4AM0Q

Structure of dengue virus strain 4 diii in complex with fab 2h12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
91
Chain Sequence
TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAB 2H12, HEAVY CHAIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
total genus 14
structure length 91
sequence length 94
chains with identical sequence R, S, T
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4am0Q00
3G7TA 2JQMA 2H0PA 5IREA 5B1CA 1RERA 3MUUA 5KVEE 3IRCA 5IZ7A 2ALAA 4AL8C 1Z3RA 5LBVA 3UZEC 5JHMA 2GG1A 4AM0Q 2I69A 4UT6A 3N44F 2JSFA 1UZGA 5GZNA 3C6EA 2R29A 4L5FE 3VTTA 1OKEA 3N40F 4FFZA 5LBSA 1Z66A 4UTCA 4X42A 3UYPB 3J27A 1OANA 5KVFE 5JHLA 5KVDE 3N43F 2JV6A 2P5PA 3UZVA 5LCVA 4GT0A 3C5XA 4ALAC 4FG0A 4FFYA 4UT9A 2HG0A 3J2PA 3UAJA 5KVGE 4GSXA 3WE1A 1OK8A 3UZQB 2R69A 3N42F 1SVBA 1URZA 4BZ2A 4UTBA 1PJWA 3P54A 5AAMC 5H37A 5GZOA 4BZ1A 4UTAA 1S6NA 1ZTXE 5AAWC 1TG8A 2V33A 3N41F
chains in the Genus database with same CATH superfamily
1FVDB 3OGCB 5LWYL 2BHYA 3B34A 3C9NA 3BVVA 3UCQA 2D7TL 1A2YA 4M3KB 2BCKB 2F1AA 3CAFA 4A6YA 2AJVH 1NAKH 1U58B 2C9AA 3CDGB 3QFJD 4NQXA 2ZWSA 4G8EB 3APNA 5AD0B 2G2RB 2YGOA 3DUSA 3FO2B 1F1GA 3DHUA 4MAZA 4YO0A 4MSWB 1FFNA 4CADB 3MV9D 4WNQA 2A9ML 1ZLWK 2CK2A 3HNSL 4XHJD 4ZFQA 1J1PH 2B14A 4XP9L 5A16A 3ETSA 1BQSA 3SHSA 3RWIA 5IB1B 2ESVA 2B1HH 4H1LA 3JWNH 4LEXH 2AAAA 3CX5J 4E41B 1AHWB 2KLRA 2X28A 1AQDB 1CLVA 1HI6A 4I0PC 4DGYL 1BOYA 4JFYA 3QUHA 3LEXA 4N6RA 3VGBA 4GRLC 1KYAA 1XT5A 4RFEA 2WXJA 1U2YA 1Z66A 4MCYB 2NSMA 4L29A 3TBTA 4XO5A 1MG3C 3HOGA 1RJYB 4FG4A 2E7CA 3AT8A 2IGLA 3BLBA 3GMOB 4GXUN 1UT2A 2XX0A 2X4UA 3GO1L 3QDMA 2P5EB 1FZOB 1XSKA 2XN9D 2NW2B 3QNYA 2PO6A 1R1CA 5PCYA 3BJLA 5L4FA 2DLTA 4TSCL 4JDZB 4EI5B 2VO8A 3LQZA 1CBJA 3KD4A 4OCRH 3I6LD 5EFIB 2XU9A 1P2CB 1XGYH 1JHTA 4ZW7A 4JLRA 4RAHA 3ZYJA 2WXGA 5CN1A 4JFWA 5KG9B 1BAFL 2WN2A 1NFIA 3HB3C 2JIXD 4JGUA 3RWCB 3NZ8B 1I8AA 4F7MB 4FYTA 3VQMA 5IMLA 3D0AA 5L2JA 2QELA 1UD2A 4WDIB 5HHPA 3O3DB 2CO7A 4I77L 4TPRH 4W1TA 5I23A 4PJ9A 5KSBB 3W9DB 4YHLH 1TJGH 1WF5A 3UBXG 1QSVA 1MNNA 2ZUWA 2EDMA 5GSVA 2AZAA 5T1JA 4OZIA 4HIQA 2FQEA 4PJIF 4C55A 3A4EA 1DYZA 1QUPA 2LAAA 1SBSL 1GTFA 1DO6A 4I1PA 3MNVA 3U2SA 4PV8A 4PCKA 2F5AL 1HK6A 3ASOB 3TTYA 1Y1UA 5IFAL 2OL3H 3F3HA 4XP1H 2HFEB 3WIFB 5K1NA 1MI5E 1PX8A 3MYZA 4YDKL 3NTCL 1INDL 1I1RA 1U8QB 3PFQA 1NDGB 2DRUA 4LASL 2EIMB 3QISA 5IVZB 3SGEI 2DJMA 2YBRB 1IFRA 3QEGL 1CDJA 3PV7A 2OQJB 5IV2B 1NBVL 2WBJD 3WFEL 4M8QA 2XA8L 3T0VA 3UP6A 3LIZA 4FKEA 4HWUA 1LD9B 1TO5A 3I74A 5I1LA 1EJ8A 4ZZKA 3QNFA 4JFOB 3T77B 5DTFA 1CGUA 1EJ6A 2W91A 4CN4A 5F9AC 5C0JB 4YH6A 3VXQB 3GSOA 4GBXC 5F89A 1TKWB 3HBQA 4PYHA 4UT6H 1F4WL 5KS9A 3U46B 4AH2A 4I0PB 1LTXA 1OTSC 4BFRA 2ENJA 1GMEA 3EYOB 2CCWA 2V3DA 4UNIA 1J5OH 4JFDE 1CLCA 4WW2A 3OAYH 4GRLB 4POZC 4LHUD 1OCRB 3KVPA 1BD2D 4I2XE 1XEDA 4HK0B 3WEXB 3WTWA 3V0VB 1U95B 2DQFA 1DSWA 2CRMA 4NDMB 4DTGL 5EORL 4UMSA 4Z95L 1AQKL 2R0KH 4HWBA 4YFEA 1L7IH 3QSKB 1G5GA 1N7MH 2VERN 3CFJB 1E9OB 5PAZA 1EAJA 4LL9A 3QZMA 4HDIB 4KHXH 4PG9B 3VXPB 1V54B 1DJGA 4R0LA 4PJGE 1EAPB 1HE8A 3FU7A 2NY5L 3QZPA 5K1VA 2YEQA 1KBBA 1NEPA 4WENB 3AABA 3U4EA 4BKTC 4Q9CA 2PTTA 4XOAA 1FPTH 4PJXE 5DUML 3NMEA 3E9UA 3KPMA 3QG7H 1FDLL 1IC5H 2UY6A 1NCTA 1NIEA 4YUEL 3D3VB 4O58H 4TVPL 3TWCH 4LQFH 3L4UA 5JYLA 1HHJA 1QLEL 3EJCA 3OPUA 3QFDB 5GRUL 3CLEH 1MVUB 2GAZA 3HB3B 3OZ9H 3TIEB 3UBFA 5BOZG 5DRWB 1JI1A 5FYLE 3BZEA 5TH2A 4EUPH 1R75A 3L54A 4L8SC 1OGSA 1SVCP 2H47C 1OK8A 1M9SA 4MNQB 4PY8I 2ZXWB 2ALWA 2BNUB 4ZTPH 1AGFB 3MV8D 1BF2A 1CC3A 2J56A 3PQYB 2XIBA 1RZ7L 3ARGC 2VLKB 3ESOA 4HW6A 3H7BA 4N0FB 2NZ9D 2YBGA 2NQCA 3R8QA 4HULB 2WGNB 2WNGA 3VWKA 1SYVB 4KI1A 2V33A 1FCCA 3L81A 3NCMA 5IGXH 5JMRA 3QCVH 2IQAB 4IU3B 2HVKB 1P4BH 4UZSA 4HX1A 1TZAA 4HLEA 4AJWA 1XF3B 3IU3B 4FP8L 1HOCB 5DC4B 5AOJA 5KBPA 4EZKA 4M4RB 5TD4A 2A6KA 1JVKA 3LN9A 4HA1A 5D7IA 3DX6A 4LSSL 3HBGA 5D1QC 1TVHB 2GTZA 2VDPL 4XR8C 5BZDB 1TOXA 3L9EA 3BO8A 1Y18A 1R0AL 1Z7JA 1GY1A 3QQDB 5D1XD 4O00A 2B1AH 4AEFA 3W2DL 3HNVL 3GC3A 3FB8B 3JV4B 4G80A 4L3CB 5EU3A 2OL3A 2J2ZB 3DVIA 4OIFA 3ZRSA 4GBXB 2VC2H 5ITFB 1B4LA 1Z9SA 1G9ML 1ZT4B 1Q0YH 2P80D 2JMRA 1E65A 2PPFA 1JUFB 1DVFC 2WIMA 3N44F 3PP4H 4HGWB 4JQVA 5AW3B 4ANKA 5FCUH 2BH0A 1T83C 4QRQB 2XKSA 2OXGB 4AENA 5EEVA 3TO4D 4DO6A 1BXXA 2ARJA 1I7UA 3MFFB 2HUEA 2J25A 1NCDH 1E4WL 3T3PE 1RK1B 3FQTA 3FOMB 4WJG3 1J1XL 2QGCA 3ARFA 5C71A 2VQUA 1E8ZA 1BF8A 3LEVL 5HHVL 3RX9A 2NT0A 3CFEA 3NFPA 4P5TD 2DEXX 4KI5D 3SPHA 1YEDA 2F68X 2DQDH 4HUWB 1G7IB 1OZTG 2BFVH 4Z7OF 5KTEH 1UQSA 3P3YA 1SRDA 4A68A 4XH2B 2BNQE 3M17B 1A4KB 1EFXD 1MCDA 2YPLE 3WOVA 5IROC 1L9PA 3QR0A 3BAXA 4L37A 4PRHE 3D4GA 5ID1A 4G5ZL 2NTSP 4KMQA 1QFWL 2VZUA 4PJ8D 2CO1A 3UERA 4OZHF 3BVUA 4HKJB 5D70L 3ZKSD 2Q3AA 4HG4K 3IDMB 2JTYA 4N8VG 4XNXH 4WCYH 2F74A 1KOAA 1N5YH 2G3MA 1NCUA 2YWYA 1U8OA 3QORC 1PCXA 2AEIT 2E75C 4U6XB 2VDNL 3U0WH 3TEWA 4AGPA 1NGYA 1OTTC 4I9WD 1CBVL 3WFDH 3OJMB 4L8BB 1XGZA 3EYUH 1NWOA 5K59F 3EJYC 1I3UA 4P5MB 1FE8H 1SN5A 5TJWK 2FJFB 1AG0A 4FYQA 4PVBA 1QRND 3BW9A 2ADGA 5JDSB 1MZZA 1OE1A 2A73A 3MGTB 1IGFH 3QXDA 4NO3A 1IBFA 1K6QH 4OF7A 5ETUA 5AW5B 1CDGA 5CLZA 1DVQA 2E7LA 1HHHA 1F4YH 1HYRC 3Q8AA 3CFDB 1MCJA 4PJFB 2ZAGA 2J88L 3MJWA 3N2JA 2CPCA 4NBZB 1YEIL 4B97A 2NNRA 4ZFZB 5D7EA 5DCCA 1PF3A 1J8HB 3G6DL 1F4HA 2HJFA 4OM0L 1PX4A 2YFNA 4PHZA 1S7UB 1BGXH 5I30H 5I5JA 4P3CH 3IMRA 4ZUSA 1E2VA 4XPHH 3UTZB 3SO3C 1N8OE 4X6EA 5IFHH 4GEIA 4NAQA 5AZEH 2Y7QA 4G7RB 4KPHH 4NCC2 2DDQL 3VFTA 4GRWE 4JPVH 4ZXBA 4AW4A 2ZX5A 5C7ZA 1G1KA 3QWNA 4OGAC 2SEBA 1DVFB 3L5WA 1UZ8A 3D39D 2K9UA 2DQEH 2CMRL 2WQ8A 3D0VA 4KKAD 4OD2B 3GSNL 5AFAA 1T1WB 2YHGA 5AB9A 2NUTA 2VLLA 3PXJA 3FF7A 3KXFA 3GJFH 3B9DA 4U1HB 4HIIA 5HYSA 2GY7B 4NT6B 4PJCE 4AUJA 3MRPB 3DX9A 2M26A 3UG4A 2B5IC 3BAIA 1E4XH 3MC0A 3W56A 2ZAHA 1A4CA 3T1WA 2XWEA 1QFWI 4UQ2B 3FB6B 5J12C 1OF2B 3VXSE 2DBLL 1ZHLB 4ZMVA 5DMKB 4R7DA 4YR6A 4ADIA 3IBEA 4X8GA 1SJMA 1L3NA 3STZB 4GLRI 1C5DA 4H5SB 5HHXL 1W0WA 4MQ7B 3KL3A 5E8PA 4FAAB 3SCMA 1CYXA 3FCTA 3KS0H 3OR6B 4M5ZH 3CN2A 4JMXA 2DH2A 2IPUG 4GFTB 3RKDC 5BS0E 3O8XA 5LUMA 2FGWL 5FUOL 5DQJB 2D31A 3NIFF 3FKUS 4Z0BL 2EQDA 5C0AD 2Y1ZA 1OSEA 4TLKA 5BZWB 1EDQA 4X9BA 2V8LA 1UH2A 3FT9A 2JKWA 5HHMD 1EEZB 2H2PD 4NYLA 4IRSD 4AEEA 2WGXA 1FI8C 5ADPL 1M71A 35C8L 1OHZA 3QORB 3MLWH 4JM0A 4F2MA 3S37X 1FVEA 1FJ1A 1PG7L 3GYRA 4Y1AB 4Y19D 4JN2B 1BBJA 5JXEA 1JHLH 2ADJA 1CGWA 2X4NA 1KXQA 1ZV9A 5JUEL 4CVWA 4Q2ZB 2P46B 5DJYA 1LP9E 2GKIA 2RACA 1C08B 3O4LE 1QKZH 5SWZA 3RGBA 1KXVC 4HIJB 3TBWA 3IGKA 1CE1L 2LLGA 2AMGA 4LPYA 3AAZB 2WAHA 2WQRA 1YEKH 3WJMA 3GPSA 1MUJA 3KPPA 4PRBA 3EHBD 3AMKA 4Z7IA 3FK3A 1XIWD 1HNGA 4MD0B 5BZXA 3L4XA 1MHPH 2VLRD 1IL1B 1LO2H 2B77A 4ODSL 3ISYA 4HSAC 3DURB 2DN7A 1RSYA 4NPYB 5AVRB 1OSZA 2W0FA 1CGVA 4U1MB 1SDDA 3BYTA 3IJ8A 2RCSH 5ESVA 2ESVD 4XMKH 4XB7A 5G2NA 1EH9A 2F7QA 2XNAB 1JN6B 4NRYA 1E6JL 3EYQD 2W0KA 4P4RA 1D9KA 1FVCA 4JY6B 4HPHA 4QO1B 1KV7A 1SMOA 3O6FC 3S3SA 3SDXA 4EBQL 4NRZB 1BXAA 4W6XB 4CMHC 3L9RA 3S9DB 3TP4A 2MHAA 4RBPK 5HD8C 3T6WA 2G3NA 2E27H 4Q8BA 4Y5YA 2IGFH 5B1BB 3V9EA 1XR8A 1N67A 5I5RA 5DMGC 4XAWH 4XC3H 1JYXA 5I5IA 1HZLA 3EO1B 5H94A 4L4TB 2BSED 1GYVA 2B5IB 5JO5A 1IGIL 2D03L 4HJ0D 4OLVH 2XUWA 1MCKA 3HAEG 4NQDD 4ODBD 5DZ9A 2Y9RT 3D85B 2VR4A 2PO6D 5J12B 2X6MA 3SPCA 1WC7B 3RWJB 1AKJB 3W11C 4EOWH 4H2AA 4LVHC 4DPRA 4RAUB 5F3BB 5I6PA 5I0XA 2FL5A 2LABA 2EE3A 1IQWL 4GW1A 1GGBH 1JPSL 5JOPD 4S2SB 2L7UA 5TQ2L 5H35A 8FABB 2IJ0C 2CBQA 3U1SL 2AJXH 4UUJB 1C12A 4D94A 4LEOB 3VFNB 2G75A 3VXRA 5HYQB 3OB0H 1PD0A 3OX8A 1R24A 1LO5A 4X98A 2WUBL 2IPKA 4S1DC 5BJTB 1MFEH 5CCKL 5JHBA 2XJKA 1ADQH 1BAGA 4Z7UF 3V0WL 4Y9EA 2Y1YA 3KH3A 1GCFA 5B8CC 1WG3A 4AKPA 2WMPB 4NKOA 4HOZA 5GHWL 2XVKA 3QUYA 1Q9WB 2YEVB 3V8OA 1VSCA 1I7TB 3C5JB 3EGSA 4HLJA 1BLNB 1BQLH 1QPKA 2BVPB 1UM4L 2WYHA 1Q94A 3IJ9A 4I0KA 1SUJA 3PP3K 1NBYA 3RUGE 4L3EA 3G5WA 4GRMB 3RX7A 2IANA 3JVGA 5KBLA 3RA7H 5F9OL 3DX7A 4JO1H 5DURB 4YPJA 1P6WA 1D5RA 2NNAB 2XBZA 2XYBA 4ZUWA 1ID2A 3MRQB 3OXSB 4CU7A 1YSOA 4AMWA 2PYEA 1T03H 3BH9A 3L3HB 4LLYA 4NO5A 1QPPA 2VDKB 4JZNB 5E8EB 1OAUL 5LN8A 2OMXB 5INCA 1HNYA 1YNLH 1WIOA 4FCAA 2OZ4H 4LGSB 5CMAB 1F02I 4KFMA 4JFXB 5HI5D 5DHXB 2A6JA 4KQ3L 2IG2L 4N0UE 5FHBH 3N41B 1LO0L 1XGTB 2X4RA 4DESA 4AM0Q 4Q9QH 4RAVA 2VLJA 2PWDA 4HJ1A 5GISL 5AKTA 5L0QC 1NCAH 1RFDL 2AV1B 1HL4A 5D2NA 5DHMC 1NMBL 3IJSA 2BZCA 4JKPL 5C9JB 4WTZA 3I75A 3O6FB 4H25B 3LB6D 2FO4B 3OG6B 1PZUB 2DWEB 1S46A 5AZ2L 3PFUA 2E74C 1XSOA 2N1TE 4CMHB 4UQEA 1UXWA 4OFYD 4JQIH 4MMXA 3L3IA 4LSVL 4OD3H 2CALA 1PMYA 2E0PA 3VI3B 2IXQB 4RGMC 5CKGA 3UYRH 2XA3A 4PJEA 3SPIA 1MLBB 4G7SB 2VQ1A 4NHUA 4K0OA 5ESAB 4N24A 2ODHA 4Z3GA 1UKQA 4DAGL 3G5YA 1ONQA 2R9HD 4NQCB 1OCOB 2GQHA 3ZYOA 4DWHA 1D5IH 1ZIAA 2WP3T 1CUOA 3L7EB 2JJTA 1G9EA 2DM3A 1XQ4A 4GH7B 5F6HJ 3FH7A 2XZQL 1ZS8A 3OR7B 4JR9H 4Q52A 4HZ1A 2ZNXA 3ZZLA 4LVHB 2RFXB 4ALAL 4PLOB 1JFHA 1ZK5A 4P46D 3MRRB 1YMME 3QS2A 2IO5A 4FLRA 4N20A 1NGPH 4H26A 4Y4KA 3TH4T 1AO7B 3M8OH 1ZA6B 1BW8A 3CVHH 3O6KL 1MCPH 4RGOL 2GEQA 2APXA 1J0ZA 2BCKA 4X6CE 3QWRA 2VW7A 2KLTA 2LT9A 1QLRB 5DVPA 4EPSA 3DV4A 2CJUL 3BAEL 4FNUA 5TF0A 4ZSOB 2IAMC 4GP8B 4N0YL 3BDXA 1P7KB 5LGYA 4W81A 4WI0B 4Y8AA 4ANVA 4MNGA 2ZUYA 3B8YA 2AJ3B 3CMOL 3GI9L 3FULA 5B8CB 1WGOA 4N6QA 1FZMA 4XRCA 4HJTA 4EZMA 3DX1A 5KS9F 2IBBA 4POUB 4Z7VF 3SY0B 2H3NA 3H3KA 1FL3B 1RY7B 3ROLA 4MJIB 4PJDE 4LAJH 3S5ZA 4D0DB 1K4CA 4ETYA 5IQMA 1E67A 3GMNA 4UTBL 4XMPH 1KJ2B 3PJNA 1HIMH 3U4BH 3WSQH 5JW5B 4XXWA 3FFCA 1ORSB 3OC8A 2EZ0C 1KJVA 2Y6SD 1NA8A 3ZE1F 4UV4H 4E36A 3AJ7A 4PRPE 3GSWB 3IDGA 3QQ4B 4G82A 4GW5A 4Z78A 4NBXB 2V7NA 2VUOA 5T1KA 3BH4A 2ICWA 4WO4C 2BOBA 5BRQA 1OGAA 5HGAA 1CFNB 3II1A 5EO9B 7TAAA 5HYIA 1F42A 2PWHA 2VMJA 1FH2A 1WO2A 3V4VB 4A6YL 4FD0A 4PBDA 4GSUA 4FFWC 4X7SL 4ZO7A 5L0QB 3TJHC 3AMLA 2J8UF 1ZY9A 4OI7A 3MRGA 1NPNA 4H8WL 1TQCB 2XKNA 4HS3B 4FA8A 3FCUB 3PABB 4M7ZC 4JM2D 2DICA 4KAQL 3ESPA 5EFIA 3TO2B 4KK5C 1ETZA 2KPNA 2UX7A 4KXBA 2XV0A 1JPFB 3P3SA 1IEAA 4PJBF 3WTTA 2R29H 4OLWH 2UXGA 4O02H 4OLUL 4YPGA 2MRYA 4MFHA 3V6OE 2QQLH 3VXMA 3WJLC 2OZ4A 1HXMB 4A04A 3KYKL 4RGMB 4FLHA 4WK2B 4AVKA 5AOIA 2H1PH 1N3NA 2VQTA 4JANA 3S35H 1EJOH 5DUBB 1OHQA 2IQ9L 5BO0D 4AC2A 1MAJA 4LRNL 4FXTA 3T4AA 4W9IC 2VLMD 2F15A 1T7WA 4G9FA 3RE0A 5I8CB 2X38A 1L9QA 1KPUB 2H32H 1UH3A 4APQD 1SLXA 5IB5A 3GKWL 3KYMB 2QL1A 4HS8H 3O6ML 2ZQKA 1N6UA 4JQIA 3QFJE 3VCLA 5C7XH 1QR1B 2HFEA 1TU2B 4A37A 3N43B 2GK0A 2YK1H 1CN4A 3CHPA 4PTUA 2IH3A 3CDZB 4U6VH 4I5BB 1MF2H 3MV9E 5KVEL 1RIHH 1GGIH 1LEGB 1D2PA 2QSVA 4G7YH 3FN9A 3Q2NA 3VGHA 2YBRA 5E24E 3M88A 5FKAB 1JHKL 4FG6C 2NDFA 2B4CH 4Q6IC 1UM5L 2IAMB 4M5TA 3DOSA 5C0CB 3T4YB 2ZUUA 5JHDD 3RVTC 4NWTL 1KB9K 5EWIH 1FIGH 1GS8A 2A83A 4X6DA 1QP1A 1WV7T 3DRTB 4WO0A 5D8JH 1U2CA 1Z0NA 3FPXA 1CD8A 3T1FB 3ATFA 4X7EC 3PJSB 1TQBC 1I8MB 4ZOBA 5H37G 3CVHA 4LMQE 4M00A 3CJJA 1WPCA 4QWWD 4ZNEE 3L6FB 2H41A 2R1YB 2F8IA 4H44C 4NI3A 4WHTB 4YSOA 1ZGLP 3ABKB 4MRBA 2HRPH 3G04A 3SQOL 2DIAA 4WEMB 2QKIC 4HK0A 2Y2YA 3LPPA 3ELAT 4E9WA 3UZEA 1JZ8A 4PGZA 3R7RA 1ZVSA 2ZKXA 2DYSB 3EYFB 3WUZA 1SOXA 2A74C 3B2PA 3L3DB 3HC3H 4WO4B 2Y07L 4LCYB 5MEQB 2CDFA 1V8HA 1S78C 2X9WA 4WHCA 1OOWA 3VFSA 3U6XA 4DK6A 3FRPG 3O2WL 4DP8X 3DI3B 3HMXH 1LDSA 2MCMA 1ZTMA 2D9QB 5E6IA 4HISA 5ANMA 4YQXL 3K6SA 2XVBA 3DHMA 3RLSA 5CZXD 3LIZL 4TRPL 4ENED 3H55A 1N64L 3OAWA 4M7ZB 3RDTC 4XWGL 4I3SH 5E0FA 4AYFB 2A6IA 4UDUA 2X2IA 3IT8D 1VERA 3JVFC 3OG4B 3FT1A 3PWJB 1KBGH 1VESA 3PWPB 5A2LH 4OGXL 3BUYA 4AKOA 2MNJB 4OZGE 5J6GA 1SFHA 5ID0B 2PF6A 3FUJA 5FECB 1U8LB 5KYWB 4C57C 4ZMYA 1CB4A 3WKPA 4RA0C 2L04A 1A9BB 2PP8A 5HVHB 4X4ME 1GSKA 2JB5H 2Y5EA 2VZOA 1JD7A 2PW2A 3TA3A 2Y0SA 4DP5X 3V9CA 2WO3B 4XPTH 4Z6AT 3TU6A 1IT9H 1XCXA 4LGPB 5EBMB 2RR3A 3RJQB 1J1PL 1QQDB 3ET9F 5I15L 5IW6B 4HWBL 3L2NA 4O02A 3VD9A 2IQAA 3O81A 4BHUA 3GXUB 4PJ7E 5JHAA 2QHRL 1OB1B 5DWUL 4KO9A 2HLFD 5AAPA 3RVXD 1BFSA 3GJEA 3O3BA 4KKBC 4XCCH 5DD0L 5AW8B 4RQQA 5DI8A 3O2DH 3LJ3A 3PLYA 1IBBA 2YMXL 3BVNA 1IQDB 2EE6A 3SEPA 1QLFB 4F2FA 2FH6A 4UT7L 4QRTA 1U91A 1UWYA 1MRDL 1W15A 3NIGF 4JRYB 1KELH 2YOCA 1SHXA 1ZOXA 4Q6IB 4UI2A 1NANH 2P4AB 3MUZ1 4P23D 5JXED 2H32A 5E23A 4BZ2A 4J28A 3QXVA 4MB4A 3BSGA 3P54A 5F1KC 2J2ZA 4JFSA 1MJ7L 1O6SA 4FQCH 1TQBB 1BD2E 2BERA 4XNUL 1DZBA 1ZLVH 3T2PA 2A99A 2O5ZH 4YSSA 2ICEB 2XY1A 5I6XC 2VDOL 2OXGA 3STBA 2EILB 3ILQD 3QZWB 4DK5A 4OCRL 1AXTH 3MV7E 3VJ6B 1X5FA 5B3NA 1XGYL 2QKIB 2FECL 3FOMA 3V10A 5JZ7D 1W16A 2W60B 1BAWA 3NIDF 3NFNA 3SDDC 3UTSD 5CJXA 2BRRH 3LN4A 3NBNA 1H3GA 1AHKA 3VFOA 1DR9A 4CJ1A 2A74B 1FAKT 2ZF9A 3QDGD 5DS8A 3FAXA 4MVBD 5C0ND 4IDJL 4F8QA 3VXUD 3QDJA 1QASA 4XCYA 2IH1B 5DRZA 3RGVA 4TPRL 3SOBH 4XWOC 4FEIA 3X1EA 5HXMA 3OJ2C 3WHE1 4M6MH 4YHLL 4JM4H 4WSJA 3DIDA 2YEZB 3STLB 1XGRA 5EIIA 2GY5A 3BUBA 2V2XB 1RU9H 4ICWA 2F19H 1JZHA 1TFHA 4LESA 4PWIA 5LO7A 3RDTB 3U48A 2YRLA 3J07A 2W92A 4A2MA 2AVFA 3LNGA 1CXHA 3F83A 1ZD6A 4YBLB 1PDKB 1YYCA 4UIKH 4DP4X 1ZSHA 3WFZA 2RH0A 2OL3L 4JGMA 2HJLB 4WUUB 4XP1L 3VI4A 1I31A 4Y88A 3MRKB 4IIZA 3VAEA 4CBZA 2VXTL 3K80A 2HAZA 1WUNT 4FQLL 4M4PA 2OYKA 7PAZA 4FJZA 2BMKA 3EH4B 4L8SA 1OEZW 2XRAH 4KROC 3HJ0A 2UZYB 3VFUB 3U36A 3HMXA 1QVOA 3ATAA 1BEYL 4A38A 3F7LA 3HI1A 1YEJH 2K9FB 1JVLA 3BFQG 5EU7E 1UVQB 2E6JA 4L8BA 3TBVA 1UD5A 1UYWL 4J3SA 3ARGA 1AGEA 2IF7A 2YSTA 2OSLA 2R27A 4JKLA 4NKMA 5ACZB 2Q1EA 5J1AB 1ZTXL 2HH0H 4IOFD 2UXTA 4OZ4A 4PRIB 3KWTA 4FTVE 4A7TA 2BVQA 3UBHA 2AERT 2C5DC 1GS7A 1KF9B 3KE0A 2PCYA 5EU6D 3SODB 4X8JB 3HLAA 2OJEB 4P9MH 4J4PC 3TN0D 1AD9A 3LMJH 5LGHH 3X1NA 3T65A 4K3EH 3FH8A 1URLA 5J6SA 4YXLL 5EOTB 3VXRD 5EEZA 1A4JA 4ELKB 1G6RB 5FW7A 5CHNB 1XCQB 2PW1B 2V5SA 4F7EB 3VYOA 1INQB 5A3IC 3WUWB 4JO4H 3IETA 3N3EA 5D1QA 2YLHA 3DXAE 4XZUA 1M7IA 4X5PA 1PY0A 1V7NH 5CBAB 3HZMB 2KC0A 1IAOB 3EDJA 3QUYD 5CJ5A 1HEHC 2F18A 2X87A 2FECI 4QOKB 5LXGL 1L7IL 2WKOA 1YMHB 3ESMA 3ECBA 2JWYA 5EBWA 3UPRA 2GJZB 2ZSWB 4KHXL 3NQIA 1CI3M 2XWJB 3GLDA 1A14H 3L1OH 5CZKA 4IEFB 1E4KC 5I6XB 1MCEA 1GYWA 2Z31D 1XFPA 1IC5L 5M94B 3OAUH 4EDWH 5I6NA 4N1EA 5EPMA 1AJ7H 2XFGB 1RZQA 3F00A 5B1CA 3TWCL 3JT2A 4LQFL 5ERWA 2HVBA 2P5WB 4KI5E 3T8MA 3SDDB 1G94A 2OJ1A 1JNLL 1QWUA 3MRPA 3OZ9L 4XPFH 3G6JE 1BZ8A 4XN9A 2J72A 3BZ4A 1YYML 1N2RA 4LE8A 4LRIC 2HTKC 1HCZA 4JFFD 2VLJD 5E2TH 5LQBH 2R39A 3NT0A 5JOFB 4XVSH 4AV0A 3GHBL 4PWFA 4NS0A 4NQEE 4ZTPL 3T04D 4OZFG 3TYFA 1DQJB 3JWOC 2ZUQC 2DQCH 1HL8A 3RIFF 3REWA 1SJVA 1RPUA 5EB9A 5D7KD 4F8PA 3N6YA 2W95A 4OKVB 3W0WB 5ISZD 4B96A 1BQHB 3NK4A 2R4SH 1SY6A 2OMVB 2BDNL 3JTSA 4DZ8B 2O6CA 1UACH 4IBWA 1P4BL 1Q9OA 4YJZL 2BP5M 3BP7B 3PF2A 1E7VA 1KLGB 4C56E 3TFKC 4Y4HB 1U6AH 3IFLL 1FFTB 4PVNA 3JUZA 4KROB 3RKPA 2X53A 1REIA 4MNHB 5AB0A 3GMQA 1U8MB 5IHZA 4YHMH 2LU5A 3CMGA 4QHLA 2JNZA 3ULSA 3GIVB 2GYSA 4TSAL 3K3QA 1F6FB 5TDOA 3GEWB 2F54D 2R23A 1A7OH 4F8TA 1KJMA 3AT0A 2B1AL 2XWDA 3T0XA 3O4OC 2N01B 1E5YA 1FZKB 2VOTA 5AALA 5KN5B 3HI5H 3KPNB 3QDAA 3SKNA 4R83A 3QHZH 3TT3H 4M3JA 2C9QA 4AM0A 4PS4H 2F53B 3KBFA 1VKXB 1KLFA 5F96H 3GLAA 5ABZA 3CPLB 4JQXC 5TGBA 3RIAF 4BDVB 1KCRH 2PCPA 2X4TA 4ZMLA 5E4AA 1KXTB 2GJRA 1QSEE 2EYRB 2V2WA 3Q6GH 4MXQD 4ZRGA 5K9QI 4F7TB 2W07B 2WLLB 3KYNA 1I7RA 3OKEA 1BVKB 3CXDL 3R7QA 1NCDL 5IVXA 2EDYA 3HZYA 2P48B 1WFTA 1H3WM 1E28A 3RY4A 2W5PA 1D6EB 1HKLL 2KZBA 3NCYS 4B9GA 5JMOC 1WT5C 1M57B 4OB5H 4BFGA 3D39E 4NNXB 1IKFL 4UNTA 4E41D 3BZDA 4HWNA 4LVOC 1C16A 3BXNA 3IU4L 1Q9KA 5I8EA 2Q10A 3E0GA 5E2VH 4KVNH 4U1KB 1R3JB 5L88H 5IM7B 1XD1A 3JWDC 4NZUL 4BE5A 4L5FL 3UTTA 2BIOA 2BFVL 1JTPA 2HUHA 5KTEL 5EU5A 4R7LA 2EUXA 5DK0B 1NGWA 1T1XA 5SV4A 1HYSD 3IYLW 2B9AA 4UILH 2X4QB 3L3KB 3QGVA 1EEYB 1TITA 5FLVA 3C2AH 3AXLB 2DV6A 5CFHA 1ZCRA 4MX7A 1MFDH 4WCYL 4XNXL 3T3MB 1N6QL 1W6WA 1N5YL 4P5KB 5F7FA 3FCSA 3ZX1A 3W37A 4EI5D 5D1ZC 5FGBA 5D4IA 5C0AE 3MGOB 2ZUQB 4JY5H 3SSGA 3EYUL 1Y1DA 3EO0A 2CGRH 1FE8L 1DJXA 1NUFA 1YN7B 5F2FA 1HILA 4PG2A 4RFNC 1DTUA 2G9KA 2BP0B 3W81A 2MPVA 4OU3A 1K6QL 2CRIA 4HU8A 3V79C 5FO7A 3ABZA 3B2UC 4X0KA 3SD2A 2ADIB 4Y19E 2R4RL 1TVBB 2FWLB 3VXOB 4PP2B 3ZTJH 1CLOH 2BCMA 3EIFA 5TDPB 3WNOA 1UWEH 4ZFOA 3UEZA 2J57A 1U3HA 4Y2OB 3UZVA 3OPZH 4J3OH 3UDWC 4AK1A 2O61A 3CXHJ 4N2KA 1BGXL 3H9ZA 5I30L 1SOKA 2NX5B 4FERA 2ZKHL 3SBQA 5H4ZA 1BMWA 4GUCA 5AZEL 1LDPL 3O4OB 3Q6FA 2VLRE 2CXKA 2H26B 1X5ZA 4UINH 4CC0A 4DIXA 4ZTEA 2X0VA 2G5UA 2V5RA 4FL4B 3K5RA 2WZ0A 1T04B 4JFUA 2D7OA 4GQPH 2NNAA 2P45B 5EOCL 2R2BB 2JQAA 4QXUH 1HEZA 4PJAF 2H7WA 4PLNC 4NO2A 2ESVE 3OWRA 2R83A 1PAMA 5FHAL 4FTDA 4AIEA 1I7ZB 4XCNA 3VFRB 1EAQA 2VERA 2CIIB 2N56A 5C09A 1V3KA 2XQ0A 3EJPA 1DBJH 1WHPA 3G9VA 3IMVA 5DJ2B 3ZDYF 3S96B 2UZPA 1GJUA 1X5IA 4LVOB 3UBXB 3MNMA 2MQCA 4I0PD 2IWKA 3SN6N 3SJVA 4HUNB 5IF0A 2LV4A 2PLTA 3R19A 1PKQA 2EDDA 2PTUA 4H25A 4NZFA 4GRLD 3WKQA 4ECNA 4ZMOA 3IB4A 1CD9B 5EC2A 3KGTA 3QDME 3IS0X 1Z0MA 3DJ9A 4YSQA 4M5ZL 1VACB 4ODHH 4ZAKA 4P59L 1N5AB 3G5VA 2HTLC 2M8XA 5KVEE 5LDSA 2CR6A 4MMZC 4HU2A 1ZAGA 2GIYA 5FO8A 2DWXA 5E70A 5GRXG 1KPRB 4TQ8A 3N1MC 3L9BA 2FK9A 3X2QB 1IC0A 3B8SA 4EKJA 4WAFA 4HIEB 3MLWL 1T5KA 1XX9C 2AKRB 3JV5A 4HJEA 2WNKA 5D1ZB 5JOPE 3V4PB 1TXKA 1QATA 1XHHA 3BKML 4H1LG 5JPMA 3BPOC 2YXVA 3GSQB 3NJIA 5IHLB 3BESR 2WXNA 3HB3D 3KVDD 3CSTA 4RFNB 1QKZL 3T0WA 1ICTA 2UXVA 1TTCA 4HD5A 3T0AA 1JAEA 3WE6A 1J05B 5AYQA 4Z7QE 4OZIE 4X4YA 3O3AA 1B0RA 1KIPA 4MQTB 4MNQD 4NKDA 5KVFE 2KKQA 3BQUC 3DRQA 3VRJB 3X1BA 1MHPL 2DQIL 2DWDA 1LO2L 2ATKB 3PQYD 2GI0A 1ZLEA 3CVDA 2V37A 5KBNC 5FV2A 5CZRA 4X6DF 3EGXA 5EG6C 5F88A 4KQ0A 1G7QA 2HP4A 5I19H 2QLYA 1EO5A 1VGKA 3IK2A 3SY0A 2XICA 4HKBA 3FYEB 1LQBC 1MFVA 5GJTH 1MI5B 3B9KA 2Z64C 4BK5C 2C9VA 2H6UA 5FUCE 3LN5A 3I02A 5DQ9A 3VD0A 3MNWB 4GINA 3QXUA 4GS7C 1EQWA 1DUZA 3U6XS 2NUPA 4AYGA 5JIIA 4XBEL 3PY9A 3QQ3A 5I8OH 1HE7A 2PMZA 3FMGH 3CQFA 1M7DB 4A2EA 4XODA 1HAWA 2RHEA 4GG6A 2VSDA 5ENWA 2OBGA 2WINA 4H88H 2QFRA 2E8ZA 3CZGA 1SEQL 3ULUL 5HYEA 3H9SA 1AOZA 4OLVL 1JWSA 3IJ7A 1PYWB 2J71A 4GBXD 3P73B 4R4NC 2PWGA 4QXVA 3APCA 1OTSD 1FG2A 2IWEA 1NC2B 2COVD 2DW5A 5FFGA 1YPZA 2DLGA 3H0TA 4JFDB 5D2LA 5DO2C 4EOWL 5A40E 1RD6A 4I2XB 5CD3B 4MDIB 4POZD 1A5FH 1SYSB 1CXLA 2NYKA 2WUCL 2VABB 2PXYA 5SWQA 4TL4A 2J6EH 3HI6H 1VGEL 3AU1A 2VMDA 3ARBC 1IAIM 5EZOL 4ODUB 1UZ6E 4MMZB 4F3FB 4JZJA 2AJXL 4UU9A 3V8CA 3DX0A 4HF5H 3ILEA 1EIBA 2GBVA 1IM9B 4RIRB 1TCMA 4MZIA 4WNJA 4CW1B 3NACL 1IEBB 1NH6A 1IBGH 4Y7MA 4LLMA 4DKEL 1ZLDA 4XXCA 2HRHA 5CIPB 3FOLA 4ONHB 1MFEL 4E9VA 4ZX4A 4XVUC 4HUVB 2FATL 4EO5A 3F7VB 3TZVA 4ADGA 1JXDA 2Z35B 1AKPA 1YNTB 3BPOB 4E5XA 3TNNA 3IAQA 1BQLL 2HYMA 3FFDA 1RUMH 4YNYA 2NTFB 4ZOCA 4JVUA 1Q1PA 1KDJA 1LLAA 3RVWC 1KZYA 4X42A 3RA7L 1G7HB 2KERA 3GSRA 2GFBB 3HS9A 3KVQA 2XFXB 3GBEA 4R90H 1BBDH 3BQUB 2FEJA 4HC1H 5GRVK 2Q3ZA 2EDKA 4R5VA 5B38B 4RESB 4Z7NF 5FA4A 3ARGD 3IVKA 2WSKA 4Z1PA 1YNLL 3N1PC 4ZUUB 4QMEA 2OZ4L 3HBPA 1AIZA 1X5JA 5FHBL 1X7QA 2QVTA 5T33H 4DH2A 4MAYC 2NXYC 3BWUC 4K5LA 5D7IE 3WLWC 1Q8MA 1KTDB 1MXGA 2CDGB 3DBXB 3GSVA 4U0QB 4RRPA 4WHTA 2BINA 1UT9A 2W9EL 3DIFB 2DMCA 2X40A 2VIRA 3MCG1 2V3FA 3CK0H 3ORJA 3RIKA 3TPUB 3ZIMA 1T20B 4G42A 3Q8BA 1J8HD 1VJSA 3L1GA 4JAMB 4K7PL 3VFVA 1G4MA 4GS7B 5D1QD 5FAAA 1XH3A 3DI2B 5I1JH 3ULVL 1O7DC 3OKKB 4JQIL 3NYKA 6PCYA 4OD3L 1ZT1B 3TVMA 3SBWC 1FL6A 3UAJC 4M3HA 4AJYV 1K8DB 4N8VB 4NENB 4WGVB 3LZPA 2X70A 4BIKA 4F37K 3GMMA 2PCXA 3P4MA 1KXHA 3BKYL 5EUKA 2OFQA 2APWA 1H8SA 3FU3A 4LFHG 1D5IL 1DVFD 2WOYA 5DJZA 5TK4A 4MYWB 2K4WA 1ZTXE 5EZLB 1A6UH 5CJ8A 2DMGA 1JGEB 3T3PB 3BUDA 2DQHH 3RWHA 5HI3C 5EV7A 4GAGH 4XBPB 5FF6A 4Q9BA 3B83A 5I1AA 3U6RB 4ZS7H 2WLYA 2VXQH 4YLCA 2QPFA 5F9WC 1PTZA 2ICWI 3M8OL 1I9RL 3CVHL 3ARBB 2VLME 4MQXC 2CO2A 3QC5X 2WLIA 4H8HA 2ZYRA 3DKHA 4TSBL 2Z7ZA 4QRPB 4AL8C 4KHTL 5I2IA 5JHMA 3C8KB 5BUAA 4XNQB 2NZ1A 1L7TH 5KJ4A 2DS4A 3I6GB 4AGOA 1BQUA 1JPST 2NXZC 2BNQB 2YPLB 3NP3A 4LP8A 25C8L 5F1SA 1GYCA 4JB9H 1L0XA 1HZKA 1I3RB 3GXDA 4MJ5B 5IROD 4FADA 4PRHB 5E2WH 2AI0L 2Z8RA 3FTZA 3WS3B 1JK9B 1GZQA 3MJ9H 4TYUA 4IOIB 5EEYA 2VUYA 1DBMH 3S37H 1E2ZA 4IRZH 4OJDH 4Z9KB 2ZOKA 5GGVY 3HHSA 5JHDE 3BVWA 3RZWA 5CJQL 3U4BL 3QORD 1XV8A 4NUQA 1YDPB 4Z0XB 2DQ6A 1B6DA 1F5WA 2QMJA 4R97C 1AGDA 1OTTD 1JPTL 1T7ZA 4Y1AD 3IF1A 2ILLA 4UV4L 1H9VA 2P5PA 3RFZC 5TDNA 3AXIA 1HXKA 3LPOA 3MO1B 4RGNC 3EJYD 4Q58C 4A1RA 3BHBA 3KDMA 3F6IA 4BH7B 1LO4L 4KRMB 4B41A 3V6FA 2OTWB 3MLVH 3EGDA 2A3TA 5G5DA 3QCUL 4NN7C 3X3GH 4DNLA 1TJHL 4MAYB 3OMNB 4BSWA 2NXYB 4P99A 2QADB 2B2XL 1SF3A 3KLQA 1FL5A 2C3VA 1YECL 1KGXA 3OF6A 1NSNH 1TETH 1XSJA 3BWSA 3ZZSA 1DQMH 1Q72L 2MNWA 4HC1A 4F1ZA 2FYYB 3E2HC 5DHVB 1SFDA 4O02L 4JFPA 3EH5B 1XZ0B 4FS0A 4XXDA 2QQLL 1TVDA 4XBMA 3ILDA 4R8WL 2J1XA 5KBKA 3AY4A 1UOKA 1UWXH 2WKLA 4GO9A 3DPBA 1IIIA 4Y4FC 5DGRA 2X4SA 3FTGA 4GRWB 3EG9A 1JF1A 2H1PL 1RK0A 3GBNH 3LVEA 4N25A 5K9QG 2H3XC 1CTOA 5IIEB 2QSCH 1EJOL 1KGIA 1I1AC 2C9UA 4OGAD 5J1TC 4C58B 3KXFE 3L13A 3TV3H 4H7VA 2ITCA 3RDTA 1E90A 4N2IA 2EVIA 4BZ2L 1ITBB 3PGDB 4RDQF 1N8ZA 4AGQA 4HS8L 3RPIB 1J86A 2FSDA 4WUUA 4PJCB 4RMRA 1PG7W 3VGGA 1WGVA 2DF3A 1BFVL 3PXLA 3SQRA 4G6ML 4HS6A 5F9WB 4L4TD 1OAZH 4U6VL 5DT1H 3UXFA 2ZKYA 1RIHL 5EUOA 1HH6B 1PQZB 2UZYA 1S8DA 2EYTB 3VXSB 4AYMC 2GPZA 1M1XA 3D85D 4QCIA 4TUJB 4NP4H 4XI5C 5C0IB 3UAEA 2UV3A 3LRMA 3DDFA 2X4OA 1AKJD 2B4CL 3H3PH 3IGAB 4JVPA 1CFTB 2BOCB 3D06A 4HMCA 5EEWA 5GGTA 5BS0B 2NXZB 1E4HA 4K73A 3RKDD 5EWIL 3CC1A 1FIGL 2FT7A 5SV3A 3WL9A 1U8JA 4E42B 3RI5F 3TEYA 5D8JL 4HLZH 5IP4A 2QMKA 3GSUA 4XP4H 1VFUA 3KBPA 3D0LB 3VA6A 2VXQA 5F1IA 3NJKA 4F2ME 2OP4H 4KRPC 4L5FE 5E5UB 1RI8A 5EZJB 4G1EB 1HINH 4XNBA 2OTUA 1IVLA 5FK9A 3PWUA 1MCHA 4V2CB 5I6MA 2YFOA 3K0WA 1KXQE 3QPQC 4JFTA 1G87A 3MOAL 2GUYA 4R97B 4JKWA 3JXAA 2G2PA 3NZHL 4WFEE 5HYSG 2R15A 3VW3H 3RFZB 3HC4H 3I3BA 4RGNB 2C3XA 4U1NB 4MXVE 1T21B 1LP9B 4BXVA 3H2PA 2AQQA 3K71A 1JGDA 3RP1A 3HAEB 5F8QC 1RZ8A 4JCLA 4BHUI 5HDBF 2FNWA 2VXUL 3HMXL 1J5HA 2CKNA 1FO0H 3NRQA 3HZKA 4IRZA 5SWSA 3S7GA 3VUAA 5DURD 4BFIA 3UC0H 5FYJU 1OWWA 3GPEA 4EE2A 3HCVB 3QXTA 2DD8L 1HHKB 5JPNB 3LD8C 2MTPA 4JHUA 4XNMA 3GI8H 1JXKA 3E2HB 2PPEA 3VXUE 3WFHB 2KYIA 2VE6B 3TESA 4MZ2A 3IDXL 2QGBA 2G9HB 5KBMA 4NRXA 3SDXE 4DOHE 1Z32X 3UZQB 4Y4FB 4K8RH 1XCTA 3B9VA 2ATAA 5DF0A 2D3NA 3KGSA 4WWKB 1F8TL 1IX2A 3O2VL 5K9KA 1I1AB 2XWBA 2P43B 3L2MA 4P57B 1ASPA 3O6FD 5FA3A 2FWSA 1NEZA 5C08A 2J43A 4XPTL 1M56B 4R7XA 2RQ8A 4ZUTA 1IT9L 4ODXB 2Z6FA 4KTGA 3LKSA 4PRDA 1DN2A 4U1JB 3P2TA 3UCRA 5HD8D 2OMVA 1KCBA 1H0DB 5L4IA 2KL6A 3LRHA 2APSA 4UAHA 4QKTA 5DMGD 4MWFA 3HE7A 1ZE3H 5CEZD 5LNGA 3OLEA 1OW0C 1LK2B 1Z9NA 4HBQA 3ABMB 2AEPH 3EFFB 1JV2A 4XN1A 4PB9H 1VRSA 4G6AC 4NQCD 4AQ1A 4XCCL 4Z3FA 4CA4A 1KBKA 1U8MA 1UEMA 2D2CC 5IQ7L 1ULVA 1GS6X 1PD1A 4M7KH 5I66A 3W11D 5FDYA 1DLFH 2GG1A 4MA7L 3ME0A 1UA6H 1TEFA 5AYUL 2Q9OA 2B16A 1AZUA 3PNWB 4M1DH 3VXRE 2YPKB 1AO7D 5J6HA 1ECZA 4FQCL 1UXLA 2YAEA 1G5AA 3R0MA 4KRPB 4RZCB 3CFBA 4Y2DC 1QO3A 5HGDA 3F62A 1JFQL 2UYLA 1AXTL 1AGCB 4MB3A 5IUSA 4XTRC 1BFOB 1H6UA 5DFWH 5J8OA 4S1DD 3LKRB 4JO2L 1AR2A 1PL3A 3UG5A 2QT6A 1SY6L 5DD6A 5AG8A 2JI3A 1V3MA 1A7RL 2DYPA 3RL2A 4L3EE 2BRRL 4KZDH 2IANE 1OOAA 4WFGE 4FQ1H 1U41A 2BSTB 2NY5C 3L3OC 1BVNP 4HCRH 5M95B 1VFAA 3P69A 1IFGA 3EBGA 3FHEA 3E6FA 5IM7A 1WAAF 5KAQF 2PYEE 2X12A 3RQ3A 2PUQT 5DHDA 4Y9BA 2L4OA 4JM4L 1G43A 3ZRFC 1RJLA 2OYLA 1M1SA 2CCLA 3DVGA 2Q3XA 3TEXA 4G43A 2Y24A 1FHNA 2F19L 1P7HL 3FONB 3ENEA 5C92A 4KGLA 1LK3H 3VVWA 3LD8B 4JFFE 2VLJE 3DMMB 3LNHA 4YVUA 4QD2E 3UFIA 4XCEB 4ZTOH 3T8VA 4L9DA 1HHGB 4DVBB 4GSXA 5D2NE 4N0UB 5KW9H 3A22A 4UIMB 4TQEL 5E8OB 5D7KE 2D8KA 3KCPB 1OLZA 5ISZE 4D7PA 1A3LL 1KY7A 1BVOA 5AAWA 2DKMA 1AP2B 1YEJL 2UX6A 4JG1H 1SJHB 2XWXA 4XO3A 4ZQKB 4A7QA 1KENL 5JIMA 1T1ZB 3THML 4HMEA 4PJEE 1ED3A 3WIHA 1PLBA 4F7PA 3V6OC 4I48B 2DTSA 3HJEA 2PR4L 4R2GC 3MRFA 5GZOC 1NANI 2Y69B 3X11B 3ZTDC 1UGKA 3BPCB 2HKAA 5CLYA 4JG0L 3AG4B 3BIKA 3LMJL 3OZLA 1ZHNB 4K3EL 4CMMB 2O72A 5DEGA 4C47A 4X4XA 5MP6H 4G71B 3QQNA 1T1YA 4J8QA 1GOHA 3U7YL 2V5YA 1T6VN 2E4FA 4HH9A 3QH3A 5DDHB 2ED9A 4ZX5A 4JFQB 1XH1A 1BX2B 2D0FA 1RLBA 1J0HA 5L8LB 3FU8A 3P4NB 5DHYA 4ATTA 2XWRA 3KYOB 3ULUE 1G9MC 1A6TB 2BSSA 3O9WA 1OVZA 1BFTA 5GRJH 2H26A 3OKMA 4I18A 4RA3A 2GJ6A 3ZZQA 1VFMA 4X6CB 4LVNC 5JW4R 1TIUA 1NPUA 1VLXA 2G3XA 4WTZG 4FA7B 4EIGB 1B2WH 1D7BA 4MNGE 3L1OL 2CPUA 3NGBC 3P9LB 4JFEA 4M6OH 4Y2DB 3S36L 5BQDA 1GOFA 4J3OF 1Z5LB 5BMFH 2QPEB 2ROYA 3OAUL 2IAMD 2VMCA 5EHFA 4E9LA 4EDWL 1J8KA 1IEHA 5C0CD 2YAHA 1BF5A 5DRXB 3MLTA 1OSYA 3FB5A 4LP5A 3RPKA 3CCHA 1KPVA 1XTMA 4XPFL 1LEIA 3CSYA 2C7UA 1WT5A 2ZYHA 4G7QB 3L3OB 4PJDB 4QXTA 1RMFH 1YPZF 1BZQK 1QOKA 5D2LF 1F3RB 5EU4A 4ZFOL 2M1KA 2JXMB 3HN3A 4DEWA 3NA9H 5TE4H 2YWZA 2EZ0D 1OGAE 2ATPB 1QLEB 3GRBA 3QULA 3VDBA 4S1RH 2BM3A 4PRPB 2ISDA 5E08L 2KMWA 1BVZA 3BWZA 5E1AB 1N5AA 5K1JA 4DP9X 4S0HA 3A4FA 1V05A 3DO7A 5IBTL 4WO4D 5TF1H 3K81A 1MHHB 2DB8A 3FQXB 4LSRL 3S97C 4GUOA 3M1OA 3EW3B 1PZ2A 2C3GA 4MXWH 2A2QT 1ZGLA 1TQTA 4FFWD 3N42F 4ABWA 1NGQH 1U6AL 2YKLL 3X12B 3AWGA 1YYLL 1ZLSH 1K5WA 4HIHA 4MMYB 1F3DJ 4YHML 3VXME 4KK5D 2W94A 3FPYA 4BZ1A 1G1YA 5AVWB 3MRBA 3ZHDA 4YMPA 2YA0A 4UOZA 4WY7H 3C8HA 3PWPD 2NZIA 3KCWA 4R2GB 4WQOA 3NN8B 3FQWA 4HZLA 5GS0H 3MPCA 2EINB 3LDBB 3HI5L 4LEBA 3QHZL 2O6DA 3TT3L 2GSGA 1A7NH 1W8OA 2VYRE 3EOAB 3EOBA 4KV5E 1USZA 3IFOA 1U92B 3QXWA 1E40A 2YSSA 3B9EA 5CD5C 1JZ2A 1UUNA 2OK0L 5J3HC 1KCRL 2VDPB 1LL1A 3ULVE 2ATKA 5IZ7A 1JF5A 4MDRA 3Q1EA 4QF1A 4LK4A 1Z5HA 4M02A 3FNKA 4QXGL 2B59B 1CF8L 1X9QA 4OCXL 2G30A 1HZHL 1RVFL 4WF7A 2O5YL 3APFA 5J4MA 5L4JA 4YVNA 4XP6L 3U25A 4ZFGH 4GQ9H 4IMKC 4NZDA 3FRPB 1EXUB 4JHZA 4QGTA 3E1ZA 2UY7A 2OX5A 3PHQB 1R5IB 3EJTA 2XXMB 3MV9B 3QCTH 4KJPC 2P52A 3FQYA 4F5CA 5IWLC 5E2VL 4U6YB 5DEFB 4LVNB 2ID5A 4BFBD 1JWMA 1FAIH 3NGBB 1FRGL 4FG6D 5E5MA 5ICXA 3UTQB 3WIIH 3PL6C 1EX0A 4V33A 1KB3A 4A2LA 1M7DA 3QNZA 1GL4B 2UZXB 4OUUB 3L5XL 4UILL 5C8JB 3RVTD 3QRGH 1I8KA 2DM4A 4JM2F 1E9PA 2OULB 3C2AL 2IWFA 2D73A 1WTGT 4ISVB 3S48A 4HIXL 4XE5B 4BKLA 3LV3B 3H42L 3P73A 2Y5TA 1KTLB 2VB5A 3KNBA 4ZZFA 5F21B 4QRRA 4XHQA 2VL5A 2GTWB 1T0NA 2YKKA 4IU2B 5TPWL 5BXFA 2VXVH 4JHAH 4AG4H 3N04A 2OMTB 3L1FA 4A7GF 5IFJB 2B3RA 4Z3HA 1VEMA 5C9KA 4ZK8A 4W6YB 3IFNH 3MX0B 4QAWA 2CGRL 4EKXA 5IKCA 1M6OB 3L7FB 1RXLA 2JCCA 4A63A 4NC0B 1CICA 1W0VB 4P3WA 4HUUA 1IB5A 3HC0B 2L8AA 1S78D 1NDMA 3R06A 2VDNB 4M48L 1NGZA 3HPJB 4FN0A 4AC4A 1F11B 1MW3A 1ZEAL 2E7DA 4BWTA 3BWAB 2GSIA 2R7EB 1TCRB 1WBYB 4YDVA 1DCLA 1UWEL 1H5BA 1H3UA 3KWWA 3C8DA 5I1KL 3RDTD 3ZK0A 1D5XA 2X3CA 4I85A 4R3SA 1F4XL 1T5WA 3WHXB 3MJ8B 4OVUA 4YXKH 1S7RB 4LCWB 4ZG1A 5MERA 3ASNB 4OZGB 4WUUD 5FCSH 4N0CC 5GPRA 1CFMA 3PQYE 4UINL 1AD0A 1RP9A 4ZPVB 1ESOA 3MRCB 3ALPA 1QHOA 2DLEA 5T3ZH 1QTPA 3VRIA 3KDPB 2IMNA 1KJ3H 2P8MA 3BQUA 4G6KH 5DR5L 2XXGA 3INUH 1NWPA 2WCGA 2O93L 5B38A 1J5CA 2YMTA 4BFJA 1DJHA 3LPFA 2RD0A 3HNTH 5IEKA 1B88A 3UBGA 4HFUL 2BC4B 3VD3A 5ICZA 1HXYA 2XWTB 3N06B 4TNEA 4PJ7B 3QZBA 3RL1B 1DBJL 2WBJB 1CTMA 3K2MC 1S7TB 2CDGA 5IR1A 4O5LL 5GJSL 1T89A 2IIJA 3C60A 4GQZA 1FNLA 4KXDA 1D5ZA 4UOJA 3W9EA 2I9LB 5B3JE 4DFIA 1IC4H 3GSNB 3E6HB 3P4LA 4IRJC 4KKBD 5KOVC 2FJGA 3D25B 1KY6A 2AABH 2EEBA 3PL6B 3VD5A 1O9WA 4QRAA 4IMLB 4ODHL 5KSVB 2GITB 4QT5B 3BT2H 3SZKC 1T4WA 4G59C 3BH8A 3OJDA 1OAKH 3PU7A 4OLEA 4YC2B 2HPOA 4QOKD 1NM9A 3FRUB 4BH8A 3ZE2F 4LCUA 1KG0A 4MA3B 4D8PA 5TFSH 4W9EC 2ETWA 3P30H 3D4ZA 4FQPA 4AQEB 1BD2B 1RHHA 4NGHH 3OL2A 4XX1E 3F65A 2HLAA 3VRLE 4QLWA 2LGNA 1K3IA 3GXNA 1IBYA 4FJ6A 2AQ3A 3CSGA 5IHWA 3MV7B 5C97A 4MJ6B 1AS7A 2JKXA 4AZ8B 1KN4L 5HYJB 3HRZC 2E9WA 3ZJAA 3RB5A 5B4MC 3K8MA 2P5WD 4I1NB 5D71L 3SDDD 2CBMA 3QDJE 4LL4A 1ETB1 3F05A 1G7MA 2J7LA 4Z77B 2VKXA 1XTLA 1JZ5A 2P7TA 4X5XA 3N44B 2AK1H 5CGTA 1OXYA 3WS6C 4ELMF 3WTYA 4OD1H 3QJTB 3MBWB 5E6UB 1CYGA 5EO0A 4H20H 3WY4A 1MFBH 4L18A 1JXJA 1RL1A 3IJEB 4XWOD 4AMXA 3FTSA 1E9QA 3LH8A 3IJYA 5FGSA 3SE8H 1YRKA 3HPLB 5C08D 3VI4E 4WKZA 4DN3H 1T5XA 4FQXC 4DP1X 2OMUB 3BKCH 3W0WD 2AF2A 2VSMB 1ZRUA 5CWSA 2OV0A 2QLVB 3L4YA 4PGDB 4QRBA 5I19L 5J89A 1RURL 1PS3A 5C3TA 4DKDC 2FBJL 1NINA 2B9BA 4JS7A 4EDXA 1G7JB 4I4WB 2ZXEB 5GJTL 1KGYE 4ETQB 1QFWM 3D87B 1C5CH 3A6BL 4R5XA 2IDCA 4J1UA 4O4YL 1S7VB 3U7WH 1R5WA 4KROD 4XX1G 4ZOEA 3I9GH 1OLLA 3GMPB 1IKOP 3ZQXA 2YD4A 2GIMA 3QE5A 3Q9PA 1T0OA 4OLXH 1J0YA 4YSDA 1S2EA 1GJIA 2EDEA 5MENB 3FMGL 4FTVB 1XGUB 2EO9A 4LCCC 5CJOH 4QTHB 3VSTA 5K93A 4H88L 4HJGA 4PJFE 5T1MB 2AJYH 4N8PA 3KW7A 3ES6B 4PMFA 2QQNL 3B6SB 3MFGB 3AVEA 4J4PD 4BSVA 4C83A 2F53D 4UM8A 5C6TH 3VH8A 3ZTNL 5D1QE 3S8WA 3LH2H 4OZFB 4XO9A 1GCYA 2QPUA 4QGYA 1VADB 5EIIG 3RILA 1T80A 4F57H 1VFBA 3WYRA 4IRJB 2V7HA 3DGDA 5I1IH 3SDCC 5C2UB 1S7WB 4LSUH 3T09A 1A5FL 2PNDA 3TT1H 4Z3TA 5A3ID 3DETC 3WY2A 2E7BA 3DXAB 5I0WA 1ACYH 2UUDH 1T4KB 2VR6A 4YXHH 5IJCC 1PY9A 1D6VL 1MFNA 1B4RA 2XTLA 2OR8A 3SBWA 4BFFA 1PZCA 1ZVNA 3BSZH 1A1OB 5D9SB 1RZJL 2DH3A 3JTTB 1DEEB 5MEPB 6CGTA 4HF5L 2JJSA 4MCZB 4JPKH 1XF5B 4LPCA 1X5MA 5C2BL 5BNXD 1IBGL 1DSFL 3DTDA 4ALAC 3VNZA 2HX8A 3MROA 3CU1A 2WN3A 3GM0A 4KU1A 3QNXB 4IIQB 3HRZB 4PGEB 5A6MA 2YAOA 2JI2A 5DSCA 3G6JB 2WTPA 1DQDH 4CGTA 1WVZA 2KZKA 3HE6A 1DEDA 2ZCKH 3KWVA 4WI2A 3SQBA 3R4DA 4ATWA 1HEJC 3VFGH 2HTKD 4KOCA 4WHDA 3LRSB 3B1TA 4P2RA 3LTVA 5EBGA 1CQKA 2OMZA 1MJ8H 4NQEB 1SJEB 3V52L 4H0IA 3IDJB 3MR9B 2R69H 3F6JA 1HTYA 1SVBA 1ZWIB 4HC1L 4MAUH 1GGYA 4FABH 2H0FA 2IOMA 4LL1A 2C1OB 2YMOA 3CH1B 1YY8B 1FHGA 4FQXB 2YC1A 5BVPH 2NNXA 1TEGA 2WKGA 4QHNB 4U1IA 3GSXB 3QIUC 4AX3A 5T33L 1YN6A 5GGSA 4M7LL 4QYOA 4Z7WA 1DANT 1FNEB 1A1NA 3C5ZA 2DEYX 5GGUA 1TZGH 2DLFL 3DROA 1I9EA 3SGKA 4C56B 5E4IA 5INDB 2X4PA 1X5GA 1PVHA 5CKAA 2AV7B 3GBDA 3TFKD 2EVHA 3Q1SL 5KUMA 3ZE0F 5E1QA 3CK0L 4ONGL 3CFKB 3WDHA 1M2OA 3EF4A 2CXGA 1TSHA 1W8NA 2WXLA 3K5SA 1N4XL 3MREB 1WFMA 4OF6A 2FJHB 4N28A 1UEYA 2DI7A 3DUUA 5FIEA 1OK0A 5KUKA 4G8IA 3MACH 4HV8B 5TK2A 2NX5D 4U3SA 2CDEB 3MRMB 5HDQH 3RWEA 3M45A 4LCCB 1TQWA 5AW7B 4H8WC 4N8CH 2WPGA 1VF5C 2B20A 5E9AA 2YAMA 3BOVA 5C0GB 4ZQTA 3OLDA 3RBGA 4ZS6C 5JNYB 4LNRB 4YZFF 3QI9A 5IVXE 4JFED 3Q2CA 3HUJA 4ZW3A 4BGDA 2ZUXA 3BGMA 1QSEB 3OKYA 1OAYL 4KKCC 3LKPB 4NM4L 5GGTL 2N0KA 5HHOB 5F1OB 3SDCB 1MHEA 5A2KH 4RDQG 2DQHL 3T6ZA 4K94H 1Q9LA 4NN5C 4ZS7L 3M46A 2VXQL 1TUPA 3UGUA 4DW2L 3GMLA 5FYKU 3D39B 4D9RE 4PJHA 3UTTE 4CILA 4BWWA 1OAQH 3U9PH 4EF3A 5G4OA 4AQ8A 3SKMA 2X41A 4U2ZA 1L7TL 5T3XD 1X4XA 4RMQA 4XCFH 2QHLA 1H15B 3WFCH 2EIDA 5K39A 2UWEA 4JB9L 3SYOA 2KZWA 3UO1L 3MOQA 5LGJA 2IBZY 1Y6MR 3K7UA 4FLOA 3UADA 5H2BB 2FIKB 4M56A 3NA4A 3BSZA 4GI8A 4OVVA 1ML0A 3S37L 5BW7A 2VAJA 3PWLA 3FO1A 4IRZL 3QK0A 3DX3A 3RJDA 3MYJB 3CZEA 4R7NA 3RZCA 3QBTB 1E27B 2CM6A 4P07A 5C0AB 4Z8FH 5D1ZD 1AACA 4UQIM 4BFKA 4GFXA 4NB7A 4B7LA 4ACPA 2OJZH 4NNYA 4YDJB 4AYEC 3KWXA 2AZUA 3O6LH 3UJIH 1DL7H 4PJ9C 2KDGA 2EE2A 4EVNA 1BJMA 3QIUB 2BJMH 4QHKI 1UOLA 3Q01A 2ED8A 2X42A 2YUZA 3MODL 4RDBA 5DEZA 3X3GL 5BVJB 3GDBA 5KVGH 1EWHA 4L3AA 4Y19B 3B2UD 3F7RA 3G7TA 1U8PA 1IGTB 2JJVA 3WY3A 5DZVA 3S88H 2Q86A 3B2XA 5IREA 4K3HA 4Y16C 4GUPB 3LKRA 2WXQA 1TETL 3HR5A 3N0PB 3NSCA 1DQML 5F71A 1LGVA 2WQUA 2EP6A 3V4VH 1S4IA 1XR9A 1IGML 2L0DA 2OCFD 2P42B 2LU3A 4A6YB 3KPLB 3SZ6A 2EE9A 4NQXB 3P0VH 1DDHA 3TPKA 2FLMA 1I8IA 2D9CA 3V5HA 1CD0A 1BVLB 1MI5D 1P4UA 3DUSB 4YO0B 5FUCC 1FFNB 1GW0A 1NFDA 2E46A 2ZG3A 4WNQB 2NW3A 2W1NA 1BREA 5A16B 3EOYG 2VDRL 1UZGA 3RWIB 2ESVB 4H1LB 4L8CA 4LCIL 1MQ8A 5T1DL 5GS1A 4YAQA 3IAPA 5DJ8A 2BZDA 1GZPA 1HI6B 2ERJC 1Z9LA 3I50H 3G5ZA 5F1NA 5DUPH 4JFYB 4NN5B 3MBEC 1FFQA 3LEXB 5CF3A 1KULA 4N6RB 4WW2C 7FABH 1OAZL 1PKQE 4OT1H 3MCKA 3K72A 5GXBB 3NPSC 4L29B 4HYTB 3TBTB 4MA8L 2WIIA 2X2JA 5LNEA 1NC2D 4YHOH 1FLRH 4ZQKA 1V27A 1JYVA 4DO5A 3RTQA 1LO3H 3FUDA 4PPTA 3WY1A 1IM3A 2X4UB 3QDMB 4TQHA 4CKQA 4MDJA 3WLBA 2ZJSH 4TUKH 1BZ7A 5KSBF 5GSRA 3SPVA 4P49A 2PO6B 3MCLH 3PWNA 2HTLD 3LZNA 2C9RA 2I27N 2QV4A 1ZHNA 2OP4L 1KGUA 3LQZB 3EBAA 1OW0A 3HBZA 4NZRH 4LPUA 1IM9D 1JHTB 4JLRB 1HINL 4IOSD 5LAXA 1GAFH 3A21A 3FW6A 5DDHA 4YSPA 1NCNA 1NFIB 1KYDA 4UANA 3TXAA 1KTBA 1CGYA 2Y36H 2P24A 4JVWA 4X9FA 2F1EA 5IMLB 3BAKA 5K9JH 1CL7L 5L2JB 4L3FA 5HHPB 2V5TA 2Q7YA 3V5KB 1DQQA 3A24A 2CO7B 4G7VH 2LU4A 4XP5H 2OR7A 4PJ9B 4PV9A 3FUKA 5GSVB 3Q8FA 4Z7QB 4OZIB 3ZYZA 2CRYA 4GKOA 1QI5A 3CFCH 3JWOL 3VWKC 5IBLC 3MNVB 3U2SB 4OJYA 4HXBH 4PV8B 4U2YA 3UC0L 1MHCA 3BQUD 3KPRA 5D4QA 4GO8A 3VB9A 3MUUA 3WIHL 4Y16B 4U6HA 3FO0H 1OP5K 1HS6A 3S5LA 1B4JH 5ACLA 3GI8L 3V2AR 3WEMA 4QR7A 2NLJA 4XB3A 3UMTA 1WAEA 4HAKA 4M8QB 4XAKD 5IMOA 3SGDH 4DERA 4DKAA 2P47B 3EYVA 3KLAB 3BMVA 5I1LB 3O11A 2GSMB 2YRPA 4NPJA 4K2UH 1SN2A 4GG6E 2DQJH 3FH5A 3UO8B 2YQ2A 3NCEB 3C6EA 4AYID 2JCCF 4JW3A 3GSOB 1EXGA 4Q56A 2YAFA 4JQVC 5LBSH 5KS9B 1JJUA 1LVEA 1WWCA 1WZAA 3FQXA 1PNDA 1M3JA 2ERJB 4N1HB 4AH2B 4YDZA 3MBEB 1F6AA 4WW2B 5EULV 4IKLA 2OYPA 3K1KC 3NPSB 4R4ND 2YPVH 5HSFA 2HKHL 2DQFB 1X3DA 3ARFC 3AY2A 5I74C 5ICYA 4XO4A 4M7KL 5GRZA 3JSSA 5DO2D 2D0GA 5AW0B 4XBGA 4XB8A 5D7JA 2H3KA 1UA6L 4RMVA 1JXFA 2HG5A 2AJSH 4M1DL 4P4KA 4QRFA 3FU7B 5ACMA 3U4EB 1CL7I 3ARBD 4NQUA 2PTTB 3S3DB 3ZOAA 1KSRA 2IBZX 3KPMB 2UY6B 5T3XL 4NUPA 3F7YA 4QRPD 5HP5A 4NQSA 5E2UL 3V7MA 5J13B 1VIWA 3DYPA 4GKNA 2CLZA 1HHJB 3ECVA 1EHNA 1RP8A 4J3OG 3M1CA 2WJ7A 4M5YL 2CM5A 2GAZB 3ARZA 5A2BA 3FU6A 3IJHA 3NG5A 2BNQD 4XVUD 2YPLD 3BZEB 5TH2B 5T1LA 3R8BB 4KVCL 5F7HA 3NH7H 2AHIA 4KZDL 1CFBA 4FQ1L 1MRFH 1PBYA 1TTGA 4LLDA 3NRPA 2VZTA 1PKOA 3ILPA 4XPAH 2VDOB 2YN5A 3QR1A 2BP3A 1L9OA 4IS6A 1DFBH 4CBPA 3VFMA 3RAJH 3H7BB 4PJIA 4OAWA 3RVWD 1IKNA 4FHBD 5FYJL 3UTQA 3VWKB 4BZ1L 3IS1X 2H0PA 3LNFA 4HQQH 1M4KA 1LK3L 4MGXA 4PJ5A 4JHWH 5BPPA 2P1YA 1ROCA 2E7LC 4HX1B 5T5NG 5J06A 3GBMH 5I8KH 4ZTOL 2EE0A 3LZQA 2ZCLH 4F9PA 5KW9L 1CDIA 4JO8A 2A6KB 4P2OA 5D7IB 3DX6B 2TAAA 4MAYD 4X8CA 2NXYD 4XNAA 2Q8BL 3WLWD 4ANUA 1KCWA 1YCSA 4OV5A 2GTZB 4PQXA 3NCWA 1J48A 1P1ZA 3N50A 1MWAA 3DBSA 3BO8B 1EMTH 4B6ZA 1N10A 1Y18B 4JG1L 1A6WL 1R3IL 5HTSA 4ZXBC 4G80B 2AITA 4UNUA 1TQVA 5EU3B 1FP5A 2OL3B 4AMKH 4E5XG 3L7FA 1BQRA 1TTUA 5IJBC 2BOLA 3BDYH 2GABA 4L8DA 1A66A 3BKJL 3UAJD 3MVSA 2WWKO 3QG6A 3QEUA 4MBRA 4AENB 1F11A 2HLEB 3DOIA 3CG8A 4DUXA 2ARJB 1I7UB 1I53A 3P0GB 1CIDA 4AUYA 3AG1B 3L08A 4HHGA 1TYRA 2BK8A 3LYRA 3L45A 3ARFB 5I74B 4DVRL 1YQVH 4RMUA 3QXAA 3MRHB 4MCMA 3CFEB 4RMWA 1S9VA 4LCWA 1UJ3A 5HGHA 4WI8A 3NFPB 3U9WA 5HI3D 3CBJB 3HFFA 1J9RA 2EDWA 1G6RH 5GRJL 1MJUL 1YEDB 2B08A 2B8OT 3C6SA 4RRPG 4OI9A 2ZOWA 1XXFC 4XN8A 1RUKH 3JZ7A 4MQXD 3SCMC 3S35X 4CRPA 4PB0H 1UQSB 3VXSD 1JIBA 1B2WL 3K6OA 5I16A 5KJRH 3O8XC 2XTJE 2MOQA 5J7CC 1EPFA 3QWOA 3HMWH 4W4OA 4PN6A 4L37B 5FUZH 5BCAA 5ID1B 4BCZA 4MHHI 4KNTA 1WZLA 2NXZD 3SB3A 1DBKH 1Z1WA 4BUHA 2QBWA 3EKCA 5B39A 1EA9C 2F74B 1Z6JT 2WXPA 4XNYL 1S7TA 4ZYKA 1CDUA 3B7TA 1AZBA 4E9SA 2CA4A 1RMFL 2NY6C 2WLHA 1P0SE 1AYOA 1TG8A 5DS1A 2BWIA 3BPLC 5F9DC 4GSDH 2GCYA 3NA9L 5TE4L 4B27A 1HCFX 2ADGB 3BW9B 4L0PB 4CSTA 1ZSDA 3LKNA 2A73B 3QXDB 4NO3B 5KSVA 2H6PA 5E8DL 4L23A 1TTRA 4KY1L 4YGVA 5ETUB 5FM4A 5JXAH 3MNDA 1P84K 3LZOA 4RGND 1UB6A 1OAXH 2FD6L 2WVVA 3DLQR 3L4ZA 3FRUA 2J1WA 2H0EA 4AQAA 1CFQA 3FQ4A 1TJMA 4MXWL 2WXOA 4BE6A 1ZHBA 4FXKA 3KLHC 3QWQB 1TO4A 1NGQL 2HJFB 4H8VA 5DJCA 1ZLSL 2EO7A 2YD3A 3D5OF 4ZUSB 1X4YA 2JF1A 2JSFA 4NJAH 3BUIA 4X6EB 1H8OA 2Y7QB 5KANI 2OXHA 4ZXBB 3VFTB 3R1GL 1D3CA 1IO4C 4KDTA 1EHXA 4AT6A 4WY7L 1D9KC 3D30A 3OAYK 2LW3A 2SEBB 3L5WB 1UZ8B 1NDTA 2MCAA 4YSEA 1A7NL 3D0VB 4QHUA 4Y4FD 1HN1A 2JV6A 1H3VA 1UXSA 2NUTB 2VLLB 3MRIA 2CK0H 3KXFB 4Y5YC 1MW2A 1I1AD 2XOTA 3QJHB 2WYIA 4FQQA 4MJHA 5HYSB 4HIIB 1F86A 4P9HH 4WUUE 3E9TA 3WN5A 2QV2A 1EGJA 3DX9B 3KM1A 4QAMB 5F7LB 3FHAA 4PGDA 4OW6A 5CGMA 4FE9A 1IGYA 1AZCA 4KXZH 4HHAA 1X44A 5EUOE 4Z7WF 4HK3J 4R7DB 1EVUA 4YR6B 5IVNA 1BMGA 1WIPA 1C5DB 3QCTL 3QQ9C 1W0WB 2VKWA 3T5WA 3VD4A 3PPSA 5E8PB 4JPWL 3SCMB 5SX5H 3FCTB 4W9ZA 3N1GC 5F7WC 4ZFFA 3DJRA 3EO9L 4XI5D 1EBPA 1FAIL 3O8XB 2WTRA 1BXVA 1FNAA 4KQ4L 4ZPTA 2D31B 1QFUH 3WIIL 3NZUA 3NP4A 2YQ3A 4X9YA 3C08H 1QBMH 4HVBA 5BV7L 3WCYA 1AIFA 2EC9T 4YZWA 2X3AA 4OZHA 1DQKA 4NYLB 4UQ3A 4IHOA 4ZO9A 1UWGH 4RNRA 5IHBA 1M71B 2DTMH 4KTDH 4F2MB 1ETA1 2VW6A 1FVEB 3GK8H 3FQNA 1FJ1B 4H8QA 5IJDC 4KRPD 1I1YA 2NY6B 5GGVH 2OMWA 1BBJB 1UT1A 3KLSA 2ADJB 1MY5A 4X6FA 2X4NB 3BPLB 1XF4A 2FYVA 3NSDA 4X5LA 4AG4L 1RZIA 3QPQD 5DJYB 5IB3A 2AC0A 1JV5A 3QYNA 1FC1A 1P7BA 5SWZB 1OPOA 3IFNL 3ARQA 3QP3A 3TBWB 3O3EA 5I73C 1NLDL 1HAUA 3IKKA 3CH8A 3JVGC 1BCIA 3UAAA 1XGPA 1Z9OA 4PJHF 2QTVA 3AITA 3WJMB 1MUJB 3KPPB 5SWSE 4X0NA 2CHZA 4V1DA 1MEXH 4DKTA 1KFAH 1E5UI 4BBWA 1T0PB 1P6FA 1R3LA 2F8XC 1FFPA 3LQMA 1FNGA 3NFSH 3E8UL 2ZG2A 4P2YA 4FOMA 1A9EA 4UV7H 4X80L 2EH7L 2P5WE 1OSZB 2W0FB 1NLBL 2V9TA 1SDDB 2MNUA 4BYHA 5A2AA 5ESVB 3HN5A 3LS5H 1RLWA 1GOGA 5FFLA 1B6UA 1IBZA 5D7LA 2BS71 4YXKL 1KCSH 3K2IA 4XMLH 4NRYB 5D2NC 3W3BA 5D7SH 2ZXBA 3LH9A 3MCYA 4P4RB 5AW1B 1D9KB 1FVCB 5I1CL 2W0PA 2J44A 2B15A 1X5KA 4DQOH 4ZMZA 5F7AA 4YX2L 3SDXB 2NNFA 4DOHB 2BY0A 5FB8A 4YHKL 5C08E 4J39A 2C26A 3V0EA 1S3KH 1U8NA 2Z93A 3L9RB 5DZNA 5JHLA 2BFGA 1EBAA 5T3ZL 4MMXC 2E3VA 4X50A 1QSFA 2MHAB 4NSKA 3CX2A 3Q43A 3INUL 1GPOH 4Y5YB 4F9LC 1XR8B 1JOIA 3B5GA 3IDYC 3EZJB 4XT1C 3T6VA 5H94B 3S3PA 3QRFM 3JYBA 3D34A 1A7BA 5JO5B 2CHNA 4KTEH 1BV8A 3UPAA 2G60H 1GYUA 5LAPA 4B9YA 4EN3A 1J9TA 2JJTC 3LSOA 4QTIH 5C0BA 1IAIH 3B43A 5F9JA 2PKDA 1IC4L 4WK4B 4J7RA 1S7SA 4G6AD 4YSTA 2FL5B 1BOGA 3CFKA 3ARDA 4KJWC 2HKFH 1E3XA 1OCCB 4GW1B 4KFZC 2EUWA 2UZIH 4BD4A 2CR3A 2ITDA 4Y4KC 2FE0A 3CVIH 3UABA 2AABL 1AANA 4NCC1 1HHIA 1SXNA 2XXFA 3NJLA 3MLZL 5H35B 5IB4A 2F53E 3ULUC 4JFHE 1C12B 2EDTA 3FXIC 2JKRM 3VWJA 4U3XA 1YAZA 4LF3A 1OAKL 2G75B 1SQ2N 4QHMA 5A43C 3JWDH 1JYNA 2D7MA 3OX8B 1R24B 5BQ7A 1SEBA 4R26H 5TFSL 3AQZA 1LO5B 4X98B 1HT6A 2IPKB 4NGHL 2V9UA 4F8OA 4MB1A 4M1GH 2TSBA 4QYAA 4NM8H 1NEZG 4Y2DD 4OFVA 2FBOJ 4NKOB 3N41F 1QZ1A 4ICXA 2KS0A 3EGSB 4EIUA 4XTRD 5IUCA 3DTXA 1Q94B 1H9DA 1NBYB 4KZEL 4L3EB 5I73B 4CU8A 1ZANL 1G9HA 1ZJAA 2IANB 3K4DA 2NY7H 2MPAH 3ABLB 2Q87A 4XXWC 5JW3H 2NY2C 3CZUB 5D5MA 3DX7B 5E56A 4HUMB 4XVJH 2ITFA 4ZUWB 2EVFA 1YVLA 1UKTA 2PYEB 1SXZA 2X6BA 3BH9B 1MFBL 4LLYB 4NO5B 3K6NA 3SPGA 1M53A 1UFUA 3VI3F 5IG7A 3T0DA 3GMRA 5INCB 2XHNA 4TVPD 2BLFA 1JZ3A 1GHFH 1V10A 3BKCL 2X4RB 4LZKA 1JZFA 1NL0L 1W72A 3Q0HA 3AC0A 2VLJB 4RAVB 1NMAL 1UCTA 2ENPA 1OM9A 3KPSA 2FIKA 1CR9L 2AK4A 3CPUA 5D2NB 4QLRA 5AB2A 2FHBA 3IJSB 1IVTA 1EEQA 3RIFK 4G8AC 4KH2A 3I75B 1C5CL 4NLHA 1A1MA 2V8MA 3GJFK 4N90D 2R56H 3U7WL 1UXWB 4MMXB 4GIAA 4PD4J 3L3IB 5I82A 3Q48A 5GGRY 3X13A 1WYJA 1KIQA 4PJEB 3DNKA 3MZTA 4BKSC 2VQ1B 2Z0BA 2ZYIA 1DSYA 3Q2WA 4NHUB 1I85A 1ES0A 1NUDA 3MRLA 4PAZA 4DUVA 1FUNA 4UZGA 4MBOA 1BA9A 3G5YB 4R2GD 2VJ0A 3LZFH 3SGJA 4XN4A 5DXWA 1ONQB 2AJYL 2JLLA 5GZOD 3T4AC 3GRGA 2BNRA 2MTAA 2EACA 2NR6A 1ZS8B 2RAMA 5C6TL 4R4FL 5FYKD 1G0XA 2BW4A 5KYYA 3EH1A 1IGTA 4F57L 5GZNC 3ULVC 2VUKA 4NXKA 1SMAA 5JQ6L 1BM7A 3B56A 2R2EA 1N59A 3N85H 4LKXA 5MI0C 5FS5A 1LEKA 4GAYA 4LSUL 2X2HA 4H26B 4Y4KB 3WE1A 1ACYL 3BP6A 3CZFA 3VU2A 4GW4A 4PYGA 3KPLA 3RIAK 4OJAA 1QA9A 3EDEA 3BSZL 2EKJA 3IDIA 2VN3A 5B1JC 4JFEE 1BVLA 1DN0A 3DV4B 4N2MA 1O9VA 3QEQA 2ZNWA 1X7TA 3ML8A 4JPKL 3V4UL 1PCSA 5AWNL 1MFAL 1VZIA 3MU3A 4HK3N 3MOBH 4MNGB 1XH0A 1A21A 4HOWA 4Z7UA 3C09B 1QTSA 1R4XA 4I7ZC 3IM1A 5FLUA 3CHSA 4AYSA 4JG5A 3G08A 3KEHA 3KWUA 1BECA 4LIQH 1FZMB 4XRCB 4X5RA 5JIKA 1F18A 4PJ5D 2H3NB 2YXWA 3ROLB 2CO6A 2D4FA 4O9HL 3TBYA 1K4CB 1KTCA 3GMNB 4G3YL 5F7UA 1DQDL 3I9IA 5T3XE 2I7SA 3FFCB 5GRYA 2NY2B 3S2CA 1KJVB 3F58H 3VFGL 3UZEC 2WNWA 3QIBA 1J0JA 2FRGP 3MHZA 3IDGB 2BIHA 1MJ8L 3ZDXE 1YEHL 3EADA 4GW5B 4Z78B 2V7NB 5T1KB 1T7VA 3PV6A 2ICWB 5E2WL 2BOBB 3T0EA 3TJPA 5FYLH 1OGAB 2WLJA 5HGAB 4AEHH 4CVXA 3FUEA 4FABL 4K9EH 1F3DH 1KB5H 2SODB 3BRDA 2BIPA 1KTKE 4KTYA 2Q7NA 1CXFA 4N5UA 5E6IC 5I0YA 4RH4A 2FQDA 1DQLH 3ZDYB 5BO1H 4Q0XL 3HIZA 3MRGB 2XKNB 3V0FA 4NUJA 1TSRA 4P05A 3DUHA 3L4CA 3ZRCC 1TZGL 1ETZB 2AQNA 5FYJE 1FBIH 3GRWH 1IEAB 1RUAH 4YPGB 1GR7A 3N43F 3W39A 4BUGA 4JDTH 1H3TA 5C07A 1MCWM 4NJ9H 3VXMB 1EHLH 1Q1JH 1RSFA 4UOW0 5IQ9A 4GAAA 4WEBH 3V5KA 4LLVA 4P5SA 1ND0A 1YEWA 4LCWD 4P2QA 1N3NB 4JANB 3GBLA 3TA3C 4N8CL 4KNQA 3T4AB 2WAQA 4M62L 3VFPA 4G9FB 4UTAH 3PCYA 3P02A 5IB5B 1HU8A 4BCXA 3MGAA 4EEEA 5CD5D 4S1QH 5JW4M 5J3HD 2WWMC 4Y16A 3VCLB 4JBSA 2GK0B 2NOYA 4PTUB 2IH3B 3OB0K 4FZ8H 4F5CE 4E9YA 2DJUA 1CFVH 3T2OA 3MLXH 3H9HA 2IDSA 2WWNA 4R4BA 4LHJB 4CKVX 3U9PL 5KZCB 3MLPA 4KJPD 1BEXA 4MHHG 2JELH 3KLAA 3U83A 3NCBB 3DOSB 1SHMA 4X4KA 4AVHA 3BCDA 4Y8DC 4MD4A 4K5MA 2A83B 4X6DB 3UJJH 4Z5RA 4OKDA 1YHPA 4RFOL 5F7EL 3PL6D 3WD5L 4M5SA 5DUJA 4QKXB 3HZVA 1SLVA 3CVHB 4Z7VA 4E0RA 3ULAB 4QRRE 3MBEA 4NN6C 3QHTC 3EUUA 4RMTA 3G04B 4N2AA 2B4CC 1PSKL 2VZ1A 3WHE0 5CJXC 2A9BA 1ZVSB 5CSZA 1MAMH 3KLDA 3MV7D 2UVFA 3GLZA 3I84A 4Z8FL 4U4BA 1AGBA 3SBRA 2ORBH 2CDFB 1J9CT 2OJZL 5HYJD 3VGFA 3VFSB 2QR0A 4K5PA 3I9PA 4FKKA 4MJ2A 3RGVC 1DBAL 1DL7L 4HKXA 3JZYA 5DJ6A 3VNYA 2OMYA 5E6IB 5DYFA 3IKCA 5ANMB 2BJML 3K6SB 2EIZA 2J8UA 1IFHL 2VCOA 3A47A 4PJXA 5KVGL 1L9SA 2X6AA 5DLMH 1AZVA 1JWUA 3MZGB 2Y22A 5IW3A 1MVYA 2DQMA 3BN3B 2A6IB 3L95A 3MNZA 4UDUB 3TYGH 5HVFB 5KANG 1QMUA 2AXGA 3NDYE 4G8FA 3S88L 4PJBA 1KYOK 4E9TA 3WU1A 2AQSA 1T66C 3N9GH 3BUYB 1U0QA 4HCGA 5J6GB 2Z65C 3P1VA 1JSYA 1ADWA 2HJKA 4M7LT 4OJCA 5BRZA 1KB5A 3QZLA 3EJSA 1B9ZA 1FZJA 4PBVC 2EH8H 2YUVA 4GKSA