 5EZIH 4OU3A 3CVIL 4JPKH 1D7FA 3LMJL 3T8XA 3O4LA 2I85A 3EYVA 2KC0A 2X4TB 1YNKH 4WWKC 3ZE2E 5F1IA 5IBUB 3X3FH 3E6HB 1XGQB 4P59L 2CDFA 1V5JA 1IQDB 4N8VB 1UT9A 1OTTC 2HJKB 4PJDB 4NKDA 3WSQH 1WAEA 3PJNA 3WLBA 4AIOA 1N8ZB 3ECQA 2NXZD 1IEBB 1P4BH 4OJCA 4OLVH 4PR5B 5LNGA 4YPGA 2YAQA 4DK6A 3BE1L 3MCKB 4GQPH 5D5MF 1YEJL 1IE4A 2WWKT 4GAJL 1S3KH 2Y5TA 4FKKA 4ZUUB 2EIDA 3GHEL 4WENB 4NUMA 4L9LB 1BQHA 4PJ7F 3QW9A 5FFLA 3VQMA 1KCVL 4I48B 4FXKC 3SGEI 1W8EA 4YGVB 3X11B 2ZX7A 4L3AA 5DT1L 3ABGA 1RSYA 4OLYH 5DMIL 3TVMB 2EVFA 3MBEC 4K7FB 3LTVA 2ZUXA 2EE9A 1HXYA 2QL1A 4M3HA 2RD0A 5AALA 2OMWA 5KTEL 3HS8A 2WN2A 2WQAA 4I0PA 1ZHNB 4EAEA 3CBRA 3GQFA 4M8QA 1EGJL 4O5LL 3BCFA 3QUZB 1NEUA 4AYSA 4JLRA 3B8YA 2JNZA 4ODHL 4E9SA 32C2B 3VFUA 4RGNC 1HOCA 3SDYL 5SV4A 4IRJB 5EV7A 4QPEA 4F58L 2ICWB 2FIKA 2Z93B 5E2JA 2XWBA 3L7FA 1W72L 3DYOA 1K9TA 3H54A 5F70A 5K5YA 2A6IA 4ZAKA 2Z91A 3WTSA 1G4RA 4QCIA 1WFTA 3THMH 1AI1L 1TNMA 3ISYA 4DIXA 2AQPA 3GXUB 4OCNC 1ZKAA 5GGSB 1VGKB 4TPRL 1YEHL 1DZBA 1FZMB 1YQVL 2C1PB 4X4XA 3VU2A 1NAKH 5I1LA 3WTYA 3UYPA 5GJSL 4P05A 4FULA 4A2GA 3LKOA 5C6TH 1ZVHA 4EVNA 1LILA 1EXGA 1XMWA 2XTLA 2YPLD 4R7VA 2KT6A 1MCWW 3DV6B 4XT1C 4GQQA 1NEZB 3V7MA 2CGRH 4N0UB 1TO4A 5E1HB 3F84A 2P8PB 3PWJA 3S36X 1NJ9B 4OCWH 3S3CB 2QPDB 3G5ZA 1P5UC 4K2UH 2X89A 3FFCE 3KLQA 5I1KL 4LGRB 3AY2A 4PH8A 3BKCL 5ANMA 2DQGL 1QPKA 1A3QA 4XP4H 2XNAA 3UJIH 2ZOKB 3C2AL 3TBSB 3PWPE 1LQBC 1L9NA 2FQEA 4OF7A 2F8XC 4MWFB 2PPFA 4PD4J 4K4KA 1EEYB 1F58H 1FVEA 5HHNA 3V8OA 1F90H 2GTQA 3I6LD 4E0RA 1FN4B 3L3HB 5BZZA 1IBDA 3R7RA 2A99A 5I16B 2Z92A 5DURB 1I9IL 4RSVA 1O9ZA 2HLAA 3ZY7A 1K8IB 3TBYB 3PAUA 5E56A 3FTGB 2FSEA 2ATPB 1D2OA 4I3RH 3WFHB 4AQOA 1BXXA 1XL6A 1U3HB 5FIEA 3UEQA 1F4YH 4RX4A 2W0FB 4LHUA 4LOUD 4N1EA 4X4ME 5TDPA 1A1NA 1MFBL 4JNXA 4LLMB 1NGYA 2VXQH 2L0DA 4XP5L 4OQTH 5K59F 2VWEC 4XB8A 2BM3A 3W81A 4W9ZA 4PJFF 4JQIA 3H9ZA 3NK3A 3V79C 1N70A 1UACL 1BVOA 2DQUH 3KYKL 4G8AC 2LHAA 1KPVA 1ZT7A 3KL3A 3KM2A 5F88B 5BVJB 1AR1B 5L0QB 2F53A 3ATEA 1R6VA 3DRTA 4LU5H 1D7DA 4YL4A 1H9VA 3T0AA 5IY5B 3OLDA 3BWSA 3UP6A 5CZXC 5IB3B 1BHGA 2EUVA 3MFFB 5SX5K 5JHLA 3HNTH 1J11A 3FFCA 2BWQA 5KVGL 4UOW1 1IGFL 1CDHA 1JPFB 5CZKA 4N1HB 4OI9A 4AEFA 2CO6B 4HIIB 1XCWA 4EI5A 3ZUCA 4K3EH 3G6JE 1JPST 2QBWA 3HNTL 4YHNB 4RMSA 9CGTA 2VDPH 2Y36L 2MKLC 4QHLA 4RFOL 2XV0A 3DK2A 4ZTEA 2B1AH 4XNZB 4B9PA 1J48A 3IFLH 4X9GA 1K72A 3EBAA 1RLBA 4PJ8C 2VAJA 3IDNA 4E41B 3FQTA 3ZOAA 1ZEAH 3KPMA 4HAGA 4PJAF 1ZIAA 4GKNB 4ONFL 5KAQG 1X6LA 5AW4B 4NQSB 1OD7A 4R5TA 2R29H 1FGVL 5F7NC 2VLKE 5J56B 4XCCH 2W65A 3PFUA 4OV5B 1YN7B 1NUDA 5ALCL 1BW8A 2CLRA 5JQHC 5KBLA 2HT2C 3DLQR 4PJ8A 4ZX3A 1I9JH 3P9MA 1RZ8B 1EMTH 3CZLA 5E2TL 4UM9A 3H56A 4P3DA 4XCCL 1S7VB 4JPVH 2FR4B 2ARJQ 3NPSB 2Q86B 5EOTB 4J2XA 5C0NC 1LNUB 3EH3B 1CB4A 1OTTD 5DFTA 4BK5A 3UROR 4OCSL 2D03H 2XBZA 1ZY9A 3QPXH 5T1MB 1FH2A 4TTGA 4G8GB 3RFZA 5DDHB 5KVDH 3D30A 1E27B 5CUSL 3SDAC 4PGEB 3UC2A 5CD3B 4ZS7L 2ARJB 3LEYL 4R4ND 1CO1A 1T5WB 3N5AA 3QS2A 2QVMA 4K23H 1P0SE 4JRFA 5I1IL 5EC1B 4F9LA 5IG7A 4JQXA 5FO8A 4YSCA 3ZYIA 5HHOB 2C9PA 2NXYB 2WBJD 4JHZA 3MYJB 5CLXA 1YJDL 5F3BB 3ATAA 3CVHA 4MAZA 5I1IH 3EAKA 2ZAGA 3F04A 2P5WD 3BGMB 1WTGT 4XPTH 3CMGA 4MFHA 1SN2A 3HZVB 5LNDA 2OSLA 1D5RA 1G7LA 1T3FB 2FWOB 1NBCA 1FZKA 3N41F 2IGLA 1BVNT 2X4NB 4QHUB 5FGCE 4GFTB 4ABVA 4NENA 1GMIA 5KVMC 1DN0A 3U7WL 4LVNB 3L3IB 1OSPL 1A9BB 2LV4A 2XZZA 1IAMA 3OKDA 4RISL 4K55A 5EPMB 3JQOB 4U6YA 3ZGIA 2FAUA 2PWDA 1Q9WA 5BUPA 4ALAH 5TQ2L 4OUUB 3QEHB 1I1AA 2G3ZA 1P4UA 3BP5A 1ASQA 1EFXD 4JM2A 4TM9A 4WO4C 3GNMH 5C8JB 4CVUA 5GRUH 4JY6A 4LCIL 4WY7L 3O3EB 4OLUL 2K4WA 1PLGH 3JWNE 1FC1A 5IW3A 2R4SL 3SD2A 3F3HA 4K0OA 3QUYC 3VDAA 1PFOA 2OK0L 3TASA 4D94A 2A9CA 4X0NA 2P80A 3VD0A 4LDOB 4JN1L 1U8IA 4KKBC 3H9SA 3NSYA 5KSBB 3A6BH 2R4SH 4N90D 4NFBA 4TLTA 3TX4A 3AU1B 4JG0H 2WN3A 5D5MA 3U9UA 1G1CA 5IQ9A 1WGOA 3T2PA 5MEOA 5BZWB 4GAGH 5MEQA 5AFAA 5F7EL 3VW3H 3FXIC 3F7QA 4MMYA 5BV7L 3ARFB 4FI8A 3VGEA 1T0NA 1MUJB 1KJ2A 1FO0B 4NRZB 1SF3A 4C8XA 1ACYL 5FCUL 3ZZQA 2FBOJ 3WGVB 5EG6C 4PJHA 4KO9A 4XPFL 2ZG3A 5GGTH 3STLB 5HHXH 1EHLL 4N0YH 1H6TA 1DVUA 4UUJA 1UWXK 3BRFA 4LXFA 5FUCC 5GJSH 5CBEB 1HSAA 2P24A 1H15A 2GSIB 4NNPH 3Q13A 1KENL 4JCWA 2BSEA 3OF6D 3GLDA 1A9EB 5CGYC 4EI6B 1R24B 3MNVA 5FA4A 2CXKA 3E9TA 4BUGA 4YIQB 4LEXL 2Y7MA 4HXAL 1XD0A 3LKRA 3QIBC 4BHUA 4NUJB 3T3ME 5BV7C 4WWKD 5L7XL 4HWNA 2XN9B 3ELAT 3ARWA 4KI5D 4Q9BA 3VFOB 3KJ4B 2HVKA 3HAEH 5FYJL 3VXME 1QFWL 3PGCB 5MERA 4PTUA 4QTHB 5IHUH 3B3IA 5AW1B 3MNDA 1NGWB 4N8CH 2NY6B 3OM3B 2C26A 4X6FA 4CN1A 4GO9A 3CFIC 1H3PL 4K8RL 4MQXD 3DHMA 4FQ2H 3TYGL 4MXWH 1WFJA 3FRPB 1IVLA 4K8RD 1QA9B 3MJ8A 3HEIB 4L3CB 4UT6A 1T2QL 4H1LA 5L88H 3RWJB 2J1YA 3DIDA 4R7DB 3HHMA 4K5LA 1OP3K 3RWDA 5I0WA 1P84J 3U30B 1N64H 3O41B 4OVVA 1PZ3A 2A1WL 4PWHA 5CP3A 3VRLF 4Z7OE 2OV0A 4UZSA 3N44F 1ZV2A 2ENQA 4UB0L 4KRLB 1Y1DA 3LRKA 1NC4B 3QNYA 4ONHB 1ZLVH 1FP5A 4MNHB 3APDA 1NCBL 2EYTB 5EU6E 1GGYA 2IEPA 2VAAB 3WFEL 3F65A 5L8JB 2JELH 3UABA 4X5LA 5JW4M 1MWOA 4GUOA 3W5MA 3MLYH 4PG2A 1CLYL 4XVSL 4AENB 5A7EA 2BOBB 2YKLH 3MOAL 2JJVA 1D5ZB 4RMVA 1SM3H 4TQ8A 1V7NH 4PJIA 1NCTA 2BXZA 3MFGB 3PV6B 4GFXA 5FM5M 5C6WH 2VC2L 4HWUA 2F15A 3MTXA 2NW2B 5CEXB 2D9QB 4GG6A 4L0ZA 1MOEA 2XWEA 3GSVA 1D5IH 4JGMA 5BO0D 3FO1A 1E30A 1OP5K 1MCOH 3S4SG 5C0ND 1XF2A 3WKNA 3U25A 5D4QA 2DQFA 3ZTEA 4Y5VB 5T5NG 4YSTA 1T1WB 2FJHB 2UY6A 2XXCB 3RKDC 4OZHB 4I2XE 4QJ4B 3M8OL 4FNLL 4JFHE 4AUJA 5HYJA 1ZJBA 1RZ7H 2H0FA 4NUQA 5CSZB 4ADJA 5LDUA 5C7ZA 3U4AA 1KY6A 3HFFA 3Q3GB 1F45A 1IM9D 3EFOB 4KI5E 1CDBA 2R23B 2ZZUT 3MRIB 5F9JA 2CCLA 1CK0L 4ELMB 2B1AL 5GZOC 4WWID 4NO5B 3WIAA 1U3ZA 1T6BX 1UD6A 1WD8A 1T0MB 2ADIB 5I1CH 1Q90A 4N6RB 4IK6A 4FQCH 4HAFA 3UCRA 1XBRA 2ZCLH 4EPSA 4HUCA 1R3HB 3ULSB 3R06A 4WU7A 2Z3FA 1MCPL 1PYWA 3TT1L 4QDGA 4TQEL 5TF1L 5KYUA 2X9XA 3SKNB 3DSFL 5C0CA 1AD0A 1DSWA 1NGXA 2Y0SA 1JDAA 3RZWA 3QO0B 2BVQB 3CSFA 3EGSA 2W5PA 3KJ6H 4LNRB 4BH7A 5B21A 2VMDA 3FU8A 3CFEB 4OTXL 4R5XA 4NFDA 4NQDB 2E7LA 1AGDB 1FSKB 2NX5E 3WIFA 3T09A 3FRPG 4UDTA 2KQNA 4GRLB 1QG3A 2ZKXA 1YMME 1HYRC 2RA1A 2IOMA 3NIGF 2NNAA 3LYRA 2D03L 2VDLB 4PG9B 4A38A 1IRAY 5IROC 1NFKA 2M83A 1MI5A 1VFAB 4LZKA 4XVOA 4KGLA 3GTNA 1X5HA 5CIPA 3V4PB 4HX1B 4PUBL 5FYKL 1XWVA 4G9FD 4XAWH 3UTPE 4F7EA 5IVNA 1RUML 1I8KB 5DR5H 3WCYA 5B3SB 5C97A 5HYFA 2P5WB 4NQDD 3FU9A 5CJ8A 1T7ZA 1ROCA 4KGJA 1JF5A 2L04A 1T04B 3WJMB 1XH1A 5IHZA 3V4VA 4Z7NB 1LP9B 3ME0B 4BZ1H 3BFWA 3EBGA 5EZOH 3RWEB 4MXVE 1CD1A 2GCYB 2J7LA 5JDSA 4W68A 2N3JA 4OBSA 1SGKA 4ZX5A 2ISDA 2X89D 3QDGE 4UOZA 4OKVB 4BZ1L 4QF1A 4KNUA 5GSVB 1M7IB 2FGWH 1I8MB 3BDXA 2QJDA 1J87A 1NBYB 2OS7A 2H41A 4HCRH 4M7JH 4XCFH 3B1TA 1ORQB 1S46A 2C3WA 5EO1B 1A6ZA 2EDLA 3EF7A 3PP3K 1RXLA 4IBQA 1OAYL 3Q8EA 3L3OC 1BQHG 4XGZA 1OAUH 4B95C 2WCSA 5DTFA 3O6ML 1X6NA 5DLML 2DTMH 4XMKL 3ZDXB 2I9TB 5BS0D 4WI6A 4WFHD 3BE1H 1P1ZB 2EH8L 2YBGA 1JZ8A 2GI0A 4G5ZH 3WAJA 3WIIL 1CXLA 2ITCB 3LDBB 3K2UL 7FABH 3CDZB 1EFXB 2IOOA 3FCTA 1JPGA 4G7VL 4PV8B 2BCKA 1UXMA 1AG6A 1T20A 2G0KA 3KR3L 1U8OA 2RMNA 4A67A 4ZZKA 5I66B 3V55A 3D07A 1F8TL 1SMDA 5ACZB 1TF4A 1YZZA 1ED3B 2DBLH 4HS3A 1MI5E 1Q0YL 1X9RA 2NY5H 3CN1A 1XSJA 3C75A 1OXYA 3PHSA 4ZFOA 4YXLH 4HK3J 4P46A 2XVKA 3OQRA 2OK0H 2XVLA 4K5OA 3C5SA 1IM3A 1BZQK 2ZPKL 4O00A 4O58L 4WFFD 5EO0A 2NUTB 1HT6A 4L4TB 2K78A 1PZ5B 2WUCL 1E67A 4RBPK 5GSRB 4DVBB 5DJDB 1AGFA 5K9OB 5D4HA 4F58H 1QOKA 3OG4B 1YNTB 2BVYA 1DQMH 5EUOE 3RAJL 4H26B 1IC4L 2Y23A 1EH9A 3C5ZC 1Q1PA 3GXTA 2FCBA 2C4FU 5L4IA 5AZUA 2Y2YA 3DNKA 2A6JB 1YEDA 2FL5B 3W9DA 5IB1B 3UOAB 1QSZA 1RJYB 1EAPA 2F7RA 4UTBL 3ULUC 4LLWB 2GABA 4RMUA 3WKQA 1BLNB 3TS8A 3FB5B 4HIEB 1LWHA 1T1XB 4JANA 1S9KC 4BDVA 4HLEA 4MBOA 1F5WA 2Y3NA 5T3ZD 5DMGC 3OVUB 1T7WA 2V3DA 3NIFE 4YDVB 3BC9A 1OIOA 1ZA6A 4PTTA 1J18A 3QWQB 3QWNA 5HYIA 4F2MB 4B6ZA 2J3SA 3PF2A 4IRSD 4MMXB 1PX3A 3CLWA 2VJ8A 4E42A 1J9RA 4RIRB 3NN8B 5J06A 2VZSA 3BT2H 3U2IA 5DD3H 2LFEA 4UM8B 1NCJA 5EUKA 2FJFB 3T77B 1SJMA 3CBJB 5F8QC 3IU3A 5ITFA 3DRQA 4D0CA 3SJVE 3GMNA 1YUHB 2ZXAA 1OANA 3KWWB 5T3XL 5HYSB 5KVFH 3GKZA 3T1WA 3FO2B 4X80L 4XNDA 3GINA 3HCVB 2QPEB 2BSCA 3DTXB 5EDXA 2JSFA 4P23D 4DCQA 3HE6B 2ENPA 2GFBB 3UH8A 2IAMC 4PBXA 1ETZB 2WO4A 4R26H 1ZHKA 3VXRB 3AZUA 4W9FC 1YY8A 5JHLL 2DKMA 2DIEA 3RWIA 3LRSA 1M6UA 4P5MB 5LN4A 3U2SB 2DQ6A 4M1DH 4NPYB 3VFGH 3KEHA 1R5VA 5E8EA 4KWUA 1DUZB 1YY9D 4CADA 5DC0A 1D3CA 5J13C 2DRUA 1KLFB 5I8KL 1MFBH 1QBLH 3BUDA 5PCYA 3QDHA 1AQDB 3L13A 4Y4FB 3KGRA 1N5YH 3LRMA 3W11D 1IX2A 1M6OB 4FQQB 3U6XS 4BA0A 2XV6B 3FOLB 1QAWA 3VRJB 1JPSH 3IK2A 2R2BA 4AQEB 3ABMB 3JWNC 4X5WB 4OH2A 4F92B 5I1GH 3JWDH 1ES0B 1I1AD 1USQA 3ULVC 4V1DB 1IGJA 3MU3A 4MQ7A 2O6CA 2UWEA 4HU8A 5K9JH 1PS3A 1Q9LB 3S34H 3ZKND 4ENEC 3U1SH 1M71B 3INOA 4LCWD 1RK7A 3GC3A 4PRAB 4R4NC 3NYKA 3T08A 1B9ZA 5INCA 3P2DA 3ZZSA 1ACCA 4EN3A 3PWNA 3DO7B 1JGIA 4L5FE 4NQQA 2F1AA 3UZEA 3SBQA 1XZ0A 1I7ZB 1Z3GL 1TIUA 5JPMA 1GJUA 2FEEL 4NN6C 4XXDB 2XPGB 1A7BA 1TCRA 4RDQG 3RX8A 1UOLA 5IHBA 1E4XI 4HIJA 4F27A 3K4DA 5C2BL 3QQ3A 1FORH 4FNPA 3SJVA 1RVFL 4ZO7A 4EI0A 1S9VB 2BY3A 2X41A 2IH1B 2RH0A 4OZGA 5BZXA 3V0HA 2VLJE 2VJXA 4KZ0A 4N0FB 2LABA 1FFNA 4H8PA 1NGPH 4J3OH 4ZOCA 3UIYA 1AGCB 3DV4B 3NACL 4M7KH 4POYA 3PL6B 3MLWH 2O61B 2NQDA 2YWZA 1T1ZA 3DI3B 2JJWA 4HWZA 2IANB 4BFOA 4HIXH 4LLVB 3TA3A 4TVSa 5DI8A 3BVNB 2BP8B 3HC3H 5E99H 4BE6A 3IJEA 3WJLA 4U7SA 1UB5B 4JDTL 4X99B 4BZ2L 1EZVX 3CU1A 4PGBA 2ZOLB 4YWGL 3TEYA 4URTB 1NOLA 4GMTH 2D7MA 4OLXL 1UOKA 1RUPH 4XE5B 4JDEA 2XYBA 4JZJA 3HZKB 1PZCA 1OF2B 4IIQC 1S8DB 5C0DA 4IW4C 3SCMB 3HHSB 3M17A 4HPYL 5FFOA 3TA3C 3QEQD 3D25B 5DHVB 1V05A 4OAWB 1EDYA 2X0VA 2R29L 4XPHL 1EERB 2EDMA 2BIOA 3O8XB 1KYOJ 1OT4A 2F7QA 2X70B 4G6JH 1TYEB 2H3NA 1JHKH 3GUFA 3DGCR 3OX8B 4TTDD 4OD2B 5FECA 5HPOA 5KJ7E 3NZSA 3KS0J 1AJ7H 4HHWA 1CGWA 1S9XB 4B9IA 3SDDB 4ZS7H 1MAML 4GYBA 3Q6GL 4PJCB 4AG4H 4EIGB 4JZJC 1UT2A 3L4UA 3PWUA 3EG9A 2HFEA 1NANI 3N85L 3K6DA 4AGLA 2CJUH 4G1EB 2M2DA 3DMMD 2VIRB 3EH5B 5DEGB 1JWMA 2APWA 2BOCA 3ARBC 1QKZH 3KLAA 4KROC 3SOBL 4XAWL 1LE9A 1NC2D 5AOJA 3UFIA 3P2TA 4OZGE 1FFTB 1U2YA 5F1KC 2H32B 2F74A 1GRWA 1N5AB 5ID0B 3GUTA 1DBKH 5DFWH 5ISZA 3SQBB 4AOFA 1KCWA 2MCPH 1L9PA 3CK0H 5AQ0A 1QPXA 4XPTL 1JK8B 2B2XL 1DQLL 1TENA 3OBAA 3WIHH 4F24A 2EECA 2XA8H 5C0JA 5F9WB 1IL1B 3IDIB 1YRKA 3OWEA 4NN5B 2OMTA 3VE0B 1LDPH 5DJ0A 5DJAB 3LN5A 5SWSB 1YYML 3HG5A 5EZIL 2COQA 3FBQA 5FEBA 4HOXA 5FLVA 4JO3L 3DUUB 2IPKA 2XQBH 2QHLA 3WD5L 3WDHA 2IIJA 4HJ0C 4J3TA 2WCPA 1X5KA 1E6JL 3FUHA 4X6DA 3VXOB 3GHPA 3QG6A 5ENWA 3T4AC 3WNIA 2J71A 3RPIA 4FA6A 4AX3A 4XI5D 3D2UB 3ARGB 1RZJH 3BPOC 5GRUL 3ZYJA 1AG0A 4JRXE 4GPVA 4Z3EA 5LQBH 2QEJA 3GM8A 3UBGA 4KAQH 1V27A 4HKXA 1YLBB 1S3KL 4JGUA 3UXFA 3BSHA 4PY8I 2IOIA 4KZEH 1J10A 1E4WL 1BSIA 3WL9A 1XDTT 2QADB 2VL5B 1U8KA 1IM9A 4PJ7A 3BSGA 3BD4A 3N42B 2J88L 2FQGA 3C2SA 5I17A 3UPRB 5IM7B 3WO4B 3V0EA 3WDJA 2CBMA 4GQRA 1NKGA 3HC2A 5CJXC 4KXDA 3I6GA 5J11B 2LTQC 5FS5A 2WXHA 3I9IA 5GGUA 1KLUA 4HC1H 2J88H 4CVZB 2HKFH 2PF6A 3IXTB 2C1OB 3FFDA 5I6NA 8FABB 3R8BB 3TN0A 3TESA 5E6IB 5IVXF 1MJ8L 3NIDB 1OP5H 3P4MB 3NZ8A 6TAAA 2HN7B 4Y2NA 4W9HC 3SB3A 2ED8A 2HXAA 2BMKB 4YHMH 4FDWA 4OQTA 3GS0A 4WHTA 4X98B 4PBWD 2X42A 3KW7A 3ILDA 3U48A 3KXFE 4UNVA 4AQ8A 1PJ9A 5INDA 5C0GA 3Q1EA 4YPJA 2IQAA 3KPPB 3Q6FA 4BD4A 1KPRB 1HILA 1QR1B 3ATFA 4L37B 3AS2A 2XWJA 5HJ3B 4C54A 4X42A 1NCWL 2F53E 2Z7WA 3RTQA 4NJAL 3PGFH 5KS9E 1JRHH 3OXRA 1J5OH 4UILH 1MLBB 3RL1A 2FH6A 5I23A 4CW1A 1D5XB 2IDQA 4OM1H 4CDHA 4JRXA 4YBQD 5IMOB 4KJPD 4NZUH 5ABZA 2P47B 2AMUA 3RIFK 4AMXA 4EUPH 2FECL 4FFYH 1L3NA 4KOBA 1R34A 3M86A 1QFWH 5JXEA 1YCSA 3U6RA 4D0DB 2WZ0A 4JL2A 5GRVK 4FFVD 4J12A 2PPCA 3QFJB 4PJ7E 2DM4A 3K3QA 4NQTA 4MDIA 1KXTA 2DIBA 2Q0ZX 4NZ8A 5E08H 4Z7OF 1QRND 1B88A 2OMYB 4RH4A 4IEFA 4Z7AA 2VABB 4PM1A 1BFVL 4HXAH 4NO2A 4HZLB 2VM3A 4Y4FD 5F44A 5K33A 3ABKB 2CCWA 1PGRB 3ULVF 2K8MA 1JWUA 5IBTL 4Z7UA 4MQSB 5IJKC 4XP6L 4DKAA 2VUKA 4XVUD 5FYJH 2JV6A 3E6HA 5C07D 4LPTA 2DV6A 4NZTL 3K4ZA 2VLKA 4NKDB 5I8KH 1TITA 3LSOB 3O4LD 1HQ4B 4IJ3C 3TYGH 3KGUA 3BKYL 4MSWA 2NY0B 5DEFB 3GRBA 1CLYH 1RSFA 4XVSH 3WNPA 5D7IF 1WLHA 3MOAH 1BQHB 5KYXB 3CDGB 3QUKB 1NCNA 4AXWB 5EU6D 3ZO9A 3BSZH 3PWVB 1HCFX 5SV3A 2WMPA 3F7YB 4KKBD 4WGKA 3CHXA 5JLZB 3IAGC 1NGQL 3QQDA 4KJPC 5KS9A 1J0YA 3B6SB 1PIFA 3KYOA 1ADQL 2QMKA 5FKAA 3LPPA 1T6VN 4ZAKD 1CGSH 4X7TB 4I0PB 4LDEB 5LN8A 1HXKA 1VZHA 1XEDA 3Q2WA 3WGUB 3LXAA 1EANA 3DYPA 4XN1A 3HN8A 1KB5L 2MNJB 3KYMA 2WKGA 3L2MA 1A47A 2XJLA 4FXKB 4GQZA 5E2WH 2FBJH 3ALXA 1RZKL 3BJLA 1MHEA 1E5YA 1L6ZA 1DBAH 1OAKL 1WEJH 1NAMA 4OCLC 3WTWA 1SEQL