4AM0Q

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
91
Chain Sequence
b'TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
total genus 14
structure length 91
sequence length 94
chains with identical sequence R, S, T
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4am0Q00
5LBVA 1S6NA 3N43F 3C6EA 1OK8A 5B1CA 3N41F 3UZQB 4BZ1A 3P54A 1Z66A 3N44F 3N40F 3G7TA 1UZGA 1Z3RA 4L5FE 3MUUA 4FFYA 2ALAA 5IREA 2HG0A 4GSXA 5GZNA 4GT0A 2R69A 5AAWC 4UTAA 3UZEC 4UT9A 5GZOA 4UT6A 1SVBA 5H37A 2JV6A 3IRCA 1OANA 4AL8C 5JHLA 5IZ7A 3J2PA 2H0PA 4FG0A 5LCVA 2JSFA 3UZVA 4X42A 5KVDE 3C5XA 1RERA 5AAMC 1OKEA 2I69A 4ALAC 4FFZA 3UYPB 1PJWA 1URZA 2V33A 3J27A 3N42F 4AM0Q 2R29A 3VTTA 4UTCA 4BZ2A 2GG1A 3UAJA 1ZTXE 3WE1A 5LBSA 5KVGE 1TG8A 4UTBA 5KVEE 5JHMA 5KVFE 2P5PA 2JQMA
chains in the Genus database with same CATH superfamily
2A9BA 4ODWB 2XSKA 5KVFH 5KJRL 2I85A 3U1SL 5DZJA 1O0VA 1WFJA 4NZ8A 1OT1A 2OJ1A 5IB2A 4JY5L 5ETUB 2A0LD 3HR6A 1EHNA 2VN7A 4F58L 3EGSB 3T04D 2ICCA 2AK4A 3CFUA 5E2VH 3QDGD 1B0RA 3H8NA 1PG7H 2EE2A 3QEHB 3QRGH 5HGGS 2G3NA 5LNEA 2IAAC 5IVXF 3AQZA 1OO2A 1TU2A 1A14H 1F11B 4Y2LA 3ZN6A 1GH7A 2ALAA 3SZ6A 3C87A 4NQCA 2X6UA 3MV01 1PPIA 5F7KC 5DDHA 5C0AA 1UFGA 4P2RD 5EG6C 3B2PA 1HDMA 2VDQL 1OXYA 3ZE0F 1ROCA 3UTTD 4ETQA 2YRZA 2ICWJ 3G04B 3LN4A 1ONQA 1XCTB 3KL5A 3QXAA 3TA3C 2FVNA 1KFGA 3BVVA 3X13A 2J25A 3SO3B 3DOSA 5TQ2L 1U3HC 3U1QA 2OXGB 4XCNA 4JG1H 3G5ZA 3O4LA 4ZFOL 4ELDA 4YPJA 2VDKB 2Y7QA 3DHUA 4PUBL 4GBXB 4JRYB 5T3ZH 2J7LA 1GYVA 2R4SH 3QQ4B 4XNQB 5DD3H 1UXLA 4DAGL 2Z7UA 4GKOA 3LPFA 1TTBA 3LKPA 2EEFA 5E99L 3QXDB 5ADPH 2QPEB 1KTBA 1NCBL 2UXFA 3KW7A 4AEIH 4X4MA 4XOAA 1IX2A 2D2OA 1P5UC 2QHRH 2Y36H 2FD6H 4OD3H 1O5PA 5J57B 3OAUH 5ABZA 2PO6A 1WYJA 2FDBP 4M9PA 3VFRA 1R0AH 1BREA 3N6YA 3PABB 4RETB 1AC0A 1BIIA 2DZEA 1CF8H 3O6LL 5KJRH 1FFPB 4NSKB 4RGND 1YZZA 3ILPA 4EF3A 4JY5H 2B08A 3ARRA 4F58H 5D9SA 1T5XB 2CDGA 4J4PC 3ESMA 2LE9A 3RNQA 2WQXA 3WS6A 4YSCA 3DSFL 4Q89A 4G9DB 4U2YA 1BLIA 4K94C 4ORGB 2VRKA 5AW4B 1WC7A 4IHBA 2B3IA 4L05A 4H0LC 4NB7A 5HI4C 4F9PA 4WK4B 1R1CA 4AM0Q 3LZFL 4Z5RA 4PJGB 1N19A 4N8PA 1KCSL 2ORBL 2XWJB 2Y5TB 5A3IC 2CUMA 5GISH 3EJJX 5J3HD 3WE6B 2JI3A 2WXNA 3VI3F 2VDQH 1R5IB 3PL6C 5KVDL 1HX0A 3QG6B 3PV6A 2ZXCA 1IE5A 1I3VA 3II1A 1BMGA 2B4CL 4J3BA 3SJVD 4FQ1L 1DO5A 3KH4A 4NQCE 1SBSL 2CSPA 2QSQA 1A47A 3OB0H 4R96A 3FUNA 2CHXA 5DQJA 5C0AE 1N18A 1RZJC 3FHEA 4IEFB 1GCYA 4LE8A 2HYMA 2DWEB 3N85L 4NQQA 5EIQA 1AHWA 4KNQA 2WXFA 4D0CA 5DJYA 2EEAA 3VFVB 1UYWH 2PTVA 4DAGH 1VFBB 3W39A 4PLJD 1FA4A 4U3HA 1YEGH 4XCYB 1NCIA 5E99H 1FO0L 2EKSA 2PWHA 4TQEH 2WWKT 1NCBH 2BIQA 4Y89A 2ROXA 3BZFA 3JVGC 4JGJA 4X98A 1M6UA 43C9A 5IQLA 2ZOKB 5M94B 1W16A 1VF5C 1U8MA 5IEKB 3T1FB 4ABWA 3LTVA 8PAZA 5I6XB 3O6LH 1FZMB 4IRSA 2NY2D 2AANA 5I18L 3NABL 3RDTD 5IESL 4O2CB 2BIPA 2BOBB 3MRBB 2OYKA 1FZOB 4UTBL 4N2AA 1KELH 5FKAA 3DSFH 4JZOA 4MDJA 5MI0B 1S9WB 2WXPA 5JHLA 5GRUL 2VW6A 3QO1B 5DMGD 4L2LA 4DK6A 1RK0B 4FG0A 1RLBA 4UYPA 2ZX9A 4NM4L 3ZRSA 2MHAB 2AQRA 4TLKA 4R7DB 3HI1B 4ADIA 5L9DH 1NMBL 3LZFH 2ORBH 4UMGA 4N3UA 5EF0A 1EZVX 3TS8A 2R7EA 3L81A 3MRNB 3V0GA 1AXTL 3L1EA 1CF1A 5DD0L 3CC5A 4PY8I 4WFFD 5KVDH 4FERA 1HH9A 4Z0BH 2XICA 1SVZA 4FQ1H 3TYGL 4DVBA 3D7PA 3EYSL 1SHWA 3BFWA 4Q58C 3VU2A 1ZLWK 4F27A 1D5XB 3QIWC 3FH7A 4GG6E 3N85H 4FQXD 4FTVD 1DR9A 4TV3A 5FFOA 3AJ7A 3ISRA 3EG9B 3CDYA 2CR6A 1M2VB 3NCXA 5F96L 1DVFD 1AQHA 5J6GA 2OZ4H 5IQ9A 5ACLA 1FO0H 1ZE3C 4OZGF 5CLWA 1RJZA 2ESVA 4TQPA 3DMMC 5EUKA 4P4KD 4QRQB 3MNVB 3GSNL 5IROC 4PJHB 1KCVL 4TUJA 3TA3B 2CA4A 2YXFA 3FQXA 3C6SA 2Y5EA 3LNFA 2ZQKA 4M3KB 5FECA 3NBNA 5D4QA 1U3HB 1BD2D 2YPKB 4WO4A 3GZKA 5IESH 1NWPA 4PTTA 4CSTA 1KSRA 3UJJL 3CD4A 4Q9QL 3BKJL 2BSSB 4M6MH 4OZHE 3BAYA 3FCGA 3LV3B 4WUUD 2OTUB 4OLWL 1JZ8A 4PRAA 3D85A 3AG4B 3DVNA 4XAKD 5IJKC 5GRUH 2GCYB 2EH7L 3FUHA 2OMZA 1M3JA 1A4JA 1MZYA 1QQDB 3DX7B 4HYTB 2WTPA 3JQOB 4P3DB 1PZDA 1B9KA 1P5UB 2P5ED 2F61A 1FVDB 1NMBH 2KERA 4YSUA 2YQGA 1MFEH 2V7HB 3VUAA 5A40E 2HT4C 2MJWA 5EF1A 1AXTH 4MYPA 2ITCA 2P9RA 2A4EA 5DD0H 2X3BA 2ZCHL 1ZVNA 2CCVA 4M29A 4PJCB 1MNUL 2VDMB 4JFQB 5KSVA 3IBOA 5KYYA 3S9DB 3RU8H 3TYGH 2HMIC 3C09B 4YEEA 4BZ1L 3EYSH 1N0XH 4L23A 1KTCA 4JFDB 2OM5A 1UWYA 2EYSA 3M8OL 3U25A 3UZQA 3P4MA 4LEEA 1X7TA 2F2HA 4D0BA 3S96B 4ZNEA 3UGEA 2IF7A 3RIAK 4WTZG 1JZFA 5ESQA 5ESAB 3M7OA 2R15A 5F96H 3VFPB 5E8DL 4BCYA 4X9BA 1Q9WA 3MCLL 1N8OE 2NXYD 5FW6A 2ZICA 5JXAL 5K1NA 2K4WA 3GSNH 1KCVH 4IMKC 4NUJA 2P8PA 3SE9H 3WNNA 4QHLA 3EF4A 3ARGD 1GS7A 1AHWC 4Y4KD 5F44A 2B1AL 3MRFB 4U1IB 4XCFL 5C09A 2V3DA 4TVPD 5I28A 1EBPA 4XVSL 4HVBA 1YEKL 3BKJH 2DWDB 4B95C 1TNNA 1B4JL 3GGWB 2JLLA 3OC5A 3LKRA 4OLWH 1X5AA 4F7EB 5D96C 1KB9J 4WI6A 4Z76A 3LZPA 2VLJB 4UCFA 3CLEL 3MV8A 5HVGB 1DFBH 5EO1B 2LU4A 2VDNL 3UYRL 3RYMA 5K9OA 1ZGLP 3KPTA 3RTQA 5ICZB 3K2MC 5LLIC 2ZG1A 1IM3B 2WBXA 2BXYA 4AJVA 3CG8A 4IRSC 4MZ3A 4OM0L 5L4FA 1AMYA 1I1AD 4Y19D 1MI5A 4HIXL 3DX9B 5E6ZA 3MRPB 3CFIC 4HS3B 3T6VA 4U33A 2ZCHH 3MRRA 4Z6AT 4U1HB 1A22B 2H9GB 3AADB 3BLKA 5BVPL 5I1AA 3MNMA 1XAUA 3EHBD 1DHKA 4QMEA 2M26A 3I3DA 4JLRB 1J10A 3KCWA 3OJVC 1AAJA 1E2ZA 4WKZA 4BZ1H 5A2KH 4LCWA 3O3BA 3M8OH 3O41B 2VERA 3GSWA 4GOSA 3QNYB 5D2LA 3RNKA 5LKNA 4MB4A 1D6EA 4UUJA 4OFYA 2WUBL 5SWZD 2FLMA 4KKRA 1UZ8B 4BWUA 4QOKD 5LGJA 1VA9A 4X6BA 3V79C 3HZVB 3KYNA 4P5MA 5E8DH 5LWYL 1YY8B 1N64L 3GSRB 2D7OA 3MCLH 3WIFB 1MLBA 1UT2A 4H88H 5JXAH 1NC4D 1CGXA 2VQ4A 3T3MF 5BVJA 4WDIA 4IJ3C 1X5JA 2JKIS 4FFWC 1TTRA 1VZHA 5G4MA 5T8IA 4QCIB 1UWFA 3KL0A 4E9TA 2WN2A 2EXSA 3JV6A 2LV4A 5L2KD 1EGJA 2ZTBA 1AG6A 4YDLC 3KS0H 4XCFH 5C0IA 2GQHA 3AS3A 3QIWB 1L6PA 4ANWA 5JOEA 2ARJA 4UM9D 4NQCB 4XVSH 5DUPL 3IXTB 4FQLL 3MJ9A 1B4JH 2JQAA 4YDJA 3C8KA 4NLHA 1FFQA 3O2VL 4OF7A 1T7ZA 3C2AH 3OV6A 3MMEB 2XBTA 1A4KB 4FI7A 3SCMC 1XGPB 2Z6FA 1IGYB 3CLEH 4N2KA 4J6IA 1A7QL 2VDNH 3ARBA 4LPWA 2DL9A 3QXAB 4UDUB 5AVYB 5C09E 2TRHA 3MRCB 4J1UB 2V4LA 3SOBL 5JQ6L 5B1JC 3DMMB 3SE4C 1FVCA 5BJTB 4NAMA 5TE7L 5HDOA 4BDVB 4OM0H 3K46A 1C12B 1P4BL 2X6MA 5H35B 5JUEH 1FL3A 3MV8E 1ZDSA 2ZYSA 3UTSA 2BVOB 3M07A 1HL9A 5B7MA 3SODB 4X5XA 3KM2A 4G7SB 1FI8C 1WO2A 1NGPH 1TYRA 3S6CA 1SVCP 3PWNB 3GIZH 1NEUA 1UOKA 2WQUA 2MRYA 1MI5E 3BWUF 5C07A 5LAXA 2GK2A 4GUOA 3QUZD 2QEJA 4ACTA 3EFOA 4HU8A 4U1GC 3ABZA 1FHNA 1AG0A 5F97E 5HDQH 5HGAB 2Q6WB 3H3KA 2ZP9A 3QI9A 3LRKA 4LSPL 4W9LC 5LWYH 4LCWE 1BVZA 3CQPA 4DEWA 1N64H 2F1EA 4KFZC 2YD9A 5D2LE 4L8BA 4XB3A 4GKNA 4ZO9A 2NX5D 1MHEA 3BXNB 2XKNB 3ASWA 1TTAA 1W6LA 4XPHL 2V9QA 3GJFB 4EOWL 5BUPA 1IKOP 4AGOA 5HDLA 3QC5X 3MYJB 3CZJA 1NM4A 1GGYA 1QR4A 1NFIB 2CGYA 2QFRA 5A6IA 5DSCA 3EGDB 2QTVA 3I3BA 4H0IA 5DLML 3DGGA 3L5JA 2PETA 2ZAGA 3Q5TA 4FQLH 4HPOL 1ET5A 4BHUA 2PCFA 2BC4B 4RRPM 5LBSA 3IKCA 5JDSB 2ZSVA 1JF6A 1UENA 3ZQXA 4GG6B 3OKKB 1A7QH 2A4CA 2R29L 2YAPA 1JXJA 3BAKA 4F9LC 5TE7H 1NAKH 2PF6A 4PVLA 2BDNL 1MEXH 2DKUA 3A4DA 3BCFA 4UBDD 1P4BH 5IMLA 3I6KA 5H8DA 3S5YA 1UB6A 1CZ8L 4K94H 4Y2DB 3L95B 4CMMA 4JDEB 3BX7C 4P23A 4YR6B 1OB0A 5E0QA 4NQTA 4WW2F 3W39B 1ETA1 2WK2A 4QGYA 1RULH 4PRPE 5I17B 1E9QA 5D96B 4NUGH 3FU8A 4NNXA 3EAKA 2MH4A 4AQEB 2W07A 2UX6A 3RTQC 3SPCA 3IGAB 5T3XD 3OKDA 3UZEC 4R4BB 4OZHB 5IVOA 5KUMA 3P9MB 1V3LA 3HC0A 4GQPH 3UG3A 1JZEA 4QHPA 3OPZL 4PG9B 3D3VA 5C07E 3QIBC 4IRSB 4KDWA 4KK5C 4LZKA 2IPTL 5HHQA 1OGTA 3MV9D 2P24A 3BJ91 4O58L 3TJHD 3FO1A 4U1LA 2HKAA 4U6VH 4JRXB 3VI4A 4HULB 3ARQA 3V5KB 2K6WA 1VZIA 4EOWH 3VW3L 1E3FA 3DSNA 1X9RA 2EUZA 4FL4B 4UDTB 1JGEA 2ID5A 1E6JL 1VFUA 4N2HA 1N0LA 2HT3C 2VERN 2WWOA 3HPLB 4FEIA 4TOYL 1CU4H 4X7CC 5DLMH 5EUOF 3L3KA 4PWKA 2CUHA 3ZKMC 4HPOH 4Y7OC 3VGAC 4AYMC 2RR3A 1AXSA 2XZAL 3DRQA 5DCCA 3UCQA 3ECBA 4DKTA 2H2SD 3W5NA 3AC0A 1MCDA 5D7HA 3EDKA 2R29H 4JO8A 1AKPA 3VYPA 4IJ3B 4FNSA 4OZ4A 1JGDA 1JXGA 2BDNH 1DSFL 2E46A 4ZS7H 3EFFA 1QLEB 1CZ8H 3Q6FB 4HJ1A 3RVVD 5BUAA 3BD3A 2Q3ZA 1QSVA 3PF2A 3BYYA 4HMEA 4YDLB 4XP4H 4ENED 3VG9C 4OV6F 3O9WC 3H3BC 1WCQA 2JKNA 4OUUA 3ARBC 4ZS6C 2EEDA 5EC1B 3WAKA 2DICA 5FCUH 4L9LC 3C5ZA 4KKZA 4GMTL 3SCMB 1XL6A 3HZMB 2VAJA 4X99A 4HKXA 1OT4A 1XGQA 2X4OA 2EDXA 5F9AC 3RL2A 4M56A 3OKLB 4TUJB 3CN0A 4Y1AE 3HZYA 3MHZA 2EXYC 1F90H 3BAXA 4GI6A 5F3HA 1K8IA 3IFOB 3HFFA 1Z9PA 2FJSA 2IPTH 1C5DB 4O58H 1FL5A 4BKSC 1IBFA 5EN2B 5EOTB 5CIPA 2A74C 2HUHA 1DJWA 1TNMA 4IBSA 1Z3GH 3KHOA 3VW3H 3SBQA 1IEAA 1KWKA 3D3VE 5B1AB 4U1NB 1ZE3H 2V5RA 4BCZA 3ZDYF 3TVMD 1FSKC 2OCFD 5IJVB 3V0FA 4TOYH 4PG2C 1E27B 1YJDC 4V11A 3UAJC 3DUSB 3VI4E 1YEEL 2DBLH 1OQXA 4QUOA 5IR1B 4HC1L 3ZZ1A 1IJ9A 5I8CA 2XZAH 2ZOTA 5TK2A 3NIGE 2EVFA 1JF1A 1WA0X 2A5UA 4IHOA 3EH1A 2PW2A 3D2TA 3ERXA 3HG0A 3N0PB 2IMNA 4OGAD 5JMRA 1S7WB 5IY5B 2EYSB 4I9WE 1KJ3L 1DSFH 1QPPA 3IS1X 4RNRB 3NVQA 1K6QL 3QIUC 1RY7B 4P57A 1R46A 5F6HJ 3HRZA 2Y2TA 2YXWA 3KEHA 1XL4A 4JL1A 1ACYL 1X4YA 1JMZA 4ZMYA 3ARXA 2GFBA 4OY9A 4YNYA 4YBQD 1UXMA 5HTSA 1V27A 2EC8A 3W1ZA 2E7CA 4HUXA 1A5FL 3D4CA 2FJFA 2OBGA 1D5BB 1D7FA 2QQNL 4G3YL 4GMTH 2C3GA 1ROWA 2VO5A 1FAKT 2F53B 2KL6A 1FF5A 4EN3A 2X1QA 1MWAA 1JV5B 2PR9A 4HFWA 4B9IA 5JHLL 5ECJE 5L0QC 4P99A 4IOIA 3D52A 1TYEB 4G8IB 4F7KA 2IH3B 5T33L 4LSVL 2WJ7A 4P23C 5KVGL 1LP9F 1INDH 1KN2L 4Y9CA 1S7RA 3B9KD 4ZOCA 3D0LA 4DVRL 4G6FB 4XNMB 5HHMB 3VG0L 4JHUA 5HD8C 3OGCB 4TSCL 1U8HA 3FFCE 2WO2B 2OI9C 4WWKD 3TN0D 3ARDA 4Z76B 4LLMA 3MV8B 2HLFD 2G75A 4MS8D 1UA6L 4R3SA 4P3CL 3ROOA 4GW5B 2P5WE 3NCBB 5DFWH 4CSPA 1VENA 3RTQB 4Y8AA 4N26A 1FIEA 3T77A 3H0TB 1KCUL 4DN4L 2OMWA 4PRID 1MVFA 1GOGA 3QIBB 1JOIA 3U46A 4DPCX 1PW3A 4FRWA 5JORA 4WO0A 4XTRC 1GGTA 2VXVL 5HGDA 2C4FU 7FABL 4GXFA 3O3BB 1TUPA 1KJ3H 1INEH 3MV7A 1FNEA 2CKBB 2DEYX 3DV6A 3NJFA 1YNLL 4WU5A 1OCCB 2J56A 2Z92B 4NO3B 1ACYH 4Z7NE 4J39A 1BYNA 4LNRA 1XF1A 4X6BB 4QRTA 1IZJA 3UBXB 5DK2B 3VGAB 2ZF9A 4U2ZA 4PRDA 2QQNH 3U9PL 5BW7C 4JO1L 4G3YH 2GT9A 5F7EL 4NQSB 3EO1A 1DJGA 1XCXA 1HHGA 4GLRI 1UXSB 5JIHA 3H4FA 5BVJB 3M1CA 3VWKA 1UZ6E 5D1ZD 5H94B 1BLNA 5JHLH 3S3BB 3HI6L 4YZFE 3VH8A 3O8XD 2BNRD 4U1KA 3MI6A 5I1CL 3EBHA 5D1XA 2DMGA 5KVGH 1ID2A 1KN2H 1BYPA 2RACA 1ILSA 2FZ3B 2G3XA 4KK9D 3OSKA 4HISA 3LS5H 5B22A 4XPFH 4PJ9D 4DVRH 4HJGA 4JAMA 1WBZB 4L3ED 3INOA 4MCYB 3MLXH 2W9EL 4TSCH 4A68A 3OR6B 3VG9B 3O9WB 2FX9L 3HN8A 1G4RA 3ARBB 4HKBA 4NKDB 4P3CH 4L9LB 5E6RB 5DD6B 3SKOA 1PLGL 2A73B 2AZUA 2KHAA 4LQ1A 5I1LA 5DFVC 4M5TA 2I24N 4KOBA 1VIWA 1XO8A 2C9AA 1XF3B 1QLEH 4PRPB 3UCRA 5A6MA 5I71B 3QUXA 3DYPA 1KCUH 5F9WC 4DN4H 1AYOA 3FTZA 4MMXA 5DEFA 2NYYC 2QVIA 3MLYH 1AZZC 2G9HA 4WFEE 3VSUA 2BH0A 4IU3B 1A8ZA 5A2FA 4V1DD 5G55A 2A74B 4QXGL 4X4XB 5E4OA 3MA7B 3KBEA 4KPHL 3I02B 2HRPL 1YNLH 3FU5A 4PJ5D 3R19A 4ELKA 1FSKB 3IDNB 3B2VH 3LQAC 1IVLA 4XN9A 1Z9MA 1BBJA 4Z3IA 2H2PC 2EXWC 1T5WA 5DC9B 4AQ1C 4DP1X 3HLKA 3MV7E 4JO1H 5DJ8A 1XH3B 3QDMD 4PJBB 5F7EH 3UEZA 3ZYJA 1LK2A 1MHEB 4DP5X 4DSYA 2GY5A 3BWAA 4ZXBC 5SX5K 3O3EB 3FRPB 3C9NA 4DKFH 2FATL 1YY9C 4GH7B 3HI6H 1CLYL 4M7KL 4B0MM 2XNAB 5I1CH 3NRQA 1KACB 4YLQT 5AEAA 5FGSA 3F6IA 3QIUB 4YHNB 1YEHL 3MLTB 5DJDA 3U6RA 5AW0B 4R5TA 3EYOB 4FC3E 5F70A 3V4PA 4OCMC 3IJ9A 2FX9H 1T03L 2L7JA 3FYEB 1PQZA 4YSPA 3VCLB 4PJ7F 3VGFA 1AR1C 1G6RA 3LSOA 1KXQA 1L9OA 3FOLA 3HZ3A 5GGRB 2OMYA 1NGXA 3HI5L 1ZLVK 3VQMA 4BSWB 1JPGB 4MBOA 1GMEA 4K5PA 3D48R 1SNRA 1B4TA 1DUYA 1R24B 3I6KB 5L0QB 1YMHB 1M7UA 3B7SA 3SZKC 3PNWB 32C2B 3RIFK 3ZQ9A 4OQ1A 2ZXAA 4C4KT 1MFDL 1UFUA 4P23B 1CWVA 2F7IA 4Y1AB 5DA4A 3ARDC 1LVEA 1BVNT 4QXGH 2B0SL 3K4DA 4U3SA 4QY8A 1PFCA 1QLRB 2QVTA 1RHHB 3BHBA 2P8LA 1T6BX 1I3GL 4WV1C 4RCAA 5FF6B 1UM6L 5JMOC 4Z3TA 3C5SB 5IB1A 4EDXB 2EE0A 2D31A 1JVLA 2G0LA 5AVUB 1ZLWH 2Y3AA 1EGJL 2WLYA 2VR4A 5EO0A 4QT5A 1E9OB 2ICEA 1SN2A 1CDIA 4HQQL 4A63A 1ZVYA 3NJLA 4O02A 5E4EC 2UYLA 5GRVK 4FJ6A 1IGCL 5FO8B 2NY4C 3K2IA 4NQDB 1FH5L 4A38A 3P73A 1MREL 2FATH 4NHUB 1CLYH 1PD1A 1FNGB 3OHXA 4D9RD 2JLPA 2F08A 1QSZA 2AQPA 3OZKA 1YEHH 5CCGE 2R59A 4KKBD 3L5WB 5CEZL 4OFIA 4DP0X 1MW2A 4IIQA 4TQ8A 4NQXB 3NJVA 4X80L 3A21A 3QCUL 4B41A 3PXLA 2EE6A 5D2NB 5ALCL 2K9UA 4XOCA 3G5YA 1I8LC 3KPSA 1L3WA 3QJTB 1U30A 4E2OA 1HK6A 2DQJL 4EMZA 4KK6C 4OZ4B 1RUMH 3HR5B 5BRZA 2A9CA 3BUBA 5EPMA 4YHYC 5HI5C 2ZAHA 1XCQA 3MX0B 5LG1A 2X3CA 1WE5A 1TITA 2CO6B 2IALB 4NT6B 1KXQE 3OKNA 1HXMB 1MXDA 3W2DH 1NCWL 4R7NA 2ZCKL 4X7DC 1JK8B 1U8NA 2F58H 2UZIL 4G6KH 4OUUB 2ADGB 1KB5A 2B0SH 1DEDA 3B4NA 2AGJH 3PHAA 3UGXA 4OZIF 4ZK8A 1J5CA 4X99B 1UM6H 1XGQB 4C83B 3RL2B 2YA1A 3QR0A 3JZYA 2GUOA 1YN7A 4AY0A 3FFCB 3ZE0E 5F3HB 1EGJH 3DUHA 4X6FB 2MCMA 3ESVF 4HQQH 4IBUA 3DXAD 4PJXA 2P5WB 2J8OA 1KIRA 1RP8A 5F9WB 3MJ9H 1IGCH 4ZOEA 1FH5H 3L13A 4PMFA 5LBSL 4RFNC 2AABH 2NY0C 5C6PB 3DV4B 4YAQB 4WNQA 3SPIA 8FABA 3DTXB 4MVBC 2GK0B 1W0WB 1PD0A 2BIIA 4AXWA 5M7QA 3O2DA 5CEZH 1DSWA 5KJ4A 3FUJA 4S0TD 3UX9B 4KJPC 4RZCA 4X80H 1PYWA 1JZJA 2IPKB 2V9TA 5ALCH 2BSEA 1OARL 1A4BA 3LPPA 4AQ1B 4F1ZA 1S7QB 4PY8J 2AEOA 2NTFB 4AC2A 4ZXBB 3T2PA 3UTZB 2DQJH 5MEQB 1XB6A 1MCRA 4LASL 3V4VA 3WIHA 1F1DA 4M6AA 2VUYA 2YKLL 4P57B 5IIEA 2P43B 2VM3A 1FL6B 2GJZA 2VXTL 2XG4B 4TUOA 2FIKA 1YJDH 1NCWH 5HHPA 2ZCKH 3RWDA 3H85A 4IW4C 1EANA 4X42A 2H3NA 3VD0A 3JWDC 2XPGA 1CICC 3TIEA 3KE0A 1MFUA 3OWEA 3L6FA 5CF3A 3QO0A 1VESA 2HKHL 4MB5A 1AR1B 1C7SA 4IMLB 2AJUL 3VI3E 3GPSA 3FT4A 1AZUA 3TTSA 3Q2WA 5IKCA 4YGAB 3NTCL 3GZQA 3LXBA 2VZOA 3WDHA 4NIYE 4FLQA 2JTYA 4ATTA 4LEXH 3WGVB 2DH3A 3CLFL 3SGJA 1AKJA 5J1SC 3STZA 5LBSH 1U8HB 2DQTL 4FNRA 3IJYB 4AE0A 3ARDB 4Z7UA 2JKSA 1J8HD 1DTUA 1P7QA 1KGCD 3I50L 1NBYB 5IW1A 4KJWC 3BPNB 2P4AB 1U91A 2PKDA 5CGMA 4WV1B 3K74B 1PZAA 3QE5A 5AOIA 3REWA 4XMTA 3HHMA 4QJ4B 3GT6A 3IU4L 4NO0A 4MNHB 2R8SL 3ZHDA 1OARH 1HN1A 2WLHA 2DD8L 5G5DB 4LNVA 4EUPB 5JORB 5E4EB 3WS3A 1KGXA 4P05A 5HGDB 2NY4B 3ARFA 2NW2A 4YFLI 3UTOA 5KS9F 1QSEA 3OR7B 1FNEB 5F1NB 1ZXQA 3ZTNH 3FTGA 2VXTH 3AQDA 5DVKA 2BJML 4LNRB 2NDFA 5FOBA 2HZHA 2LVCA 2G4GA 1DQIA 1CR9L 2XFXB 1CFQA 4FXTA 4OZFB 5CBEA 4GI9A 2R0KH 1OSZB 4ODVL 1J0KA 1FG2B 1HHGB 1ZA6B 1OP9A 1R3LB 2HKHH 2Y69B 1S9KC 1EXGA 2AJUH 5T5NF 1E5ZA 3BWSA 3ISYA 3KWXA 3NH7H 5BV7L 5A2BA 3QQNA 1EVUA 1OGSA 3NTCH 4YHYB 1NEZA 1IFHL 1T2XA 4UQBA 1MAJA 2DN7A 4FNUA 4LARH 1OD9A 4NC1C 3CLFH 4WK2B 3QHZL 3RJQB 3WLWC 4D94A 3D69B 4JJOA 2UY7A 5FYJL 5F7DA 5E94A 3UGUA 4BK5C 2EEBA 4LKCB 3I50H 3SDDA 5IOKA 5E6UB 2CO2A 3JT0A 3TBVB 5FUCE 4NKOB 3CFMA 3GPEA 4JKKA 4ZFZA 1SJHB 1Z5LB 4I7ZC 4P2OD 5I1LB 2XETA 2WUCL 3V0JA 5CD3B 3BLPX 4OZGE 4XVOA 4Z7UE 3AG1B 5CFHA 1PBYA 5GZOC 4I13B 2L8AA 1KPRA 3IU4H 2BVPB 4N8CL 3QQ9C 1J5IA 4JZJA 4DGIL 3T1WA 2DD8H 4MCNA 4Z8FH 4BSVB 2PWGA 3D2UB 3E1F1 3K80A 4LCIL 1Q1JL 2WD0A 3OF6D 1N2RB 5J5EA 1BQHB 2Z93A 3DVGA 4Y4HD 5MENE 1JPSL 2BSRA 4RFNB 1LGVA 1G1KA 3DPDA 3JV4A 2NY0B 3NK4A 2EYTB 2O4EA 2R2HA 5FM5M 2DLFL 3GQFA 2NW3B 1D5MA 1B6DA 4PP2B 2BJMH 2CHZA 4QRUA 3F3HA 4DGVL 4YXHH 1BBJB 1KWGA 1X4ZA 3Q3GA 4RWYL 2XXGA 5JNYB 3OBAA 2IAND 4FXGA 3DK2A 1QSEE 2R0ZL 2V9RA 3PY9A 4JM2A 4NQEA 3PDDA 3BVNA 4ODVH 4OFVA 5CIPH 2V2XA 5FYLE 5TD4A 2CPCA 3UO8B 2ZKMX 1KTRL 1ZS2A 2OMVA 1PDKB 4EN2A 1OV8A 3CDFA 3X3FL 4LKXA 3BN3B 2HFTA 3GTVA 1G7LB 1T1WB 3Q5OA 1ZT7A 5BV7H 4R5XA 2H8PB 4PJ8A 2ZXBA 1AZBA 1F02I 2IG2L 4GP5B 4PIBA 5EA0L 3TO2B 3OVUB 2WY3B 2P7TA 1O6SA 3FF8A 3UJTL 3TEXA 4B50A 4DPBX 3QHZH 4PYGA 1R17A 1IAOA 3LPOA 4YWGL 5FYJH 5KZCD 3HN5A 2ALWA 1DQDL 1CICB 4JY4A 4HOMA 1WWCA 1HEZB 2GITA 3QEGL 4L3CB 1M71B 2UY6B 2VQ1A 3F7VB 1S8DB 3WMQA 4ZW5A 4GQ9L 5E6IC 5HJBA 3TWCL 5IVXB 5KYXB 2WUCH 1HC1A 1ZAGA 3G7TA 3MCKB 3MRJA 1LD9B 4HCIA 4HEPA 2E6QA 4YDIL 5FUCC 2K1MA 4N8CH 3SGJC 2HG0A 2NXZD 3IPFA 4DGIH 3EYFB 4EI5A 2F7QA 5GRZA 4LCIH 1Q1JH 2IFGA 3ZE0B 2D0FA 3SKMB 4X9HA 1GYWA 1EFXA 1JPSH 4K9EL 4N28A 4YLBA 5TQ0L 5IGXL 4P46D 3C5JA 3N50A 5IJCC 3GMLB 1MWAH 2DLFH 4HXBH 2OL3A 3BP5A 1J11A 1F3RB 1ODAA 3GWJA 1G7PA 3BH4A 1JUFB 3MGTB 4RWYH 4QT5B 4JFOB 4XBPA 4E41A 5ISZB 3SBWA 4C4UA 2R0ZH 2NZ9D 2AFNA 4I0PC 2VGLM 1XHHA 5IB4A 5JOFB 4G8GD 1UGKA 5PCYA 4CC0A 4F7PA 2K0RA 1MCIA 1Q9KB 3ARFC 1DQTA 1M3IA 2FQGA 3OMNB 4KVPA 3X3FH 1G7JA 4MAYD 3U82B 2P26A 3FB6A 1EDYA 3FU3A 3MXVL 5B21A 1NAMA 3VXMA 5DO2D 4NQEE 2J8UF 1JYVA 2NNFA 4MA7L 2IG2H 5EA0H 1B2WL 4MBRA 3IRZA 2WB7A 4KX9A 3UJTH 2Z65C 1NWOA 4AGNA 4LIQL 1DLHA 4PTUB 3QORD 4G9FA 5JHDD 4YWGH 4AC4A 2WO4A 1DQDH 4PI2A 3U2SA 3H3PL 2FEEL 5D1QA 3G5YB 1H19A 5DJXB 5JZ7D 3QEGH 3OTTA 2N3JA 4OF6A 4HHAA 2Z31A 3EJYD 3QJRB 4GQ9H 4YZWA 3TWCH 5E9DD 2VABB 4ADGA 2WAQA 5I2IB 1DFXA 2ZOWA 3GSUB 3P4OA 4DWHA 3G6JA 3ZHFA 2ZYIA 3T3ME 5DZ9A 3VH8G 2YD0A 5F7WC 1J1XL 2XG5A 2BSTB 2YAEA 3VI3B 1HYSC 1EV2E 3QGVA 4IRJD 5FYKU 4M8UA 5TDPB 3JTSB 1QWNA 1BAFH 4K9EH 2DH2A 4N2OA 5IGXH 3BYTA 5C7ZA 4U1SA 3SGKA 3UPAA 1AS6A 5ESVA 2QL1A 2XRAL 2YC1A 4QHKI 4TYUA 3V7AE 3VWJC 4AKOA 2IQ9L 4ZO8A 1A3RL 1URLA 2CU9A 2JI2A 4BFKA 1X6LA 4JZJC 5I0VA 4U7SA 3LRSB 1ZT1A 4BWWA 1MLCA 5FK9B 4S0HA 1EJ6A 5FIEA 4W9DC 2AKRA 3NPSC 4L37A 1UWXK 4WWPA 4AZUA 4QXTA 1J8SA 3NRPA 3V4PL 3KDMB 4BQ8A 1MCCA 2B9AA 1R5VA 1Z3RA 5K59E 4X5WB 4L4VB 5HBBA 4E41E 1ZHBA 2DV6A 3MXVH 3BH9B 4JKPH 5D7IA 1G6RL 3ZKQD 3OAWA 3BSGA 3QRBA 5F1SA 1U0QA 5AG9A 5GZNA 4UANA 3HJEA 1B2WH 5DJ2B 1HHIA 5EO9A 4GFXA 4AXWB 4L0ZA 4LCUA 4LIQH 3O6FB 2P8MA 4FXGC 2GSGB 4AQZA 4NI6A 1CT8B 3I6LE 4JM2C 4U4BA 4GBXD 4YXLH 3VXME 4NBXB 1R9FA 3F7PC 4GINA 4G43B 1SVBA 4XMZA 5ACMA 3UPRB 3H3PH 3MBEA 1OGPA 4G6AD 3RWIB 3BKML 1RPUA 3LB6C 4Z77B 3VXSD 1IGJA 4G9FE 1EAPB 3RDJA 5K9KA 3S37X 4J6RL 4JMNA 5SX4I 1GJUA 1HCFX 4AVKA 1S7VA 4XZ4A 2M83A 2J2ZB 4ZTOH 4YHZL 5IIEB 5J1TC 2XV0A 4MJHA 3GS0A 3BO8B 3UBGA 2RALA 4AI7A 1U8LA 2JKTM 4MDIB 4Z7VA 3AXHA 3RRQA 1N3NB 4K9JA 2XPGB 3TIEB 3CXDL 3ZT7A 4ZUSA 4JPWL 3G6JE 1TPXC 2IAMD 2ZP0T 2PW1B 4O02L 3RZWA 1T04B 3FZUC 3FQNA 1MCOL 2XRAH 1ZA3A 4U1MB 4WWNA 5CZVL 3AS0A 4N0CC 3FAXA 4XCCL 4OIFA 5E6IB 3KM1A 3MRIA 4UF7C 1AFVL 1KCBA 4HWBA 4DCQA 4R4ND 1X5MA 3V4PH 5HGHB 5AVWB 3PS6A 3QNXB 1EX0A 4OZGB 4Z7UB 2L3BA 1T22A 2A83A 1H3PL 1P7QB 2W60A 1G6RH 5IW1B 1VJSA 4UTCA 2P28B 3NN8A 2WYIA 2F19L 3F6LA 1SGKA 1T4KB 3GHPA 2XWEA 3BN9C 4NC0B 5J0BA 2ZZUT 4O2FB 3T3PF 5MENB 1JS4A 4HS8L 4NO0B 1BXAA 4OJYA 2ITDA 4GKZB 4DUXA 4IOFD 3BWUC 4JJHA 4I0PB 3QULB 2WXQA 5BQ7A 3RY5A 1U92B 3WKNA 1BX2B 1FRGH 1Z9NA 2X70A 1KB5L 1YHPA 2OJEB 5ANHA 2NW2B 1KIUB 1YEIL 3QDJA 4J6RH 3ZDZF 3LNIA 4WU7B 4ZPVB 2IDCA 1BXUA 4YHZH 5CZXC 5KANG 3UEQA 5EBMB 3JVFC 3N40F 3UIZA 4EIBA 3FYIB 2DQFA 3SY0A 3BP4A 3K6IA 1VAHA 4P48A 4BE5A 4BFBD 3TBTA 4Z7IA 1TKWA 3CXDH 4HUVB 2PLTA 3ZHLA 2CRIA 2NY6C 4P5RA 4O02H 4HUMB 4MXQC 1J1OH 2HT2C 2WVTA 2Z31C 1DE4B 1MCOH 4Z7VE 1TTCA 4DZBA 2E74C 5E4IA 3RWEB 1F42A 5I5JA 4KY2A 1ZLUK 4XCCH 1QRNA 2JXMB 4NN5B 3ARZA 4TN9A 1JTPA 3MV11 1QFWM 2QQLL 3VSVA 3B3IB 3O0LA 4F57L 1E28A 3FCSA 4OJAA 2WHVA 1FGVL 1XZ0B 1P4IL 1MIEL 1QFPA 1D5RA 1H8LA 4AZ8A 1LE9A 1H3PH 3VFOB 2NR6C 5SX5H 3SKNB 1FFOB 5GRVL 3FT3B 3MRGA 2WYZA 4J3WA 5DJ6B 2ZWKA 3WNMA 2HLAA 4FFVC 3GFUA 4LFHD 3NJXA 2F19H 1A3LL 4RMBA 3WIHL 3V4VL 3GI8H 3LX9A 4IJTA 2LGNA 3VWJB 3L3OA 3VXUD 1KY6A 2YJLA 3IETB 4HS8H 3T09A 4Z7AA 4AH2A 4HG4J 1ULVA 4WW2C 1RV6X 4L48A 4A2LA 1T7WA 4ZNCD 2O61A 4JZJB 5EC2A 2VM9A 1JDAA 3QH3A 1H6FA 3VRIB 2I32A 4Q9RH 1DZ0A 3NPSB 3KD4A 3R8BB 5C7XH 1KB5H 2XWRA 4NRXB 1OGAA 1LO4H 3KBPA 4JFPB 1HVXA 1R33A 1YEIH 5ENWB 1MH5A 1I8MA 4I2XA 1ZLVH 3FT2A 3ETBF 3NG5A 1ADQA 4OFQA 3T65A 2X89A 3MLSL 4K5MA 1U3HD 4MMZA 4NX0A 5ID0B 2WM0A 2Q9OA 3U9UB 3MBEC 3FONB 1FN4A 4FNLH 4RFOL 5E8PA 4PSRA 4RMVA 1QFWL 3F12A 3TPUB 4RSVA 2LR4A 2OTWB 3N1GC 4LKXB 1WIOA 5IW3A 3VXPB 2B3RA 2VC2B 3BRDA 1EZUA 5CNHA 4YL4A 5DWUL 3RWCA 3KPRD 1FZJA 2XBDA 2E9IA 4K71C 2QQLH 2VN3A 3VE0B 1A66A 3O2DH 3MBWB 1HHHB 3GBML 4F57H 4HV8A 3C6EA 3D4ZA 2MOQA 3BW9A 3K72B 1O5DT 1I8IB 4GXVL 3BPCA 1FGVH 3V2AR 5AAPA 5JPNB 1MIEH 1QRNE 1S3KH 4JHAL 4JRFA 3T3MB 1ZV9A 4KKCC 4E9YA 3IVKA 3QR2A 2LU5A 4MJIA 4PJIF 1ANUA 5L2JA 5DK3A 4ZFFB 1A3LH 4KU1A 4J4PD 1J7VR 3V4VH 3WIHH 1OWRM 2BO0A 4JN2B 1S5HB 1BVNP 1O7DC 2MTAA 4OD2A 5JO5B 3PUUA 4HKJA 5FYLL 4L9DA 5HVWA 2NZIA 5D5MF 3N3EA 1VRSA 35C8L 5HI4D 4MD0B 4IS6B 3OKOA 4XNZC 5D93C 2FT6A 4K7PY 4LSSL 2AS5M 4UT9A 1KEML 1NICA 3HS8A 2D7TL 1E0OB 3RTLA 2DWSA 4DKEL 1E8XA 1LP9E 4FQ2L 2D03L 2DB8A 4ZOBA 1A6AB 3OZ9L 4L8DA 3PL6D 1FDLL 2UZXB 2X88A 1IAMA 1HL5A 4FG4A 4KH2A 1EJ8A 3E6FA 1ZGLA 4FZEL 1L9RA 3DIFA 3MLSH 2N1TE 5JW3L 3AQYA 3LEXA 1RU9H 2CBOA 3KLKA 4B5ZA 4I2XE 3FTSA 2YPLB 5HDWA 3LXCA 4RFOH 4WHTB 5HI3C 1ZK9A 4K2UL 4HAFA 4L29A 4RAUB 4RA3A 3UBXI 1RMFL 1QFWH 4WTWA 4F7PB 1NA8A 4UNTA 1P2CB 2X4UB 4U1JB 4JO3L 5FW7A 1IBDA 4U6XA 3A67L 3PXHA 3WN5A 5C0JB 2QGDA 2XWBB 1JE6A 4CVUA 3MTXA 3PQYB 1T7XA 2B8OT 4GXVH 3O11A 3ULUE 4XMXA 3K8LA 1WGVA 4XXCA 1O6VA 2J6WA 1I7ZA 2VT0A 2HTKC 3EFDL 4XE0A 2EDQA 2NY6B 2HFGL 3VA2C 3TBYB 4P8QA 4MJ5B 1BF5A 3LJ3A 2OMNA 1KNOA 4R26H 3QEUA 4ELMF 2BW5A 3DX6B 2CO3A 5I23A 2VISB 1HSAA 3LRHA 2MIZA 3AT8A 3CIQA 5FYLH 1X5HA 2KYIA 2XHNA 4JO4L 2K45A 1ITBB 1ZMYA 1BPLB 4CMHC 4LSSH 3CZGA 2XG5B 1KEMH 2JNZA 1SOSA 3WFHB 4DKEH 4A2FA 4FQ2H 1S7SB 4K4KA 2Y1VA 1Z5HA 3HOGA 3OZ9H 4TLUA 1YEJH 4XX5A 2AAAA 3EJQA 1FDLH 3UYOD 4H4NA 3IF1A 4PGZA 4G71B 4DUWA 1HI6B 2LFEA 3L3OC 4FZEH 3Q7JA 1TJXA 2XA8H 2H26B 5FAAA 2ZXGA 4B3VA 5JW3H 3KCPB 5H4ZA 3QIWD 3L3GB 4CKVX 2FSDA 1A2YB 1ORQB 4NQCD 2ZUUA 4WW2B 5C0AD 2VYRE 1V5JA 1K5WA 3HVDA 3D87B 1MCFA 4QXTB 1RMFH 4DUVA 3KWWA 1LTXA 2AMGA 5CN3A 1QABA 1U8IA 3ZSSA 1J5OL 2E47A 1VADB 2YUZA 3CSBA 4GIAA 1TZIB 5LGKA 5AFAA 4M61A 3CPLA 2JE8A 2D3NA 3DWTA 1JGVH 1VKXA 3A67H 3DMMD 3VD9A 5IROD 4P4RA 3WFCL 5DVLA 1O9WA 4ZUWA 4Q74A 3T2OA 4CDHA 2IV8A 2V5SA 3C8DA 5K9JL 1QWUA 2A0LC 3GRGA 4AOFA 2JKLA 1JPFA 1U8PA 3GMMB 3BGFC 1NM9A 4J3OC 1XBDA 5C0FB 4GAYA 1GGIL 1KIQB 3ULUC 2HFGH 3G08B 4JGNA 2PP9A 4MNQA 1JBJA 1BXXA 4UI2A 1U95A 5DJZB 3L45A 3TWYA 1ZEAL 1N8ZA 2PMZA 2FBOJ 4P2CG 5EUOB 1SLUA 3G5VB 5DVOA 2OL3L 3I74A 3DA0A 4CNIA 4K71B 2IQAA 5TF0A 1JRHI 1LO5B 1GGCL 1XGRA 3A6CL 3IN2A 4Z7VB 5AW2B 2Z35B 2BWIA 3F8UB 5F9JB 2HT4D 3LKSB 5EFIB 15C8H 2PTTB 3BQUA 1I3RB 3SPGA 1MNNA 1TQBC 3ZLQC 5C0BB 1PCSA 1T0NA 4D7BA 5A7BA 1ZA3B 3GSXB 2HMID 3D39B 4KGJA 1WBYA 3RX7A 1E5AA 2VC2H 1NAML 4ZFQA 2EVJA 4HWUA 4PJ7E 2CIIB 2X0UA 1LM8V 1JHTA 3QEQB 4L1SA 4YHIB 2NCMA 3J27A 2QHLA 4HEPG 3WKML 1G5GA 1D7DA 2ZUTA 5HVHC 3OZLA 3SSGA 4XNZB 5D93B 2OSWA 1KT2B 3V7AG 1PZ2A 4AMKL 5KW9L 1ND0B 1HIML 1AE6L 5C08B 2IWEA 2WXGA 4Y5VC 3UYPA 2ZUQB 2DM4A 2MOGA 4KXBA 3WFCH 1W8EA 3FOMA 3OG6B 2MNJB 3HNTL 4RGNC 1EHLL 4ZMTA 1TEYA 1MAMH 5IFAL 5K9JH 5KSUB 3P2BA 4KDTC 3F5WA 3H7BB 3CFJB 4YBLC 5MHSE 1TZGL 1QBML 4PCTA 2ITDB 3NOIA 4NS0A 3L4WA 1GGIH 1VFAA 5E08H 1WFMA 4PJFA 3ZDYB 1A1OA 1J0ZA 4FJYA 5DWPA 5DK0B 2GTZA 4FS0A 5C0RL 2OL3H 4JFXB 5HYJB 4Y8DC 3A6CH 4MNQE 4FQHA 4LLQA 4CVXA 2V5TA 3EYQD 2ZOOA 1TOXA 4IRSD 4RH4A 1AGBA 2BY0A 4TKWA 3S7GA 4ZX5A 1UUSA 1G7QB 3MLWH 1CI5A 2VDPL 1JTOA 4XOEA 5HYEA 5FCSH 2PYFB 3KW8A 4BM7A 1EFQA 1BM7A 4XBEL 5ACZA 1BQUA 1NAMH 4YXKL 4HJUA 4X6CF 1GJIA 1I1FA 3BFOA 3CZNA 3ROLA 3S36X 4P2QB 3FQRB 2BHYA 4PLJC 1CE6A 3SDYL 4JDVB 3W5MA 1MW1A 3RUGA 2XI9A 1NKOA 4ZPTA 4CMHB 3KPPA 4IM8A 4AZ8B 1HIMH 2E3VA 2EDJA 3VFTB 2AQSA 3CBRA 5AYUL 3ZKND 2Q87A 3BT0A 3RAJL 3P77A 4FFWD 2CDEB 4M8VA 3L3OB 1SY6A 4GQRA 2VZUA 4OZIE 4W9IC 1LP9B 1NMAL 2PN5A 1EHLH 3V6ZA 3FT9A 1F6AA 3RDTC 5C9KA 4NRYA 3UG5A 2FL5A 3ZZSA 1TZGH 1QBMH 4PV9B 4K7FB 4FFZA 1C16A 2GVYA 2R0LL 2DJ4A 3VGDA 4HCGA 3CHPA 4ZYKB 2BP0A 1DN0A 5K9QG 3AABA 2F0CA 2ZT9C 3F04A 4IBTA 4W6YB 2FR4B 5C0RH 4ZMXA 5I6KA 3GS7A 4X5QA 3GDBA 4Y4FC 4HIHA 3HLAB 4PJFE 4TUKL 4UMSA 4PLNC 1OTSC 1E4XL 4I3RL 3CN2A 3SB3A 4UU9A 2VDPH 5E8PB 1MHHB 2DM3A 1TTFA 2LLGA 3BGFB 3D85D 3FO9B 3BVDB 4C56E 1DJZA 2HSIA 3QDGB 3GXIA 4G82A 2QQQA 4FQXC 4ERSH 1QYGL 4YXKH 5MERA 3JTTA 3CMOL 4BXSV 5F9OL 4KJYA 3GSOA 4JHZA 3KPNB 2CJSA 4K3DL 5FO7B 3SDYH 3QNFA 1DVFC 1B88A 4P2RB 1RI8A 2ZCZA 4FN0A 1ED3A 3MNWA 1Y0LA 5GS2D 1IFGA 2XDHA 4P4KC 3AREC 1FV1B 4ANKA 2TAAA 4F2MA 4JX0A 1SMAA 1A9EA 4G42A 2FYYA 3IVKB 1E4KC 1ZK5A 3CX5J 3Q2CA 4PBDA 2WXKA 1IL1A 1TQBB 1NCNA 3RUGE 4EJ1C 1IJNA 4RMQA 1I7RB 5JW5B 3GMRA 5C0NC 1P6FA 2R1WA 3C60A 5HSFA 1NMAH 5DHYA 1NJ9B 3B56A 3VRLE 3D9AL 1QO3A 4MCMA 3FSAA 2H3KA 2I25N 2R0LH 2RH0A 1XH0A 3QUKB 2XKSA 2V0AA 5DZAA 5GGTA 3E3QE 4TTDD 5HVHB 1UACL 2G5UA 4ICWA 3WDIA 3BZ5A 4Y5VB 4J3TA 1A6VL 5FA4B 1J1PH 2A6JA 3BZEB 2FTAA 4PJEA 5EHFA 4TUKH 5F71A 3LEXB 1QA9A 5C09D 1E4XH 1IU1A 3R06B 4RGNB 5A16A 1MXGA 2ED9A 2FX8H 4I3RH 4QTHB 2LW3A 4HWBH 3RI5K 4G6FD 1MCLA 4YBLB 5LAPA 4XP9L 3I84A 5CJOL 3KVPA 1ES0B 3MV8D 4UV7L 3IMWA 1CTOA 4XNBA 3V0EA 1GA2A 3CMOH 4F24A 5F9OH 3HJ0A 4JJ5A 3RTQD 3IGFA 4OF8A 1XXDC 4F15C 3GNML 2GYSA 5I74B 1HL4A 2Y23A 1OM3L 2NXYC 1BPVA 4FYSA 2C9QA 4ANUA 5PAZA 4KK5D 3TA4D 3CCHA 1I7ZB 4U7MA 5BCAA 1UWXH 1KJ2L 5I1DB 3WYRA 1KB3A 1NDMA 3SJVB 4ZMPA 2W0LA 3ARGC 1X5KA 2YD1A 1CLZL 4LCWD 4Y4KC 3QZPA 3WCYA 4ETYA 2ATPA 1HT6A 1UM4L 1LNUB 1L9PA 2CK0H 1ADQL 4OFYD 1GS8A 3D9AH 2HT3D 4FHBD 3CDCA 3VVWA 5DYOB 3OM3B 4W4NA 3E6HA 3HEIB 3ZKMD 1I53A 5E24E 3FDWA 4JFYB 5I26A 4G6ML 5K69A 4PJ7B 1WHOA 2WWMD 1GZQA 1ZGLM 1GJWA 3TGXA 1I9JL 1GCFA 1OAXL 3GMNB 2FT8A 2VB5A 1IKNC 2BOCA 2J1WA 1JZDC 1K4CA 1A6VH 1I1AC 1WD8A 2DTML 5IM7A 4OH2A 5JHAA 4C8XA 2EDEA 3LEYH 1FZKB 3GHBL 3SE3A 3BUTA 3JWOL 2WINB 2VJXA 3TEYA 2X4TB 3RDTB 3EHBC 4PREB 3A0OA 3HVNA 3RB7A 4XP9H 1KPVA 1OAJA 1OOWA 5CJOH 1NFAA 2ITFA 3U9WA 3OXRA 1MQKL 1U8IB 2C3HA 3D4YA 1NIDA 4KTGA 3B2XA 3SDXA 5JPMA 1NPNA 3ARBD 2GSIA 4NENA 4Y1TA 4M61B 2GB2A 3MREB 4M62L 3PFQA 1JCVA 1QEXA 5EZLA 4ZSOA 1E4HA 3MVSA 1MY5A 3GNMH 4IBVA 2FGZA 1M1XB 1IVTA 4PRPD 1J12A 2UZYA 4XC3L 2DIBA 4Y4FB 2CH8A 2XX0A 2BHZA 2F5BL 4M7LL 3BD5A 1FNFA 2CO7A 1L0QA 2J6EA 5T1KA 4UT9L 2BNQA 3IJSA 2Y0SA 5T3XE 5I1HL 1RZPA 2R23A 5C07D 1AD0B 1CLZH 2YRLA 4AX3A 2VXSL 5JTWA 3B6SA 3VRJA 1BZ7B 4J3OG 1UM4H 4GG8A 4F7TB 4FQXB 4FTVB 1ADQH 4PGDA 2MCPL 3UAJD 1S5IL 2EDLA 1PFOA 1K9TA 1V05A 2XQYK 3IWUA 1DVFB 3QISA 3GS4A 3S35X 5SWQB 2N59A 3CDGB 4G6MH 4GW1B 2CKBL 4FABL 3A22A 2XA3A 1I9JH 4NI3A 1WA1X 3AREB 4P4KB 1OAXH 5CSZB 3ULAB 4J3OH 1L0YA 5MEOA 3OB8A 5A43C 4LVHC 1G43A 3ULUH 4QHKJ 2DTMH 3QA3A 4HGKC 2GAZA 1E5YA 1BD2B 3GHBH 1PY9A 3JWOH 4QRRA 3QIUD 1SJEA 1LEIB 3WNKA 4CU8A 1YNTA 2JTDA 2AV1A 4XO3A 3DTUB 2XX1A 3ZL4L 4WUUB 2D0HA 1T2QH 3QNZB 4HOZA 2R1YA 5CJ5A 1MQKH 4OZIB 2OMUA 2CR0A 2R1XB 3G6DL 4HJSA 3EW3B 4M62H 1IEBB 1FVEB 5CHNA 4XR8C 2K8QA 5F7BA 1CLOL 1G7IB 4W9JC 1ZLUH 4Z7QF 5EEYA 3SGDI 1WAEA 1Z1WA 2OQJB 1NLDL 4X50A 4XC3H 3QJVB 1GXEA 2C5DC 5CXPA 4P23D 4IYKA 3I75A 3IN0A 3WMSA 1N4XH 4M7LH 5EBWB 4UZSA 4Y1AD 2A1WH 4ZSOE 3CVIL 2DOCA 3L3JA 4UT9H 3P54A 2ZUWA 3GRWL 4E0RB 1BAGA 1U8CA 1X5GA 2VXSH 3V4UH 5CJXA 1ZCRA 2Y7SA 4ILDA 5AOJA 1QR1B 1QSFA 4XGZB 1IQDB 4QWWC 4ZMQA 1J9QA 5GXBB 1LQSR 2Y07L 2ZKXA 2N7BA 2MCPH 1OHZA 1P1VA 2BNQE 5A1AA 5C0CA 4M7JL 1RJCA 4C56B 5H2BA 2CRYA 1MVUB 4CADB 4F15B 3D3VD 3KBHE 1AGBB 3S4SB 4AQOA 3MFFB 3K71B 5FOJA 1RLWA 2Z1PA 1JZ7A 1SUJA 2NXYB 3HZKB 4FABH 5D7EA 4XOBA 2BFVL 4L8SA 2Z7WA 2H1XA 1RJYB 5H37A 1ZLDA 1RIUL 2XUWA 3ECVA 3ZTCC 5ACZB 1HZLA 4KZCA 1ERNA 3ARGB 4UM8A 4K8RL 4Y4KB 5DRNA 5ITFB 3VNYA 1Z5YD 2C9UA 3VGGA 1PZ5B 4QF1B 1IAKA 3JYBA 2WXMA 2X4SA 5EU3B 2BRRH 2XQYA 3MOBL 3U4EA 5KYUA 3L4ZA 3ZL4H 4I9WD 3U79A 4PGBA 4WW1A 5IHBA 1A6ZB 3QZNA 4NDMA 5I6MA 4PV8B 1P7KB 3FCTA 3G6DH 2VAAB 5AW6B 4AGMA 5FDWA 4JANA 1X44A 3CU7A 3SO5A 3H9HA 2HJFA 1CLOH 2X9ZA 3SE3C 1PSKL 2DWTA 1V3MA 2OP4H 4M7ZC 4FQIL 1GMIA 1I1AB 1SEQL 2V3FA 4Y19B 3V6ZB 1Y18B 1RK1A 5ICXA 1R3JA 2FSEA 1G6VK 1MJUL 3V9EA 1YN6B 4V2CB 4PBVC 2X12A 5IQ7L 2GC7C 4J2XA 3CVIH 1E7VA 3BQVA 5AL0A 3EHBB 5FEBA 1KXTB 2BSBA 4QTIH 2OKMA 1F4AA 5FA3B 3UBHA 3C5ZD 2IBBA 3WJJA 2VLLB 3RKDD 3BIKB 3HE7A 4KUCD 3RZCA 1H15A 3T0BA 2Y07H 3QVAA 2OSLA 4PFEA 3FFCD 3ZO9A 3S8WA 1E9PA 3TJEL 3WJLA 2GBUA 2H2SC 5E23A 5FKPA 2W0KA 1TSHA 2AQNA 1QSFE 1MFAL 1QTYT 1SMOA 2P5WD 1XGTB 4KI5F 1NC4B 1JVKA 3N40P 3R4DA 1K4DB 2BFVH 4PJCF 4RLDA 2E76C 3PIQA 3FJTA 5C0CE 2MQGA 3VU1A 3ULSA 4HWZB 1RIUH 3RWJA 5KS9B 2A6IB 2ZYHA 4W9GC 5GSRB 3RVVC 4CGTA 3CHQA 3TYFA 4K8RH 3TNNA 1WEJH 3IDJA 1RUAH 2OSYA 3VSQA 3ZTJG 4KJYB 1S2EA 2BVQB 3F83A 1NTDA 3RWHA 4FJZA 3VTMA 4UM9B 1Y1UA 4HIJA 4WUKL 3TOPA 1NDGA 1OL0A 3MOBH 1BZ9B 4H7VA 2OMTB 1OW0A 2YLHA 1GPOL 2H2PD 4XH2A 2YSTA 5CSBA 5ANMB 2BZ7A 1ET8A 1TTGA 2ENJA 4ZXBD 1W72A 4FMKA 1FG9C 1NGQL 3ZTJH 5E6SB 1PSKH 3LH2L 3ML8A 3DECA 5MP6L 2V17L 2ZOLB 4MXVF 1CFTB 5EEXA 3QUMA 1SEQH 4J3XA 5DHYB 1A7RL 1F58L 2VDRH 3CHRA 3ZHKA 1MJUH 1GC1L 2CGZA 3MC0A 1J87A 1BVLB 4MYWB 4BSJA 5IQ7H 4WI3A 3DDFA 4NZJA 3TIDB 3TVMC 4TSAL 4EN3D 3PJSA 4DTGL 4P0DA 3VFSA 3PXJA 1MRFL 1JYWA 2AF2A 4XXWC 2YSSB 1AO7E 4BK4A 4YPGA 2A6JB 2ZWSA 3MDJA 1Z9LA 5CEXA 3NZ8B 2FECI 3POCA 1MFAH 1D9KA 4KNTA 3FSWA 1IGFL 5DQDL 5A2CA 1JZ6A 1E65A 2NX5B 1M42A 3BH8B 1MHCB 4JPIB 2IOIA 4NAQA 5DUBB 4LAQL 2C9SA 1T80A 3FQ2A 3T3PE 5I5IA 3ARDD 2WZAA 3OJDA 4YE0A 1XF4A 2GJPA 4G1MA 2E9BA 5AL8A 4DGYL 4GUPA 1YEFL 3J8F7 1NGYB 3CSGA 3AY2A 2I27N 4HCRA 2Z0BA 1SDAB 3QPQC 4BIKA 3IJ7A 1SY6L 4WUKH 1T20B 5IFHL 3O3DB 3FU0A 1WH0A 3CCHB 2PYEA 4IK6A 4X8XA 4WF7A 1CIDA 1J0HA 4IKNA 4FFZL 1B0GA 1TVHA 2ZKHL 4DQOH 3ARWA 3EOBA 4JFSA 2NY4D 1NGQH 3IMSA 4P5KB 4BZ2A 3LH2H 5MP6H 3VD2A 1T7YA 2V17H 3RGVA 1A21A 4I3SH 3B9KC 2GW5A 1F58H 3VDCA 4CKQA 3B7UX 4OFPA 1SYVA 3QQ3B 1GC1H 3GMQA 3RVWD 4KTYA 5DHEA 1TETL 4GB9A 5EIIA 2AXGB 3CUPB 4M1DL 1SDYA 4WWKC 4B53A 3PWVB 1BFOA 4XO9A 2GIXA 1CFNA 4MX7B 3C6LA 4PR5B 1M05B 3MLZL 1GZQB 2FUQA 2Z4TA 4TSAH 5DURB 4PJIA 4DTGH 5C8JB 5TH2B 2WMPA 3STLA 2X4QA 1MRFH 1TFHA 3VWKD 4KXDA 5ABDE 4FQQA 5LQBH 2R8SH 4Y5YA 3X12B 4KK6D 2GTWA 2NT1A 2EDDA 3QZLA 5HI5D 2R2EB 3CFDA 4M7ZB 3UFIA 2VW7A 4XB7A 1XMEB 4HFUH 1VGEL 3E38A 4ONHA 4JM0A 1K8DB 2WLIA 4LAQH 1PAZA 3HN3A 2VSCA 2LT9A 2PP7A 3RVUC 2JK5B 4E42A 1MRCL 3HE7C 4Q4IA 5ELIA 4D9LL 1J05B 1YEFH 4TPRL 3ESUF 3WJLC 4OVVA 5JHBA 1F41A 1SY6H 5IFHH 5IQOA 1MJ8L 2BWDA 3QUXD 5HHOA 3MROA 4I1NB 1ZSDA 3CJJA 3O3AB 3WUWA 1SMDA 3QRLA 4FFZH 4OIIL 5GS0C 5CKAA 2ZKHH 4XHQA 5D1ZC 3SE8L 5GGTL 4PRNB 3TC9A 1BOGA 2YBRA 3FU7A 2J8UB 3NZHL 4DO5A 4I4WA 1OAKL 3APCA 4KK9C 2NY0D 4K7PL 1P4LA 2PYEE 2WQVA 3M17B 4LHQB 4PJ9C 1AD9A 4KNSA 3ZMNA 2F1BA 1PG7W 1TETH 1KEGL 3LKOA 4O5LL 1OAQL 4RDQG 4Y2OA 5C1MB 4M1DH 4X6DA 5GGSY 1AS7A 5HDBE 2RJMA 4MD4B 1RZIA 1QHPA 4KJPD 3Q6GL 4FXKC 1J8RA 1GZPB 1RD6A 2LHAA 4PSPA 2DKMA 3FQWB 3P3RA 2NNAB 3D4GA 4E9VA 5MEOB 1KLUA 1HWWA 1LO2L 1UURA 3V6FA 4NFDA 3BAIA 1LDPL 3N1MC 4Y1SA 4BUGA 2VDLL 4TNEA 3MJ7B 4F80A 1CXHA 5LDSA 4EZLA 2EIZA 3CVHA 1HE7A 4PJIE 1VGEH 1LWJA 3T6ZA 3BGMB 1KGWA 3MRMB 2BMKA 4OM1L 4G80B 5E8OB 1MRCH 2WTOA 3IXAB 3M1BA 4LLWA 4W1TA 4D9LH 1EZLA 3DROA 4RFEA 5E4AA 3TVMB 1NC2A 2JQMA 4KWUA 4TPRH 3VXOB 3GZOA 2PR4L 5CHNB 3ZE2E 1KCRL 2W65B 1MFVA 5E2TH 2IBZY 2Y6SC 3B2MA 5CAYB 1MJ8H 1XF2A 1OSPL 4XCEB 1CGVA 2J88L 5T1LA 4OT1L 1RXLA 2OMXB 3E0GA 2F8XC 1DN2A 5TJWK 3RHWK 4OIIH 4KO6A 5H4YA 3SE8H 5GGTH 2ENSA 2I7OA 3GMPB 2ZSWB 4TXVB 4JHVA 3P0YH 1M53A 5HHOE 1CJYA 1QSFB 3EOAB 2FJGB 1GKEA 1OAKH 2VLKA 4K7PH 2QPUA 2BNUB 4RAVB 4NPKA 1N5AA 4KJWD 1VCBC 4JM4L 5DRXA 5C0CB 1ACCA 4O5LH 1OAQH 1KEGH 4YK4C 1WZLA 4LO9A 4N68A 4OCWL 4Q4EA 1EEZB 1GAFH 4N1CA 1FFNB 3ZIMA 3KGRA 2NUPB 1C8PA 4A6YB 3Q6GH 4R4FL 4ZUTA 4OQTA 4DW2H 3TBBA 4GKSB 4MQXC 3ZR5A 2CQVA 1YAZA 3REVA 3B5TA 1TZHB 3A23A 1LO2H 3RGVC 1IGIL 4X6DE 1LDPH 4LP4A 3TZVA 2VDLH 1JHKL 1U3ZA 5T1MA 5B39A 5T1JA 3LQZB 3B9KB 2Y4SA 3L9RA 2HG5B 3WMPA 3P2DA 1YEDA 2X4SB 5T3XH 3U4EB 3MUZ1 3GBNH 4WWKB 2LOEA 1LO3L 3DVFA 3EH5B 4LPCA 4N9GB 4N2DA 3QJUB 4PWHA 3FF7A 1A1MB 3NCJH 3AS2A 4HK0A 2FO1A 4NRZA 5DZOA 5AAMC 2ZD0A 4ZAKC 3WTVA 4JANB 1Q9LA 2EDNA 1E3XA 4H8PA 5B1BB 5K9QI 1UATA 4QRSB 4Y5YC 2PR4H 1A1NA 3K1DA 1NOAA 1CXKA 1KCRH 4X5PA 1C1EL 3W56A 1SHSA 2WNWA 5G4OA 3MO1B 2VN5A 5C6TH 1OSPH 4ODUB 1KPUB 2J88H 3NUKA 4LRIC 2B1OA 1DQQA 3UDWC 3JWDL 4PJDA 4PRIB 1KC5H 3T4AC 3O6ML 1AGDB 3B9AA 5CWSB 1KTLA 1AO7B 4OLZH 5AUMA 4IBZA 3BJLA 3WLWD 5DMJB 4P9ML 4J27A 1KB9K 5JW4N 2IC2A 4M43H 1CQYA 3Q8BA 3SKJL 3VX1A 1I82A 1SM3L 4JM4H 2A2QT 2QR0A 2QV4A 4JO5A 2CCLA 3T3PB 3ZTEA 4LLDA 3U4BL 1JZ4A 5FB8B 1F8TL 5JHMA 1FP5A 4BQCA 1ZIBA 2XVBA 1NGZB 3V9CA 3QQ9D 3PWPE 1NKGA 1S7XA 2X4NA 3KLAA 3PIQB 4NJ9L 2MEJB 5GJTL 3WY1A 3CFBA 5EBLA 5HHXH 1SEBB 3MKGA 5D1ZB 5D72L 1UWEH 3S37L 3ZDZB 4Y5XA 1AOZA 1JHKH 1YLBB 2KLTA 3TNNB 4A7VA 1Q38A 3FTVA 2XWTB 4LCYA 2FBJL 3WI9A 3UH8A 2Z4QA 1KV3A 2Q7YA 4PJ9B 2JIXA 4B5EA 3QUYA 4L3FA 3MZGB 4XMVA 2CBMA 1QFHA 3O4OC 2NCEA 3RX5A 3DPBA 1J48A 4XNYL 4O2EA 3LHPL 5HJDA 3KYMA 1CD0A 4HWEH 3AT9A 2J6EH 4FXKB 3TFBA 1LEGA 1G9NL 3EKCA 3VVVA 3X14B 3LN9A 3FCUB 1KBBA 2J5LC 4GXUN 4OGYL 1C1EH 4FE9A 1OPGL 3V5HB 2YAQA 1L3NA 1WP6A 1WWWX 2P80D 2MCAA 5IP4A 4BKLB 3EYVA 2MPAL 3ASOB 1JWMB 4UQCA 2ZX7A 3D0AA 3AM8A 3PGDB 5KG9A 3PV7A 3MRKA 4Y16C 2F5AL 1OE3A 4RMRA 4RIRB 2WVVA 2YOCA 1ZLSL 5IK3B 3PJSB 3SD5A 4JNXA 3OSVA 4PJ5B 3DX8A 3SKJH 4X6EB 1CL7I 2Z7YA 4YL9A 2HVJB 4HAKA 1MCWM 2B2XL 4PRBA 4ES8A 2FCBA 1F8TH 4M4RA 3T8MA 1E7UA 3WTWA 4PGCA 1G9EA 4HBCL 2YMXL 2YEZA 5KWYC 4HIEB 1A9BB 3QDMB 5I16A 2VR8A 3DBXB 1AKJD 2EACA 4FG6C 2WQAA 3QT2A 5GJTH 2Z0UA 2CIKA 3GBLA 3RFZC 3TT1L 5D72H 3B37A 3S37H 1P7QD 1XF4B 3D25B 2R0WL 4O51B 4PBWD 1URZA 5EB9A 4ZW7A 3EZ8A 5D2LF 1Q4NX 1XZWA 3E8VA 3QZWB 4WI0B 1HNFA 2FBJH 3ESNA 2VE6B 3ZTDC 1QLFA 1UA3A 5MEND 5IF0B 1N7ML 4YK4B 2HJLB 4XNYH 4NO0D 3LHPH 1QZ1A 4HLJA 3WL9A 2WQRA 4GO9A 2WXRA 4LLYA 5DS2A 3T0EA 4NP4L 1D5ZA 2HUEA 4I0PD 5HJ3B 4R2GC 1G9NH 3PDOA 2E7LC 1PGRB 1T1XA 1UXWA 2B20A 3ARFD 3OGOE 1P6AB 2QMJA 3AAZB 4IGBA 3EDFA 4ZFOA 4MB1A 3IWVA 2WWNA 5H37G 3T4YB 1QSED 4AYDC 1JNHB 1AMXA 3PPEA 4POZC 1E5BA 4XB8A 3LKQA 5CUSH 1G7MA 5GS1A 1QBAA 3RIAF 5CGTA 5EU6E 5DJCB 3ME0B 3HCVA 2XFGB 1S9VB 2V6HA 2VLRA 3VFWA 3JWNH 4NNYB 4QHMB 1KJVA 1UB5A 2XQYG 5T3ZE 1HHJB 4G8FA 5HYSB 3CVBA 1UOLA 4MLSA 1JDCA 4PJIB 4WJKB 3PPSA 4NKMA 2EXTA 2HVKA 5H37H 3WEXA 1XIWA 2Q76A 3ES6B 1JXDA 3K91A 1L7TL 4ZAKB 1U58A 5IW6A 2ZE0A 3QARA 5K39B 5IV2B 3M86A 4Y5YB 3KPMA 3AT0A 3QJHB 5I75C 4K3JH 2WWKO 5D5MB 4ZS7L 4HBCH 2YMXH 5AD0A 4UINH 4C55A 1ORSA 2X9WA 4IK7A 4N2NA 4JG0L 1WFUA 1MCKA 3T4AB 3O45A 5LG6A 4N90E 3GLEA 3KR3L 3TT1H 2XIDA 1MFCL 3SYQA 1HYSD 2R0WH 3SDDD 2ICWB 4PHXA 3MCYA 4R83A 3WFBH 1DJYA 1DJXA 4N0YL 1W72L 2NOYA 4EIGB 4ZDHB 5E9AA 4M93C 3VWJD 2V8LA 4N0UA 3L2MA 1N7MH 3Q1EA 3QUML 4U6YB 3OJ2C 1I1CA 4OJDH 2QVKA 4MZRA 4D8OA 1I9RL 5DMIL 1JWSB 3OMZA 4GMSL 1A6TA 3VFNA 1MCPL 3JZ7A 4Y5XC 1CS6A 4NHCL 1T1ZA 4KVNL 1N59A 3SGEI 3FB5B 3MRDA 5A2AA 3VXQB 1SDDA 4QJ3B 3T0EE 1QRKA 4A7SA 1EK3A 4PI0A 4LSRL 1CXFA 1S7UB 1RIHL 1J0IA 4PLKD 5TPWL 2IOMA 5GQBA 2CLVB 1J88A 2G4EA 3BP7B 1IAIH 5DJ0B 4NQED 1NCDL 4JM2D 4BINA 3O4OB 3LVEA 5CP3A 4L4JA 5GGSA 2DIEA 1H8SA 4ELMB 1I1YB 1U93B 3TF7C 3LB6D 3Q44A 3QWOB 2VLRE 1A6PA 2J5LB 2IH8A 3HRPA 3HC4L 2VN6A 3NT0A 1UVQA 3ZSTA 1INQB 1T83C 3BOVA 3CVHB 3IDIA 4OKVB 4WGKA 4LHUA 3KPLB 5DF0A 3WE1A 3RVXD 4UTBA 2OMBA 4Y4HC 3AZUA 3KR3H 1AGFB 4X4YB 3IDMA 3EYUL 4KHXH 3W9EB 1MFCH 2F9BT 2KLSA 3DO7A 3QYCA 2JCCA 4LLWB 3ML9A 4Y16B 2LVEA 2QFPA 3DROB 1MDAA 1O7SA 2LU3A 3NESA 1H3GA 4N0YH 2Y1YA 4YO0A 1W72H 3BPOC 1G9ML 3IGUA 1MFNA 1UCTA 1TVBA 2X2UA 3MLRH 1SYSB 4BZ2L 3CSYB 1A8JH 3QUMH 3S34L 4N3TA 4N0CD 3L4XA 3AXIA 3K5SA 4GSRA 1Q0XL 3FT0A 5DMIH 2CJ3A 1UKQA 2CCWA 2AXJA 4PP1C 3VI4F 4XXDA 2F68X 4N0UE 4NHCH 1F5WA 3OLGA 4QHUB 1EFXD 5DEGA 4KVNH 2YFNA 5JQHC 5EDXA 3RFZB 1JF5A 5E8NA 1AGCB 4AMXA 1AXIB 3NIGF 2K6YA 4Z0XA 3VFUB 1ZHLA 3PWPB 3VXTB 1N5AB 4LSRH 3P9LB 2HJKB 3IMBA 4KQ3L 2WOBA 5I82A 4JFEA 5TPWH 4QHNB 3ZDWA 3BN9D 4TNVK 4E41D 4KUZL 5KYWB 2CGRL 1NCDH 5EV7A 5CP7B 1BOYA 5BUGA 5IOPA 1WFNA 2AW2A 3LKNA 4KFMA 5F88B 4IGBC 4MQ7A 2F7PA 3J7HA 3I6LD 4R2GB 4R5VA 1VFMA 4Y9FA 5DHVB 3VXMD 3U0WH 3K6SA 4PV1C 4RQQA 2NXZC 4OUOA 3HC4H 5DRZB 4G6JL 1ZPUA 4HCRH 3FQTA 4MD5B 3PWUB 5CZXD 1CLCA 2RMNA 1BFVL 2NQ3A 5F6IC 4HGWA 4QO1B 1RZ8A 1CBJA 4YSTA 5EIIG 1ZTXL 4KTDL 4TUUA 3EYUH 1ZHNB 3SIKA 5JYMA 5JW4Q 4P46C 4UYQA 1DO6A 1J8HB 1OKEA 2EKJA 3NPZB 5EZIH 4U6HB 3PGFL 1NCJA 2Z31D 5DZVA 1JNNL 4YJZL 1SXZA 1DVQA 2FWOB 4BZ2H 5HJGA 2ZX6A 2G60L 3FSVA 3AY4C 4JREC 2V33A 4M5YL 5IMKA 2H32A 2CLRA 2Y1AA 1WIUA 3N42F 2Z91B 4ODXB 5GGUA 1WCBA 1T66C 1FYTA 3D18B 3F7YB 4TQIA 4XPTH 3US1A 1UQSB 5J1AA 3P0VL 2W8CA 4M5ZL 2NR6D 3D0VB 4PY7A 4WJ5B 1NBZA 4X7EC 4X7TB 4D9QE 4GRLA 4AENA 4OJFH 4ZODA 4FFVD 3PHOA 4Z23A 3W11D 2VIRA 1IBBA 4KQ3H 1IC0A 2DIJA 3QORC 4LLDB 2BHFA 4I88A 5EU4A 3OAZK 4M93B 2XYCA 4KUZH 3SYCA 3QUGA 5BXFA 4NKIL 1SLVA 2B4CC 3S5LB 2W95A 3GLZA 4GRMB 1S7XB 4LU5L 2X7LA 2RTTA 3W3BA 1ZOXA 4ZTPL 4Z7NF 4JFEE 2QSCH 4PCKA 5EBLB 2I9TB 1EUTA 1OTTD 5DEJA 3QXUA 4JVPA 4N0FB 2J43A 1S7TB 5CILL 4QDGA 5AVSB 2PWFA 3NCMA 4G6JH 4N2BA 3L1OL 5E1AA 1QEWA 1CFSA 2DDQL 1XSKA 4IRJC 3Q0HA 1UZ6F 4GIOA 2WIIB 4YH6A 1ZTXH 3HUJA 1MJJB 4YZFF 4KTDH 4O2EB 2YWZA 3QCTH 2MFNA 3MBED 2IDSA 4OCRL 3NEXA 1H9VA 3QXVA 1KG0A 3FN3A 5EU6B 5T1DL 2J8HA 1OE2A 2Q8BH 2L04A 4P2OB 4AQ8C 2YFOA 4G1EA 1TCRB 3V6OE 4CRPA 4HUWB 2I5YL 2V7NB 4X6CB 5GRXG 3MRHA 1HINL 4J2QA 4XZUB 1L9QA 3CFCL 2UUDK 3VJ6B 1XR8A 2P5EA 1SHXA 1JD9A 2N56A 5IG7B 1I1RA 5TDNA 2VR3A 2WW8A 4Y4HB 4OQTL 2KC0A 3P0VH 4MSWA 2W94A 3JV5A 4KKCD 4JZNB 4L0PB 3F58L 3BPOB 4A2HA 1FYTE 1F3DJ 2DEWX 4PRBB 2Y9RT 3FMGL 2RB8A 1BF2A 1M2OA 4F2FA 4Z7OE 4NCC2 4JVWA 2YD3A 3CVHH 1SHMA 4NKIH 1PKQE 3LAFA 3EXJA 1OD7A 1DDHA 3DX3A 4G6AC 3T0VA 4LU5H 2V37A 1V7ML 4ZTPH 2ZKYA 4EAEA 1IM9A 5BZDA 1RVFL 5CILH 1DBJL 4FMFA 2A4ZA 4W4OC 4LVOC 1LWRA 2ZUSA 3L1OH 3SDAA 4NZFA 2DDQH 3P4NB 3H4HA 2NT0A 4QRPE 2BWQA 4W9EC 2V2TB 5DRWB 2VDQB 1BJ1J 1XV8A 2OXHB 2E75C 1EO5A 2IAMC 1OT2A 5KZCB 1XR9B 3LS4L 4G7VL 3B83A 3VXRE 1V8HA 3EIFA 4OCRH 4OLUL 2C9VA 4UILL 1R6VA 5CGYD 1CI3M 3PDOB 2O6EA 5HI3D 2YD6A 5T1DH 5D7LA 3QG7H 1TZOA 4Z3GA 4LF3B 4K23L 5DHDA 5E9NA 3HUJE 3KMDA 4JCLA 2I5YH 5HGBB 5F0PB 3RGBA 2NXZB 2EECA 2XY2A 3CFCH 4LSTH 2JKJA 3V6OC 1Z0MA 3HG2A 5LNGA 1X7QB 2HN7A 1PY4A 2VLRB 5BOJA 5F6IB 1WUZA 1JPST 2J1ZA 5BS0A 3FQ4A 4OQTH 4LEOA 2K70A 4JDZB 1LHZA 4P46B 3IFPB 4RBPK 4TLSA 1L5GB 2HTKD 3U0PA 5F3BA 1QNIA 1TF4A 3FSOA 3BP6A 4HOXA 4HKZA 2AXFA 3KPMB 1QRND 3NJGA 4NZTL 2E7HA 5D7JA 3FMGH 1JWUA 4FCAA 4MJ4A 1YVLA 4NPJA 5LBGA 3EJUA 1I8KA 4JREB 4XP5L 1N6QL 2BS8A 1HCVA 4AL8L 4G8GB 2FEJA 5SWZA 4H5SA 1NLBL 5CU9A 4DFIA 2NLJA 3IB4A 1IGTA 1UH3A 1RQ5A 3O2WL 4RMTA 1RVFH 4GRLC 1DBJH 2WB1A 2LTQC 3BAJA 3ULVE 5GGQL 1Q94A 4MNGA 3P3SA 3X1NA 3EGXB 2CRMA 4R6UA 4F7MA 1J0YA 2FYVA 1CD9B 3SPVB 3QORB 1QASA 3NA9L 5JHDB 4XMLL 4RGMB 5L2KA 5C0DB 3OPUA 5TF1L 4OLUH 1NDTA 4Y7MA 3PLYA 4BH8A 3S5LG 4ALAL 1HQRB 4L18A 2WXJA 5B7EA 4K23H 5E9DB 2I9LB 1CVSC 4PWIA 2W5PA 4KI5E 3CU1A 1DEEA 3MGAA 4FKKA 1RZFL 2FAUA 2Y1ZA 5D7LE 4M1CD 1LMKA 1E40A 3WGUB 3TNMB 1FO0B 2ZWYA 2SEBA 2YAMA 4IRJB 3CSTA 2KQNA 3F00A 4PWJA 5TE6L 3WKQA 3HC3L 4AK2A 2Z8RA 4J3OD 1PIGA 1RCYA 3ULUD 1CTMA 4A7QA 1LE5A 4NWUL 5CD5C 4NZTH 5DS8B 3KLHD 1AHMA 3KVDD 5BS0E 4UQ3A 1JV2A 1EHAA 3L9YA 1U8OA 3QUZA 4K55A 5TDOA 3IDIB 4XP5H 4DZ8B 3CXFA 3CZKA 2ZF8A 2OW6A 4MMYB 2AV7A 4PJAA 1E42A 2W0FB 4MXVE 4HZLA 1NLBH 1PNDA 2BCKA 1JNLL 1SXSA 4RRPA 3OG4B 5C2UB 1JN6B 3KYOA 5AW5B 3CN3A 3HIZA 4HS6A 2YUXA 5E2WH 2QSTA 2IGLA 3CK0L 3PCYA 4GPVA 4PCSA 5AKTA 5FYKL 5GGQH 3RILA 4YVUA 3W81A 4LLVA 1ZJAA 1JNJA 3CFKA 5HY9B 5IB3B 1KJMA 2FEDC 1PU0A 3LXAA 5DQ9B 3TCLA 5KSAC 4G8EB 1EEYB 3NA9H 2CO1A 2Y5QA 4XMLH 3RBGA 3N1FC 1EXUB 2WZ0A 4N8VA 4ZRGA 2C1OB 4UV4H 1JSYA 2P45B 4MNGE 4Q6IC 3GC3A 1YQVL 3QFDA 4ALAH 3B7YA 1HHKA 1FNSL 2XACC 3DLQR 3L3HA 3VXSB 2BX5A 2CUIA 4APQC 4M03A 2JH2A 1DBKH 4FP8L 1XD1A 3UERA 1AP2A 2EQDA 3L8QA 3KZ8A 3QJFA 1P53A 3ECUA 2CALA 3BSZA 3GSVA 2E7DA 4JFEB 3WHXA 2CLZB 5F0JB 3SN6N 4KI5C 1ZT4A 3U1SH 3BEVB 4JY6B 1E5UI 1DQJA 1T21A 2JJSC 3A3YB 1F3JA 3GJEB 2XVLA 3OX8B 5TE6H 2IAMB 4G7YL 4HJ0C 1AIFB 1VACA 3GSNB 2ZXWB 4G72B 1S78C 5E5MB 3FBQA 5M95B 2XTJE 5ERWB 3ATDA 1AHKA 2PXYC 3CZFA 3IJEB 4QI3A 4LLUB 4NWUH 1ML0A 2C7FA 1DVUA 3KNBB 1OCRB 2HWZL 3E80A 2ADJA 4V33A 4MTMA 2AJZA 3ZQWA 4B9GA 1BP3B 2WP3T 1RERA 2AK4E 3APNA 1XD0A 3FU9A 4HT1L 3S4SA 1HOCA 2P46B 3G5XB 5F7UA 3APDA 3FHAA 4MJ2A 3WY4A 5ID1A 1ZS8A 1JNLH 1ETZB 2I07B 1K2DA 4GQQA 3AU0A 3L1GA 2A7BA 4F3FA 1R75A 3MLVL 1PS3A 3MV9A 5FYKH 4FI8A 4PJAE 5TQ2H 2QADC 3RWFA 4UOW0 3TO4A 2HFFB 1OSYA 4HC1A 5DZNA 2VXQA 1NPJA 2W1NA 3MJ8A 4PUBH 1KTDB 3RIFF 3N2JA 1PY0A 4Q7DA 3T6XA 3PE9A 1F86A 3QYNA 2AJVL 4M8RA 2P49B 4L1TA 2BVYA 4PJXF 5IMMB 1P5VB 2HRGA 1V10A 3H9SA 1QUNA 3TURA 5F89A 1YQVH 3ZUNC 3O4LE 4CC4A 4JR9L 1O6TA 3NCCB 5AB2A 1U36A 4XBGB 1ZWIA 1KLFB 1PKQB 1DUZB 2BP8A 2QGEA 1O9ZA 1NBQA 3GO1L 4GRLB 1J0JA 3EO9L 1IE4A 3GB7B 4QAMB 4HK3J 4Z7QB 3RWGB 3EO0B 1R3KB 1H0DA 3GSQB 3TBWA 3MRLA 4GW4A 4X4ME 2F74B 1RZGA 2ZOUA 3OD3A 2W91A 3CBJB 5FUOL 4GFTB 4G7YH 3GYRA 2X7LB 4KHTL 2CDFA 4M00A 3KAAA 4ODBD 4D0DB 1EMTL 3L5XL 3MJ6A 4HIPA 4Q56A 1DVTA 1QPXA 2IXQB 2YJQA 1UGNA 2ZWLT 4B3EA 4QRPB 1BVKA 4XO5A 1SZNA 3QCVL 2Z8VC 2HWZH 3FCBA 5MHSD 3QFJA 1E8ZA 3VXRB 5C0GB 1GHFL 2XTJC 4DFHA 1PX4A 5I30L 3GIVA 2G5BB 1KCSH 4HT1H 1RL1A 3RGHA 1QG3A 4Y4FD 3S35L 1PKOA 5B4MC 3HUJB 3QJSB 3TEZA 2H6PA 3ESPA 5D7KE 3B43A 1OTSD 2FGWL 5CBAA 5FM4A 5FW8A 4OKDA 4CSSA 2VDNB 5F1IA 3HMWL 2B4CH 1MCQA 3S0PA 4FHJA 4MNQD 4CDGC 1KG0B 1SBSH 5AENA 3RPKA 2O26U 4WEMB 4E9LA 4MHHI 5D6CA 3VXUB 4S2SB 1HEJC 3VGBA 3HMXA 4H8UA 4B9JA 4XNDA 3MA9L 3QP3A 1NGWB 1W0VA 4QKXB 2OS7A 1NQBA 1KYFA 2QQKL 4Q9RL 1G5AA