2VXQH

Crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
213
Chain Sequence
VQLLESGPGLVKPAQTLSLSCAVSGGSIRSGGYYWSWIRQHPGKGLEWIGYIYHSGNTYYNPSLKSRIAMSVDTSENKFSLRLNSVTAADTAVYYCARLDGYTLDIWGQGTLVTVSSSTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLLEN ALLERGEN PHL P 2
publication title High-Affinity Ige Recognition of a Conformational Epitope of the Major Respiratory Allergen Phl P 2 as Revealed by X-Ray Crystallography.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 41
structure length 213
sequence length 216
ec nomenclature
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH01
2FSEA 1UACL 5FUOH 5ID0B 2NYYC 3RL1A 1GZPA 3FT3A 1WZ1H 4JVPA 3TN0B 5H94B 5HPOA 1LO0L 4JJ5A 3TBWA 4H0HB 3G6JF 4HIEB 1CL7I 3GSVA 4POZD 1FL6A 3IDIA 4LLDB 1KTDA 2BNQA 1L6ZA 3GBLA 3KYNA 3QCTL 4HJGB 3PQYA 4YGVB 4M62L 3X3FL 1PSKH 5B22A 4RGNB 2AJXH 1JTPA 5KVEH 2P8LB 3LSOA 3G08B 5C0AA 5HGGS 4PPTA 1IC1A 1WAAA 1X5AA 1UQSA 3LN4B 2FGWL 5I30H 5EPMB 4LSQH 4IDLA 3ULVE 4ONFL 2B4CL 2EH7H 5I0ZA 4GFTB 5T3ZD 1QD0A 4TUOB 4RWYL 3OG4B 4J12A 3L6FB 4KTDH 1CFTB 2R8SH 3MCKB 4R6UA 1CVRA 1LHZA 2FSEB 3GUTA 3HUJA 5BOZG 4PD4K 1IGCH 4CKVX 3M8OH 2VLKE 1B88A 4HWZA 2W38A 3OQ3B 1AGCA 1GZPB 5HDOA 3FT3B 1UZ6E 3V4PL 4F58L 4JO1L 4JJ5B 3BT2H 3TBWB 4Y5YC 1ZA6A 3I2CH 3GSVB 3TA3C 1FL6B 3IDIB 1KTDB 2BNQB 4MXWH 3KYNB 1DBJH 3PQYB 2JB5H 1CDUA 4Z7OF 1A9EA 4KRPD 4HC1H 3BH8A 4XCCH 2C4FT 3CPLA 1RU9H 1OTSC 3D5OF 2NY2C 2FR4A 3LSOB 3QA3A 1T1ZA 2XZQL 5C0AB 5F6IB 1U41A 3LKPA 2FIRT 3T0DA 4QYOA 1UQSB 5FOJA 3BIKA 4U7SA 5KS9E 4NRXA 1GYAA 2MMXA 2GJJA 3EYFA 1UYWH 5T5NG 1AO7D 3WMSA 3MC0A 3GNMH 3CXDL 3VD5A 4Y5XC 2FBJH 1VDGA 2R2BA 3EAKA 4FFWC 4XB8A 3FRPA 3GUTB 3MOAH 3VXTB 1CICC 1BAFL 1P5VA 4HWZB 3MJ7A 4JM2F 3WJJC 1IAOA 3HA0A 1AGCB 3I85A 4GBXD 2HKFH 1EVTC 1CCZA 3BESR 1ZA6B 2FEDD 1AE6L 1DQDL 1RZKL 4QOKE 1OPGL 4K7PY 3RGVC 4FQJH 3B9AA 2HLFC 3UTTA 2J5LC 5EOTA 3EO9L 4NN5C 3TYGL 1RUAL 3CSPA 1A9EB 4GQ9L 3BH8B 3D48R 4FOMA 3DROA 3CPLB 4ONGL 4CN1A 3O2VH 1Z3GL 3VDAA 2FR4B 4JFXB 3QA3B 4X6CE 1T1ZB 2IQ9L 3N9GH 3C60D 4JFFD 3LKPB 4MD5A 2IBBA 5EH1A 2NQCA 4QYOB 1XF2A 3BIKB 3VDCA 3QCVH 4CMHB 4ZS6C 4NRXB 2D4DA 3R4DA 4KROC 4KTYA 2VQ1A 3O8XA 1FPTH 4U49A 3EYFB 4YHOL 5EOQL 4UTAL 3TBVA 4JFEE 1X4YA 5T1DL 1ORSA 4HWEH 1A3LL 3KPSD 4LPYA 4OLXL 3MJ7B 3O11A 1IAOB 5CSGA 3MQIA 3L1OH 5GGVH 4PJXA 4JQXC 1D5IL 2Y6SC 4IOFC 4GLRI 4NQVA 3RY4A 1MHCA 3S6CA 4WNQA 4X4ME 4YXHH 1CTOA 5C0ND 2F58H 1SM3L 2BXYA 2DIAA 3UTTB 2D03H 4HFUH 5EOTB 1QA9A 1HYSD 3MACH 3NA9L 2DLTA 1H0DA 3QAZB 3DROB 1LDPL 3VMNA 4FQXD 4A2MA 1NGQH 1H3XA 2R39A 2KDGA 2ZWLT 5B39G 3VRLE 5GS3A 2JJTC 4MD5B 3DXAA 4J7RA 4IRJD 2PXYC 1A8JH 2VDKH 5GRWA 1XF2B 4GBXC 1GHFH 3QPQD 3ZKXB 1FFRA 1RVFH 3S88H 3R0MA 2E7HA 2KQMA 4JO4H 1D7FA 2VLMD 2VQ1B 4RWHA 3O8XB 5CP7A 2G60L 4FZ8L 3VD3A 3TBVB 1MUJA 1QNZL 2QTEA 1T1YA 4FQIH 3SGDI 3B3IA 1ORSB 1PG7X 5J12C 5SX5K 3ZYZA 1OTTD 2Y5EA 3DJ9A 4F7TA 5GGVY 4BH8A 3O11B 4Q0XH 3UMTA 4JRWA 3WYRA 4P2RD 3TJHC 3O0RH 2IANA 5EU7E 4LRIC 4PJXB 4I3GA 4U1JA 4U1LA 5EIIA 1BM3H 3U9UA 5I1GH 4NQVB 1MHCB 5CIPB 4FQLL 4WNQB 3FMGH 3VW3L 2YWYA 5C86A 1FLTX 3QWRD 1QA9B 2HWZH 4OLYH 5JPNA 1IC4H 5HI3D 5HHOD 4PRPA 4ERSL 4G7VH 1IGMH 4KPHL 1FBIH 1H0DB 4PJDA 3SKJL 2UWEA 1OAKL 3IS1X 5EZIL 2J7LA 5C07A 4KY1H 2BVPA 3C8KA 1EMTH 5KVFL 5MI0B 4DTGL 2MQCA 3OJDA 2M2DA 3DXAB 1Q94A 3CC5A 4HD9A 3I84A 4JFZH 3SKMA 1AXIB 2ED8A 2W9EL 4MQXD 4JPWL 4GKZB 4OIIL 3HMXL 3ES6A 4C57C 4F7MA 1MFAL 3WSQH 3HC4L 1RULH 1KB5L 5CP7B 2A9MH 2BHUA 3DSNA 1MRFH 5C0NC 3HG1D 1MUJB 1F3RB 3QO1A 1KXVC 4O2CA 1T1YB 2FX9L 1YEJL 1JGVH 3B5TA 2Z8SA 1J1OL 3B3IB 3EYVA 1DANU 2ITDA 4MNGA 4PTUA 4F7TB 3VH8G 3ZYIA 4BH8B 3QZWG 5DURD 4HEME 5ESQA 4NP4H 2IANB 4F57H 3HNTL 4U1JB 3RA7L 4U1LB 5EIIB 5D8JL 3U9UB 2NY5C 3MV9D 1I9JH 2X5PA 5I9QB 4L4TD 3UO1H 5DUMH 5GRVL 2EDHA 3T3ME 1KLFA 2VKWA 1NANH 4PUBH 1YMMD 1G9EA 5TPWH 1A9BA 1FNEA 3OG6B 3B43A 5JPNB 3PWUA 3F58L 4PRPB 2F5AH 5I15L 1AFVH 1N6QL 4JRYA 5CEXA 4PJDB 2UWEB 3LV3A 4NC1E 4WY7L 2X89A 5C07B 2BVPB 4NNYA 3C8KB 3NIGE 3Q1SL 3QG7H 3KXFA 4QHKJ 1NCAL 1A6TA 2P44B 3S5LA 3VG9B 3OJDB 2FX7L 1Q94B 4LASH 3CC5B 6CGTA 4P9HH 3SKMB 2C26A 4QF1A 1F4WL 3JUZA 1GGBL 3A6BL 4YHNA 1CGSL 3HPJA 3ULUC 4HKXA 3ES6B 4F7MB 3MA7A 2BOCA 4XCEA 3QO1B 4Q9RH 4H88L 4O2CB 3DUHA 3GM8A 3NTCH 4UOW1 2APTA 3UCRA 4W4OC 2WBJC 1EHAA 3EYVB 2ITDB 3RAJH 2FEEL 4MNGB 3IRPX 4PTUB 1T7VA 5TE7L 4K9EH 4MQSB 1DSFL 4LEOA 5ESQB 1WT5C 3TO4D 4KKLD 1KXTB 4M6OL 1BQUA 5C0BA 4Y4HC 1Y6KR 4X4YA 1CL7L 4P48A 3RZCA 4GW4A 1A9BB 1FNEB 5GGQH 1AHWC 1WIOA 3WCYA 2CGRL 3PWUB 2QADD 3BSZH 1OCWH 1LILA 1RSFA 1JGLH 4JRYB 2VYRE 5CEXB 3LV3B 2E6JA 1HILA 3MFGB 1TTUA 4OAWB 3KPPA 5FKAA 3JTSB 4NNYB 5F1IA 4K3GA 3KXFB 3Q48A 2VXUH 3S5LB 1G9ML 3HAEH 4EI6A 4LQFH 3UYOD 2NXYB 2XKNA 1FCCA 3U1SL 4XT1C 2I24N 4QF1B 3HZKA 2YRLA 1JWMA 5E0QA 4YHNB 3HPJB 4HKXB 3MLXH 3RJDA 3MA7B 3QUYC 4OCRH 2BOCB 4RBPH 4ZUWA 4XCEB 5A40E 5EUOE 4K2UL 3ZTNH 4FTVD 3HI6L 4OZGA 1QHPA 5I73C 2VR5A 5HXMA 4OD3H 4G8FA 2OMBA 4DKEL 3QJHA 5D1XC 1B0GA 5MEND 5ISZE 3QCUL 2LVCA 2DF3A 4YDIH 5F8QC 3RNQA 3HTLX 3MRNA 4LEOB 4YXKH 3S36H 2H45A 1NMCB 2AI0H 1GOHA 1F00I 2APFA 4JKMA 5C0BB 3LIZL 3LDBB 4X4YB 3RZCB 1GGCH 1YY9C 3BPNC 4GW4B 1XEDA 1HINH 5J1AA 4NJ9H 4DVBA 4N90E 5ICZA 2P42B 3BN3B 5GISH 1HILB 2VOTA 3KPPB 5FKAB 4BA8A 5F1IB 5FK9A 3MV8E 3EOBA 2AS5M 3TZVA 4O2FA 1FO0L 4TTDC 4MA7L 4EI6B 1MCRA 2KZ1B 2XKNB 3VXPA 3IF1A 1TCRA 2VZOA 5K9JL 3HZKB 2E7LA 4HW6A 5C2BH 1QLRA 1JWMB 1T2XA 2HT2C 1EO8H 4IS6A 5IMKB 2B1AH 2E7BA 4ZUWB 4JN1L 5IT2H 5DF0A 1TCMA 3PF2A 1IGFH 4XNUH 4OZGB 5JW4Q 1EJOH 1XCQA 2X10A 1KSRA 4G8FB 5JMOC 3QJHB 1B0GB 1OVZA 1IKNC 1RIHH 3RNQB 3MRNB 4RCAA 5IHUH 1FV1A 4HKBA 5BVPL 3KYKH 4RMWA 1ED3A 3WXWL 1ZVYA 4GOSA 4YC2C 4LP4A 2VISA 4N1EA 4QCIA 5I1JH 1JUFA 1ZK9A 3PP3K 3ARFA 4WWKC 5E08L 2F19H 2G9HA 5J1AB 3BDXA 3O6FC 3I9GL 3MGOA 2ZSWA 1UWXH 2WW8A 5FO7A 4DVBB 5ICZB 5D2LA 5JXEA 3MLRL 2X1XR 1A1NA 5FV1L 4YFLF 1MFNA 1OAXL 5DEGA 2QQLH 5FK9B 3V4UH 1LQSR 3EOBB 5I75B 3T65A 5IFHH 3TZVB 4O2FB 4G9FD 1I9RH 2ZNWA 4OF6A 1FRGL 1PKQE 2XZZA 3DX9A 1Z6JT 3VXPB 3IF1B 5DJ0A 1TCRB 1IC5L 1QLRB 4JGUA 4LU5H 5IWLA 3UBXI 5FYKL 1TTGA 3GI8L 4IS6B 3C6LD 3KGRA 7FABH 1J86A 4UDUA 1LE5A 2VQUA 1CLCA 3TFKC 1T22A 2DWEA 3ARYA 3HR5A 4P4KD 2BK8A 3ILQD 4G43A 1PYWB 4HMDA 4RMUA 3PGFL 4WI2A 5IJKA 1XCQB 4CU7A 2VR9A 3BE1H 1NL0L 1C1EL 1J1XL 1SJXA 3VWKD 1F58L 4QHNA 3CVHL 4O9HH 4YPGA 5D7LA 4U0RB 1FV1B 4OGAD 4ZNCD 4KJQC 4LIQE 4X6EA 5I1EH 2VLLA 2IAMA 2ZPKH 1ED3B 4MZ2A 4MJ6A 2GJ6A 3MX0A 2VISB 4QCIB 1JUFB 3ARFB 1KB9J 5HTSA 2G9HB 1S9YA 5E9DE 5CJXA 4ORZC 2J8UA 3MGOB 2ZSWB 5FO7B 5LQBL 5D2LB 4UNTA 5GZND 4NQEE 1ACYL 2J88L 4EN3C 4PGEA 1A1NB 2X4NA 4O5LH 5JTWA 5DEGB 4KV5E 1KEML 4MDJA 1FC2D 3T65B 4MLSA 1XZ0A 2IG2L 1CVSC 3UJIH 2BSRA 3DX9B 1E4WL 5B21A 1KJVA 5DJ0B 1BIIA 1ZVSA 1KJ2L 1HNFA 3DMMA 3BGFC 4KHXL 3RTQA 4UDUB 2WIMA 1LE5B 4RA3A 2OL3H 5IESL 1T22B 2DWEB 3HR5B 3G5ZA 4G43B 3VXSD 3EJYC 5EO0A 3T0ED 1ZANH 3WNLA 3WKML 3HNVL 3GMOA 4QHNB 1TETL 1J0HA 3QIWC 1RZFH 4YPGB 5D7LB 4WEMB 4GJTB 1UM5L 4X6EB 2Z35B 2VLLB 2IAMB 1BD2D 5DUPH 4MJ6B 2GJ6B 4G3YH 4XTRC 3TBTA 3QG6A 1QLEL 3ZKQD 1S9YB 4PFEA 2J8UB 4GAJH 2DQTL 4B53A 4XPTL 4WW2A 2B4CC 4PGEB 4G7YH 4XPFH 4XVTL 1IGIH 2X4NB 1AKJD 4ELMF 4P49A 1QSFD 3MLVH 4MDJB 1BJMA 3EUUA 1RV6X 4K94H 1XZ0B 1ZV5A 2EIZA 4X6DA 4M1DH 2BSRB 5FB8A 1MAKA 5SV4A 1KJVB 1NMAL 4CDHA 1BIIB 1ZVSB 3DMMB 3BD4A 3D6GA 4MA3A 3RTQB 3MOBH 1PEWA 4R0LA 1DZBA 3GK8H 2YPLA 3G5ZB 5CJBA 3WDHA 3C5ZD 4QXGH 5K59E 5EO0B 2VXTH 1T7WA 2BNQE 3GEWB 3MRCA 4GT7A 4U6YA 3GMOB 3PQYE 2EDKA 4OF7A 4PB9L 3CJJA 4RGOH 2KH2B 2IMMA 4WUUE 2D3VA 2V2XA 4KJPC 1KENL 5TDOB 4ZXBC 3D85D 2KKQA 4HWUA 5C0AE 4Y1AA 3TBTB 1WAAE 3QG6B 3HAEA 3X17A 2ORBH 4HDIA 2XOTA 3V2AR 4N5UA 1WBXA 3U82B 3TIEA 4FNLH 2Q8AH 4WW2B 3C9NA 1A6WH 1NCNA 3LVEA 4QRPA 3MCG1 4WTXA 3B2UC 4UINH 3QUXD 3T0EC 4PJ8D 5JOPE 4E0RA 4N0UA 2EIZB 4TUKL 4X6DB 4IHOA 5FHAH 4JM4L 1FP5A 5FB8B 1HIML 5CEYA 4GRLC 1S9XA 4MA3B 5CCKL 1XIWA 1TMCB 4Y2DC 5DI8A 1PY4A 1YJDL 3KR3H 3VGGA 4R0LB 3QRGH 2YPLB 4CDGC 2CRYA 1RZKC 4ZYKB 5IF0A 3E1F1 3ZKND 3OV6A 1FFPA 1QFWH 3MRCB 2OJZH 4U6YB 3ULVF 1FVDA 5GRYA 1ZXQA 1KN2H 3MBXL 5JQ6H 4X7FC 2J6EA 2V2XB 1W72A 5DD0H 3I6LE 3M1BA 3QQNA 5HYIA 5F9JA 4Y1AB 1INQA 3KYMA 1KEGH 3KPMA 4Z95L 2VLJD 4K8RL 3HAEB 1BQHG 5C0RH 3OPZL 4HDIB 1QBLH 4Y88A 3EHBC 5JQHC 1WBXB 1UZ6F 3TIEB 4NRYA 3MJ9H 1JYXA 1GIGL 3C9NB 2O5ZL 4DOHB 2XICA 5J6GB 3FRUA 3F7YA 4QRPB 2YRPA 1QSEA 1RZ8A 4E0RB 4N0UB 1M05A 4KI5D 4NQDA 2H1PL 3VFRA 3ALXA 1EJ6A 4KKAC 5CEYB 4XNYL 3O9WD 4PTTA 1S9XB 4URTB 1XIWB 5C6PB 5DI8B 3LHPH 4IRSD 4CW1A 1QRKA 1ZTXH 2ZUUA 4NO5A 3V0AC 2NCMA 3RY5A 2ESVA 3OKLA 2WUBL 5IF0B 1OP3H 3NCBB 1SVZA 1FFPB 2X09A 3JVGC 2N7AA 3UTTE 3UYRH 4CADA 5KS9F 3RWFA 1K85A 1FVDB 1SY6A 4PJ9A 5BS0D 3FO0H 1L7TL 5FGSA 3GJFA 4DN3L 4QTIL 3GM0A 4Y8AA 5C6TL 5I71B 4HAFA 3G9AB 1W72B 5ERWA 3ZTJG 3M1BB 1RZJL 1N0LA 2VSDA 4OTXH 4CUCA 4NFCA 2IMNA 3LRGA 5F9JB 3HE6D 5H37H 1LK2A 2F54A 1INQB 1KIQA 3KYMB 3KPMB 4ODVH 5EBWA 1IEHA 4BZ1H 3MNZA 3RDTA 2Q3AA 2IPKA 4JKPL 4NRYB 5KW9H 4Z0XA 2AW2A 3FFCA 2R0WL 3FRUB 3F7YB 1QSEB 4UT7H 1RZ8B 4OCLC 1MJ8L 1G0XA 3BP5A 3KLSA 1RHHB 4U6HA 1M05B 4NQDB 5TF1H 1QFUH 3DSFL 3HI5L 2RAMA 2OTWA 4PTTB 2GYSA 5DVNA 3O4OC 5DJXA 4QTHA 3LEVH 1FFOA 4RZCA 4CW1B 2WBWB 3V8OA 1LEIA 1DEDA 4YZFE 4CBPA 3BRFA 4PJHE 1BGXH 4NO5B 1U2HA 4HPYL 4X6CF 2NY4C 1A0QH 2ESVB 1DQML 4O4YL 4ZODA 4P2YA 3DVFA 1FNHA 3C6SA 4CADB 3RWFB 4LRNH 4PJ9B 4P5TA 3GJFB 4ODTL 1VEMA 4JRXE 3A6CL 3QI9C 1LE9A 5TGBA 5ADPH 5ERWB 4V1DD 2OTPA 3SE9H 3D87B 4ZPVA 4Z7UA 1LK2B 2F54B 3MCLH 1KIQB 3DXAE 1CIDA 5EBWB 1VPOH 3MNZB 4X8JA 4QLRA 3RDTB 3VWJC 4AT6A 2IPKB 5E6ZA 2RGSA 2AAVA 4Z0XB 3FFCB 2LV4A 2GIYA 5DMGC 2OX5A 3VXRA 3BP5B 4GSDL 4U6HB 3SDDD 1UKSA 5C92A 1TQCC 2H2PC 1J5OH 2OTWB 3MLZL 4U6VH 1QFWM 5DJXB 4QTHB 1FFOB 4RZCB 5BV7C 1LEIB 2CR3A 3MRLA 2EXWC 5CILH 2OJEA 4GRWH 3VRLF 3DETC 3QDJD 3DX6A 4HXBH 3OKKA 5CJ5A 2FATL 1G7HA 1VB9A 4K3EH 4ZTOL 3UJTL 3C6SB 5GS0H 4HKJA 4MCYA 2CLZA 4P5TB 3L3OA 4CNIA 4P46C 2WMPA 4N5EC 1KGCD 3GRWH 1T83C 4PJDE 5EORH 4POUB 3SPVA 1LE9B 4MA8H 5TGBB 4OZFH 1MFCL 4ZPVB 4Z7UB 4TYUA 4LIQL 1CZ8L 4U2YA 2V7HA 4ZD3L 4OI7A 4KZEH 4X8JB 5TE4L 1FQ9C 4J2XA 3S96A 3SOBH 4UV7L 3CFKA 1NCCH 4N8CL 1DP0A 4XXCA 1QR4A 2BRRH 4LEXH 4OM1L 2A74A 5F89A 5AAMA 4JG0L 1FG2A 3B6SA 1VSCA 4PJEA 3VXRB 4YHMH 2HFTA 2WQ8A 2X70A 3C5JA 1R5IA 3O4LD 4M7KH 1PLGL 3CFIC 4NKOA 1CQKA 4LHJB 4KKCC 4X6BA 2EO1A 2AEPL 3BKJL 4PRBA 4ENEC 3MRLB 1CG9A 1CU4L 3ARSA 4S1DD 1I1AD 3DX6B 3OKKB 1G7HB 2E27L 4S1RL 4LFHD 3O6KL 1PAMA 4HKJB 1RZ7L 4HX1A 4OGYH 4C56A 4MCYB 2CLZB 4OLZL 3L3OB 5EU6D 4CNIB 2B2XL 2FJFA 4HUNB 1F6LL 3W11D 3LH2H 4OQTL 1FGVH 3SPVB 1YYLL 2NY6B 3FO2A 3MJ8A 4UAOC 1KELH 5I1LA 1AY1L 1YNLH 1KPVA 2MKLC 1G9MC 2V7HB 4JDTH 4P3CH 1CXLA 2FHFA 1L6XA 2UVEA 3NPSC 3VXME 1T66D 3S96B 1T03H 3IDGA 3CFKB 3PIQA 1TXKA 2W59A 3MRQA 2A74B 4XC3H 1BJ8A 5F89B 1FG2B 3B6SB 3HB3D 4R7DA 4PJEB 3ULVC 3T3MF 4NOBA 4S1SL 2DWDA 2X70B 3C5JB 3QHFH 1F3DH 1R5IB 5C09D 5MEPA 2YPKA 4XVJL 4JQVC 2F8XC 1CLZL 4NKOB 1QRND 5ACMA 4X6BB 1YEHH 4YWGL 1X6NA 1I1FA 1T2JA 1U8MA 4PRBB 2VDNH 1CG9B 1VFMA 4U1IB 4LGSB 5E00A 5C08D 3NIGF 1PEZA 4R90H 3CUPB 3T1WA 2AJVH 5FYKD 1F2QA 3VFVA 3SQOL 2MCG1 1TIUA 4M5YH 2ATKA 4HIXH 1OGAA 3N1FC 1CXHA 1G7JA 4NT6A 2FJFB 1ZLSH 3HRZA 1FL3B 3MREB 4XRCA 1EDQA 2R56L 3FO2B 4LVNB 3LS5H 2CK0L 4UDTA 1P69B 2ED7A 4Y19A 2N4IA 1R6VA 5AYUH 5DA0B 3MJ8B 2MCPH 2EDLA 5TF0A 5I1LB 1JGDA 1KPVB 4PJ7A 4LSVH 5A2KH 5FIEA 4PRHD 3VD7A 1SJEA 4IOSD 3BI9X 5DFVC 4RFNB 3RBSA 3MBEA 3IDGB 4NZRH 4O00A 2EDNA 3PIQB 1KF9B 3MRQB 1YEEH 3NCJH 5HI5C 2HH0L 4R7DB 2ZCLH 3PABA 4XH2A 4E41D 2DWDB 1UVQA 2C9AA 4OZGE 3WFHA 5MEPB 1OL0A 1BECA 2YPKB 4F9PA 2R2HA 1XF3A 4HQQL 4Y5YA 2L0DA 5HVHC 4ZSOA 1I1FB 1U8MB 5IG7A 5KJRL 5E00B 1D9KC 1OT1A 4GAFB 4N68A 3V4VL 1U8NA 3BZFA 5IB1A 4YHKL 1JYWA 3JWOL 2CDGA 2V5SA 4LVOB 4DVRL 4W6XB 3VFVB 1QTYT 1UJTA 2DDQL 3FOMA 1DTUA 5HGBA 2XN9A 4NWTH 2AJYL 4PD4J 2ATKB 1OGAB 3WN5A 5I8EA 4PJIE 1G7JB 4YHPA 4NT6B 1UKTA 1RK0A 2VC2H 5BXFA 1JNNL 3SJVE 1NBQA 3HRZB 5EUOF 4XRCB 5F7DA 2YPVH 3DX7A 3PV7A 4UDTB 4NZTL 1FLRH 2EDRA 1BBJA 4PS4H 4Y19B 3WNPA 3V95A 5CGMA 4KHTH 1JGDB 3AS3A 2FWOA 4PJ7B 1D5BA 4M02A 4Y7MA 1SJEB 2NPLX 3HR6A 4KUZH 5F9WB 1BFTA 3KJ4C 1GOGA 4FZEH 4R2GB 3MBEB 3SCMD 3SKNA 2E9WA 5CZVL 4M48H 1NMBH 5L9DH 3FN0H 2V2WA 5D9SA 1NLBH 2XY1A 5HYSG 2Z0BA 3PABB 4XH2B 1UVQB 3WFHB 1FE8H 2R2HB 1MCDA 5IMMA 1XF3B 3WS6A 2VDMH 4G6KL 4Y5YB 2H32A 2VL4A 1JI1A 1JGUL 4ZSOB 3W0WD 3GKWL 5DMIH 2D0GA 1B2WL 5IG7B 1I1CA 3CSBA 3NABL 5T33H 5I1AA 1U8NB 3BZFB 1D3CA 3MLSH 2MJWA 5IB1B 3KLDA 3BKCH 3L7FA 4LVHB 2CDGB 4YHLL 2GTWA 3CD4A 3FOMB 5HGBB 1S9WA 4KRNA 2XN9B 5FXCH 3WN5B 5I8EB 5AZ2H 2AQ1A 4YHPB 2R69H 1RK0B 1WFOA 3MRRA 5BXFB 3AGVA 3OAZH 4PJAA 4OLVL 4JPIA 2R2CA 5F7DB 3DX7B 3P30H 1BBJB 4KVCH 5HYEA 2H3NA 1S5IL 3PDGA 3VE0A 4MAYD 1J18A 2FWOB 2FH8A 3LQZB 1D5BB 1V8HA 2XQBL 3ARBD 1UCBL 2R15A 3LB6C 3ARDD 2DRUA 3SKNB 5E2TL 4M6AA 1MLBA 3NGBC 2JELH 1MCWW 2V2WB 5FGBA 5D9SB 3CVIL 3HE7C 2I5YL 5M7QA 3QXWA 5CKAA 3QO0A 5MHSD 4TNVF 4JQXA 5IMMB 1Y6MR 4K3JH 4NO3A 2AQ2A 4Z9KB 1VA9A 3LS4L 2H32B 2HTLD 2F74A 5I1AB 5EWIL 4CVXA 4UV4H 3U7AA 1A3RH 1EZVX 3L7FB 2GTWB 5HGAA 1AO7A 2DQUH 5EU7C 1S9WB 4JO2H 2AJUH 1P9MC 1KCSL 1S7VA 5EA0L 4R26L 3EDEA 1MI5D 2J8UE 3F12A 3MRRB 5E2WH 2EC9U 4PJAB 3O3EA 4JPIB 1EGJH 4R9HA 5L6YH 4GBXA 2W0LA 2JJWA 5K9QG 1BZ7A 1CXIA 2H3NB 4LAJH 3WUWA 3VE0B 1L9MA 1U0QA 1K3ZA 2A38A 2YA1A 4TRPL 3QYCA 2UZIH 1MCPL 2BVUA 4EQ3A 1TZHA 2BHYA 4J3WA 4FP8H 3VFSA 4KRPB 4EXKA 3QISA 5F7KC 2HJLA 2HLAA 2IPTH 4WI3A 3QO0B 3BMVA 5EOCJ 2I26N 2DL2A 1P53A 2J8HA 4KRLB 4BSVA 3C60A 4JFFA 4NO3B 4BK4A 4NZUH 4EQ2A 1EX0A 4TSAL 4F7EA 4WEBL 4X9IA 3UP1A 1NANI 1YZZA 1JZ4A 2F74B 3BEVA 4CVXB 4D0DA 4KV5F 3QDGD 3UROR 5DZLA 1MNUH 1YEDB 1HCFX 5HGAB 1AO7B 1CFNA 3WO3B 3IXTA 2DQDH 2HRLA 3RI5F 4C54A 4LCIH 3KPSA 5GGTL 1FC1A 3F12B 1B0WA 1X5FA 2JE8A 4NZJA 3O3EB 3WNOA 4CVWA 2OZ4H 5ENWA 1P1ZA 4GBXB 1X5HA 1BZ7B 4HT1H 1UB5A 3RZWA 3WUWB 1TVHA 4NNPH 4W70A 1ODAA 4NC1C 2HKHL 5I1DB 2Q20A 2W9DH 2HTLC 3DX8A 2R0KH 2HT4D 4EBQL 2QQQA 2GSGA 2JCCE 1TZHB 4XBGA 1YJDC 4JLRA 4NO0D 3VFSB 4TSBH 1WIPA 4XP9H 1IT9H 2HJLB 2HLAB 4KK6D 4L9LA 5CS7A 4FQXA 2E7MA 5BO1H 4Y16D 1EUTA 4BSVB 3C60B 4JFFB 4B50A 3QHTC 1WZ1L 4Q6IC 5HPMA 4YAQA 4YHYB 4IRJA 4NM8H 4F7EB 5DVKA 3BEVB 1V3JA 4D0DB 2EDFA 4AMKH 4CN4A 3H9HA 4LL9A 2GY7B 5DJAB 5JHDD 1O7SA 4JM2D 3QQ9D 1CFNB 3QDME 1TLKA 3IXTB 4DW2L 2I07A 4BQ6A 5J6HA 4WJ5B 4HF5H 5IB5A 2L4OA 1F13A 4K8RC 1SHMA 3KPSB 1UG9A 3PL6D 2F53D 3TT1H 5ENWB 1TZGL 2EXYD 1P1ZB 4FMKA 1MIEH 4P2RA 4WO4C 5DD3H 5E94A 5I76A 1UB5B 4OJFH 5I30L 1NPUA 1TVHB 5K59F 3M45A 3QIBD 1JPTH 2ARJQ 3H9SA 1NUNB 4XHJC 5LJYH 4KZDH 3DX8B 2EH7L 3QWRA 2GSGB 5FYJD 3IDXH 5HHOA 4XBGB 3DI2B 4JLRB 3QXDA 4KTDL 4ZAKD 1MCHA 4L9LB 4FQXB 3UTSD 5F1OB 1IGCL 1EO7A 1I75A 1WAAF 3M8OL 2DM7A 2DTMH 4LMQI 4AEHH 3BUYA 4UBDC 3F6LA 3BX7C 5HPMB 4YAQB 3FQXA 5F9OH 4IRJB 3SDXA 4OFKA 1KCKA 1XGTA 1OAUL 4LSRL 3I2CL 3BZDA 3N0PB 1F4AA 4JY5H 4PV8A 4D9RE 3H9HB 1RZJC 4K7PL 2JB5L 3KLAA 3HG1A 1ZE3C 2I07B 1TQBB 4FFVD 4DN4H 5J6HB 4HC1L 4XMKH 3WS3A 5IB5B 1PX3A 3IAPA 2PW2A 5IBUG 1N3NA 4EI5C 2QSCL 3WLBA 5IW3A 3W2DH 5E94B 4P2RB 5I76B 1BWMA 5A2JH 2MWCA 5SWZD 4TVPL 2Q3ZA 1DVFC 2XY2A 2EECA 1JI2A 3U46A 3MV9A 3H9SB 5KSAC 4L4TA 2HTKC 2GT9A 3MJGX 4Y5VA 1YMMA 3AROA 1UYWL 4C83A 1EH9A 3GNML 5HHOB 4G8EA 1S7TA 3QXDB 4KJWD 4RISH 3MOAL 3FT4A 1F4XH 4ESKA 3OJ2C 4FQ1H 1MQKH 3BKMH 1AGDA 4RBPK 2HKFL 3BUYB 3NZHH 5JIKA 1G0YR 3FQXB 3KPLA 2OTUA 3SDXB 1XGTB 4LLQA 5BRZE 2CO6B 1AHWB 4FQJL 4PV8B 3GIZL 5J06A 3H42L 2C7UA 3KLAB 3HG1B 4JJHA 2F54E 4JFDE 3IYLW 3BWAA 3WS3B 3TNMA 2PW2B 4WTZG 4MHHG 5L2KD 1N3NB 3O2VL 4HUMB 1Q9OA 1SBSL 1MCKA 5DURB 1A5FH 5DS8A 3TO4A 5B8CA 5SWSD 2X4PA 3DUSA 3U46B 3MV9B 3QCVL 4L4TB 3CX2A 3LQAL 1MFEH 2GT9B 4P2QD 4Q2ZA 4Y5VB 1U8OA 1YMMB 4C83B 1Z5LA 3RVVD 4Q97A 4G8EB 1S7TB 5DMJB 3NCMA 5BZWA 4Q6YA 5DJYA 3B9KD 4HWEL 3FB6A 3FT4B 2D7TL 4QRRD 4HGKC 4F37F 4S10A 2Y5TA 1AGDB 3VU2A 3L1OL 5GGVL 1DBAH 3MV11 1IILE 2WUCL 3IU4H 1BFSA 3KPLB 2OTUB 2KPNA 3FQRA 4LLQB 3S36X 3BPNB 4YXHL 1MREL 2F58L 2J3SA 1F97A 2D03L 4HFUL 2C7UB 4Z7UE 1GJIA 3RWHA 3EJZC 3BWAB 4FTVA 4N9GA 1WBZA 3TNMB 4XNZC 1MCCA 1Q9OB 1KLGA 2K7PA 4YZFF 4ALAH 4PJHF 4KRMB 5MENA 4KWUA 4AG4L 4P2OD 5DS8B 3SE4C 3TO4B 5B8CB 1REIA 2VDKL 3PWNA 1UWXK 2X4PB 4M1CC 4XWOD 3DUSB 1GHFL 3S88L 1BWWA 2VZSA 4JO4L 2X1PA 4Q2ZB 2XTLA 1U8OB 1HH9A 5F3HB 5DQ9A 1EHXA 2R4SL 3IFNH 1GAFH 2QADB 1Z5LB 5I1HH 1NCTA 5BZWB 3BPOC 4FQIL 5DJYB 1A1MA 2B39A 5DK0A 4XP5L 1F5WA 2NW2A 4R4ND 2Y5TB 4N8VB 1KIRA 3H7BA 5ADOL 3O0RL 5B4MD 3WIHH 2DB8A 5DZOA 3C5SA 3FQRB 4U4BA 3HI1A 5JW4M 1C5CL 1A6VH 1NEZA 4OF5A 1CD0A 2HWZL 3KHOA 3PWJA 5IQ7H 4G7VL 4D2NA 4FABH 4K07A 3BMWA 3RWHB 5JR1H 4FTVB 4RGNC 4N9GB 1WBZB 4AQ1B 3RVVC 4MSWA 3E2HC 4KY1L 1KLGB 4ZTPH 1EMTL 5MENB 3B9KC 4NFBA 2RJMA 3CXHK 2R29H 1C16A 4YJZL 1FHGA 1U8LA 3PWNB 4X9BA 3T09A 4NBXB 2V5YA 4XBPA 4X80H 2PTVA 1XF1A 3WSQL 2P5EA 2EKSA 3T2QA 5EO9A 1RULL 3NFNA 4ODSL 1HH9B 1QYGH 5DQ9B 1MRFL 4PJDF 4GH7B 3X3GH 2O5XL 3WV0A 1A1MB 5DK0B 2NZ9C 5KVGH 4QWWC 4J4PC 1T04A 3RWCA 2NW2B 1JIBA 1EEZA 1KIRB 3H7BB 3KPTA 4YEEA 4G9FA 4TNVK 3U0TA 4NP4L 3MV7E 4R4BA 5LWYH 1BZQK 4ORGA 1MCNA 4LSTH 3C5SB 1I9JL 3UO1L 5T3XD 3HI1B 1CT8A 5DUML 4L5FL 1NEZB 1NBZA 4RMSA 3C6LA 5I8KH 3F7RA 3PWJB 4L3CA 2IFFH 1WFNA 1AFVL 5CLTA 4P4KA 1GC1H 3MRFA 3JV0A 5JA9A 4MSWB 4ZFGH 4PJ5E 5F6IC 3QG7L 3VWKA 4LKXA 1QVOB 1Y0LA 5D6DA 2DQFA 1MF2H 1C16B 4LASL 2R23A 4OUUB 1U8LB 1DUYA 4NWUH 4OFDA 4I3SL 1IAMA 4XBPB 4KDWA 1J9CT 2GJZA 2P5EB 2EKSB 1FGNH 5EO9B 3NFNB 1BREA 4QO1A 1RIVH 1R3IL 3EZ8A 4Q9RL 4OGZA 4YUEH 3RVXC 3ELAT 3NTCL 5CZXD 1QFWI 2BJMH 3MXVH 3I02A 3L3JA 3RAJL 5E1AA 4J3UA 1T04B 3RWCB 4K9EL 1EEZB 2NR6D 1W8OA 4DEPC 12E8H 4NO2A 4G9FB 1RMFL 4PYHA 4R4BB 1OGAE 4ORGB 1CT8B 4OZHA 5L2JA 5I0DA 4XXDA 1NBZB 3ETBF 1V3KA 3C6LB 1WEJH 4WFHD 4LGPB 1S78C 5HHVH 3BSZL 4L3CB 1OCWL 1BLNA 1NCUA 4PJ7E 3EBAA 4P4KB 3MRFB 5A43C 2DI9A 2HRPH 3VXSA 1MJUH 2H41A 3QXAA 4QXUH 1UXWA 3B83A 3T0EA 1FNFA 3VWKB 4LKXB 1PD6A 3S34L 4XB7A 2AJSL 2PR4L 1Y0LB 2DYPD 2P4AB 3ZKMC 2DQFB 4Z7NE 2R23B 4DK3A 3EO0A 4CMHC 1DUYB 1B4RA 5C7XH 1N59A 1BD2A 3WFDH 3BGMA 3MLXL 2GJZB 3N1GC 3ULSA 3VGDA 5L88H 2X05A 1BBDH 4WDIA 1U6AH 1JMXA 3QRFM 1IGYA 4FQQA 5KANG 3I02B 3QP3A 1SVCP 3EJJX 3L3JB 1AKJA 2BDNL 2EE2A 5E1AB 1QSFA 4NKIL 5ACLA 5IVOA 4NO2B 4YXKL 4KK9C 3S36L 5FYLE 4HS8H 1JBJA 4R96A 4PJBA 4K71C 4OT1H 4OZHB 1LP9A 5L2JB 1FORH 4XXDB 1GGCL 3PNWA 3DLQR 4OZGF 1OLZA 3BOVA 1BLNB 3QAZC 3FRPG 4UT6H 3W9DA 4O2EA 3VXSB 3C5ZA 5GISL 3QXAB 3T0EB 5EBLA 1UXWB 1BVZA 3DUUA 5HJ3B 4D3CH 3ARUA 4WU7A 2XTJC 4P9MH 5TQ2L 3ZKXC 3EO0B 1N59B 1BD2B 2I60H 3TPUA 3BGMB 3O8XC 3D85A 5B38A 2WWMC 3MLTA 4PLKC 1INDH 4PJIF 1WSST 3ULSB 2DQHL 4JKKA 1NEUA 1VFUA 4WDIB 5IT2L 5B3JE 4XHQA 1IGFL 1NGZA 2EO9A 3DVGB 3U0WL 4XNUL 1N7MH 2PO6D 1IGYB 4FQQB 5LGJA 4KTEL 2D2OA 3GI9L 1AKJB 3S3JA 1QSFB 5FYKU 3QUXA 5IHUL 4PJ8A 4XMLH 5CAYB 3D9AL 1H5BA 3T4YA 4BQBA 1QFHA 35C8L 4R96B 4G6AC 4PJBB 1BJ1J 5EOCH 5KTEH 2ERJB 1OP3K 1YYMH 1LP9B 3H3KA 3NCYS 4PRDA 3PNWB 4I48A 1E6JL 2F19L 5CEZE 1PW3A 3W9DB 4NC2B 4PJFA 4DAGH 4O2EB 3C5ZB 4OZFG 5MI0C 1YEKL 4M7LT 5EBLB 4HIJA 2QQLL 3DUUB 3T2PA 5IFHL 3J7HA 4N0FA 1X44A 2RIKA 4UT9H 4WU7B 1X3DA 4DGIL 2IWGA 2ICWA 5FYLH 4JFOA 3BYYA 4NQSA 2X2YA 4QHKI 3VFOA 3TPUB 3D85B 1OM3H 5B38B 1F90L 3MLTB 1U8JA 1J11A 7FABL 2YD3A 1AQDA 4E9LA 4RAHA 2VLJA 1NGZB 1F4YH 2NTSP 5KSBE 3V5DA 2GITA 2JKXA 1N64L 5LGJB 5K9OA 1BQLH 4O9HL 1G84A 3QUXB 2P43B 4PJ8B 3L9RA 4HK3J 1I8KA 1H5BB 3T4YB 1ZHKA 4U3XA 2ZPKL 1WCQA 2DD8L 3MODH 4M1GH 1FDLH 3O9WA 4HLJA 1JK8A 5DMYA 1HQ4A 2VDRH 4Z7QE 4IRSA 4GG6F 4PRDB 4JFHD 2ICCA 1KPUA 4I48B 3OAUH 4YDJA 1F6AA 4LHQB 3HMXA 3L5HA 1IEAA 1ZT7A 2VRAA 4HIJB 4XNMA 3VG9C 1ACZA 5IBLD 4N0FB 5BS0A 1S7RA 1C7TA 3NCCB 3UJIL 2ICWB 2H2SD 4JFOB 4Z78A 4NQSB 8FABA 3VFOB 3F62A 4GKNA 4DGYH 2V17L 2N56A 2M1KA 3HE6A 1U8JB 4EDWH 2J8UF 4LCWE 1AQDB 2OL3L 1I7ZA 2VLJB 5E8DH 3AY4A 1SQ2N 1DDHA 4RMQA 3U2SA 3V5DB 2GITB 4O51A 5I1IL 3S3PA 5K9OB 3U9PH 2KZWA 2IBGA 3T3PE 2Y23A 2Q8BH 4F37K 3MUJA 3L9RB 1I8KB 1G1YA 1ZHKB 2BY1A 5DUPL 3KPSE 3O9WB 5CSZA 1JK8B 2NXZC 1HQ4B 4G3YL 3WE6A 4IRSB 4Z7VE 3BO8A 2YS4A 1KPUB 1CS6A 2JJVA 5ECJE 2Y36H 4YDJB 1F6AB 5KAQF 4RNRB 2FHCA 4GAJL 5KOMC 4JB9L 1W0WA 1A7PL 5E7BA 1ZT7B 2CLRA 5FM5O 4XPFL 1JFQL 3DYPA 5DJZA 1PKOA 2ZZUT 4PGBA 4XNMB 4QGYA 1OARH 2YUXA 3ALWA 3IETA 3P0VH 5BS0B 4K94L 1S7RB 2NXYC 4BSJA 1T21A 4M1DL 5EZLA 2VLKD 4Z78B 4JHAH 3TJEH 8FABB 2HG5A 4V1DA 4GKNB 3FN3A 3MOBL 3DVIA 3BP7A 1J12A 3HE6B 3X14A 1K5NA 4RMTA 1I7ZB 1V7MH 2AKRA 3FZUD 4WW2F 1U2CA 3DV4A 4U7MA 3UAJD 1DDHB 4J3SA 2PN5A 3U2SB 3FQWA 4O51B 3MLYH 1DBML 2DLFL 2AK4E 4A6YH 1NMCC 4RGOL 2EIEA 4KUCF 3VXQA 3OL2A 3SDDA 1FVEA 5IBLC 1RIUL 2JCCF 5CSZB 3LDBC 2R9HC 3RZCC 5J13B 1EPFA 4XCFL 3WE6B 3BO8B 4P2RE 3QEGH 3D0LA 2A9NH 4Z5RA 2YMXH 3ULUE 2ORBL 3MJ6A 3H9SE 3QDJA 3EYUH 2D31A 1W0WB 2CLRB 2ADIB 5LBSH 5DJZB 1A6WL 5B3NA 4PGBB 4UINL 3WFZA 2BNUA 3IETB 2NY0D 5CJOH 5FHAL 1T21B 3I75A 1BQSA 4M9PA 5EZLB 5J1TC 1OF2A 1WF5A 3U6RA 2HG5B 4V1DB 1SMOA 4QY8A 3BP7B 3RU8L 4GXUN 1MCJA 1K5NB 2YWZA 3SDXE 2DIBA 1N6UA 2AKRB 4QOKD 3DV4B 1Q1JL 1NC2D 3FQWB 3UTPE 1VERA 1RUQH 2ZUSA 1QFWL 1DBKH 4TNWF 3QNZA 2DQEH 1DLFH 2YD5A 4G6ML 4KK5D 3VXQB 3SDDB 1F8TH 1FVEB 4MAUH 4R4FH 3O4LA 1N5AA 4QRQA 4M6NL 1URLA 4PRIA 1FO0A 3RNKA 4XPGL 3D0LB 1XCTA 3I50H 5L8KB 4L3EE 4Z5RB 1NGPH 1QBLL 3MV9E 3QDJB 15C8H 1I1AA 2D31B 3LQAC 5I75C 4XAWH 4JE4B 1YMME 3TZVC 1DN0A 1L0QA 2YBRA 2FLRT 4XP4H 3V7AE 1D5ZA 2BNUB 5EU6A 3OKEA 4JVUA 1QO3A 4KFZC 2X4RA 3I75B 4R7NA 1NSNL 1NCWL 4B7IA 4P0DA 1OF2B 4XX1E 3G6DL 4RMVA 3BP6A 1J8KA 3U6RB 3OJVC 1V5JA 4QY8B 3LHPL 1CFVL 2DJUA 4R3SA 1OP5H 1ZTXL 2FGZA 1IM9D 5HHMD 4IJ3B 3ULUH 2NW3A 1VFBA 3ZT6A 5CP3H 3W39A 5HD8D 3QNZB 4U0RC 4QEGA 3A67H 3DTXA 1I3VA 4IBLT 3IFLH 2HN7A 5C09A 3O4LB 4FN0A 1N5AB 4QRQB 4NIKB 2Z8RA 5ESVA 4DGVH 1QRNA 1FO0B 4PRIB 3TCLA 3ARFC 3RNKB 2APXA 4ODVL 1XCTB 1ZHLA 5CHNA 2A6IA 5C08A 4PIRF 2HFGH 4BZ1L 5JXEC 1IQDA 1I1AB 3P73A 1MFDH 5KW9L 3MZGB 1ZKAA 1MY7A 3MA9H 1DN0B 2J4WH 2YBRB 1D5ZB 1QACA 3HCVB 5EU6B 3OKEB 1JV5A 1OOAA 1QO3B 2X4RB 4R7NB 5TF1L 1QFUL 5FYJU 2YA0A 3EIFA 2K1MA 3VFPA 4PR5A 3BP6B 5IWLC 1T0MA 4U6TA 3P4LA 3LEVL 2VLRB 3O6MH 3SDYH 4R3SB 4LPVA 1U36A 2J1KA 4YXLH 3ARTA 5CJQL 5CD5D 3ZDXE 5IJKC 4UNUA 4PRHA 2OR8A 2NW3B 3REVA 1VFBB 3KG5A 5DC4B 1JPGA 3DYMA 4NSKA 3DRTA 4RFOL 4DUXA 2ZSVA 3W39B 3NN8A 3DTXB 4E41A 1OWWA 2IAMC 3V79C 2HN7B 5C09B 3ZT5A 4YHZH 4I8DA 3BHBA 5T3ZL 2W07A 3FO9A 3B2VH 2RCSH 5ESVB 3SE9L 1QRNB 2AEWA 3TCLB 3V8CA 5IVXA 5FAAA 4OIBA 1ROWA 3WLWD 3MCLL 1VGEH 2DQGH 1ZHLB 2GAZA 2A6IB 4TPRH 5CHNB 5CJXC 5C08B 1WFUA 3I6GA 4YE4H 1E0OB 3ZE1F 1IQDB 1NFIA 3PP4H 5M95B 4TQEH 3P73B 4HHAA 1AP2A 1E4JA 3UJJL 2XXCB 1JYNA 1T7YA 3VXOA 1JV5B 2X7LA 3RFZC 4TULL 3PWPD 2AABH 2AQ3A 1QKZH 2WV3A 3DMMC 3VFPB 2O93L 4PR5B 4Z7UF 3RTQC 5I8OH 1T0MB 5JORA 2AXFA 4AK1A 3CLFH 5TE6H 1MSPA 4UQ2A 1IC7H 1NGXA 4U1SA 3ARXA 4PRHB 4H8WL 5ESAA 1A7RH 2C3WA 3REVB 1SJHA 1JPGB 4NSKB 3DRTB 2FZ3A 2ZSVB 3SCMA 5B39A 3NN8B 4K3EL 2DN7A 1NBVH 4X9FA 2ICES 4LHUG 5HDQH 1J8HE 3RVWD 3GBNH 5L7XL 1X4XA 2NY7H 3X13A 1AIFA 4E41B 1LO4H 3GRWL 5KSVA 5EORL 5C71A 3BHBB 3FO9B 2NY1D 4DCQA 3RHWF 3CMOH 4HZAA 1B0RA 5IVXB 3W0WA 3I3DA 2GAZB 3I6GB 2H26A 5KAQG 3JV6A 4WW2C 1NFIB 3RUGE 5ACZA 3RVUD 4HHAB 5E4EC 1AP2B 2XWTA 5HYJD 2P5EE 3KAAA 1A7NH 4LEXL 1FYTE 3NIDE 3T0BA 4XPBH 1CXEA 1T3FA 3VXOB 2X7LB 3ARVA 2OLDA 2WP3T 3GMNA 4LSPL 2VN4A 2DLGA 1CD1A 5JORB 2OXGA 4R0LC 2Q6WA 2AXFB 3AB0B 3GZKA 5AWNH 4K9EC 4MAYA 1QPPA 1JNLH 4G9FE 3U30B 2Q76A 1BF8A 2GK0A 1NGXB 2PF6A 4U1SB 3QHZL 4ZFFA 3ARBA 5ESAB 1SJHB 3S37H 3ARDA 2FZ3B 3SCMB 5BJTA 1PZUB 2XZAL 4HIIA 2R1WA 3X13B 5KSVB 1GGIH 4NHCH 3LH2L 1JWSA 2NX5D 2PKDA 2D4FA 5HI4D 4DCQB 2VMFA 4ZDHA 1ZS8A 2BY0A 4U7KA 1B0RB 1KELL 1YNLL 1EEYA 1S9VA 4N0CC 3U4EA 1FNSH 1MRDH 4JDTL 3EYOB 3L5XL 2H26B 4PJCE 4ZO6A 3TH2T 3JV6B 1ZLWK 3ESVF 5ACZB 1T03L 2XWTB 3SQBA 1FIEA 1S8DA 3QZWA 4XPHL 1YEGH 3T2NL 4XC3L 1AR1C 4PLJD 1M7IA 2CLVA 1N4XL 1T3FB 1OD9A 5EFIA 3QHFL 1MI5A 3G6JA 4I18A 3GMNB 5DGQA 5ISZD 2JLLA 2V5TA 1XIWC 2RB8A 1CD1B 2HT3C 1T6VN 2Q6WB 4MAYB 1UACH 2A2QT 1ZGLM 2Q76B 3OTTA 2GK0B 1CLOH 4ZFFB 3ARBB 1T0PB 4PP1C 3ARDB 1DUZA 1K4CA 2VZ1A 2CXKA 1YEIH 4OZHE 3SDAD 5BJTB 5JUEL 4N90D 4HIIB 5TDPA 5ALCH 4WHTA 5I71C 2LVEA 2R1WB 3TH3T 3MV8D 3AREC 1JWSB 3T0EE 1JP5A 4OCMC 3VFTA 5AYUL 3X3FH 3B9EA 4ZDHB 1ZS8B 2MCPL 4OSUL 4Q7DA 4UB0L 1EEYB 1S9VB 3LKQA 3U4EB 2D0HA 5AAWA 4LSVL 3QR2A 2X1WL 2IALA 3QDGA 1PZ5A 1BD2E 4GMTH 2FRGP 1BJ1H 4NZRL 3L3HA 1S8DB 3QZWB 1YEEL 2FGWH 4JHZA 3NCJL 4M00A 2VH5L 4OFVA 1M7IB 2CLVB 4ONFH 2ZCLL 2QHLA 2B4CH 1MWAH 4I18B 1MI5B 3G6JB 4KVNH 5E2UH 5EFIB 5IB2A 4Q6IB 3O2DA 4P3DA 1KBGH 4JY6A 4PJ7F 3VG0H 1JZ3A 3NH7H 4MB5A 3QULA 3MPCA 4C59B 5A2FA 3LEYL 4X4ZA 2XFXA 4XVUD 1FCGA 4NN6B 4PJBE 1DUZB 2AV1A 1K4CB 4Z7NF 1LP9E 4AM0B 3V4PH 4F58H 4JO1H 4PJ9C 4NO0A 5DHVA 3GSOA 3B8YA 5TDPB 3MUZ1 2O26U 4WHTB 2VC2L 2IEPA 1YECH 2OP4L 4PLJC 4Y16A 1SYSA 4I4WA 3X12A 4D9LL 3CSYA 1FN4A 4PS4L 3VFTB 1X5IA 4H1LH 3ET9F 1OQOA 3C8DA 3HFMH 1ADQA 3R0NA 4KHTL 4WHCA 2YEZA 2APWA 3LKQB 5ICXA 3RDTC 4IRZL 2CKBH 2IALB 5T1MA 1ZT4A 3QDGB 5DT1H 1PZ5B 3ARQA 3P9LA 5JHDA 1P4BH 5EBMB 4JM2A 1O5DT 3L3HB 4M48L 1GOFA 1NMBL 5L9DL 5C0DA 1OSPL 4MJIE 1EIBA 4HUVA 2VB5A 3AU1A 3HMWH 3QB7C 3PL6A 5IB2B 4X5XA 2F53A 1YY8A 4P3DB 3KPOA 3CXDH 4JY6B 3QULB 1KC5L 4RMRA 2WP3O 5E8NA 5DMIL 4Y4FD 2YUVA 4OZ4A 3QIBA 2XFXB 3MLSL 1CF8H 1ZGLA 2WAHA 1TTFA 3IJHA 2Q7YA 2XKSA 2AV1B 1A6ZA 4ZFZA 1CE1L 1CXKA 3KYAA 4MVBD 5DHYA 5E9DD 2X4UA 4NO0B 4P5TC 5DHVB 3GSOB 4ZAKA 5AZ2L 4TNWK 1DQDH 4NQED 1QBMH 2R69L 5AEAA 1UCTA 3P0YH 4MNHA 3UTSA 2CXGA 3KPRE 4Y16B 1SYSB 4I4WB 3P2TA 4LOUC 5B3JF 1RUAH 3CSYB 5GJSH 1FN4B 3T08A 4OB5H 5E6ID 4GQ9H 4UOJA 5E7FA 1O0VA 5IP4A 2YEZB 4ONGH 5ICXB 1Z3GH 5T1MB 1ZT4B 2IQ9H 3P9LB 3SDCD 5E03A 1R3HA 1EVUA 5JHDB 4ZOEA 1MQ8A 2R2EA 4JM2B 1UM6H 2VDOH 4DFHA 2JELL 4D94A 5C0DB 4DKFH 2WQRA 4HUVB 1JRHH 3AU1B 3PL6B 4OFYD 4X5XB 5GGUA 2F53B 1YY8B 4YHOH 5EOQH 2Y1VA 2HVJA 4Y2OA 3KPOB 4K3JL 1M71B 2IQAA 5SWZA 4PBVC 5E8NB 4MX7A 4X83A 4OZ4B 5AD0A 3QIBB 4KI5E 3ZTJH 1ZGLB 3IJHB 2Q7YB 1A6ZB 4ZFZB 1SMAA 4XPAH 1H3PH 1TVDA 3WFCH 3G5VA 5DHYB 1RFDH 2X4UB 2CJUL 2GHWB 4ZAKB 3W9EA 4FQ2L 1DANT 2DMKA 5GRJH 1E4KA 4MNHB 1SM3H 1MCQA 3UTSB 2NY6C 5E2WL 1EGJL 1TPXB 4FXKA 3RIAF 5L6YL 4HH8A 5KSBF 1FSKB 1FAIL 2LE9A 4HUUA 1LDPH 4NRZA 2YK1H 4K94C 2H6PA 4GKOA 1DFBL 3TPKA 1VEPA 1I85A 4OCNC 2CQVA 2UZIL 1R3HB 4XXCC 3SGJA 2R2EB 2D7MA 4JQIH 2BCKA 2JJSC 2RFXA 1EUUA 3GJFK 1EV2E 1ZHBB 2YXMA 3FQTA 5IEKA 2E6PA 5L2KA 4Z7QF 3PWLA 2K9UA 5GGUB 2FYYA 2ARJA 4KI1A 2HVJB 1QNZH 3QUMA 2IQAB 4NZUL 1MVFA 4OLWH 2DI7A 4WUUD 5SWZB 4MX7B 5EU3A 5SWSA 1YNTA 3ZHKA 5AD0B 1UB6A 3RKPA 4YQXH 2AVGA 4P2QA 1MNUL 1CE6A 1YC8A 4PY8I 5ITBL 2DQDL 4F3FA 5GS2H 3G5VB 1CYGA 1FFQA 4X5WA 3W9EB 3B9KA 5DLMH 1RK1A 4Z77A 5DJCA 4LVNC 1UWEH 3RVTD 3VFGL 5D7IE 4QRRA 1TJGH 4KXZH 4FXKB 2DBJA 4N1HB 4ERSH 5JOPD 5DQJA 3VFNA 4HUUB 1IGJA 3SKJH 4NNPL 4JR9L 3DGGA 4NRZB 5DD1H 2H6PB 3T3PF 2W9DL 5HBBA 1HCVA 1MFBH 4RFNC 4LSUH 2R0KL 4V1DE 3BPOB 1NDGA 2QHRH 2MFNA 1L0YA 4HEPG 2EYSA 4XP9L 2BCKB 1P7KA 2RFXB 1BEYH 1KN4H 4OKDA 4TSCL 4J4PA 3FQTB 4JPWH 3UDWA 3CXHJ 5IEKB 5L2KB 4OIIH 3PWLB 5BO1L 1MFAH 4Z7VF 5F7WC 1KB5H 2FYYB 2ARJB 3QUMB 3GSNH 1PDKA 4G6JL 4NM8L 1QBAA 5EU3B 5SWSB 1YNTB 1UB6B 1RZIA 3SY0A 5ETUA 5C70A 4AMKL 4LVOC 1AQKH 4P2QB 1EHLH 1R0AH 1CE6B 5BV7H 5IFAH 3MRJA 1YMHA 3H7LA 1B4JH 1HE7A 3RA7H 1KCVH 3E2HB 4F3FB 1EAJA 4HF5L 4X5WB 3ISWA 4PGZA 3B9KB 5TQ0L 1RK1B 4Z77B 1X5JA 3QDJE 4HJ0D 4NCC1 4OI9A 3TT1L 4QRRB 2LTQB 2ZUQB 5DD3L 5I15H 5DQJB 3VFNB 3EYQD 1IGJB 3RHWK 1CDGA 1KTLA 1ZEAH 3DGGB 4HCRA 4WY7H 4NYLA 1JPTL 4KKBD 4NOFA 1J0ZA 1GVIA 5F9WC 2X44D 3Q1SH 2P45B 4R2GC 3MBEC 3WNKA 2OR7A 3N85L 2FX7H 3Q5YA 3B5GA 3IDXL 3WIIL 1G9NH 4FFYL 1NDGB 2EYSB 1P7KB 1TJIL 1F4WH 1GGBH 3RL1B 1CGSH 4X98A 4F9PC 4YNYA 4L8SA 3ULUF 1CDYA 4AEHL 2B1HH 5F9OL 3P11H 2ZG1A 2OCFD 1RZIB 3SY0B 4LVHC 5ETUB 4JY5L 2GW5A 4TOYH 3MRJB 25C8H 4PRIE 1YMHB 5AG8A 3O3DA 3ZYOA 3WN5C 3QFJE 4DN4L 4XMKL 4M6OH 1HXYA 1KULA 1I8IA 2D9CA 4LPXA 4DUWA 2CKBA 4J1UA 4HAGA 1CL7H 1JNHA 5GS0D 3VA6A 2FX8H 2CH8A 1XH3A 2CGRH 3SDXF 3W2DL 4ZUUA 1BPVA 5AZEH 3ESUF 1UT9A 1KTLB 4QRTA 4DUVA 4NYLB 4POZC 5I74C 3WHE0 2EDOA 4QHMA 1G9MH 3PGDA 2VLRE 5DYOA 3D39E 3HUJB 4K23H 4M93B 2XKUA 4RISL 4X98B 4DEPB 1IAIH 4FQ1L 4ZO9A 1P6FA 3BKML 3WS6C 2BVTA 4YNYB 4L8SB 3ULVH 3NZHL 4HJ0C 3HI6H 4JRXD 1W0VA 1JWUA 5C1MB 4DKEH 3S4SA 4EKXA 1VACA 5KSUA 3BIBX 3GKZA 3ARGD 3LN5A 3BPLC 1QRNE 3O3DB 1RZGA 5JNYA 1HXYB 5C08E 1I8IB 3FB5A 4XI5D 5FYKE 3QEQE 3LIZH 2CKBB 2Z4QA 1JNHB 1CBVL 4GXVH 2APBA 1XH3B 4K3DL 4ETYA 4ZUUB 1M7XA 5CSBA 5I6XB 4U3HA 1NLDH 5CGTA 1U3HD 1UENA 4QRTB 1MFEL 4I5BA 4KK8D 1W0YT 2R2BB 4QHMB 3V0VA 2UY6A 3PGDB 5FGBC 4WIQA 4KRPC 5DYOB 3TV3L 3VD4A 2H8PA 1EK3A 1Q72L 2Y06L 3BISA 4PRHE 4FXLA 4H8WC 1EZVY 1T7XA 4H0GA 2P47B 1QOKA 1FZMA 2HFFA 3T0WA 4WFFE 4JN1H 3VMPA 2X1QA 1DBAL 2DYPA 1BFVL 1KJMA 1MHHA 4S0SD 4K71B 1W0VB 4YBQD 1N5YH 1JWUB 4E41E 1QLFA 4PLNC 1XGQA 4Z7WE 3S4SB 3WD5H 1VACB 4X7DC 5KSUB 4LLUA 2F9BT 7CGTA 3DHJA 5BVPH 1RZGB 4PY7A 4JDVA 5JNYB 2MPAH 4IEFB 4BFIA 1D5XA 3CLEH 8CGTA 3WXVL 1MJ7L 2V6HA 2Z4QB 1MEXL 2XTJB 4NCDA 5E08H 3ZDXF 3OKNA 3DO7A 3N1MC 2GY5A 5D96B 5D72L 3EKCA 2FEDC 1HN1A 1VFOA 5L8JB 5CBEA 5K93A 3S9DB 1H8SA 4I5BB 4UMGA 4I0KA 4PRNA 3V0VB 1DL7L 1FRGH 5I1HL 1U8QA 1I3RA 3U36A 2H8PB 5GSVA 3NBNA 3JTTA 3T8XA 1YQVH 1V7NH 3GI8H 2XA8H 2G2RA 3C60C 1FZMB 2HFFB 1CFQA 1AXTH 4GW5A 4MMXC 4YHYC 2GKIA 1LMKA 1NCDL 2CO7B 2VWEC 2DYPB 1KJMB 1MHHB 5GGTA 3VXUE 3WIHL 2MSPA 3PGFH 4JY4A 5FA4A 1C1EH 3OAYH 1QLFB 4BSWA 1XGQB 1F58H 1A6VL 4LLUB 1K8DA 5LXGL 4FABL 3QUZD 4PY7B 1FH5L 1U8PA 4JDVB 2Z8WC 2OS7A 4L4VE 3VXMD 4BFIB 3ZHLA 2PO6A 5HYQA 1D5XB 3AVEA 1NFDE 1A6UL 4Z76A 4HH9A 4ZTPL 5CFHA 1DCLA 4GS7B 3OKNB 3U7YH 3DO7B 1KXQE 2X4QA 2R29L 3K8LA 2N7BA 4I77H 4WRLA 5CBEB 3U7WL 2YN5A 4MNQE 1HYSC 4PRNB 4NQCE 4POYA 5F9DC 4KU1A 2XPGA 1U8QB 1I3RB 3U36B 3X3GL 4L9LC 4YK4C 1KJ2H 3JTTB 2UUDH 4FQXC 5GSVB 3T8XB 3P4MA 3AFLA 4KHXH 1T4KA 5KVGL 1T80A 1RUMH 4F80A 1JPST 2OQJA 2G2RB 1JHLL 2C1PA 1CFQB 1YNKL 5IESH 4IRJC 4WHDA 5CGYD 5IMOA 3RUGF 1AH1A 3QPQC 4JY4B 5FA4B 4LSTL 2BVYA 1LWRA 4BSWB 4HJJL 5MHSE 3NPZB 3WKMH 3HNVH 3SBWA 3NIDF 4QNPE 2PUQT 1K8DB 4ELMA 1NJ9A 3CU1A 1TQBC 1EFQA 1J1PH 1GC1L 1U8PB 3KPNA 2PO6B 4HWBH 5HYQB 1OTTC 4Z76B 4ZFGL 4HH9B 4NUJA 3ZT7A 3H0TA 5EUKA 4OI8A 3BQUD 1G7IA 2X4QB 5JOEA 3RIAK 1MF2L 1R5VA 1FNLA 4NWUL 3RWJA 4ETQA 3H9ZA 4U05A 3JWDH 5GRXG 1CGVA 3T1FA 4JPKH 1UWGH 5IBTL 5HI3C 5D7SH 1BP3B 1RIVL 4LLMA 5DR5H 4YUEL 5I18H 2XPGB 4V2BA 3IDYB 2BJML 2EYTA 3MXVL 5DEFA 3P4MB 1T4KB 1MLCA 4QRUA 2OQJB 2A1WH 4HC1A 2C1PB 3ZE0E 2AGJL 4P23D 4PJCF 5JHLL 5E5UB 5IMOB 4OLUH 3SJVD 1RUPL 5E5MA 2NXZB 4MQXC 3IDMA 1V3MA 3ARPA 2R0ZL 5D6CA 4ELMB 3VMOA 1NJ9B 4PB9H 5D1QD 5HHVL 1J7VR 1HHKA 1N0XL 3NZ8A 3KPNB 1A6TB 1KENH 3MXWH 5D5MA 3QDGE 1MJUL 4QXUL 4NUJB 1NAKH 3H0TB 5EUKB 5ABDE 1IE5A 1G7IB 1L7IH 5C8JA 1R5VB 4OZHF 3RWJB 5C7XL 4ETQB 4AIZA 3BAEL 4Y5VC 3SGEI 2MKWA 3T1FB 4JM4H 4M7JH 4LLMB 2DMBA 3DIFA 1U8HA 1RJZA 4X99A 1U6AL 4QHUA 4GO6B 2EYTB 5DEFB 4FS0A 4U33A 3MTRA 1MLCB 4Y4KD 6FABL 1YJDH 4XCNA 4QRUB 2WZPD 3QDAA 3R8BB 2AP2A 4G8GE 5DK3A 1CLYL 1H15A 2EC8A 3TLRA 5E5MB 2VLKA 1BFOA 2W9LA 3B4NA 3IDMB 5F71A 4M6MH 3V7AG 1JTOA 1FORL 1F3DJ 5D6CB 2E8YA 1YEFH 2ID5A 1JNJA 3MBXH 1HHKB 4UT6L 4XX1G 3NZ8B 1MY5A 1WIUA 1C7SA 2PTUA 4CAGA 5D5MB 3H6JA 2XZCH 1HHHA 5INCA 5D70H 5JDJA 4K8RH 3TO4C 4AJ0A 5B8CC 4KKLC 5C8JB 4AEFA 4PJBF 4P9ML 4HXAH 1LP9F 4XNXL 1T1WA 4AIZB 4ZNEE 3EOTH 1PG7L 4ZUSA 4X7SH 1INDL 2VSCA 2QADC 5KS9A 4U1MA 2IBZX 3GMPA 2H1PH 3DIFB 1RJZB 4X99B 3CMGA 4QHUB 3V5HA 2VXVH 3E8UH 2Z92A 3T0XA 4GAGL 4XCNB 1QBBA 1OP5K 3GSWA 4FXGA 2AEQH 1H15B 1YN6A 2VLKB 1BFOB 4OF3A 5D71L 4AEEA 4MCZA 3CH1A 5EOCL 2E6QA 3TC9A 3LD8B 5DK2A 1NAMH 5KVMC 1L7TH 4DN3H 3GJEA 4LHUD 1E4XH 4KMLB 5HYSA 4QOKA 1MELA 1ONQA 2Y07H 4DAGL 1NC2A 1OSZA 4F15B 1RZJH 5HHQA 3EZJB 4N8VG 1HHHB 5CJ8A 4EVNA 5I1CH 1J0JA 5INCB 3LKSA 4JZJA 3RPIA 4LP5A 3AS1A 4X6CA 3C08L 4JKPH 1T1WB 2R0WH 2R1XA 4ZUSB 4JEGB 2Y72A 5DRXA 4DZBA 4FG6D 3RWDA 2VN7A 1BHGA 3CX5J 5KS9B 1JF1A 1SEQH 4U1MB 3GMPB 5SWZE 4DKDC 3IU3A 3HI5H 3TT3H 1F4YL 2CRZA 3V5HB 3RY6C 2DS4A 2JF1A 4OBSA 4RA0C 2Z92B 4HKBB 2EDBA 1U95A 2WINA 5I8CA 2ZCKL 1II4E 3GSWB 4FXGB 2NY0B 3WHXA 2HMID 1YN6B 1FDLL 4MCZB 3CH1B 4HUXA 4PJGA 1VHPA 5DK2B 2DKSA 3HZVA 3GJEB 3OAUL 4M4PA 3HZYA 3I3BA 1IM9A 5HYSB 4QOKB 3A6CH 1ONQB 4KUCD 3K2UL 1NC2B 5EC1A 1B90A 1OSZB 1QHOA 4HGWA 5HHQB 4EVNB 4PRAA 4BZ2H 4CVUA 3QIUD 4KI5F 1GCFA 3LKSB 4JZJB 1P2CA 2UZYB 3SO3B 3JBG7 3RPIB 3LN9A 4X6CB 2FB4H 5J57B 3C2SA 4XBEL 5BW7A 4CL7A 2R1XB 4DGYL 1EO5A 1G6RH 4L29A 5FCUL 4DZBB 3RWDB 1S7SA 4GSDH 4EDWL 4WI4A 3KDMA 1JF1B 5E8DL 3SE8H 3IU3B 1KNOA 5SWSE 1HZHL 2FD6H 3MLZH 5F6HI 4HBCL 3UZQA 3QDMD 4NFDA 4P2QE 3UC0H 3U9PL 4H26A 4XGZA 3C8HA 1A02N 1CDJA 4M7ZC 2WINB 4RGNE 5I8CB 2Q8BL 1QFPA 3C2AH 3WHXB 2W0PA 3D3VA 5IQ9A 4PJGB 4QT5A 4ZTOH 4WGVB 3C6LC 4WI5A 3FHAA 3HZVB 1E6OH 4XWGH 4P4KC 2Y36L 3HZYB 3ILQC 1IM9B 3K46A 2YD2A 5HHMB 1DEEA 1LEGA 4FG6C 1A22B 2C4XA 5EC1B 1I9IH 1Q0XL 4HGWB 5DO2D 3VWKC 5DFWH 1G0DA 1DQLL 2X42A 4LIQH 3OJMB 2EIBA 4MMZC 1OARL 5D6DC 4ZD3H 4BM7A 1P2CB 3P0VL 4OGAC 1MRCL 1W8NA 4JHAL 1CIUA 2NY3D 3IB4A 4JG0H 3KLHD 2VE6A 4L29B 1S7SB 4M7LH 3N06B 3KDMB 1RI8A 1V7ML 5D7IF 1BOGA 1KNOB 4EUPG 5GZNC 2DIJA 4D9RD 4GUPA 4O58H 4HG4J 4CGTA 3MLYL 2MTPA 1CFBA 4H26B 4XGZB 3MLPA 3BKJH 1LO2L 1RAMA 1I8MA 1CU4H 2X41A 2X1OA 5ELIA 3PWPA 1I3UA 1CDBA 2XI9A 2IF7A 3D3VB 5IQ9B 2E27H 4S1RH 3AAZA 4QT5B 2V7NA 3G9VA 3ZDYE 1SJVA 4NBYB 1M6OA 3TVMD 2LU3A 2A9NL 5FKPA 5E4EB 4OQTH 1DEEB 1LEGB 4Q9QH 1QR1A 3EYUL 4OKVA 3HLAA 1HWGB 4H1LG 5LBSL 3FB7A 5GZOD 2CPCA 3K4AA 3TP4A 4NJAH 3FQNA 1LO3H 5J1SC 3HUJE 5FDYA 5DWUL 4L8CA 4NM4H 5GJTH 3RBGA 5T1KD 4AQOA 4JHBA 2HJKA 2EE6A 2OK0H 1NDMA 2VE6B 1I8LA 3E3QC 4HKZA 5BRZD 4RGMB 1BOGB 3IS0X 4XVJH 2AXGA 5JMRA 1VKXA 4GUPB 1CLZH 2A6KA 1RUQL 5GHWL 4XP6H 4MWFA 3EFDH 1DBKL 3S37X 5HYJA 2F54D 4JFDD 1I8MB 1DLFL 5DO2C 3AREA 5LG1A 1KFAH 1F8TL 3PWPB 4MAUL 1AGEA 2X4OA 4R4FL 1FFNA 2ERJC 4JANA 3AAZB 3HZMA 2V7NB 1OHQA 1OTUD 4JPVH 2VR4A 1M6OB 2R4RH 5ALBL 3I50L 4HPOH 5FKPB 3AS2A 4RRPA 5T5FH 3C5ZC 3QH3A 1QR1B 3FQUA 4OKVB 5T3XE 1RHFA 3R1GL 1ZHNA 3FB7B 4IHOB 2EZ0D 4OZIA 2DBLL 3MRBA 3FQNB 1JTTA 4ACPA 2VUYA 3W5NA 4L8CB 1KUMA 3INUL 4MYWB 3K74B 2FBOJ 5DQDL 2NX5A 2B20A 2HJKB 1NCBH 2NY1B 1NDMB 4LK4A 4HKZB 4JN2A 4QKXB 5L8LB 5DVLA 2FNBA 4UILL 4H20H 4JVWA 3RRQA 3O2DL 2AXGB 4J6RH 1VKXB 3U79A 4HQQH 2A6KB 5EUOA 3NAAH 4MWFB 2R1YA 5HYJB 3J8F7 3QUXC 5F7MC 4PJ8C 3V4VH 1H5BC 3AREB 2YN3A 1HHGA 3MMEA 4L8DA 4YHKH 1EBPA 1AGEB 2X4OB 1HNGA 1FFNB 5ISZA 4C55A 4JANB 1A14L 2DDQH 1P4LA 3HZMB 2XTJE 3BN9D 4I0PD 2COQA 5IGXL 1JNNH 1WZKA 1ITBB 3QH3B 3FQUB 3ZKNC 4NZTH 5MEQA 1MFDL 1ZHNB 2WANA 1KCRL 3MA9L 5D7JD 3SDAA 1JRHI 1RUKL 1ADQL 4OZIB 3MRBB 3VFRB 3MROA 2EC9T 4ZOCA 3MV8A 4MZ3A 3FO1A 4PJXE 2NX5B 4PB0L 2ITCA 2DM4A 3AXLA 5SX4I 4YX2H 3OKLB 3O6ML 1X4ZA 3SDYL 1UEYA 2V9TA 1HKLL 4JN2B 4YXLL 4UOW0 1C5BL 2B5IC 1KPRA 5IBUB 3RWEA 4JREC 2QBWA 4JG1H 3LZFH 4NGHL 5EUOB 5JZ7D 2R1YB 1JGUH 4NQXA 4M8VA 1B2WH 5FUCE 3NABH 4G80A 5SV3A 4KI5C 1N2RA 4N9OB 4YFLI 3VJ6A 5EU5A 1HHGB 3HNSH 3MMEB 4L8DB 3O9WC 1I9EA 4MS8D 5ISZB 3BD3A 3LMJH 5FYJL 1P4LB 1U9KA 3B2VL 4IMLA 1JN6A 2RCSL 4IRSC 2BNRA 3MRDA 4LPCA 5CLWA 2FO1A 2XACC 4P99A 4RAVA 2AJ3A 2MQ3A 4QGTA 4OLVH 4F7PA 3PP4L 1I3GL 5MEQB 5IB4A 2NZIA 5E99H 1SEBA 3SDAB 5MP6H 2IGFH 2OL3A 5GPRA 3TO2A 4Z7WF 3MROB 2XQBH 5I1KH 1UCBH 3WFBL 2AABL 3MV8B 3FO1B 2IANE 5I8OL 1MIMH 2ITCB 3AXLB 3FAXA 3MV7D 3HE6C 1PKQA 3QUKA 3CLFL 3MLWH 3ABZA 1Q38A 5TE6L 1IC7L 3AY4C 1KPRB 3FAWA 3RWEB 5A2IH 4PRPE 3LS4H 2WLZA 4NQXB 1NBVL 1RD6A 2UWEE 2YUZA 3RKDD 5HDQL 3FFDA 2XIDA 4G80B 5C07E 3VJ6B 1N2RB 5EWIH 3TWCL 1MAMH 2NY7L 2O5YL 5EU5B 1GC1C 2CR6A 4PJ5D 1A21A 1CTNA 3GDBA 5TFSL 1KIUA 1VEOA 4LLYA 3O2WH 3ARRA 5DD5L 5J13C 1NH6A 4IMLB 1JN6B 2BNRB 3MRDB 1KCSH 4I9WD 5CIPH 4AT6B 1FVCA 4RAVB 5EA0H 2AJ3B 4R26H 4ODHH 2NYYD 5D2NA 2KQNA 5GRUH 3N1QC 2BVQA 4F7PB 5IB4B 2JJSA 2CK2A 4YEFA 2OL3B 3QXTA 5E9DA 4XVSL 2AXHA 4DJMA 4XCYA 4XPBL 4NQEA 5JZ7C 4MNGE 3EGSA 5E1HB 1D6EA 2BZDA 1EXUA 3Q6FA 5IB3A 3U4BH 1TJHH 1INEL 2OJEB 5AWNL 1PKQB 3QUKB 5E6IA 5IVNA 1JNLL 1NFDF 3K4DA 4YIQA 2EIDA 4AEIH 4DQOH 1KIPA 1R3JA 3SDCA 3QUML 4RQQA 4JRYE 4WEBH 4HIEA 3FFDB 3ZKSD 3SDDC 1UKQA 1GGIL 2CKNA 3KXFE 4OFYA 4OD1L 1T2QL 4AIXA 1ZLUH 4X7CC 1FVCB 3VGAB 1CD9B 1X5KA 4AY0A 1P6AB 2ZKHH 4X6FA 2KL6A 4PG9A 5D2NB 3PXHA 1MCIA 3MNVA 2BVQB 4OV5A 2QQNL 3TA3D 3WL9A 5E9DB 4XCYB 5ID1A 4NQEB 3EGSB 5T1LD 1D6EB 4QNPF 3VRJA 1IZKA 5JO5A 1EXUB 4WHYG 2P49B 2W91A 3SO5A 3Q6FB 3MR9A 5ILTH 5IB3B 1OTSD 2ZJSH 2NY2D 5E6IB 5FYLD 2AK1L 1OLLA 3HN3A 1EBAA 4IJ3C 4YIQB 5C0BE 2P1YA 3RP1A 1YPZA 3DRQA 1CLOL 1KIPB 3CCHA 5BMFH 1JZ5A 1R3JB 3SDCB 4HX1B 5DFTA 1B6UA 4C56B 1YEIL 2APVA 4RQQB 4TVPE 4R8WL 2E8ZA 3OF6D 5ALCL 4O02H 5EZOH 4WTWA 3MJ9A 2LU7A 4M03A 2EH8H 2ZCHH 2CMRL 5D5ME 1H8OA 3S8WA 4FFWD 1F45A 2B7DT 4DW2H 4Q58C 1CICD 2YRZA 4WUUA 1AI1L 4S1DC 4X6FB 4LCCA 5GRVK 4PG9B 4AZ8A 1I1AC 3V6OA 3ZE0F 3MNVB 4GMTL 4KC3B 4KQ4H 3T2OA 1TZGH 2XNAA 4OV5B 4WFED 3WNNA 5DXWA 3RGVD 3ECBA 3WL9B 5LGHL 4HCRL 1Z9SA 2HLFD 1IAII 2R0LL 1WWAX 3K1KC 5ID1B 3W11C 1MWAL 4KVNL 5E2UL 3VRJB 5JO5B 2A83A 4HMCA 5A16A 3MR9B 5JW3H 2PYED 1KBGL 5K33A 3VG0L 3NH7L 1OW0A 3GHEH 1LVEA 2ATPA 3VXTA 5DRWA 1YPZB 3DRQB 2J2ZA 4OFIA 5DC0A 3CCHB 1T66C 4I1NB 3LKRA 2BSSA 4LFHG 1ZT1A 1F2XK 1TITA 4ZS6D 5CEZD 4KROD 3HB3C 5I17A 4OD2A 1OAUH 3G6AA 4WV1A 4LSRH 2X9WA 1YECL 2VZUA 2XRAH 4K7PH 4JZNA 5KVDL 5C0FA 3O6LL 3HFML 4WUUB 1K6QL 4YDVA 1IBGL 1CK0H 4OM0H 1KYOJ 2QSCH 4JFXA 4P59L 2CKBL 4LCCB 5DT1L 5E8PA 2Y6SD 4YH6A 2YKLH 4IOFD 4Y8DC 2XNAB 1P4BL 1FJ1A 4M5ZL 2D7OA 5HVWA 4XAKE 4TVPH 1XR9A 3EDFA 4DKAA 3ECBB 3BDBA 3ZDZE 4S11A 4RFEA 5T3XL 1EERB 2MOVA 3QSKB 4HS3A 4Y0GA 3HMWL 3BFOA 2A83B 2UVFA 5HDLA 3ZYJA 5A16B 1HK6A 3H3PL 2ATPB 3VD9A 2DTSA 3FB8A 4YO0A 5DRWB 3LPWA 1HDMA 1UJ3A 3VFUA 1CF8L 3S35H 3LKRB 2PXYD 3OKMA 2BSSB 5FO8A 1ZT1B 3VGFA 1R3LA 5CINL 5D2LE 5I17B 4OD2B 3G6AB 1MHPH 4WV1B 1QBML 5JXAH 43CAA 3P0YL 2PYFA 2K7QA 3GIZH 3STZA 2UY7A 1CGTA 3H42H 1PJ9A 3OXRA 5GJSL 5KOVC 1RURH 4JZNB 4OB5L 5C0FB 4JGMA 5I74B 2W92A 1WTLA 4YDVB 4CMMA 2EYRA 1CGXA 2DQIL 3TJHD 1SBSH 4K55A 5E8PB 5CBAA 3KHQA 1OT2A 5HDBE 3SE3A 3VA2C 4LCWD 3ZL4H 1FJ1B 4LPWA 1UM6L 2VDOL 4NHUA 1XR9B 5FO9A 5D1ZD 4DKFL 3BRGC 4RFEB 1JRHL 4FFZL 4HS3B 3LQAH 5D7LE 2E5EA 1H3VA 3AB0C 2LQRA 3UPCA 3GRWA 3U30C 1Z2KA 3IVKA 2GJ6E 3FB8B 3GSXA 5FECA 4YO0B 2JIXD 3O3BA 1HDMB 2D7TH 1UJ3B 4OZFA 3VFUB 3BPLB 5DVMA 1Z0NA 3SCMC 3OKMB 4PJGE 4PJHA 1H3WM 5FO8B 1R3LB 2WUCH 4XPAL 1H3PL 3WFCL 1RFDL 5CIPA 5GRJL 4M9OA 3MLUH 5HHME 43CAB 1MREH 4S0TD 2PYFB 5BZDA 3STZB 1LD9A 4UTBH 3MOQA 3L3DA 3OXRB 4OGXL 5EU4A 5IROA 5KZCD 4JRXA 1WZMA 2YK1L 4CMMB 2EYRB 2F5BL 1UC6A 1MLBB 3IDNA 4AG4H 5CBAB 3L5JA 3ARGA 3Q6GH 2FJGA 3EYSH 4NHUB 4JQIL 5FO9B 4GRWB 5JW4N 4N0RA 1LK3L 4GKZA 2AK4D 2OR9L 3V7MA 4JAMA 2R4SH 3IDJA 4OQ1A 4D9QE 4OLWL 3ORJA 4MAYC 3MSPA 1OAZH 3IVKB 4BQCA 1U3HA 2VAAA 5J3HD 5K9QI 2W0FA 3D2UD 3GSXB 4X7EC 3ARBC 4XP5H 5FECB 2VL5A 3O3BB 4YQXL 4OZFB 3ARDC 3D3VE 2EKJA 3K7UA 1S7VB 3RJQB 1S5HA 5ADOH 4PJHB 5JIPA 4DZ8A 4YHIA 3ULUD 4KAQL 1ZLWH 3H9SD 2VNCA 1Q0YH 3OAYK 5DLML 5D1ZC 1C5CH 1G7MA 5BZDB 1UWEL 4EEEA 1LD9B 1TJGL 1H3UA 3L3DB 4X6DE 2WBJD 1JCKA 1J88A 5EU4B 4JRXB 4EZMA 3BRDA 1YN7A 3KJ6L 5DD1L 4B7LA 4U1HA 4IMKA 4N0YL 4LARH 1XGPA 1MFBL 3IDNB 4LSUL 3P0GB 3ARGB 2YPLE 2FJGB 5FUOL 2QHRL 3K0WA 4Y4HD 1F4HA 1BEYL 1KN4L 4I18C 3TF7C 3UTPD 4TN9A 1S7WA 2VABA 4ODSH 4JAMB 3IDJB 2JTDA 2LAAA 1MCOH 4MQTB 3GSNL 3WKNA 1W2KT 2BRQA 2O5XH 1U3HB 2VAAB 2UUDK 2W0FB 3LKOA 5A3ID 2BERA 1WWWX 2VL5B 3PWPE 4NN6C 4Y1AE 4OCXH 5I16A 1AQKL 2X40A 1EHLL 1R0AL 1PSKL 5BV7L 5IFAL 1S5HB 2ARWA 4L3ED 2XV6B 1A47A 4YHIB 4DZ8B 2AJXL 4F9LA 2VO5A 5KVEL 1B4JL 1KCVL 1FAKT 3QUYD 4DOHE 3B9DA 5E2JA 3BVNA 4L5FH 5IW1A 4QRPE 4N1CA 2V2TA 1G7MB 2PCPA 1KG0A 4LSQL 4N0UE 3NCEB 1HHIA 2GUOA 3FHQA 5F1SA 2BY2A 1JZ2A 5D1XD 3ZE2E 1ZEAL 1YN7B 4OAWA 4U1HB 1QEWA 5AUMA 3JTSA 4I13B 1XGPB 2DQJH 4YDLB 5BQ7A 5J3HC 2R8SL 4YK4B 5F44A 3CFBA 1A7OH 1G9NL 4LMQE 2QR0A 5HVFB 3QUZA 4I3SH 3VXMA 4NPYA 1YY9D 3UZVB 1S7WB 3ZDYF 3IKCA 2VABB 5BCAA 3JZ7A 3V0WH 3BT2L 4JO3H 1R3IH 3BD5A 5HYJE 2B1HL 5E95B 4MXWL 3BDYH 3IT8D 3P11L 1Y18A 3LKOB 1DBJL 5IKCA 5JOFA 2EE3A 4TTDD 5I16B 2VXQH 2HT4C 3HUJF 4XCCL 4TOYL 25C8L 3DARA 1RU9L 2DI8A 1RMFH 2HT2D 4KK6C 1HH6A 5IMLA 3BVNB 4Y16C 5IW1B 5JA8B 5J8OA 2V2TB 1QSEE 3ZZ1A 2PCPB 3NVQA 2FX8L 1KG0B 2VERN 4KDVA 4QXWA 3UYPA 5EO1A 3VI3E 1HHIB 4NQDE 4PBXA 3Q0HA 5AZEL 3CFEA 3LKNA 4R97B 2GUOB 3REWA 4OZIE 1GSMA 4LLAA 1QEWB 5AUMB 2GEEA 2FBJL 1U8IA 5BQ7B 4MA1C 4JM2C 3S34H 2NX5E 3QQ9C 4P5MA 5A3IC 2AJSH 2PR4H 4LPTA 2ESVE 3CFBB 3C09B 2QR0B 4K23L 3QUZB 3DGCR 1TNNA 3VXMB 1MCWM 4NPYB 2UYLA 4WWKD 3PL6C 1C8PA 3IKCB 1IAIL 2C1OA 5IMKA 3O6FD 3AS0A 2EXYC 2OXHA 1U93A 3BQUA 3ULVL 3QNXA 5JPMA 2ICEA 3V5KA 3QIBC 1Y18B 5IKCB 5JOFB 2BDNH 4H5SA 3SEPA 4NKIH 1E4XI 4ZPTA 3WLBB 4ZAKC 1JE6A 3DO3A 3N9GL 3FFCE 1HH6B</