4AM0Q

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
91
Chain Sequence
b'TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
total genus 14
structure length 91
sequence length 94
chains with identical sequence R, S, T
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4am0Q00
1Z66A 5JHMA 3C6EA 1TG8A 4UTCA 4UTAA 2I69A 1OK8A 5LBSA 1Z3RA 4FFZA 5KVFE 2JSFA 4FFYA 2JV6A 5B1CA 2R69A 5IREA 3J2PA 5H37A 3N42F 3VTTA 1PJWA 3UZQB 4UTBA 5GZOA 4AL8C 1ZTXE 1URZA 2P5PA 1SVBA 5AAWC 3UZVA 1UZGA 3C5XA 2JQMA 2HG0A 4UT6A 3N40F 4X42A 5KVDE 2GG1A 3J27A 3UYPB 3UZEC 2V33A 3UAJA 4UT9A 1RERA 4FG0A 3MUUA 3G7TA 4BZ1A 2H0PA 1S6NA 5LCVA 1OKEA 5KVGE 1OANA 5GZNA 4BZ2A 3N43F 4GT0A 2R29A 4GSXA 3P54A 4L5FE 5AAMC 2ALAA 5KVEE 3N41F 4AM0Q 5IZ7A 5JHLA 3WE1A 3IRCA 5LBVA 4ALAC 3N44F
chains in the Genus database with same CATH superfamily
4Y19D 2YHGA 1IGYB 4QXGL 1IAMA 3CV5A 3WN5C 1X5ZA 3L2MA 1DVFA 2Q8AH 2Y7OA 5C9KA 4P0DA 3KWXA 1JE6A 4TVPD 3CFJA 4KMTL 4EOWH 1HJBC 3UYRH 3QIWD 3VFGL 5IR1A 1XD0A 3BZFA 2XZAL 1FHGA 3LB6D 4LCUB 2JIXB 4X6CE 4BUHA 3RU8H 3VMNA 3WKYA 3L7EB 3SJVD 3VX0A 3HC0B 2IOOA 3O0RL 4JHWH 1MJ7H 2PXYB 4RGMC 4X4KA 5JUEH 4HF5H 4P5KB 3SCMD 4UOW1 4MD0B 3EBAA 1G7HA 2XX1A 4GI8A 2WD0A 5EFIA 1PU0A 1YQVH 2DWEA 1PJWA 4RQQB 4XVTH 5MEQB 2AP2A 2AEQH 1CGUA 4Z5RA 5I6XB 3QCUH 5EOTA 4KI5F 4R9HA 4HWBL 4N0FA 1ZTXL 2K9FB 1KFAL 3PHOB 2CRIA 2ERJB 4PWJA 2GPZA 3UJJH 4LBEA 5C0IB 1MCEA 3CZFB 4KHXH 3NFSH 4NN5C 3UPAA 1EJOL 3CX5J 2HAZA 4W9ZA 1MKFA 3REWB 4RAUB 3MUHL 1M42A 2YUZA 4MVBC 4QT5A 3V5KB 4BFIA 4CVXB 3UJIH 3O0LA 2EYSA 2CAKA 1YYCA 1WUZA 3MJWA 5G4NA 2PTUA 5ICXA 4AW4A 2A6DB 1MFCH 4I77H 3ECWA 1FO0A 1S8DA 3F2LA 5J3HD 4ZW3A 3I84A 5ITFA 2AHIA 4HKJA 2HT2C 1VESA 5LWYL 1RU9L 5D72L 1CLZH 2VR6A 3FB5A 5KYUA 1FO0L 1R24A 3SKOA 2FWOA 3IDGA 1KIQA 1JGEB 1BMZA 4FFTA 5AW2B 2YGPA 1F00I 3SEPA 1WTGT 2NOYA 4XPHL 4TTGA 4JM0A 4X8CA 3BUTA 4L29A 2WWMD 1EZVY 2E7MA 1T04B 4WEBL 3VDCA 3BAYA 2ZX7A 2AITA 3S35L 4YDNA 4PRDA 4APQD 35C8H 2NUPB 3RVTC 3IDXH 2V5RA 4I2XE 1DBJL 1BX2B 3NMEA 3OR6A 2CIKA 2EZ0C 2OJEB 5TDOB 6FABH 3D06A 3QCVL 3FTWA 4M6MH 4PCKA 5DF0A 4RMWA 3KPPA 4NNPL 2DQHL 2A83A 1I3RB 3DJZA 2O6DA 4TRPH 5LVEA 3T2LA 1B6UA 4M8UA 3ZE1E 1F58L 2LTQB 3K2IA 2B08A 3NCMA 3KYKH 4M4PA 1PEWA 3T65B 1SZNA 4Z0XA 1MI5A 4JCMA 4DZBA 2X4RA 5BRZD 2NCMA 5F3BA 4G8FA 1FNLA 5EA0H 3IXAA 4HS8H 4AL8L 1IGMH 4GAGL 2GSGB 1MDTA 3TOPA 1MJUH 3BKCH 1B4JL 4KUCD 1QRNE 4NO5B 1KJ2L 4F58L 4AOFA 5BV7H 1QTYT 3CIQA 3L1OL 4PCTA 4AIXA 4IRJB 1UWFA 3HS0A 3V79C 4ZNEA 2NY3D 4CMHC 3JWNH 2GCYA 1UD5A 2WTOA 2Z64C 4M7KL 3L3OC 7PAZA 3DIFB 4KK5D 3H85A 4XPGH 4U1GC 4YHIA 3MRFA 3WKPA 5I75B 4NQUA 1ICTA 4PJFA 5MENB 4MA3B 1BAFL 3ZYZA 1I85A 3INOA 3T2QA 4D9QE 1XGRA 4KQ0A 3HPJB 1TF4A 3F65A 1BZ8A 4PJFF 4UNVA 4B9KC 5I15L 1HEZA 3ZDZF 5EOCH 1R34A 2LGNA 4KUZL 4KRPB 5FYKE 4EVNB 2DF3A 3VFUA 3VSUA 1K6QL 1RJZA 1ZRUA 3WY4A 4JE0A 1FNGB 3BKYL 3I6KB 4JRXD 3ZTNL 5IVXB 1JXDA 2VZ1A 1I9JH 3BXNB 2PCYA 5AAWC 4PHZA 1QTPA 1E9OB 1GGBH 1ZTMA 4G42A 2CIIB 2FNBA 5BXFA 4NUPA 2P28B 4F7PB 3JUYA 1PY0A 3GZQA 1QSVA 4Y9BA 2OMNA 1I75A 3S34L 4MNQD 4WI0B 3V0IA 5C0DB 2UZXA 2BIHA 2AMGA 3LS4L 2QQKH 1Q0EA 4JFZH 5HXMA 3SKUD 3QJVB 1OPOA 2VOTA 3C8HA 3EJUA 5EC1B 1U8MA 5FHAH 4ZAKD 3SKMB 1RZ7H 1CI5A 1K8DB 4OGZA 3C87A 4ZK8A 4WI2A 4OCRH 2NX5B 1YEJH 4QHKJ 3S3SA 1N6UA 3C6LA 4HXBH 1NCDH 2YA0A 1MRFL 4CU6A 1JPGB 4JDZB 3NCCB 4R5TA 4F1SA 1BJ1H 1PD6A 2BY3A 3WI9A 2EO1A 5E6RB 2FB4H 1Q9WA 1R6VA 2AJSH 5HHVL 1XL6A 3B9KA 2EDBA 5F88B 4JPWH 2EVHA 2VXUL 3D39B 3IJYA 1GZQA 3VFMA 1EXUB 4E9YA 1EXGA 3CLEL 4JN2B 1EEQA 2O6CA 5DJ2B 5AAMA 4EI6A 5HVWA 5IMMA 1DQDH 3RILA 4HIQA 2WVVA 5T3XD 4OCYL 2VIRB 2FRGP 1Q4NX 3QYMA 5CJOH 1SY6H 2BCKA 1DJSA 2JKTM 5CZVH 1NOLA 1VRSA 4YC2B 3MNVB 3QJXA 5KJ4A 3M88A 4JM4L 2Y23A 5E9DE 4G80B 3W57A 3A23A 3MV7B 1Q0YH 4K8RC 4MMZC 2J4WH 4PJAE 5C0BD 3MO1B 3VVVA 1NPNA 3U9UA 3V0VA 1FA4A 4WTXA 5JHMA 1NFKA 3VJ6B 1WFJA 3ETBF 2NNAA 3PCYA 4DGIL 3U1QA 5J1AB 1IEAB 3IETA 3MOQA 3AY4C 1ILUA 4JZOB 4DP2X 4ZPVA 4HUWA 2VXTL 5D96B 3HC4H 3EBHA 1PNCA 3FZUD 1G7QB 3BZ4B 3ZHDA 1T2JA 3SQOH 1NFDB 2OL3H 3L3IB 3U0PB 3VXOB 5D7LE 2CJUL 3EFOB 2OW6A 2E7HA 1OCWL 3U4KA 4N68A 3KXFA 1BAWA 5CWSB 3BMVA 15C8H 1XGPB 4MRBA 5F0MB 4JDTL 4ERSH 3JYBA 4TLSA 2OJZL 2GC4C 5AYUL 3HUJE 4PQXA 5H37G 5K9OA 2BPBA 3BT2L 2EXYD 2JKNA 4U3CA 5CP7B 5B38G 2YWZA 2KYIA 3F7LA 2GTWB 3ISRA 5IVNA 2DDQL 4ONFL 2VLJB 3ZDYE 3N44B 2R2EB 3N1MC 4HJEA 2GJRA 3DO3A 3MRIA 5F3HA 3RY4A 1EV2E 1T5XB 1UA6H 1MHEA 2Z92A 1P2CA 4IJ3B 4MBOA 4Z7QF 5HGBB 5SV3A 3V6OC 3S4SG 5DD3H 3QAZB 3BRGC 5AOJA 1ZE3C 2IALA 3QWRD 5GGRB 4C56B 5B3JF 3QZOA 3H9SA 1YDPB 4LVNC 3TA3C 1ZJBA 2ZJSH 2XWBA 2CG9X 2BVYA 3B5HA 3GBLA 4LDEB 3ULVD 1I3GH 1P1ZB 4I8DA 4B95C 4XBPA 3WLWC 1AS8A 2IPTL 5F0JB 3U2SB 3HMXH 4HOMA 4J7RA 4YL4A 5DJ8A 1RERA 3MQIA 3LVEA 3PWPA 3WFCL 1FH2A 4OZIA 3R0MA 4N22A 1IBGH 4WV1C 3LRSB 4O2EB 1WFTA 1P7QA 3CN3A 4OZIF 3DJRA 4LLMA 3GS7A 2KZWA 4P4KB 1NZRA 1IC1A 2F8IA 3OR7A 4HA1A 2B4CL 3BO8B 5HI4C 1K4CB 3BH8A 1DBAL 4RBPK 2CJ3A 1R19A 1QSEE 2XQYA 3WJMB 3C75A 1R0AH 3W82A 3BW9B 1KYOJ 3FCSB 2C7UA 3GLZA 5CJ5A 5KSAA 1OANA 1TU2B 1BBJB 4FA7B 1XXDC 4ZMZA 2AGJH 1MWAL 2V2XB 3MJ8B 1L4IA 2N4IA 4LVOB 2ARWA 4KDTA 3JV4A 5I23A 3CMOL 2Q5BA 4FMVA 5D2LB 5TDPB 3X1GA 2CHDA 1MW1A 2OS7A 5ID0B 3K2MC 2BY0A 4U1IA 4H1LB 1DQLL 3PAUA 5FAAA 2CJTA 4LBAA 2HYMA 1RK1B 3B2XA 1OAQH 4U31A 4D0BB 2WVTA 3K4AA 3H6AA 4R90L 1OAXL 2HMID 2FLMA 3HN3A 3QHZL 4PTUB 5EF1A 3VD1A 4N6RB 3HNSL 2VB5A 1KTBA 2DJMA 5CU9A 2BJMH 3PAZA 1TQVA 1GYUA 3WUZA 2X1OA 3B9AA 5FK9A 5H2BA 3B43A 3ZJAA 2ZUXA 3MCKA 3O8XA 1EO7A 1KXQE 4LCCC 3CWGA 3HI5L 3O9WD 3CFDB 1A6ZA 4RIRA 3TA4D 2OMTA 4RBPH 1JN6B 4IHBA 3SGDI 5C86A 2CM6A 2Q86A 3BPNC 4Q56A 2Q7YA 5DC2A 5DFVC 1PZSA 1RUPL 2VITB 4OZFH 3TBYB 4JFEB 1Q1JL 1QO3B 1HESA 1PBYA 4WRLA 5DVMA 3VGDA 4YFEA 5HYJD 3HG1D 1ROCA 4WIQA 4HG4J 5EUOA 2FEEL 3TPKA 5C08A 3W11D 3QORA 3SDXA 1O6SA 3MYJB 4L2YA 1CFTB 4RX4A 2UZIH 3MROA 5EUOF 1UUNA 5F7EL 1XB6A 2WQSA 4IU2B 2R69H 3GMQB 3LRLA 3SDXF 1U8HB 5DGRA 5H37H 1BF2A 3E6HA 5I19H 2Z8SA 3QFDB 5T1LD 2Z91A 2OP4L 3Q2VA 1G87A 1JP5A 1NLBL 1KXTA 1S9YA 2WJ5A 2FEDC 2Y72A 3DNKA 3RWCB 5I76A 1U8KA 5IESL 1XGUB 3CVBA 1N19A 2WYIA 4FQIH 5JPMC 1FPTH 3DX6A 2J8HA 4PJEE 1XF5B 4UU9A 3N1PC 2NZIA 3HE7B 4V2CB 4L4VD 4XCFH 2X3CA 3KBHE 1TJHL 3QA3B 5F7BA 5DCCA 2J3SA 2RAMA 3GSNB 3C09C 1FZJA 4X7SL 2NY2C 3WLBB 1AXIB 1ZHKA 4NUJA 1MFAH 4RMUA 4IDLA 3PRZA 3BVXA 2CDGB 3DSFH 5TPWH 3UBFA 2BVUA 1OAYL 2QQLL 3DHPA 3N6YA 1CDIA 4HH9A 4QHUA 5EZLB 4U1NA 4M8QB 4BZ2A 4F2MA 2ICEA 5KJ7E 3LQMA 3X3GH 4XVUD 1IGTA 2P8PB 1R3JB 2G9HA 4LSTH 1G6RA 1LP9A 4G8GA 1XQ4A 4I3GA 4O00A 1FNEB 2JTYA 5IGXL 1MFVA 4KK6C 5LNEA 2YO3A 1LP9F 2H0JA 4M1GH 1QLEH 3RHWK 4NBZB 4C83B 4P46B 4Z78A 3MNMA 3WIHL 3D2TA 2X9XA 5GGTH 4Z8FH 2VLLB 4NT6A 3ZRCC 2EIZB 4CN4A 1JZIA 4TSBL 3HZKB 5KYXA 5I2IB 2WXKA 5EF2A 1DBKL 3SDDA 3FT0A 1S7TB 4PTTB 2NY4C 1SMOA 2B0SH 5DUPH 2Z0UA 1FYHB 1MLBA 3TNMB 4A6YH 2MPAL 1RZIB 2E7BA 3K1KC 2X1QA 3NCYS 4PJCB 4WY7L 3VXSA 4HX1B 1I8AA 5T3ZL 4KGJA 2JE8A 2YKKA 3PLYA 2LR4A 4G9FB 3GSOA 5DR5H 3FQNA 3K5RA 3NRFA 3QI9B 3O6LL 1D5IL 1JGIA 1KN2L 2WKLA 4JO4H 4PB0H 4ONHA 4JFQA 3RA7H 5TFSH 1RPUA 3GPEA 5SWSE 5KZCB 3ZR5A 3O3BB 2DIBA 4IRZA 1M7IB 1C7TA 5F89A 3PHSA 3R19A 2MRYA 2E7DA 2CGYA 3U30C 1N59A 4ZMOA 5E95B 2A2QT 2FUQA 4MJ2A 1B0GB 1P9MA 1VHPA 2P7TB 2VWEE 4LGRB 3HS9A 3UC2A 4QRQB 1WA1X 1JZ6A 3FDWA 1QZNA 3HLAA 1EANA 3ME0B 2E4FA 1ETA1 4N0RA 5DJDB 3LEXA 3PWLA 3AVEA 3K6SB 1RMFH 2N7SA 2ZPKL 4FQ1H 2X4PB 4ZUSA 4G6KH 3QH3B 2V37A 1AHWA 1YNKH 5E4OA 1BWWA 2Q1EA 3FUKA 3I85A 1N12A 3MC0A 4LVHB 4P23B 4DJMA 2MOQA 1XGQB 4RMVA 1YEDA 4WKXA 4XN2A 4KTDL 4MKTA 5FO8A 3H55A 1ZLDA 3NQIA 3SGEI 1V7NH 4KOCA 1CTMA 4PJ7E 3MNDA 2ARJB 1RQ5A 3ZL4L 1BEYL 3VW3H 4BEIA 4MXQC 4HD9A 1I1AC 2F74A 4PY7B 1UEMA 2H2PC 1D5ZA 4PLKC 2H0PA 2J44A 4W4NA 5HHOE 3P4NA 3SN6N 4E42B 3D0LA 3BRDA 1PZCA 4LSVL 3KCPB 1S7XB 1UEYA 4GSDH 2RBLA 1N6VA 4UOJA 1J5DA 1ZA3A 1OARL 5IROA 4OTXH 4KJWC 3QW9A 4U1LB 3CZLA 3E80A 4JR9L 1JWSA 2EDRA 3UAJD 4A04A 5CP3H 2V3EA 2NY0C 1WRFA 4PRHE 5DWUL 2N7BA 5GGQH 5FYLL 4XE0A 4QRPA 3FB7A 2AMUA 2K78A 1HH6B 1CLYH 1DJGA 1NDGB 1RV6X 2HLAB 2HUHA 3DRQB 2AERT 3LZOA 1IGJB 4JPQA 3WFBH 2E75C 4QHNB 3D87B 3VWKA 2ENYA 2YLKA 2IG2H 3P73B 2WLHA 2X4OA 1NC2D 3I74A 4FXGB 3T04D 4Q9RL 5HP5A 2FIKA 2YR3A 1LEKB 4ZQKA 3NRQA 3EO9L 1PLBA 4KY1L 5GZND 3B2MA 4M3HA 3R18A 5EU6A 4M1DL 4DEWA 1OE3A 3PL6D 1F13A 3D52A 4P8QA 4RFOL 4CVZA 2EUWA 1TO4A 2XN2A 1KTCA 4MQSB 3VFVA 1OF2B 1MSPA 1CIUA 4OKVA 4XN9A 2OLDA 3UTSB 1N4XL 5I16A 4F9LC 5JOPE 3Q5TA 3OTTA 5BVJB 2BDNL 2MTPA 3OKEB 4J3OG 3DOSB 5IBUB 4XXWA 1NBYB 1Y0LA 3N41B 4PWEA 3HZVA 3PHQB 2FLBT 1HK6A 4GUOA 4FQQA 4DQOH 4MASA 1JZEA 4WKZB 5CGBA 3S96B 5KSBB 1G7PB 3LPFA 3BHBA 3WL9B 2A9DA 1DVFD 3V0DA 1PSKL 1OF0A 2NMSA 2VDKB 5BJTA 5LGJB 3O3UN 3BPCA 5HJ3A 2EDJA 1KLFB 3BGFB 3BKML 1R75A 1KGIA 3B8SA 4FFZH 2XRAH 1QPKA 1KULA 3FCUB 2Q6WB 4JFOB 2GBVA 1MFEH 2Y22A 3SGJA 4Z7NE 3UX9B 1REIA 1WGVA 2XTSA 2H3KA 3WFZA 1BOGA 3RUGE 1LE9B 1S5HA 4DAGL 1PDKB 4KI5D 1KN4L 5JDJA 2Y07H 4YHLL 2UV3A 3KGUA 2B9AA 3QIBC 5AENA 3VFRB 3PGFH 3V8CA 4B5ZA 3TN0A 5EDSA 3BDXA 3WTWA 2PO6C 4ZO8A 3K4DA 3EO0A 1UM5L 4JFDE 1F4YH 2AV7B 5E2TH 3VQ2C 3MZTA 1BBDH 2AK4A 3UROR 5EU5B 1A4CA 3WAJA 3ARZA 1H3TA 1MVUB 1IFGA 4WFEE 4BSJA 5ISZE 2JKIS 4X6DB 1ZXQA 3GKZA 5A2BA 3L08A 2A9NL 3E6FA 5FA3B 1FVDB 3TH2T 1JJUA 1CICA 1SXBA 2W0PA 4FQPA 3ALPA 5DS8A 1HCZA 2ICES 1GKEA 4KQ3L 5CAYB 5KVGH 1JPSH 3NIGF 4XNZC 2H6UA 1DQML 2Q8AL 1FL6A 1NA8A 1NCAH 3JTSA 4JZNB 1RKRA 1T21A 3QQ9C 4Y16A 4PJIA 1A6TB 5T1MB 4CUCA 5IQ7L 4W4OC 3LHPH 1HCFX 4JW3A 3M6DA 4WI8A 1Z66A 1HDMB 3PXLA 4PJIF 4LPXA 3WJJA 4HJ0C 3MFFA 3N0AA 1UH2A 4R8WL 3BAWA 4L9LC 1ESOA 4H0HB 5DYFA 3TJHC 1GOHA 3E2HC 3SQBA 2AJZA 4JHWL 4L4TB 4N2LA 5EIIG 2B1HL 5K39A 3E0GA 2D2CC 3PXHA 4HF5L 4KKZA 1G1KA 4Z3IA 4JL2A 3NN8A 3S0PA 3IDJA 1NUDA 4XB7A 5HHNB 1FFRA 3SDCB 3MCLL 3D4CA 3FQWB 3DDFA 4LSQL 4AMXA 1S78C 4XN8A 2WLZA 3IJHB 3W0WD 2R0KL 1XEDA 3ZTDC 1J7VR 1MI5D 3T09A 4KHXL 5D1QC 4L4JA 1AGFB 1AQ8A 4LCWA 1TCMA 1XR8B 2UZYB 4UCFA 3LNEA 4U6YB 4JB9L 3W5NA 1UHVA 2Z31C 4CSPA 5GRJH 3I3EA 3TH3T 3UJIL 2PF6A 3DPBA 4MS8D 4J28A 3QVAA 1RH8A 5I1DA 3PJSB 3PHAA 1T1WA 3FFCB 4TM9A 5J6SA 5GRZA 1MFCL 1WS8A 4I77L 4J3OH 3FPXA 4APXB 4KRNA 5J6HB 3CFNA 4XH2B 1ZJAA 2EIDA 2X44D 1GH7A 3FO2A 4F7KA 3KGSA 1A6VH 5DS2A 1XH2A 2VLKE 4X0KB 5C07A 3RB7A 1DDHA 1YVLA 2NY6C 1PAZA 4QJ3B 4ZFFB 4KFZC 1NBQA 2VMJA 3LSOA 3EYFA 5HGDB 4B3EA 3AUWB 3UTPD 2MNJB 3WEMA 3BZEA 1I1FA 3T0VA 3DETD 3Q3GB 1QLFB 1A8ZA 35C8L 3RDTC 3CTTA 3IDXL 2D7TL 3WGUB 1UD3A 3ILEA 1H15B 4M6NH 1IM3B 2F58H 3RPBA 4M6ML 3H7BB 5IV2A 4E5XA 1E4XH 4FXKB 5CBAB 1RHHA 1FZMA 3EGDB 5H4ZA 3LIZH 1CF8H 3T2PA 5JNYB 4KK8D 1AXTH 1OP3H 4O4YL 2Q3AA 4QRTA 2QZ5A 1PZ2A 1WYJA 5EA0L 4HS8L 4M7LH 3ZKND 4IOFC 1X3DA 3C6LD 3BUIA 3BKCL 3RIFK 4LHUB 2BNRA 3TCLB 3VYPA 3EJCA 5JR1L 4KI1A 2CR6A 5BV7L 3RB5A 3QUXC 2EO9A 3K2KA 1CUOA 1GGTA 4XBMA 3TBVA 4BGDA 1SN2A 3DSNB 4N0UB 3QDMB 5IVXE 4XPGL 2YSSB 1ZHNA 3EFFA 4GKZB 5TTRA 2X6AA 1QSFA 2BW4A 1HE7A 2BMKB 1S7SA 5CFHA 3WTVA 5GRWA 3BPOB 3Q2WA 1Z5LB 3B6SA 1TCRA 4YFLF 2IPUG 2H26A 1LQSR 2B59A 1JXFA 2AXGA 2FO4B 2EE6A 4X4XA 1AD9A 4JQIH 4CJ1A 5I73B 2NX5E 3B9DA 3BPLC 3U7WH 4AENA 4J6RH 2NR6C 3KPOA 1QZ1A 4CJ0A 4GO6B 1QFPA 4PUBH 3VI4B 1NM4A 1LYQA 1QBBA 4YNYB 3GSUB 3K6IA 1PLCA 3W5MA 1ET5A 4RH4A 4AK2A 1FJ1A 4JFZL 5TE6H 4XVSH 5FHAL 2Y6SD 3BH9B 1COBA 1O0VA 3ARFB 4E9TA 2CDEB 4GY4A 4L8CA 3O6ML 1AC6A 3CDGB 3IAQA 1YEJL 3UAAA 4PR5B 4NO0A 5C6WH 5L4IA 2BOBA 5I66A 1NCDL 4GW1B 3KXFD 4MB1A 1ZLWH 4DQAA 3F7YB 3S8GB 1I8MB 1S3KH 1SXNA 4HAKA 2FB4L 3VE0B 4Z77B 1AR1D 5D93C 3T08A 1XAKA 5I9QB 2GVYA 2WVUA 3QGVA 3EH1A 4ODSH 2OMZA 5DC0A 1DQDL 4MQ7B 3UTQB 1NANI 2WKOA 1E4HA 3MV7E 4X9BA 4AVJA 4B0MB 1MW2A 4H5SA 2BXYA 4AMKL 3EUUA 4BH8A 1WAPA 1IRAY 1J8HB 4LSPH 2WKOF 4HJJH 1TTAA 3JV6B 1YG9A 3IMBA 3FQTA 4WLCA 5CZVL 5LXVA 3UG5A 3CZNA 3H9SD 3FQXA 2OTWA 5ALBH 4MGXA 4G1EB 5GS2D 2PP9A 1FG9C 1S4IA 1KCRH 3MA7B 4F2FA 1H6UA 1IAII 1LEGB 5IFHL 3D34A 3ILPB 3VQMA 4E41E 3U79A 1WIOA 4NPJA 3VFNB 5I8CA 1FVCB 1K2DA 4NKDA 5CZXC 2J4WL 3P3RA 3PWPD 4QR7A 2G75A 4NFDA 2IPUK 2JJSA 3EYVB 5GGVY 4ZXBB 2ZUWA 4NBYB 5D8JH 1WFIA 2WLNA 1A1MA 1P7QD 3QUYA 1ZS2A 4FFWD 5FWRA 5CM1A 4Z3GA 4JPVL 3AAZA 1KGUA 2H8PA 4OD1L 2OL3A 2LW3A 4OY9A 2JKSA 3HC4L 3A6OA 2WXNA 4ZRGA 4N3TA 4R4BB 3D4GA 1M7DB 2NDFA 5CSGA 5IQNA 2OL3L 3SQOL 5JLZB 4WW2B 4IRSA 4X7EC 1H8NA 4IIZA 1HHIB 1XB8A 5KSAD 1J9RA 1FYTA 4Y4KA 2ZT9C 4ERSL 15C8L 1J5CA 1F3DJ 1L9QA 5B22A 3SYOA 1Q9LA 3QQ3A 1QFHA 3SE9H 1PZ5B 2ESVB 1MCWM 2BHYA 4FNTA 1A9BB 2BSRB 4YUEH 1A4JA 4UMGA 3PGDB 5B39B 3CN2A 2FQFA 4N5ED 5SWZB 4AZ8B 1RULH 1OTSC 3DECA 3IFPA 3IKCA 3GMOB 3FT2A 4P2QE 1UH3A 4HHGA 4BZYA 4ZYKA 2GABA 3VTTA 1GJWA 3CSFA 1XIWC 1JIBA 2WXHA 4R7NB 4OW6A 1HZHH 1X9UA 2ZJSL 1FGVL 2ZWZA 4GRWH 3GHEL 4QRAA 1QR1A 1B4RA 2BVEA 4FJ6A 1FFOA 3WN6A 2WV3A 3G6AA 4PG2C 4R4NC 3TC9A 3O8XD 3RVUD 3U2IA 2IANB 2KL6A 1FG2A 2FR4A 2J8UA 4F3FB 4LLYB 1R4XA 3V4UL 5DJ6B 2XIDA 1ZT4B 2XVGA 1HTYA 1R3LA 2J8UF 2QT6A 4I3SH 1L3WA 3AUVA 2Y5QA 5DRWB 4DFHA 2VLRB 5D2LE 2P8MB 2TSAA 2BSSA 5BRPA 3B2VH 4HT1H 2IWFA 3MV11 2WLIB 3ARGB 1EXHA 1BIIB 4AH2B 3DTUB 3OKYA 5BQDA 3SZ6A 5C08D 3QORD 3ZO9A 3F00A 5IP4A 2QVMA 4RX4D 4BSVA 4NZUL 4QAMB 5F7LB 4LARH 4TNVF 4XNMB 1BM3H 2OTUA 4MAUH 2J88H 1CVSC 1CO1A 3NT0A 1BMGA 1E28B 3O2WH 1XF1A 3F6IA 2ITDA 4LP5A 1KTLB 4J4PA 4KJPD 5D70H 1OLLA 1QMUA 4FE9A 5HHPB 4P3CH 1SUHA 4HWNA 2VZUA 1OTUC 4FI6A 4MA1B 1W2KT 1WAAE 1ITBB 1KB9J 3RTQB 1DN0B 3VU1A 2TRHA 1KYOK 2MQGA 4DGWC 3BFQG 1EDQA 1XF4B 1CZ8H 3GLDA 4IIQB 3UZQA 3MRKA 5I74B 2BJML 1KV3A 3U25A 5I1IL 1IM9B 1OZUA 2Z0BA 2ZIDA 1Q90A 1XCQB 3OMIB 2A4CA 3R06B 2D7PA 2EC9T 3AGVA 1AZUA 1I7UA 2ICWI 4JFEE 2E56A 4RSVA 1IQDA 4OVUA 5GSRB 3UTTB 1CT8A 4U6XA 3ARBA 3CFEB 5K1NA 5DC4B 1IL1B 3CVHB 1KYAA 1S7VB 5C0JA 1X44A 2CE6A 4WI3A 1GGIL 3L1FA 3OWEA 3VRLF 5EB9A 4ES8A 5KS9B 3L4YA 2W91A 1SVCP 1M3IA 4G8GD 2QZQA 3L81A 4H25A 2JELH 5T5NG 3OZ9H 3SE3C 1BQHB 1A14H 3CSYA 5KG9B 5C6PB 3UBXB 3C5SB 4MA8H 4N24A 2R8SH 5TF0A 4JFXB 5G55A 1QBLL 2R69A 5EPMB 3GXTA 3ZDXB 1CDBA 5H37A 3RWIA 3EH4B 2Q0ZX 5B38A 5CHNB 3G5YB 3SDDD 5EBWA 4BHUA 1QI5A 2P44B 4XN4A 5T3ZD 4PLJC 1J0ZA 5CR8A 1JL8A 3KHOA 2MCAA 3O3EA 1DZBA 1G9HA 4UOW0 3BIKB 3QDJA 2XPZA 5D7HA 4KX7A 3VXSD 3DWTA 2NYYD 1O7VA 4PAZA 4BSWA 1EAOA 4Y7MA 5FFOA 2OMYB 3TFBA 3S4SA 2WP3O 4Y5YA 3KLLA 4JG1H 3OKNB 3LNHA 4E9VA 2QVTA 1ZGLP 4HS6A 1HSBA 1UXMA 4HISA 4FADA 3VXTA 1FPTL 4XAKD 4WV1A 4R7XA 3VI3A 3WKQA 1DCEA 3UZEC 2EYRA 1D5BB 4IW4C 3VI3F 3MRGA 2X9ZA 3TBWB 4DO6A 4KNUA 4GG6E 2IADA 5D7SL 1II4E 2QSCH 1UXSB 4LLDA 4L9DA 4NDMB 5TPWL 3I9AA 3OD3A 3T6ZA 1E5ZA 3ATFA 1YEIH 3H3KA 4PJHA 5CU5A 4RCAA 3GIZH 4QUOA 1KG0B 3JUZA 1MRDL 2FAUA 3G08B 4PJHF 2XKUA 2C3WA 1VCAA 2GI7A 3S37X 5GGTA 2VABA 2XWRA 4BQ9A 3FRUB 1ZHLA 2WNXA 4OFDA 1TQCC 2E46A 2JH2A 2QGDA 4Z8FL 3X11A 2BNQA 1OGAE 4FMKA 1CGVA 3K5SA 2WQUA 4A6YA 3QP3A 4EDWH 1XMWA 2X9YA 3HRZB 1L9RA 1UACH 2ZCHH 1ZV9A 2B0SL 4OAWA 4NUGH 2X7LA 4A6YL 5B8CB 2DWDB 3TEXA 1I1RA 4X9YA 4UM9A 3V0AC 5IT2H 1QATA 5DR5L 2HFGH 2CLVB 2V7NB 1JUFA 3QO0B 3N1QC 5GSVB 5ES4B 4PB0L 1NMCB 5EZPA 1C7SA 3FT4B 4OLYH 3NEXA 1HI6B 1OIOA 4YAQB 3EDKA 5TFSL 3ZKMD 4A37A 5IROD 5J12B 4KVNH 2ZWYA 2HRPL 3C5ZB 1UD8A 3WIIH 5F21B 5J5EA 2FX8H 5FYLD 1S9WB 2A6IA 3WDHA 2YRBA 4GMSL 4N3UA 2MHAA 5T1KA 5DK3A 4QRPD 4XB8A 2YRLA 2WWOA 4P07A 1UKSA 4H8WL 2E9WA 2R2HA 3WXWL 3HHRB 3VWKD 5DZLA 4UQ3A 4GIOA 1E90A 3L5WA 1RP8A 2R0ZH 5HPOA 4GRLC 4K94C 3RHWF 2HP4A 4M48H 3L17A 2Q20A 3FCGA 1I82A 1ORQB 2E86A 5EU6D 1EHKB 1LDPH 5JPNA 1Y6MR 2X70A 1QWHA 4G6KL 4EBQH 1UCBH 5A2AA 2FO1A 2VKXA 4FQXC 5I26A 1EAPA 1QHQA 3OC8A 4LO9A 1YNKL 4KNQA 4D8PB 4HLZG 4PRBA 4PV9B 3C5XA 1JRHI 5FO9A 1P69B 3N40F 5HDOA 3KLHC 5I1AB 2Y2TA 1EWHA 4IKKA 4N85A 4UOQA 2XG5B 2XTJB 4PJDB 4L8SC 4Y5XB 4NQEB 4WNSA 5T33H 3ALXA 4TUJB 1F2XK 1CQKA 5JIDA 2B7DT 3EYOA 2BX5A 3PG2A 4EI5C 2I9TB 1VEMA 2X4QA 4F7MA 2EDHA 3O45B 2W9DL 1WH0A 5DRNA 1A3RL 5JZ7C 4XHJD 4Z7WA 5CXPA 3VSVA 3S5LB 4GUPB 2W80C 5CP3A 4XMXA 5E99L 2Z35A 2O72A 5DVLA 4LLUA 4XPAL 2VWEC 1QPXA 2HT4D 3LIUA 4MZ2A 5DFAA 5I1LA 2NTSP 5DEGA 5C7XH 4NN7B 5GGQL 1URLA 2BC4B 1DE4B 2H2SD 4FX5A 3EKCA 1SEQH 1YPZF 5I6LA 1CLYL 5JW3H 1TTCA 1N3NB 3VFPB 5LO7A 1HHKB 2OMUB 4JFPA 4BGLA 1SVZA 4G82A 1N5AB 5DD6B 3Q6FA 3UTSE 1UGKA 2IG2L 2A74B 3CCHB 5FM8A 1NDMA 4PREB 3WO3B 4MB4A 4OH2A 5DSCA 3D1MC 4K2UL 4CMMA 1FAKT 4P4RB 3TN0D 1KPRB 4HXAH 3U83A 2K9UA 4MJ5A 4OB5H 5KSBE 2IIJA 2AK4D 3L9RB 4Z76A 5J11C 2UVFA 4IJTA 4AQ1A 4CNIA 1QASA 2Y5TA 4HKXA 3D7PA 1BVKB 2EC8A 1O6VA 4BFGA 4PCSA 1CICD 5FHBH 1DBBL 2VDML 1GIGL 5AW7B 4BA8A 2E3VA 3DC0A 3T3PF 4D9RD 4DPAX 4DQOL 4EKXA 2WJ7A 3IU3B 4BDVB 1IEBA 1X5HA 1J5IA 4FFZA 1E7UA 2V5TA 4X7TB 4ODBD 4M93B 5ACZB 4Y16D 2Y0SA 1ZAGA 4FFZL 3QZWG 2XRAL 3GMRA 5IK3B 3FBKA 1RXLA 3DYMA 2PCPB 2JKLA 2M1KA 4MJJA 2DTMH 2DI7A 1JWUB 4GKSB 2IQAA 1P53A 2VAJA 5LAXB 1OB0A 1WWAX 3NJLA 2Y24A 2VRKA 3BUYB 4DOHB 4KVCL 1WWCA 4B7IA 1VACB 1F4WL 5GIRA 3ECBB 3OLEA 3BZDA 4X6DE 2X41A 4Y4FB 2VJ0A 1M05B 5AEAA 4A7QA 1G4MA 1SLUA 1KLUA 2BRRL 1F6LL 3PGFL 3PIQA 4DKAA 3GEWB 2ZOWA 3SB3A 2YD2A 3MBWA 1ZLUH 1I1AA 1JI2A 1EEYA 4FHJA 4A1RA 2G3XA 4NRXA 2XNAA 4LCWD 4YHZH 3JWDC 4JRYA 5E2TL 3HI1A 1MNUL 5FA4B 4QLRA 2A9CA 2CUAA 2QADB 1PFOA 2NNFA 3ARWA 3IT8D 2UY6B 1SYSA 4FLOA 2YEZB 3PYCA 4GLRH 4HLZH 5DJXA 4KXAA 1QFUH 4XX1G 3G04A 4I18C 3QEUB 4OZGA 3U82B 4XCEB 2PABA 3TNNB 2V9QA 3GRWL 1CL7L 5TQ2H 2YPLA 3KR3H 3RX7A 1SQ2N 2D3VA 4OZGF 4WAFA 4YN3A 1CGTA 2JB5H 4L4TE 5KVGL 1B4LA 5KANG 1JPSL 4WK2B 5C07D 1AZZC 1NCAL 4HK3N 1R5WA 5C3IA 3QPKA 2NNXA 2B8OT 4WDIB 4ZJ9A 3STLB 3US9A 3OZLA 3ROLB 5E2UL 1TTBA 3LHPL 4P2RA 4TQHA 1GVIA 1ZWIA 2QJDA 3ILQC 4LL9A 2AQ3A 3T1FA 5BZDA 1FC1A 3QXUA 1N0LA 1SXCA 4NP4H 4S1QH 3VNYA 4LEBA 9PCYA 4K07A 3TO2B 5HJGA 1A9EB 4HPYH 3CHOA 2R0WL 1AYOA 3FUIA 2QKIA 4OCSH 4PJXA 4LLWA 4D7BA 1PZUB 4GQ9L 3X12A 3T4YA 4WK0B 3SZKC 4FA6A 3AREC 4PJXF 3D0VB 4HV8A 4OSUH 2WTPA 1YUHA 4O58L 4FP8H 3FFCE 3N9GH 3ZYIA 5JA8B 3GUTA 1X7TA 3TZVA 3MDJA 1AO7A 4B9YA 2BS71 2F61A 1E3XA 3OKKA 3CFMA 2BNRD 1RCYA 2GBAA 1H8OA 1OSPH 1KIRA 3NBNA 3MLTA 4GYBA 3VG0H 2PXYC 3H8NA 3THMH 3TJPA 4JMNA 2P5WA 2YXFA 1CU4H 4J3OF 1I7RB 1A1NB 3UGEA 2XIBA 3KPSE 3EHBD 3UG3A 5I6XC 3MXVL 2R56L 1T1YA 3QXAA 4GG6F 4HGMA 3P9LB 1A6VL 3QHFH 1QSFD 3IJ7A 5E0QA 3SOBH 1GW6A 3TU6A 3ULUH 3WMPA 5C0CA 5E1GA 2GHZA 4KXBA 1NJ9B 2VSKB 2R4RL 1RPKA 3FSVA 4XZ4A 1FDLH 2FJHB 2WAQA 2EXTA 4TNGA 2H45A 4MYPA 3UAFA 1YEEH 2QLVB 5D5MA 4AUJA 3T0EB 2XETA 3L2NA 3GMLB 1D5XA 1U3JA 3CU1A 4G6FD 4N0CC 1MIEH 1G94A 5D5MF 5C97A 5LB1A 2AANA 3LIZA 1NSNH 4X5RA 2VKWA 12E8L 3MBEA 3KPQB 1EZSA 4WJG3 2YRPA 1I8UA 1E4XL 1T4KB 3LIZL 1MELA 3JWDH 4N1CA 5JMRA 5FDYA 1E5YA 4MSWA 1OT2A 5G5DA 3KCWA 4CW1B 3BRFA 1DVQA 2E9IA 3HZMB 3T3MB 2J20A 2ZCLH 3MFGB 4NO0D 4PRIA 4OV5B 2JB6B 4HKZB 4ANXA 4YMPA 2FJUB 1E2WA 4NZDA 1FWXA 3ZMNA 1WDAA 1VFMA 4RFEA 4NZTH 3IU4L 2FYVA 4FYQA 2FUTA 2X12A 3QQDA 1NEZB 2LABA 1IIIA 2XWCA 3L5XH 3F62A 5LUMA 1WCBB 4DFIA 1WT5C 1MEXL 3ISYA 5EIQA 3BCDA 3FH8A 3FSAA 3JBG7 2LTQC 2UWEA 4UQBA 3K6FA 5LBVA 2YPKB 3LRKA 1TZAA 4MD5A 3HVNA 1G9NL 2F0CA 2UWEF 3MOAH 3NP3A 3PPSA 1U92A 4P5TA 4JQIA 2ID5A 3TEUA 4OUUA 1GYWA 4NO3B 4AIZA 4JQIL 2X4TB 4HKBB 5DJAA 2RFXA 4IRJC 3QK0A 2WYZA 5EIIA 5TE4H 3QE5A 4Y19B 1A5FL 2VZOA 1M2VA 3FK3A 4J6RL 1RAMA 4KXZI 5DLMH 1QVOA 4KKPA 5D6CB 5D7KD 4WJ5B 5IB3A 3HRPA 5I75C 2GITA 1K85A 3U4BL 3QJFB 3QUYD 4M4RA 3F7VB 2AJ3B 3CQFA 1MHPL 3VCLA 5H94B 1WV7T 2D8KA 3MI6A 3QIWB 4XVSL 3RIFF 4EIZC 2WXJA 2O5ZH 3HFMH 4PV8B 3OMAB 4KRPC 4JFHE 4IRSD 3DMMA 1X5KA 4G5AA 1FYTD 1P5VB 3II2A 3SJVB 4Y4KD 5BW7A 3AJ7A 4FLSA 1J8HE 1S3KL 1Z0NA 3D69B 4K71B 3SCMB 4HMEA 5DU7A 5DMIL 3CBJB 5EN2A 1XHHA 4HGWB 3MPCA 1F45A 2OSXA 2H6PB 2TRYA 3ALWA 3RVVC 5E56A 4ODSL 3LQZA 1EAQA 1HCYA 1JVKA 4TQEL 5BS0B 1BFSA 3W9DA 4OIBA 5FUZH 1JS4A 4GO9A 4HJJL 1OSEA 2F7OA 4UMSA 1TKWB 3CFKA 5F0PB 4DWHA 3DVFA 5ALBL 3WJLA 2WBJC 4A2FA 1N64L 2N01B 3VXNB 2J73A 1OP5K 4NAJA 2WCPA 4JO5A 2J1ZA 3VACA 3U4EA 1E6JH 3DROB 3GM8A 4XZUB 1QUPA 2DV6A 3TTYA 3BT0A 2VH5H 1MRCL 3DUUB 4HJIA 2BSBA 3QJQB 4JO1L 3BN9D 2XVBA 3CJJA 3QDAA 3UTZB 3VTMA 3QFJA 3T6QC 1NGYA 2CO7B 5D8JL 2GYSA 3QRLA 4U1KA 3INUH 4OZHB 4H8WC 4XXDB 1KTRL 2ESVE 2Z7WA 1DSYA 5FOBB 3A24A 3GB7A 2H3NB 3ETSA 1LD9A 4BWTA 4DERA 4YC2C 4XMLH 5FECB 4MXWL 3VXPB 3IB4A 1G7JB 2WO3B 1P4BH 4DKEH 3ET9F 4XR8C 5IM7A 3QNFA 2OMWA 2CBQA 1SMAA 3DLQR 1UVQA 3L3DB 2O5YL 1FZKA 1PAMA 3V5DA 3ZMRA 2CUIA 3SE9L 1OWWA 4LRIA 4NCDA 1EA9C 2ZSWA 1CFVH 5MHSD 4HMDA 7TAAA 4M9PA 4J4PD 1BV8A 1AZRA 5IQ9A 1UB6B 2M83A 4RA3A 4HIIA 3GXMA 3OXRA 1S7UA 3DYOA 1NAMH 2GB2A 2IANE 5D96C 3RWHB 4UOZA 4DN3H 3H3PH 3UFIA 1OP5H 2WY3B 1HZHL 4AGOA 3HAEB 3X1EA 4GRWF 5FYJE 4PJ8C 2C1OB 2VLRE 4RA0C 2FX9H 2NY3B 4LLQA 4HUUA 2F6AA 1QRNA 1QWUA 3ECVA 5BMFH 4XI5C 5ITBH 4G7RB 3MODH 1DO6A 3PWVA 4TS6A 3FB6B 2J7LA 3ARBD 2AXFB 5GJSH 4I1NB 4BE6A 2PCFB 3OB8A 3OJVC 3GZKA 3RNQB 1XBDA 4O9HH 3FB8A 5TGBA 3FFDA 1E5BA 1SEBB 5CZRA 4AMWA 4AYID 4IJ3C 5D1XE 3F58H 1YA5A 2CZNA 3QAZC 2EH7H 2SEBA 2NUTA 3WE6A 3B2VL 3DXAB 3NACH 2D73A 2XKNA 4JRXB 3RVXD 4ZOBA 4RWHA 3MGOA 5DLLA 1LXMA 5E1HB 1OCRB 1TVBB 4J23A 5EEXA 3Q06A 3F83A 4YDKL 3KYOB 1H3VA 3K8LA 4LSRH 2RQ8A 4ETYA 5DJYB 2Y2WA 2CGRH 4LARL 5BOZG 4FQ2L 4ZDHB 4AYFB 1BM3L 2J88L 2YC1B 3RZCA 3X1BA 1DN2A 3QDJD 2Z65C 5D70L 1NUGA 4LSSL 2VCOA 3C08H 5I5RA 1AKJB 1LO5A 3MZGB 4P4KC 4Y2OA 5EULV 1CN4A 4HEMA 2VDRB 4J2XA 5AKSA 3MLUL 3HTLX 3AXHA 3QAQA 2FWLB 1TLKA 1TXKA 1CZ8L 3WN5B 5I8KH 2XZZA 5KS9E 3Q2NA 4KVPA 3KJ4C 3M1BA 1PD1A 4IMLA 2VDOB 1NGZA 3T2OA 4PIBA 4KKCC 4LVOC 2K6YA 4UILH 3REVA 3IDIB 2X4SA 5E8PB 4ODTL 1F02I 4MQXC 3AC0A 3PV6B 2R2BB 2BIIA 1HYSC 3L9BA 2FJFA 1IVTA 1KEGH 1NCIA 3ZDXE 1WZKA 2CR3A 4Y9CA 5A43C 5I6MA 2YD6A 4OFVA 4CC4C 4ZI8A 2D9CA 5HVHB 4K5OA 3R1GH 2JELL 4M5YH 3APDA 1A14L 2XDHA 4B60A 2WXFA 4UQ2B 2R8SL 1BZEA 1VSCA 1U93B 1C08A 5C0BB 1IAIM 1T1ZB 1S9VB 2BNQD 5KBKA 1C1EH 1DYZA 4NENA 3N43B 2KQNA 3IFLH 1RFDH 1CE1H 1V8HA 2X09A 3ZRFC 2EDWA 3DBXA 1JK9A 3MJ9H 1KXVA 3GD1C 4HUKB 4P9ML 1T6WA 1OP4A 3QUKB 1UD2A 4TSCH 1BZOA 3UG4A 4Q74A 4UM9D 5L4FA 1K5NA 3ORJA 1MHCB 5IREA 3NJVA 1F90L 3PFUA 3KVQA 2YPVL 3NCXA 4GKNA 3MRBB 1XF2A 1F86A 4HHAA 4G43B 3UPCA 4NKMB 5ICZA 1OCZB 1YECH 2N56A 5IFAH 4G7YH 4ICWA 5C09A 3BFOA 3VRJB 1PTZA 2X3BA 1HHJA 4ANUA 5T1KD 3NIFB 2GTZB 4E9LA 1GAFH 4JFFE 1HZKA 3BVNB 1L0QA 4PVNA 5HDBB 5I8EA 5AVSB 2JQZA 8PAZA 2EIKB 1BLNA 3NCWA 2OQJB 3FUFA 3HNVH 1NLDL 1SOXA 2CXGA 1UD6A 3FCTA 3AT0A 4JY5L 1RZKH 1GGCL 1ZA6B 2EEFA 5F93C 3SPJA 4FLHA 4ZSOB 5TE7H 3SDAA 3QZLA 3QQ4A 5EBLB 3EDDA 3SPVB 4Z1PA 1KWGA 2YD3A 4G9DB 3D5OF 4B7LA 2GEQA 4Y2DA 3S3DB 3L7FA 3QRBA 2FEDD 3I6LE 3CFIC 4ENED 5DUJA 4EDWL 4UDTB 2ZCHL 4NWTH 4RAVB 4G11A 5GS1B 3LXAA 3A22A 4NUGL 3VYOA 3PWUA 4GG8B 5DMGD 4M5ZH 4WVRA 5DJCB 3RG1C 5IT2L 3VA2C 5ENWA 2HFGL 4F24A 5A6LA 4MJIA 3LY6A 3DRTB 3L3OB 4JRLA 1ZK9A 4X5LA 4UTAL 4Q6IA 3O41B 5KBLA 2NY1C 2QDWA 1E4WL 3MNZB 4IKJA 4H26B 2VR9A 3WIIL 4F8OA 5IFJA 5FGCB 4KO7A 5DQ9B 4P46C 3IDYB 3BGMB 4H20H 1BZ7A 1NEPA 1T0PB 3S2CA 3VFSA 3N2JA 4F7CA 1BZ9B 4PFEA 4UBDD 5EOQL 3SKNB 3IVKA 3KYNB 1UT1A 1AI1H 4N2OA 3QO1B 4H1LH 4X5WA 2V2TA 4KROC 5I5IA 1D6EA 3WNPA 5JORB 5FKAB 1I1YB 2R0ZL 5KW9H 1YNTA 2AC0A 5IOPB 1BEXA 1J88A 2XTJE 4PJDE 5DDHA 4M48L 3C8KA 3CC5B 4NQEE 4XNAA 2H32H 1L0YA 1YNTF 1X5JA 3W2DL 5DFWH 4CBPA 1UCBL 3CIAA 2VQTA 4JG5A 1WBXB 4ODHL 2E9GA 4FI7A 5ICUA 1RZJH 1XGYH 4U6HB 1CPUA 3KYMA 5T5NF 4TV3A 5GISL 4KTEH 2R83A 5FB8A 5HY9B 4XXCA 1S7WB 3ETBJ 3KLAA 4E0RA 3OX8B 2BFVH 3T0XA 1LLAA 2DQUH 1QEWB 4OM1H 4C55A 3WFDH 1P7KB 1ODAA 5E8NB 3QEGH 2DLHA 4BK5A 2V8MA 1B0WA 4Y4HC 3BQUA 4JFYB 3DHMA 4WCYH 1JZJA 2MMXA 1C12B 1S9XA 1GCFA 5CSZA 3ZTEA 4JY4A 1N0XH 2WINA 5EORL 4HDIA 4LL1A 4HYTB 3EBIA 2MQ3A 4P23C 2EE0A 4QOKB 4Z7OF 5C7XL 1INQB 1G9NC 5AD0A 2NQ3A 1SEQL 5DHXB 5JW3L 2WIMA 1CDGA 2WN3A 1M6OA 2XBTA 1JWMA 3LV3A 4UWQB 4Y5VA 4C58B 4HCIA 4NRYB 3S36X 4IYKA 5DYOA 5HYFA 1FCGA 3QUZA 1WA0X 3BI9X 1XCTB 5E1AB 1JV5B 1Z7JA 1J0YA 4L4VB 1I1AD 4MXQD 4KXDA 4HXAL 1UH4A 3KDPB 1EMTH 3EYQC 4GUCA 4JRYD 4JJ5B 5C0AA 3ERXA 3V6ZB 1I7TA 1MJJB 1DEDA 1TEYA 5DVPA 3VD3A 1HNFA 2Y1ZA 2APTA 4ANWA 5E6ZA 2XQBH 3UO1L 3ETTA 3S35X 2YPLD 2PPCA 4DZ8B 2NY0D 2R59A 3AXLA 2ZYRA 4L37A 1DLHA 3QPQC 3GDCA 5CGYD 4K7PX 1KCBA 2VM9A 2BVPB 2OSYA 2R1WA 3BVUA 4DOHE 3GMPA 4QJ4B 5KVEH 1AOHA 4XWGH 1T5WA 4Y1AA 1HEJC 3ES6B 1RURH 2ATKA 2JJTC 2OMVA 4ZTEA 3WIFB 4P2RD 2OMXA 5ETUA 4NJ9H 1CXEA 3HKZA 2DTML 3A4AA 1QLRB 4FHBD 1QFWH 2H47C 3DGGA 1P4IH 1X6NA 1WFUA 4TSAH 3B1TA 1FAIL 3EJZD 5IBLC 1OOAA 1YN6A 2GJPA 3ZQXA 5LLIC 3CSPA 3FAWA 4Y9FA 2HPTA 4LKXA 2YGOA 3QYCA 5CLTA 4EPSA 3B7UX 3A6BH 1JHTB 3A47A 4FL4C 4UANA 1XB3A 4FYTA 4X9FA 2HFFB 5CINL 3TO4A 4F27A 5FUCE 4RZKA 5E6IA 1YC8A 3TTSA 3TBCA 1CR9H 3TZVD 4HZLA 4DTGL 4TNEA 1AO7D 2FSEA 4YHZL 2HJKA 1MCKA 5I1JL 2HG0A 4ELKB 4YDVB 3WKNA 1TSHA 3GJFB 5JTWA 3G6JA 2ORBH 2X9WA 3MRCB 4AQEB 2XWJA 4J3OD 4X0NA 3V5HB 2NZ1A 1DBMH 1QFUL 2J2ZA 2QHRH 4MDIB 2ZKHL 5FX3A 4LEOA 4G83A 1WGOA 2DBLH 1ORSA 2AV1A 4NHCH 4S0SD 1XEUA 1I4FA 2P5WD 3F3HA 4LLAA 5CBEB 3SO5A 4GXUN 3GS4A 3KR3L 3BKJH 4EZMA 3PWNA 1TPXB 4GXFA 4Q6KA 1CE6B 4YXLH 3L3JA 4ODXA 4PGDA 2OK0H 1FFPB 1BWMA 3GSRB 4ZUVB 1TOXA 1R3KA 2GJJA 3NJNA 5C0CD 2OR9H 3U1SL 2VDQB 3QNZB 4U33A 3HB3D 4XBGB 4K73A 1KBBA 2ZNWA 1N5YL 5CN1A 1H5BB 2G5UA 1USQA 3MUY1 3QEQB 3NIDF 4KJYA 3FPYA 4NP4L 4EJ1C 1WBYB 1E8YA 4R2GD 2PWHA 3DOIA 2D03H 1HH9B 1SN5A 2GBTA 3MBED 3B56A 5F6IB 1GA2A 4JJOA 1MW0A 4P59H 2ED7A 2VXQH 3QS3A 1F11A 2BOCA 2V4LA 4HWZA 1XF3A 3KM2A 4OJDH 2N1KA 3DX7B 2VNCA 1LM8V 4FGMA 4FP8L 4HAFA 4LCCB 5CSBA 3H7LA 5KYYB 2IF7A 2YD5A 3N9GL 4NHUA 5DA0B 5DVOA 5FOJA 3NJGA 3V0JA 1F4AA 2WM0A 5T1DH 2YJLA 3BWAA 4PRID 3FSWA 4QMEA 3BPNB 3OXSA 2X4UA 4U3SB 2QTVA 1ZS8A 2IXQB 3QXDB 4I87A 4JCLA 4AV4A 3GJEB 1OSPL 2WUCH 3FN0L 1AP2B 3D3VA 2EXWC 1NGWA 5B3SB 1HOCA 3QB7C 1JGVL 5C0NC 3EW3B 3AM8C 4G59C 3T0EE 3SDCC 3WKMH 1D9KA 3GGWB 2KDYA 3D25A 3L4XA 3PL6B 3RNKA 4N0YL 1KENH 3ULUF 3ULUL 5GRUH 1MIMH 3MTXA 4YHPB 4IS6A 3MRJA 4Y9EA 5H35B 4F33B 1GRWA 3QZWA 4P5TD 2WC7A 3SGKA 3V55A 4QRFA 1B88A 2VUKA 3VXUA 1YEEL 4GBXC 3QUHA 1GC1C 1BXXA 2ADIB 4MCZA 5E8OA 1QD0A 3MRQB 2HN7B 4BKLB 5FC9A 4OCWL 1DO5A 3LMJH 1NSNL 4G72B 2IBBA 1JZGA 3C09B 1DVFB 2XN9B 4WW1B 4XP1H 5K1JA 3U7YH 1T7ZA 3MRLA 4FG4A 3F7PC 3SPCA 3GSWA 3CFJB 3ZSTA 4CDHA 1JYXA 4XNUL 3HE6C 2YFNA 2HVKA 3MLSL 5JW5B 2F1BA 3ZU8A 3BZFB 3LRHA 5E7FA 4ZTOH 4JPIA 2JCWA 1WZ1H 5BVPH 4JQVA 2ZCLL 5I30H 1ZGLB 3DMMD 5CEZH 4H7VA 5A2CA 1KJMA 4ZMXA 1WICA 3FHQA 3BH4A 1IO4C 4JM2A 3P2TA 3VSQA 5F7YC 1G7HB 1TJGH 2J43A 2DWEB 1U3HC 1XD1A 1NGQH 3CC1A 1RVFL 1CFSB 1WVZA 4JM2F 4AIEA 2WGXA 4DUWA 4Z5RB 3B8YA 4MNHA 3Q2LA 1SYVA 4K5LA 1DQJB 3L5XL 4D9LH 4N0FB 2BP8A 2ZX9A 3W0WA 4FXKC 3AS3A 4LBEB 3MCYA 4PJ5A 4Y19E 1O5DT 4X5QA 4UDUB 4WU5A 4WWKA 2CUHA 1PKQA 3LD8B 3TM6A 2XJLA 4QT5B 4TVPE 4YQXL 2HSIA 4XNQA 2I5YH 1HWGB 1DFBL 2K70A 3QZBA 1ZY9A 3KWVA 2E8YA 4G5ZH 5ICXB 1AVAA 2X6CA 5D7JA 1YY9C 1FO0B 1S8DB 2MPVA 3BP5A 5ITFB 4HKJB 3SJVE 2IMNA 5DLML 3M1CA 3QFJD 3FB5B 1X6LA 2BVTA 3OV6A 4OF3A 5IBTH 3SKOB 4WF7A 2FWOB 5KYUB 3IDGB 1KIQB 1LNUA 1PG7H 2HZHA 2JIXA 4YE4H 3X13A 2BERA 5IB2A 3HG3A 1BQRA 3ZHKA 2G60H 4KZEH 4MD0A 4M61A 4L48A 4M3JA 2DY2A 3CDFA 4PRDB 4FQHA 5F9DC 4WI9A 2JCCA 3I9IA 1ZSHA 1U2HA 3OR6B 4FEIA 1BD2A 1RSFA 2CIKB 4U1MA 2JCCF 1V54B 3KPPB 4WSJA 1JZ7A 2R0LL 3CZFA 2XVKA 3RL2A 4HUXB 3PQYA 3P40A 4RAUA 4V33A 3UMTA 4R4FH 3W0WB 1N6QH 4Z7UB 1AHMA 4DZBB 4YL9A 4Z0XB 5LNGA 1MI5B 4CVXA 5IB5A 2X4RB 3K6NA 5F3BB 4G8FB 5FUZL 2HTKD 1KJ2B 3IXAB 4GMTH 4K3DH 2CCVA 3ARFC 1AGCA 3D6GA 5DURB 4MA7H 4HSQA 3ZZQA 2NY5H 5EO0A 4DH2A 5INCA 1YMMA 5AG9A 2L8AA 3BMWA 1AACA 4JHVA 3GO1H 1QTSA 4K23H 2GCYB 1E6JL 1QRND 2F68X 4ISVA 1JNJA 1JGEA 4KHTL 2IWKA 1HHGB 2YMTA 3MRFB 4W6XB 4PJFB 2CO4A 1ROWA 4LRNH 4P5RA 5I9QC 3ATEA 2ICWJ 2ZWSA 3TIDA 2DQMA 1T04A 1XGRB 1OM3L 3V6BR 2MTAA 3CFQA 4AIOA 5DO2C 3INUL 5JXAL 1HEZB 3O81A 3RFRA 2WXIA 1I53A 1PKOA 1BX2A 2B1OA 3IYLW 2L04A 1KCKA 4J3UA 3VFUB 1JHKH 1QW9A 2OJEA 4X9IA 3CN0A 4XMLL 4DGUA 5CS7A 5BRZE 2B2XH 1R17A 1P4BL 4DKEL 3QJTB 1PPIA 4G42B 4F9PC 3D08A 5HPMA 5IIEA 5BXFB 3M8OL 1U8NA 4X6BA 1O9VA 3T65A 1RUKH 1QKZH 5J4MA 4NERA 5ADOH 3Q7JA 2UZXB 1HXYA 3RZCD 3N55A 4MMXC 3O2DH 3DPDA 3W9EA 4XT1C 1DQIA 1Q94B 1NAMA 2D0HA 2J55A 1MH5A 1A7QH 4N8VG 4W9KC 4HJGB 1NAML 2Y7QA 3FQYA 3C6LB 4DN3L 2DQGL 2VMFA 4CDGC 4TF4A 4WW2C 5B39G 3OBAA 4LLVA 1MCJA 5HHMD 3SDYL 6TAAA 5MENA 2BHZA 4MA3A 1UKQA 1RL1A 3IJ8A 2XT1B 3B9KB 4WHTB 2QPEB 2I85A 4NM8H 3C9NB 5AYQA 3IJYB 1SFHA 1GZQB 4Z7VE 2F9BT 4EI6B 5IMMB 4M7ZB 5BMFL 3GM0A 4JRXE 4YHMH 4ABWA 3MODL 2JVUA 1JZ4A 3CBRA 4EVNA 2LV4A 3OJ2C 2WQVA 3BWUF 1PL3A 5GJSL 2WVVB 1W6WA 4UV7L 5KVFE 2QFPA 1FNGA 3I6KA 3SPHA 2AJVH 4J8QA 4QRRA 2BCKB 1DLFH 3BXNA 3F58L 1OO2A 4MNQE 4HCFA 3FL7A 2F5AH 1J9SA 3IE9A 4B9JA 2A5UA 4GKLA 2EH7L 5I71B 3S37L 4FABH 5FUOH 3JSSA 4OFPA 1OAUL 5GRYA 4DP9X 4PGCA 1XVSA 2P1YA 1KB5B 2XA8H 3I6GA 2B77A 3FO0L 1C16A 4ORGB 3F12B 2MWCA 1CLOH 4WEMB 2C7FA 4OGXH 2PO6B 5EC1A 2NNAB 4FFYH 2CGRL 5E9DD 1K8DA 2H3XC 3KLDA 3IETB 2FECL 2VZVA 3Q8EA 4XP6L 4A2EA 1MCOL 3SGDH 4MAYA 4DKFH 3LQAC 2F8VA 2DI8A 2JI2A 4ZPVB 5C8JA 5LXGH 4HUWB 4JDZA 3C08L 5A3IC 2OA9A 1SDDA 5CF3A 4LSUH 1GOGA 1OAZL 2J1KA 4YIQA 4B9IA 2FWSA 3D39A 4Q2ZA 5T3XE 3KJ6L 1AQDA 1EXUA 3DHJA 4YDIH 3ZUNC 3KXFB 4JGUA 1PW3A 3FTXA 5I8KL 4UT6H 3ARGC 2BFGA 5K9OB 2LLGA 4MAZA 2PWGA 3MRPA 4X4ME 5DRXB 3VXRB 1AR1B 3OLGA 3LNFA 3QC6X 2VIRA 1HL9A 4OBRA 3MRIB 5F3HB 5D1XC 1G4RA 4PP2B 4Z7QB 5E6SB 4ZT1A 3TBTB 4YR6A 1B9ZA 1BXVA 5C0BE 1ASPA 1TQSA 2Z92B 1P2CB 1F4HA 2B3IA 5KUMA 5EEUA 4MA1C 2R1YA 1JMXA 1JPEA 1L9OA 1IB5A 2R29A 4XPFH 1QRKA 2XUWA 2VC2H 4WHDA 1LK3H 3RTQC 4P9HL 3UEZA 3MO1A 4EI0A 3SDAD 2XWBB 3UMNA 3R1GL 4LMQE 2E7LA 2E9BA 4DPCX 1PJ9A 1KEMH 2R29L 4MCNA 5G4MA 4PWFA 3SE4C 4IIQC 2WBWB 4XBPB 5AUMB 5I74C 3S5ZA 5J1AA 4D0CA 3GI8H 4Y2DD 3CZGA 5C0GB 5E23A 5DJ8B 3FNKA 5HSFA 3PWPB 4JZOA 1PNDA 3MJ9A 1C1EL 2E27H 2HLFD 1I7ZB 3NCBB 3IFLL 1HNYA 4QGYA 1G7QA 1HSAB 4RZCB 1NFDA 4E2OA 1D6VL 1P7QB 4LLMB 5J9PA 3HR5A 1HQ4A 3OR7B 1NKGA 1RIVL 4JS7A 3X14A 1NFDF 2PR4H 5L2KA 1VKXA 1XGPA 4JHUA 1OZTG 5HDBE 3DYPA 4MJID 3B7SA 1MWAB 4EQ3A 1ZVSA 2R1XA 5CP7A 1J0HA 2V9TA 5EN3A 2VGLM 1OM9A 2VLJA 2WWNA 1YECL 4HOWA 2W65B 2OR7A 3G9VA 4CU8A 4M6AA 4HQQL 2JV6A 1T5XA 2BNUA 4LAQL 3CHSA 4YSUA 2IAMB 2NY6B 3WTSA 1GAFL 2JQAA 1UJ3C 2DIEA 3RWFB 4GRMA 3VGBA 2XV2A 2FCBA 4X83A 4C56A 4POYA 2NXYD 3LJ3A 5I0YA 4RLDA 3RY6A 1YDPA 4U1IB 3SOTA 3A5VA 3D2UA 1HKLL 1XZ0A 4JVWA 1AS6A 3HNVL 4HMCA 4NNYA 32C2A 2PWFA 5EOCJ 3S36H 1FLRH 1BOYA 3KWUA 3U2SA 2OX5B 5F7WC 4FNLL 4WGKA 4FEMA 1KCLA 4XVJH 4AK1A 2WYTA 1Y6NR 2X4NA 4AGLA 4KMQA 3STZB 3C2AL 3KM1A 1KGJA 3LRSA 4QXUH 2VM4A 2GTQA 2A9MH 3MCKB 4XPTH 4GQRA 4KJQD 3M17A 4R5XA 1LTXA 1K4CA 4GKOA 3P2BA 1A6ZB 3QG7L 3WJMA 2APVA 1M6UA 2HT3C 1VFBA 2OMTB 2RMNA 2YUWA 4NWTL 2NZ9C 3IPFA 1W72L 1S7RB 4M5ZL 3L1GA 2F53A 3GK8H 2Q86B 5FXCH 2V2XA 1TMCB 3BQUD 3MJ8A 2UZPA 5GS0C 3GBMH 2BCMA 3FO9B 3S6CA 1AQKH 3NJIA 3O6FA 3L48A 4IBTA 1MVFA 1BJ1J 4BQ8A 1CG9A 2R9HD 2FYYA 2ADJA 3HG0A 3OGOE 5FF6A 3UBGA 1WWWX 3SDXB 1O6SB 2Z3FA 3H2PA 3ECQA 2JJUA 4KKAC 4DEUA 2IDTA 1EDYA 5D1ZA 2V7HA 1AXSB 3PDOB 1F4XH 3SGEH 2DQDH 4GSUA 1DQKA 3V7AE 1QG3A 3E6HB 4D0BA 3RX8A 1MLCB 2YUVA 4PTUA 1OB1B 5ALCL 2FNWA 3PDGA 3MNWA 4N6RA 5KYWB 5B8CC 1KXTB 1IC5H 4N2AA 3EOAB 2PYEA 1WIPA 2H32A 3VB9A 1G5AA 1IFHH 1KYDA 4GNKB 3UDWA 3QUZD 3WV0A 2EEXA 1FSKB 3OMNB 2IBZX 3DX6B 4G6AD 4WU7A 4UU9B 1B2YA 1CLCA 2X89A 4J5VA 5J12C 3ZK0A 4TUOA 4F20A 3FT3A 1FFTB 3C5ZC 1JXKA 1RZJL 1CFQB 1FZJB 3FH7A 4KKLD 4KTEL 5C0AD 1PF3A 1ZHKB 4NUJB 3LDBB 1MQKL 1FRGH 4N2GA 5BO1H 4TULH 3IGAB 3HG1E 1QA9B 2EINB 1FHNA 3CDCA 4XCNB 4Y8AA 5K5YA 2F54A 4QHUB 4U1NB 4WFFD 1HC1A 2RJMA 2W88A 5GQBA 2ICEB 5KBDA 2IV9A 1IGTB 2BP0A 3TEZA 1JV2B 1MCQA 2G9HB 1E8WA 1KZQA 2W5PA 2WIIB 4LGPB 4NFBA 3AWEA 4ZPTB 3W38A 3IMTA 5JOFA 5HI5C 5FCUH 4NWUH 4WCYL 5KBMA 3S88H 2AJUL 4I0PC 4IU2A 3WHXA 4LFHG 4Y1AD 4TOYH 1OGPA 3ZKSD 4L18A 5KYXB 2FDBP 5JYLA 3H6JA 2IEPA 2P52A 1KDJA 1HL8A 4HZAA 3TX4A 5FGBC 3BP7A 2BIPA 5DI8B 1OWRM 1JDCA 3WS6A 5ADPL 4L4VE 1MLBB 2XTJC 1XSOA 4N8UA 4PG9A 4NGHL 4Y5XC 3HC3H 2MFNA 4P3DB 3FQNB 1IC7L 2RCSL 3HE7A 3QA3A 3L1EA 1QHOA 3MRMB 4ONHB 1AG0A 1NBZA 3TO4D 4TKWA 5E6ID 1U8PA 1FV1A 2IGLA 4TUKH 5F89B 2CDGA 2NT1A 2AABH 4GH7B 4QF1A 5EZLA 4OIAA 2X2JA 1N59B 2OXGB 3U0WL 4V2BA 1MCSA 2FK9A 4HPOH 2UXVA 3KAAA 1VGEH 5EIVA 1FNEA 4HUNB 1IAKA 3GS0A 3GWJA 4QXTB 4KK9C 4HCRH 1XR9A 2XQBL 3HLAB 4P2OB 1ACZA 3FHAA 3EJYC 4LOUD 2XYCA 4HJSA 2YFOA 2VLLA 4HD5A 2EDOA 3PWLB 2A74C 2JI3A 2EIZA 4N2KA 3E9UA 4JKPH 4ZUSB 3HZKA 1EGJH 2XICA 3V52L 5F1IB 5LDSA 4D0DA 3DJSA 2VISA 4AKQA 5KVFL 1BM7A 3V95A 2AJYH 5A7EA 5KYNA 8FABA 1RZIA 4PJCA 1A9VA 5FO8B 3ZTCC 1DUZB 4L5FH 3ZHFA 5C3LD 1EHXA 4G9FA 3QI9A 4PJCF 4K15A 3VRIA 1R5IA 4ODUA 1TNMA 1Y18B 4I85A 1XIWB 4TSAL 1L7TH 1SQMA 3PV7A 3P4NB 5DK0A 3LZRA 1OK8A 3QR1A 4KGLA 1CVRA 2FBJH 3KLQA 3UYPA 3CE1A 1ZA3B 2AQ1A 1KXHA 5FDWA 4A2HA 3LS5L 5DA4A 1D5MB 1NCBH 2YD7A 1JWSB 2FO8A 4M93C 4XWOC 3D18A 4QRQA 5E51A 5TH2B 4S1RH 3GHBH 4QRPB 4YXHL 3OPZH 4QYOA 2WWKO 2EUXA 3NZ8A 2J6WA 3UO8B 3E8UH 5T3XL 3HZ3A 4A67A 4JO3H 3D3VD 4WUKH 3VWKB 2XZQH 4DVRH 2X4PA 2QHRL 1DBML 1PQZA 3KL5A 1URIA 1D7CA 3F7QA 4UT9L 3ZDYB 4YDLB 4I9XA 5TK2A 4KZDL 2KZ1B 2DYRB 1W0WA 5ILTH 3ZRSA 2R51A 1U21A 3BKJL 4LU5H 4ZQKB 1D9KD 1MCIA 4GSRA 4K9EL 4YXLL 5AVXB 4ZFGH 4ZMPA 3ULUD 2OK0L 1VIWA 4CVZB 3GI9L 2ARJA 4HIPA 4JAMB 2OR9L 1MQ8A 1A7OH 4NCC2 1NKRA 4AWJC 4Q52A 4OKVB 4E42A 3DI2B 3S8WA 4UIKH 3QWOB 4C57C 5I16B 2WANA 4KPHH 5IQOA 3HBPA 3VXUD 3KCPA 1S7XA 3BSZA 4OCMC 3ZBMA 2ZUUA 1Y0LB 3VUAA 3JQOB 3TV3H 1XSJA 3JT0A 3HZVB 1SOQA 2WXGA 3BSZL 4PBXA 5FUCC 2PWDA 2VXQA 4U1LA 1H0DA 1G6VK 3BHBB 2J72A 5IY5B 4YOKA 4XC1H 5DZPA 2VTFA 5BJTB 2Z1PA 5D2NA 2VXQL 3AABA 5FWQA 4AEHL 3TVMA 2JI1A 5KTEH 2IPKB 3RURA 1HH6A 1NDGA 3BUBA 3DRQA 2DEYX 3RE0A 5L88L 2ZKWA 4QHNA 4L2LA 5I1GH 1MAML 2I26N 1VERA 3P73A 4FXGA 5IG7A 1EHNA 3FYIB 4G7SB 4CADB 5IHUH 2WUCL 2UUDH 4JM2D 3OAYH 1EQWA 1S5HB 2HB0A 1TETL 3IXTB 3RWDA 4P5MA 1UADC 2A77H 4ZO7A 4J39A 5CLWA 5KBPA 2Y2YA 2C8NA 2PTTB 1O5PA 2GJ6A 4M9OA 3WKML 4L3FA 1AMYA 3CHRA 3TN0B 4PJ5D 4TNWF 1EIBA 3RGHA 3ULVL 3ULVF 2A6JA 3HBGA 4FFVC 4MD4A 4KX8A 1KENL 3OKEA 2P5EA 3DOSA 2OM5A 3MREA 4WWKD 1KOAA 4NXSA 3DX0A 1IE5A 4WI6A 1UOKA 2EKSB 3H9YA 3PHQA 1WP6A 3HHSA 5B4MC 2YOCA 3K72A 3WL9A 4YSAA 4U2YA 5GRXG 5IBLD 2A1WH 4ZTPH 3ZTJG 5D7JD 1RZ8A 1K3IA 4PI0A 3OQRA 5FPIA 4BCZA 4DW2L 4XP1L 1U30A 2NTFA 4FC3E 3JTSB 2JIXD 4IGBC 1CYGA 4Y16B 5L4MA 3B7RL 4KI5E 4PJIB 4UINH 1ZTXE 3AT8A 2BINA 1BQSA 1W80A 4OZ4B 1IZKA 2G0LA 3D50A 2ZF9A 3NJFA 3S7GA 1X5GA 4PIRF 2AVGA 3LZNA 1A6WH 3FQUA 3MFFB 5BVPL 3WHE0 1Z32X 2AQTA 3CXDL 1G9MC 5I30L 3QCTH 1NWOA 3SQBB 2AJZB 2OZNA 4JBSA 4IK7A 1BD2D 4MFHA 4DP7X 3T0EC 4GQZA 1TVHB 4J3WA 4I9WD 3P11H 1SNRA 5K59E 1P5UA 1E3FA 2E6QA 1NGQL 3GBNL 2IC2A 3PQYD 2AV7A 3CLFL 4ZMYA 1JZ8A 4D9LL 1PD0A 1IV8A 1NTDA 2E8ZA 2EUZA 1OALA 2HJLB 4FCAA 3BVWA 4QCIA 3DBSA 3LKRA 3FSZA 5IKCA 1T0OA 2AQ2A 3ZQWA 4PJEB 4JDEA 3CZKA 4XBEH 1NEZG 1YMMD 5AVZB 4QRUA 3W39A 3ARRA 4LIQE 1RIUL 3DPBB 5JYMA 3VSTA 5I1DB 2QMKA 2KMWA 1DVSA 3S9DB 3L54A 4G5ZL 4JZNA 2VQUA 4LF3A 5D6DC 1QQDB 5E5UB 4HPHA 4M03A 2EC9U 2AEPH 2P24A 1T89A 4OD2A 1NANH 4G8IA 1BF5A 3FO2B 2DYSB 5IBTL 2CQVA 1GY2A 4JHZA 6PCYA 1PG7L 1LMIA 1DDHB 3KW7A 5GRVK 4OLUL 2CJSA 3MJ6A 4Z3HA 3EYFB 1GZPA 1KCVH 2G60L 3BZEB 3SKJL 4LHJB 3W3BA 1K4DB 3B1UA 3W0WE 1EHLL 1IAIH 2E6PA 4JFTA 1MI5E 1OGTA 2XY2A 2D0GA 2J5LB 3C6EA 4AGNA 1OLZA 1MG2C 3IJHA 5IV2B 4YHOL 4E5XB 3HG5A 4PVLA 1G1CA 5AZ2H 4ZNEE 1XR8A 4ZFOA 4U6YA 5I1HL 3FUJA 3O6KH 4WSKA 4ZMNA 2G30A 3RFZA 4K3EL 3LNDA 2DMHA 4L8SB 4OM0H 4QRTB 4ZFOL 1A3ZA 2DQIH 4PJFE 3QIWC 1OAKL 5BV7B 3ZDZE 1HL4A 3PJSA 2V2TB 4EI5B 3CX2A 1MFDL 1YAIA 3OMZA 4NJAH 1AGEB 4Z7AA 3LB6C 4J3SA 2NY5L 2LAAA 3TP4A 3CPLB 4APXA 5J6HA 1SJHA 5MEND 4XH2A 4BFNA 5EZJA 3LAFA 2ZXGA 4K23L 4K71C 3UTPE 4YWGL 2EE2A 3TBVB 3SCMC 4X0KA 3HNTH 4DK6A 4L3EA 3Q5OA 4ZFFA 3EHBB 5DC9B 3P4OA 4LRNL 4ZW5A 3ZTJH 1YEWA 3EFFB 3U36A 1G84A 5E03A 3BYYA 4UNUA 4RWYH 3ZHLA 1PS3A 3ZYOA 3Q3GA 3M07A 4QRRD 3HJ0A 2WSKA 4MNGA 1GS8A 4DK5A 3B6SB 5C71A 4RMRA 1LQBC 2H26B 2B59B 3SY0A 4OIIH 1T2QH 3TONA 4X4XB 4ELMA 2A73B 2ZUYA 3C60A 4E9WA 4GP4B 4G6FB 5CBAA 1M9WA 3T0DA 5JO5B 2EDTA 4AENB 4FZEH 4ELMF 1J8RA 3NABH 3QG6B 4WENB 1BF8A 5JNYA 4G71B 3KPOB 1KLGA 1RUKL 4LQ1A 5D7IA 1DANT 5LCVA 3WUWB 1OTTC 5J3HC 4DT2A 5E5MA 3QARA 4LEEA 5J11B 2DWTA 2XPYA 5DUML 2VDNH 1WA2X 5D7IF 5LCVL 4MAYD 1HYRC 5E00A 3ASWA 1YY8A 4QHLA 3QUML 1U3ZA 4KWUA 4L8CB 8CGTA 2RIKA 2MCPH 4HP5A 1E27B 3D39D 2CRYA 5CN3A 5I66B 5GPRA 4XPBH 1Y1DA 3CN1A 4N0UA 4P48A 1HCVA 4QKXB 4R0LA 5DT1H 5E2WH 3QDMA 2YEVB 4PS4H 1YJDC 4APQC 5HYSA 2P49B 4NUQA 2YSSA 3OHXC 4PRHB 4FN0A 4TPRL 5GGUA 1L6XA 3WSQL 4ZFZB 1PEZA 3KWTA 1EBPA 5EBMA 4CAGA 2NQCA 3QPXL 1K5WA 1GJIA 5L8LB 1A4KA 2LU4A 3WNOA 4H5SB 3HAEG 4MWFB 4AI7A 2FO4A 4BH8B 2AJVL 5CD5D 3Q9PA 3FQTB 4TL5A 4AQOA 4X6FA 3FQXB 2OTWB 2F5AL 2PKDA 1F56A 2WB1A 1FGNH 1ZOXA 4FABL 5FUOL 1U41A 2XLLA 4QWWD 4AV5A 4UQCA 2VUYA 3VI4A 4Q8BA 2XA8L 5I8CB 4WWID 1KCSH 2HVBA 4NKDB 4UQ9A 3GSUA 4FFYA 3N91A 2NW3A 2NY3C 3BAEL 3P77A 4FRWA 3G5VA 3VI4F 1CLOL 2IOIA 4FZ8L 5ID1B 1MOEA 4KK5C 1ACYL 3LZFL 2GUOA 1EUTA 3BH9A 3KXFE 3N42F 1E8ZA 2CDEA 1NBCA 3LYRA 4N87A 2EDQA 1A1MB 2OV0A 2CHZA 3CDGA 4GPVA 3IGKA 2Z4TA 1ZT1B 4PR5A 5LXGL 2OL3B 1ED3A 1M1XA 1RHFA 2GAZA 2HWZH 1T4WA 2QGEA 3A67L 3DVIA 4OLXL 5AQ0A 2MCG1 1I8MA 4HS3A 1W8OA 1BQLH 4JG0H 4LSUL 2XZCH 1MJ8H 4Z7QE 4IRSB 4XI5D 1GYCA 2ZG1A 1WIUA 4UT6A 5E70A 2VLJD 3OB0H 5B3JE 4Y4KB 3N1GC 5EWIH 1BFVH 3MLZL 4UT6L 2HKFL 4JKWA 4UV4L 1LMKA 5DHDA 4N8PA 1Q9LB 3H9SE 3QULA 3QQ3B 1NOAA 1G7MB 1Z9PA 3C5JB 1YEGL 2AZUA 2OW7A 3U7AA 2J6EH 4D3CL 4DGVH 4Z7NB 5SX5K 2W0LA 4C56D 1TFPA 5E6YA 1FNFA 1USZA 3IFPB 4XO5A 3IKCB 3D2UD 3T8XB 1CD1A 4G1EA 1Z5HA 1UYWH 1IGIH 3PWPE 1LEGA 4U7SA 4OZIE 1CQYA 1JGLL 1GZHA 3HI6L 3ILPA 4IBQA 3VFNA 3K2UL 2VC2L 3T8VA 1LK3L 3H53A 2VAAB 1WZAA 4QGTA 2MCMA 3GLEA 3UJTH 1FIGH 3AREB 3RKDD 3QRGH 4JFDB 4DP8X 1QR1B 3RZWA 3VAEA 5EMYA 4PJBA 4ZXBA 1FFOB 4GJTB 1R3HA 3GI8L 3SBWC 3G6AB 5LG6A 1ZSDA 1X7SA 1ZV5A 5ISZB 3SO3B 4PJBF 1NCTA 3JWOH 3VXQB 5L2JA 4GO8A 2FR4B 1FG2B 4EUPG 2J8UB 4N2CA 1FUNA 1RK0A 4R4BA 4OLZH 4ZMTA 4AZUA 2A0LD 3U6XA 5CN2A 2CA3A 1EO5A 2FZ3A 5KAQG 3AMLA 4JNXA 2F53D 1TQBB 3CPUA 5HVGB 1T0NA 4N8VA 1L6ZA 2BSSB 2APFA 1A25A 3IAGC 1G5GA 2X6MA 3DX1A 1ANUA 5HVHC 1PZ5A 2ESVA 3O6FD 2YGQA 2M26A 3JZYA 2W9EH 4K9EC 2BSRA 2XFGB 3NFNA 3AB0B 1XH3A 3PGDA 5B39A 1SJXA 2VXVH 5SWZA 4BSVB 4FQCL 5SX5H 5D1ZD 3GMOA 1DQQA 3D9AH 4G6ML 2OTUB 1XDTT 1LK2B 1B4TA 2W92A 3WY2A 2WUBH 2WZAA 1JPFA 2O6FA 2IOMA 4U6TA 3VD7A 1N2RB 5C6TH 2RHEA 4BFKA 3ZR6A 1UJTA 4R7NA 2VJ8A 2HH0L 4NQVB 1SBSH 1BYPA 3S36L 1SUJA 2PYED 1IC4L 2CGZA 5K59F 4AJYV 3HAEH 4TN9A 1FZOB 4GT7A 1IBZA 2HLEB 3BIBX 3UZQB 3OZKA 1TEGA 1XFPA 3MRKB 2X89D 3NESA 4NPYA 2GKIA 5GZOA 4BQ6A 2QDVA 2XHNA 3JV0A 3VFOA 4WO4A 3I3DA 4LLYA 5DJ6A 4ALAL 1I7UB 4YDJA 1OXYA 1ZT4A 1DVUA 2MKWA 4JQXC 2EXYC 2NRDA 4YBQC 5A1AA 2A9ML 2Y3NA 1F1DA 1CT8B 5DRWA 4BFBD 1CBVL 4U6XB 1DEEA 2P8MA 3ARBB 1A1OB 1HU8A 2WZ0A 3GF8A 5EUOE 4F93B 2F54D 5C08E 3SDXE 4CKQA 2ADGA 2ED8A 4EN3A 4LIQL 4X9GA 1SBBA 3KDMA 1H8LA 2C9UA 3I6SA 5CKGA 4PH8A 4LCIH 1HIML 3GBML 4PVBA 4MX7A 2VLKB 3U1PA 3PY9A 4K7PL 1AQKL 3WO4B 4XOBA 3JYCA 3LX9A 3QDGA 4W9GC 1KTLA 2ZCKH 3NZUA 1JRHH 2F2HA 2L7EA 3RWIB 4BFFA 5HHPA 4F7TA 3WDJA 2CHXA 2EEDA 1QX1A 5EBWB 1ECYA 1FE8H 3TBBA 2DQDL 3RTQA 4XNXH 5I5MA 5E1IA 1TZGH 1ZXKA 1T2XA 3QDJB 1B6DA 4HBCH 4JLRA 3L3GA 4KH9A 4KKBD 1XF4A 5GS1C 5IJKA 1O75A 4ZX6A 2VDRH 3HE7D 1IC5L 4XP4L 3S4SB 2W95A 1IM9A 2O30A 3P4LA 4Y5YB 1IUZA 1IFHL 3HCVB 1XCQA 3R06A 4HS6B 1PVHA 1DJYA 1HSBB 2VW7A 1NCWL 4U1SB 3GXNA 3MR9B 3NCEB 4F2ME 3DV4B 4PU2A 3UTTA 2WGNB 2VDOH 3VI3B 2R4SH 4R26H 3CFEA 1LP9E 4OGAD 2A99A 2G2RA 1F8TH 4G8GE 2EYRB 1S7VA 5A2KH 1QWNA 4X99A 3WE1A 3IDYC 3IRPX 1U4EA 1HKFA 3MRGB 3QZNA 2DWXA 3MV01 1GW0A 3HW7A 2IADB 4EQ2A 4KNSA 3D30A 4LLDB 4NZ8A 4TULL 5DZJA 1MFBH 4WNQA 5I1KH 3BOVA 3IJEA 4PJHB 1Q0XH 3WNLA 3SYQA 2AF2A 3TEYA 4K0OA 4EUPH 3V4PA 1FN4B 5KG9A 1XT5A 1WWBX 4UI2A 1EFXA 4OF0A 1QBMH 3C5SA 4XNYL 4ZS6D 5T3ZE 4JFXA 1NC4A 1A7BA 1QUNB 2VDPL 2VQ1A 1GPOH 2YOAA 3EH3B 4LAJH 3V4PL 2HMIC 4H2AA 2VABB 4HIEA 3VXSE 3S88L 1JPTH 3B7TA 4M62H 3G5YA 1ZHLB 5CCGE 4B96A 1K72A 2WB7A 3CNKA 1R3IL 3LN4A 4IDJH 2YAQA 3BIKA 4ZNCD 3O3DA 4QHKI 4A6YB 4YX2H 1I3UA 4G9FD 4KDVA 4W68A 1RZFL 4XAKE 1BA9A 3QI9D 2OMYA 4NCC1 5IQMA 1DJIA 4NQCA 3OKNA 3O9WC 4IBVA 4ABQA 5KZCD 5LKNA 3EUDA 2WBJB 2XN1A 1NL0L 2ZOTA 3MN8A 3HC3L 3L5IA 4FQLH 4UM9B 1NGXA 2W94A 1F41A 5GGSA 1AQMA 2EH8H 5MERB 2UVEA 3QUGA 1NOFA 3OSKA 4AEEA 1J5HA 4B9FA 3AZUA 1YQ2A 3TBWA 5D4QA 3WS3B 3ZL1A 5KVDE 4GAJL 2A6IB 1UXSA 1ET8A 2PTVA 1VZIA 2AABL 2MHAB 3W11C 4W81A 3KS0J 5T1KB 2CK0H 2WHVA 1KG0A 3HR6A 4AEIL 4DN4H 4HCRA 2M8XA 4LVEA 1T1XB 4MTMA 5EZOH 4C54A 4FG0A 3L3HB 4G1MA 1VGEL 3HMWH 3CK0H 1I3VA 4HCRL 3OWRA