3FCTB

Mature metal chelatase catalytic antibody with hapten
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKIVPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (METAL CHELATASE CATALYTIC ANTIBODY)
publication title Structural and kinetic evidence for strain in biological catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 216
sequence length 216
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fctB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fctB02
4H1LH 4GRLB 3LPFA 5GRJH 3W39A 4FQCL 2X1QA 4EKXA 2DLIA 1MWAB 4LHUB 1FJ1A 2AJYH 3RTQC 3UO1H 2WSKA 2KKQA 4F3FA 2VZOA 4YH6A 2CUMA 4ZDHB 3JTSB 2RJMA 3KXFA 1UQSB 4FQQB 4NN5C 3BD4A 1G6VK 4TVSa 4Y5VA 1RZFH 2QQQA 1YYML 4P2CG 1AGCA 5C0NC 3AS0A 3FN0H 4DZBB 1QFWI 2NY2B 1IGMH 2K3TA 5I18L 5SWSB 2CJUH 1OGAB 4NM4H 4HXAL 3QHFL 4JKWA 2ZWLT 5ISZE 4WI8A 2VWEC 3TBSB 1KTDA 3EYQD 2QSCL 2X4RA 2P5WA 1FZKA 5IV2B 4WFHE 4HF5H 1C5CH 2ZOLA 2JJVA 3T0XA 1Q9LB 1D9KB 3BH8A 2MFNA 2XFXA 1NGWA 4GKZB 2R69H 1LO5A 3X3FH 1JZ7A 2F74A 3ULVD 3QWRD 2OI9B 3IU4H 5HYJD 4F33B 1BM3H 5DWUL 1NC2A 3NCYP 3GMNA 3MOAL 3QDAA 4NPYA 1NLBL 5IB5B 4M62L 5I1DA 4NKIH 2HT3C 2FLRT 3ZKXB 3NN8B 3WIFA 1U3HA 3QNXB 3V0VB 3LRSA 4Y4HB 2E7BA 1CE6B 1PY9A 5HPOA 5IHZB 4X9HA 5IG7A 4HWZA 1SBSH 5KW9L 1ZGLB 4P5MA 5I16A 1J1PL 1L0YA 5IQ9A 2DTML 2AVGA 3RTQB 1KNOB 1X9QA 3DRQA 4OZIB 5E94A 4MD5A 5I66A 4GMTH 5CIPA 1J0KA 3D85B 1NBYA 1YECL 2X9WA 4WEMB 4GH7B 1KIRA 4E42B 3KPSA 1RZ8B 3C2SA 1KLFA 2VXUL 2HJKA 4GRWH 5C0DA 2V9QA 3RUGF 1BQSA 4HLZH 1DBJL 1FCCA 2PXYD 3GMLA 4JO2H 5DO2C 1I8MB 4HG4K 5D5MA 3H7BA 4U6HA 3ZHLA 1MELA 5IFJA 4NOFA 43CAA 5FYLD 5ID1A 1GGYA 3NA9L 4P3CH 5C09B 4DKFL 1BQHA 4YBHA 5C8JB 1QRNB 3OB0H 4MDJA 2YPLB 4OLYL 2GT9B 1KJ3L 4C4KO 5BMFL 1HHHB 1UH3A 1VFMA 4HAGA 3VXTB 5E1HB 1RUQL 3KPOB 1LO2H 2Y7QB 3GSVA 3V8OA 3RU8L 2F53D 2AK1H 5EU3A 4QHUA 4JN2B 2NX5A 2MHAA 1BZ7B 3DTXB 4XNMA 1QOKA 3CVIH 4LEXL 3L7FA 1A6ZA 3QCVL 1GGBL 4Z7VB 5KS9F 3JXAA 1WWBX 1U8PA 3SDDB 4PP1D 1RZIA 2AXGA 4MSWA 4HJ0D 5GS0L 4QRQA 5AWNH 1FFQA 4X80L 3NIDF 3CH8A 4MCYA 4PFEA 1E4WH 5JW4M 3LEXB 4X7FC 1UZ8B 3MACH 3ULVC 3HLAA 5J7CC 5BRZA 2VLRD 4I18A 1OM3H 5GZND 3WUWA 1AY1H 5L2KE 4XNXL 3FN9A 3U2SA 5DFWH 3VXQB 1JZ3A 3RNKB 1Q1JL 4PJEA 3BZEA 1G9ML 4L3CB 4J3XA 2OSLB 1KT2B 3LIZH 4WFFD 3VGAC 2KUTA 3MSPA 3ULUL 2ZUYA 4ODSH 4XPGL 5IUSA 1S7SA 4HH9B 1F8TH 3RVWD 3VGFA 1JRHH 3QIBA 3QG7L 4K3GA 1ZHKA 2RFXA 4PS4L 4P3DB 4RCAA 4XP6H 5CGMA 4CJ1A 3FB7A 1EHLL 1QUNA 3EUUA 3H42H 2VQ1B 3WHXB 5FOBB 4L8SC 4XT1C 3UC0H 4WHYH 5DHYB 4HPYL 5BXFA 2ZZUT 4X5LA 5D7KD 5C1MB 3UBXG 5DD5L 2X09A 1LVEA 2EXWD 2Y5TB 2DBLL 4OJFH 5D6DC 1MQKH 3IXAB 2QL1A 2DKMA 2HJFA 3QUZC 4R0LA 1JZ4A 3HC3L 1OAUH 4M6MH 3V5HA 3VG9C 1MRDH 3GEWB 4L4TD 4O9HL 3V95A 2XN9D 2LQRA 4PJGF 1GOFA 2PXYC 2QR0B 2Z4QA 1V3JA 4PB9L 3QCTL 3ILPB 3X14A 2YRPA 1NKRA 4U1KA 4P2RB 5EO9A 3SPVB 4PJCA 3BKYH 2O5YH 2FSEB 5F1NB 2CH8A 4ERSL 1JNHB 4C59B 2VXVH 2N1KA 4JHBA 1XGUB 2VZ3A 5D2LE 3SKNB 3DX6B 4NQSB 1DLHA 3HI1A 4OCSL 4KI5E 1JYWA 2H2PD 4LLMA 5IFHH 4FQJH 2Z91A 4WGVB 3M1BB 5ESAA 5KANI 3MREB 3KPTA 4YNYB 2G5RA 3FB5B 4GAGH 5E2UH 4U7MA 4TUOB 1NCCH 1RQ5A 5L9DH 5KSBB 1S7UB 1UM4L 3GJFH 1F5WA 1CR9H 2Y1VA 3I6LD 2EC9T 3ES6A 4PP1C 1INEH 4UBDD 4HJ0C 2XZCL 3DO3A 4LQ1A 4PJ9B 2FGWL 3QRGL 1FYHB 2Z93B 1A1OB 4PJDE 5CUSL 5DZLA 2IALA 3RQ3A 2ADFH 4BQCA 3GI8L 1X5XA 2YPVL 3CIQA 4K7PY 4IRJB 3OHXB 1L0QA 1FVEB 3D0VB 3B9AA 5B38G 5GZNC 4UU9B 2IANB 3VFSB 1HQ4B 3MUY1 1CL7H 3BSZH 5F3HB 4Y2DB 2X4NB 4ZYKA 1TQBC 2NW2B 1JGUH 4BK4A 4I2XE 1OAKH 1ZT1B 3JTTA 3RVWC 3FONA 3QXUA 4GT7A 3O2WH 5HYSG 1I8KB 4NQUA 1JF5A 4I3RL 4NKMA 4S0SD 5ACLA 1MCPH 4ZTPL 2C9AA 3DV6B 3MFFA 4OQTH 1FN4A 1H0DA 3KHOA 3EYVB 3PDOB 4X6CE 3Q3GA 5E08L 3I3EA 3QUMA 1T22B 5DJXB 1IEHA 1QP1A 4Z78B 4HD9A 4NQTA 4OD1H 1QG3A 2VE6A 3O2DA 2VLLA 4YDIL 1DBML 3ZO0A 2F53B 3OAZH 3MR9A 3QQ3A 2WIIA 1XZ0B 2Q8AL 5DSCB 2X1XR 3SDAA 3MLVL 2EDJA 5IF0A 1WZKA 1HHJB 2VAJA 2Z92B 1S9WB 2XNAA 1IGFH 2P45B 5E6YA 4GG6B 3WIHL 4NBXB 1FDLL 3KS0H 4LU5L 3G5YA 1R3JA 2V5YA 3ZKND 2EDQA 3ARDA 1RJZA 5DJ6B 1EEZA 5DJ0A 5TGBA 3U0TB 4CMMA 1I1AA 3O6KH 2H2PC 1FC1A 2XKNA 5T3ZE 3LCYA 2APWA 3DGGB 2Y07H 4RQQA 3T0EA 3A67L 4P9ML 1P1ZA 2G60L 3IYLW 2VLRB 4JDTH 1KXVC 2E9JA 5KVGH 4G42A 4N0FB 4DWHA 3VXOB 5F6IC 3LH2L 1QLFA 4IMKA 2AV7A 3ROLA 3KPPA 1CVRA 1YY8A 2G2RB 1NMBH 2I5YL 5MERB 2DI9A 2R15A 4JDVB 4MA8L 4UBDC 1GZPA 4C83A 3NCYS 1RZKH 1YEGL 5HHMD 4JLRA 1M7IA 1JJUA 3GI9H 3BGAA 5DK2B 1CG9B 5D7SH 5ISZB 5HVHB 4JZJC 4TNWK 3S6CA 4ACPA 4GG8B 2J1KA 4NQXA 1N0LA 2JB5L 1FORH 1PKQB 3MRMA 3RWCA 3TNMB 1CGXA 4LAQL 5T1KA 1ES0A 3KYNB 1I9RH 1NKOA 2XIDA 4XC1L 5CINL 5E99L 1EUUA 1QPXA 2ZUUA 2FZ3A 4L4TB 4M7ZC 3MJ7A 3H3BC 4G9DB 2BDNL 4RIRA 3C8KA 3MRGA 1CYGA 4GKNB 3UJJH 2VSDA 1PSKL 5D72L 5E03A 1JHTA 1O7VA 3LKPA 2ZKHL 4ZUWB 3IFNH 4HMEA 5EO0A 1EPFA 1X5LA 3OF6A 5IMMA 4UAOB 3QQ4A 4JANB 5JHDA 3LQMA 2B1HL 1JNJA 5GGUB 1N6QL 2CKBB 4QXGL 3M17A 4G6JH 3VFMA 5MEQB 2F5AL 5HHOE 4BKLA 1TQCC 2O5ZL 3ARZA 5JOPD 3WIIH 3VFOA 3VH8G 1V3MA 4M3JA 4P57A 1I4FB 5SX5H 5GS1A 4KTDL 3REVA 5F6IB 4KUZH 5FA3B 3E0GA 4YHMH 2BRQA 5EU6D 4PRPE 1XGTA 1KYOK 3ZKNC 3IJHA 3TBYB 3IGAB 3UTQB 4CMHB 4POZD 1TJHL 1ORSB 4XNUL 2YMXL 4XP4L 4JKPL 1CK0H 3H9SD 1F6AB 2VO5A 1XF5A 1I7ZB 2DD8H 4UNTA 3QNYB 4DJMA 2BP3A 1ZT7B 3PABB 1FYTE 3HZVA 1URLA 1T7VA 2GTZB 3C87A 4G6ML 1NFDA 2F58L 5JHLL 4XB7A 2QKIA 1NQBA 2W07A 1SJEA 5DMYA 1MFCH 3V52L 4MNQD 4Z6AT 4OQ1A 2RBLA 4WWKD 5E2JA 2F19H 1KB5A 1YYLL 2VUYA 4I3SL 2ICWJ 3MV9D 4NQVA 4PJEF 3UTZA 4NZTH 4Q2ZA 5F3BA 3KWWB 2VZTA 4JFXB 1UEYA 4BH7A 2GY5A 1OAQH 3WNNA 1P7HL 1S5IL 3S4SG 2A6DB 5T1LD 2X44D 4OLZH 4NRYB 2R1WB 4KRNA 1EFXA 2D31A 2W91A 2PYEE 3FFCA 4P59H 5CJ8A 1PZUB 4H20H 1MFDL 4CU7A 3EW3B 3S3PA 3VD7A 4BZ2H 3TO4A 1R3LB 4HK3J 3S35X 3D18B 3V6OA 4CDGC 3EOAA 4F9PC 1BF8A 3MRLA 5IOPA 4B53A 2XZQH 3P2TA 1GZQA 4XX1G 4Y1AE 5IEKA 4YIQB 1B90A 4HIHB 4APQA 4X7EC 2P5EA 5B3NA 1F3RB 1QO3A 3HRPA 4LEOA 1JNLH 2EE3A 4PJCF 4KRMB 3LQZB 2X4SB 4XVJH 5IGXL 2XZAL 4C56A 1J8KA 4XP1L 3U4EB 4U3XA 4JZNB 3P11H 1KOAA 4X6EA 3Q6FA 3MRRB 3MV7B 4KDWA 1E6JH 3WUZA 1T7WA 4H1LB 1GJIA 3U0WH 4EI6B 1HHKA 4POZC 2D03H 4JVPA 4F57L 4JRYE 4QHNB 3OKLB 3QIUA 3VFTB 1AP2B 2ZCLL 1I1FA 4HBCL 4JFPA 1IARB 1FZJB 5IBTH 5E4EB 3WSQL 5CZXD 1RUMH 3LPGA 5CP3H 3X3GH 4EOWL 3VRJB 3ZTNH 5TQ2L 5D1XC 5D2LB 3X13B 3HKFA 3QUYB 4WNQB 4R2GB 4PJ5A 1BZ9B 3QA3B 4KV5F 4BSVB 1N2RA 1CI5A 4TPRH 3ARBD 1NCWL 4OD2B 1CDCA 5A43C 3AY4A 5HHVL 3O3BB 3DYOA 3PWJB 4Y2OA 4WWKC 2DI7A 1QLRB 1A6PA 2VZUA 3OPZH 5CKAA 5E56A 3CSYA 4K7PL 5GZOD 4TQEL 1U6AH 3B9EA 2IAMA 1ONQA 4OD3H 4PJHA 4AT6A 1BBJA 5IROC 1RIVL 1HH9B 1A6AA 4EDWL 4IS6A 1W72B 5F7DA 4NFBA 4HKZA 1PX4A 3NIFE 4K9EH 3ECBB 4Z95H 4PJDB 2AXJA 1RI8A 4U1GB 1FL3A 4NJ9L 3JWNC 2NZ9D 1YN7B 4J6RH 3VWKD 5KSAB 1P4IH 3ZKSD 2FLBT 3HNVH 1SVCP 3L3OA 4JG0H 2HFGL 4E41A 4WFEE 4RWYL 5HYEA 1BJ1H 2PO6A 5C0AD 2UYLB 2I9LB 1MH5B 2HT2D 4W6XB 3NH7H 2BC4B 2UUDH 3EJYD 5DQJA 1N7ML 3ROOB 1O7SA 3KPLB 4TRPH 3WBDA 4Z7OF 2ZOKA 3GSRB 15C8H 3V7AG 1FVCA 4FA8A 4XPHH 4Q74A 2Y5EA 5DUPL 1UFUA 2NY0B 4NGHH 5ICYA 1U2CA 5C6TH 2AEPH 4ELMA 4CADB 3O2VL 1UXSB 2GHWB 4KKAD 4XPFL 3VMNA 2GJZA 4Z8FL 4R9HA 4ZUVA 2P7TB 4LVOC 2KH2B 4XXDA 3R0NA 4NN6C 4Y5XB 4RAUA 3T0AA 2ITCB 4HLJA 3T3MF 5TQ0L 3DXAA 3NMEA 1JI1A 1KIQA 4MA7H 4NIKB 3BO8A 3MRKB 1LO4L 3S36H 3VXNB 4ETYA 1ZXQA 2EECA 1EH9A 4PRNB 1RPQA 1IFHL 3GSXA 4HQQL 4KRPB 3RZCB 2NTFA 3B6SB 4M6AA 1K6QL 3TYGH 4WU5B 2RIKA 5FO9A 3VRIA 2CIKA 4UT7H 5CZXC 1GOHA 1CLYL 5IVZB 4PV8B 4CNIB 4PLNC 2D7MA 4UI2A 2D0GA 3GMMA 5GGSY 3ARRA 1DQLL 5DD0H 3ARBC 3GKWL 1LE9B 2JJTC 5CMAB 1JMXA 3KDMA 1ZA6A 1WT5A 3X11B 4HK0B 2UV3A 3VXUE 5KJRH 1XF2B 4U6VH 1KCUH 2I9TB 3EYFA 4OZFA 5BW7C 1X5HA 2R1YA 1RUAH 4G7VH 5GZOC 1BAFH 1AD9B 1KACB 1IC7H 1X5IA 4YEEA 3QXDB 4JM2D 4LSPH 4K55A 2QHRL 2FYYA 3GBML 4Z7WE 1MJ8L 3RDTD 4PB0H 4OLUL 1QKZH 5T5FL 1Z9LA 5FYKH 3UBXA 3D0LB 2NZ9C 5T1DH 4HAFA 2A0LD 1FQ9C 3HG1D 3QCUH 5D1ZA 3VWKC 5IHBA 3MLYH 4MDIB 2R29L 4PJ8B 2ICWA 5I1CH 1KCVL 1Q9WB 4KY1H 3C8DA 1MREL 5DZOA 4R97B 2HT2C 3EJYC 1AC6A 3WFEL 3AMLA 3VFGH 4K94C 4LCWD 5F7LB 3UAJD 5GRUL 1AXSB 4CAGA 5I1JL 2XWTA 3S88H 4ZD3L 2VXSL 5LAXA 1ZGLM 1L7IL 5GJSL 4PYGA 2ZSVB 4NQCA 3GUTA 2CDFB 5IKCB 4KKAC 1IJ9A 1JWUA 2UZIH 4PRHD 1LD9B 1CF8L 1HIML 1JGEB 3FB6B 1EGJL 3BQUD 4NO0D 1JPGB 3VXPB 2MSPA 3BIKB 5E1AA 4HZAA 4CVXB 2H32A 2FX9H 1NCAH 3DYMA 1VGEL 1IAII 1RV6X 4GSDH 3P4NA 5JW5A 1MIMH 4XPTH 3RY6C 5HHOB 1EMTL 1XIWC 2CRYA 3ULSA 3RVXD 5BV7H 1U8QA 2ITDB 1UEMA 4X99B 4PD4J 1S7VB 1VEPA 5B8CA 5AAWA 4TSBL 4UILH 5I1KH 2HJLA 1PG7X 5D7JB 4BM7A 2VDKL 1QLEH 1B4JH 1EZVX 5CD5D 1NFDF 3ESUF 3WNKA 2NY5C 1YEHL 2GIYA 4XGZB 3VI3F 1H5BA 5FHBH 3DURB 4Z9KB 3ULVL 2E8YA 3IDJB 2EDEA 3VFPB 2ZCKL 5FGRA 1Z6JT 3LKSB 3QB7C 1A1NB 1Y0LB 5FDWB 4GFTB 1UKQA 4OAWA 4X6DE 4PY7A 4UV4H 4L4VA 1JZ5A 5J9PB 1AGBB 4Y16B 5C08E 2XRAH 4KI1A 2VR4A 3QAZB 3PQYE 5BZWB 1KF9B 4ZTOL 1FYTB 1S3KL 3ARGA 4XRCA 1RZGA 1AGEB 3GJFB 2Q1EA 5I9QB 4YO0B 1A3QA 3HC0B 1IQWL 1NC4A 2J8UB 6CGTA 2IG2H 4DGYL 4X83A 3KNBB 3HR5A 4JM2C 5HYQA 1KCKA 5DVMA 5JOFB 3IFLH 3A6CL 3E2HC 4PR5B 4G8GD 4IHOA 5ESVB 3RDTC 4HWUA 4FNLH 4OZ4A 4XBGB 3GGWA 4GQ9H 4U49A 5IB4B 4AEIL 4ZXBB 4RX4A 4M03A 1JPFA 1PJ9A 3SDXA 1FO0L 2ESVE 4PJIA 3MX0A 5I74C 3B9DA 1IEAA 3FT4B 3OR6A 3WJJC 5BZDB 3CFIC 3OKEA 1PD6A 1DQMH 4QHMB 4CVZB 1T2XA 4XHJD 5E9DE 5ENWB 1BD2D 2V2XB 4NQDD 1XCQA 2J5LC 4TVPH 1MCJA 3CFBA 5LGJA 3L3JA 5DRWA 1VA9A 3RWIB 4J4PA 4JPKL 3VFRB 1CU4H 2XWJA 3K80A 3LB6D 3OAYH 2C3XA 1IAOB 2DKUA 3RPIB 3RWEB 1T20A 3UP1A 3F58L 4N0YH 1BOGB 1WCBA 3EO0B 2MNUA 3V4VL 4NZRL 3NIDE 3PGDB 3RWFA 5BJTB 3NFPB 1E4XH 1UB6B 4M6NH 4Y1AB 4LIQL 4L8CA 5EZIL 1NEZB 5ILTL 2GSIB 4PTUB 1RK1B 4J23A 4ZAKC 2FB4L 2E7HA 2R4SH 3RVXC 5JZ7D 1UZ6F 3CNKA 2JJSC 5GISL 4PG9A 4IRSA 2BSRA 3I6KA 5AYUL 2EDBA 5AZ2L 3D3VB 4TNVF 3CH1B 4HW6A 3D39D 3TA3A 4MXWH 2K7QA 2QJDA 2VABA 2ARWA 2D7TH 2QQNH 5I1HH 3WDHA 7FABH 3PGCB 4JRYB 4I0PD 4EI5D 5DQDL 3THMH 4R7NA 1C12B 1A7RL 1DQDL 2FECL 2VDNH 3OXSA 2R8SL 5CIPH 4LARL 5EOCL 3HMWL 2IMMA 2J88H 3CPLB 4UDTA 4PJHF 5I30H 3K4AA 1AR2A 3LDBC 5BS0E 3QRFM 4ZSOE 1P9MC 4U1LB 3BRFA 1MF2L 1NLDL 1YN6A 4O5LH 5DJDB 3T09A 2RB8A 1KPVB 1VFBA 3VJ6B 1F13A 1LNUA 5FYKE 1T83C 5DTFA 2ADJA 3IS1X 5EIIB 1JTTA 3DSFH 3BGFB 5FK9A 2ZCHH 4NWUH 5EZJB 4WI9A 3NGBB 5JO5B 3QSKB 3QWOA 4HG4J 3L1OL 3UPRA 4NC2B 2DQFA 1FFOA 3GSWB 1Y18B 5KVFL 2W0FB 4FQXA 2R56H 2NPLX 3B3IA 3BPNB 4MD4A 3BQUB 2VOTA 5FEBA 4B7IA 2OLDA 5DJZB 5KZCD 4OFYD 3V6BR 4XHJC 3O6MH 3WYRA 4JFHE 3U7YL 2EE6A 2X41A 3DETD 2CDGA 3H9HB 1DEEB 3LB6C 4U33A 5DJAB 1SJHA 3FQXA 4Y4KD 4AIZB 5JORB 4ZFOL 2AQ3A 5HVWA 2D7PA 3L3KA 2FX8H 3WFDL 3H3PL 3FO0H 3W82A 3LHPL 3N0PB 3UTSE 3WS6A 1X5YA 3S34H 4G6KL 43C9B 3PJSB 4XH2A 5JZ7C 5GRWA 2XWBA 3WIHA 3U79A 2BVQA 1LILA 3M07A 5GGVY 2SEBB 1ZS8B 4D94A 3N06B 3V5KB 3B5TA 5D2NA 2F8VA 1IT9H 3CX5K 5C3TA 2COQA 4L8BB 3HHRB 5SWZA 3MYJA 4G8GB 4Y19A 1XCTA 3GSNL 3WL9B 3VFWB 3UDWA 3FFDB 4JFDE 4EI5C 5HGDA 5ITBL 5KOMC 5ANMA 3NFNA 1H15A 3IKCA 5ALCH 4Y0GA 2PTTB 2FHFA 1TZGL 1PYWA 2HRPH 2W9LA 5FFLA 3OAUH 1MEXL 3HPJB 1MCWM 3DUHA 2O61B 3HE7D 3MUGB 3LMJH 3MRCB 3IDXL 3CVHB 1DN0A 1IGIH 3FO1A 2DF3A 4JO3L 4L4JA 1QYGL 3QPXL 1CDYA 5EBGA 3VXUB 4Z77B 1BFSA 4V1DE 3KXFE 1CFVH 3NCFB 3NZ8A 3S97C 2EO1A 5HHXH 3G6JA 3DUUA 2XQYG 1RJYB 3KYMA 4U2YA 3MOQA 3KGRA 4C57C 1M6OB 1R24A 5F1IB 2CKNA 3ZT7A 1T21B 2KZWA 4XVSL 1IM9B 4D9LL 1T89C 1LE5A 2AJUH 5K93A 3UJIL 2W38A 5FECA 4TVPE 2HKHH 3VE0B 3DX8A 5C07D 1ZT4A 4NT6B 3PHQB 1A3LL 4P46D 3WCYA 2ARJB 3DETC 3DHMA 3TNNA 1XH3A 2FL5A 1YEDB 2P5WE 3U9UB 1YY9D 4L3EA 5F1OB 2JELH 4MJID 1A9EB 4Y4KC 4GW4A 4P99A 3MLSH 5EBLB 5M7QA 2DQTL 1G7JA 1X7QA 3F8UB 1RFDH 3KJ6H 3ZE0E 5HDQL 4WCYH 1IC5L 4OFKA 3U83A 1UJTA 4I0PB 4JFYB 1M1SA 1FNEB 1XAUA 4RMSA 4XBEL 5IMKA 4WDIA 1RIHL 1P69B 5FO8A 4RGMC 5EO1B 2FEDD 3LKNB 1IAKB 2VQUA 4XNQA 1MAML 3UYRH 4YPGA 2AJYL 3M45A 3O81A 3WN5A 1E28B 1NCBH 2EXYD 1AD0A 4JY6A 1HEZA 3MO1A 1L7TH 2BMKB 2IMNA 4ZO8A 3MJ8A 3TO2B 5IT2H 3MCLH 1I3GL 1BEYH 5B39G 4UQ2A 2IC2A 4GUPB 4A6YB 1ND0B 1PLGH 3GJEB 3JWDH 3LEYH 5I1AB 1J0JA 3FQNA 1ZSDB 1IGML 1KEMH 3KPSE 2AAVA 1GIGH 2WNGA 4MMZC 5C2BH 3BX7C 1OP5K 2OTWB 1YC8A 1FSKB 4PGJA 1IC1A 3HZMA 3V0WH 3QUMH 1YDPA 1G7MB 5HSFA 3K81A 5K9JL 5KZCB 3ZZ1A 2AKRB 3K7UA 2HH0H 2ZPKH 5D5ME 1EXUB 4OFDA 2YUWA 3QQ9D 1ETZB 2Y25A 1G6RL 3CXHK 3PQYB 3RWHB 3T3PE 4JKKA 2MOVA 3NCEB 1JFQL 1QEWB 2DM3A 2EDYA 3SDXF 3P3YA 4LRIC 4PJIF 1U8NA 4EN3C 3ULUF 4D0DB 4P4KD 4NN7B 3VDCA 4UUJA 3F65A 3RUGB 3I02B 4ONHB 1IC4H 5HGAB 4PJAF 3CFKB 2NX5E 1U3YA 3QFJB 4HUXB 5LBSL 5CD3B 1BBDH 2X10A 5A3ID 5H2BB 2PW2A 5JDSB 1RUPL 4PTTA 3E6FB 4DGVL 3O3UN 4P46C 1VEOA 3G04B 4GW1A 5F6HJ 3PL6B 3TCLB 3OKKB 3ZHDA 1SBSL 1Q94B 4PYHA 1T0NB 1YY9C 4MMXC 1PAMA 2H9GA 2JIXB 4PRID 3D5OF 2KZ1B 2ZSWA 5DURD 5ETUB 3V6FB 4N8VB 3EDFA 4P2OD 1Q9OA 3BZDA 4HUWB 4O58L 4U0QB 1MHPH 1R3KB 4QYOB 5BRZE 4MJ6B 4K3JH 1OL0A 1FZOB 1TXKA 5KS9B 3RWJB 3D9AL 2MPAH 2FEDC 8FABB 1NMAH 5FUOH 3HPLA 1YNKL 3STLB 2EXYC 4QXUL 3HE7B 3S5LA 3GO1L 4U05A 5INDA 3MBXH 3QEHB 5FF6B 1I8LC 1T80A 1OARH 5IIEB 5FKAA 3GMPA 5JLZB 4G9FA 12E8H 3GMRA 4FOMA 3WFBH 2Q3ZA 3KYKH 1K8DB 5GSVB 2VLJA 4FABL 4FTVD 1NSNH 3IDGB 4UOW1 3BDYL 1YEEL 2CLVA 3GHEL 1Z3GL 2OBGA 4H1LG 4M43L 3IB4A 4DZ8A 4ZOBA 2FJFA 3U9PH 1Y6MR 1BIHA 2DWDB 5TDOB 1V3KA 1WSST 1VFAB 3O3EB 5C07B 2AI0L 3OR7A 3VD4A 4NRXB 1XR8B 2X4QB 5C0JB 1OTTD 4P46B 2E6JA 3DPBA 4HX1B 5CLWA 1E4WL 4PJCE 1HKLH 4RWHA 4M6OH 4KKNA 5BS0B 4ZSOB 1N5AA 1Q8MA 4MJIB 4D0BA 4P4KC 4XTRC 5E6IA 3JV4B 1WIUA 4U1HA 4JFFD 2EYTA 1WBXA 2B39A 4L8DB 4NDMA 2Z31B 4PJGB 4YHYC 2X40A 2VL5B 4OFIA 4RGND 5BVJB 1JN6A 2NR6D 2L4OA 4Q7DA 2GK2A 2FD6H 2IGFL 5A3IC 2MTPA 4MAYB 4DKAA 2DQHL 4ODSL 1ZLVH 2HVKA 3WE6A 1RHHB 4UNVA 3GSQA 4KZEL 1UADC 2P8MA 3SQBA 3MCKA 2X7LB 2EIDA 4QCIB 4S1SL 2VXQH 1FLRH 4U1MB 3DX9B 1EEQA 2CSPA 2DLTA 4KHXL 4G7YH 4YXLL 4HCRH 2J2ZA 4NQEE 4Z5RA 2XZZA 3D85A 5C0IB 4P2OC 2EH7H 1PQZA 2BFVL 2VR9A 3P40A 2PKDA 1KB5H 2KQNA 4M6ML 1MRDL 3RX7A 3V2AR 3TBVB 4BZ1H 2CGRH 3QH3A 4X7DC 5EOQH 1FGVL 4HGWB 1UB5B 1DQJB 4JFEA 3GM0A 3MLUL 2B5IC 5L8KB 2P42B 5BV7B 3ARTA 3UTSB 5EOCJ 2VXVL 4JR9H 2NW3A 2FR4B 3REWB 2Q20A 1A5FL 3T2PA 3I3BA 4LSUL 3TBTA 3QWQB 3MRBA 5L2KD 4FQJL 1CDIA 4HLZG 1TETH 4P4KB 3MXVL 3DX7A 4NUJB 1FIGL 3T77A 1IGYA 1Q72L 4K3EL 4U6XA 5CILH 3EO9H 2XPGB 1LP9A 1NCCL 1KGCD 4JRXD 4M5ZL 3HN3A 2HVJB 4LVNB 1FL5A 4P23B 2WUBH 1OF2B 2YC1A 3G6JF 4X8JB 1OTTC 1D5ZB 3B9VA 2VQTA 3MA9L 5ADOL 1UJ3C 4EBQL 1U92A 4K94L 3HNTL 2JKXA 4LPTA 4R3SB 4J3WA 1U8IB 4N1CA 1D5XA 3U46B 1TZHA 5DJYA 5EN2B 2A9MH 4JPWL 3W39B 3WO4B 1QFUL 1FJ1B 4KZDH 5L2JA 3T0EE 4LASH 4UT6L 4F3FB 2YRLA 3MRFA 1S8DA 3BP7A 3BI9X 2NR6C 3TV3H 1LDPL 3BSZL 4WY7L 3O0RH 2DWEA 3BESR 1JE6A 2EEAA 4Y5VB 5MI0C 4WI4A 2J8OA 1AGCB 3ZL4H 4MWFA 1IEBA 5E24E 5L6YH 4N8CH 4YDVA 4K7FA 5HI4D 1MCPL 1SVZA 4OQTL 3EFDL 5B21A 3WNMA 3IDNA 1QNZH 2MCPH 4OLWL 4BYHA 5IQ7L 2Q7YA 2NY5L 3BRDA 2APXA 2CRIA 1HYSD 1KTDB 4JKLA 1J5OL 4WHCA 2X4RB 2P5WB 1FZKB 4OD1L 1EGJA 5CWSA 2E6QA 2ZOLB 1VERA 3BH8B 4N0UA 1TTGA 4WTZG 2J4WH 2Z35A 2XFXB 1NGWB 3VXRD 2R2HA 1LO5B 2F74B 4BSWA 1YMME 1E4JA 1F4HA 3KHQA 1IGFL 1WICA 5I71B 1NC2B 3GMNB 3SDCD 3IDYB 5EC2A 4NPYB 1AC0A 4UOW0 1G7LA 4ZNEA 4QWWC 5I1DB 3LPWA 3MJ6A 1HINL 3O6KL 3ARPA 2WBJD 3WIFB 3QWRA 2IADA 5F96H 1U3HB 2DM2A 5JHDE 3SKUD 5HYJA 3LRSB 2DBJA 2AABH 2Y07L 5IBUB 3MLRH 4MB4A 5IG7B 2ADGA 3PWUA 4HWZB 2VDPH 4NWTL 4JDTL 4XBPA 4P5MB 3SN6N 2XYCA 5I16B 4M1GL 5DVKA 5IQ9B 1ZEAH 3TGXA 1JZ6A 3K0WA 1M7DA 4XAWH 4R8WH 5DJ2A 3DRQB 3BYYA 4RGNB 4RRPA 4NFDA 4P49A 5E94B 4MD5B 4ODWA 1A7NL 5I66B 5CIPB 1NMBL 1NBYB 5AG9A 1KIRB 2Z93A 3KPSB 1G9EA 5J0BA 4Q6IC 3LOWA 2GJ6D 2EKJA 3GI9L 4NNPL 2HJKB 5C0DB 5GSRA 3WV0A 1YEJH 4L8SA 4YZFE 5IJVA 2VDLL 3GMLB 4FQCH 3EDEA 3QPQD 2FBJL 3MXWL 2H8PA 2AEQL 1CXHA 3H7BB 3QUZA 1BECA 4U6HB 1EEYA 1A64A 5IFJB 3QI9D 2OK0L 2HYMA 43CAB 5ID1B 3WLBA 3OX8A 1BQHB 1D6VH 1A14H 5I1IL 1NFDE 1FO0A 1KULA 1YYMH 1Q9KA 2BVTA 4MDJB 2PXYA 2E5EA 3UJJL 5AUMA 3GSVB 5IEHA 5HI4C 5EU3B 4HXAH 4QHUB 4Q9CA 3QHFH 2NX5B 4LQFL 3RJDA 4MNGA 2MHAB 1M71A 4XNMB 5EUOA 1D5IL 3L7FB 1A6ZB 3O11A 1DANU 2QSCH 1HYSC 4OZFH 2PCPA 3EZJB 1HDMA 1U8PB 1RZIB 4U3HA 2AXGB 2GYSA 4MSWB 4RDQF 4QRQB 3D2UD 4UTAL 4JB9L 4MCYB 2G9HA 1F3JA 1U8OA 3O4OB 2JLLA 2Y4SA 5MEND 5JW4Q 1CXIA 3ILQC 3WS3A 5DWUH 3HLAB 1T1WA 4JQIL 4S0TD 4PREA 3WUWB 4I18B 5BRZB 4C58B 3U2SB 3SDCC 4PJEB 5J11B 3BZEB 5CJXC 4IDLA 4WTWA 1FFRA 1JI2A 2ILLA 3V6OE 5A16A 5H35A 2WBJC 2PN5A 5TDPA 4PRBA 1S7SB 1OY3B 4LPWA 3QIBB 5KW9H 2D7OA 1ZHKB 3KVQA 2RFXB 1NEZG 1J1PH 4M48L 2DTMH 3FB7B 4LAJH 2J6EL 4K71C 2EIBA 2DOCA 3VXOA 2P5EE 1UT9A 3RIFK 3EGSA 5BXFB 2ATPA 1LO0H 3B4NA 3BDXA 2J12B 1WF5A 1YECH 1W0VA 3P0YL 4C56E 2HJFB 4R0LB 3QJHA 2VXUH 4LLWA 4AH2A 1G7QA 3V5HB 4XAKE 2F19L 3MRQA 3QXVA 4DUVA 1S9VA 4LRNH 1DBJH 2H32H 4NZTL 2B4CC 1T5XA 2Z4QB 1E4KC 3QPQC 4H8WC 3U36A 3X14B 3C5ZD 4DK3A 3VD3A 5ABDE 9CGTA 4LGRB 4U1KB 5EO9B 1UZ6E 4P5KA 1PEZA 5T3XE 4TSCL 4PJCB 2AJSL 3NA9H 2YN3A 3QI9C 4WHTA 1MAKA 1FGNL 2R0WH 2XN9A 4U0RC 3O6FD 1KJ3H 5BMFH 1DLHB 3HI1B 4LLMB 3TJEL 3KYAA 2Z91B 3VRLF 3AGVA 3RU8H 5ESAB 2FIRT 3OJDA 3J7HA 3WNLA 1UCBL 1YEKL 4EQ3A 2BSSA 1JHKH 4LEXH 3O9WC 3QDGD 1LQSR 4D9RE 4PJHE 4ZFOA 2R0KL 3ES6B 1WZLA 2C4FU 5GS0H 4X80H 3FQRA 3RX5A 1F58L 5B39A 4YPJA 5J6HA 2AK4D 2IALB 1R5IA 1JNLL 4QTIL 4KROB 3IDIA 1J8HD 4GOSA 5FGCE 3GFUA 4C4KT 1Q1JH 5GRVK 5IMLA 1E6JL 1G7PA 4FZ8H 4E41E 1KJVA 2HP4A 3Q5OA 4QHLA 1MRFL 4JM4L 1GXEA 3GKZA 4IMKC 3MV8D 4KVNL 4ZYKB 3ULUH 3UEZA 4JZJA 4XPGH 1RZJH 3QEGH 5IMOA 4QT5A 3QG7H 1NAML 3JTTB 3VGGA 4PS4H 3FONB 3ZSTA 1X6NA 1LP9F 2BNQD 3PXHA 3GSNA 4JHAL 3ZTNL 4NKMB 4N9OB 4HPYH 4CUCA 4ELME 3MFFB 1CXLA 3STZA 1FN4B 1PDKA 1H0DB 5DD5H 1FC2D 2DBLH 4K8RC 2PYED 3Q3GB 4XP9L 1AO7E 1KJMA 3CUPA 3QUMB 3ALXA 5CBEA 4H5SA 1FFPA 4NCDA 1QFWH 1T5WA 2VE6B 2BHYA 2X9XA 4JCLA 2VLLB 1MCBA 4WIQA 3MR9B 3QQ3B 2WIIB 2NYYD 4D8PA 4PB9H 3FFCD 3QCTH 3SDAB 3FB8A 1FPTL 5IF0B 5E0QA 3C5ZC 1QSEE 2XNAB 4OI8A 4HEME 3OB8A 2EICA 1FP5A 5BOPA 4ERSH 3G5YB 1R3JB 4LSTL 3L5JA 1S7QA 2RCSL 3PHOA 3ARDB 2BSED 4HUKB 4LSSL 1RJZB 5EDXA 3O6FC 1DBAL 1EEZB 2B1AL 1C5DA 2DJUA 4HS3A 3WEXA 5DJ0B 5TGBB 4CMMB 1I1AB 2XKNB 1B0GA 4ZUTA 3U0PA 4S1RL 5E5UB 4APQD 4RQQB 3T0EB 1R0AL 1P1ZB 4N9GA 4DN3L 1NH6A 1NGYA 1MCLA 3ARXA 4G42B 3DBXA 1QLFB 3OKMA 1UM4H 5DMGD 5ERWA 3QEQD 4QRPE 3ROLB 4JO4L 3KPPB 4LF3A 1YY8B 1A6WH 2NNAA 1GZPB 5HJ3A 1E27A 3QRGH 4C83B 1P84K 4JLRB 1M7IB 5CUSH 5F9WC 1QD0A 3GI8H 5CP7A 1P4BH 5LGHH 2PR4H 2VSCA 1HXMA 1XGQA 2AXFA 5KVDH 1P6AB 4NQXB 3BPOC 1OTSD 1OWWA 4QRRA 4WI2A 3RWCB 3MRMB 3ULVF 3OJMB 4PJ5D 5T1KB 1ES0B 2AQ1A 3S36L 4XPAH 5DEFA 4HH8A 3U30C 3VFVA 2FZ3B 2P8LA 1PX3A 4F7MA 3MJ7B 4RIRB 1IQDA 3C8KB 3MRGB 2EDOA 3BMVA 3Q5TA 5F9JA 5C3LD 4I3RH 4FMKA 1YQVH 5JA8B 1ACYL 1JHTB 4ZTPH 4BQ9A 3LKPB 2IAMD 5EORH 4NQCE 3KPQA 4PG2C 5EO0B 2V2TA 1BF2A 2EKSA 2VISA 5HI3D 3RY4A 5DD0L 5IMMB 3QQ4B 5E08H 4HC1H 2BVEA 4JAMA 4WFED 3O41A 4XVUD 2QQLL 5BVPL 4U6VL 1KCUL 3M17B 3VFMB 4YDIH 1DBMH 3LS4H 4BKLB 4OF8A 1GGCL 3MLVH 1G6RA 3VFOB 1UKSA 4X4YA 4OCNC 2WP3O 4F9PA 4NKOA 4P57B 2DQDH 3O8XC 4LSPL 5GS1B 3N85L 3REVB 3WIHH 1FE8L 1K5NA 1FDLH 4LU5H 3B9KD 4HK3N 1V5JA 2VLMD 4UT9H 5DR5L 1XGTB 2YEZA 2JK5A 2E8ZA 2BHZA 5DD6A 3IJHB 4I3GA 5EULV 1CS6A 2XXCB 1MJUH 3MLYL 1T0MA 5GHWH 3HRZA 1XF5B 5DRZA 1IMHC 3A67H 4P9MH 5EUOF 3CX5J 2G60H 2LVEA 4APQC 5J3HC 2NY1D 1XGRA 4XNYL 3X17A 4OV5A 2M2DA 3L95A 3HZVB 2XTLA 2BSTA 5EU6A 2O5XL 3KLHD 1NFDB 1HSBA 4EXKA 3B43A 2QKIB 2EE2A 3Q1SH 1SJEB 5DMGC 5FM8A 3H9SA 1U2HA 4JFOA 3S88L 3DXAD 1YEGH 4ODUA 1K3ZA 1KB5B 3R8QA 2WW8A 4NQVB 5D1XA 3UTZB 4Q2ZB 5F3BB 3BEVA 4YUEL 1F2XK 4NHUA 1OTSC 1OPGL 1OQXA 2JB5H 4BH7B 4PJIE 3ABZA 4MNQA 3ULUE 4EUPA 1MIML 4LAQH 3W9DA 2OZ4L 4XC1H 4WWKA 5E99H 4H26B 4Z7UF 4F7CA 1DZBA 1U95A 4LMQE 3MV9A 4QF1A 8CGTA 1WCQA 2YXFA 4LLVA 1W8OA 1EFXB 2D31B 5IROA 5T33L 3FFCB 1UKTA 1PSKH 35C8L 4I13B 2GTWA 4IIQC 4P3WA 5C71A 3UZQA 3TO4B 2WINA 5T1LA 1ED3A 3EOAB 2AERT 5DDHA 5HI3C 1KC5L 3CDYA 3MRLB 4U1JA 3TPKA 5IOPB 1U93A 1QA9A 4QXGH 1ZA3A 2CRZA 1GZQB 1WIPA 4OGZA 4GW5A 5IEKB 3BN9D 5E5MA 2F5AH 3C09B 1G7IA 2O5ZH 4APQB 2P5EB 1R5WA 3BW9A 1QO3B 2D2OA 3DRTA 4LEOB 5MHSD 4UV7L 2QSQA 1KTLA 4KTDH 5FB8A 4KK5D 4U7KA 3DV4A 4C56B 4LOUC 1V7NL 4X6EB 3Q6FB 3B9KC 3QDMD 5C70A 1FH5H 1TJHH 1HHKB 2XACC 2YMXH 4XP4H 4JKPH 1YC7A 1BFTA 4FMFA 1IM3A 3MV11 3QIUB 1BGXL 4FFYL 1I1FB 1T2QL 4JFPB 1P7QA 2NY1C 2VERN 4JFQA 5K59F 4ORZC 2F58H 3KLHC 1RAMA 3BPLB 4PJ5B 3ZE2F 3P4MA 1KB9J 1N2RB 3DVGA 3V52H 4QNPF 4HKBA 3O4LD 5D96C 3PDGA 2HA1A 1FZMB 4N0YL 1YYLH 2QQKL 4I3SH 5I6XB 3AS2A 3CSYB 2GAZA 4ISVA 2IAMB 1ONQB 4PJHB 4AT6B 1BBJB 4M6NL 3ARBA 2JJTA 1A6AB 4OFPA 4IS6B 1EAPA 2ZUSA 1GGUA 5F7DB 3EFFA 4HKZB 5F7UA 1S5IH 2R4SL 4L1HA 4L4VD 1FL3B 5F9AC 5BW7A 2XTJE 5FGCB 4PY8J 4DTGL 4MA1B 3ARGD 3OKDA 3L3OB 4IJ3B 1MFDH 4E41B 2DMKA 2PO6B 1KEGH 4JQXC 3QUKA 1NC4D 5IB3A 5DLML 5EWIH 5DQJB 4D3CL 5FYJE 1U36A 2D0HA 1G0DA 3MNWA 5EFIA 3VWKA 2ZOKB 3VI4E 2ESVD 2VDNL 3FKUS 1FVCB 2X4OA 5I8CA 4WUUA 4WRLA 2YBRA 5CJOL 3BN9C 4IOSD 4OBSA 5C0AA 5ICYB 1VFOA 2RHEA 4P5TD 4EIZC 4ELMB 5E9DD 4HUUA 2P24A 4ORGA 3UPAA 1CGTA 3SKMA 2GJZB 2XZAH 4KXZI 3UTPE 4XP1H 4KK5C 4ZUVB 2NXZD 4U7SA 2WAHA 4XXDB 2DIBA 4RAUB 5TF0A 3T2OA 5D2NE 3LS5H 4NWUL 3DXAB 1KIQB 5D96B 3UTTD 3BO8B 4KMTL 4F57H 4LVEA 4Y19E 3SE3C 2FBOJ 4PP2A 1GH7A 3CZJA 3RAJH 4F8TA 2ZCLH 3GSXB 1N6VA 2FJHA 2NTFB 5FO9B 3VRIB 5JXAH 2CIKB 4EOWH 4KJQD 5IJKC 3O6ML 5TQ2H 3LD8C 2CLRA 3RY6A 4R96A 4ZODA 1XIWA 2OS7A 5GRVL 1EVTC 3GMMB 4BFBD 1NCWH 2CMRL 4OQTA 1SJXA 4JPVH 5JPNA 3KDMB 5HHVH 1ZA6B 1X5KA 5K9QG 3FHQA 1UVQA 1PKOA 4JKMA 3EYFB 4OZFB 5T5NF 1T66D 2FX8L 1K8IA 3G6JE 3PF2A 4K7PH 4TQEH 1YNTA 2LU4A 2R1YB 5DHXB 4X7TA 1NDMA 4GAYA 3EOTH 4POUB 1RIVH 4HPOL 1MQ8A 4NJAL 4RFOH 1XGYL 3QXWA 3NZHL 2FYYB 2QBWA 2X4TA 4MGXA 2UVFA 4P2QE 1TIUA 4NJ9H 1F4XL 4PJ7A 2L7UA 3MLXH 4WVRA 3UBXB 5E8OA 2Y36L 5D1ZB 3MFGB 3PWNA 4U2ZA 3IETA 2WBWB 4JN1L 4BA8A 2HFGH 4H25A 4RWYH 4JM2A 2ICWB 1IT9L 4L3EE 3BPCA 5BQ7A 3BKCL 1WGOA 1JRHI 3G6DL 1N7MH 3RDTA 4HUMB 1VENA 3ZYJA 3HG1A 3T0VA 5ALCL 2NLJA 4NCC1 3RNQA 5DUPH 2HRPL 2XWTB 5LAXB 4CBPA 3EOBA 3WJJA 4P5TC 4FQXD 4NQCB 3DROA 3GUTB 4XPFH 1S7XB 1JWUB 1NANH 4Z8FH 3BGMA 1JNNL 4GS7C 5IBUG 5E1AB 2NXZC 1I7RA 4LCWA 1RZJC 3KLSA 1BJ1J 2R9HD 4MB5A 2H32B 2NY4B 1T1ZA 5TQ0H 4D9QE 2X4PA 3P4NB 3BJLA 5HHXL 5JW5B 3QDHA 1DCLA 1N59A 3C08L 3ULSB 4EXPX 1U8QB 1LO4H 5EOTA 5B8CB 4PRHA 4YFEA 2VC2L 4FQHA 2HJLB 1IFHH 4WU7A 4NO0A 4HQQH 1K6QH 3TJHD 5DD3H 1H5BB 1CLYH 2ICCA 2HKHL 4KJQC 1G84A 4OZGE 2XY2A 2E9IA 3B8SA 4ZAKA 4EZMA 1UENA 1DQLH 4OAWB 4CW1A 2JJSA 4YC2B 4PY7B 4L4VB 4M61A 2IPKA 3QNZA 4GRWF 4M02A 4NHCL 3BHBA 3EOYG 4PRDA 2CXGA 1BQHG 4TTGA 3ARGB 4XRCB 1OW0C 4XHQA 1RZGB 1T66C 2VDMH 1RFDL 4OBRA 2FIKA 3KJ6L 1NC4B 5D7IF 1FNHA 1LO3H 3L9RA 3HR5B 2VKWA 5HYQB 1DJSA 3GBMH 1MJ8H 4OLUH 4IHOB 1J05A 5T5FH 3LVEA 1F4WL 4OZ4B 3WFCH 3GGWB 3UYRL 2C1PA 1P9MA 5K9KA 1T2JA 1JPFB 2R29H 1AQKH 4JJ5A 1CL7I 2OM5A 3SDXB 2DMBA 4PJIB 1IEAB 3MCLL 2CLZA 1JPSH 1ERNA 1MREH 3OR6B 2B4CL 1BEYL 4V1DD 3WJLC 1T83A 4DEPB 3OKEB 4LLQA 4H8WL 4M3KB 1GPOH 4XP5L 4KQ4H 4QHKI 1BQLH 1MLBA 4PJAB 1XCQB 2J6EA 3WUWG 5GRUH 3WXWL 3U82B 3CFBB 5LGJB 3L3JB 1GIGL 5DRWB 5C2BL 3VA2C 5ICZA 3QUXC 1Z9MA 4ZD3H 2VXSH 2XWJB 4FG6D 1L7IH 3V0WL 1T20B 4WI3A 5D7LE 4FQXC 4HGKC 1CF8H 1HIMH 5E2WL 1WCBB 1EGJH 5EPMA 4E5XA 4ZO9A 5EB9A 1BD2A 2ZPKL 4Y88A 3RWFB 1UACH 4NQDA 3L5WA 1BWWA 2QEJA 5A2LH 4V2BA 2R9HC 4L8CB 3QP3A 1GSMA 2YK1L 4XMPL 1EMTH 3MROA 4UQ3A 4ONFL 3PUCA 5DJCA 2IPTL 3RZWA 2YA1A 4G9FE 5KBNC 4WV1C 3NIGE 3MRDA 4PG9B 2VDKH 4IRSB 4OM1L 2BSRB 3I6KB 5D93C 5IVXA 5SWSE 1OGAE 3TJHC 4OT1H 3TA3B 4G5ZL 2ICEA 2ZCKH 2VABB 3PDDA 4AM0A 2Q3AA 3ALPA 1HI6A 3LKOA 5DD1L 2IH3A 1WAAA 5FO7A 4V2CB 4R7NB 4HDIA 3CJJA 3OXSB 3T2NH 4ZTOH 1S3KH 3D39A 4UDTB 5BO1H 4N90D 2EDFA 4WI7A 1IQWH 5DRNA 2YD8A 1OCWL 4O2FA 1MHPL 4S10A 2QV2A 3H6JA 4HT1L 4K3JL 1YN6B 3BKMH 4DGYH 4OF5A 4E0RA 4EI5A 2BHUA 1VFBB 1LNUB 5I8OL 4IMLA 5DTFB 2ADJB 1DL7H 1OLZA 5GGRY 3GMOA 1MHCA 4K8RL 5FK9B 5ITFA 3QWOB 3SGJC 3UPRB 1MY5A 1DR9A 2DQFB 1FFOB 1MVUA 4OV6F 5GRXG 1G9NC 6FABL 4FQXB 3I75A 3ARWA 4HGMA 1FO0H 4FZEL 4L5FH 3B3IB 1UM5L 2W1NA 3QBTB 5JR1L 4MD4B 1YUHA 2X4UA 4P4RA 3S37H 4OZIE 5DC0A 3NPSC 3VDBA 5I17A 2XTJB 2CDGB 2HAZA 4JPKH 2VDRL 5L88H 2PETA 4FG6C 3P77A 1SJHB 3B2VL 3FQXB 1T89A 5HGHA 4XPBL 3S36X 5DYOA 3BVNA 3MNVA 5C0EB 3V4VH 4OFYA 1JWMA 4NZRH 4BZYA 3ALWA 3L3KB 1EXUA 2JB6A 4JFEE 4MCZA 4LIQH 3K8LA 5EZIH 5ILTH 2CK2A 2DQGL 4Y4KA 2FB4H 2JCCF 4NZDA 1QRNE 2YPLE 4XH2B 5MEPA 2XWBB 5GISH 3ARSA 3UROR 5AYUH 2BVQB 1L9MA 5C0CD 1L0XA 1OT2A 5AZ2H 4UIMA 2E7MA 1FVDA 5CD3A 5D2NB 5DK0B 1MLCA 5CKGA 3MUJA 4BK5A 1BZQK 4I9WD 4J12A 3MRNA 4OZHA 1NBZA 1NMCC 5SWZB 1LP9E 3MYJB 4Y19B 4DK6A 1XCTB 4HIXH 3LY6A 1DQDH 2IPUK 5HGDB 2R8SH 5ANMB 3NFNB 2BZDA 3VWJD 1H15B 3IKCB 3O3AA 5EOCH 3HMWH 4NOBA 3TWCL 4EVNB 1PYWB 4HCRL 2ADIA 3GRWH 1RZ7L 4AY0A 1WBZA 1EDQA 3WN5C 2D7NA 2WUCH 4HV8A 3NPSB 1B6DA 1CWVA 5DRXA 2E9BA 1DN0B 4PJ7F 1ZLSL 3FO1B 5JIIA 4AL8L 4BZ1L 3C6LD 3NZ8B 1FNLA 3DI2B 3G6JB 3GMQA 3DUUB 4JM2F 3E3QC 3IJYA 2VLJD 5IW6A 5KVFH 1JYNA 3KYMB 4KKBD 4KJYA 2QHLA 1I75A 1WIOA 2ZJSL 4RMVA 1R24B 4DGIL 2V5RA 5IWLC 1LE5B 4ODVL 2WQ8A 4JDZA 5FECB 3DSNA 4YXKH 3DX8B 3U7YH 2P1YA 4LRIA 1ZT4B 4EN3A 4CGTA 3TNNB 1XH3B 2FL5B 3EYSL 3I50H 1F6FB 4L3EB 3V6ZA 4WO4D 2BRRL 4N0UE 4GW4B 1DEDA 4RISL 4M4PA 5LWYL 4ZG1A 4WWID 1G7JB 1X7QB 2EO9A 3WFDH 3CFCL 3H3PH 5DVNA 2MKWA 2P48B 1NMCB 4PGEA 3LHPH 3TH2T 2HFEA 2NY7L 4G6KH 1UM6H 5IMKB 4FHBD 4WDIB 4ZNEE 1E6OL 5FO8B 3S9DB 1PY4A 2CK0H 1J86A 5D70L 4XNQB 3ULVE 4BELD 4YPGB 2HMID 5HYJE 1T7XA 3PP3H 1FIEA 4KZDL 5IHUL 3WN5B 2HFFA 4LASL 1AD0B 4JY6B 1HEZB 3MO1B 2XV6B 3MJ8B 3D1MC 4UQ2B 1KFAL 1MIEL 1WTLA 3ZL4L 5KSBE 3SO3B 3GSNH 3KLDA 5ITBH 2RR3A 3FQNB 5L6YL 3VWJC 1RURH 4N8CL 1MHHA 1TZGH 3L5HA 1ZLWK 3VG0H 2OYPA 2Y72A 3KG5A 3HZMB 2MCPL 1MEXH 5IB2A 3F6LA 1YDPB 2BY3A 1I8LA 5J13B 3DUSA 2V2WA 1EO5A 3NCJL 1WWCA 3IDXH 5KN5A 5DA4A 3KR3L 4JO3H 1DVFD 1QYGH 3DYPA 3QPXH 4X9GA 1CGYA 3P9WB 4Z0XA 3C6LC 4AEHL 5DA0B 4MNHA 1U8NB 2BY2A 2A9NL 4KKBC 4UUJB 2OZ4A 4CRPA 4LK4A 1TFHA 1IVLA 1OAXL 2Q7NA 2ZUQB 4HFUH 3UJIH 4QRSA 1HXYA 3R06A 5FYLE 4OLEA 3G5VA 4M1CC 4IDJL 1BPVA 1LDSA 2PW2B 2WWKT 5EUOE 4D2NA 4PTTB 1A3LH 2VDQH 4GW1B 3MJGX 3P30L 1EK3A 3W11D 4QOKD 5LCVL 2HWZH 5SX4H 4M8QA 4UTBL 1HKFA 1RIUL 2H9GB 2F53E 3RP1A 4WO4C 4KAQL 2DQTH 2ZSWB 1K2DA 2LTQB 4W68A 2W0KA 4LIQE 1Q9OB 3JVGC 1VSCA 4YGAB 5HDQH 3P9MA 2VRAA 5I76A 4UB0L 3F7YA 1UH4A 3DMMD 1MCWW 3G9VA 4NFCA 4XBEH 1RIHH 4ZUSA 1H8SA 2BOBA 4RFNB 4PRIA 5IVXF 4NZUL 5DO2D 3HI6H 1MAMH 1SM3H 3IXTA 4P2OA 2EH8L 3HPLB 1P53A 2HMIC 2V5MA 2VLRE 3S5LB 3U6RA 5J12B 4WGWB 1D6VL 1I3GH 2J7LA 1A14L 5EIVA 5C0FA 1WAAF 5INDB 3WHE1 3CVHL 3KPRD 1Y6KR 1AFVL 3GMPB 4WFFE 4Y5YC 4G9FB 5FKAB 1YMMD 4AQ1B 4IOIA 3GMRB 3MGTA 4LKCA 2VDOL 2DLEA 2DLGA 1M4KA 1A2YA 2VLJB 1R6VA 4OCRL 5FV1L 2CLVB 2CIIA 1CLZL 3PWLA 3IFOA 1ZVSA 5D1QD 4DZ8B 2YKLH 2FJFB 4O02L 4G80A 5K9JH 2DTSA 4URTB 4AMKH 5D7KE 1PKQE 1DVFC 3OR7B 1G6RH 1HHIA 4FTVA 1JFQH 4I77H 2VN4A 3V5DA 3G5ZA 4L4TE 5EH1A 2XN9E 1N5AB 3QFDA 4D0BB 2A38A 5MEOA 5E6IB 4U1HB 5DMJB 2EYTB 1WBXB 4Q6YA 2F15A 1C1EH 3VGEA 4NDMB 5AD0A 3MRIA 1JN6B 2HKFL 5LBSH 5M94B 1UJ3A 3WFHA 1BOYA 4MJ4A 5DQ9A 1RUPH 1QVOA 3HC4H 3S98A 4DGVH 4M93C 3SY0B 2HVKB 3WE6B 1VFUA 1NGZA 3GSQB 3OL2A 3W11C 2P8MB 4JFFA 3MCKB 4BFIA 2DLFL 3CZFA 3AS3A 3PG2A 4RSVA 1EEUA 4S2SA 5J1TC 4QNPE 5L0QC 1LO0L 4Z5RB 1D5BA 4NN5B 1I1YA 3V7MA 4O58H 1PQZB 4LP5A 3WLWD 4F15C 3QUZD 2OXGA 2AJVL 5EZLA 1JWSA 3I6LE 1HNFA 3DMMC 5A1AA 3D9AH 4Z7VF 4F37K 4LRNL 1INQA 1A0QH 4QGTA 3QH3B 2VZSA 3QO1A 1N64H 3VXSD 3WNPA 4EUPH 3N1MC 1IGTA 1YNKH 4JFEB 1A1MA 2F54D 4QXUH 1DE4A 2IF7A 4OZHF 1U8MA 3GO1H 2OP4L 5L8JB 3F12A 4BUGA 2NW3B 5FOJA 2R0WL 4QY8A 3TN0D 1B4RA 5C7XH 3BKJH 1T03H 3TBTB 4PV9A 3MRBB 4W70A 4FABH 3BDYH 4FQ1H 1YEEH 3GHEH 1Z3GH 1S9KC 1KENL 2W60A 3DX7B 4M43H 1JHKL 3T77B 1IGYB 1Z5LA 4U6XB 4L1DA 3U4BL 5D1QC 4N0CD 1LP9B 1CBVL 3FTGA 2AI0H 5L2KA 3T04D 2HG5A 3ARQA 3P0GB 3ZDYE 1FL5B 2BOCA 2HT4D 2YC1B 5HHNA 4KKCD 4MVBD 1U92B 3LEVL 2VR5A 4JHZA 1D5XB 2P47B 1TZHB 5DJYB 5T1MA 4JRXA 5L0QB 2PTVA 3GIVA 4FZ8L 5L2JB 5K9QI 3MRFB 1S8DB 3BP7B 4Q6IA 2IGFH 2H2SD 4OZFG 1A22B 2DQHH 2DWEB 3ZT6A 5E8DL 1RZJL 3QEGL 4KZEH 3I3DA 3FL7A 2CD0A 4MWFB 1A47A 5E2VL 1IEBB 2BVYA 4PJFA 5IFAH 4S1SH 3MV01 4HJGA 1NAKL 3L5IA 3DJ9A 5CCKL 4YDVB 1J1OL 4K7FB 4KHXH 4YXLH 3DHJA 3OSKA 2OTUA 3IDNB 1HH6A 2Q7YB 2BFVH 4ZPTA 4J7RA 3WLWC 3WDJA 4Q58C 3R0MA 4KHTL 1MCQA 4H0HB 2Q86B 3MV7E 1XF4A 2ERJC 1U8JA 3B8YA 1QFWL 4NP4L 5CWSB 5HHME 4N0UB 2Z35B 1E4XI 1MRCL 2G75B 2R2HB 3SKJL 5INCA 3WHE0 4MYWB 1FGVH 5GGVH 1ITBB 2AEIT 4BSWB 1T6WA 3MLUH 1AKJA 4J8RA 3SJVD 5EC2B 5F70A 5HY9A 3UMTA 1G7LB 3LN5A 3TN0C 1A5FH 3VXRA 4LSUH 3LZFL 4AIXA 3I85A 1CICD 1JTOA 1D5MA 2IADB 3FAXA 2NY6D 5HYJB 1QSZA 1TJGH 2QADD 4QGYA 3MXVH 2ADGB 3PWUB 1CXEA 4XBPB 4DVBA 5L7XL 1FIGH 3SDCA 1EAJA 1Q72H 1ZVHA 3C5SA 4K3EH 5CJXA 4CL7A 1WZ1L 4LKXA 5JIHA 1QBLH 1M7DB 5DJ2B 3VGAB 4N0CC 4M5ZH 2GUOA 3IT8D 2CUHA 4ODWB 2WBJA 2IWGA 4YHOL 1A6WL 3NPZB 3MOBL 2HT4C 3MA9H 4YBLC 5ADOH 3IAGC 4M7LT 4EBQH 4KKCC 2YPKA 4MVBC 4JREC 4K94H 3HNTH 4JGJA 5GSRB 1P4BL 4K2UL 3L6FA 1RJCA 3SCMD 1WISA 3HFML 4I2XA 5LGHL 4L8SB 5JOPE 2PR4L 5IJVB 4JPWH 1IILE 5KVDL 1QFUH 3RL1A 2H8PB 3NACH 4UT6H 2V7NA 5IP4A 3QUZB 1D6EA 4Y8DC 4G8EA 5E8EA 1EEYB 1LDPH 4WY7H 4LCCC 1EJ6A 2GJ6A 2H2SC 4IM8A 4JFZL 4NO3A 5EU6E 3OX8B 3VG9B 3WLBB 4XPAL 1FO0B 5JPMA 1R5VA 4KJPD 1Q9KB 1BHGA 1KPRA 4YK4C 1NCTA 4X6CA 4U4BA 2PXYB 5IW3A 1E4KA 5AUMB 2B20A 3H9SE 3G08A 1A7QL 3BJ91 2EDLA 3SOBL 1YQVL 1S78D 5IEHB 1AGFA 3EFDH 3QI9A 5EORL 4MNGB 3V8CA 2P43B 3QO0A 1M71B 3IJSA 4OLWH 5GPRA 4Q97A 5IQ7H 2ZUXA 5EUOB 3D69A 4JHWH 2NY5H 4GRWE 3R1GH 1FNSL 2C3VA 4HC1L 3O11B 3MMEA 1J5OH 3PXJA 1RD6A 2PCPB 3PNWA 1HDMB 3H0TA 2PW1A 4QRTA 2HN7A 3QG6A 3LS4L 2G9HB 2DIAA 5E6ZA 1F3JB 1U8OB 3O9WA 1N8ZA 1WITA 2DQDL 4QRPD 3MV9E 1Q0XH 1B2WL 4GKSA 3WS3B 1T1WB 4TTDD 4PREB 5C0GA 1S5HA 3IAPA 1YZZA 4UT9L 1QFWM 1T7ZA 4ZFFA 4KDVA 4LGSB 3CLEL 3D2UA 2Q8BH 1HINH 3UX9B 1MJUL 5GHWL 5A16B 1CICC 5H35B 5MENA 4MJ2A 1GYAA 2RAMA 5TDPB 2NY6C 4PRBB 2QADC 3LN4A 4NWTH 3P9LA 4Z7UB 2DDQL 4M1GH 3M8OH 5AAMA 5CZVL 2DICA 4XZUA 1DUZA 4UINL 2VH5L 1G9NL 1CDBA 3EGSB 1A7NH 2ATPB 3Q1SL 4BSJA 1TQBB 4N5UA 1B0RA 2A73B 4QRRD 3OMZA 5TF1L 1W0VB 4X6BA 4HFWA 1X5AA 3QJHB 4LLWB 4AH2B 1G7QB 4NNPH 3RIFF 1MFNA 3MRQB 2OR8A 3BP4A 1EV2E 3OKNA 1S9VB 2ATKA 3SCMC 4UNUA 2VDLH 2XT1B 5HHQA 1UWXH 2FBJH 4C54A 1T5XB 3MXWH 2AEQH 3U36B 4FN0A 2DL9A 1AR1C 5CSZA 4P5KB 5JUEL 2EIZA 2OK0H 4WHTB 1ZTXL 1XF3A 5I1IH 3D87B 4PBWD 2P8PA 2EEBA 1YMHA 2XN9B 4P0DA 4HZLA 2AXHA 4KJPC 1CXKA 3QZWA 1PEWA 4PIRF 5IB1A 4Y89A 1A7OL 5KSUA 3C5ZA 4XMLH 4WI6A 4IRZL 3OJDB 1S78C 4LQFH 5DHVH 3GSOA 2BSSB 2ENYA 1D5IH 4WEBH 2A1WL 3RFZC 1LEIA 4HXBL 4Z0BL 3O6FA 4K3HA 2OL3L 1DSFH 4ZFOB 5HI5D 3UJTL 4UTAH 1QR1A 3FQRB 4JB9H 1X5JA 4PRPA 5B39B 5TJWK 5E00A 5J6HB 1R5IB 3QDGA 1QFHA 5H94A 3IDIB 3RA7H 4JQIH 1UH2A 3F62A 3AM8C 3QIWD 4TTDC 1OP5H 4HUNB 5I2IA 4LLDA 4FFVD 3TVMD 5IMLB 1G7PB 1FH5L 4OFVA 2VYRE 5FKPA 1KJVB 1I7TA 3BP5A 4FP8L 1JPST 3SQOH 1HSAA 4QHLB 1KXQE 3VXMD 2AK4A 4HWNA 3W5MA 4OKVA 4JZJB 4G8FA 1J8HA 4FFWD 5IMOB 4QT5B 4M48H 1NCDH 4XCNA 3DVFA 2YWZA 1Z2KA 2J6EH 3GSNB 4YDJA 25C8L 3K8KA 5D1XD 1I85C 5C0AE 3RY5A 2J8UE 3OTTA 2BNUA 3STZB 3MV8A 1EHAA 4X0KA 3P0YH 4UIKH 4HCRA 4M7ZB 1KJMB 3CUPB 3KYOA 3SE9L 4ZMAT 1U8HA 1G0YR 1I9EA 1H3VA 5CBEB 3FAWA 4H5SB 1FFPB 2BNQA 2VN7A 1T5WB 2E3VA 4MA3A 2W65A 4D8PB 4WW2C 3W0WD 4PG2A 4YAQA 2BXYA 4M7JH 5GRYA 3FB8B 4GXUN 5KG9A 3QISA 1RU9L 2PYEA 3ARVA 4ENED 3C60D 4TSCH 2AJSH 4O2EA 4CVWA 1YJDC 4H26A 4P2YA 1FGNH 4W4OC 4PJFF 1JHLL 1S7QB 1MCHA 3PHOB 1K4CA 1TQCB 1C5DB 4HS3B 1WEJL 3GB7A 1BVLB 3WEXB 2AS5M 1ADQL 3TJEH 1WBYA 1CZ8H 1TJIL 3O8XA 1B0GB 4F80A 4ZUTB 3U0PB 1EUTA 3DIFA 4N9GB 1UCBH 1YEKH 1KEGL 5EWIL 4LGPB 2R0ZL 1NGYB 1DANT 5HDBE 3JWOC 3H9YA 5DI8A 3LRHA 1F6LL 3UPCA 3DBXB 3OKMB 5ERWB 2R2BA 4L9LC 2R0KH 4LF3B 1IKFL 2YUVA 2FJGA 5HI5C 1F58H 4ZUUA 4WUKL 2VLKD 2NNAB 5HJ3B 4YHLL 1E27B 1UG9A 2ARJQ 2Z8VC 3SO5A 4YGVA 4QTIH 3DVIA 5FA4A 5CP7B 3N1FC 2YXMA 2EEDA 1UXWA 1P7QD 3QIWC 3D3VE 1HXMB 1XGQB 2AXFB 5MP6L 2JE8A 2UVEA 3QEQA 2N7AA 5E2TL 3E6HA 4LCIH 4M7LL 4FFVC 3LS5L 3U1SH 5HHPA 3TVMC 4YHPA 4M9OA 4KH2A 3VFNA 3NFSH 4QRRB 4X4ME 1MRFH 4JM4H 3D6GA 1BX2A 5HHMB 2NXYD 1I1RA 1NGPL 1KLGA 4KVNH 3L3GA 1SQ2N 3FMGL 5DEFB 4RZCA 1HN1A 1ROWA 4PUBH 3RAJL 3VFVB 1NAMH 2P8LB 3HG1E 2R2EA 4FFWC 5EU7C 4G6FD 4PJDF 4F7MB 5F7MC 2GK0A 1IQDB 5JXAL 3SBWC 3JV6A 4JHAH 5F9JB 2PYFB 3BUYA 4OF0A 2I07A 1NCNA 3KPQB 1HNGA 4RFEB 1VDGA 2V2TB 1N26A 2EKSB 2VISB 1N0XL 4JPVL 4XP9H 1IRAY 1CGUA 2QSVA 4JAMB 1FZMA 3PP3K 3O41B 4OF3A 1BQUA 5EU4A 4O00A 4O4YL 1A6VL 2H41A 4IIQA 4MJ5A 1WUNT 1C5BH 1G6RB 3EOTL 4X4YB 4PRHE 1FPTH 4NKOB 5GGTL 4HBQA 4RFOL 4R4BA 4TSAL 4ENEC 1KCRL 3C60C 1K5NB 5I0ZA 3OKOA 4OSUL 4LSTH 4X6CF 5DGRA 1KBGH 2RCSH 2YEZB 1NFIA 1QFOA 2JK5B 3MLXL 4GJTB 4LSSH 3PWPD 5DD6B 5FM4A 1DBAH 2B1AH 4Q0XL 4RGOL 3VW3H 5D6CB 3UTPD 1CD1A 1T0MB 3MZGB 4WUUD 2D9CA 4Y4FC 3HRZB 5DRZB 4S1RH 2ZUTA 1R0AH 1ZHBA 1XGRB 3T65A 4DN3H 4OV5B 3B9KA 2APVA 3MBED 3L95B 1INDL 2BSTB 5EU6B 3SDYH 4CKVX 3NCBB 3QHTC 3EO1A 3TZVD 1HSBB 3AB0C 2X2YA 2C4FT 3MJ9L 4JO4H 3RWGA 4NNYA 4DKDC 3H9SB 4JFOB 1KV3A 3IS0X 1IGJA 4ODUB 3DLQR 3UYOD 4Y7MA 1WQVT 3C9NA 1JV5A 1VEMA 4GRWB 5F97E 5D1XB 1DBKL 3BAEL 3BEVB 4JPIA 4NHUB 4MNQB 1BIIA 1XIWD 4EUPB 3BE1H 3DARA 3WO3B 3W9DB 2DMCA 2NXYC 4JY4A 4G8GE 4WWKB 4F7CB 3HZKA 3HMXH 1U95B 3LSOA 3MV9B 4QF1B 1MI5D 2ZNWA 4LLVB 5DD3L 3RGVD 3T4AA 3VD9A 1CLCA 5CEXA 1H3PL 2GTWB 4NBZB 1ACYH 2A6JA 1HILA 1AHWC 2YD6A 1ZLUK 1ORQA 2WINB 3IFPA 4RDQG 1TTFA 5T1LB 3CDGA 1ED3B 1QSFD 3GBLA 5DDHB 2IH1A 2BNRD 1BD2E 4XB8A 4U1JB 1EO8H 4NQDE 4ZS6D 1U93B 1QA9B 2QQLH 1ZA3B 5BVPH 3S5LG 4GW5B 5ICXA 4K3DH 2IBZX 5E5MB 1AGDA 4Z7WA 1A9BA 1GGCH 1G7IB 2FRGP 2VDML 2X9YA 2XQBH 1R5WB 4JQXA 3BW9B 4ZFZA 2YZ1A 1CD8A 1ZK9A 3DRTB 4K23H 5IESH 1OAZH 4HIIA 1LO3L 3K46A 5GGRA 1KTLB 3N85H 5FB8B 1FE8H 3DV4B 4M1DH 4HUVA 4ZS7L 5DR5H 3G5XA 5FCSH 3WFCL 4BFGA 3SGDH 5I73C 2I25N 5GJTH 1AQKL 5ESQA 1WAAE 1IM3B 1RVFH 4TULL 4LVOB 1J1XL 2VMFA 1JPSL 1JPTL 1VPOL 3MODL 4XNYH 1Q38A 1P7QB 4NN6B 4DOHE 2N7BA 2O5XH 3MBEC 4JFQB 4PBVC 3D39E 3QDMA 1GPOL 5IHLB 4KQ4L 1BQLL 5FDYA 3TZVC 1CFBA 3BRGC 3L3IA 3SE3A 2E7CA 3P4MB 1NL0L 3DVGB 1G1YA 2FO4A 1T4KA 4HKBB 1N3NA 4GAJL 3QDJD 2R23A 2X5PA 5I8EA 1LGVA 1S7XA 1JF1A 1QFPA 5L8LB 1MCIA 1P2CA 5IJKA 4OCLC 3HI5L 1UACL 2GAZB 3QT2A 4ISVB 4OIIH 4YUEH 3BH9A 1OPGH 2D4FA 3NTCL 4NO5A 3RPKA 2H6PA 1MAJA 3ARBB 1EAPB 3O4LA 4U1NA 3EFFB 4ZPVA 4ZAKD 2OZ4H 4GBXD 2QSTA 5TE4H 4X6DA 1T04A 2Z0BA 4F9LC 1KCLA 1DFBL 5T33H 1MCSA 3RGVC 35C8H 4OT1L 5C08A 1MJJA 2DYPD 3OKDB 3QHZH 2YR3A 1MCKA 1W0WA 3A6BL 4R4FL 2FEEI 3I2CH 3QUKB 5IB3B 1CXFA 2WBKA 3EBAA 4KTEL 3NAAL 4XWGL 4ELKA 5CBAA 1KC5H 1QBMH 3MNWB 5DF0A 1TNNA 5EFIB 3VWKB 4ZS6C 3T2NL 1C16A 1J0IA 2X4OB 5DK3A 5I8CB 4WUUB 2WQRA 5BO1L 1R3HA 2YBRB 3INUL 3AXLA 5C0AB 3FOMA 1TVBA 3BWAA 4HUUB 2P24B 4ORGB 4UV7H 3RUGE 3G6AA 3SKMB 2XKUA 3BKML 1HCVA 3SGEI 3FRPA 1BFVL 1I7UA 1V7NH 4YHIA 1T3FA 4MX7A 2ESVA 5CHNA 3KJ4C 3GHBL 3QFJE 1DL7L 2R2CA 3ZYZA 5J57B 2O93L 1BREA 1LWRA 3CCHA 4GRLD 1A8JH 3ETBF 1CFQA 4P5TA 4LHUD 4E9LA 5E9DA 2ZG1A 3FQWA 3EAKA 3ARYA 4PP2B 4L5FL 1BGXH 2A77L 2C7UA 4FFYH 5FGBC 3IAQA 1T2QH 1QQDA 3WFZA 3IDMA 2FJHB 1LHZA 3S37L 1DUYA 4UMGA 4PLKC 3ZMRA 2BX5A 4ALAL 2NY2D 2CLRB 4PJAA 4R96B 1P6FA 3AREA 1XIWB 4HMDA 1A7BA 4TOYH 1EFQA 3UTTA 5SWSD 3F7RA 5L88L 5JPNB 1KJ2L 5KS9E 2MKLC 3RJQB 5I75C 4HIJA 2LU3A 1UVQB 3VDAA 2QQKH 2EYSA 4XCEA 4XNZC 5EUKA 1G7HA 1K8IB 1YNTB 4X7TB 1NDMB 4GAYB 3CFJA 2FH8A 5FXCH 3FT3A 2X4TB 4X5XA 3HUJA 4GBXC 3ME0A 3UBXI 4PJ7B 1OW0A 4CVUA 5E8OB 4EQ2A 4DTGH 1CCZA 4LNRA 2DI8A 3PWNB 3L3HA 3IETB 2ICWI 4NSKA 4H25B 3CDCA 1A7PL 1EZVY 2ZG2A 4JM2B 3CSPA 3BPCB 5BQ7B 3E2HB 5DLMH 3OZ9L 1JYXA 3CMOL 4D3CH 4Y4HD 3RDTB 4X6FA 2G5BA 5C07E 4PLJD 4HIXL 5GQBA 1UWEL 3HG1B 1T0PB 2X1PA 4LVHC 3CU1A 3TIEB 2NLJB 4PGZA 3RNQB 3TBWA 5CJOH 5I74B 3GRWL 4CU6A 3WJLA 3EOBB 4MJIE 5C0BD 3DROB 4FXKA 5T3XL 2WUCL 1OGTA 3BGMB 4PGCA 4AENA 1WJ3A 4PJGE 2J5LB 1I7RB 4LCWB 4PJBA 3QUXA 3KLAA 4G43A 4LPVA 3ZT5A 1T1ZB 1MCNA 2X4PB 4U6YA 4LSQH 2ICES 4GRLC 1N59B 4KMTH 4RRPG 1F90L 4NC0B 5EOTB 3DVNA 3J8F7 3OGCA 4MLSA 4PRHB 1JZ8A 1LK3H 4FQHB 1H3TA 4WU7B 3T0WA 4NO0B 5JQ6L 5C09D 5ACZA 1CGSL 3A6OA 2M26A 5CEZD 4YXKL 2YPLD 2YA2A 1ZHLA 2VZ1A 1OT1A 4RMRA 1S9XA 2NY2C 4ZAKB 1IAIL 2A2QT 3C5JA 2CMRH 3VMOA 4CW1B 4JRWA 4WV1A 1AI1L 4X5WA 4PD4K 4RA0C 3HE6A 5DS8A 4YWGL 4M61B 4PJXA 5FYKU 3I50L 2IPKB 3QNZB 3NOIA 4HMCA 3BHBB 4HC1A 4PRDB 5DJ8A 5C0EA 1U0QA 3HS0A 3SDDD 1FLTX 1U8LA 2FIKB 1FV1A 3CFDA 4HPOH 4NJAH 1S7RA 1CN4A 2DJSA 3L9RB 1XGYH 1JF6A 3NZHH 4M8VA 4I1NB 2FDBP 4XVTH 2OI9C 1UM6L 2E7LC 1F4XH 2CK0L 4TUKH 1J05B 5LXGL 1T6VN 3LDBB 2Y36H 5KVEH 2C1PB 3F7VA 2D4DA 1G1CA 2BY0A 4HWEH 4XCFL 4JN1H 4JFDA 4OCXL 5K9KB 4JJ5B 5DK0A 5SWQA 5F44A 2CLZB 3BKCH 3QQNA 3G6DH 5HBBA 4LSVH 4LLQB 3FOLA 4Y4HC 3TH4T 4LMQI 3SGJA 4PLJC 1MLBB 3RBGA 1JUFA 4OLXL 4Z7WF 5KVMC 2GCYA 1RURL 2C1OB 4Q9RL 5ICZB 4EVNA 3VG0L 1X44A 4HEPG 4V1DA 4HS8L 1BJMA 3Q6GL 1FRGL 4PRIE 4ETQA 5C9JA 1FCGA 4NZJA 3SEPA 1JNNH 5EPMB 3O3DA 3LQAC 4E5XB 1BD2B 4NQDB 3L5WB 1RMFL 4UDUA 4P9HH 3MLPA 3HAEA 4MD0A 1F4YL 3C08H 4XC3L 1GGIL 3MROB 4LLYA 4UQ3B 4EN3D 5DJCB 3WD5L 1MUJA 4XI5D 3T08A 2VC2H 4P2RD 3MRDB 4HFUL 5IVXB 3BT2L 2ICEB 1U8KA 4AM0B 1W72H 2VITA 5K9OA 2VDQL 3BEWA 1HI6B 2YD9A 3LKOB 1J12A 2IH3B 5C9KA 1UWXK 1CFNA 5FO7B 4LDEB 2HWZL 4OM0L 2VAAA 4HDIB 3T8XA 3QJFA 4NHCH 1ZWIA 1AXTL 4FTVE 4DOHB 1ZHNA 4GMSH 4KK6D 3D39B 2OL3A 1Z0NA 2OJZL 4QO1A 1IAIM 2AEWA 3SDDC 5DRNB 4O2FB 1UWGH 4PJ9D 2WMPA 2FHCA 1F3DH 4M4RA 1D3CA 4E0RB 4EI5B 5HYFA 4IMLB 4X6DF 3GMOB 4IRJD 1MHCB 1F4WH 3EYUL 3WXVH 3HI6L 3BDBA 5ITFB 3K8MA 1SM3L 1YEIL 1ODAA 4QXTA 4F2MA 1TPXC 2F8XC 2IAND 1MVUB 1P4LA 2VZVA 3I75B 4G6AD 4RAVA 5C0BB 5CEYA 4JFFE 5A40E 3JBG7 2DL2A 5ALBL 1CD9B 1AJ7L 2W59A 2B4CH 1YUHB 4JVUA 4Y2DD 2R1XA 3AU1A 4KXZH 2X4UB 4P4RB 4H8WH 4RGNE 1NAMB 4ODBD 4XP5H 4M00A 2NTSP 3W2DL 5J1AA 2WZPD 5DEGA 1QRKA 3WXWH 5I17B 1AE6H 2YOCA 1MNUL 5A2IH 1YJDL 3IVKA 2YSSA 1X4YA 2EDHA 4JY5L 4D0CA 3VGHA 2DQEL 3P77B 3MCG1 4GLRH 5C6WH 5IR1A 5JXED 5IWLA 5HGHB 5E7FA 5DYOB 2YKLL 3BVNB 5E2WH 3MNVB 4AMKL 1JWMB 2JB6B 1S9YA 4YE4H 2XKSA 4MCZB 2WIMA 1DBBL 5F7EL 3H7LA 3TF7C 4I77L 3JWOL 1KIPA 2YK1H 4XMPH 2IFFL 5T3ZH 2DJ4A 3FN3A 4DCQA 4ONFH 4Y4KB 3WNOA 2IPTH 1NBVL 5MEPB 4XTRD 4XI5C 2V5TA 4XCYA 1X3DA 3LKQA 4OM1H 5DXWA 4YR6A 1KELH 3EYQC 1C1EL 1GOGA 4UIMB 5GXBB 1M05A 4N68A 1FVDB 1LK2A 3OV6A 4G5ZH 2C4XA 4MQ7A 4K7PX 1MLCB 1NGXA 1ADQA 3PGFL 3HC4L 2YHGA 3EDKA 3MRNB 4OZHB 3DECA 1TCMA 1NBZB 4RGMB 5DD1H 1AH1A 2E9WA 1OHQA 1CTOA 3G9AB 1XEDA 1MFEL 5EG6C 5C0CA 4RNRA 3S3JA 3FQUA 1TPXB 2DN7A 3O3AB 1IBGL 1O5DT 1CDHA 4KK6C 2ADIB 1WBZB 1HCFX 1R3IL 4EDXA 1OCWH 1FAIL 4HT1H 4HV8B 1KGCE 4JRXE 4PJ9C 3HUJF 2E27L 1IZJA 4PJEE 2Z8RA 5DRXB 2VXTL 3VCLA 5I8OH 3VWJA 4MHHG 4AEFA 5ISZD 1KCSH 3FHAA 4K8RH 3RI5K 1A0QL 4IRJC 3QYCA 1N64L 4HKXA 1KIUA 1BVKA 3GMQB 3IJYB 1NUDA 1QHPA 3MUHL 4WFHD 6FABH 5IW6B 4FZEH 4G6AC 4KJYB 3UXFA 1UM5H 4PJFE 4AG4L 3PV6A 5JR1H 5GIRA 1PG7L 1N4XL 3CK0L 4AIOA 4Y2DC 3SE8L 4JDZB 3HCVA 3BKJL 5C7XL 2OR9H 1T03L 3C6LA 4EN3B 1BFOA 5T5NG 2VDRH 4FQ1L 4BH8A 2LU7A 2YWYA 4R7DA 1EHNA 3B2VH 1LEGA 5JQHC 4WEUD 4XPBH 3V6ZB 3X12A 1FNAA 5JXEC 1N5YL 1HK6A 1FAKT 2YD5A 3QULA 1TZIA 4PJBF 3V4PL 3BZFA 3KAAA 5E8NA 4YQXL 4OTXL 5F8RC 5CFHA 4PGEB 1NGQL 2HFEB 1FG2A 1RJLA 5DMIL 2DQGH 5GGTA 1J88A 4DKEH 4WO4A 2CDEA 1SMOA 3VXRE 3GK8L 3JVGA 1OSPH 5J8OA 1KYOJ 2HFFB 5AEAA 4KDTC 2MCG1 3GIZH 1FNGA 5TDNA 4PJXF 3SY0A 4NQEA 3MZTA 3F7QA 1VGKA 4GXVH 5IFAL 5I1LA 1XMWA 4KV5E 4O51A 3FT2A 3HA0A 3DO7A 3TWCH 1WFNA 5I8KL 1MHHB 2W9EL 3MJ9A 1VKXA 2BVPA 1RZ7H 1F97A 2DRUA 4BUHA 5IB2B 1JMZA 3DUSB 5FUZL 3MRPA 2V2WB 4Y5YA 3U7WH 3QEUA 5KN5B 1NUGA 1A4KA 2UZXB 1OP3H 1ZLSH 1Z9SA 1V7MH 4AL8H 4RBPK 4RMUA 3H3KA 5HVHC 2VIRA 3LN9A 2GJ6E 2ID5A 3BIBX 2EYRA 4Z0XB 5KAQF 5GGVL 2HFTA 4MNHB 3S96A 1B0WA 2EXWC 3FCTA 3MNZA 2ZJSH 4DGIH 4ODHH 5FYJL 3TYFA 1DVFA 4ODVH 4WJ5A 4QWWD 4RA3A 1TNMA 4LCUA 3N50A 1E0OB 4QRSB 1HXYB 3R06B 3ELAT 1C08A 1TDQA 1ZKAA 3AAZA 3G5VB 1J0YA 2OR7A 2X89D 2V9TA 1TJGL 1J0ZA 1OB1A 3MLTA 3EYSH 3TCXA 2YN5A 4Z7OE 3TIDA 4EUPG 4M8QB 4YHYB 2BRRH 2EC8A 4RISH 1QBLL 5IBLD 4YDLC 4UAOC 1SEQL 5LWYH 1K2DB 4UZGA 3CFCH 1P5VA 3QXAA 2OQJA 1OAYL 3P9MB 5I76B 3F7YB 2DQJL 3H9ZA 2NY7H 1O0VA 4QOKA 5IM7A 2FNBA 1E6OH 4ZUSB 2F9BT 2BOBB 4PRIB 4QKXB 2CRMA 3T3ME 5DURB 5D70H 5AG8A 2CXKA 3IXTB 4P2OB 5MENE 3MV7D 3MTRA 5IHUH 5I15L 2OCFD 3NACL 1D7FA 4ESKA 4JZOA 5JW4R 4DW2L 3FQTA 1DQQA 4CMHC 4HWBL 2A6KA 3U6RB 3DMMA 3ZE0F 5C0FB 3WMSA 1KFAH 1MIEH 2IBBA 2ED9A 1SEBA 4IOIB 2EDXA 2V5SA 3MGTB 3MLWH 4LKCB 3T4YA 2B5IB 2JJWA 1A2YB 3SE4C 1VACA 1XF1A 4NBYB 3QUYD 2B2XH 2VL4A 4R2GD 2CIIB 1TENA 3PWLB 4KI5D 1AKJD 3IFOB 4JHWL 1ZVSB 3KPRA 3R1GL 3NCJH 4G80B 2Q86A 1YMMA 3KR3H 1V3LA 1U58A 3S37X 4X7SH 1HHIB 2G75A 4FTVB 4DAGL 3V5DB 3G5ZB 3MC0A 4JJHA 4AEHH 3ILQD 3VU2A 5D1QA 1Q0XL 4I4WA 3QFDB