3FCTB

Mature metal chelatase catalytic antibody with hapten
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKIVPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY)
publication title Structural and kinetic evidence for strain in biological catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fctB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fctB02
1G7JB 4OSUH 4UV7L 3PWNA 3P9LB 5I8CA 3I84A 3H9ZA 2ADGB 3VXNB 3KS0H 2GJZB 2EEBA 1I85C 2XPGA 1P4BH 1WUNT 4PJ8D 4KKBD 1DJSA 3CH1B 1RZKH 4FQQA 3QUXA 1QPPA 4GW4B 1Q0XL 4GG8A 2P5ED 4J3XA 5EU3A 3RZCC 1S78C 1VHPA 2O5ZL 3CVHH 4D2NA 1TVHB 5IB3B 1TIUA 3TESA 1ZVSA 1NH6A 1S7VB 4XX1E 5I16B 1LDPH 1NMCC 4AH2B 5C86A 4KROC 3H3KA 3F8UB 4JFDD 4NOFA 2AGJH 5FV1L 1N59B 2R15A 4NCC2 4ODVL 1KENH 1WZKA 3QPXL 5EN2B 3VG0L 4PJCB 1ZTXH 2GSGB 4P57A 1AFVH 4NQUA 5IT2H 4WY7H 5ERWA 1NEZB 3CSYB 3TVMA 5J6HB 3BYYA 4XT1C 4QRRA 4L1DA 4KTDL 4NNPL 2K3TA 2AJSL 1M6OB 2E8ZA 2IG2L 1MCEA 3H9HA 3HI1B 4MAUL 2KKQA 2XA8H 2XWTA 1VFOA 4W6WB 1M05A 1P5VA 4GRWB 1CF8L 4XVJH 4HIHA 4NKQB 3VD9A 5ID1A 4CBPA 5IMKA 2D03H 3I6GA 1NKRA 1D6EB 3EJYD 4CMHB 2UZXB 3TIEA 4JJ5A 5HJ3B 1CFQB 4G7YH 1U93A 5DD1H 1FORH 4PP2B 4R4FL 4PB0L 3CFJB 2BVQA 4JQXA 3DYOA 4NQSB 3S3SA 2FX8L 5F6HI 2WZPD 4FQHA 5MEPB 1A1NB 2F53B 3WMSA 5C2UB 2LTQC 5C07B 2BVOA 5I30H 1IKNA 4ZAKA 2NTFB 2FO4B 4JFFA 2F58L 1PSKL 3FT3A 2CUMA 2NXZB 5D6DA 4LHJB 3KR3H 3HAEH 3MRHA 1HCVA 3L3IB 1JN6A 1P9MC 4R4BA 2FHFA 3RQ3A 4OJFH 3NIDE 1XF3A 1WZMA 5C0RH 1EHXA 4YDIL 5F9OL 5IR1A 1FGNL 4LSVH 4ZS6D 4K2UL 4G9DA 2LU7A 5CBAA 2BVPB 4Y5YB 2LVEA 1YPZE 5SX4I 3TT3H 2X7LA 1IGTB 5ACLA 3HRZB 3GUTA 5DR5L 1A7PL 3IJHB 4Z0BL 1KN4H 4MDJA 2AK1L 2VDRH 1IC1A 1F11A 4OGYH 2VR4A 4LVNB 4APQA 4DKFH 2ICWB 3D3VB 1LE9B 4GKZA 1OAUH 1GOFA 5FKAB 1E6OH 1JPTL 4FOMA 2HTKC 4ZDHB 1YC8A 1TNMA 1FVDA 1GGCL 2C4FT 1MFAL 2J8OA 4NZJA 4HCRL 5F3HB 3OR7A 1YPZF 2YMXL 4L9LB 5FOBB 3DO3A 4OQ1A 3ESUF 4JJHA 3LV3B 3GK8H 4FXKA 5FO7B 3OKNA 4OLEA 2MQCA 1C5CL 4UNTA 4NO5B 4Z7WE 5DFVD 4X4XA 3C60A 5JIKA 4WU5B 4HDIB 4TSCH 4UBDD 3U82B 4LGSB 1AC0A 5E2TL 1KCVH 4PRHB 1SJEA 1HHKA 4RGOH 2NY6C 4NRZA 4ZO7A 1JGEB 3DUSA 3TN0C 3EJZC 1IL1A 3HNVH 4WU7A 1KCLA 3V4PL 3E6HB 1WTGT 1NCUA 3IFLL 1RULH 2UUDH 1MREL 3SDAA 1QFUH 2F8OA 1EMTH 3LKPB 5C0IA 4JO4L 3Q6GH 3OGCB 1OWRM 1GOGA 1LEKA 3BESR 5GS1A 1T1YB 4UB0L 3UJJL 4GAYA 1C1EH 3INUH 3WL9B 3BRDA 4XC3H 1QO3A 3O4LE 3WIFB 2AI0L 4M4RA 2XNAA 4JFEE 2AJ3A 2WBJA 4PD4K 3RWHA 1LD9A 1F4WL 1T0NA 1QVOA 1KEGH 3EW3B 1FPTL 3P77A 5DZNA 1E28A 4HX1B 1U8QA 4YDLC 2HT3D 5EFIB 4D9QD 4V2BA 4W6XB 3RJDA 5DJXB 4QRUA 3QJFB 4N90D 2J1KA 4QXUL 4OM1H 3H9YA 1VB9A 5SX5K 1I7ZB 1I75A 4GG6E 4OZHF 4OCSH 5ESVA 3ARED 3O4LD 4ODBD 3MRLA 1OAYH 3B2UD 1MCDA 1NC2D 5D2NC 4DQOH 1BQHG 1XR9B 4JHAL 9CGTA 2B2XL 4KI5E 3W11C 1DEEB 4X6EB 4FMKA 1AD0B 1EH9A 3T0EC 3W0WD 1G9MH 3C6SB 1BQHA 3TM6A 5BXFB 2WAHA 5JMOC 3HUJB 5K9QG 3A6BL 2QR0B 4LSSL 1CIDA 1N2RA 2F19H 3MGTA 3S34L 1S7QA 4PGBA 2JJSC 2BY1A 1RIUL 1MIEL 1SMOA 4JY6B 4U1JB 2PTUA 4OLVL 2XQBL 2IANA 3B6SA 4LHUD 4MQXD 2XQYK 1CG9B 4MNQA 4Y2DC 4W4NA 3LRGA 3R1GL 3QH3B 1RUMH 5A2FA 5CJ8A 1FH5L 3PGFH 2AK4B 1FP5A 3B83A 3M17A 4MGXA 2JJUA 1D5MB 2P49B 5KS9E 2GTZA 3DUHA 1R5VA 4Z7UF 1RVFL 1DTUA 2J6EA 4L8CB 5IJKC 3D0LA 2VOTA 1KB9J 3UTTE 4LRNH 5I73C 3VFPA 4WHYG 2HT2D 3MLWH 3BP7A 3KLHD 3FMGH 4KI1A 1MRCH 5MI0C 3UZQA 4IRJD 5D1XC 1AP2B 3GKWH 4YHNA 5T3XD 4QLRA 2VLRB 4O2FB 4DZ8B 5T33H 2OTUA 5CEYB 3P4LA 3MV8A 5HGBA 5LKNA 5LWYL 4LCCB 4UZGA 5I1CL 2DI7A 1A6TB 2I5YL 1DQLH 4I0PC 1SYVB 4PJDF 4ZFZA 1XGUB 3LAFA 1A9EA 5M94B 3OL2A 1AE6H 3OXSB 4LNRA 4OI8A 3FRUB 4H8WL 4RMRA 1WWAX 2E27L 3B9KA 5IEHA 1SJXA 5JOPE 3VFRB 4JKKA 3IDYB 4AIOA 12E8H 2B1HL 4K55A 4PTTB 3SO3C 1EO7A 1U91B 3D69A 4JFHD 3RWGB 5I76A 3PP3H 2ADJB 1B88A 4OZIF 1INDH 1MCPH 1Y6MR 4WWKC 3SBWC 1K5NA 1JP5A 5BMFL 3EFDH 3SGDI 3WN5B 4GKNA 5I18H 2QQNH 1LO2L 3N1FC 5H94A 2F54E 5CZKA 1CGVA 1SMAA 1S7XB 3BD3A 3PDGA 5TF1H 5I1IH 4U7SA 1LE5B 1JWMA 4D8PB 2YK1H 5AZEL 2EDHA 4NC1C 5JW4N 3CFIC 1T4KA 1V7NL 3DX7A 4XBPA 3HZVA 1OB1B 3MRBA 4RBPH 3FB6A 1O0VA 3EYSL 2X42A 3D39B 1UZ8A 4UDUB 3EBAA 4JO1H 4UIKL 1SEBA 4G8EB 4NT6B 4X7FC 2W60A 3DX9B 1CFBA 3RZCD 1S78D 4JO3H 3H9SE 1QEWB 1X5FA 3FO0L 1KB5L 4NOBA 3RUGB 2FEEL 5CS7A 3BXNB 4PYGA 3L6FB 2XN9E 3G08A 5DK3A 3HMWL 3VFNB 5D2LF 1A4JA 3BDYH 5FECA 1OAQL 2R9HC 4PJEE 5GSVB 3WIHH 2PW2A 4NNXB 1CLZL 5KANI 2IBGA 4UQ2B 3GEWB 4HS6A 5DC4B 3JV5A 3ZLQC 4YHZL 5FB8B 3C5SA 4DN4L 4ETQA 1OP9A 1HHGB 5DJ0A 3MO1B 3UC0H 2MOVA 4FTVE 3H9SD 4N5UA 5EUOA 4RGNC 4Y16A 4JZNB 4ORZC 1ZHBA 5EORH 3SDXF 1VFBA 2XN9D 4Y4KC 2FL5B 3QHFH 2R23B 4K9EH 4P3CL 4XHJC 3WNNA 1CDIA 4X4MA 1KLUB 5E95B 4IS6A 5DMGC 5EZLA 1P84J 3LN5B 2PYFA 5J0BA 4XB7A 5DHYB 4Z76B 4ZUSB 4OKDA 1DE4A 2HKHH 1B4JH 4HHAA 4NO0D 1JUFB 4X9IA 1IC5H 2G2RA 1MFDH 2N7BA 3J7HA 1IM9A 4YO0B 5E7FA 1LP9B 2C3WA 2L4OA 5A2JH 1F58L 3RVWC 5KSBA 4NO2B 1A6UH 1GL4B 5FF6B 1CL7L 1JGLH 2VL5B 2XZAL 3JWOL 1KIQB 1EFXA 4P5MB 4JFPB 4KJPC 4ODHH 3REWB 4HUKB 1KCKA 3QIWB 2R1XB 2NY3B 4XMLL 3R06B 4C56A 4YBLC 5L8KB 5GXBB 3HAEG 4PJHF 3WNMA 2HH0H 2PO6B 3GI8L 1I4FB 3MLSH 1FNSL 1ZT4B 2HFGH 5E70A 4JANB 3QWQB 2GIYA 3QUYA 2XACC 5D7JA 2EZ0D 3HAEA 3DBXB 1S7TB 3WO4C 3RIFK 3MPCA 4GW1A 3K4ZA 4OKVA 1UVQA 3EO0A 1VKXB 2QSTA 3SKJL 3EYVA 5JOFA 1J10A 4RFOH 1KXVC 3H0TA 2A0LC 3QFJA 4KRPB 3WLWC 4UQ3B 5BW7A 1CTNA 3IRPX 4QHMA 2GK0A 1A9BA 1S9XA 4JRXA 1PX4A 3G9AB 1KCSH 1UA6L 4ZSOE 2NY6D 5LGHH 5TE7L 3BP4B 2X41A 5C2BL 4V1DA 2FJGB 3TN0D 5D4QA 3EJZD 1AGBB 5KSAA 3ZYOA 2FX7H 4WDIB 5FKPB 2O93L 1YY9D 5HXMA 1H8SA 3SJVA 3BKML 5FK9B 3BPCB 4LKCA 1WAAF 3MUZ1 3QBTB 2OTWA 3QAZB 4LLMB 1OSPL 2GUOA 3WFEH 3KDMB 3CFKB 1YMMB 5L9DL 3LSOB 5I74B 1MFEL 1NCCH 1LEGA 1Z9SA 1MI5D 1FFPB 3C5ZA 1UQSB 2R1YB 1L6XA 3PWPA 4FQLH 3BVNB 1QA9A 1S7UB 3NACH 5DEZA 3L3KB 1D5ZA 5H37G 3F62A 3I75A 2ITDB 5HDBF 1WC7B 1P7QA 1ZT1B 1G0YR 2FR4B 4LVOB 5CJXC 4KJWD 1SVZA 4NFDA 2X1XR 3ZDZE 4NHUA 4QNPE 2VDPL 5D70L 4M61B 3L3HB 2V7NA 1OSZB 3G6JB 5HI3D 3VRLF 1MELA 3O3DB 5FIEA 4YHYC 1KIPA 4GS7B 1QRNE 1OTUC 2IPTH 5EG6C 5CJ5A 2C3VB 3MREA 4AT6A 1TJIL 1L7TL 3QPQC 3G6AA 3R0MA 2XY2A 4LCUA 2CPCA 2O5YH 4YBHA 1V8HA 1IEAB 5TQ0H 2XYCA 2EO9A 2A74A 3HZKB 3RWFB 4XCNA 5D7IA 3G5YA 5JHDD 1NGQH 3BSZH 3LZFH 4FFZL 1GGIL 5EBMA 4EIZC 2VISA 3RY6C 4L3EB 5IVNA 3GBML 3LRHA 2VMFA 5I8KL 5I1KL 2VLJB 2VZTA 4NBYB 3K0WA 1QHPA 3IFNL 5D5MF 2KZ1B 4AENA 2A1WL 4Z7NE 1MHEB 3UTSE 5IHZA 4AQOA 3W11D 2WM0A 3MOQA 1J5OH 1J1XH 4G8FA 2IPKA 5GS0H 2ATKB 2CRYA 1PBYA 5CWSB 3HCVB 4Q6IC 3T0ED 3P11L 2CXGA 5E8DH 1LQSR 3V4UH 1FL6B 2OK0L 5JDSB 3UTQA 2N1KA 5J12B 1I1AC 4XVSL 5TF0A 3GMQB 1WCBA 3RVVC 2VH5L 1XCQB 2CRZA 2C4XA 1FDLH 4M7ZB 4Y2DD 4UINH 1QLFB 3AS2A 3PUCA 3KPQA 3QNZB 2CDEB 4WUUE 5DVNA 5CCKH 5T1KA 3EDFA 1H15A 3VWKA 4JPVL 3IFPA 1NAML 3WEXB 1FAIL 4QF1B 3EOAA 4WHTB 3KJ4C 5CAYB 3VGGA 3VXOA 3U9PL 3VH8B 5HYJB 4XBEL 1M7DB 3SOBH 4Z5RA 4M3KB 5HHQB 3RNKB 5I8OH 1PY9A 1FC1A 4PPTA 4LQFL 2PUQT 5JHLH 2FNBA 3KPPB 2Q76B 3TFKC 3BQUB 3NH7H 3T4YB 3QHZH 5DFTA 3AB0B 3CX5J 5IFHH 5HHPA 4DFIA 5DTFA 1R3HA 3HG1A 4MJIE 3VFGL 3LQAL 4KY1L 3NFPB 5DK0A 4MQSB 2X4RB 1XIWA 3FQTA 4TNVK 2Z8WC 3LEXA 4I0PD 1NANH 2JCCF 2MNUA 1N4XL 5SWSB 3DURA 2O5ZH 4PJAF 2YEZA 4I48A 4RWYL 3MNVB 2KUTA 2DAVA 1OGAA 2ZOKA 2GCYA 4FQPA 4ODVH 4X4YB 1C5DA 5IFJA 3MX0A 4GH7B 5E03A 3O2DL 1FG2B 4AEFA 4F7EA 4RWHA 4P23C 4RZCA 4MJID 4NUGL 2DL2A 4WWKD 1NFIB 2WMPA 4MXVF 3G5VA 3SE4C 4NNPH 4KV5F 4ZXBB 1I1FB 1Q9KA 4XGZA 4IOFD 2IG2H 4MSWB 5DRWB 3DXAB 1UWEH 4X98A 5DT1L 4P5TB 4IEFB 2YPLE 4MAUH 1KC5H 1FNLA 4YIQA 2J88L 3AU1A 4WTZG 3VXRD 1CF8H 4C59B 1JPFB 3PHQA 5HGDA 5E00B 2QLVB 4XCYB 2BK8A 5JW5A 4ZFGL 2HP4A 3MUGB 3QUXC 4JLRB 3FO1A 4KUZL 5ENWA 3RWCB 5DK2A 5E08H 1MRFL 1TZHB 4PB0H 4Z0XA 2FX8H 5JR1H 2RAMA 1RFDL 2B4CC 5EU4B 5J11C 1IM3B 1KJ3L 3OAZK 3JV4B 3CZFB 2F58H 5EIIB 1PSKH 4MD0A 2YPLD 2DRUA 2YPVL 3EOBB 2VLMD 3IDXH 4P2YA 4C55A 3DTXB 3TVMC 5B39G 4P9HH 3L7EB 3TBWB 5EU6A 4WFEE 1CE1L 2Y6SC 4DCQB 4GBXA 3IRZA 4PLNC 2VLKD 1MLBA 1CLOL 3WS3B 3EDEA 2M26A 1A7BA 1EIBA 2R9HD 1B6DA 5LGJB 5C0CA 1BD2E 1G7LB 4U1KA 3H3PL 4LOUC 3RWJA 3WFCL 4YDIH 5F9OH 4NWUL 1FGNH 3CPLA 4H0HB 1Z5LB 4RCAA 2VZVA 4D94A 4PJ5B 4PJ7E 1F6FB 3V8OA 2E7CA 3QO0B 3I50H 3VD3A 1XGPA 3LS5L 3S37H 1A7PH 2G5BB 1T1ZB 4KMTH 2JIXB 4RGND 2AK1H 2NLJB 2ZSWB 4O5LL 4JQXC 3OJMB 2E7LA 3PABB 5FM8A 3M1BB 4R7DA 2ZSVB 1HSAA 4OI7A 3H7BA 5HVGB 4XHJD 1J0KA 4JVWA 3U0PA 4ZAKC 1JPTH 1BD2D 4PTUA 5DMGD 2IFFL 1GGCH 4JO2L 4LAQH 5F9JA 3B8SA 5CUSL 2YMXH 2EDQA 1UWXK 1C12A 2EYSB 1C5CH 1PX3A 2H9GB 3WIHA 3TIDB 1MCWM 3GHEL 1C16B 1K2DA 4N0FB 5KTEL 1KB5B 4I3RL 1O7VA 1X5JA 1G0DA 1PYWB 2JB6A 5E2TH 4TUOA 5IJVB 1NGYB 3RVWD 2R2BB 2LU3A 1OHQA 2UVFA 2Y5EA 4K94H 2YA2A 2A9NH 4O2CA 4OFYA 5BRZA 3DX8B 3ZKQD 3KYNB 4WO4A 5GZOC 3OTTA 2VXSL 1FN4B 4OCNC 5HHXH 3BZEA 2MQ3A 2WBWB 5AUMA 4Y4FB 3V4PH 5CIPB 4FQ2L 4HC1L 1EUUA 4LSTL 4KJPD 2OSLB 4JKLA 4PJFF 1QBAA 3MV9D 2Y23A 1EHAA 5HY9A 3VXSA 3SDYL 1QR1B 4HWUA 1BFOB 3UYPA 3K4DA 4F58L 1FIGL 3BH8B 1A3QA 1FSKB 1RY7B 2KDGA 4GOSA 4G9FE 1M7IA 2XY1A 4NN7B 4FQIL 1BWWA 2G9HB 4I1NB 4UB0H 3UJJH 3EGSA 1XGRB 3C60C 1AO7B 2BSED 3QDJB 3PNWA 5IIEB 1S9VA 2R2HB 1Q1JH 4PBXA 5TGBA 4JQIH 2AI0H 3UBXA 1G1YA 3O41A 3VXMD 4YGAB 1F4WH 2A0LD 1IARB 3BE1L 3HC3L 3S96B 3WLWD 4H1LB 3MRMA 1FPTH 2C1PA 3TO4B 2VQTA 3W2DH 3QRGL 4ODTL 3R8QA 5D1QA 3ZKXC 3JVGA 1A22B 3VGEA 4E0RA 4U1SA 5EOQL 1AQKL 4QXUH 4NYLB 5FA3B 4BUGA 5L2KB 3U7WL 5HYSB 5GGRA 2VDMH 4LSDA 1PAMA 1U8NB 3VXQA 8FABA 1R5WB 5E1AA 3IXTB 4NQXB 3G04B 5FHBL 1ZLWK 2DQCL 1ZS8A 3SDCA 4GAGL 2NX5A 2VR9A 5DEGB 4BYHA 3QUMH 4UAOB 5GZNC 1GZQA 1H3VA 1TNNA 3KPNB 4WI6A 2EIDA 1T66D 2UY7A 3PWUB 5HYQB 4IRSA 2KBGA 5IW1B 1TQBB 3BEWA 5E8OA 1WIPA 2WBJC 1GAFH 4I2XE 5I0DA 1D5XB 1OL0A 2N56A 3QULB 3A0OA 1I7UA 3S34H 1HHIA 2P5EB 1MIEH 1MVUB 4IIQB 4OLVH 1HDMA 2XFXA 5HVHB 3D85A 2UWEF 3QISA 4G6FB 2ICWI 4G8GE 1OTUD 3R1GH 3BJLA 5GRZA 1A7OH 1FH5H 1BLNA 3BO8A 2RCSL 3S36H 2E6QA 2VZ3A 4HUNB 4O51B 1FRGH 5E99H 4HWBL 1ZSDA 4XCEA 5GGQL 1YEHL 5L88H 3V7AE 2IAMA 3PDOA 5HGHA 3BRFA 1CXIA 1NGPH 3C2SA 2AAVA 1EEUA 1LNUA 3PL6A 4CVZB 5MENE 1IGYA 1D6VH 4G8GD 2EEDA 3TCXA 4AEEA 2B5IB 1F42A 1I7TB 1WZLA 3P73B 4PRIA 4KKNA 3QJHB 2J8UF 4L8SB 5LWYH 4BELD 3GIZH 3ZL4H 2N4IA 4OF6A 3KYOB 3IKKA 1A6AB 3BH9A 2I5YH 1I1AD 3RWIB 2ITCB 5CD5C 3RVVD 3QIUA 5IHUH 3SGEI 3SO5A 1MJ7L 4NKMB 1TVDA 4UV4L 5KVMC 4H8WH 2ZUSA 1OVZA 4Z95L 2E27H 2EDLA 1U58B 4NBXB 1BFSA 5C08E 1I1RA 3HC4L 2B1HH 3D25A 4MVBC 5FO8B 4LSRL 1D5IL 4RISH 4ZPTB 1I3GL 3ZT5A 3NGBB 2A83A 4LPUA 4MD5B 5HD8C 1TCRA 5BMFH 5D72L 3VFOB 3DI3B 4OCXL 1VSCA 4L8DB 1BZQK 4BQ9A 1NFDE 3DX6A 5I1JH 3TWCH 1QZ1A 3GJFH 3L1OH 2IADA 4TOYL 1IKFH 2NY7L 1ZLUH 3TFKD 3GSRB 5GGSA 4U3HA 2A77L 2SEBA 3BMWA 3GSUA 3T0AA 2WINA 2BCKB 4U1MA 4X6CF 5FYLD 3SQBA 3IDUA 4OZGE 3HB3C 3OKMA 2V2XB 3ARTA 2YD6A 1LK2A 1TITA 2CK2A 4UIKH 4L4VA 1DQDL 2BMKA 4XAWH 4M48L 3Q3GA 3OPZH 1YPZB 1IVLA 3HC0A 3MRFB 4LFHG 2FYYB 3WHE1 3BP5A 2E7BA 4M5ZL 5ACZB 1JFQH 5GRVK 4V2CB 2R8SH 3HN3A 1KCRH 4LLYB 4OCYH 1RV6X 3TV3H 5DS8A 2AW2A 3B43A 3HMWH 1V7ML 1OAQH 1RJLB 3DUUA 3ARZA 3KPRA 3NFNA 1KF9B 4PS4L 4X8JB 1RK1A 4P23D 2WWMC 1CLZH 1T7WA 2AEQH 2XG4A 1NAMB 1DLHB 1J0JA 1YA5A 5CBEB 1IEHA 4WWID 2Q7YB 3ULSB 3DVGB 3BOVA 4OIIL 2DQJH 4IJ3B 1CXFA 4NZUL 1QOKA 1U8KB 1UXSB 4Z7WB 5MHSD 2DLIA 3BWUC 3QWOB 3MODL 4NKOB 4X7EC 5B3JE 3CGTA 3E3QC 2APFA 4S1RL 3WHE0 3QUXD 4P3CH 4JPKL 4JFQB 3QG6B 1ZXQA 2LAAA 3CSBA 1VPOL 5DJYB 2P45B 3GRWH 1F90L 2V5TA 3HHRB 5I71B 1EUTA 5DF0A 1T7VA 3ZE2E 2R69L 2HVKB 1NBVL 4NZTH 5AG9A 2IALB 1NDMA 3ARFA 5FUZL 3TVMD 4CGTA 3JWDC 4NJ9L 4H1LH 4QRRD 3DV4A 2HRPL 2Y6SD 1YMHB 4JHWH 4E5XB 2MHAA 2UUDK 2FZ3B 2IMNA 2X10A 3BX7C 4CMMB 4EUPH 1X5XA 2IH1A 4JFFE 3ZHDA 4LOUD 2FSEA 2WNGA 1RU9L 2OP4L 2M2DA 3T4AB 1CL7H 4Z7OF 4Y16C 2XZAH 5E8PA 3GI9H 3JWOH 2P44B 3BGMA 3O4LB 1JHKL 3IDIB 1I3RB 2EYTB 1G7MB 1MJJA 3U4BL 1NC2B 1RIVL 3BGAA 4JFEB 5AWNH 1NUFA 3T2QA 4F7MA 1S5HA 4YDJA 4MQTB 4YPGA 3UTPD 5IROA 5I75C 2DWEA 1G1CA 1FNSH 4ZAKD 4JFFD 3DARA 3CU7A 5FOJA 3FOMA 2CLZA 1FZKA 4LSQL 4H0GA 3SKJH 4I5BA 4GG6B 2VERN 1PJ9A 5IQ9B 2CDGB 1XF1A 2HJKB 2YRPA 4LHUB 4D0DA 3F5WB 5ESAA 1DBAL 2DLGA 3JXAA 5HHNA 4ZFFA 3GGWB 3L5XL 2DQDH 5TE7H 4C83A 4FXGA 2J4WL 5GZOD 5TH2B 3KPLA 4MA7L 5KSUA 4APQD 1CICA 1QSEA 1UM4L 5GGTH 3C8KB 1K4DA 3F65A 3QUYC 4G42A 1J8HD 1MFEH 4NN5B 5D7JC 4IRJB 1P7HL 1IT9L 3RBSA 1AXSA 3VGAB 5KVEL 4NRXA 1DLFL 3D18A 1R5IA 4PJIA 2YSSA 4XNUL 2Z91A 5ADPL 3NZHL 3BPOC 1N6VA 5KS9B 3C60D 43CAA 3ULVE 2W0PA 2FIKA 1IQDA 2BERA 2Q3AA 2H45A 5C0BA 3CLEL 1HSBB 5BW7C 1VADA 1LO0L 1ZANL 4X6BA 4YHOL 5IK3A 3UTTB 1NLBL 2J8HA 5D70H 4PR5A 4RX4A 3B9VA 5LQBL 1YNTB 1G7PA 4X6DF 2BXYA 4KKCC 1AGFB 2YD3A 1C7TA 2NZ9C 5I1HH 5KSAC 2BSTB 2I60L 2GJ6E 3O4OB 2UV3A 3BEVB 1IC4L 1TJIH 3HA0A 1L7TH 1CFTB 3U36A 2WBKA 4ZUTB 5ILTL 1WEJH 3SDAD 2P1YA 4I18A 3V6ZB 2Q86A 4DEPC 5I2IB 4KMLB 5TQ2L 3TBVB 2ZUWA 3TP4A 1U3ZA 1GGIH 3IDNA 3C5ZC 4YJZL 5C0EA 2X09A 2X9YA 5I8KH 1ZGLM 3CC5B 3F7VA 1IE5A 4EI6B 3IFNH 1HNFA 4D3CL 5BV7B 4LVEA 1MFCL 2OM5A 4D0BB 1G6RH 2D7PA 1ND0A 1G7IA 3P30L 1DUZB 3MFGB 4M7JH 3VWJA 5GZND 4UOJA 4KFZC 1XMWA 1HXYA 3EYQC 4QYOA 1ZWIA 4E42A 1S7WB 1JYVA 2WBJD 1U2HA 3RY4A 2V2WB 1KTDB 3RPKA 5I19L 1T1WB 3MACH 5GIRA 5JW3L 3RZCB 1MUJA 1XZ0B 2R0KH 4OT1L 2VH5H 5ICZB 5KN5B 3GO1L 3PWVA 4GW5A 3DRQB 4IDJH 2F54B 1A6VL 1TDQA 1CD8A 3ARVA 1QBLL 3PHOB 3QXDB 3T04D 5FYKH 3MXWH 3X17A 5C6PB 3BZFA 5IF0A 3T0DA 3NA9L 1ETZB 2R2CA 2CUHA 4JPVH 4K3DL 1AHWC 1NAMH 1KACB 1FAIH 1A3LL 2ZPKH 4MNQE 3PP4L 4U4BA 5EU5A 2YD7A 3QUMA 1GRWA 2NNAB 3F58L 4DN3H 4XBEH 5DZLA 1HXMB 2CO7B 3H9SB 4XXDB 3U46B 4Y88A 3IDGA 3IETB 1SYSA 2ZKHH 1F45A 3BZDA 2IEPA 2XN9B 1EEYA 1BX2A 2KPNA 2VWEE 5JMRA 3OAYK 1CFSB 2P8MA 1HKFA 4PJEB 4U6YB 3MBEA 3VFGH 2IAND 4XP1L 1FNGB 3L7FB 4Q6YA 2B1AL 3GMPA 1A1OB 1N4XH 4HK3J 4H25B 5CD5D 3V6FA 3C08L 3G9VA 3WNLA 3FQNB 2ZNXA 2P24B 3MV8E 4OQTH 2EECA 4FTVB 4JFXB 4RWYH 2I9TB 4M5YH 5K59E 4MLIA 4AIZA 2AV7A 1FZOB 5E9DB 3O2DH 5CD3B 5IB2B 4MVBD 1FVCA 4UIMA 1T6WA 4QCIA 1FJ1B 5J89A 1YZZA 2H6PA 4MNGA 4NUGH 4HPOL 4KJYB 5HD8D 3E6FB 4QRQA 3IFOA 2YRLA 2DWDB 3FB8B 4FFWC 5FYJE 4Z18A 1KJMB 4NQVB 2J88H 5DJDA 1I9IH 5F8QC 5K59F 5T1LD 1PDKA 3MV8D 2ICEB 3W81A 4LP4A 4QY8A 2VSDA 4LMQI 4HQQL 1XIWC 1BF2A 1Z0NA 3LOWA 4PRAB 5HPMA 3GIVA 1MRFH 1U41A 3HB3D 4U6TA 1DQQA 5DDHB 4Q0XL 3RI5F 5EC2A 1RFDH 43C9A 1AXIB 2I07A 3THML 3QUKB 1KYOJ 4OZ4B 5JNYB 3BIKB 4LSPL 1KLGA 5FYJD 2BSSA 3NPSC 3TYFB 5CEXB 1NGWB 2VE6B 5GGUA 1I7RB 3FT4A 5JO5A 1HHJA 2COQA 4QHUB 4P59L 3IU3A 1KTRL 4WI2A 3VFTB 3X11B 5M7QA 2D0HA 2NY6B 3H3PH 4YUEL 4ZNCD 1CVRA 3WFCH 4JDVA 2Q20A 4NWUH 2HFFB 1OT1A 1PKOA 3MJ9A 2V17L 2Z8SA 3HMXA 5IMOB 1NFKA 2OS7A 3I2CL 1HZHL 3LRSA 4LCWA 5FUOL 1KBGL 4WFHE 1P5UA 4XMPL 3STZB 5LXGH 1VGKB 1AGCB 4GRMA 3R8BB 2C1OB 4MQ7B 1JGDA 2HMIC 4O5LH 3ZTJH 3O11B 1MIMH 3QDMA 4OF8A 3VI3F 5T3XH 2JJTA 3BGFB 3C6LA 4NHCL 4ZS7L 4DKEL 4ZSOB 3QDAA 3RIAK 5EUOE 2X9XA 1YN7A 4R90L 5CP3A 4JO2H 2ESVE 5BOZG 1OF2B 2P5WE 5F89B 4GBXC 1E27B 1S9WB 2RHEA 2D0FA 5E94A 1TVBA 3FTGB 4PJBA 1TCMA 4EIGB 3GHEH 4X4ME 4CN6A 2VZOA 5KTEH 4HUUB 3SPVB 4I3RH 4LDLB 1BM3L 1O5DT 1WFTA 3ARBB 2ZP0T 4HGKC 3RU8L 5JPMB 1AJ7H 4YDLB 4EZMA 5C8JB 2V9TA 3LKQB 2V7HA 4UDTA 3BKYH 4MXQC 4LCYB 2VXSH 3WFDH 4M9PA 2PYED 4Y16D 2E7LC 5MERA 1F5WA 1RHHB 1RJYA 4MJ4A 4Z78B 3NCJH 1R3LA 1MCJA 4FQ2H 2YHGA 4LSTH 1W8OA 2W9EL 3OJ2C 1J7VR 3DVNA 3C09B 3GRWA 3SDYH 2Y7QB 3MROA 1JK8A 3PGDA 1NMAL 5A3IC 5GJSL 4HUVA 3NCYP 1T20A 5FUCC 1QRNB 4EUPG 3TJHC 5JA8B 1F2QA 5I1DB 3OMZA 4MHHG 4C56E 1RZGB 2QJDA 2QSQA 1V5JA 3C9NA 5E2WL 1TZGL 4EUPA 1IM9D 1CT8B 1CGYA 1YNLL 2CD0A 1BPVA 5KSBF 1O7SA 4IOIA 4HLZH 5B38G 3A6OA 5BS0A 3QUZC 3BE1H 3HC3H 4Q9QH 4Y2DB 1CDYA 4ODUB 1W0WB 5EZIH 1BQLL 4RFEB 5F7KC 3UTSB 3IDJA 3QRGH 4MLSA 4P2OA 5CJQL 3MCLL 5IG7B 3K1KC 1ZMYA 3U7YL 5B38A 1AY1L 3RHWF 1EFXD 5ICXB 1H3TA 4O4YL 1PLGH 4GXUM 3QFJE 5CILL 4XNMA 1AQKH 1Q9LA 3HPJB 3DETC 1OAKL 1K6QL 3MJ8A 4M62H 3RY5A 3UJTL 3MRIB 1C8PA 4JRXE 1URLA 3LVEA 4DGYL 3O3AB 4HAFA 4X7CC 4GMSL 4L1HA 1FGVL 5FHBH 3ARGA 2DQCH 4V1DE 3QUYD 4OF7A 2BX5A 4MA1C 5D7JD 3P4MB 2PR4H 3SJVE 4OM0L 2NPLX 2OXHA 4PRBB 4L3AA 3TLRA 2RFXA 5IB5B 3CCHA 1BZ9B 2G60L 4WUUB 5DD5L 4F2MA 1W0VA 2X4UA 2CKNA 32C2B 3E8UL 5DJAB 5ABDE 2B4CL 3T1FB 2FD6H 3W39A 3QZWG 4C57C 4I0PB 3U9UB 1A1MB 3BPLB 4JDZB 3V2AR 3RGVA 1RPQA 4JRXD 4UT9L 5D1QC 4YHML 3JVGC 1N5AB 3P4OA 4RAUA 3TCLA 3FCTA 3QZWA 5KSVB 1KIRA 2P48B 4PV9A 5KSAD 5GGVL 3MJ7A 4EXKA 5E8NB 2RCSH 3SJVD 1OP5H 4MAYB 3CXDL 5GGTA 2VAAB 3FB7A 2DQGL 1YC7A 3DWTA 4MJIB 4PJ9A 2H32H 4HWBH 3UTZB 5D93C 5GGQH 1F6AB 1YEHH 3MRDA 3CIQA 4IHOB 5EC1A 3SDCC 3P0VL 3KVQA 3C5ZD 1I8IB 3NBNA 4J3VA 3PWPD 1GGYA 1EFQA 4GSDL 4EEEA 4IRSC 2X4TB 4CJ0A 5F88A 5D7IE 4JPWH 3SKMA 1MF2L 2LV4A 2PXYA 1V3LA 2W0FA 2BRRL 1NAKH 3EYQD 5JUEL 2I27N 3PGCB 2VDLH 4WW2A 2H2SC 4RMSA 1U0QA 1BBDH 2ZUXA 5D9SB 3VFUB 5DA0B 4JKPL 4MB4A 1XR8B 4IMKC 1JZ6A 2YBRA 4UV4H 1UH2A 2YPLB 1JV5B 4ENEC 3V9FA 1MSPA 4OTXL 1RIHL 3SKNA 2EXYC 3OR6A 4LP5A 2VDKL 4Z95H 1T2XA 3TT1L 4QOKA 4P4RB 3HC4H 2R2EB 3RDTA 4YDKH 4WFFE 4LSRH 4JN2B 1LO4L 4NRYA 3MC0A 3IAPA 1I3GH 1YYML 2JLLA 4P2RA 1G6RA 1MCKA 2P8LA 1N5YL 4OCWL 5K9KA 5D72H 3FKUS 3O0RL 3SQOH 3MZTA 3D0VB 1R0AH 4HH9B 4MJ6A 1NGXB 4P2QA 1L0XA 1J05B 4NDMB 3OKYA 2R0ZL 5IMMA 3X3GL 2NY7H 4YNYB 2VQ1B 2Y25A 3FO9B 2A77H 2J5LB 4YXLL 5FA4B 1K8IA 1C08A 3CH1A 1X9QA 4J3UA 2D7MA 4GW4A 3VCLB 3QIUC 5EOTA 3LIZL 3DO7A 1BD2B 5IB3A 2OJZH 1CL7I 2A73B 3UAJC 3IT8D 4X0KA 3ZTNL 1RZ8B 1DQDH 1N59A 1RUPH 3E0GA 3LPWA 4PJ7B 1X6NA 1TLKA 2CRMA 3HG1E 4M5ZH 2RR3A 4DOHE 5T1KD 3CSYA 3VWKD 1CD0A 5EDXA 2FLRT 4LARL 1T5XA 4HKZB 3NABL 3LN4A 5AD0B 1XF2A 2Z92A 4PS4H 4LGPB 3AUVA 4KDWA 3JV6A 3HS0A 4G6ML 5IWLA 2X89D 3T65A 3ULVL 1U8LA 3T2NL 4QHLA 2E7HA 2RB8A 4FFWD 5C9KA 1YDPA 1FYHB 5HJ3A 3V7MA 1CFQA 1A7RL 1JNNL 4WENB 4NBZB 1EBAA 1U8JB 4HUMB 5BZDA 5EIVA 4YGVB 4NQSA 1S5IL 5IFAL 1HIML 4YBLB 1KCUL 1YEJL 1XIWD 2Z35A 2G75A 5DQDH 4S1RH 3LH2H 1E4KA 4OQTA 4OD2B 1GYAA 1BVLB 1RD6A 1VPOH 3HTLX 1I9JL 1F90H 5IVZB 5I15L 3O8XB 5H8DA 1OGAD 2HVJB 2DQHH 4U1IB 2R69H 3L3IA 4R3SA 1NBVH 1MJUL 2AXGB 4MDIA 1QFWM 4NCC1 2Q6WB 4JGUA 5CMAA 1YJDC 5TDNB 2HRPH 2LFGA 2XTJC 1T0PB 3QIBB 4HBCH 4GRLB 3AREA 3UZEA 4NN6C 4OZHA 4Y5YA 4MCZA 1J12A 1HN1A 4PFEA 4S1DC 5I66B 2NYYC 3HRZA 5BZWB 4G9FB 1U8MB 3A6CL 5EU6E 5IKCB 3OXRA 5C71A 4B7IA 2Z31B 3T09A 2DQFB 1U8IA 3OF6A 2BC4A 2YXFA 4O58L 4TN9A 5C0CE 4I4WA 5DYOB 5DSCA 4LHUG 4PRDB 1LE9A 1X5HA 4QTIL 2PN5A 3MRGB 3RL2B 3U4BH 2HMID 2PW1A 4JAMB 3H6JA 1EAPB 1WISA 5F3HA 3GM8A 1GOHA 1T2QL 4NO5A 5I9QB 1PVHA 5IB4B 3ARFC 5AYUL 1K8DB 2XG5A 3CNKA 3P0YL 3VFSB 5F7MC 4L3CA 5EU6D 1TQCB 3QNYB 3EZJB 5D1ZC 4GBXD 4YK4C 3T0VA 1EA9C 1JWSA 4U05A 4DTGL 1QFWL 4L5FL 3RWDB 1FNHA 5C0CD 3KPSD 4X5XA 2ICCA 3UMTA 4TUJB 1CR9L 2GTWB 4QTHB 3ZTJG 4YHYB 4KQ3H 5FUCE 2J6EL 3L5XH 5EOCJ 1IGIL 4OD1L 1DN2A 2I24N 3MMEB 2XWBB 4KVNL 1T3FA 5HYIA 1F97A 5D7LD 4MA7H 1R24B 3NCBB 4I2XB 5IROC 2A2QT 3K74B 1HH6A 2X4OB 5BRZE 2X4QB 4QGYA 1X5ZA 4JN1L 4L8BB 2CLVB 1T1YA 5A3ID 3FB5B 4M8QA 1UKTA 3MTRA 4LPYA 4PJDA 4XH2B 4G8GB 5FDWB 4QRPA 1DLFH 3QA3A 3TJHD 3WIFA 4Q6IB 2DQTL 1TJHH 2AQ1A 4YHIA 4RIRB 1UB6A 3U0TA 4J1UB 4X9FA 5ADPH 1LO5A 3ROOA 3VXSE 2PF6A 4PLOB 1OM3L 1I1AB 3V5DA 5KAQF 1LO0H 1ZANH 1B2WH 3MLYH 4YHOH 5FYJL 4LF3A 1NLDL 5E5MB 1ZKAA 4H88L 5BRZD 4OFYD 4MWFB 3QUZD 3AS3A 4OZIA 2X2YA 3HPLA 4WO4D 3HZMA 4GLRH 1XCTB 5AZ2L 5MENB 2I60H 1D5BB 1I7ZA 1IC4H 4XCFL 4GFTB 2APWA 2A6IB 3CSGA 5JLZB 4HD9A 1CICC 1RZ7L 2MCPL 4LLDB 3LMJL 1RUQL 4F7CA 1ZA3A 3NFSL 3KJ4B 3VXSD 1ZT7B 3IF1B 3OKLB 1PW3A 5TQ2H 4UI2A 3QCTL 2DLFH 2QV2A 4CU8A 4Z8FL 3STBA 1INQB 4GUPB 4D3CH 4HLZG 4UTBL 3DGGA 4HKXB 4HIIB 3C6SA 3V0WL 5HVWA 5I1AB 3CLFH 3ALXA 8CGTA 3MLTB 3P30H 5JW4Q 3HUJA 2GITB 4K7PL 1GZPA 2QR0A 1XGYL 4H5SB 4N8VG 4LAJH 2P7TB 4FZEL 1B6UA 5C08B 4K3EL 3SGKA 4L29A 5KG9B 3CMOH 3D9AH 4F3FB 2NX5E 4N8VA 3WXWL 1D9KC 4MNHB 2EKSB 5D2LA 3UO1L 4G8IA 5JW3H 3NIGF 4OT1H 3K2UH 2AK4A 1MLCA 4W6YB 4JM2C 5D1QD 3T2OA 5K9OA 1A6VH 1JHTB 1NFDB 4PGEA 1KT2A 1CTOA 1QBLH 3GJFK 3ABZA 3NIFE 3OX8B 5E4IA 3IAGC 1FV1A 1P1ZA 2OZ4H 1ZLUK 2GEEA 1KGCE 1J87A 5FGBA 4LEOA 4ZUWB 4LASL 3ARDA 1WT5C 1YQVL 1RK0A 4K3DH 4P23B 2P46B 4HZLA 4MJ5A 4OZGB 5F1IA 4B0MM 4POUB 4LPTA 4R7NB 3FQWA 4HK0B 3SDXA 3SDCD 3H42L 3QYCA 1EJOL 2NX5D 4G6JL 5F7HA 3L3JA 1NDGA 1IZJA 3VWJC 5H35B 5ITFB 1CFNA 2VLRA 4O2FA 3PWNB 4DZ8A 5C3LD 2ARJA 4IRSD 2WWKO 2AGJL 4JFOB 2XPGB 3HNSL 4OD3H 2PCPB 5ETUA 4URTB 4ODXA 4FQQB 4F37K 3QUXB 2CO6B 4GG8B 4U0RB 3NTCH 5EU3B 4XP1H 2H2SD 1ZVSB 3D85D 3VXTA 3Q0HA 4Y5XC 4X5WB 1P9MA 4NM4H 5HGAA 3WE6A 4DUWA 2ZNWA 4Q2ZA 1VEOA 4X9GA 2XA8L 2WLZA 4PRIE 4P57B 4ENED 4XVJL 2H32A 1XF4A 2FX9L 3TVMB 5EO1A 2EXYD 1F4AA 1YEIH 3VDBA 1KG0A 4CU7A 4RGMB 1IQWH 3WN5A 4S1QL 3CSPA 4G7YL 5AAMA 1FORL 3H9HB 3X12A 1R6VA 2XWTB 4HPOH 2D7OA 1M05B 1EO5A 3DVFA 4HIHB 5JIPA 1U3YA 4YHPB 3QP3A 4KKLC 4PJHA 5ID1B 1LE5A 1BFTA 1MHCA 1X5IA 5I30L 5IMKB 2AJXH 3I6GB 2K7QA 1FAKT 1F4HA 2NZIA 2WW8A 4FS0A 1HQRA 3TIEB 4JJ5B 2HA1A 5IVXA 4LU5L 4PRID 1U93B 4TNWK 4O2EB 3PQYA 2BVQB 3KR3L 1QBML 3UROR 4FQHB 2H26A 4NO3A 4HQQH 2B7DT 4FQ1H 3QQ9C 2D9QB 3AAZA 3FOLA 1DDHA 2BVOB 2MTPA 3QIUD 4ZAKB 2RGSA 4JFFB 4Q0XH 5CFHA 1QEWA 2A6DA 3UAJD 3FT3B 1ODAA 1FVEB 3RIFF 3THMH 1TTFA 3TT3L 2L7UA 4MZ2A 4UT6L 4WI4A 3VFNA 1IAIM 5ID0A 1JN6B 4LSPH 4R4BB 3TN0A 4Y1AE 2W0LA 1XF3B 2VDRL 4ZODA 3UPCA 3E1F1 4OGYL 2AXHA 4QHKJ 4Z7VF 4L4VE 5IR1B 1JPGB 5FO9A 1KOAA 3UPRA 4G9DB 1JCKA 3FN9A 4DKFL 4PY7A 4P59H 5CBAB 1EDQA 1WAAA 1OAUL 2MPAH 3H2WA 3O6FA 5EBGA 1E6OL 4LVHC 4YUEH 2CUIA 4AM0B 1X7QA 1K3IA 3V5HB 1MI5A 1QHOA 2V17H 4JR9H 2EDKA 4MDJB 5CGMA 3GB7A 4S2SB 1UB5A 1KBGH 1U95A 1X44A 3KPRE 4APQB 5JIIA 4NGHL 3Q1SH 3VGDA 1KLUA 3GMNA 1WTLA 4L4VD 2VIRA 2V6HA 4P4KC 4MCYA 3MUHL 4NHCH 3OR7B 5TE6H 4Y19E 1P2CA 4AEIL 2VZ1A 5DHYA 4FXKB 1HE7A 3OKNB 5FGSA 5K33A 4R90H 4X4XB 3C60B 3B2VH 5D8JL 3HNVL 1T0MA 4YO0A 4MMZC 4LFHD 1SY6H 4FQCH 2DM7A 4MXWL 1T83A 3KPRD 1SJEB 1HHKB 4N8PA 3D2UD 3BIBX 4NRZB 2XTJD 1MCHA 3DUSB 1M4KA 4FQJH 2XWJA 3KWWA 3Q6GL 4WU7B 4G43B 2AJZB 4GKOA 4S1DD 2HJLA 1KPRA 2W59A 5D7SL 5D5MA 4P5MA 4U1HA 1C1EL 3RTQB 1B0GA 4JFPA 1UXWB 3SDAB 4XC3L 1BZ7A 3OJVC 3T0EA 3EYOA 2Y07H 5CZXC 2DKSA 5C0IB 2PO6A 4HKBA 2W9EH 1I4FA 2Y1VA 2GSIA 1LEKB 1ZT4A 1KEGL 3EHBC 5GS1B 5F6HJ 4YXKL 1NMAH 1FFOA 4GAYB 5E5RB 2YN3A 5L0QC 5GJSH 5FYLH 1G9EA 1HNGA 1MCOH 4CKVX 1QO3B 3N85L 2GJ6B 3X14B 4EDXB 4R6UA 3ARFD 2XNAB 4OM1L 4TULL 1ZHNA 4LGRB 2AJ3B 2WBJB 4S1SH 3RWHB 1T0NB 2H41A 1QVOB 3HKFA 5CINL 5H2BA 5D1ZD 1TZGH 4OUUB 5CSZB 4OCSL 3PHSA 2ERJB 1YNLH 3EJJX 5F9DC 1E28B 1A7QH 1OAYL 5ALBH 2Y4SA 3UCRA 4DQOL 4N9OB 1VGEL 2IWGA 5IJKA 3QEQA 4QRUB 2FJGA 4YC2C 1KTLA 1BQLH 5C0JA 1NGZA 3UYRL 5FKPA 5CJQH 1FNAA 2VABA 1G9ML 1L4IA 5ESVB 3T3ME 1AY1H 3CDGA 5DD6A 4LLMA 3MRLB 5D1XA 4HZAA 1Q94A 1YMMA 3LSOA 1FCCA 3C5JA 1OAKH 2X9WA 4XPBL 4Q9RL 1U9KA 2X5PA 3UJTH 4PREA 1UQSA 2R1YA 4M93B 4P5KA 1A5FH 1FGVH 4M6OL 1AXTL 2W91A 1S7UA 4BFBD 1BQHB 2JCCA 4OM0H 1ZT1A 3MGTB 4PJAA 1FHGA 1GC1C 5DD5H 3H7LA 3MYZA 4IMLA 1MFNA 3B6SB 2B4CH 4M61A 5T3ZD 3DSNA 4MNQB 3FFDA 2EEAA 4LRNL 4RDQF 4MMXC 4N1EA 4P2OC 4PJIE 3DIFA 4I8DA 2QEJA 4UT9H 3M17B 4WWKA 4WI8A 3MLUH 3O6MH 3GMLB 1MRCL 2GTZB 3T3PF 3RBGA 5GGVH 4ELMF 4R96A 5E2VL 3WNPA 1MCWW 3CXDH 3D0LB 5T33L 4XNXH 5F8RC 1CICD 5C0GA 2KQMA 1QSED 3QFDA 3VFPB 4BA8A 3N50A 3O2VL 4A2LA 3ARGC 5ITBH 1DQLL 3QXWA 1MHEA 2Z0BA 4XC1L 3MOAL 5I6XB 3D87B 4J3OC 1RZIA 4YHNB 4PJIF 2HFTA 1AE6L 1UCTA 4NNYA 3HI5L 3EOYG 1PQZA 3MV8B 4JY4A 5HGBB 4HMDA 4XI5C 4PIRF 2A38A 1X3DA 4F7TB 5C0BD 2FDBP 5F7EH 3GMQA 2BRRH 4H20H 4XVTH 3RGVC 4AL8H 1A9EB 1BF8A 1INDL 1ERNA 4RX4D 1B0RA 4XP4H 5TDOA 1QLFA 3EFDL 1D9KD 1UZ6F 5I18L 2QQNL 4JKPH 3B9KB 4R8WL 1BOYA 4HSQA 4JM2F 5IEHB 3AS0A 5KJRL 4HEPG 1YQ2A 1BOGB 2FHBA 4YAQA 3D69B 5INDA 4OTXH 1RIHH 1JPSL 5I76B 4AIXA 4PJ9C 3ZO0A 3TT1H 2LU4A 4XRCB 3VH8A 4GKNB 5HYJA 3GSNA 4PGZA 1JPST 1LO4H 3CFDA 3RNKA 4JO1L 2BHYA 4S10A 4Y7MA 3KPPA 3DYPA 4JM4H 1F02I 4OCWH 4Y4KA 5B21A 1ZLSL 4FQXC 4UNVA 3VWJD 3ARRA 3KPOB 4XBPB 3B9DA 3MRBB 3TPKA 3FB6B 3U6RB 2R0ZH 1IAKA 3X3GH 3LQMA 4PUBL 4TSAL 3RX7A 4WW2C 4OBSA 1QFOA 1SEBB 4YXLH 3BDYL 2W60B 1L9MA 1NUNB 3WIHL 4EI5A 3RJQB 3QWRA 1CDCA 3LIZH 5LG1A 5F6IB 3GHBH 4KK5C 1P84K 1RJCA 5DWUL 4Z9KB 1D3CA 3ZTNH 2OZ4A 1CLCA 4BKLA 4K23L 2EC8A 5DRZA 3WKMH 5FECB 3PE9A 3RDTC 4HT1H 4A2MA 2PW2B 1OW0A 4PJGF 3WJLA 5IB1A 4HS6B 3NABH 3QQ3A 3V0VA 4ZXBA 7FABL 1I1FA 3C5SB 3QHFL 4B41A 4MSWA 3MV9A 5DJ0B 3W82A 1DVFA 3C8DA 1ZLVK 4KVCL 4JHZA 4ZTOL 5EUOB 3T2NH 1JPFA 4KKLD 3GSVB 4Y16B 4BSVA 2ESVB 1SBBA 4MJ2A 5E00A 3IGAA 1ZHBB 1KJVA 2E6PA 2P5WB 1N6UA 2HKHL 1A7RH 1B4JL 2ENYA 2WP3T 4NQDD 1IC5L 1YUHA 3MBED 4IDLA 1S5IH 5IFAH 1HIMH 1KCUH 2VDOL 4Z6AT 2QADC 5I75B 3VXMA 3QQ9D 2HAZA 1A6UL 2PYFB 2BOBB 1XAUA 2EH7H 3ZKSD 3JV4A 2VJXA 3OSKA 5E4EC 4CL7A 1VESA 1YECL 1I3VA 1ORQA 1MJ8L 5SV3A 1JGLL 4HHAB 2HKFL 1R3KA 2G2RB 1EO8H 3V6OC 2BXZA 4JZJA 1KULA 1A6ZB 3KLSA 3IJYA 4OLZH 3ZDYF 1SM3H 1BVZA 5IWLC 1OTTC 3LEVL 4LLWA 3ZE1E 2A6KA 4R9HA 3MLSL 2HFGL 1EHLL 3QO0A 4CMHC 3JSSA 5SWZA 3S7GA 1EFXB 3A6CH 4LLVB 3HNTL 1EX0A 2NLJA 3AXLA 4D9RE 4C56B 1KXTB 1U8PB 5CGYC 2ZSVA 3K46A 4N1HB 4O58H 1IJ9A 2GY7B 4QTIH 2GT9A 1E4KC 2NXYC 2ZUQC 2OMNA 3QUYB 1MCBA 2CDFA 3S98A 5CJXA 4J3TA 4GLRI 4LCWE 4RFNB 3HAEB 4XBGA 1YEDA 2NXZC 2QSCH 4GW1B 1UVQB 3EO0B 5F3BA 4KZEL 3EYVB 2H9GA 1CDBA 1M71B 2UWEA 5JOFB 4MD4A 3P0YH 2FX7L 1EGJA 3QDME 3H0TB 1IAMA 4QRTA 3QFJB 3SDDA 3CD4A 4XWOC 2A6JA 4ZD3L 4NSKA 3OGOE 4WIQA 2XTLA 4QHMB 4Y5YC 4G6AC 1QFWH 2GK0B 5IJVA 4L5FH 1A9BB 1NGYA 4U33A 1S9XB 2R2BA 4JRXB 1CR9H 4JQVA 2YXMA 4LIQL 4V1DB 3KYNA 3IS0X 2FEDC 5KSAB 5J13C 4LCWD 4Y4FA 5MP6L 4LRIC 3SJVB 3S35H 1IGIH 1Q9OA 1QSFA 5CIPA 4LKCB 4PJBE 2OQJA 2OTWB 4XNQA 4YHLL 2GUOB 3RNQB 3BP6A 4BH8A 4U3CA 4DEPB 3QDMD 4M1DH 1LEGB 5CZXD 4WHYH 3C5ZB 5L7XL 4NJAL 3VI4F 4HV8A 4JN1H 3EHBD 1QA9B 5IGXH 2OR8A 1D5ZB 2IPTL 2VXQL 5JPNA 1WWCA 1CCZA 1PEWA 3QDJA 3CK0L 1P7QB 5IIEA 2QQLH 2FJFB 1KNOA 5FCUH 4N1CA 3F7PC 1OP5K 4NHUB 3VMPA 1OM3H 2V7NB 5TQ0L 1JNHA 3BSZL 1KIPB 3OAUL 4M1CC 4XVUD 2C9AA 3MREB 1NLDH 1HOCA 1WFUA 4AT6B 4H88H 2ZG2A 1F3JA 3G6AB 4LCUB 4WHDA 3QQ4A 5EULV 3WFBL 5L2KA 2D2OA 4DW2H 2A74B 5K9JH 4W4OC 5D7IB 3G5YB 4XCFH 1BIHA 1T1XA 2VISB 3V4UL 1RZ7H 2MCPH 1LK3H 3LMJH 2O61A 1RUQH 5IOPA 2FGZA 1KN2L 5BS0E 3E2HC 3NFSH 4G80A 4AENB 2V2TB 1KTKE 4HF5L 3ZE0F 5IHZB 1RUKL 2XXMB 3QCTH 4G8FB 2AVGA 2IPKB 4X6CA 3I3DA 4NUJB 4Z8FH 3KPNA 1FDLL 4BK5A 4UTBH 5DO2C 4UINL 3V0WH 3DYMA 2P42B 5DUML 4Z7QF 4K7PH 3UTQB 5BOPA 3EO1B 1D5XA 5CCKL 5C6TL 5HVFB 4OV5A 1WCBB 4K3EH 1MVUA 4IIQA 1NJ9A 3QDGA 2W65A 2ZUYA 5BS0D 1W0YT 3WXWH 4J3SA 2IQAB 4XXCA 3UO1H 4K3JL 3SOBL 3VFWA 4P2OD 2PETA 5I8OL 2NTSP 1WBZA 4JFDE 3JWDH 3JWNC 3L3DB 5JHLL 3SE4A 3VWKB 1RI8A 3QRFM 3IFPB 1CE6A 2YZ1A 3EOAB 1CZ8H 3VXOB 1KELH 2FJHA 2EDWA 1KIUA 4LASH 1QG3A 1YQVH 2X6MA 2V5MA 4Z5RB 5TDPA 1X4YA 3ARGD 1C7SA 4CVZA 3H42H 1EJOH 4G6JH 5I8EB 5FEBA 3SE3C 1U8HA 5HHPB 2VO5A 4F57H 1I7TA 1R3HB 3HG1B 5DTFB 3LKSA 3SGKC 4DOHB 5E1HB 4XI5D 5DVLA 1NL0H 3HNSH 2R1WA 3WYRA 1XIWB 3FQTB 4F80A 5IHLB 3VGBA 2H2PC 4Q9BA 2ZUUA 3DURB 3RGVD 2Y5TA 3MRJA 1P4IH 2YEZB 2D3VA 3S4SG 4I48B 5JOEA 4HBQA 3DJ9A 1A6PA 1UWEL 3WD5L 3T0WA 4YFEA 1U58A 1KC5L 1JTPA 3ESVF 5FGBC 1JZ7A 3ARDC 3S4SA 4F7EB 3NPSB 5FO8A 2FX9H 1RQ5A 4ZPTA 1Y18A 4PJ9D 4MD5A 2X05A 1W72A 5EWIL 3G5VB 1BJ1H 1H5BB 4S1QH 4XGZB 4J2XA 4YE4H 5E08L 4X98B 4L8DA 5JR1L 2A9MH 3V79C 3AU1B 2FWOA 3PHQB 4LCCC 3GSRA 2W9DH 5HGDB 2O5XH 4ZOEA 2CLRA 1IZKA 2PXYD 5JW5B 3MNWB 1FYTA 3IDXL 4LU5H 3FO1B 1J1PL 4P9HL 4WW2F 5DK2B 5ENWB 3TA3A 1MNUH 3LPGA 1PGRB 5C92A 3M45A 1QBMH 3QO1A 1MCFA 4J7RA 4WUKL 5C9JA 3Q6FA 1L0QA 3EOTH 1JRHL 1OOAA 4P2QE 4U31A 4HIEB 1DANT 4MD0B 2YWZA 4KK5D 2X70A 2XOTA 1WF5A 4JGJA 3ILPA 3U2SA 5EU6B 2DDQL 4KPHH 4UT6H 3I50L 3M8OL 4QOKD 3S37L 3QR2A 3WN5C 3RDTD 5C0CB 4KMTL 3BWAA 3TPUA 5B39B 1PFCA 4P2RD 2XA3A 3CPLB 4YLQT 5FYKE 3S88L 5CBEA 3LEYL 3WHXB 4KRNA 3CDYA 4N9GB 1JWUA 5C09A 4YZFF 4RMUA 1J8HA 1XGPB 2EE3A 3P3YA 5E8EA 4LAQL 2EE6A 4P2QD 1XF5A 1PG7W 4HAGA 4Z7WA 4U1NA 3U0WL 4R7DB 1ORSA 1HSAB 2FH8A 2H3NA 4Y0GA 5J06A 3LKRA 3QXAA 4JFQA 4NGHH 3U0PB 4CN1A 2NY4D 4PTUB 2QADD 4HXBL 3ULUC 1AKJB 4RAVA 1CN4A 5FYKD 4N8CL 4PJCF 1Y0LA 4K94L 2HVKA 4AEIH 2A9NL 5H37H 1N7ML 4X6DA 3REVA 3SE9L 4U1LA 3MRNA 1DN0A 5CGTA 5HHXL 2M1KA 5D8JH 1K2DB 1TPXB 3F6LA 2F74B 4ZO9A 1FG9C 3FN3A 1CYGA 3ZDXF 1N8ZA 4Y8AA 4LPWA 1SBSL 2FHCA 2JB6B 4TUOB 4MXWH 3O6FC 2UYLA 3PV6B 5BRZB 3MA9H 4GRWF 3B3IB 1RMFH 1CBVH 4I3GA 1OTTD 2XZZA 3SCMB 4WO4B 3T08A 4D9QE 1INEH 3BZEB 2OR9L 5AUMB 2JKXA 2ED7A 1CQKA 4ZFOA 2BVEA 4N90E 5D7SH 1EJ6A 4MA8L 1HINH 2EE2A 1G7MA 4XNZC 4ETYA 4HFWB 3AY4A 3STLA 5HY9B 3VXSB 4JFEA 1Q1JL 4OZHE 4JQIL 2CMRL 5DUPH 1FL3A 1MWAH 5LJYH 5F97E 4QXGH 5C07D 1M7IB 4C4KO 2NXYD 4YXKH 4CVWA 5HHVL 2UZIH 3W2DL 4WJ5A 5I17A 4JKMA 2DM3A 1J8KA 3W0WE 3PNWB 2VDNL 3L9RA 4R0LB 1L7IH 5TGBB 3N85H 3O41B 3JBG7 1OQOA 4FFYH 2HJKA 1T83C 4TULH 1YEKL 5CINH 1AI1L 4WRLA 2VDML 3ZYIA 3MRMB 2C1PB 3GGWA 3N1QC 4XPAL 1OAZH 4G6AD 5GSRA 4E0RB 1VGEH 3U1SL 5T5NF 4U1SB 1S9YA 2FEDD 3KYKL 3UYRH 4MZ3A 3QUML 2AJUL 3BKJL 1T7XA 3OF6D 5GGRB 3EYFA 4PV8B 3B5TA 3MFFA 2PO6C 3VXQB 5ISZA 8FABB 5E1AB 4Z7UE 1GAFL 1J0HA 5D93B 4MYWB 1RZJC 3RPIA 1ZS8B 5IEKB 3VD4A 1MCQA 3ZYJA 4XPBH 4Q9RH 3SDCB 2NX5B 1GZQB 1XGQB 3GJEA 1EK3A 1MCRA 4M6OH 1H8NA 1AXTH 4IRSB 4NM8L 3BEWB 3EDDA 1DEDA 3DROA 5T3XE 1A7OL 1MCIA 4KRPC 4ZTPL 4PG2A 3BN9C 1WJ3A 3S36L 3TZVA 2DOCA 1I7UB 1HHIB 1QQDB 1FRGL 5E99L 1HDMB 2BOCA 2XFXB 3UTTA 5JORA 5L88L 3D85B 1YNTA 4PJDE 3GKZA 4M1CD 4QRPE 1NGPL 3OKEA 1BLNB 3BO8B 3BEVA 4WNQA 1H0DB 2O26U 1CFTA 3O3BA 4ZUTA 1WWBX 1ZSDB 1D6VL 4XCEB 3V6ZA 3Q2CA 1T04A 5E2VH 2IAMB 5I74C 4JFHE 5DMIL 5HGHB 2EDJA 5T1LA 3HRPA 4MA3A 3GIZL 4LLUA 3ZL4L 3CC5A 3O2VH 4OZIE 1QSVA 4EOWH 3AS1A 4YDVA 3OB0H 4D0BA 1LNUB 3PL6B 3MCKA 4S0SD 4XC1H 3MOAH 1IGYB 5FGRA 1DUZA 5IHUL 3HE6A 4QRPD 1QPXA 3V52L 1Q9WA 4LVOC 4PRIB 3HI5H 2F8XC 3TF7C 2EDRA 4KU1A 4YBQD 1A6WL 1FBIH 2V2WA 3BH9B 1KTDA 5DVMA 1IGCH 5C0AA 3FQUA 3QIUB 3BUYB 4RISL 4OCLC 4YHKL 4JE4B 1XFPA 4HGMA 3DRQA 4JFYA 2GAZA 2F54A 4OUOA 4FNLH 3BHBA 3PHOA 4R8WH 5KJRH 3UJIL 3TNNB 3QI9A 2VN4A 5I1JL 3TWCL 3V4VL 3D25B 3L1OL 1ETZA 3MRCB 3EYUH 1IKFL 3VFMA 4ALAL 1JPSH 4DWHA 3MJ9L 3HMXL 4QWWC 2A83B 3F7YA 5D2LE 2AEIT 1TCRB 5ELIA 2PKDA 4A6YA 4XPGL 1B9ZA 3QEGL 5ICYA 4WGWB 4YXHH 1RURH 4PGDA 3IETA 2IADB 3HUJF 4XAWL 4KMQA 3LKNA 1ZLSH 5GGSB 2ENSA 2ZOLA 2KL6A 2SEBB 3GSUB 3OPZL 2WINB 1F00I 3MRPA 2YUXA 5B3NA 1JFQL 4BZ2H 4KROD 2R8SL 4PB9L 2HJFA 4Y1AB 1WCQA 3OKMB 1KCRL 4PUBH 4TSAH 4OCYL 1BIIA 3MR9A 1LK2B 3TV3L 3SDXE 2GQHA 2EIZA 3BN3B 4L4VB 4M7ZC 1DANU 5GRYA 2H2PD 3WLBA 1FO0A 2AEQL 3HC0B 2AK4D 3BP5B 4ZYKA 5LBSH 4XP5L 5DWUH 4FTVA 4LKXA 2ICWJ 5BJTA 3I6KA 1JF1A 2CIKA 3FFCA 1ONQA 4K23H 5EBWA 2DQJL 5AYQA 5DS8B 3GMMA 5E9DA 4OAWA 5DZOA 3ARDD 3DUUB 3KPRB 3NFNB 3CU1A 1RK1B 2ED9A 1UC6A 2PYEA 3BD5A 4WGVB 1MAKA 3E6FA 2DD8L 4JB9L 4F8TA 1IC7L 7FABH 3JTSA 3PXJA 4FFVC 2L7JA 3BQUC 3ZKMC 3I6LE 2C4FU 1ZA6A 3T8XA 4O00A 4Y19B 2H8PB 1TJGH 3AB0C 4BFIA 3WXVL 2ZZUT 2VLRD 5K9QI 4KVCH 3GRWL 5DD0L 4ZTOH 2DN7A 4KK9C 2DYPA 1JI1A 4L4TA 4NZTL 2XKNB 1QFWI 1I1YA 3EDJA 3TBYA 3WNOA 4AG4H 3PWJA 5B22A 4EI5C 1JMZA 4JHWL 1Z9MA 1ACZA 1LO3H 2VDOH 4PJHE 4NQCA 3G5XA 4X9HA 4PY8I 5IVXE 4FG6C 3I6LD 4PRNA 5DLMH 5B8CA 3RKDC 1NDMB 4JHBA 3PQYE 1YECH 2VITA 4KXZI 5HDQL 1MJ8H 5CEXA 1OW0C 1NGWA 2HKFH 1I7RA 3GI9L 2BNUA 3WJLC 4QHUA 4ZXBC 4UNUA 3ES6B 1K4CA 2BSRB 1HH9A 2YD2A 3VFTA 2IH1B 3BD4A 5EUKB 4P5TC 5AWNL 1DVFC 2FSEB 1NCAL 3QNXA 1CD9B 3LEVH 4UT7H 1OARL 1T22A 3DI2B 2EDFA 2NW3A 5E8PB 3T1WA 3GSXB 1EHLH 5IVXF 2HTKD 3BGMB 5DA4A 1VGKA 1AGCA 4LEXH 2Q7NA 1MJJB 4MQ7A 3HNTH 3LY6A 4CNIA 3PQYD 4PG9A 4F7MB 3D39D 3O11A 3L3OA 1S5HB 1WAAE 4M6AA 2G5RA 1ITBB 1CDHA 2EKJA 1MI5E 3ULUF 3K3QA 1MHHA 5F1OB 3RUGF 2MFNA 3FOMB 3ULUD 1WBXA 3V95A 3MNZA 1E4JA 2DQDL 3BISA 6FABL 2CLZB 1SJHA 3MXVL 1E27A 1FZKB 1S9WA 4KZEH 1MCCA 3LN9A 4WI9A 4I5BB 4JZJC 5HDBE 4WFGD 4I9WE 5ESAB 2IPUG 3U79A 4R2GC 1JZ2A 1UJ3A 5HHNB 4ZD3H 4ZFFB 3NZ8A 5GGTL 1EVUA 2OI9C 3O6FD 1NBYA 5C8JA 4P49A 4NKDA 3VRLE 4C83B 3FT2B 2YN5A 2ZJSH 4LIQH 1YY8A 4FXGB 2PTTA 3KHQA 4I13B 2Z4QA 3KPLB 5MP6H 5KSUB 3OKOA 1RHHA 4Z78A 3NMEA 1CICB 3QEHA 4YHLH 4R4NC 4YX2H 5JHDE 1K4DB 4UTAH 4DAGH 4H0IA 1S3KH 4G42B 4I9WD 1DBML 2CJUL 1UGNA 1AXSB 1DBKH 5D2NE 4NJAH 5L7XH 1QRNA 4NRXB 3D18B 4YFLF 4JRYA 5D5ME 1R5IB 3K1DA 4HMEA 2VRAA 3OHXA 2Z91B 4P99A 3W9EA 5I1DA 5I1HL 2VXQH 43CAB 1Z3GL 4EVNA 3T0EE 3DVIA 2FIKB 3CK0H 3V6BR 1IQDB 2EC9T 1LP9F 2DQIL 3SDDC 1VADB 4X6BB 5A2IH 5IK3B 1WEJL 3VW3L 1WBYA 4PR5B 4PLJC 5CP7A 1J11A 3O45A 1G7PB 4JQVC 3RVUC 3OAUH 3ARQA 1M7XA 4CDGC 1AHWA 3KNBA 2R29L 4Y4FC 3FAXA 4H26B 2CR6A 2Q8AH 3U36B 1T5WA 1G6RL 3F7RA 3IKCA 3ECBA 1MHPH 1BBJB 3WFBH 4I18B 4M7JL 2Q86B 1MWAA 1OPGL 1XH3A 4HGWB 3IDNB 4F7PA 2PO6D 1FSKC 5C0EB 4CADB 1LEIA 3F7VB 1KN2H 3CFEA 3QEQE 5IBUG 5TJWK 1UH4A 1ZHKA 1JYXA 2F15A 4HF5H 1RUKH 3MACL 1ND0B 1G7IB 3P4MA 1UWGL 2R0KL 5BQ7A 1HYRC 5L6YL 3VWJB 1HQ4A 5IB5A 4IDJL 1HXYB 4QYOB 32C2A 4E42B 5DUMH 5FYKL 3MXWL 2I9LA 3PIQB 4KRPD 5C6TH 5A2KH 1QFPA 3TO4C 5GIRB 4X83A 1MUJB 3O9WA 4KHTL 3HE7A 4WI5A 2ZPKL 3ME0A 1QUNA 4MS8C 3HLAA 3QEQD 5I1GH 2JCCE 4DN3L 4K3JH 4PJAE 3DGCR 3OZ9L 3G5ZA 4JZOA 2X89A 5HI4C 1YJDH 5EU7C 3BIAX 4K3GA 2ZKHL 3OKKA 4HIXH 5D1XD 1OGTA 4FMFA 4GQ9L 4ZO6A 1YMMD 1F6AA 5EU5B 5FAAA 3VMOA 4IHOA 3QUMB 4BFGA 5DI8A 5MEOB 4I0CC 2FRGP 4UAOC 3ZZ1A 2FLBT 4Z77A 3CVIL 1PD6A 5J4MA 4MXVE 4ONHA 1MEXL 3ILQC 4KV5E 3I85A 3IDGB 1SYSB 1TQBC 4HK3N 1EXUB 3BZ4B 4KJQC 1S7SA 4TSBH 2DICA 3VXRE 1EEYB 4OQTL 3Q48A 4M5YL 2P8MB 4IIQC 5ESQA 4NC1E 1UEYA 3G6JF 3MBEB 5A16A 5JXAL 3KXFA 1ADQH 1IGJA 4GKSA 3VFUA 5IMLA 4NQTA 4XXCC 4R26L 1MCLA 3V6FB 3NCEB 5F96L 2BDNH 1N3NA 3VA2C 2BVTA 1FZJA 3WD5H 2YUVA 2DTML 2VLME 4AIZB 1OLZA 4OGXH 2AV7B 1KPUA 1FE8L 1I9IL 3ALWA 4B50A 2R2EA 3OWEA 1ES0A 2X4NA 4RA0C 1FVCB 4BZYA 1T03H 3W5MA 5A2LH 4JN2A 2VLKE 1A02N 2H6PB 4QWWD 5DQ9A 5E6ZA 5IQ7H 1G9NC 3S5LG 1NC4B 5EWIH 2APTA 3FQRA 4QRQB 3IFOB 3O3EA 2VXUL 1PZUB 2W0KA 2BVYA 2EH8H 3D0VA 1NUDA 1G7QA 3IVKB 2YWYA 2R4RH 3L3GB 5DJDB 1IMHC 3S5LA 3C2AH 3SEPA 4L8SC 4YNYA 3FO9A 5F70A 4QY8B 3WUZA 2OBGA 1OWWA 5FA4A 4RGNE 2HTLC 1J1PH 3MA7A 1B4RA 1DQQB 4ELKA 4Q58C 4QXWA 4WUKH 5EC2B 43C9B 1HKLL 1RZ8A 5F7NC 1S7RA 3TGXA 4BH7B 3KPSA 1JRHH 2X1WL 4KUCF 2B8OT 1L0YA 2BJMH 4KUCD 2X1QA 5T3ZH 2F8VA 1N6QH 2BSSB 4FZ8L 35C8L 3X3FL 2FBOJ 5E5UB 3NGBC 2DDQH 5AD0A 4XZUB 3M8OH 3CFBA 3FT4B 5JO5B 3RP1A 5LXGL 3IU3B 3BI9X 3I9GL 5F1NA 5HYJD 5D7LA 3GJFB 5JW4R 1MIML 1I8KA 5T3XL 2FH6A 3I02B 5F7UA 3S88H 1GCFA 2VKXA 2IBZY 4Y4KD 3LEYH 2IBZX 4LCWB 4FFVD 4ZG1A 5D71L 2B39A 3DMMB 1CIUA 4PGCB 4GRMB 1IGFL 4HFUH 1YN6A 2YD1A 2AEWA 1MPAH 2E9BA 3TA3C 4YGVA 4KK9D 2R4SH 3QDMB 3U0WH 2GJJA 2NY5C 5KAQG 3MV9E 3C6LB 4ORGA 4PJFE 4EI5D 3QWRD 3KPTA 2EICA 3MLVL 4Q7DA 1YN7B 4HXBH 1F13A 2P8PA 1KPVA 4PRPA 4N8CH 1AJ7L 2KQNA 4U1IA 3QUZA 4ZOCA 3RKDD 1N7MH 3BKYL 1TVBB 5E94B 2Z93A 3SE9H 4PJBB 1ZOXA 3WFDL 5JDJA 2E8YA 5AG8A 1VFAA 3VXME 2NY1C 1U3JA 3NCJL 1X5GA 1NCBL 2CRIA 4GRLA 1SBSH 4ZXBD 3X13A 3BKCL 1JI2A 4EN3A 4IM8A 5FCSH 1VEPA 1FNEB 2DQEH 1DVFD 5J1AA 4IJ3C 4G9FA 2V7HB 4UDTB 2LE9A 5IKCA 5DC0A 2ADIB 2ORBH 2OR9H 2AV1A 5MERB 4DVBB 1RJYB 3UBXG 1R3LB 1BMGA 1P4LA 1VEMA 5L2JA 4MA8H 1VDGA 1MVFA 4Y4HA 3RL2A 3DVNB 1TTUA 3TO2A 2WP3O 1JK8B 3PGDB 3WV0A 1S8DB 4JAMA 1EAPA 2CMRH 3RI5K 5I71C 3LQAC 4HUVB 2DIBA 1EVTC 1T20B 5SWZE 1UACL 1NBZA 4Q9QL 5C0DA 5EZIL 5HHVH 5KVFH 1G7HA 5EZOH 4WEUD 2VDNH 2L0DA 4EUPB 2B20A 1I9RL 4WW1A 2IBBA 4PJXA 1PLGL 1FLRH 1N0XH 2DL9A 4IOIB 4G3YL 3O3UN 3UEZA 1YEKH 3VGFA 5BS0B 1AI1H 3DRTA 4M62L 4R2GD 3RWEA 3K2MC 1BEYH 4KTEL 1FZMA 3IDJB 4QRSB 1UWXH 4P2OB 4XPAH 3TNMA 4M7KL 2UWEE 5B38B 5SWZD 3U1SH 5BCAA 1WGOA 2PR4L 4XNMB 3KYKH 1Q9LB 3AY4C 1BAFL 4N0UA 1HI6A 4ZPVA 1LGVA 2AJUH 3BKJH 3MJ8B 2F5AL 4I2XA 4NCDA 2X4QA 3LDBB 3FL7A 2BP3A 2FD6L 2IH3A 2BRQA 3ARGB 3GSWA 4PJ8B 4CRPA 2DJUA 2NY0C 5DHVH 1FL5A 5GS2D 3UDWC 2ID5A 1QSFE 3SKOA 1PZ5B 5FDWA 2RFXB 5D6CA 4JFDB 4NM8H 4F2MB 1MAML 1W0VB 4HWZA 3JTTA 2AXFA 5IM7A 4IMKA 5LAXB 7CGTA 3W39B 4ZTPH 3SDDD 3QPQD 4HUWA 1ZVYA 4OZFG 2J8UE 2WLYA 4DK6A 4KI5C 5EO9A 3MBXH 3RGVB 4ZQKA 2CKBA 4PLJD 4RAUB 2DJ4A 3TCLB 3FCTB 3QZWB 3TBSA 1GVIA 1KIRB 3RL1B 3L5IA 4PV9B 3RVUD 4OZFA 3MJ7B 1CD1A 1D5BA 4Y4FD 3SY0A 1Z9LA 1QSFD 5ALCL 1JF5A 4ZUUA 4K71B 4LLDA 4PJ9B 3DV6A 4JPWL 1ZT7A 4TPRH 3WNKA 3OKLA 3MRDB 5EC1B 5DMIH 1NAKL 4N5EC 4IRJC 4U49A 1KJ2H 2VDLL 3VA6A 4OV6F 2EDDA 1BBDL 2D31A 3CMGA 2VXTL 2GFBA 3B5HA 3IU4L 4HIIA 4K3HA 1A4KB 3Q5OA 2BFVH 5F93C 5L2KE 3UYOD 3MLTA 5F88B 1A7NH 3MGAA 4ZUVA 1H3WM 3QDJD 5J8OA 4H5SA 3N9GL 3SKMB 4KGLA 4PG2C 3TZVC 2PXYB 3V52H 2W0FB 3GMRB 4TNWF 1IBGH 1F3RB 4J12A 1JHLH 1DL7H 1HWHB 5FYLE 1A6WH 4X6CE 4YDKL 1ED3B 2YKLH 3N1MC 4YHKH 5DJZA 1PKQA 3O4OC 4JG0L 2F5BL 2YBRB 5GGRY 4Z7VA 4MS8D 1NFDA 1QLRA 3SKNB 3SQOL 1J88A 1DSFH 2X4SA 4Y5VB 1R0AL 4QHKI 4DGVL 5L2KD 1ZV5A 3UJIH 1IAOA 2Q87A 2EIBA 3V4VH 3NN8B 3RDTB 1EEZB 1L6ZA 3QDGE 4ALAH 4NRYB 1CS6A 3MJ9H 3HMXH 2P43B 5DEFA 1G6RB 1DQML 4R7NA 5GHWL 2P8LB 5BV7C 1CGUA 3UBXI 4U1GC 5FHAH 2K9UA 4XPGH 3MRQA 3HE6C 3IB4A 3QEGH 5H35A 2OJZL 5KVDH 2HN7B 3ILQD 4P2QB 4KQ4L 1RUPL 3A67L 5IMMB 4KJQD 4JFOA 1BVKA 4NWTH 2PCPA 4XWGL 2OJEA 2CIIA 1K8IB 1C08B 5MHSE 1N26A 1GIGH 3FO2B 4HIJA 4XAKE 5ANMA 4JPIA 4PB9H 1F4YH 5EOTB 4LQ1A 5CP3H 3QDGD 2BY2A 2NY4B 3DO7B 2WUBL 5GRJH 3QXTA 5CZVH 2QADB 4X5WA 4X0KB 1Z9OA 4X99A 4G6FD 5T1MB 4BM7A 3D2UA 3BJ91 1AR2A 1Q72L 5GQBA 3QI9C 3MJGX 5E4EB 2DMCA 4QXTA 4XP5H 5DJ2B 3VFVB 3N1PC 2J3SA 1UT9A 2BHZA 1T5XB 1XGTA 1D7FA 2W07A 3GMOA 4AEHL 3LN4B 1P6FA 2IPUK 1XF2B 2Z92B 2QKIA 1X5AA 4HJGA 4QRRE 1U3HA 4ERSL 4JDTH 4XAKD 3JV6B 3HS0B 2V9RA 5C0FA 2DD8H 4JB9H 5TFSH 1CGSH 3T65B 1IC7H 1U8LB 5DQDL 4QHLB 4YHPA 3MCG1 1QKZH 3LH2L 1YDPB 3WXVH 5DD0H 1RZJL 5I1EH 3LD8B 2Y72A 4Z7OE 5BVJA 4O2EA 5BZDB 1ADQA 2DQHL 3MRKA 2E3VA 4CU6A 2Z35B 2G75B 3PWLA 2HTLD 4BSWA 4OFKA 3VXPA 5J6GA 3UTPE 3U4EA 2NXYB 2ZUQB 1OY3B 5D1ZA 5GPRA 4HBCL 1DP0A 4TRPL 1FVEA 3PV7A 1GC1H 4M7LL 5L8LB 4R3SB 1FYTE 1NMBL 5C1MB 5FM5M 5HDQH 4MDIB 5CMAB 3I3BA 4M7LT 1JPGA 3AREB 4ACPA 3W9DA 4OZHB 5JIHA 4MCZB 3K80A 5GGSY 2R0WH 2EDYA 1NCAH 4AM0A 5E56A 5MEQA 4RAHA 3V5HA 3CJJA 3OXRB 3U30B 1GGBH 5J13B 3CXHJ 1OARH 4S2SA 4XP6L 1FFNB 1U8IB 4R97B 3W0WB 2FO1A 4OB5L 1U8OA 2BC4B 4I4WB 5DSCB 1FYTD 3NIDF 3BYTA 3TA3D 1HILA 2APXA 3V5KA 3P2TA 2PW1B 2EZ0C 3VGHA 4RDQG 5DD3L 5C09E 1J8HE 4KHXH 2BNQA 5B8CC 5GS3A 4KQ3L 2ZCHH 2VUOA 3BAEH 4L3CB 3CUPB 6FABH 5IW6B 1YEGL 3MXVH 3KLAA 5IV2A 5KOVC 1AGDA 1JWSB 2HLAB 4RMTA 4X5XB 4JCMA 1CXHA 4QHNA 4Z7UB 4ELMA 2XRAH 2NY1D 3WSQH 4U0QB 2ZCKL 3MLRL 1YY9C 4G43A 2AJZA 5C09D 4X6DE 2DBJA 3RTQA 2C7UB 4Z7WF 1T3FB 2H1PL 5F71A 1UXWA 2VZSA 5CJOH 1CU4L 1A64A 1F6LL 1TJHL 5JXEA 3BGFC 3DPBA 1HH6B 3OG6B 2QSVA 3E2HB 1VACB 3T2PA 1DBMH 1CK0L 2AKRA 2M8XA 2CJUH 4M8QB 3WFHA 3AGVA 1B2WL 3MLYL 5HHME 1QD0A 1EERB 4PJDB 4QRPB 1QRKA 3QA3B 4X7TA 2GJ6A 1EEQA 4YHIB 5F7LB 4LBEA 4KJWC 3U0TB 1UB6B 3VRIA 3X14A 1D9KA 2X4PA 3PG2A 1LO5B 3ROOB 4EDXA 1ROWA 3JZ7A 4OI9A 2QHRL 2XV6B 1Z3GH 4P48A 5FM5O 5HI3C 4JM2A 4NFBA 4OUUA 5CSZA 2DQIH 3V5DB 1OTSC 1UJ3C 5EZJA 3ARBC 1DQJA 4NQEA 3ZSTA 3VW3H 4XTRC 4LF3B 4N0CC 3FQXA 1NANI 4Q97A 4OZIB 3HPLB 1WT5A 2DLFL 5KANG 1OP3H 3HZMB 3OB0K 2R29H 5HHMD 4G6KH 3GSNL 4ISVA 2IC2A 2OL3A 3CLFL 1KFAH 4F7CB 1ZA3B 1YEEH 3C09C 4F33A 4JFED 3ZT7A 1OPGH 4J8RB 4FN0A 5DJ6A 4YEEA 1A14H 1E4XH 5DJ8A 1IEBB 3QCVL 1FQ9C 5SV4A 3CMOL 3D9AL 4I3SH 1JGUL 2NY0D 3DGGB 2D4FA 1WQVT 3BPNC 1J86A 3PP3K 4CW1A 3BW9A 1UWGH 1W8NA 1GZPB 3K2UL 5L6YH 4KKAC 3HZYA 1NMCB 4Y5XA 4ZMAT 5ISZE 4GG6F 4KROB 3VXUA 1GSMA 4L29B 3GBNH 2VLLB 2OZ4L 3S37X 5JQHC 4N8VB 4KI5F 5D2LB 2IANE 4G8IB 4KI5D 1WICA 4X9BA 5AEAA 2OXGA 4KHTH 1MLCB 4RBPK 4PJGA 4YWGH 4HXAH 5K9OB 1JZ3A 3DLQR 3GDBA 3GMLA 4PGEB 2FECL 4D0CA 1KT2B 5DMKB 1FV1B 1P1ZB 1I8MA 3OZ9H 4HKJA 4QEGA 1E4WL 4LEOB 3ARDB 3TH3T 4GAJL 1RK0B 1RUAL 5ISZD 4HZLB 4MJ5B 4GRWH 2JB5L 3K8KA 5DHVA 4GQ9H 5F1IB 4OD3L 4TVPE 3FQWB 5EBLA 1JRHI 2WIIA 3SDXB 5F7DA 4N5ED 1NCDL 4NQDA 3NTCL 4M6MH 3L3JB 3U7AA 1NDGB 3MLXL 2AJVL 1CFNB 4E9LA 3CVIH 3RGHA 1QP1A 1MEXH 4NM4L 5GRUL 2ARJB 5KS9F 2LTQB 1BQUA 3L95A 4KZDH 5ETUB 4XNYL 1Z6JT 3TZVD 4F7TA 1MFBL 4ODXB 3BPLC 5IBTH 4NO0B 3UTTD 3O9WC 3HE7C 1PG7L 5E24E 3L5WB 1YEIL 5JXAH 3VXTB 2MSPA 1IQWL 5HGAB 3WE6B 2C26A 2NW2B 4TVPD 1HEZA 4Q2ZB 4R26H 2CQVA 3LCYA 5F96H 4CVXA 4DVRL 4UMGA 4MAYC 1BOGA 2H32B 1XF4B 3DNKA 4KH2A 5DRNB 4TUKL 5EO1B 1LILA 1UG9A 2AJXL 4OLYL 5F72S 2DTMH 1KG0B 3BRGC 1KJ2A 4XRCA 5C0AE 1FE8H 2DM2A 4U6HA 4IOFC 2JTDA 2JE8A 1DBJH 1A2YB 3X12B 5CKAA 4AY0A 4HG4K 4MB5A 3GSOA 4FQ1L 5D96C 2VXUH 5TE4L 4PJHB 4LCIL 4FXLA 1GH7A 1MHCB 2HFEB 3HE6D 2D0GA 1HQRB 3KPOA 4HMCA 2BNRA 5ADOL 4K8RC 1JBJA 5JOPD 5IVXB 1X4XA 2K7PA 4P4KA 3U6RA 5GJTL 3PJSA 3HR5B 3PQYB 5HYEA 1DFBH 4U6XA 2NMSA 1AIFB 3OJDA 4HH8A 2H26B 2X44D 4NO3B 3K4AA 2DQUL 3AAZB 3FOLB 1DDHB 5C0AD 3JV0A 1EGJL 3VI3E 3E3QE 2A6DB 2F54D 1HKLH 3U83A 4NP4L 4HJ0C 2MPAL