1AY1H

Anti taq fab tp7
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
213
structure length
213
Chain Sequence
EVQLQESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords TP7 FAB
publication title Structural studies on an inhibitory antibody against Thermus aquaticus DNA polymerase suggest mode of inhibition.
pubmed doi rcsb
total genus 35
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1997-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ay1H02
1NUFA 2E6PA 2IH3A 4FQJL 1PSKH 5IQ7L 4HKBA 4HBCL 3TM6A 3V4VL 3VFNA 4ELMF 4OF7A 2DQIH 2D7MA 4ODUB 1YEFH 3ZZ1A 5HHOA 1YMMA 2BNQB 3BISA 1AC6A 4M5YH 3QQ4A 2AJ3B 3IXTA 3MX0A 1SBSH 4JM2F 3KGRA 5HYIA 1S5IH 4KI5F 1ZSDB 5FO7A 1MHCB 3UO1H 1RUKH 5IB3A 4HPOL 1J0KA 4XTRC 3NZ8A 1AC0A 4NDMA 4K23H 5IJKC 5IMLA 1AE6L 3T8XB 4EN3B 1UZ8A 2F53A 2NZIA 5E08L 1ZT7B 2A6IB 4OQTA 5DRXA 3OKKA 3RWGA 1PYWB 3IJHB 1S8DA 2AGJH 3IVKA 4AMKL 1MAKA 1IM9D 2Z91B 3AXLB 3HNVL 5JMOC 3HNTH 4UT6L 3W9DB 3EBAA 4J4PA 1KIRB 3ZKMC 2F74A 1LMKA 1A7PL 2J4WH 3FCTB 3PQYA 4JY5L 4QRSB 1KPUA 2W0FB 2YD2A 3SJVD 4EI5A 2AS5M 3MRDA 5CD3B 3C2AL 5FYJL 5HPOA 5GHWL 2NY0B 3T0EA 3FT3B 4ODXB 2HVJA 2O61A 1HINL 1T89A 5FDYA 5I75C 1QLRA 2VL4A 3ZDYF 2HA1A 1CICC 2Z31C 3EO0A 3GO1L 5HHPA 1JI1A 2H2PC 4GW5B 5DQDL 1KCLA 5HYJB 2OZ4H 2QQLH 5GGTA 1UENA 5D5MF 2CKBA 3HZVB 3BHBB 3UC0L 4IS6B 3KLHC 2HG5B 1UJ3C 1HZHL 2F8XC 2DQCL 3TBSA 3MZTA 4RGNB 4JHAH 5TFSL 4QHNB 5AD0A 4JO4H 4TPRH 2X4SB 1KPRB 3QCUL 3CFCL 1MJ8L 1F3JB 1KLGB 2HFEA 1IKFL 1MFNA 1DVFB 3ARDA 3WXWH 1QRNE 2NY6B 4UUJA 3PABA 4XPHL 4JFFE 4U4BA 4KJWD 1G7MB 2IADB 3LHPL 1EGJA 4R8WH 3PHQB 4HDIA 1DDHB 2B4CL 4H1LH 5J6GA 4TUJA 5HI4C 4DWHA 4R4FH 4I4WA 3L3OA 4OAWA 1PAMA 3S35L 5HHVL 1WEJL 1DN0A 3MROA 1HWGB 4TSAL 5CJQL 4QOKE 3EGSB 3ZYIA 3O4OC 4PLNC 3QUMB 2P47B 3F12A 4X6BB 1AGBB 2CGRL 5BW7A 3TBVA 4K2UH 3GSWA 5FOBB 5T3ZE 3MV11 3D0VB 5HGDB 1PKQE 3SDCC 4XB7A 4M00A 1D5ZB 1T20A 3L3JA 1Z3GL 2UVEA 1S9VA 5IGXH 4Y1AD 4JANB 3VWKC 3PGCA 4HIIA 2PXYC 4WUKL 5JNYB 3GB7A 3FTGA 3DV6A 35C8L 4XBPB 3ES6B 4JJ5B 3O3EB 2P5WE 5HTSA 5EORH 4ZNEA 3GKWH 4WGWB 3VXRE 3SCMC 1JCKA 2P5EE 2PTTA 2AABL 5EIVA 4PGEA 1VGKB 3LQZB 5DMJB 4U31A 1SMAA 2NY6D 4NT6B 2BHUA 1IAOA 4L8BA 3ZKXC 4XP6L 4M03A 4N0YL 4M1DL 1V3LA 1RVFH 3QUXD 2GTWB 3UEZA 4G6FD 2NX5D 2VZVA 3GSNH 4YPJA 4X98B 4KUZL 3P4MA 4X9GA 5E5MA 1B0GA 1U8IB 3CFJB 4ALAL 4HV8A 1C1EH 3OXSA 4LASL 2WQ8A 1JWUB 1N3NB 2IF7A 3UTTB 4B53A 2ED9A 1U2CA 1WZKA 1W0WA 4Z95L 4I18C 4RNRB 4U6XA 4RFOL 1U3HA 3T2OA 5HYQB 1KACB 3JUZA 4JZNB 1GGUA 1BWMA 1F4YL 3E6FA 1GCFA 5J11C 1JRHH 4KMTL 5FUOH 5D6DA 2NXYB 2AJSL 3P77A 4UINH 2NMSA 1ZANH 3A67L 4OLUH 5I17A 2E9IA 3AREC 3KYOA 3JV4A 4KRPC 4W4NA 4U33A 1QRNB 3QIBB 5ERWB 1I7UB 1IJ9A 4JFFB 4KY1H 1ZEAH 5SWSB 5DK2B 4X6DE 2HKFL 1FNFA 3TIEB 1CFNA 2ILLA 1BGXH 3TV3H 4U6YB 4HGWA 3GHBL 2ADGB 3GKZA 4X7EC 1ACZA 3MGOB 1RUAL 2B0SL 2B1AH 3QIWC 5K33A 1JRHI 1S3KL 1A3RH 3DX7A 1K2DA 3W2DL 4QOKB 1TMCB 5FM8A 3RVXC 2AXGA 5FF6B 3MV9D 5I19H 1CT8A 2R15A 3U7YL 4GXVL 1ED3A 3P0VH 4L8CA 1PKQB 5E5RB 2BFVL 1AR1C 2RBLA 3IFLL 2QADD 4KDTA 2C1PB 5L6YH 3B6SB 5IUSA 3DO7B 2EZ0D 2RHEA 5KW9H 1FVEA 2IPUK 3V0VA 2A73A 5E2TH 5HHNB 1NCAL 1T3FB 4J1UB 1TQBC 1UVQA 1OTTC 3I3BA 3TT3H 2Q3AA 4DGVL 2X1PA 2P5WB 1RUQH 4H8WL 1VKXA 3U0WL 3G08B 3VXRB 2R29H 1MRDL 1X5FA 2ZPKL 5I8CA 3QUML 1RJCA 2EYRA 3RUGE 3V6FA 2XA8L 2ZG2A 2PETA 4MAYD 5J0BA 4IRZL 2NR6D 5EO9A 1YN7B 2GJZB 3BP6A 1AXIB 1YEIH 2R0KH 4YXHH 2BXYA 5JW4M 5I1DB 1I85A 2DQEH 4WI4A 1HHJA 1T6WA 3K8MA 1OWWA 4W6XB 2W9EL 1JWSB 1VEOA 4QOKD 3L3DB 5IEKB 3BKJL 4R6UA 4K8RD 4KZDH 1EZVY 4F15C 1G7LB 3UJJH 2AXFB 3QEQD 1WICA 4O02L 4YQXL 1MH5A 3GJFH 4ZDHA 1OAXL 4ONGH 3V5DA 4QT5A 5A1AA 3IU4L 3C9NB 1Y0LB 1IBGL 2CR6A 2WLZA 1I1CA 1ZA6A 1RURH 3CFDA 3IDMA 4NQXB 1KBGH 2ZUVA 2I60H 5KJRL 1DBAH 3D85D 4PS4H 4DN4H 5GS0C 1K4CA 1OD9A 1R5VB 43C9A 1WIUA 2WIIB 4Z76A 3I6KB 4N0FB 2P5ED 3I50L 3PNWA 2EH7H 3IB4A 2CXGA 5LWYL 4NWUH 5DFVC 1MCRA 2X4NA 3HE7C 4WWKC 5IWLC 5DGRA 4X6DB 3V7AG 3K2UH 3UTSA 3ARFD 3VFMA 3T08A 2Z35B 4LLQB 4P46A 4QCIB 1V7NL 4PJFF 3GZKA 3KPLB 5BCAA 4NN6B 3BE1H 5IBLC 3JWDC 3L7FB 4RRPG 3UZVB 2PTVA 4JREB 4EEEA 1A6WL 4UILL 4JPKL 4OJFL 1FNGB 1N4XH 5FM5O 3VXQB 2VH5L 4MXWH 1OSZA 2DBJA 4XPBL 1CDBA 1J0HA 2J8UA 4G6MH 4DEPB 4MD0B 5ICZB 3ZKMD 1DQJB 4XC3L 4V2BA 3OJVC 1OLZA 3OAUL 4JN1H 1MLBB 1ZS8A 4XXDB 3U7WH 3QFJE 4Z0BH 1CDHA 2VDLH 1AP2B 3MJ9H 1VB9A 3LKSB 5AG9A 3RX8A 3MLYL 1MPAL 2F8OA 5DMKA 4X80L 1KJMA 3GSVA 3JVGC 2AP2A 3I9GL 5IHUH 2A74A 4NNPL 3EYSL 1CS6A 4NO0B 2F19L 2PYED 2D4FA 4KJPC 1FVDB 3EO9L 4PBXA 4KRLB 2EH8H 3BEWA 3RUGB 3W11C 3KLHD 1A3LH 4WGVB 4WO4A 2HJFB 3H3KA 5FGBA 4OCXH 5J89A 5T3ZL 3WKMH 3QI9C 1HI6A 5K93A 3G6AB 4U6VL 3NFPB 2GTZB 2DQGL 4JFEA 3G6DH 3MBEA 3Q2CA 4PB9H 4D0BA 3G6JE 1QOKA 2A6KB 2ZSVB 5EU3A 1IAKB 4LK4A 3MV7A 4LCYA 3U4EA 4GBXA 4POYA 2IGFH 3VJ6A 2GY7B 3QFDA 2OTUA 4R2GB 5DRWB 1H5BC 3GSRB 4WW2B 5E5UB 5BV7B 2AJXH 4P23A 2Q7NA 1HYSD 2MFNA 4C56E 3ECBB 3FFCB 3QH3B 2AV1B 1MCQA 3LS4H 1CK0H 3VWJC 2RIKA 4M6OH 5DZNA 5DUMH 5E6IA 5JDSB 4OCSH 3D0LB 4DK3A 4PRPA 4JRXE 1CQKA 2C9AA 4M6MH 2VDPH 1BFVL 4EDWL 1M71B 5HGGS 4APQA 1I75A 3SDCD 5I73C 4KTYA 3BW9A 2VC2H 4EIZC 3PV6A 1H8OA 3EYFB 4Q9QH 5C08E 1L6XA 3BZFA 1XGTB 3RJQB 4F7CA 3VWKD 1VFOA 2VXTL 5DR5L 1D3CA 2PXYD 3GBLA 2J8UF 1I9JL 5E70A 2W9LA 1BLNB 4CU6A 4LGSB 5F8RC 1BAFL 4LHUB 2PCPB 3LH2L 4ELKB 2OJEA 4LMQI 3WDIA 3THMH 2JJVA 1EDQA 1MFAH 4P2RE 2GT9B 5D7JA 4POUB 1W2KT 1OAYH 2GI7A 5HI3C 2KUTA 4EBQL 5DURD 3GBNL 1Z2KA 5IVZA 3RL2B 5GGRY 4WU7A 5BXFB 5LXGH 1NGQH 4QY8B 1BVKB 4HIXL 5IW6B 2NPLX 2FX9L 4YHLL 4WI3A 5CBEB 3HI5L 3Q6FA 3PL6C 4MB5A 3PP3H 3EFFB 4Q9BA 5D7LE 1YNLL 2Y9RT 1I7TA 3QFJB 5SWQB 3O3DB 3VRIB 5JHLH 5JOEA 3MACH 1JPTL 3DUHA 2EO9A 5ISZA 3QISA 2Y36L 4F7MA 1UB6A 5CINH 4QXTB 5IFAH 2HN7A 3P2TA 5EBMA 3FRPA 4I77L 3UBXI 4MLSA 3VI4F 3LKNB 4KXZH 1EVUA 5D72H 2MKWA 5L2KD 2CK2A 3HC4H 1YN6B 1AHWC 1RQ5A 4OQTH 3D2UB 4ZS6D 5ILTL 1LEIB 4MDIB 2OM5A 1MCNA 4YIQB 4QHMB 2F54A 3UDWA 1OP3K 4LHUD 1OF2B 3GSXA 3SE4A 2R4RL 3G6JB 3BKYH 1J05A 3FOLB 1GYAA 3I3DA 3IFNH 1LWRA 4NQDA 4XBGA 1NFIB 4JKLA 1EX0A 4KKCD 2FGZA 4NO3A 3S36X 3LKQA 1G1YA 2VDKL 4R96B 5K9QI 1JNNH 4KXZI 1SQ2N 3EFDH 3UZEA 4R4BA 3JWNC 4C56B 4Y2OA 1CLYH 4MA8L 1BF2A 3MRMA 1KXTB 3WIFA 3QIWD 3DX9A 2C1OB 3CXHK 4BFGA 2J6EH 3LRSA 1JIBA 5GGTH 5H94A 3RVXD 2CKBH 2YPKA 1H9VA 3GMMB 4PFEA 4JRXB 3GDBA 1CXLA 5DD0L 4BZ1H 1JGVL 1AR1D 1MFCL 1HEZA 1NCBL 1YA5A 2BHZA 4DKEH 5JW5B 4LSDA 4NO5B 5C08B 3HNSL 3WFCL 2BNRA 5CAYB 1HIML 4XCFL 4P2OA 5IF0A 2KPNA 4K3JL 4GT7A 2CPCA 5BV7L 1U93B 4R4ND 3FOMB 3PWUA 5KTEH 1EGJH 4TSBL 3SDDC 3MUGB 4P2RB 1NMAL 5KSBA 4L3CA 2F9BT 1KEGL 1BVLA 4YHML 3RFZC 1QA9B 1VERA 1FH5H 5T5FH 1F4HA 4OIIL 1FGVH 4MHHI 2SEBA 3VFWA 2Q7YB 4Q9RH 1NC4A 4IRJD 2R1WA 4KQ3H 4KWUA 4YHKL 1EPFA 3LS5H 1JI2A 4O51B 4FABH 5MEPB 3RWFA 3DWTA 4U1GC 2FO4B 1K6QH 5LGKA 4J8RA 1JWMB 2LAAA 3ZDZF 1EO8H 1E0OB 2NW3A 5C0DB 5HHXH 5FEBA 5D7LB 3M07A 3UROR 1FIGH 2Y25A 4PBVC 4WV1C 5GS1B 4PRDA 2JJSA 4XVTL 2XZAL 1MCEA 4KAQH 3SQOL 4TVPH 5F6IB 1S7UA 2V2WB 3GK8L 3SO3B 1MCDA 3MA9H 3OKMA 3DRQB 3QEUB 4HUMB 2IQAB 4KJYA 1OPGH 3CSYB 2Z92A 4MNHB 4U1IA 5HDQH 5CLTA 2C3XA 4P57A 1FO0A 3WN5B 2B20A 3C6LA 4Y2DA 3ULVE 1IC5L 5TF0A 2NNAB 3REWA 3LKRB 4JDTH 3QEGH 3O9WA 4H88L 5GS0D 5AG8A 4U2YA 4JRYD 3NFSL 4JFXB 1FG9C 1B6UA 3QQ3B 4YJZL 4OSUL 3MLRL 3W39B 3QHTC 3ZSSA 5J4MA 2OL3H 3LKPB 1CD0A 2ZSWA 2DDQH 4PRIE 3ZDXF 5C0FB 3DXAA 1KCVL 1R3LA 1YEGL 2CRIA 2DKMA 3TJHD 3U4BH 4P2QE 1CDJA 4XHJC 2H1PL 1GGCL 1VHPA 5C2BH 3J7HA 2IBGA 4XNZB 5IBLD 1BOGB 1L7TL 4FFWD 4RFEA 4HPYL 4LRIC 1OP5H 3HR5A 3OKLA 2I5YH 5C0IB 1M7DB 3BIAX 2VE6B 3P9LA 2VLLA 3MYJA 3IXAA 5FYLD 1FDLL 4IIQB 4DKFH 2OJZH 1AQDB 3AVEA 4S10A 2N4IA 3SBWC 2B4CC 3BKMH 3G9VA 3AMKA 3ZE2F 2YUZA 4I2XE 4HEME 1IQWL 5D6CA 4XVUC 4WIQA 1D6EB 4Y8DC 1NEZA 4DOHE 1XF4B 1H3WM 4NUJB 2FHFA 1MOEA 1UKQA 4F7EA 1GPOL 1KCKA 2BNUA 5D7IA 2Q8AL 5JUEH 3O6ML 3BPNB 4KJPD 3U82B 1PJ9A 1WZLA 3QPXL 2NY1C 5DDHB 3QNYB 4G3YH 3K0WA 1ETZA 3PGFL 5EUOE 2VWEE 3S4SA 5D2NC 1AGCB 1YQVL 1HYRC 3O8XC 4OLVH 4N0CC 2E7LC 1MNUH 3AS0A 3V7MA 4ZQKB 4BA8A 4ODTL 3L5XL 4NKIH 1A7QL 4M6NL 4K71C 1I4FA 4FQXC 3T3PF 4HUKB 1Z0MA 2VZ3A 3H6JA 3MZGB 3VG0L 4LCIH 3FN0H 1CE1L 5HBBA 4N9OB 5F21B 5FK9A 4C54A 4WEBL 4HK3J 2V2XB 4AEHL 2DLFH 2A9MH 1S7RB 5IFJB 1FBIH 3MLUH 3KPSD 3ARGD 5F9OH 2R1YA 4NKMB 5I9QC 4U1KB 4LSTL 3T0WA 4KTDH 4JFYB 1U8HB 1MI5D 4K94L 4Y4KD 4S2SA 3JV0A 2VZTA 5JTWA 5T1DL 4EN3C 2WWMC 4HLJA 4HIJA 3RGHA 3P11H 4PLJD 4PRIB 3D18B 5DK3A 1NBQA 5HI3D 2HJLA 4P2QB 4HWBL 5BJTA 2QHLA 5I1JH 3W9EA 1ZTXH 2R23A 5IHZA 2C26A 3L3IB 4KV5E 5D7IF 4CN6A 4MA1B 4J3VA 2EIBA 5E00B 3MRIB 3NIDF 4LIQH 3QWOA 4YX2L 2BY2A 1P1ZA 2NY0C 1J0JA 2QSQA 4UIKH 3RWEA 3TIDA 3BGMA 4L8SA 1P84J 1ZHLA 5HJ3B 4GKNA 5C09A 2FGWH 3TNNB 1AGDA 4LLYB 3JTTB 1A14H 4I2XB 2X41A 3OPZL 5IMMB 2QV2A 2YMXH 1DEDA 4DOHB 3IDXH 5E0QA 4P5KB 2AEPL 1BQLH 5I66A 3TYFB 3QDME 3F58L 2DMCA 1RMFL 4O58H 1SY6A 5CFHA 2A1WH 1FV1B 5DXWA 3C5ZA 4U3XA 3KG5A 4Z7UB 3UXFA 1J1XL 3KYKL 5T1LA 2BX5A 4X9HA 4G9DB 5EUOB 4LVOC 1DVFC 1NANH 5DRZA 4YAQA 3AS3A 4CL7A 3UTPE 5ID0A 2YKLL 1PEZA 3CDCA 1ZT1B 2VR4A 2FX8L 2IMMA 3P4LA 1G7JA 4PRID 3X12A 4C57C 3RWHA 4P2QD 4PJBA 4H8WC 4P4KB 2FB4L 3NAAL 5TPWL 2X89A 1D5XA 4NRZB 1CXKA 2VAJA 3HPLA 1FL3B 3UTZA 5BS0D 2ICWA 4Q6IC 5EBGA 4D8PA 4RAVB 2DIBA 4OB5H 1OWRM 5EIIB 1NANI 4CU7A 3TYGL 4F9LA 4Z7WE 4WUUD 1S78D 3CVHA 1HILB 3TPUA 2AW2A 4KPHL 4YXLL 1IFHH 1EFXB 3DV4B 3KWWB 2NXZB 1U41A 1N6VA 1D6VL 1I8LC 5J6HB 3FAXA 3TZVB 2ESVE 1MCLA 5DQ9B 1G0XA 1QFWM 2DJSA 3CFIC 4UTAH 3FT4A 1RK0A 3BPLC 2R2BB 5E95B 5MEOB 3MBXL 3OB0H 1JK8A 5FYKU 4N68A 2PO6A 2BMKA 1FL5A 4O2EB 4M43L 4TTDC 3VGDA 2X9YA 3RWDA 3W0WD 2YD3A 4JKKA 2HFFA 1KTDB 1MJJA 2XA3A 1G84A 2YPVH 1W0VB 1ZVYA 1PY4A 4PJEA 4FFVD 4NZRH 2DI7A 5IB5A 5K9OA 3HE6D 4GQPH 4QRRE 4N8CL 5HHME 3ULVL 2I26N 4N1EA 2BOCB 4P4KD 3UJIL 1P2CB 2B39A 3U7AA 1IGJB 4GOSA 1ADQL 5MERA 4LCWD 4MNQE 4BZYA 3X17A 3GRWA 1JZ4A 5ACMA 3RVTD 5E03A 4C55A 1F00I 4JFHE 1JZ6A 4OCWL 3F7YB 4G6JH 5GRWA 1U8MB 3DVFA 4FTVE 5DEZA 3INUH 1IM9A 2X9WA 4HC1A 3RIAF 4UB0L 1NBVL 1QBLH 3RGVC 2BVYA 2DAVA 4PJBF 3QDMB 1I1YB 2UWEA 1IC4L 3DX8B 5EOTB 2NXZD 2X5PA 4IMKA 4UT9L 2VLKE 2O5YL 5DFWH 4AEEA 1A0QH 2NXYC 4K55A 1YEJH 3K2MC 3TO2A 2ZZUT 3IS0X 3KR3L 2FR4A 4DTGH 1BQHA 1IGML 3O6KH 3VRLE 1ES0B 4NQUA 3QIBC 4BSWA 4OZ4B 3I84A 4PYHA 5C71A 1MEXL 4F57L 4OD3H 4OZIA 4HS8H 3MFGB 2WSKA 4XPGH 5J1AA 3BRDA 1LK3L 1LE5A 4MD4B 3QULA 3VGEA 4HLZH 4ACPA 5FKPB 3WSQH 3MRKB 2B5IB 3CNKA 3DVNA 1WBXB 3NOIA 3BMWA 4OGYL 4YDVB 2HTKC 4ZO6A 4FQ1H 3RPIB 4CNIB 3HAEG 1W0YT 4CVUA 4QXUL 3DSNA 4YXKL 3SKNA 4LPTA 4ESKA 4AQOA 4YUEH 4Z7WB 1YY9D 1LO5A 1Z9OA 2FIKA 1WUNT 4N5UA 4XMKL 3N06B 2Z8RA 3Q3GB 4ZOCA 1NCNA 4RX4D 4HQQH 2ENSA 5DLML 1ZLUK 3STZA 5K59F 1IL1B 2YPLE 1DTUA 2DRUA 4J23A 4XC1L 5FCUL 4K3DH 2VXUL 5AUMA 1XIWD 2H3NB 5C6TL 2P8PB 2X1OA 1HK6A 1RPQA 5I76B 5T33L 2YK1L 3BI9X 3NCJH 5IMKA 5DD6B 8FABB 4ONOA 3MR9B 2V2TB 1A7OH 1A6AB 2QR0A 4PJ8C 5C0RH 5IIEA 2YD7A 4RMUA 4J3SA 5E1HB 4PLKD 3NH7L 3UTPD 4KZEH 4X5WB 2NY1D 4OZGF 2A77H 4H0HB 1D5IH 4YFDB 2V5RA 4QRRB 5HHMB 2UWEF 4DJMA 3U6RB 1Q9KB 1T04A 4KMLB 1JHLH 4WI2A 1WCBA 3DX6B 3C5JA 4PJGE 4N0CD 4RMQA 3KJ6L 3WDHA 4MDJA 3B2UD 3IRPX 1UCBL 1C08B 1P4IL 1FNSH 3JWOC 3GEWB 4G43A 4IRSA 1FYTD 4YBLB 5C0BD 4FTVB 4JDVB 2XPGB 4OZIF 3HMXA 1OY3B 4WFEE 3O2DL 3C2SA 4GRWE 2R1XB 2LVCA 5TGBA 1NMCB 2DJ4A 3H9ZA 4HIHB 3CJJA 3QO0B 1HOCB 5HDLA 2ZUTA 5IESH 4HZLB 3QUXA 1G6RB 2YD5A 3CCHA 3F7QA 5F89B 4UNVA 2VLKB 2X4RB 4JPIB 5INDA 2GCYB 4A6YB 4D2NA 2WAHA 2ESVD 3VXTB 1JV5A 5D1XB 4EVNB 1JE6A 2D0HA 4XVJH 4GS7B 5I30L 3U30B 3QNZA 3DI3B 5ADPL 5E8NB 3T2QA 3K4ZA 2FBOJ 3NTCH 2NY3C 1AD9B 3FO9A 4ZXBA 2IG2L 4EDXB 4R26H 3B5TA 1U91A 3TCXA 1NDMA 1KFAL 2FX7H 4JGMA 3RDTA 5D70L 2AERT 3HLAA 3ISWA 1QBML 4Q58C 4ZUSB 4NN6C 1HH9B 2FZ3A 4QRRD 3ZTJG 1T83A 4JREC 3ULUC 2ZOKB 1HSBA 2VDRL 3FB5B 2OTWB 4R0LB 2P24A 3S3PA 3VGHA 4DEPC 2Y07L 3QA3B 4MNQD 3RA7H 3UPRB 1UKTA 2X05A 1FO0H 3ZSTA 3DECA 3S35X 3IDIB 3OHXA 3WFEH 1MWAA 5ESAB 4OCLC 2JCCF 4MS8D 2WUBL 2X4OA 4YEFA 3DHJA 3BRGC 3ARQA 4OZHA 3JZ7A 4XAWH 4N0UE 2J7LA 4P48A 1JZ3A 4WEMB 5EBWB 2YPLB 3D39B 3DVIA 2VLKD 3TT1L 4AIXA 2BRRH 3RTQB 3MV9A 1OAKL 5DMGD 3SKJL 1VGEH 1Q94B 1RJZB 2EDYA 3GBMH 1OQOA 5MI0B 2XTJE 4V1DB 1FFNA 3AFLA 3LQMA 1VSCA 5DD1H 5HY9B 2H32A 4DAGH 3FQRA 4OV5A 1R5WA 3V8CA 4GAYA 1IMHC 5F3HB 1A7NH 1C5DA 2P4AB 4TNWK 1QO3B 1G7PA 3ULSA 1G7HB 4L9DA 5EU7E 5KN5A 3BEVB 4G6KL 4QHKI 4L9LC 4PJGB 4XCYA 1QTYT 4WW2C 2OXGA 1JN6A 4Z78B 1CCZA 5T3XD 5FYKH 1XGPB 4JKPH 5KS9A 2CUIA 2R39A 4G8EA 3DETC 1BM3L 1SJVA 4JN2B 3ZKNC 3QXAA 4HT1L 3IS1X 1SEBB 4KDVA 4M8VA 2DQTL 3OGCA 4PJAA 2Q8BL 4GRWB 3MOAL 3PP4H 5BZWB 2DQDL 4MA3A 4XCCL 5IFHH 2FO1A 4JZOA 3D25B 4LHQB 3P0YH 4ZPTB 3BQUB 1JFQL 4JQIH 3MRQA 2BY0A 5CKGA 2Q76B 3H9HA 5EU6E 3KPOA 3OR6B 2ED8A 3DROB 4LCCB 5DUBB 1YUHB 2YR3A 1F2XK 5AWNL 4PY8J 3MRRA 1P9MA 5KANG 2AJVH 2XTLA 3QEQA 3QHZH 1GH7A 1WC7B 4ZS7L 4D3CL 5EA0L 4O2FA 4OZHF 4OFVA 4AIOA 3FJTA 4BH7A 3IDUA 4JFQA 1AQKL 2AJUL 1FG2A 2VSDA 4J3TA 3EYVB 3PIQB 1G6RL 4PRHE 2DM7A 1QKZL 2D3VA 3L3GA 3R1GH 3KYNA 3D85A 4LDOB 1L9NA 2FJHB 1JGEA 3QCVL 5DUPH 1S7VA 2YN5A 5E2VH 4A6YL 1ZVSB 4KVNH 4IOIB 2P44B 3QG6B 3HZYB 1A6TA 3EOAB 4NCC1 3C09B 2CRYA 4P4RA 2H2SC 5DS8B 4FP8L 4L3EA 2XQBH 1KXVC 4XNUH 4H25A 5E4EB 3VXSD 1EXUA 1PSKL 2OQJA 1TTFA 2NLJB 5IJKA 3VE0A 3Q48A 1XR8B 5HGAA 4N0UB 4F2MB 2FJFB 2DQIL 1YEFL 1BZ7A 4S1RH 3F5WB 3CGTA 3U9UA 4U1LA 1SBSL 5JPMB 1T22A 3OJDA 4XH2A 3RGVD 5E1AB 2GK0B 1S5IL 3MC0A 5GSRA 3P4NA 2XWJB 5KS9F 1EEUA 5GGVY 5IT2H 4YC2B 4Z5RA 4LU5H 3UO1L 3FB7B 3AAZA 5GISL 1S7WB 3QIUB 2XTJB 3MGTA 4HIEA 4HWZB 4EUPG 2DOCA 1KYOK 2VIRA 1TCRA 4K23L 1NAKL 4PJAF 2GQHA 4U1NA 3BUYA 3VFOA 1UG9A 2VXQH 4LQFH 2X4PA 3QUZC 1A4KB 1X5LA 5D96C 3PWPD 1IKNC 1KJVB 5L2JB 3N1QC 4X7SH 1CICA 2HFTA 2Z31A 2PYEA 1TZIB 4GRLC 5HVFB 5ESVB 4LSQL 2D7TH 2I9TB 4PRBA 5CEXB 1UJ3A 4YDKH 3MMEB 2K9UA 3P4OB 4KKAD 2HTKD 3VW3L 3CZFA 4M48H 2PN5A 3QDJE 1SY6H 2VABA 5F1IB 2J8HA 2CDGA 4G80A 4XCEA 3E0GA 4HK3N 4LF3A 3G5XA 2EE9A 4KROB 4U1MA 4HKJB 2DBLH 2OZ4L 2QQLL 4Z7VF 5EU6B 5INCA 1MCPH 4POZD 5FXCH 1MLCA 4KKLD 3TN0D 5C3TA 3ZHLA 3CVIH 4XNYH 4ZUWB 3VXPB 1PEWA 4JHAL 1INQA 4U0QB 4YR6A 4NZUH 1UT9A 2YEZA 3H2WA 2GFBA 3SE8H 3WXWL 1OGAD 5EOCH 4PJ8D 3MJGX 3U0PA 5BRZE 3MJ8B 1H3UA 2QQNH 3SDCA 2Y7QA 3BH9B 4PRHB 4R8WL 2XZCH 4PY7B 3CH1B 1E4XH 1T7YA 2AQ2A 2IANE 4R4FL 1Q0YH 4U1HA 4NHUB 3VWKA 2O93L 1XMWA 2PXYA 3BP5B 3OKDB 2ZJSH 3CVHH 5SX4H 5FUZH 4KTEH 2HRPH 1KLUA 1X5HA 2R0WH 4JR9H 1UXSA 5GS1C 2DLTA 5TE7L 4ELME 1Z5LA 2BVUA 3I85A 1MVUB 3PE9A 4MQSB 4K2UL 3SCMA 1AD0A 1QSFE 1O5DT 1BD2A 4OKVA 3BT2H 5F6IC 2CMRH 1FZKA 3VXUA 4M7KL 1UWXH 4KI5E 4Z18A 5IGXL 1AO7D 4TOYH 3CPLB 2G75A 1CDUA 2ICWI 4U7KA 2EKSB 1E4XI 2VUOA 3AU1B 1HKFA 1V5JA 4GAFB 3JV6A 1DFBL 1HQRA 5SX4I 3MNVB 5EORL 3GKWL 4E42B 4TNVK 1OTSD 2QLVB 4UDUB 1KTLB 1XAUA 1GC1H 1U8LB 3GMRA 2UZIH 4LMQE 3TBTB 4F58L 5CGMA 4MJ5B 1M7IA 2IPUG 1GIGH 2F58H 5I1KH 3WYRA 2HTLC 4I18A 4E5XB 3S97C 3GRWH 3IDGB 3T4YA 1OTUD 3P73B 3EOBB 4PRHD 4S11A 2EYSB 4LSVH 3V7AE 1MHHA 1QFPA 4Z7NE 2MHAA 1AXSB 2YC1B 3MUY1 4LOUD 1FVCB 1C1EL 2H9GA 1J12A 4UV4H 4HC1H 3RWIB 2ORBH 2ZOLB 4LKCA 4MCYB 3ZDYE 3KPMB 1BP3B 5DEFA 3O6FB 3QDJB 4NGHH 4PGBA 5GJTH 3WJLC 3W5NA 4YZFF 4QTHA 1NC2D 3J8F7 3TVMD 5D5ME 2O5ZL 3E6HA 3AREA 4NPYB 1Z6JT 1U36A 5B4MC 4HK0A 2WBJB 3BO8B 5D1QD 3WUWA 3PJSA 4HH9A 3NFNA 1R3HB 1IGTA 1DQLL 2XG4A 1JRHL 1SJXA 2BJMH 5I8OL 2JJWA 4X7TA 2DQFB 3QIWA 1IM3B 5EZJA 1G9NC 12E8H 1XGUB 5F9DC 2X2YA 4UINL 5GZND 4IOSD 3MRHA 5I1LB 1ZANL 3DTXA 1YMME 2VXVH 4OLUL 1EEQA 5HHOE 2WQRA 4YGVA 1AI1H 3O0RH 4CRPA 1J87A 4XNXL 4NN5B 4YHIB 2XT1B 1OB1A 3VI3F 1T5XA 4ZUVB 4CW1A 5BRZB 2IH1A 5CWSB 2C3WA 5TDOA 3I02B 4KY1L 1ZEAL 2ITDA 3ZE1F 4JDZA 5HSFA 1G7QA 1EAPA 1QEWA 3RKPA 1BGXL 5DD3H 3TV3L 3ZKQD 1HE7A 2CLRB 3ZKSD 3G9AB 4CBPA 5IHLB 1CFTA 1HHHB 1A3RL 4YDIH 5JW3H 3D6GA 4B7IA 5EDXA 3MO1A 1RHHA 4TSCH 5KSAD 5TH2B 2MOVA 1T1YB 1FZOA 1QSFB 3P0VL 4PPTA 5E56A 4Z0XB 3FQWA 2CIIB 4JM2B 3OKEA 4QEGA 3WKNA 5BZDA 1ODAA 4X8JB 3SKMB 3SY0A 4L4VB 1FNEA 3PQYE 3NGBB 2CDFA 1P6FA 5AYUH 3VD9A 5E2TL 4A2LA 2FECI 2JB6A 4I3SH 3TT3L 1KCSH 3PHOB 1INDH 3VRJA 2AQ3A 3T0EE 3FB6B 2R29L 2BRQA 1QHOA 1P4BH 5BVJA 1DCLA 2ENYA 4M7LH 3QO1A 1CTOA 5DD5H 1IGIH 3UAJD 4QRUB 4CDHA 5C8JB 2OMNA 3AMLA 3HG1E 3ELAT 1U58B 5HGBB 1R3JB 1WWWX 1S5HA 5JO5A 4Y4FB 5BRZD 4ORZC 4DK6A 1KENH 1VFBA 4K7FB 2V5SA 2CQVA 2E27H 2R0KL 2UYLB 3X3GH 3ARBD 2NZ9C 4YXHL 1CIUA 1NLBH 2DWDA 1XF5B 2Z93A 4K07A 1UADC 2IAND 2FATH 3HMXH 2DQEL 5C0CE 4M9OA 4K3HA 5EO0B 4ZFFB 4MA1C 4KKNA 1MF2H 4MZ3A 3HI6H 2VISA 1UWGH 5EC2B 3FQUB 4JRYA 3VFRB 3STLA 2C3VA 4KZDL 2R0ZH 5D5MB 4MGXA 4ONHB 2NYYC 2R2HA 5F70A 4PRAB 3FT2B 4G7VH 3FFDA 3HE7A 4KI5D 4WWKA 2VDOH 5IWLA 5IOPB 5B8CB 3LD8B 4PJHA 3BH8A 4X0KB 1RURL 1D5BB 2ATPB 1IAIH 4HKBB 2PUQT 3WFBH 1RZ8A 1KBGL 2CLVA 4WY7H 4M7LT 3VFNB 4PS4L 1CL7H 5DJAA 4DN4L 4XWOC 1WWCA 3P9WB 5L9DH 2WIMA 5HHOB 1YMMB 1IVLA 3IF1B 4C58B 3WNKA 2UZYB 3QQ4B 2EH7L 3IFOB 4MXQC 1INEH 2BSRA 1A3QA 2L7JA 4L4TD 1B0RA 1PG7W 3K2UL 3QUYB 4TVPE 3EKCA 5C70A 1M05A 2I24N 4ZNEE 4JPVH 4NDMB 4Y4FD 2AK4A 1UZ8B 4K9EH 1IAII 1UWEL 5DRXB 3OKKB 1CL7I 2AEWA 3JVGA 2D7QA 1S8DB 1IGYB 3IVKB 1N4XL 2IALB 2VDQL 4PREB 4MXWL 3WNLA 1CLOH 3LKOA 1I8IA 4GRLD 4G6ML 4JFPA 1NCDL 1F6AB 4CKVX 1JNHB 5T1KD 2XFXA 4JN1L 5GGSA 3DMMB 2VDLL 2BCKB 2F74B 3MJ9L 3PQYB 4BFBD 4G8GD 1GZPA 1KPUB 4NC0B 4EI5B 1YEHH 3MRDB 2DIAA 2K3TA 4ZFGL 3T0EB 1KEMH 4QRTB 1FFQA 2AV7A 5TDPB 5IHUL 2BVTA 2FWOA 2HVJB 2OS7A 3C60D 2H32H 3MUHL 4KVCL 4ETQA 1QFUH 1ZA3B 5J3HC 3VDCA 3CSBA 1AGEB 3DUUA 4IJ3C 4LSUH 4WVRA 2GAZB 1H5BA 2C7UA 3EO0B 1Z9LA 2EH8L 3C6SA 2ZCHH 4LPUA 1ONQA 1A3LL 3HG1B 3R8QA 4GRMA 5D1ZC 3PG2A 3P9MA 4OCXL 4RMRA 4HUVA 1PZUB 1UB5B 3WKML 1TJIH 3F7RA 5GGVH 3VWJA 5DJZA 3VFVA 2ZNWA 3G6DL 2D9QB 4PB9L 2OI9B 3IKCA 4X7CC 4WENB 4PJHF 4UNUA 4HWUA 3WNMA 2IGFL 1IGFH 5C0CB 1RZKH 3RWJA 3T1FA 4YDJA 1JYNA 2HFEB 3DYPA 3LN5A 1H8SA 3ARDB 3KPSA 3ARGA 4WNQA 4WFHD 3SPVA 4HUUA 2F53D 4UUJB 3GM0A 2AJXL 3PABB 5HYSA 2CLZA 5ADOL 1RZFH 1CD1A 1FGNH 2EE2A 3WFHA 4Z7QF 5D9SB 4K3GA 4HDIB 3LS4L 1MHEA 1S7XB 1CK0L 2CO7B 6FABL 2EXYD 4M6OL 4NZJA 3L9RA 3L3OB 4I4WB 5DUML 4OAWB 4CUCA 1EEYA 3FN9A 4J4PD 4OCSL 1DN0B 3MROB 5JIPA 2VXSH 1N64L 3L3HA 2W60A 5CJXC 1RY7B 1VA9A 3WLBA 4K8RH 3TBVB 1A9BA 2VC2L 4XPTL 2DLEA 1DBMH 5IJVA 4Q9QL 2RCSH 2XICA 4Q0XL 2X4UA 4MX7A 1T20B 3L3JB 5TDNB 5MEQA 1UM5L 1S9VB 3NN8A 4MZ2A 1I1AB 3PL6A 5D93B 4DW2H 1LK2A 3FTGB 3DV6B 4NQEE 3THML 1MFAL 4LEXH 2ICEB 2OR7A 4JG0H 1DQTA 1OAYL 5FHBH 2PF6A 1K8DB 5H8DA 5GGSY 2Y72A 4TUOA 4XMPH 4CMMA 4X7FC 2PTTB 1NGQL 4XP5H 2C4FT 3M8OH 1I8MB 1Y18A 3ARDD 3QEHA 1AHWA 4L8BB 1ZGLB 5CJOL 1XZ0A 3WLWC 3KAAA 2FSEA 4JO2H 2F5BL 1L6ZA 3LN4B 4UTBL 5JHLL 5E5MB 3H3PH 1A9EA 5HGHA 3GGWA 2YA1A 3M45A 3V52H 1IAMA 1EO7A 3BZ4B 4ZUTB 1IEBB 2FEEI 5D72L 3OSKA 4U7SA 4OQTL 4LKXA 4U6XB 2MKLC 1U3HB 4JG1L 2BSTA 5BS0A 1QVOA 2GW5A 3H3BC 1KT2A 1ZMYA 5I74B 4DCQB 1FLRH 4NC2B 2EDLA 3SE9L 4WUUA 3BKYL 5EU4A 3IFNL 3V4PH 4TVPD 4D9LL 2YUVA 2JF1A 1QFHA 4LEOA 4R3SA 4N8VA 2XV6B 4IMLB 3WNOA 3K81A 2DQJH 4UBDC 3KYOB 1JNNL 3JV4B 1C12A 1ZVHA 3KNBA 3ILPB 3IU3A 5IW1B 1Q9OA 3L6FA 1ORSA 3UTSE 1C7SA 2DTML 1R6VA 2EEAA 3RVVC 4WFFE 4F3FA 5GGTL 3TC9A 3SDDA 3W0WA 1N0LA 4LHUG 1K2DB 1EEZA 4BZ1L 4GKOA 1NMCC 3LEXA 1LD9A 1UGNA 1CT8B 1ED3B 5KBNC 2DKSA 3ME0A 2J8UE 4M1CC 3NCEB 4DKEL 4L8CB 5DJYA 1U95A 1OGTA 3L7EA 3VXMD 4W68A 5FM5M 1QSEA 4G9FD 1G0DA 5D1XC 2P7TA 1IC7H 5E8PA 4LCWA 3OR7B 5KTEL 2P49B 1EGJL 1BWWA 4NQEB 4PJFB 3U30C 1UVQB 2E6QA 3R4DA 5FB8A 1EHAA 1XGRA 1QRKA 5KG9B 4WV1A 1NFDA 5LVEA 5E8DH 3MCKB 4TULH 1FGVL 1PZ5A 4PJCA 2BVOB 5ITFA 3N85H 4Q9RL 1ERNA 4M3KB 1UQSA 2Y06H 4KQ3L 4PB0H 1FZJA 1Q72L 3H9YA 4I0CC 3LS5L 4FABL 3V6FB 3CXHJ 5I1AA 1RZ7H 1N5YH 1MQKH 1K6QL 5H35B 4ZPVA 4D0DA 4JFEE 1EO8L 3BP6B 5F97E 5HHXL 3CZJA 4JCLA 3MRPA 4R0LC 2D7PA 1F58L 5CS7A 2VQ1A 4P3CH 4PV8A 3MV7E 3FQTB 4JQVC 4JCMA 4R9HA 4MCZA 1UEYA 4NJ9H 4OCYL 1HHJB 2ARWA 3VI4E 3MRCA 4TVPL 3OF6D 4RGOH 5HXMA 1IQDA 1S7SA 1RUPL 4GKSA 2C3GA 3OKOA 4BH8B 2IBBA 2EIDA 3MUJA 1FSKB 3BN9D 3EZ8A 3QG7L 5HDQL 3K46A 3TBYB 3VU2A 3G04A 3DI2B 4PRPE 3V5DB 1T4KA 4GAJL 1TTUA 4JDTL 3QEGL 1F3DH 3WIIH 5E94A 5MI0C 5I6XB 3Q6GH 4TQEH 3IDMB 5BO1H 5CJ8A 4CDGC 1C16A 1S7TA 4Y16C 1WBZB 4LRIA 3V0WH 4HX1B 5DVNA 2D0FA 3T4AA 1CWVA 43C9B 1KB9K 4M93B 3OWEA 4DUVA 5ICYA 4UQ3A 3PNWB 1B4RA 4MNGA 1NGZA 1UCTA 4ONFH 3JTSA 2X4NB 3U4BL 1NBYA 2G60H 3SBWA 15C8H 2VYRE 1CIDA 3UTSB 3VFMB 5C2BL 3BZEA 4P46B 3PWLA 4XPFL 4OKDA 1BFOB 4Z8FH 4B41A 1NFDF 3U2SA 1ZT4A 2I5YL 1LDSA 5IG7A 1VFAA 2JK5A 3ILQD 4PJCF 5AAWA 1KV3A 4FQPA 1OSZB 4U6HA 2UY7A 2J8UB 4DKFL 4JLRB 2OJZL 4MJIA 5F7DA 5IV2A 5GIRA 3BKML 5D2NA 1FZMB 4WI5A 4YHOL 3O11B 4N90D 3O8XA 1EUTA 3OTTA 2DJUA 1WFTA 3B4NA 2E7LA 2GJ6A 4XZUA 1TPXC 1EZVX 1HWHB 3LB6C 3QHFL 4JEGB 1H3PH 2WNGA 3TH4T 5JUEL 4LBEA 4GQ9L 1KJMB 5F9AC 1FYTA 3GSVB 2P45B 5C0BA 2A74B 2QSTA 4FQXA 4UDTB 2AK1H 4ZYKB 3SGJC 4G3YL 1OP5K 4MA7L 3VH8A 1F02I 2Q20A 2V7HB 4UT7L 3ZDZE 4WO4B 3PDGA 4OLVL 1MRFH 4LRNH 1MNUL 4ODUA 2F54E 4UQ2B 3ZLQC 4JFEB 2YWZA 3SDAC 4D0BB 1JGUH 4QRQB 4NKIL 1IARB 4M5ZH 5M95B 3MV7B 3U4EB 4P46D 1SVCP 4GBXB 1LO2H 4WFFD 3VJ6B 1U3JA 3S9DB 3QFDB 2EDBA 2AJYH 2OTUB 3PWJA 2E9JA 3QXWA 1NAMA 3FN0L 1U8PA 3V6OA 1CLZH 4LPXA 1G0YR 4P23B 3EJZD 3F8UB 5MHSE 4EN3A 4BQ6A 1WBYB 3BRFA 1ZT7A 3L3KA 1YECH 5I1GL 1RZGB 1KJ3L 1B9ZA 3IJHA 2DLFL 5GRYA 3TFKC 1FBIL 3AXLA 4K7PX 4PRPB 5A16B 3W9DA 4OF8A 3MLVH 3MLUL 3MRFA 1W72A 5GRUH 5F9OL 1QSVA 1LO0H 1KIRA 1MCBA 3E2HB 1ITBB 2CRZA 4KTDL 2XTJC 1SJHA 4APQB 4FQHA 4FFYH 3WIHA 3BW9B 4HMDA 1DLFH 3ZDXE 2OXHA 1F3RB 3BZFB 2BNRE 4F7CB 1KIPB 1J8HA 3P11L 4OCRH 3I2CH 1UKSA 4FXGA 5E2WH 2A0LC 5GS0H 3KLDA 4D9RE 2J12B 2OJEB 1FYHB 4LVEA 4WO4D 5D7JB 5I1JL 1ZTXL 5EUKB 5HYJA 5FV2A 5FA3A 4YBQD 3HI1A 4NM4H 5IVZB 3MBED 2LU7A 4IDJL 4NBZB 3D3VA 4WU7B 2YZ8A 5CUSH 1X5AA 4UIKL 4QHNA 3ZE2E 4S1DD 2X4SA 1MCCA 1D9KD 2FGWL 3JWDH 1T21A 2DS4A 3VFSA 3MRNA 4KROC 1I7TB 4JJHA 4M7JH 5ENWB 1A14L 3E3QC 1G7MA 3IDXL 4H0IA 1P4LA 3PHQA 1BQLL 1DDHA 5E6ID 4WHYG 3WD5H 3RZWA 1K5NA 4F7MB 1UB6B 4O58L 1HHIB 4PRPD 2HN7B 5EBMB 4NN7C 2A1WL 1UYWH 1E4WH 4WW1A 2YD4A 1XGYH 3AROA 4B0MM 4HFUH 2X7LA 1U8JA 2NY4B 3OAYK 3ARWA 3QUMA 1MAMH 2P8LB 1FPTL 3IJSA 4I0PC 4JVPA 4Q6IA 4R7NA 1H15A 1WFNA 2HLFD 4RMTA 4XMLH 3MGAA 3O3BA 2F54B 5H37H 4RCAA 1A6ZA 3T3PE 1J05B 4UU9B 3TO4C 3DO3A 5JNYA 3DIFA 4XBGB 4PJ7A 1J0IA 1I8LA 4LP4A 4ZODA 1EMTH 3ES6A 3LKQB 3O3EA 1JTPA 1LDPL 3DXAE 3T2NH 1QG3A 5JZ7C 4KJQC 4R4BB 4OB5L 3KLAA 4XAKE 4RMWA 4W4OC 4AT6B 3S5LA 3UPAA 3LQZA 3WIFB 5B39A 1JNLL 2BSED 3AGVA 3LRSB 2EKJA 1F8TH 5FIEA 5GRJH 1IFHL 2YPKB 3A6BH 5H94B 3K3QA 2OYPA 2O26U 4NHCL 3KDMB 2XWTA 1F42A 5CD5D 1YEDA 2VLMD 1MJUH 2GTWA 4JFZH 5JA8B 5ISZD 4UTAL 2HVKA 1HEZB 4NZDA 5HVHC 3DARA 2BNRB 5DHVB 1YYMH 3VCLA 5IF0B 5DO2D 1JWUA 4S0SD 1YYLH 3QAZB 3UTTA 3PWUB 2YPVL 2D7NA 4OF5A 4NCC2 5D7IE 4PTUB 1TJHH 1A5FH 4L3CB 1KJ2B 1SYVA 4BKLB 4X9BA 4H1LA 4NZRL 1TCMA 4X9FA 3NIDE 4Y4HC 1QPPA 2F54D 3RGVA 3N9GH 2E8YA 4KKBD 2SEBB 4XNMA 4NQDD 1NC4B 2GK2A 1JZ8A 1MCJA 5L88H 1CGUA 3QZWG 3QRGL 1CLCA 1XH3A 4C4KT 4G6JL 1I3UA 3HAEB 3OB0K 5CMAB 4I5BA 1AXTH 4AM0A 1QRNA 3K7UA 2VDMH 4HW6A 1CDYA 3QIBA 2WBJC 5SWSA 4M62H 2BVPA 4PGCA 1I1FA 3QB7C 3S96B 3TIEA 3RHWK 1BQUA 2ADGA 3B9KD 1I9IH 2WUCH 4PJ7F 1A0QL 1QD0A 1CFSB 3MGOA 1YEJL 3EIFA 3BP7A 3WMSA 1XF2B 2APFA 4KJYB 5FF6A 2CJUH 1FO0B 1ZLSH 3RZCD 3C6LB 2XXMB 3REWB 4OD3L 4P2OD 3MJ7B 3L5HA 4HS8L 4P2YA 4AEIH 4XPGL 4P2CG 4LAQH 3KVQA 3SHSA 3GMOA 3U46B 2E9WA 2C1PA 1FHGA 3B6SA 5IM7A 1NSNH 3DO7A 2QL1A 3WSQL 5LAXB 5M94B 1F11A 4QNPF 1T3FA 4J3XA 1FL6A 2ZSWB 2IAMB 4PP1D 2EICA 3VXRA 3DXAB 4FQ1L 5EC1A 4Z6AT 1R3LB 1NC4D 2VAAB 3ORJA 5I1CH 4YUEL 1NBZA 2LQRA 4JM2C 5CIPB 4OM1H 5EZOH 4PJ8A 4ZUUA 5KVEH 4RFEB 3EDKA 4QKXB 3WNPA 3MLTB 1YN7A 2GJZA 2JIXD 1OM3H 5E4IA 2DM3A 5J8OA 4TNVF 2VLLB 1CI5A 3IDNA 3MYJB 3IXAB 4K3DL 5F7YC 5C09E 5IKCA 1TETH 5JPNA 3GHEL 4YHPA 5D6CB 1A7OL 5C0RL 5IEKA 2NY5L 3NIFF 3D48R 4F7EB 4KZEL 1B4JL 2BNUB 4Y2DD 4RBPK 5D7IB 2WP3O 3T3MF 4U0RC 1AO7A 3RX5A 1TJGL 2A77L 3O9WD 2YBRA 1D5IL 4KHXH 2DQUL 2CUHA 4WDIA 1RZJC 1ZHKA 3C9NA 3TLRA 1Y0LA 1BIIA 1JHLL 4N8PA 2A83A 3L95A 4FQJH 1CVRA 3U1SL 4CADB 3FHQA 1LO3L 5I8EA 1R5VA 3SDAD 1IAIM 5EBLA 3LN9A 4NZTH 1FNSL 3BYYA 2PR4L 3DXAD 2WIIA 1AKJB 4GAGL 2DTSA 4GXUN 4N0FA 2J5LC 1E6JH 4OUUA 4PJBE 5F71A 1XGQB 2E7CA 2EXWC 5ANMA 5IESL 2Z35A 2E5EA 2PYFB 1OAUH 3MFFA 4RMSA 5DJCA 5CP3A 4XNQA 1T0PB 5FK9B 5E08H 8CGTA 5FYKD 1KGCE 1WT5C 3TA3D 5C0JB 5ICZA 4MD0A 1NC2A 1DQJA 3JBG7 4XGZA 2R1YB 3QUYC 4KRNA 4XXDA 1MCIA 4R26L 2EE3A 4F7TA 4YHZH 3CMOH 2FX7L 1DBBH 2J88H 4JY5H 2BC4B 4YFEA 3QRFM 2A0LD 1MIEL 3C2AH 2Z9TA 1RIHH 3C5SA 5FO8A 1TVHA 1HINH 5C9JA 2IBZX 3UJTL 5I8KL 1FVDA 4MMXC 4HG4K 3RA7L 5BJTB 4PJEE 2R23B 1FO0L 1FCGA 3DMMC 2HJKA 2ADJB 1CN4A 4I13B 3WFEL 1DR9A 3G6AA 3NFPA 2GTZA 5K59E 2P48B 4X6CA 2EDFA 4JE4B 4XAWL 2ZSVA 3GI8H 1IAKA 5TFSH 1MIML 3RWEB 3T0EC 4AZ8A 3TIDB 3BGMB 4L8SB 4P5TB 1MJ8H 5C09B 4Y0GA 4L9LA 1IKFH 4Y5VB 2BRRL 32C2B 5DRWA 4WW2A 1DBKH 1VGEL 4XCNA 1R0AL 3DURA 4OZGE 5IEHA 3GBML 3ECBA 3FFCA 3QH3A 4Q97A 5I66B 2B4CH 2UWEE 2MQCA 4DAGL 1N6QH 3C5ZB 4OZFA 3S35H 3D69A 5HHVH 1WEJH 5T1LB 1A7NL 4FQCL 43CAB 4TSAH 1P7HL 4QHUA 1M71A 2AXHA 1A4JB 3GSQA 5DRZB 2CGRH 4YAQB 1JTTA 2RB8A 4G6AD 5ID0B 3ULUF 1R5IA 2WWKT 4OZIE 1DQMH 4JKPL 1G7JB 2LTQB 5TE6H 3FQXA 3PXHA 1DQQA 3L5IA 4FG6D 2VLRD 1BLNA 1I9EA 4KQ4L 3BZDA 4ELKA 1D5XB 3PP4L 2IQ9H 2GT9A 4P3WA 5FUCE 3ALXA 5IFHL 4D0CB 2Z4QA 3HPLB 2Y6SD 4LLAA 3S34H 4OLWH 3QDAA 4DKDC 4JQIL 4HJ0C 4QY8A 1BVKA 3X11A 5IW6A 4LLVA 3OGOE 3CVHB 4ZAKB 1UM6L 3H9SA 1NJ9A 1BZQK 1CXEA 4OQ1A 4L1HA 4NC1E 1I1AC 1ZWIA 4GW4A 3BAEH 4ODSH 3RWCB 5HHQA 4X6CF 4EUPB 4KUZH 1RK0B 1EHNA 1JK8B 2XWBB 3RPKA 3DNKA 1FL5B 1NAMH 4LASH 3R1GL 3B9EA 3OL2A 3RWDB 5TF1H 2HFFB 1MJJB 1J0YA 5E2VL 5DUPL 3EDJA 1YN6A 4Y4HD 2ZWLT 3MV8A 4Z95H 1U8NB 3NCFB 4CU8A 2ARJA 4Y1AE 2JCCE 1E6OL 5IB5B 5F1SA 2XQBL 3FZUC 5I1IH 1F4YH 1Q9LB 4QHMA 4QF1A 1W72H 2CIKA 3ARUA 4KMTH 1KB5A 3FOLA 5MERB 4JFDD 4LLWB 3QUZA 1NFIA 1CYGA 4RWYH 5F8QC 1X5IA 1TQCC 2XNAB 1RV6X 5HYFA 4YEEA 4R96A 4NWTL 1E4KC 1IM9B 5IT2L 4R7DA 3ARVA 4GRLA 5E9DA 4OZGB 1UEMA 2R0LH 1KGCD 3IDYB 1CD9B 5I74C 2UWEB 2C1OA 2XZZA 2FEDD 3X13B 4KK8D 4UZGA 2NX5E 1X5ZA 1C8PA 4NFCA 3SDYH 1RUAH 2B0SH 4G8GA 3GMMA 1RD6A 4JRXA 3SJVB 3TO2B 4HMCA 2FR4B 4L29A 3SE3C 2Q86A 5C0EA 2ZUWA 4X7SL 4DFIA 3C60A 4BSWB 5IP4A 5HYEA 2PO6D 2YUWA 3EO1A 3C08H 4Y5XC 4OZIB 1NGWB 4NO5A 3SN6N 2L4OA 2FHCA 1LE5B 2PW1B 2E7BA 5J13B 3QULB 2I27N 4YDKL 1I3RB 1CU4H 3FOMA 5T3XH 3DVNB 4M48L 1W8OA 3SO5A 1SY6L 5DWUL 4DGVH 4OTXH 4H8WH 4WJ5A 1MRDH 5CBAB 1V7MH 2BVQA 3SKNB 5DC4B 2YSSA 2DBLL 4WTZG 3QUMH 4TUKH 1KYOJ 4QRPD 1JHTB 1LO5B 2FYYA 2FIKB 5MEPA 4HS6B 3WV0A 5IROC 2LV4A 5SWZD 1BX2B 2D03H 3NCBB 3CVIL 4XNYL 1MUJB 3UTOA 2LAGB 5DI8A 4OZHE 1ROWA 2NW2A 2YD9A 2ZP0T 3TNMB 4NZUL 1FFPB 3STZB 5GS1A 2X4QB 5B3JF 2VZOA 3SE8L 5DHXB 1B88A 1NFKA 5EOCL 5AUMB 2HYMA 4QGYA 3MV9E 4JAMB 2W9EH 4F33A 1H3VA 2QQNL 4X4MA 5IMKB 5DSCA 3QEUA 5HD8D 4KC3B 2IQAA 4CVXA 5IIEB 2OK0H 4Z7NF 3BKJH 4H0GA 3CFEA 1MJ7H 3CSYA 5FGRA 4C83B 5EZLA 2ZJSL 3CVHL 4O02H 4Y1AB 2JCCB 25C8H 1FLTX 3HRZA 5FUZL 4KTEL 1RULH 2R0WL 4JR9L 5MP6H 1T1WA 3IU4H 5IMOB 2CDEA 3FHAA 1VDGA 1T04B 3U36A 2J6EA 1WCBB 3C5JB 3SGDH 3RIAK 2HT2C 3RKDC 3BT2L 1J10A 4N0RA 5F1OB 1XCTB 4MDJB 5DRNA 5LJYH 3LRGA 1OHQA 3FRUA 3W39A 5KS9E 4S1SH 4TOYL 4EIGB 4G43B 2GIYA 4IRSB 1FSKC 4NP4L 1KIQA 5DZLA 1ZV5A 2VITB 5HI5C 4XVSL 4PJ5A 5DVLA 3O6LH 4PJAE 5TGBB 5DJ8B 4RDQF 3WHXA 3S37H 4P9HC 1CVSC 3QUXB 5I6XC 4G6FB 3CCHB 1U6AH 2NX5B 1RIVL 1BOGA 1V7NH 1GC1L 2OX5A 1DUYB 3SGDI 1DN2A 2V7NB 4AG4H 5K9JH 3WJLA 1F4WH 4MQTB 1A6WH 1M7DA 2I25N 4ZSOA 2FD6H 1GIGL 2F58L 4UV7H 5I1KL 2AEIT 4LLDA 3QNZB 4PGDB 3GRWL 1AQDA 3NABH 3S88H 2D31A 2NTSP 3OAUH 5EWIL 4ZXBB 3QEQE 5J12B 5GSVA 2GEEA 1D6EA 3O41A 5FV1L 3RDTB 4HC1L 2NQCA 4Y88A 3HLAB 4KUCF 4NUJA 5L0QB 1OCWH 1MPAH 2R2EB 4F7PA 2FZ3B 4X80H 5GJTL 1HSBB 2WV3A 1EHLH 4Z7VE 5DDHA 3EYSH 1UJTA 3V4UL 3R06B 2A9NH 3DLQR 2VB5A 4G8IA 4L3EE 5ACZB 4IRSD 4S1QL 4D94A 5T3ZH 1MWAB 2EDOA 2BJML 4U6VH 2X4OB 4ZQKA 4OZHB 12E8L 1KOAA 4FMKA 3MOBH 1QFWH 1RUMH 2UUDH 4JM4L 1AI1L 4RISH 4PJXA 3QQ9D 3MV9B 2OL3A 1I7ZA 3M1BB 3BP4A 2RJMA 3VG9B 1FFNB 2V2XA 2FECL 3PGDA 3VXMA 2H32B 2QADB 4NJAH 4G9FA 4GO6B 4YDIL 3OB8A 4ZXBD 4ODBD 1TENA 3ULSB 4GBXC 1T0NB 3RDTD 4U1KA 5L8JB 1QFWI 4JFYA 2NY2C 1B3JA 1U8HA 5B21A 3EHBC 1JN6B 2PYEE 4P23C 2HT3C 3BPOB 5KS9B 3KYMB 4LDEB 1HHKB 5DVMA 4GJTB 2JLLA 3QXAB 5AYUL 4LLUA 2ZCKL 5F3BA 1BAFH 3IDJA 4PJAB 3LH2H 4J2XA 3KPNB 4I3SL 4MAYB 1KCSL 4I3RH 4QTIL 1INDL 1FRGH 1QUNA 3JWOH 4MA3B 4Q2ZB 4QWWC 1AFVH 1H3XA 3E2HC 4JZOB 4M7LL 1WQVT 1Q38A 1Z0NA 4HJ0D 4FMFA 4J3OC 3BGAA 2XIDA 5E00A 3MLZH 3WE6B 5A40E 3BWAA 3MRIA 3MRQB 4W70A 4Z7OF 3G5YA 3NPSC 5IB1A 2FX9H 3KPOB 3OF6A 3GMNB 3HI5H 5L7XH 4JVUA 5ICXA 5HJ3A 4O4YH 3IFPB 3P30H 3MRRB 1SJEA 2YUXA 3BD3A 5C0NC 2E27L 3QXDA 5D7JC 3X3GL 5GRVL 1YNLH 1CE6B 3QEQB 1NLBL 2FATL 4YK4B 3HZMB 3B8YA 3ESVF 1RK1A 4O2FB 4P5KA 1JPTH 4FFZH 1MF2L 4YZFE 3TYFA 1NKOA 2GITA 2Y36H 3CDGA 3GMQA 3N50A 3RBSA 4JFQB 1FV1A 4I77H 4Z7UA 4KK9C 2OP4L 4PJXF 1JZ7A 2R0ZL 3KYNB 4Z7VB 3D85B 5CP3H 3W5MA 1J5OL 5B38G 4G7VL 4MWFB 5DA0B 3UYRH 3ULUH 5ILTH 1HN1A 2DICA 2AEQH 2P5EB 2VDOL 1A6TB 3T1WA 4KRMB 1M7XA 4L3EB 1ZT1A 1H0DB 4JHWH 3U79A 2XY1A 2MSPA 5CZXC 1IAIL 3WDJA 3ARFB 3WFBL 4A2MA 3VE0B 4NYLA 4M61A 5GRVK 2R4RH 2NY7H 3PDOA 3VXUE 4BSJA 3VI3E 5L9DL 3UTQA 3WS6C 1K8IB 3B9AA 3LCYA 1SEQH 4AQ1B 3ZE1E 2EEDA 2NY4C 3O3AA 4WHTB 1NUNB 3EYQC 3OJDB 4XH2B 1BFTA 1INEL 2EC9U 2Z8SA 1FL3A 4NQVB 5GSRB 3P4NB 4XT1C 4RAVA 4Z5RB 4TYUA 5EIIA 3AAZB 4LLMA 3MGTB 1SYSA 1G7IB 1HILA 2VIRB 1TCRB 3DGCR 1JF6A 1CR9H 2DN7A 4Y19D 3BUYB 5FDWB 3SE4C 3UYOD 1U9KA 4K9EL 1EFXA 3KWWA 1MWAL 2X4PB 5DJ2A 1JYWA 4JRWA 4CAGA 5DQ9A 3M17A 5I75B 1CLOL 5D8JH 1MFCH 2PYEB 2NY5C 2R2BA 5L2KE 1J11A 5EZIH 5MEOA 4BM7A 1DSFL 3MOQA 5D1ZA 3B5GA 1VENA 4NUGL 4O2EA 4DZ8A 4PRBB 7FABH 3LQAL 4LCUA 2I9LA 1YEHL 3QR2A 4F9PC 4HMEA 2ADIA 3UMTA 1NGYB 1KEML 4L3ED 4X4ZA 3ALPA 2QEJA 4XTRD 1QFUL 2CDGB 4OZFH 4XCEB 4LSUL 3G5XB 3SDXA 2BOCA 4U1MB 4HS3B 4YHKH 3T2PA 1TJIL 1MLCB 1BOYA 1RSFA 4RFNC 2EDDA 4JVWA 4X8XA 1U8MA 1G9MC 4OT1H 3HCVB 1INQB 4K7PY 4YR6B 3G5VA 3MREA 3O4OB 1RZKL 4XVTH 3UBXG 4AIZA 1CXIA 4RIRA 2K7QA 3QDMA 5E7BA 3SQOH 1NL0H 1X4YA 3DX8A 5EOTA 3U0PB 3EYUH 5GGRA 1RZFL 1FGNL 3SDCB 2Y7QB 4U1JA 4UOW1 4NCDA 2UV3A 4JO3H 5KVFL 1CICD 1KN2L 3MLSH 4U1HB 3VWKB 1AH1A 5ALCH 2Z31D 2PXYB 2H2PD 1NDGA 5CSBA 2VXSL 1KLUB 3GMPA 4OZ4A 5JQHC 3V6ZA 1Z5LB 2HT2D 4K8RL 4H88H 4YGAB 1YJDC 1AD0B 4XP9H 5ID1A 1DBML 4MD4A 4OKVB 2RCSL 5DURB 1FZKB 5K9QG 3VXUB 4OSUH 1VADB 4PP2A 4YDVA 4YBHA 3VXNA 3RPIA 1MCOL 1YEGH 4F37F 1EIBA 4LEXL 1D9KA 4P9MH 2BVEA 1MRCL 1DLHA 1HQRB 4JG0L 1PG7L 2RFXB 3TF7C 4NM8L 2YRZA 3BWUC 3S7GA 5HI4D 4DVRH 1FAKT 2H6PA 1U8QA 1M4KA 5CHNA 4XP5L 2FEEL 2VZUA 3VA2C 1KB5H 5CP7B 3Q1SH 3SDXF 1IL1A 1M7IB 2IAMC 1LQSR 2HWZH 4LQ1A 3X3FH 3HMWL 4GG8B 5A2IH 2KQNA 1FDLH 2ICCA 5HVWA 2P8MB 1MFEL 5L2KB 3T4YB 2H3NA 3H7BB 5CKAA 3HPJA 5JIIA 4BSVB 4J7RA 1IQWH 2MHAB 4RWHA 3LEYL 3H3PL 3MR9A 2BXZA 3OX8A 5I2IB 4LKCB 3QPQC 3I75A 3RVWC 4AL8L 1S9XA 4OCMC 3V52L 4KH2A 1UACH 4MHHG 3KXFD 5DEFB 5ITBL 3FO1A 1YMHB 4JRYE 4PGBB 2OSLB 3CLEH 3SCMD 3QPXH 1PGRB 2VZSA 3E6HB 2DD8H 1BD2D 1MVFA 1Q9KA 4LPCA 4AENA 1A64A 1V05A 3DX6A 4HK0B 3VXUD 1Y6NR 3KS0H 3KPQA 1U8OB 3PJSB 1OW0C 1YQVH 2WINB 3EYOB 4HH9B 3A6CH 3DYOA 1WITA 1IGTB 1NUGA 2ITCB 4PJHE 1MCWM 5E8EA 1FLRL 4ODTH 3QIWB 3V4PL 3L5XH 4FTVA 2DF3A 2IPKB 3WBDA 4FRWA 2AVGA 3MRHB 3GIVB 3DTXB 3GJEB 3PXJA 2I07A 4YGVB 2DQJL 1J7VR 1HOCA 3QO0A 4Z7QE 1QYGH 1XT5A 4FQLH 3SOBH 1OB1B 2B8OT 3VG0H 1KUMA 4CW1B 5F89A 4Y5YB 4UIMA 5TDOB 2ITDB 5FYLE 4JDZB 1G7QB 4A6YA 1N2RB 5CILH 1EAPB 3VXTA 1SMOA 1JYXA 4WEBH 4EVNA 1D7FA 4MD5A 5C3LD 1X4ZA 1CFTB 1TQBB 4J3UA 5EULV 1FNAA 2NY2D 4PJ9C 3EHBD 3CFKA 3RHWF 1NLDL 5D7KD 1ORQA 1YY8A 1KN4H 3OKEB 3GSUA 5T1DH 3SY0B 4ZUSA 1HH9A 3B8SA 1FNEB 1CGSL 1JPSH 4IRJB 3ARED 1IC7L 4KRPD 2CDFB 5LGJA 2Y23A 3FB5A 4R0LA 4P5MA 4PGJA 4KK5C 3VRJB 5LGHH 4HWBH 3UPRA 3T77B 5C0GB 4JQVA 5BVJB 4E0RA 4OCNC 5EU5B 3IDIA 3NIGF 3QO1B 4NRXA 1LILA 1GOHA 3O81A 4LNVA 5ESAA 1HHGB 3N85L 1AIFB 1FQ9C 4JQXC 2Y06L 4PB0L 4F80A 4ODHH 4NSKB 4U3CA 4YPGB 3FB8B 1LEGA 2PW2A 1RZ7L 3B9KA 4XXCC 1MQKL 2B7DT 1TNNA 5EBWA 1F45A 3K8KA 5E2UL 3D39A 4ORGB 1JL8A 1NKRA 4P3CL 4YHYC 3AC0A 2DWDB 3RZCA 1Q94A 4BQ8A 5DJ0B 2MWCA 3KPSE 4V1DA 2Q87A 1RJYA 4RGOL 2VISB 1FFRA 5HY9A 2FLRT 4Y16A 1OTTD 4W6WB 2A6JA 4JRYB 2B2XH 2XN9D 1MI5E 2C3VB 1CG9B 1I7RB 4ZO7A 3OAZH 4L8SC 1FP5A 4P5TC 1G7HA 2W59A 2R2HB 3VFPB 1HXMA 1JPST 3FFDB 3H42H 4Y5VC 1P6AB 1T66C 2C5DC 2UZXB 4WWKB 4HXBH 1NGXB 4WTXA 5I0DA 3WIIL 1JF5A 3BH8B 4LNRA 4PJHB 2FX8H 4OLZH 1MREH 1DEEA 4O2CB 1IGCH 4BQ9A 4XB8A 5JW4R 5D2LA 4X4XA 1RZ8B 5BO1L 2FHBA 1T80A 2CLVB 3V0WL 2HT4C 1SEBA 2EDEA 3CC5B 5DJAB 3NAAH 1UM4L 5DQJA 2V9TA 5BZWA 4MVBC 1ACYL 5IK3A 2JIXA 1G9NH 4ONFL 3TWCL 1D5MA 3WJJC 1UXWA 2G60L 2ERJB 5TQ0H 1B0RB 2EC9T 3S3SA 1YEEH 1A47A 2J1KA 4E41D 2LTQC 4UAOB 1GHFH 3OR6A 4HJGA 4U6TA 3DROA 4CJ0A 2YXMA 1X6LA 1YUHA 3DBXB 4YXLH 5AEAA 1N7MH 2JJTC 4ENEC 1KCUL 1MCKA 5LG1A 1DUZA 1FAIH 3V5HB 3R0MA 1ZLWH 1C5CH 3SGJA 3LKOB 1I8IB 4JFPB 3CIQA 4FS0A 2XI9A 1S9WB 2PNDA 2XFXB 5JHDA 1OAZH 4WFGE 5ECJE 3PIQA 4ZAKC 2LFGA 4DKAA 1P7QA 5T5NF 1CFVL 2H8PB 5JXEC 5DFVD 2FJHA 1H3PL 3HE7D 3SDAA 1KB9J 4WWKD 1HXYB 2YS4A 2HH0L 2VTFA 1PQZA 4X7DC 1A6UL 2AV7B 2FWOB 3V79C 3HZYA 4W81A 2AK1L 4ETQB 4JKWA 3DUUB 2XRAH 4N8CH 2ADFH 2H41A 4NQSB 1H5BB 2C7UB 5HDOA 2KZWA 1RJLA 3MCLH 2NLJA 1ONQB 5KSBF 3PWVA 1T1ZA 4GRMB 4N1HB 1MRFL 4NFDA 5BS0E 4HUVB 4LRNL 1VESA 3VWJB 2ZNXA 3HZKB 3F5WA 5FKAB 1WVZA 4G42A 2APVA 4WUUE 3IKCB 5JPMA 2EYTA 2H26A 2GK0A 3N0PB 4JFOA 5D2LF 3TA3A 1LO2L 3RWJB 3T1FB 3VFTA 3X14A 3LN5B 2AK4D 5CLWA 2AJYL 3KPSB 3ARGB 1JP5A 4WNQB 3SPVB 5I73B 5MEND 4HWZA 1WV7T 1CLZL 4OF3A 5EO1A 5LQBH 2CLZB 1CD1B 1W8NA 1BJ8A 5T1MA 1CXHA 1MI5B 3WFHB 4JZJB 4Y4KB 1BPVA 1MHEB 1YECL 1A4KA 2BK8A 1UC6A 5JORA 5IBUB 1Z9SA 3L9RB 3KR3H 1TITA 1EEYB 1KJVA 5L2JA 1T7XA 2DL2A 3W11D 3FONB 3W0WE 2IBZY 5GRUL 2W60B 1U92B 1LO0L 3QI9D 5C2UB 5ESVA 3IDYC 4FFYL 5GXBB 1A9BB 1I3VA 1I3GH 2I9TA 5CEXA 3BPCA 1DLFL 5IJVB 3MMEA 4IMKC 3P4OA 4MJ6B 2X4UB 5IVNA 5MEQB 1QSEE 3I2CL 4N5EC 3UZQA 5E2WL 3NN8B 5GS0L 5F1IA 2R9HC 4LCWE 2DYPA 3BJLA 4NNYA 4QXUH 3SKOA 3MRJA 4JGJA 4H5SB 4HKJA 2W92A 1NFDE 1P7KA 1ITCA 4TUOB 3VWJD 4K7PH 5ETUB 1V3JA 4NM4L 5F6HI 2AKRA 5J13C 4PJCE 5CSGA 2F8VA 4XMKH 1F97A 1E4JA 2WANA 3DPBA 3VXPA 1JPGB 3QEHB 2FL5A 3JWDL 5FECA 2YA2A 1XZ0B 1QBAA 2VXUH 3QCTL 4I0PA 4M7JL 3FO0H 5F88B 2YK1H 5DVKA 1P69B 3MJ8A 3QPQD 3BH9A 5TE4H 4LARL 4HKXB 4X5XB 3WD5L 2E8ZA 3H0TA 3E1F1 5DJDB 5FYLL 5HGHB 4KJWC 1BZ9B 4NC1C 3GGWB 1UYWL 5GRZA 3TO4A 4WI9A 2BDNH 4FQ2H 4HFUL 1MCFA 2VLRA 1YDPA 3AS1A 1T2QL 5J7CC 1R3KB 4LKXB 1IT9H 3HFMH 3WCYA 2COQA 1NMBL 4HXAL 5B22A 3PV7A 3KJ6H 2IFGA 4W4OA 2BSTB 4DN3H 5BS0B 1QVOB 1KT2B 1UA6L 3LZFL 1UCBH 3TH3T 3PL6D 3H7LA 4WUUB 3D9AH 5EU4B 3MNZA 4M1GH 2EKSA 1WTLA 3QWQB 4R3SB 4N8VB 3AU1A 3O2DH 1EMTL 3MA7A 3V8OA 2CXKA 2EDJA 4MNGE 3T2NL 3KNBB 1IEAA 1V3MA 3IU3B 1Q9OB 2GSGA 4MQ7A 2OBGA 5F1NB 1JHKH 4QYOA 2YD6A 3QDGA 3Q5OA 4RGNC 5FA4A 5AZ2L 3QZWB 4L3AA 5F96H 5LCVH 4F3FB 1F8TL 3A6BL 2QQKL 3W0WB 4PJ9D 4WFGD 1EEZB 2NY6C 1MJUL 1LD9B 3NZHH 4Y4HA 3UCRA 1FJ1B 3B5HA 5E2JA 1BBDL 4LSRL 4X99A 3HE6B 4MJIE 3ZTNH 5J1SC 5D70H 3RWIA 3HC3L 2A38A 1MAJA 1U95B 3KHQA 5D2NE 5TJWK 3L7EB 4MCYA 1BECA 2KKQA 3KPMA 4WEUD 1HQ4B 1QSEB 2V5YA 1YYLL 1QQDA 4JFDA 5E8PB 4LCWB 4KK5D 3U0TB 1ZLVH 5FB8B 3IRZA 1N59B 2HFGH 1FYTE 2WBJA 3BO8A 4WV1B 1NFDB 5C0BE 4LSPH 1R3HA 4HLZG 1RZIB 1PZ5B 1FNHA 4PJCB 4ZFOA 5ITFB 1CTNA 2YZ1A 1MFDL 3WS3A 1FZJB 2WUBH 4V2CB 3RL1B 4MQXC 3FRPG 3RNQA 1H3GA 4Y7MA 1LVEA 3VFUB 3V2AR 5ELIA 1QBBA 1WCQA 3LPFA 1RHFA 4GXUM 4D0DB 2BSSA 2G2RA 1SM3H 2VDML 4YHIA 4M8QA 2VQ1B 2VZ1A 1OAKH 2CK0L 5CWSA 3I02A 4WWID 4MCZB 4M62L 4P3DA 2K1MA 1M6OA 3SDDD 3V6OE 1I9IL 2WUCL 4PD4K 2CLRA 4UOW0 2VLJD 4ZOEA 1S7SB 4GKSB 3BDXA 3FO2B 1F4XH 1JPFB 4LGPB 1XEDA 1ZLSL 5A2FA 5TH2A 5F7MC 1T1YA 4KMQA 5EIQA 3ZT6A 3G04B 3LQAC 5DJ6B 4HUXA 1T4KB 1QSED 4NO2B 2CIIA 1LP9A 4LAQL 3QNXB 3VG9C 2DWEB 1S9YB 1N8ZA 4L4VA 4OD2B 5EFIA 1BM3H 4QRPA 1S7TB 4O5LL 9CGTA 5IVOA 3BDBA 3T4AB 3K8LA 1K3IA 2XXCB 5SWZA 5IR1A 1J8HE 3MOAH 3PHOA 5E8OA 4BFIA 4G8FA 5ICYB 4UQ3B 5EOQH 1X5YA 5DTFA 3FB6A 4YDLB 2DQDH 3CUPB 4MNGB 1WGOA 4XCCH 1HH6B 5T5NG 2ZUQB 2MQ3A 5I1CL 4QRUA 4ISVB 1JFQH 4GKZB 4IHOA 1R3IH 3BPOC 4OM1L 5HYJE 4DGYH 1XIWB 1WFOA 3BZEB 3PWLB 3RJDA 5JLZB 1U58A 4ZD3L 3MODH 3L1OH 5KVEL 1CGWA 3D3VE 4EJ1C 2ZKHH 5DVOA 5AWNH 3U2SB 1ZT4B 5IVXA 4PR5B 4MAYC 4K7FA 5IG7B 5A2LH 2JK5B 2NR6C 2UYLA 3TCLA 5F9WB 2NY1B 1C5BH 4U6HB 4ZS7H 4MJIB 3MRGB 5F7DB 5IV2B 1TETL 5D2NB 1RIUL 5C9KA 4X6EA 3O8XB 1CGTA 1AQKH 4RRPA 5EC2A 3FQUA 3VFRA 1QKZH 2Z0BA 4JHZA 5T3XE 2MJWA 1OOAA 4A6YH 3GSOB 3LMJH 3MNWB 1JUFA 4XHJD 4PRAA 4LBEB 3FT2A 1KNOA 2XZQL 1FYTB 4KHXL 4K71B 5C0BB 2PKDA 5CZKA 1KG0B 5TQ2L 3IAGC 3LSOA 2LU4A 2G9HB 4X0KA 3VH8B 1GZQA 1D5BA 3I6LD 2ATPA 3OQ3B 1IZJA 1GOGA 4PJEF 3F7VA 4NZTL 5DGQA 2W0LA 2R56H 3IF1A 4QLRA 2ESVB 4FHBD 3CMGA 1WT5A 1E6JL 2AI0H 1UH3A 1YNKH 3IFOA 5KVGL 1LP9F 4PJ7E 4XVUD 4OIBA 1LE9A 3QUYA 5I9QB 1GGIH 4S0TD 1JF1A 5GISH 4OGZA 1X6NA 3PWJB 1NAMB 1O7VA 1OAUL 1U8PB 4FQQA 1NAKH 3ARFC 4OLXH 4EOWH 3P40A 3MRLA 2GJJA 3QJFA 3L3KB 3WL9A 4X6FB 1IGYA 1KELH 4MJID 4NKOB 2IALA 4PREA 5CCKH 4FZ8H 5GGQL 3O8XD 1F6AA 3LEVL 3HB3C 3MRFB 1W72B 1JNHA 4FZEL 1NCWH 2GJ6D 4QNPE 1VPOH 3IETB 1SJHB 3CMOL 3DMMA 2BCKA 4FQHB 4LSQH 4MNQB 4YHZL 1DBBL 2J88L 4JKMA 5IVXF 2QJDA 4N5ED 2GY5A 3VXSE 1J8HB 2R9HD 1RIHL 1XR9A 4FQXD 3VW3H 5C7XH 4QRTA 5TDPA 4FXGB 1T03H 3UTTE 1RU9L 1ZA3A 3FMGH 4L8DB 1AGEA 4LVHB 1QPXA 3RVUC 2GAZA 3NVQA 3CX5K 5FA3B 3HG1A 3HI1B 1T2XA 4MMZC 2BNQD 1UB5A 5GZOC 1I9RH 1TZHA 3DVGA 4NKQB 1NEZG 3D3VB 1BJMA 1QLFB 4YLQT 3GI8L 2VQUA 1T2JA 4JO1H 1JNJA 2DLGA 3AB0B 4YWGH 1HKLH 5C0CA 2KBGA 3EOTH 1T21B 5KSVA 4LVOB 4XP1L 4GRWH 3ZE0F 3NIFE 3VFSB 4EN3D 3MRNB 1DBKL 2WWMD 3PWPE 4RA3A 3TH2T 5GRXG 3S4SG 3T3ME 1DBJH 5SWSE 5D9SA 1P4LB 1S7XA 1HYSC 1K5NB 3RIFF 3O4LA 4JPWH 5DF0A 1N6QL 4WW1B 4RZCA 2X7LB 1U8JB 5CEYA 3I6GA 3WEXA 3EDFA 5TE7H 3CFBA 4HG4J 1MELA 1UH4A 3IJSB 2W0PA 4Q6IB 4PUBH 2Y5TA 4R7NB 1H15B 2E6JA 1J8HD 4G7YH 2NY0D 1DQML 2V9RA 3O3BB 4M7KH 4OV6F 5TE6L 1DQDH 5TDNA 1A6ZB 2BP3A 3MRBA 1DL7H 4GMTL 5BMFH 1RFDL 1I1AA 1LO4H 3DIFB 1NQBA 5HYJD 4PJ7B 2R4SH 5FO9B 2IQ9L 1U8KA 1V8HA 3IAQA 4Q6YA 1DFBH 4ERSL 2ICEA 2FBJH 1K8DA 4HCRA 2N1KA 3D3VD 3ROOA 3OXRA 3S34L 4OLWL 3BPLB 4KDWA 3KLAB 4RGND 5DT1H 4PRNA 1PD6A 4JY4A 3S5LB 4KU1A 1OGAE 4F58H 1AJ7H 5GGUB 5B39B 1C7TA 1I8MA 4GG6A 3LDBB 1DVFD 4U05A 3BD5A 2XOTA 4LAJH 1WLHA 3BAEL 4ODSL 4ODWB 3WO4B 2XWTB 1ZGLA 4R2GC 1YEDB 5BV7C 3LN4A 1DP0A 4PJIA 4XWGH 2HVKB 4QHKJ 1H3TA 2EDNA 4QXWA 3VXSB 1NAML 3VCLB 2GSIA 4Y89A 3BZ4A 4ZUTA 2OR9H 5TF1L 4NQCA 1IEBA 3IT8D 3S6CA 3SGEH 3O2WH 4YNYA 2O5ZH 4J6RH 1AO7E 1E4KA 1SYVB 4HKZA 4H20L 1MY7A 4H1LB 2FH8A 3B3IB 3RGVB 3WFZA 5I71B 4ZS6C 4GH7B 4LPYA 4HUWA 4PG9B 1DQLH 5I1IL 4XNMB 1W72L 4DCQA 4MQXD 5I8OH 2EIZA 3WIHL 4RA0C 1Q1JH 1QNZH 2X4TA 4Y19A 4RWYL 4IMLA 4ZFZA 1XH3B 2APTA 3SE3A 2EEBA 4AM0B 4I5BB 2AXJA 4KKCC 4XNXH 3SGEI 2M1KA 2IEPA 3ILPA 3PWPB 5IW1A 4Y5XA 4TTDD 5ANME 2R0LL 4YHNA 4DVBB 1T7WA 1A6VH 2BVPB 2R8SL 4PGCB 4OI7A 1I1FB 3K80A 1GSMA 2VOTA 4NBYB 4IOFC 3HUJA 3SDYL 2D2OA 2HP4A 3BP7B 3TBWA 2ZCLL 3ULUE 2MNUA 2BERA 1YPZA 3O2VH 1P53A 4RSVA 1J0ZA 4Y5YC 3C08L 1XCQA 4GW1A 1KC5H 3ROLB 4GG6F 3UTTD 3GMOB 2YRLA 5IM7B 1A1NB 5DEGB 1CU4L 4U2ZA 5IROA 4M5YL 3OR7A 3DHMA 1F11B 3T65A 4NQEA 3T09A 1QR1B 1A1OA 3GSNB 4PJFA 5T3XL 4R4NC 5CZVH 3TN0B 4PJIF 1FL6B 2OCFD 3HS0A 4MJ4A 4FXLA 4OTXL 5KG9A 3MCKA 1RUKL 5EC1B 1EERB 3UYPA 2ATKB 1V7ML 2BVOA 2NXYD 3U48A 1NBZB 1N5AA 4TUKL 1OGAB 4PJ8B 4XBEH 4IRJC 4ZUUB 5H35A 2D03L 5IQ9B 1QRND 2AGJL 4MSWA 1CDIA 3QIBD 4X6CE 4JFFD 3HNTL 1XF3B 2V5MA 5SWSD 5B3NA 1TVDA 3FQTA 1HDMB 3IDNB 3KPPB 2J4WL 3JSSA 5JPNB 5IKCB 3OKNB 5KAQF 4DQOH 4YHPB 2EDXA 4GMSH 5LKNA 5A2KH 3QYCA 5I1HH 2OK0L 3FFCE 1N0XH 4BH8A 1MJ7L 1P5VA 3ET9F 5T3ZD 1E28B 3TBYA 1AO7B 3CXDH 4PG2C 25C8L 4ZTPH 1RULL 5K9KB 5MP6L 2YBRB 3NA9H 2YHGA 4WDIB 1VCAA 1ZHKB 1BIIB 3OBAA 2A83B 2X70B 3HUJF 3L95B 5ESQB 2VSCA 1WBZA 4HX1A 4L1DA 4TRPH 5F9JB 5I8EB 2D7OA 2P5WD 5EBLB 1YPZF 4S1SL 4DFHA 4ZOAA 3VXRD 3ARPA 4JO4L 4TPRL 1S9KC 4OUUB 1BQHG 1L7IH 2OR8A 3O6LL 4U3HA 2A6DB 5ANMB 1UFUA 5EB9A 2NY3B 3S37L 5AZEH 1A2YB 3LIZH 4NKDA 3TJHC 2DI8A 1U6AL 3MFFB 1BFOA 4OLEA 5DJCB 1X7QB 4XNQB 3ETBF 4K3EH 4AG4L 3DYMA 1YNTA 1ZHBA 2JELH 4PTTB 1UWEH 2V17H 4FFWC 5K9JL 5CSZB 1F4WL 1CDGA 3H9SE 4HWNA 4K94C 1U2HA 3HB3D 3KXFA 2FD6L 2VDQH 4UV7L 5IBTH 4CVZB 1GAFH 3MJ6A 1NCDH 4JLRA 1NC2B 3TVMB 3NABL 3KLSA 4XGZB 2ERJC 1UZ6F 2GUOB 3S88L 4OFPA 1FZMA 3DUSA 1BREA 3O11A 3SO3C 4F7TB 5J9PA 3RY6C 5D1QB 4U1SB 4UAOC 5GS2D 2FLBT 3MTRA 4FQIH 1PX4A 1OCWL 2VR9A 5EOCJ 3WN5C 4ZFGH 5FO8B 3C5SB 1EHLL 3DOSA 1TVHB 1NCCH 3RVUD 1NGPH 4KVCH 1EO5A