2VXQH

Crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
213
Chain Sequence
VQLLESGPGLVKPAQTLSLSCAVSGGSIRSGGYYWSWIRQHPGKGLEWIGYIYHSGNTYYNPSLKSRIAMSVDTSENKFSLRLNSVTAADTAVYYCARLDGYTLDIWGQGTLVTVSSSTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Affinity Ige Recognition of a Conformational Epitope of the Major Respiratory Allergen Phl P 2 as Revealed by X-Ray Crystallography.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords POLLEN ALLERGEN PHL P 2
total genus 41
structure length 213
sequence length 216
ec nomenclature
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH01
3OB8A 1ORSB 1YMMA 1RZKC 2PYEE 4RQQA 1OWWA 4YDKH 4KKAD 4PP1D 4NQCD 4PB9H 3O41B 2AKRA 5GGQL 3S5LG 1MI5B 5J1AB 1YEIH 4PGEA 3HI5L 1LO3H 1AHWB 1UZ8B 1FFOA 5D70H 3HC0B 3LRSB 1AGFB 3BIKA 2R0WL 3HAEA 2V2WA 4IIQA 2BY2A 2WP3T 4GXVH 4HZAA 3EOYG 3Q6GL 2ERJC 4AENA 3KGRA 2PETA 5F7EH 5F3HA 3TBYB 5ERWB 1RFDH 1HH9B 2BY1A 1RIUL 1UADC 3VI4F 4R8WH 2OZ4A 4IRSA 2VIRB 1J0YA 2J4WL 3T0BA 4PLNC 1BGXL 1K8IB 2W0KA 4IIQC 4CMHC 2VLME 1WUNT 1HK6A 3CFBB 5C08D 3FT4B 1QNZH 4OLWL 4ZAKA 1R3JB 4N5UA 5GRZA 2WBJD 2VAAA 1NUDA 5D2LB 2Z8WC 1ZGLA 5DMIL 3STLB 4U4BA 4OCSH 3G9VA 4PYHA 4CU6A 5A3IC 2B0SL 4XC1H 5L88L 4U6VH 1JIBA 5T5NF 2OK0L 2WWKO 5L2JB 4I3SL 3VXMB 5HYQB 1U3YA 3WFCH 5C2BH 1KPUA 1A1MB 4NHCL 5JW4Q 3E3QE 3VXUE 4Z7OF 4QRQB 3ARSA 1QPXA 3G5YB 1A47A 3W81A 4F7PA 3VFMB 2D9QB 4XNQB 3QIUD 2AJSL 4OI9A 3VXRE 4GJTB 2NY2B 4RMUA 3OPZL 4XMPH 3U46A 3DETD 2XQYK 1JI1A 3HR5A 4PJDF 1T7WA 3AAZA 3RIFF 1LO0H 2XNAA 1NGPH 3V6FA 1NANH 4XH2A 4NSKA 4KGJA 4HX1A 1TMCB 4WGWB 3WIHH 3W9DB 4MNGE 1KJMA 2X4UB 3QIWC 4DTGH 3U4EB 5D7JC 3EUUA 4TQEH 3RKPA 4RA0C 3SKJL 3HZKA 3KPRD 5HVGB 3TJEH 2Z31D 2ZUYA 3MNVA 4OGAD 3CH1A 4C4KO 4LSPL 4LSQH 5K93A 4OZFB 1FGVH 3BWUC 2R0ZH 3ELAT 1TETH 1NCDH 1HIML 5F9OH 2R2HA 3OR7A 3QIUC 1KTLB 4M3JA 5GRVL 3RU8H 3RVWD 2GCYA 2DICA 1V7NL 4S2SB 5DGRA 1XGQB 1CWVA 4XHQA 4X0KB 2ICCA 4RNRB 3RGVB 4MB3A 5D7SL 5IEKA 3MLTB 1R5IB 3KYAA 5C0AB 3ARBA 3BH8B 1JZ4A 1CGSL 5D5MB 2A9NH 3Q6GH 5TE4H 5A16B 1CYGA 4L4VD 3VFVA 1WBYA 3BJLA 5ECJE 1G7IA 4LU5H 5DJ6A 4OBSA 2DS4A 3K4DA 3BIKB 1T1WA 2F53B 1BQLH 3LZFL 4EXPX 4OF3A 1B6DA 4G6FB 1B3JA 3HG1A 5T5FL 5C0CD 4GG6F 1LDPH 3QZWG 5CILL 5DTFA 5IGXH 1YY9C 1UH2A 3FO9B 4P9HL 2Q76B 1HCVA 1PVHA 3GIVB 1BQHG 2QSQA 4QRTA 3TBSB 3S34H 2R69H 2DI9A 3QIWA 4WJ5A 5C0IA 3P30L 3GUTB 3NPSB 5IHBA 2BRQA 1U58B 2IF7A 3LAFA 4A2MA 3QNZA 2CUIA 4UT9H 4W4NA 1PBYA 1D6VH 4JRYD 4LCWB 4YGAB 3RY5A 5IB1B 3MLYH 5EC2A 2A9ML 4Y19E 5I66A 1MFNA 3P77A 1U8HA 4LNVA 1HZHL 5HGHA 1ZWIA 4EJ1C 4FP8L 2X70A 1WWAX 3OGCA 5F7UA 1ZT1B 4R2GD 3QDJB 3VRLE 4JPVL 1FL5B 1G6RL 2HMIC 3J7HA 5CHNB 1BOYA 1ZT1A 3C8KA 4LK4A 5I76B 2ICWB 4ELMB 3SCMB 5L2KB 3MA7B 4M00A 1YJDH 3PQYA 4MCZB 5D7KD 1D6VL 4WUKL 2FX7L 4X5XB 3V6OA 3KDMB 1KB5B 3O6FA 3P9LA 3D39D 3VFNB 1VGKA 1WISA 1YQVH 4YBQC 1A22B 3MRMB 5HY9A 3LKQA 4PGCB 3B43A 5IFJB 3GSUA 5MI0B 5D9SB 5FYKD 4JHAH 1U3HB 1J05A 2XIDA 3LKPB 4Z7WA 1G7JA 2A6DB 5FKPB 1MCKA 3N1MC 4P59H 1LEIA 3P11L 4G7VH 2CRZA 5IFAH 2LVCA 3T0ED 2OI9C 4OM0L 3FFCA 4Z7UF 5GGSA 4LARH 1SM3L 4KQ4L 3GSRB 4XXDB 1RUAH 4ODTL 1UVQA 2IPUG 4G8GB 3TNNB 2HT2C 4BFBD 4X6CB 2F8VA 1LD9A 4X98B 1A9BB 4I18C 1T22A 3GMQB 1LMKA 1JNLH 1PYWA 4RGOH 4J4PD 1ERNA 4I48A 1IGCL 2AQ1A 1S9YB 4AM0B 3VXQA 3RUGB 1OTUD 3CFDA 1XIWB 1BZQK 1KYOK 3GMRA 3IDIB 5EU5A 5FYLE 1IRAY 3GMQA 4YNYA 4FABH 2IPTL 5CINL 3ARZA 3PF2A 2CR6A 4KTEH 2ATKA 5CEXA 4U6XA 3WO3B 4K9EH 4ONGL 1CICA 2J88H 1S9VA 1QKZH 5ENWB 3BUYB 2YA2A 5ALBH 1HWGB 2AS5M 3EOTL 2HKFH 1VFAA 4TNVK 2DQIL 3WFHA 3BKYL 4D9QE 1F90H 5DJAB 1H3WM 3SGKA 1ZANL 2I07A 3Q1SL 1ZHNB 1EBPA 3OQ3B 2DLTA 3OR6B 2NY4C 2NY5L 1OQOA 1PG7W 3MACL 3HS0A 1LQSR 1I7ZB 1Y18A 2YPKA 5T1LA 3C5JB 2EICA 3I85A 4NOBA 1F5WA 4ZTPL 4UU9A 1OGTB 2PTVA 5F3BA 1FORH 5D7KE 2J88L 1F3JA 4ZFZB 1FLRH 1CDJA 3T0EC 5L2KA 1ZSDA 2PW1A 1UACH 3BP7B 1NMCC 1BIIB 4N9GA 4EVNA 2GHWB 1JPFA 3R8QA 12E8H 1JHLL 2ADJB 1A7OH 2P45B 4S1RH 1AFVL 1T21A 4UT7L 1U3ZA 3S8WA 1DBML 5ACLA 4KROD 4P4KC 4NZUH 2K3TA 3C2AH 4TSBL 3OKDB 4F7TA 2OP4L 4XNYL 1HHKB 1KPVB 4EN3B 1H8NA 5GS1A 5I1AB 4HIHB 1OARH 3LEVH 2GSGB 3KPSB 4OCWL 1MCSA 4RGMC 5GXBB 3P3YA 4I0PD 3KPTA 1B6UA 1K2DA 3F5WA 3UC0H 5BS0B 2WQ8A 2GJZA 1GOFA 4Y2DA 3VXSB 4I0CC 4PJHA 2F5AL 5EU3A 5I1GH 4H8WL 5EPMA 3C8KB 4XX1G 3I3BA 2YSSB 3PHOA 3EO9L 1EH9A 2EE2A 2IFGA 2VLKB 3U0WL 1BLNB 2COQA 3MNWB 4N9GB 5IW1B 2CLZB 4EVNB 3V7MA 1YY8A 1NC4D 1U93B 3MJ9L 1S8DA 1I1YA 1BD2D 2EYSB 5GRYA 2DWEA 2EZ0C 2F74A 5I15L 1HHGB 4TNWF 1QQDA 4MXWH 1FZOB 4U3CA 4OT1L 4R0LA 4PREB 2H2PC 1K4CB 4PFEA 4CNIA 5I73B 2JIXB 1W72L 2LE9A 4GG8A 4X9BA 2ZSWA 4K7PH 5H37G 1EEUA 5EO9A 5EU6D 1P4BH 1H5BC 1MJ7H 2FZ3A 4WI8A 3EO9H 4KI1A 4ISVA 5FO8B 4MCYB 5C7XL 3BI9X 3MXVH 1RI8A 3I2CH 4J1UA 3GB7B 3NCFB 1A4JA 4Z77A 2FYYA 5T3ZD 5AZ2H 1TENA 3E3QC 3OF6A 4OZFA 3TJHC 1A7QH 1IC5L 4HPYL 4UUJB 2CKBH 3PGCA 4ODHH 3QAZB 4JFDA 3MMEA 4ERSL 4RGMB 4ONHA 1QVOB 4OZ4A 3RTQA 5C0EB 3G6JA 4CJ0A 1KLGB 3TFKC 1ZGLM 1ORSA 1YMMB 2VO5A 1DEEB 2R1XA 2MQ0A 4TVSa 1KJMB 2GK0A 1R5IA 4LIQL 5DJ8A 1T7YA 4I3RH 1KEGL 5J1SC 1IZKA 3N9GL 1NMAH 3Q1SH 5IVNA 1KLUA 1MLBB 2GJ6D 1OTSC 5F1KC 2D0HA 5F9WC 1S3KH 5FB8B 3QDJD 1NDMA 3DX7B 1U3JA 1UWEH 2DQGL 4JANA 3MLRH 2NXZD 5EUKA 3TLRA 3PGFL 1U91B 4XPAL 4JFQA 3T0EA 3KPRB 2NTFA 3SDDD 4X6FA 4OCNC 3SE8L 4KC3B 2KDGA 3K7UA 5L8LB 1N8ZA 5DEGB 1JCKA 1KPUB 5E5UB 1OAQL 3BE1H 3SE9L 4MD0A 1NL0L 1T7VA 4PPTA 5GZNC 2FEDD 3GM8A 5A3ID 5ELIA 4TRPL 1QEWB 4F3FA 5ESAA 4KZDH 2EE6A 4PB0H 3FQRB 4N8VG 5HYJA 4KRLB 4WHYH 3HTLX 4UINH 1J0JA 3DRTA 3WD5L 1OGAB 3CGTA 1WV7T 4ELME 4HUUB 1UM6L 3GKZA 5MENB 1FVEA 3TJHD 4EIZC 3MRBB 3QG6B 1X5ZA 1ZWIB 4ZFFA 2Y72A 1WZ1H 4XMPL 1I1CA 4K3HA 1YMHA 3L7EA 4YBQD 3RGHA 4KAQH 1LO0L 3SDDC 5EDXA 1CGWA 4PV9A 4NKIH 3O8XB 5IMMA 5ITBH 3MBEB 1A1MA 1NFIB 1JPSL 1NUGA 2BSRB 4FQCH 3GUTA 4X99A 5BV7C 5I1HL 1D6EA 3OV6A 4L9LB 1OW0A 2QSTA 3O6LL 4OCLC 1FVDB 1NCWH 2AI0L 4PD4K 1CG9B 3BRFA 4JREC 5I15H 4GSDL 4H88L 1UB5B 3LD8C 4MQ7A 3LKSB 2BY3A 5ICZA 3BAEL 4OCRL 4U1LA 1MREH 3VRJB 1VDGA 2Z9TA 5FDYA 1P4LB 1AHWC 4WY7H 2IPKA 3RUGE 2XTJD 5MEND 3GSWA 3MOQA 4RFOL 3MRPA 1B88A 4OTXL 1HSAA 2X1WL 3RA7L 4HS6A 1QBAA 2DM4A 3V52H 2FWOB 3BDYH 1LDSA 1J8HE 2VYRE 2FJFB 5KN5A 4TUOB 1N3NB 1E4XH 3QQ3B 4OFYD 2UUDH 1NCCH 5F8QC 4CW1A 2JB6A 5GRJL 1DSFH 1N59A 2VLJB 3WXVH 1X5XA 1D5XB 2BSSA 3DMMA 5GZOD 5I1DA 1FIGL 1ZA6A 4JFDB 5TF0A 1QBLH 3IDJA 5FF6A 4F7CA 5T3ZE 3EGSA 4Q58C 2R4SL 4OCYH 1RURL 1A02N 2JE8A 4ZTOL 4OFKA 2KQNA 4RZCB 2AXHA 2BOBA 1AD9A 4HDIB 3CJJA 1RHHA 1MWAH 4ZFOA 1QTYT 4XBGB 5DRZA 1KIPB 3PIQA 4MA3A 1H0DB 3REVB 1ZANH 1GL4B 1L0XA 1R3HA 2XXCB 3JWOC 3V6FB 5CBAB 3GHBH 5FO8A 2CO7B 2QV2A 1U8KA 1S7SA 2NY2D 1HXYB 5CEZL 3DUHA 3W39A 4RAUB 2J4WH 2PYFA 5SV3A 3S5LA 3A67H 4RIRA 5DHYB 1N6QL 3WSQL 1ODAA 2A6JA 2NW2B 4K2UH 1NGWB 1NGQH 5IMOB 1RZ7H 4GRMA 3ZTJH 4GH7B 1N5YH 4QOKD 2VLRB 1J1XL 5GS0C 3F7VA 2AV1A 2CDGA 2YKLL 4U6HA 5IIEA 1XGYL 5HYJB 4HJGB 1ITCA 3ZTNL 4WV1B 1TIUA 5HYSA 5SX5H 4ODSH 3IFOB 1GPOH 2Q6WB 4PJGA 5DJ0A 1RULH 1S9WA 4HW6A 4NQDE 3GSXA 5INDA 2OS7A 3STLA 1G7QB 4UV4L 1N4XL 1ITBB 4KJPD 1NLBH 2EYTA 1G9MC 4DZ8B 5C6TL 5D2NB 5DJDA 5DS8A 1MH5A 4YHKL 4G9FB 3V4UH 4B7LA 4G8FB 3WHE0 4PR5B 1QD0A 4FTVA 3SDAA 3DGGA 1F8TL 4JQXC 5FGCB 5C0AD 4GKZB 5HYJE 5GS1B 1F3DJ 5D7JA 2H2PD 1C12A 5I30H 4QRRE 2BNQA 4N5EC 1EBAA 1JYNA 3QFJA 1X5IA 5AAMA 5LXGH 3H9YA 2YBRA 5CEZE 4NJAL 3RJQB 2OBGA 4KMTL 3SDXB 2MHAA 2FATL 2Q7YB 4R26L 4KROB 4OD1L 4MNHA 4ZUSB 2YPLA 1QOKA 5D93C 2W59A 3L6FA 4JLRA 5ADOL 2P47B 3QEQA 1AR1C 4NRXB 1O7SA 4LHUB 3Q5OA 2F54A 5F96L 3TZVB 5FGBA 2BHUA 1AIFA 1EHLL 5C7XH 1AKJD 2Y36L 3KYOA 1U95B 3V0WH 3GB7A 4R90H 2Q87A 2X1QA 3IJHB 3QI9B 4XT1C 3KPNB 4RGNE 3QG7L 4P5TC 32C2A 3B5GA 3V0VB 2FATH 1OSPH 5CEXB 3B2VH 3RPKA 2E5EA 5I1KH 4FQHB 5B39A 2GTZB 4HSQA 4FQIH 3DHMA 5F7DB 1S9VB 4HPOL 2F19H 5DC0A 4L4TB 3AS3A 1K3IA 1SJHA 1NFDB 4KY1H 3RDTB 5ICYB 3O9WB 4JJHA 3WLWD 3TYFB 3U9PL 4HKXA 2R4RL 4OZGE 3C8DA 3ZO0A 1I8MA 4NQVA 5I1DB 3CMOH 1MIEH 4ZAKC 4KZEL 2A9NL 1Z6JT 1WTGT 3QSKB 1K4DB 3UYRH 3PWVB 3SDCA 3T1WA 4IS6A 4LCYA 5EU6B 1N6VA 2HT4D 3EYVB 4EUPA 2VISA 4R2GB 5C0AA 4WDIB 1EERB 2A73A 2V7NB 4QKXB 3CSYA 3EFFA 3UTTB 1D5BB 3ULVD 1ADQH 3D3VE 2L4OA 5FCSH 3P9MA 5KVFL 2D7NA 1BQLL 1G0YR 4ZUTB 1NUNB 1CCZA 3VXUB 3UPRA 1NFDE 1R3LB 3CCHA 3T4YB 1OSZA 4LVOB 3TT3H 3ZSTA 3QEUA 4POYA 5E24E 2ENYA 3LS5H 3S35H 3ZHLA 3I6GA 1J87A 3X13B 3ARVA 4QXUL 4W70A 1KFAL 2EYTB 2W9EL 4CADB 1JHTB 1MHHB 2O26U 2YA1A 3IAQA 4OLVH 1XR8B 2YKLH 3GJEB 4PV8A 4FXGA 4XCFL 4EKXA 2X6MA 5D7IB 4Q6IA 2D3VA 3G5ZB 4PGDB 5EU7C 3PXJA 4EDWL 5BMFL 3BGMA 5LGHL 1EX0A 4GW1A 2XN9B 2VDOL 5DFVC 3HZVA 2EDJA 4ENEC 5J6HB 1A1NB 1UXWB 5I75C 1KPRA 1F3DH 4XPFH 3WNPA 2R2BB 2A2QT 4PV9B 4K71C 1BREA 1HHJB 4GW1B 2E9BA 4ZS7L 2UVFA 3QIBB 4DKFL 1BFVL 3O3DB 3VXTB 2JJWA 5F1IB 4YPJA 4F80A 4F33B 4TQEL 1G84A 1DUYB 3RWHA 5EIQA 5HHXL 2DOCA 3QWQB 4PRIE 5KSBB 4HULB 5HHQB 1BBJB 4QXGL 5JNYB 1FNGB 1XGTA 2O5ZL 5D7LE 4YWGL 4OF5A 3MREA 1E6OH 1PKOA 2MMXA 4YFLF 3FO9A 1BQSA 4POUB 5EUOA 3CDGA 3LCYA 1QRNE 3H7BB 1NAKH 3VXSD 3HZMA 3VXNB 5IBUB 5L2KE 5CGYC 1KCVL 1FBIH 4RZCA 3C9NA 5IB4A 5GS2H 5EBWB 2R2CA 2M1KA 3LKOB 5DGQA 1OCWH 4HT1H 4PY8J 3WIHL 5F96H 4U05A 4XRCB 4KVCL 4ODXB 2XTJB 1KG0B 3BH9B 2G9HA 1VESA 4NZTL 3WN5C 4PG9B 4M48H 3VG0H 3C60B 4WUUE 4NWUL 4Q6YA 5FO7A 4HCRH 1EGJA 4XI5C 3TO2A 1MFCL 4JGUA 3RPIA 5AWNL 8CGTA 3S36H 1CE6B 3F58H 5FUZL 3L3HB 3ME0A 4HPOH 5GS3A 1ZVYA 2GSIA 1J86A 2Y7QA 3PL6C 1V7MH 4H5SA 5FM5M 4GRLC 5IBTH 5LGJB 1R5WA 3LN9A 4AEFA 2V2XA 2X5PA 4LLYB 3ULSB 3ZE0E 3OAZH 2DMBA 1Q9OA 3VWKD 2EECA 5C0DA 4XNUL 3M1BA 1JWUB 3S4SG 2W0LA 1BGXH 4LDOB 2W91A 1Q94B 4LSSH 1AGFA 1CFTA 3SQOH 1UZ8A 3RWGA 3DNKA 3MLYL 4OLWH 3ARDD 2E8YA 1Q9OB 1JWMA 5DQJA 1I3RA 1I3UA 3ARYA 2VLRE 1FORL 3V2AR 5TDPA 1A7PH 4CRPA 3QQ3A 4Z7QE 4PJBF 4WTZA 4KI5F 2GT9A 2FSEB 1R5VA 5EO9B 1BF8A 2XQBL 4PBWD 1LK2B 1QR1B 3WCYA 5L88H 2Z35B 3GMNA 4JO1L 3IJYB 4WU7B 4KRPD 2DB8A 2PYEB 4I18B 4D2NA 4K3JH 2DTSA 2OR9L 3U30C 1ZEAL 2AV7A 4QRQA 2NR6C 3GZKA 1NBZB 1YECL 5KS9B 1H3TA 1X7QB 3FQXA 3GI9H 5L9DH 5L7XH 4F8TA 3FQWA 3QP3A 3ZKSD 4HIXL 1WJ3A 4O2CA 3IJYA 4WU7A 4RWHA 5TH2A 3PQYE 4EDXA 2EC8A 3LH2H 2X7LA 1WF5A 4HUUA 4DUVA 5JXED 4KKLD 2OSLB 1A7PL 3R06B 3C2SA 2XZQH 4O2EA 3O6ML 3UZEA 4KTDH 5JHDE 4P2QE 3TGXA 1EGJH 1FNEA 4DUWA 1T7ZA 4M7JH 2AABH 4HKZA 4HUXB 4U7KA 4CDHA 3HAEH 3NA4A 1K2DB 2BNRB 1MRCH 1UFUA 1VSCA 1MCLA 3FB5A 4KHXL 4Y4FC 4HJ0D 4Y4HC 4AZ8A 3T65A 3VRIB 3ULVF 1NGWA 3UJJL 3E2HC 3HRPA 3MRIB 4I18A 4LVNB 4KVNH 4APQA 2GEEA 4XVUD 2CRIA 2R0KH 3MODH 1FE8H 4NNPL 5DJXB 2YN3A 2AV7B 4FABL 2CUMA 4X8XA 1NBVH 4WEUD 4R26H 4GKSB 3ZYZA 1QSEE 3NFSH 1VADB 5DYOA 3T4AA 3LMJL 5JOFB 1FIGH 1XIWD 4R4ND 1I3VA 2GK0B 4HT1L 5HDLA 1OLLA 3N85H 1G7LB 3AB0B 4K23H 3MA9L 3DXAA 4JFZL 4P23D 3KLDA 3MJ7B 4LSRL 4IOSD 3QWOB 5FUCE 3B3IB 1XGUB 5HHVL 1M6OA 5GS0L 3QNYB 1H15B 5EC1A 4UOJA 3MLUH 1JZ3A 1JFQL 3TCLA 4EI5D 3GIZL 5AD0A 4F9LC 5E4EB 1T1ZB 4YHYB 3DXAB 2VL5B 3ZE1E 4MGXA 2WMPA 4BK5A 1EAPA 5IOPA 2VQ1A 4EZMA 4J1UB 4K8RD 4MA1C 1CE6A 4JFED 1W0VB 1AR2A 2FHFA 3LZFH 4XPTL 1TJHH 5IQ9B 1H3PL 1O7VA 1CDHA 3U46B 4J8RB 1MFBH 2J8OA 4CN1A 2GSIB 1Q1JL 3KPQA 1DQJA 4AL8H 2J5LB 4TSBH 3PWVA 3FTGA 3G5YA 2PNDA 4NIKB 4EQ3A 5MEOA 4ODXA 3VD7A 5BOZG 3CPLA 4OIAA 5KSAD 1JZ5A 4JO4L 4YDLB 4LBEB 5CUSL 2IALA 2VDQH 1M05B 5IW6A 2NY3D 5B38G 3D39B 3JV4B 3Q5YA 5IVZA 1DN2A 1Q72L 1ZHLA 4HXBH 3HPLA 4MJ4A 1HZHH 3SGDI 5B22A 3LY6A 3L1OH 5TGBA 4KUCF 3STZA 4IHOA 2GTZA 3NCYP 3DROB 5JXEA 4TPRL 4JY6A 1VB9A 3DBXB 4G6JH 1XEDA 2AJ3A 1HILB 1D6EB 4JRWA 3OKNA 3ZKND 4I0PA 3BW9A 1AJ7L 4XMKL 5SWSA 2W0FA 2UWEE 4BFEA 2C3WA 3CFBA 2VDQL 3ET9F 3H3PH 1BX2B 2C3HA 2PTTA 3ARBC 2F8OA 4KTDL 2IAMB 9CGTA 4GMTL 4YGVA 5I0ZA 2R2BA 3LB6D 4KV5E 2BC4B 4O51A 1L9NA 3QR2A 1KSRA 1J5OL 5CJBA 3PQYD 4AJ0A 2X4QA 3H9HA 3MRCB 5CJOH 5GHWH 2DQUL 4L4VB 2XACC 3F7RA 2BMKB 4MS8C 4Y5XA 2VRAA 3QULB 1IILE 5E6IB 4NCC1 4U2YA 1IGYB 2OTWB 2P7TA 2NZ9D 3HAEB 2DKUA 3PV7A 1EMTL 4HF5H 4Y89A 3AGVA 4Q74A 2MQCA 5CIPA 3FN3A 3WKNA 4XTRD 3UTPE 4QCIB 2GFBA 1P4IL 2D7OA 3V4VL 5IEHB 3ZZ1A 3U83A 4DGIL 1NBYB 4KMLB 4N90E 3L95A 5E6ZA 4EBQL 2C1PB 2Y5TB 2LV4A 4YEEA 4FFZH 5I1CL 2PXYD 4JAMB 1FZKB 1CXEA 4JHWH 4OLXH 3VH8A 1FZMA 1SHMA 1RAMA 3S88H 4KWUA 3TV3H 2XG4A 5E00A 3GMOB 3P9MB 3ARED 2CIIB 5GGVL 4F7EB 1KB9J 4WDIA 4B5EA 2PUQT 1DQMH 3MRRB 3TH3T 1LO2H 5IG7B 2G2RB 2EDLA 3BOVA 4NRYA 4XMLH 1PYWB 5T3XH 3MRRA 4NCDA 2PYFB 5C0JB 2E7LA 2W0PA 4NFBA 1WCBB 4HWBL 1G9EA 3D9AL 4Z9KB 5INCA 1ZLSH 5BVJB 1TNMA 3H7BA 5CZXC 1TCMA 4QHMB 1T1YA 4R97C 3U9UA 3LKRA 4GOSA 4GFTB 4J6RL 2BJML 3FRPG 5B39B 4ZOEA 1H8SA 1I7RB 4O4YL 5ENWA 1T1YB 5HHME 4KGLA 2VLJE 4FFWC 1WGOA 3VFSB 2QHRH 2NYYD 3NIDF 3GNML 2A74A 5D1QB 3QUXD 3DARA 3O2VL 4O5LL 1NEZA 2W92A 4L4TD 5DEZA 1XGUA 5H94A 3A6BL 2VABA 1IAOB 4L8BB 1IAII 3U4EA 3D2UB 4ZO8A 5EN2A 5IG7A 1BFOB 4LCWD 1EPFA 3LIZH 4YR6B 4B53A 1QLRB 5F44A 2XWBB 4YHOL 3WSQH 3JWOH 2APWA 2GK2A 1RFDL 2V5RA 3TA3B 3FCTB 1OL0A 1F2QA 5DQ9B 3QDGA 1F4AA 4YDJA 3QFJB 5D7JD 4LCCA 3A6OA 1MJUH 1A1OB 1ORQA 1QLFB 2NXZC 5L9DL 2ADGB 1KTDA 4D0DB 4F37K 5FYLL 4XPGH 3QJFA 1LE9B 8FABA 4NN7C 1IQWL 3RWDA 1NGZB 2Q8BL 2F53D 5FIEA 5HY9B 4ZFOL 1C16A 5J12B 3AVEA 5BZDA 1RVFL 3REVA 3G9AB 5ETUA 3FT2B 3DO7A 2YXMA 1X5JA 4LF3B 5DRZB 3VU2A 2IAMC 3RX7A 3MLVH 2DLFH 3TO4D 3TPKA 2BFVH 1U8JB 5C0ND 1FSKC 4IHOB 2P5ED 2Y6SC 5DVLA 3VWJA 3V52L 4U6TA 3BP5A 4HWBA 2EDNA 4IRSD 1NMBL 3MJ8A 4U1HA 4L9LA 5SWZA 3TEUA 2JK5B 5KOVC 2G2RA 5E6IC 1KJ2A 4Q7DA 3MCLH 4U49A 1XGPA 1PFCA 1OAXL 2VLLB 5FCUH 3P4MB 2VZSA 1S7WB 3QUYA 4TTDC 5D72L 3ARXA 3HI1A 4J3XA 4XVUC 5GIRA 3WKML 5ICXA 1RIVH 3V9FA 1ZTXH 2VZUA 3Q5TA 1FVEB 1FZKA 3I6KB 3OKLB 1BZ7A 2BCKA 3PIQB 1AKJA 3MLZL 4MA3B 1R3KA 2KZ1B 2RB8A 5JIHA 4Z18A 3ULVH 1UH3A 1VFAB 1FP5A 2CJUL 3IU3B 1T80A 4LIQH 2CIKA 1M7XA 3IYLW 3FRUB 2AJVL 5J13C 3CVIL 1EA9C 2AJXL 2DM3A 4ZD3H 5T3XL 5IMKB 4D0CA 4PJ5B 2AEPL 3K46A 1BZ9A 4YLQT 1A3QA 2XFXB 4KTEL 2PN5A 5BRZB 1CFVL 2CIKB 4X9GA 3QQ9D 1JPGB 1U41A 2UV3A 4NM4L 5ADPL 3KNBB 3MOAL 3EGSB 2QQNL 5JHLL 3RI5F 4F2MA 1H3VA 2VDKL 4N0UB 1KJ2H 1HCFX 1RJLB 3U0PA 2A6KA 1CI5A 4QRUA 2H2SD 2JJTA 3CUPA 5D93B 2NNAA 1NEZG 2N7BA 1DE4B 1S9KC 4OGXH 3LQZB 3PGDA 1TVBA 4QRUB 1FFQA 4QRPD 2AEPH 1T83A 3NCJL 1R0AH 3IDNB 4L8SB 1SJEA 2VE6B 4WNQB 3WD5H 5FYKE 1CFVH 3DECA 4KDVA 1ZMYA 3UTTD 3VCLA 3BH9A 3DWTA 4NP4H 1OM3H 5C0RH 4HK0A 3ARFB 4D0CB 3IDGA 1BJ1J 3QXWA 2AXFA 3MZTA 1N5YL 2OP4H 4CL7A 4KRMB 1QR4A 1BFSA 4HK0B 4JO3L 3JTTB 1EO5A 1IGFH 1UM5H 5HJ3B 3EJYD 5TQ0L 1E4JA 3MYZA 3BT2L 2Q8BH 4DUXA 3GRWL 1A7NL 5KSUA 3EHBC 4HIJB 4M6ML 1FE8L 4J3TA 5LGKA 4PJCB 3DX7A 3HFML 4YHZL 3NMEA 1MRDH 2FCBA 5FGSA 4LLDB 2AP2A 5BV7L 4OUUB 1TTGA 2NXZB 1TJIL 4XPBL 4ETQA 5MI0C 4WWKD 4BUHA 1FNSH 2ZUQC 4HS3B 2ICES 3R0MA 5E2VL 4WU5B 3DBXA 1TFHA 4G6KH 4HUVA 3MBXH 4RGND 3DI3B 3TJEL 1G9NH 3MC0A 3ARFA 3KXFE 5IESL 5HI5D 1OD7A 4NHUA 3VXSA 5E8EB 3MMEB 1MPAL 2E7MA 3TPUA 3JXAA 2OSLA 5C86A 3CVHB 4UUJA 2NTFB 2YD8A 3FONA 1CGVA 5I8CA 1ED3B 1AHWA 1R3JA 3SDCC 1AGEA 4O2CB 1I75A 5SWZE 2Y25A 4WGVB 3UROR 3GBML 3VI3E 4ZOCA 3B9KD 2VDLL 3X3FL 1D9KD 4LARL 4WTWA 3FTGB 4MB4A 1SMOA 5F6HI 4UZGA 1CTOA 2EKJA 1X5LA 1D5BA 2ICEB 5J57B 4Q9QH 2VH5L 2GJ6A 3WFEH 2DAVA 4MNQD 1NC2B 4N8VA 5J3HD 2RCSH 2OJZL 1Q9LA 1XF3B 5F89B 3QCUL 2MWCA 3HNTH 4IM8A 3VJ6B 3EYFA 1SY6L 2ERJB 1FVCB 2RIKA 3U7YL 3KYNA 2NX5A 5GSRB 4GRLB 1V7ML 4F58H 3EOBA 3WN5B 2B8OT 4U1JA 3C60A 4G7YL 1KIRB 1BZ9B 1QG3A 1WC7B 5CSBA 5DMKA 4M6AA 4YXLH 4U33A 4OD2B 3O9WA 2QR0B 1UB5A 2P48B 4Z6AT 3TPUB 1N0LA 4H25A 4N0YH 1A4KB 1AP2B 2P8LA 3NZHH 5L8KB 3BZFB 4PRDB 4HIEA 2VR4A 3FJTA 2V2XB 4OFIA 2P5EB 3OAZK 4IOFC 2CGRH 2VZTA 5CWSA 4HX1B 2LAAA 3DIFB 2VDNH 4NNXA 3QFDA 4OF7A 4PLOB 1K4CA 3U4BL 4GKSA 3T1FA 1ZA3A 4Q0XL 1TQBC 3NPZB 5I17B 4J12A 3MXWL 4JFXA 2K9UA 2ZSWB 1RULL 5CJQH 1CVSC 1TDQA 3O2DH 5HPMB 4XNZB 3SKOA 4U1GB 4WFGE 2OZ4H 1A3LH 3MUJA 4NM8L 3TWCH 4DN3L 3AUVA 4HC1H 3V7AE 2YSSA 3KYMA 3PHOB 5KS9F 1Y0LB 1QSFD 1S8DB 3HN3A 4BSJA 4LLMA 4DEPB 5C09E 1U8OA 2GW5A 3ILPB 5CCKL 2F58L 4QXWA 4NT6B 1DANT 5LGHH 3N1FC 1IAOA 3OAYH 1U3HD 4HMCA 4OZIB 1NEZB 4X7FC 1FYTB 1FCCA 4DGYH 3MV7A 3RTQC 4WUUA 1WBXA 3VCLB 5INDB 2X1OA 1JHKL 1RZFH 4HGKC 5FYLD 5D7IF 5T33H 3WJLA 1OP3H 4WI2A 4ZUVB 4A6YH 4NKDB 5TE7L 4PRBB 5JHDB 2XRAL 2VR5A 1LO5B 5HGDA 4MCZA 5GJTH 3CLFL 4IOFD 4JM2F 2YPLD 4F9PC 5EZLA 4KV5F 1U2CA 2BK8A 3NIGF 2EKSA 4IRJD 4M5ZL 5DSCA 4ZXBC 1HH9A 1Q0XH 2QLVB 2HJLB 4U1IB 2ARJA 5MERA 5F3HB 1NGPL 2J2ZA 3QFJD 5GGUB 5I1KL 1PEZA 1W2KT 4RAUA 5DT1L 1KJ3L 1Z3GL 4BZ2L 5HGHB 1IZJA 1A9EB 2CIIA 1IM3A 3OAUL 3NCYS 2PTTB 3CNKA 3AXLA 2BVQB 1JGDA 1NMAL 4XXDA 3FRUA 2YPKB 5IHUH 3SQOL 4KZEH 2W07A 1P4BL 5MP6H 5GZND 3GIZH 3BEVB 5DD3L 5SX4H 4MCYA 3QAZC 2MTPA 1H0DA 5GGRB 2AJVH 5HHQA 3IJHA 4YPGA 5GGTA 1D3CA 1A3RL 5TGBB 4LPXA 4GAGH 5BZWB 1F6FB 3A6CH 2BSED 5HVHC 3GO1L 3QEHA 5C08A 2UWEA 1KLFA 2ATKB 2ZP0T 4OZFG 1Q1JH 5FDWA 3OB0K 1H5BB 4HWUA 5K9JH 1OTUC 1XF4B 4U1JB 3LSOB 1JVKA 3O9WD 2VDKH 2PO6C 5DK2B 4NN5C 1HN1A 3L3OA 5AG9A 1KPRB 4J3WA 2BVPB 1YEGL 2FJHA 2MPAH 2HN7B 5DD3H 1RZ8A 1E4KA 1OVZA 4KRPB 3RWFA 4LRNH 4HBCH 1D5IL 1FFNB 3H42H 5DJZA 3STBA 1L0QA 3QPXH 4Z7VF 1PKQE 2JKXA 2W9DL 5JR1L 2HTLC 2Q3AA 1NSNH 4ODVH 1FH5L 4LSUL 2X1XR 5I66B 2V9RA 1Z0NA 4PJ9A 4I3SH 2D0GA 3JUYA 2E7CA 1EEQA 2QQLH 4JZNB 3FB5B 1DBBH 1AIFB 1JGUL 4EEEA 2R9HD 2X4SB 1Q9WB 1VACB 4GW4A 4KHTH 3RVTD 3TBWA 3SE9H 3TT1H 3HUJE 3BFOA 3STZB 1RUKH 4TRPH 1WAAF 2WM0A 4TOYH 3FCTA 1CDGA 3MODL 2J6EA 1IC4L 4X8JB 4PP2B 4OFPA 4FP8H 3H2WA 4PJ7E 4NBZB 1E4XI 2XNAB 1CICC 1OAYL 4O9HH 4Y2OA 2MNUA 5EC2B 5EBLB 1OGTA 2KBGA 3X14B 2C4XA 1GIGH 3UTZB 4XCNB 5H94B 4KI5D 1PD6A 3DXAE 3MBED 1E6JL 1KT2A 4Q9BA 2RFXB 2B2XL 3WL9B 4WUUB 4LKXA 5C0FA 2GI7A 2R56H 2W9LA 1CE1H 2CUHA 4JKPH 5HGBB 1ONQB 4QY8A 5I74B 4JDTL 1VENA 2B1HH 3HG1B 4OB5L 3WIIL 1M71B 1ZK9A 4KK5C 5IBLC 3GIVA 4FRWA 3GSNB 5D6CB 4X80L 3VXRD 3BZFA 4PRDA 4UILL 2CK0H 3SJVD 1Q9KA 1F4WL 1NUFA 5MEOB 2EDHA 4AT6A 3HHRB 3PWJB 3M45A 1MWAL 3HE7C 3OKYA 4RAVA 4JCLA 3NPSC 3RVTC 4OQTH 3N9GH 3QIBD 4G8GA 2J8UE 2FD6L 4HHAB 5HI3C 5EO0B 4F8QA 5IR1B 5JHDA 3UJIH 2P5EE 4NO3A 5E03A 1EAPB 3QUMH 5IOPB 5EU4B 1CD1A 3UTSE 3IS1X 5C0NC 4DCQA 4QT5B 3JV5A 3MX0A 3C6SA 4WFHE 4YBLB 5DDHB 5ESQB 1C8PA 2X4NA 3CLEL 5KTEL 25C8L 4U0QB 4HIEB 2GCYB 4P4RB 4JG0H 1QVOA 1YC7A 2WSKA 4WW2A 2XFXA 3WJJA 3C5ZB 3C9NB 5IB4B 3MV8A 2AGJL 5D6CA 1RUML 2NY4B 3BO8A 3U4AA 1Q38A 2NPLX 5DXWA 2HVKB 3CDGB 3GRWA 3TNMA 3BZ4A 2JLLA 4HUKB 2AKRB 3R0NA 5ACMA 3EJJX 7CGTA 1U6AH 1FH5H 1S7UA 2LU3A 3F6LA 4QHUA 5KSVB 2A1WH 2ZCLL 3K2UL 3SGJA 1UM6H 1VPOL 4OLZL 2YD4A 1R3KB 3PDGA 2Y06L 2QADD 3KAAA 5B4MD 1MQKH 4PJIB 4Y5VC 5JDSA 4HS3A 5DVNA 5KTEH 3RZCB 2UUDK 3X12B 1NCBH 2HAZA 4GG8B 2H32B 2JJSC 5FYKL 4XZUA 5CS7A 5F1IA 2GIYA 3KLAB 4J3SA 2D7TH 1RV6X 3IKCB 3X11A 3WUZA 3U1SL 1L9MA 1NBZA 4OZFH 1PSKL 5BV7H 1MI5E 2EXWC 5IJVB 4FQCL 1N6QH 5FOBB 1W8OA 4Z7QF 3DPBA 2R1WA 4LMQE 2NZIA 3RZCC 5ICZB 3P30H 5IW1A 1F4YL 2F58H 1J8HB 1T0MA 4M43L 4ODSL 4YDIL 4HDIA 1OF2A 1NJ9A 5IJKA 3F6IA 4LP4A 1JF6A 4BFIB 1OOAA 3ZTNH 5LJYH 5FHBH 4KJWD 2ZCHH 3PWLB 1OHQA 4P23A 2RAMA 5MEQB 3BZ4B 1J8HA 1T0MB 1MVFA 3RAJL 5E9DB 1UA6L 5DK0B 5CJOL 2Z31C 1M05A 2B4CH 5IW6B 3BHBA 4QHNB 5AZEH 4WNQA 1IT9L 3OXSA 2DI8A 5D6DC 4JZNA 3O8XA 3VE0B 4MQXC 4YHML 2YD1A 2HJFB 1MAJA 2BRRH 4CN4A 4XP9H 1NGYA 1YEIL 1XF3A 5F89A 5AAWA 5BRZD 1CE1L 2C3VB 1GC1H 4IRSB 1SY6A 1OQXA 5EU4A 5GJTL 1DP0A 1LEKB 2YPVL 4GLRI 4L5FL 3MRNA 1LK2A 2O5XL 3O2DA 3MNZB 3IAPA 5DJ2A 1QR1A 4BJLA 2HT2D 4G9DA 4CU7A 2VLRD 3CZFA 4YHPB 1S7TA 3RHWF 1BIIA 1FRGH 5IT2H 2D7QA 4UIMB 1V7NH 4DFIA 4KFZC 1QSVA 4RWYH 4Y4FD 5E2TH 2AXFB 1BD2A 3S96A 4YAQA 1RIHL 4AEHH 4AEEA 4Y16C 1C5DB 3PUCA 3LRSA 3QQNA 1P7KB 3HE6A 3WHXA 5C92A 3DJ9A 2DN7A 4HMEA 3M1BB 3ZTJG 4MXQC 2YZ1A 4LPCA 2KUTA 4E5XB 2OL3A 3ZHDA 4NFDA 1FFOB 5KVFH 1KUMA 1MHCA 4PGEB 1U8QB 3RNQA 3C60C 2KH2B 5J4MA 1MQ8A 3IU3A 4U6YB 3OZ9L 1ZVHA 3ZKXC 1JMZA 1QFWL 3LPFA 4P4KD 1LEKA 4UQ2B 4WW1B 3NIFF 4FNLH 3O8XD 3V6ZA 3FOMA 5KAQF 3V4PL 4K3EH 1ZS8B 4OGAC 4ALAH 5HGGS 3DV6B 4GAJL 2HH0H 5LBSL 3ZE2F 5IV2A 4OI7A 2B4CC 2VDML 4LVHC 1PW3A 1U6AL 3CFKB 1GZQA 2ICWI 3T0EE 2IPUK 3F12B 2FX8L 3K2UH 4HKBA 1HNGA 1YEDA 1IM9D 5J12C 3EBAA 1MCCA 4V1DA 1RZIB 1CLOH 3TO4A 1QFWM 3DGGB 3RGVC 4KJYA 4OKVA 1QA9B 2VLKE 1PZ5B 4QRSB 4Y4HA 1Z9SA 3QUKA 4H8WH 5E99L 1DTUA 4OV5B 3KLHD 4ZYKB 1NBYA 1B9ZA 3ARTA 3LS5L 4N1HB 3S35L 1AH1A 3OJDA 1IAKB 1SJVA 4LLUA 3PDDA 1GAFL 4NNYA 5GRWA 1T20A 1A7OL 3FO1B 3SDXF 5FEBA 1EUUA 5KS9A 1MAKA 3BKJH 3SJVB 2BNRD 2X89A 1X6LA 5K9OB 3FFDA 3VA6A 5IIEB 1H3XA 1RJZB 4CVZA 5EOQL 4EUPB 5DR5H 1UA6H 5DLML 2DMKA 1OGAA 4MDIA 1HHHB 3DUUB 2VQUA 1MUJB 5FYJU 4DKFH 3QZWA 3MV9A 3NVQA 2BFVL 3HNVH 2KPNA 1LNUA 4AEIH 4IJ3C 4DQOH 1T03H 5DMGD 2WBJC 1U8KB 2XXMB 4PRHE 1VACA 4GW4B 1BAFL 3RZWA 3IAGC 3RDTA 5IESH 2YPLE 4OF6A 1LWRA 2AK4E 5F7DA 3UYOD 2O5XH 1A7QL 1E4WL 1IC5H 4FXLA 2Z91A 1YN6A 3FFCD 1EEYA 3BWAB 5EU6E 1DFBH 2ESVA 3IRZA 4ZUUA 4ERSH 4S1QH 5ESQA 3UTTE 4BZ1L 5EOCL 5DMYA 1I7TA 1KGCE 2J8UB 4TVPL 3PP3K 1INQB 1KXTB 3NCCB 4KK9C 4XP1H 3WS6C 2ZUWA 1BJ8A 4UIKH 3WNNA 2I5YL 4FTVE 3D2UD 5GIRB 4GUPB 3SKJH 1OD9A 2CH8A 1UWXK 3EFDL 4HUNB 2EEDA 4P46D 5I6XC 3MO1A 3HNSH 1B0WA 4LCIL 1MIEL 4OGXL 2WIIA 4NC0B 4HWZB 5A16A 4ACPA 3ETBF 1O5DT 1EZVX 3ZHKA 3PXHA 1FO0B 1MNUH 3CPLB 3HMXA 1U92A 4LSTH 4FFWD 2Z8RA 3L9RA 3RNKA 4C4KT 4LIQE 5SWZB 3QEGH 4ZD3L 3FB6B 4PJGE 3WXVL 3RU8L 3BH8A 2EKSB 4K7FA 2WIIB 1TPXC 2VXQL 5JORA 1ACYH 2MOVA 1RK0B 1YEJL 4H1LA 4JDZA 5B38B 5E4EC 1P2CA 4BSVA 5HTSA 4JG1H 3FB7A 3RRQA 2HFGH 4P5TD 1FYTD 3QXAB 4G9FA 4JKLA 1SBSL 4UAOC 1DQDH 2VZ3A 4XNUH 1YPZF 3QO1B 5LCVH 2VDMH 4K94H 4KQ3H 1WFTA 4F57H 4YEFA 5M95B 2GFBB 2FL5B 4BQBA 3ULVE 1ZKAA 4N1CA 4S1DD 1XZ0A 4FZEL 4Z95L 3B8YA 2D03H 3PJSA 1S5IH 5FOJA 1S9XA 2ORBL 4X6DE 5HYSB 3MRCA 2X4UA 5D2NC 1GGUA 4M4PA 1LNUB 3HMXL 3T2PA 3BP7A 1DQDL 5TJWK 3MBEA 4HG4J 1YYLH 4L4VA 1QSZA 3QCTH 3VFGH 4L9LC 4KHXH 5F72S 1G7PB 1TQCC 1LE5A 2X4RA 1J9CT 5D1XA 4YHIB 3WLWC 1JYVA 4Z76B 3OX8A 3P4NA 4YBLC 3QRFM 1WAAE 3VWJC 3RWIB 3L5XL 1SBBA 1UC6A 4ZODA 4P2OD 4XPHL 4N1EA 5HPOA 3N1GC 1K8DB 3ALXA 4ZYKA 3GSNL 4PJ8C 5TQ0H 3C5ZD 2DM2A 4YXKL 5SWSD 4G8EA 5EB9A 2EDDA 3BP6A 3O6MH 4NNYB 3WFHB 2AQ2A 1P9MA 2HWZH 4WUUD 4OZIF 3CX2A 5CWSB 2IH3A 1MWAB 6CGTA 3MRJA 4XC1L 1RZIA 1G7HB 1I9IL 3ARDB 4PS4L 3REWA 1AQKL 1N0XL 4K23L 2BOBB 1EGJL 5EBGA 4W4OC 2VDRL 5TE6H 4ELKA 1UB6B 2J5LC 3INUH 4DN4L 1KIUA 3FFCE 5F1SA 2V2TA 3KS0H 4FZ8H 4TSCL 4Z7VE 2X4PB 4IRSC 4WVRA 1FL5A 3KPRA 5IVZB 3RUGA 1VA9A 1QSFA 3V5DB 2QBWA 5D7LD 3V4VH 1QBBA 3OKMB 5TF1H 5I2IA 2ZUQB 4XNMB 1AGCB 4ODWB 1Q0XL 5F9OL 4Y4FA 1X7QA 2EDQA 2O5YL 4GG6A 5DA0B 2YEZA 1NC4B 3NGBB 4L1DA 3QEQD 4KDTA 1ULVA 3QNXA 2J8UF 4FQ2L 2BDNH 4NN6B 2BP3A 4UQ2A 4WW1A 5JTWA 3V6OE 3S6CA 1MFBL 4X6BB 5KG9A 1INQA 4JAMA 1ES0B 5DJCB 1N7MH 2P5EA 3VWJD 3HRZA 4L9DA 1RZGA 1AD9B 5GJSH 4PB9L 1HSBB 5B21A 4JY4A 4ORZC 2IH1A 4XAKD 2V5SA 3LEXB 4LDEB 3GHEL 4KKCD 3P2TA 1F6AA 4JO4H 1GHFL 3SN6N 5IVXF 3VFTB 3MUHL 1OSPL 2R39A 5BCAA 2OL3B 3HKFA 1W72A 1JGVL 2IBZX 3C5SB 2CPCA 1VFOA 5E1HB 3B9AA 3MGTA 3B4NA 3VFVB 1E27B 1RUPH 3ARGB 1ZLSL 1MOEA 4H26B 4WFGD 1FVCA 3OKKB 4H0HB 3C6SB 3FMGH 2R4RH 3MBEC 3PABB 5HYIA 2NXYB 2I9TA 2OZ4L 5C9JB 3BGFB 1JN6B 2ZUSA 4GQ9L 1WQVT 2ZUXA 5DRXA 2HKFL 5FGBC 3TWCL 4DN3H 4MD4B 1RJCA 1KTRL 4N0YL 1NLDH 3WMSA 2XWTA 4HBCL 2FHCA 2NY2C 4RFNB 1XGQA 2Z92A 3DV4A 2ZOKA 5F88A 3U0TA 1CLYL 4HQQH 1HDMB 4XCCL 2VLLA 2Y5EA 2PR4L 2A6DA 5GISL 2VB5A 4XCEA 2PO6A 2VUYA 3MV7B 1U3HA 3O2WL 5DFTA 3TCLB 4PGBA 5DD6A 1M6OB 4NPYA 2HFEB 4LNRA 3VMOA 5EU3B 2AEQL 1G9NC 1AD0B 4X6CF 2AABL 3KJ4B 5DF0A 5I1JL 1V3KA 3ARFD 4UT6H 4EQ2A 3GI8H 4ZOBA 1KCSL 3G5XA 2ILLA 2X41A 1F42A 1KJVA 5DUPL 1RZJL 5K9QI 4L8CA 1A6ZA 5F9JA 5HDQH 5HBBA 1DCLA 4JVPA 1A2YA 2CXGA 3HR6A 1N5AB 1UENA 4EI5C 4EOWL 4F7TB 4P2QD 1XCQB 2IAMD 4EUPG 5I8OL 5MENA 3IKKA 1KLUB 1WWBX 1IARB 4M8VA 4XZUB 3S88L 4OD3L 4Z7OE 4QHUB 4OFYA 3UDWC 1DBAL 2R56L 3VG9C 1R5VB 5GGQH 4JFFD 4DZBA 5CEYA 1PKQA 3OL2A 1IAIH 4UU9B 2OYPA 4JDTH 5FCUL 3T3PF 2YMXH 4Y5YA 4LLQB 1IEBB 1KIQB 4MAYC 5J3HC 1VFBA 3VXRA 4R6UA 4DVRL 2P8MB 4FQ2H 3RP1A 2DYPB 1JWUA 4OIIH 5CD5C 4H5SB 5E2UL 1XF2B 3THML 1T5WB 1GGBL 4HEPG 4D3CH 5CEZD 3L3HA 4PLKD 1T5XA 4S10A 4YUEH 2FX9L 3CMOL 1D7FA 1WCQA 5LGJA 3DSFH 4HIHA 4PJHE 4I4WB 1B2WH 3W0WB 1WITA 3QCVL 5ANMA 5ITFA 4CNIB 4YDVB 4YHNA 4UTBH 4I4WA 4PREA 4K3EL 4O5LH 3DMMC 2NQCA 3V5KA 4DW2H 1KG0A 3D0VA 4P46A 1II4E 3VRIA 2H3NB 2VDNL 5GRVK 3T08A 3T8XB 3VXPA 1TTUA 4R90L 1RZJC 3SE4C 3QPQC 3WFBH 2XPGA 2JF1A 2BX5A 2Z0BA 3ULUD 1MCIA 4X98A 4QHNA 4XVTH 5IMKA 2ZG2A 4LCUB 1FAIL 3BKCH 2R8SL 5CJQL 2FYYB 4LEOA 4MJ6B 2YS4A 3MLSL 1KEGH 2VMFA 1ONQA 4QY8B 3O3EA 3M07A 2JB5L 4O00A 5D1QC 5C2BL 2OLDA 2QSVA 1R24A 2Y5TA 2DQHL 1AC6A 2OQJA 4FG6C 4OLUH 1AI1H 4WFFE 4PJDE 3VWKC 1KXQE 4NSKB 5JO5A 4Y88A 3AREC 1EEZA 3C08H 4KROC 3AAZB 3RVXD 5JXAL 2IBZY 2AJSH 4P2RA 3PE9A 4LHUA 2VZ1A 2IQ9H 2F74B 5KOMC 5EZIH 3JWDH 2KL6A 5C0CE 4ZPVB 4NC1E 3BKCL 1NBQA 1YN7B 3UTPD 1K9TA 4APQC 5KSBE 1MELA 1BFVH 3VXTA 3KR3H 4JM4L 2PO6D 4GKNA 5ID1A 2JB5H 3IFNH 1BBDH 4U1IA 3TVMA 3ESUF 1IL1A 3TA3C 4AIXA 4OLYL 1YJDL 4QXGH 4XP6L 3OF6D 2A77H 2OTUA 4R7DB 1MHHA 3D69A 4JFDD 4ONFH 1UEYA 5FM4A 2RHEA 4JFPB 2HT3D 4MD0B 4X9IA 4NUGH 4Q6IB 1FIEA 4BQCA 4X80H 3W2DL 4Y16A 3RAJH 3WKMH 4H0IA 4NKOB 4M1GL 3RTQD 3QWRA 4GXUN 4I77L 4GW5B 4Y4KC 2VAAB 5IQ7H 1MRCL 5ID0A 3BX7C 3IF1A 4BZ2H 2YZ8A 3MLZH 3FT4A 2DLFL 2H32H 3ARQA 1QO3B 2H9GB 4QLRA 1JF1B 5IMLA 1KXVC 2FB4L 3O45A 3TO4B 1OT2A 1MLBA 3H9ZA 3LQAL 5F7FA 1I85A 3EDFA 3UXFA 3KXFD 2GAZA 4RDQF 5MP6L 3QI9C 1N26A 4OGZA 3SKMA 3UTQB 1IL1B 3RWJA 1C1EH 4G80A 2DJ4A 1AXSB 2NW2A 3GGWA 5ICYA 3NIFE 5EZOL 3PHQB 2DTML 1GGBH 3O3UN 1A7RL 3NA9H 2FIRT 3MUZ1 3PWPA 3MO1B 4KI5C 4JO2H 3S37H 5FA4B 4FQLL 4MJIA 3D0LA 1KACB 3L3DA 5JW3L 3GMMB 3ULVC 5KAQG 3S34L 4Z7NF 3G6AA 5JW5A 2IH1B 2ZPKL 1MFDL 2IG2L 4RQQB 3KWWB 2DRUA 3CXHJ 3L5WB 3D0LB 4XBGA 2NY5H 5DRNB 3VXOB 3HE6D 4LASL 3NACL 5B38A 3KWWA 3QRGH 1QFOA 4F15C 1U95A 5JORB 3NAAH 5A2FA 1LK3H 5C0RL 1XH3A 2UZXB 3GMRB 1CL7L 4NGHL 2VR9A 4NO2B 4OSUL 2ORBH 4QXTA 5CIPB 5FYKH 5DD0L 3NIGE 3RUGF 3VGAC 4BKLA 4MA7H 4L8SC 4D9RD 1WC7A 5DMKB 3V79C 3ES6B 1ZEAH 1U8IA 4UTAL 4NQVB 4Y5VA 1P84J 3MGAA 4P3DB 3VFOB 5BO1H 2JB6B 4YHPA 3VXSE 2DQJH 1SJXA 3SDYH 1BP3B 2WLZA 2QTEA 4R0LC 4UQ3A 3TT1L 3BT2H 2ARJQ 3HB3D 3QHZH 1K6QH 3GHBL 1IQDB 4RGNB 3OGCB 3CSBA 1LEIB 1AXIB 1WFNA 4KKBD 1FC1A 5IEKB 4U3XA 3P0GB 1U8HB 4M61B 2X4TA 4LF3A 3U30B 2RBLA 3PWPE 1CL7H 4NGHH 3CFEA 5T1KA 4UV7L 3O2WH 4ORGA 2VTFA 3F5WB 1YNKL 1NCUA 4ZFGL 3QEUB 5E7BA 5ITBL 2IMNA 3FO0H 3CK0H 1HEZA 4PRPB 5KZCB 1CR9L 3LVEA 1MI5D 3W5MA 3VRLF 5BXFB 4QRTB 5GGTH 3TBSA 1TPXB 1QSFE 5F7HA 1X5HA 1IGYA 2OTWA 5JDJA 1FFRA 2Z93A 3JWNC 3VGGA 1K6QL 4YDJB 4GRWH 1FFNA 5DJZB 5DA4A 3VFRA 5JA9A 3D3VB 2LU7A 1S7VB 2HN7A 5D96C 2ADFH 1FC2D 1CGTA 1YEEL 5E56A 4LKCB 2AV1B 4G43A 2EEAA 1KN2L 3BPNB 5DUBA 1XF4A 4UV4H 1UXSA 3JSSA 3P9WB 2O61B 4M6NL 4NJ9H 5CJXC 1RIHH 5D5MA 4PRPE 4RFOH 4YHKH 4Q6IC 1F4WH 2F15A 3QNZB 4X7TA 3RVWC 1GJIA 4XTRC 4OM1L 1H3UA 5HGAB 5DRNA 2H26A 1HQRB 3WFCL 5CMAA 2RQ8A 1J0IA 1KIPA 3FQTB 3WE6B 3WFDH 4YFEA 3MBXL 4KKBC 3QHFH 1FNHA 3MLXL 2FNBA 3FO2A 3GHEH 2YUVA 4D8PA 1R3HB 1ZHKA 4EBQH 3KYOB 4L4VE 4DVBB 4JPKL 3U9UB 1CZ8H 1WK0A 1MPAH 2AEWA 2VL5A 1CICB 1P5VA 4CVUA 2G5RA 3S37X 1EO7A 4XP1L 1INDH 5E8NA 4X6DA 1B0RA 2AVGA 2UVEA 1RURH 1R6VA 5C0JA 1YYMH 4P2RE 1V5JA 4X5WB 2ESVD 4C56D 5E2TL 1RHFA 3MV9D 2DJUA 1ZS8A 2J6EH 3KYKH 3PWPD 4OGYH 1YEFH 3GM0A 4PJDA 5KSAA 3IDJB 5JPNA 5JHDD 1K5NB 1OGAD 2VE6A 2APXA 1IC1A 4UT7H 5KSAC 3KPQB 5E08L 1PG7X 4HD9A 3MJ6A 5I8KL 5ANMB 3L7FA 2FHBA 1IJ9A 3NFPB 4G5ZH 4K94C 2YR3A 1ZLVH 3MRPB 2UYLB 1TCRA 1I7UA 2LAGB 2ZG1A 4HIIB 3G5VB 3MLRL 3E6FB 3BXNA 4LSQL 4ZUVA 4KY1L 4LVEA 4OUOA 1VPOH 1CLZH 3MRHB 4OLZH 4Y1AD 2PKDA 3GO1H 4D0BA 2RGSA 4U1SB 5DVKA 5DMGC 5H35A 4N0FB 2FBOJ 4UB0L 1OM3L 4O2FB 2BJMH 2GY5A 4Z7UE 1EEYB 4NHUB 4XWGH 3CMGA 3UZQA 3EJZD 3K1DA 4JFPA 5EU7E 1C5DA 2VOTA 3WNLA 1BWMA 4R3SA 5FA3A 5I73C 3TBVA 2ZG3A 3BKJL 1I1AC 3Q2CA 5E8PA 4QRPE 1FNEB 1TTFA 5DD1L 5CJXA 3QIWD 3MRDA 4YBHA 3U7AA 3U4BH 1A8JH 5HVHB 2CLRB 2YOCA 1WZKA 1IGIH 3ZT6A 1HHHA 4UV7H 5JXAH 1P6AB 2QQLL 5F93C 1NMCB 5ACZB 5DLMH 4P9HC 3HZYA 1JGUH 3KPMA 3SDCD 4LSVL 5MHSE 5DK3A 4JFXB 3JV6A 1W72H 4P5KB 2AK4A 2OL3H 2R29L 2XKNA 1HHJA 4P2CG 4OQ1A 1XCTB 2ZOLA 1S7WA 3ABZA 3LRGA 2HTKD 1CU4L 3J8F7 5HI4C 3LPGA 2FIKA 4WFEE 5I30L 1CN4A 3O6LH 3ILQC 3TN0D 4NWUH 1P4IH 2DF3A 5C9JA 5I9QC 3MV9E 1DBJH 1NCWL 1IGIL 2EIEA 3O0RL 5C0BB 4X7SH 4JR9L 3JWDC 2NY1B 4R4NC 1XGYH 4FFVC 1IKFL 1OGAE 5SX4I 2A6IB 3BD4A 1OF2B 3VWKB 5C0BA 3GJEA 3NIDE 4TUKH 4X6CE 3H6JA 5SWQA 2BSTB 1VKXB 4JY5H 4MA8H 4JFYB 1AQDA 1OAZL 3BP6B 3H3BC 4PLJD 3L3GA 5KS9E 5TPWH 5B8CC 4JN1L 3LQZA 4K7PY 1CT8A 4NRZA 2ZUVA 2Q8AH 1R3IH 3BIBX 3P4LA 4TTDD 4P49A 3IDNA 4L8SA 3QEGL 4HF5L 1P1ZA 3TZVC 1I7UB 2X4RB 4F2MB 1BEYH 2BZDA 1KB5L 4NRZB 3CD4A 3CUPB 4BZ1H 3ZYIA 5DC9B 2MSPA 1T5WA 2IPKB 3SPVB 4MJ5A 1S5HA 1W0WA 4URTB 2WINA 2FBJH 5I8CB 5I1CH 2H45A 3BO8B 5TQ2H 1I8KB 1OTTC 3RWCB 4Y1AB 3RTQB 1L0YA 5C0EA 3ULUC 1A64A 3O41A 4AQOA 1WSST 3DYPA 5GS1C 2IEPA 4JFEA 3EYOA 2A74B 4OQTA 3HMWL 3MLPA 2I9LA 4NCC2 3VXOA 2DIBA 2XA8L 1DANU 3AU1A 3REWB 1U91A 5D2LF 4IOIB 4FFVD 5IHZA 3X3GL 2B1AH 2GYSA 1UG9A 3C09C 5HHPA 1HSBA 3JVGA 5E6YA 1EJOL 2NXYC 4BH8B 1LEGB 1QSEB 1NCTA 2X9YA 2QQNH 2ZOLB 1B90A 4MWFB 3RPIB 1I8LC 3E8UL 4HHAA 1NKRA 3I9GL 3QUZB 2H1PH 4S1RL 1FNFA 2VITB 4MQTB 5DZNA 3AROA 4JEGB 4U3HA 1GXEA 1S78C 1XIWA 3P0YH 4PY7A 3MNWA 2E27H 1L6ZA 1NC4A 5D2NE 4U1HB 1RUKL 2EYSA 1KNOA 3NCJH 3P4MA 3OSKA 4W6YB 1ZE3C 2ED7A 5DURB 4HWZA 1X5AA 5FGCE 1A0QH 4J4PA 3R1GH 5CLWA 3RY4A 5EIIA 3WDJA 2DQTH 5ESAB 2CDEA 4R3SB 5FHAH 1NCBL 2JJVA 5L2JA 4Y2DD 3FFCB 1QRKA 2QQKL 4P23B 1J1PL 4NN6C 5BZDB 1MJJA 3WFZA 4DWHA 3GSQA 5ALCH 3BEWB 3VXUD 1KBGL 3KLSA 5GRXG 2EXYC 1F45A 4ZUUB 2J3SA 5KJRL 5EUKB 1FO0H 3MRLB 3TVMC 1S7XA 4JVUA 1WZ1L 5GGTL 1A6TA 5EWIL 3ULUE 3KPRE 1OLZA 3CCHB 2V9QA 1EMTH 4Z7VA 4YHIA 3QXVA 2XKNB 2CLVB 1VCAA 5CAYB 4C83A 4JHZA 1KELL 4PJBA 4WHTA 3IKCA 2IFFL 3X11B 5SWSE 3ILPA 3CX5K 4AG4L 5CP3H 3FN9A 2Y07L 4HGMA 4MD4A 4PP2A 4PJ8B 1PY4A 1A6PA 2OMBA 1DEEA 1FL3A 2E6PA 1S9XB 3BPNC 5J89A 4XPFL 4WFFD 4JZOB 4OAWB 2QSCH 1CBVL 3OB0H 4JHWL 1FO0L 5EOCJ 5GPRA 1IGMH 5GJSL 2X44D 3FAWA 4I9WE 3DOSA 3MRGB 1BJMA 2WIMA 3W5NA 5BRZE 3VGEA 5I18L 2NY3B 5A1AA 1GOHA 3GKWH 1XH3B 1T20B 3FO1A 1G6RB 3O4LA 3QYCA 4NNPH 2C26A 3EZ8A 3GMLA 35C8H 3UEZA 4D8PB 4K3GA 3QIWB 5GS2D 3TC9A 5IT2L 1HXMB 4MJ2A 1FG2B 1I1RA 4FQXB 5E2WL 4HUWB 5FKAB 5LWYL 1YEJH 1BMGA 4M7LT 4K9EL 2WBWB 4ONGH 3VW3H 2QADB 3ULUL 3HE6C 5AYUL 1QKZL 2ATPA 2N7AA 4HLJA 3ECBB 5HHOD 3IU4L 3OJVC 4OGYL 2AXGB 2PW2B 3RWEB 3SKNB 4MJ5B 4PJCF 3HMWH 3IS0X 4ZS6D 1HYRC 5DHVB 4PJAA 1KNOB 4PJEF 3MV8E 3TNNA 2AERT 3H9SA 3CC5A 3LB6C 2Q1EA 4RFNC 3IFLH 1CDYA 3E1F1 4WO4C 2E6QA 5T1LB 4XPAH 1WIUA 1CFNA 1MQKL 2C3GA 4NP4L 1OWRM 4NDMA 4MAYA 3UTSA 4HS6B 1S5IL 3LV3A 1RQ5A 1QSEA 5D9SA 4UDTA 2Q86A 3O8XC 3GMLB 3BUTA 5JQ6H 3FHAA 1ND0B 2ARWA 1G7MB 1H8OA 3RY6A 3VFNA 2HH0L 3BYTA 3C8HA 1RZJH 4I2XB 2ESVB 4PJ9D 4PGCA 5CUSH 4EN3A 3K2MC 4XPHH 3PHQA 3O3AB 2HTKC 3JWDL 5B3JE 5GGUA 3JTSB 1YEEH 4KPHH 1G7LA 3PWUA 1JNHA 3QDJA 1EHXA 2DBLL 5HVWA 1AC0A 3U79A 2ZCLH 3IXTB 2D9CA 5I1LA 5I74C 3RBGA 4LSVH 4NHCH 4YC2C 3H9HB 3I02A 2R0LL 1SM3H 2HKHH 2YD6A 2DQCL 4XNXL 2JCCF 5I71B 1KCSH 4PRHA 4JB9L 4H1LH 1S7XB 2AAVA 2ITCA 1IC7L 2FH8A 5C6TH 5BS0D 3MJ9H 4JY6B 3U6RB 3JTTA 2P8PA 3VDAA 1IAKA 4N0CD 3O11B 3RL2A 5SV4A 3SE3A 3VI4E 4RBPH 2X05A 4G9FD 5MEQA 3OXRB 4TSAH 2VXUH 4JFEB 2DQCH 1I1AB 3JZ7A 3F8UB 3HC4L 4M1CC 1B2WL 2ED9A 2UZIL 1BAFH 4JM2A 3QIUB 1XGRB 2C1OA 3WYRA 1MIML 3CFIC 3L9RB 2CJUH 4WFHD 1A21A 1GGYA 5F9DC 1WBYB 4C56B 3QCUH 2X70B 2XPGB 1JL8A 1X4ZA 1KN4L 2DQDH 1FPTL 2AEIT 4L5FH 3WV0A 5D7LB 3C87A 4U1MA 1AO7E 4KVNL 3L3JA 2XWTB 5E7FA 1D5MB 3G6JF 1DQLL 1RUPL 4PJEA 1VEOA 2E3VA 5IF0B 4QWWD 1BJ1H 5FV1L 4NZRH 1RJLA 4FQXA 4V1DE 4X4ZA 5AYUH 4RWYL 3NZ8B 3PL6D 1JNNL 1Z2KA 5I19H 4MS8D 1FRGL 2FBJL 4PJDB 4HFWB 2FX9H 3HNSL 1RK1A 3UO1H 3WIFB 1AFVH 3AMLA 3EYOB 2E8ZA 1FL6B 3OKOA 4JRYE 1I3GL 3MV01 4HWEL 4PJ5D 1A6VL 5HD8D 3CSGA 1UQSB 1W72B 2APBA 4LPVA 4ESKA 2AJZA 5FO9B 2D31A 1F6AB 2E7HA 2HRPL 2VC2L 3L3IB 4PJXB 3MR9B 3ROLA 4ZS6C 4PLKC 4JLRB 4L29B 3B9EA 4XXCC 2CD0A 1YNTA 2O93L 3WS3B 3EYFB 4CMMA 4KTYA 5CHNA 4JVWA 1TVDA 1Q0YH 5EULV 1DDHB 1BQUA 3N06B 4LHJB 5A2IH 1LILA 4G6JL 5KG9B 4ZDHA 2GAZB 1C12B 2WLYA 4XCYB 5D7SH 1QBML 2CRMA 4OLYH 3S36X 1DLHB 4UNVA 1I1FA 2P5WA 5CCKH 4IDJH 5KANG 4ODWA 4GBXB 4PRIA 1U58A 4HIJA 3RVVC 5D8JL 2D03L 3CXDH 5IVXA 2VLJD 1BD2E 5CLTA 2D7MA 5LG1A 4JR9H 4IDLA 2P5WE 2PCPB 5EZIL 3IJSB 3BP5B 3MCG1 3OXSB 1Q9KB 2I27N 5KSVA 3DVGA 1MCOL 5T1KD 1WFOA 43C9B 4HXBL 3D48R 3ARDA 1URLA 3V0AC 3EDKA 3L5JA 4XX1E 3L1OL 3B83A 1JYWA 2CKBA 4P5TA 1BBDL 4LLVB 1G7IB 3KHQA 3KPSE 4NZTH 2XN9D 3CU1A 3JBG7 2A77L 4IMLB 4PJ9C 3QUZD 4O2FA 3QDMD 3ZMRA 2XWJA 4S0SD 2A6JB 3V6ZB 5I1GL 5FOBA 4M7LH 3MV7E 4D0DA 5K9KA 4YQXH 1MCWM 1A2YB 2P5WB 4HH8A 1DZBA 5H2BB 1KJ3H 1TVBB 1XMWA 3GMPB 1XF5A 3EDJA 4HMDA 4KMQA 1DE4A 2H41A 1HKFA 1EEZB 3O81A 3LMJH 3FQNA 4GLRH 1XIWC 1G6VK 4LCIH 3PWUB 3RWGB 4KJQC 2D31B 4PJHF 4XP4L 5DFVD 3ROLB 3VXMA 5C0AE 3QQ4A 4L8BA 4YHLH 3QDHA 4Y5YB 1CK0H 2R0WH 4W68A 1BECA 2FX7H 2XA8H 3L3IA 1REIA 5FXCH 4Z5RA 4GXVL 2QR0A 2VSCA 2WUCL 3PWNA 4M1DH 4NQCA 3VGHA 4PJCE 1ZLWK 2WINB 1FDLL 1RIVL 2XZCH 1MY5A 5JLZA 3P0VL 5DD0H 1CD1B 5F71A 5DD5H 4DVBA 5C0DB 4Y5XC 1XAUA 4M7ZB 4LHQB 5TDOB 3F7PC 1DLHA 3T0AA 2IBBA 4ZNEA 1JP5A 4QHMA 2D4DA 3I9GH 4YJZL 5BO1L 3ULUH 3MFFB 4MJIB 4FQLH 3KLHC 5INCB 5HI3D 3GMPA 3ZL4H 4KKCC 4CJ1A 5T3XE 5EO1B 5ICXB 2LU4A 3DVFA 4IBLT 2W38A 3GSVA 5KSAB 3RWFB 4JO3H 2LVEA 2VN4A 2X10A 1E0OB 5JUEH 2OX5A 2ZKHH 5ABDE 3IFLL 3SKMB 3UTQA 1CDUA 2BNRA 4F9PA 4WEMB 5CSGA 1LK3L 3QWRD 2P42B 1TZHA 3QEQE 1A5FH 2PXYA 4P9HH 1J18A 1IMHC 4TPRH 2WAHA 3A67L 5FYJE 1WEJH 5E9DD 4FQHA 3B2UD 3WJLC 4PJHB 3MREB 4OF0A 5JQ6L 3QA3B 2J8UA 3ZLQC 5HVFB 4H1LG 4DZBB 1OAKH 2BNQE 4QRRA 2B5IB 1JZ8A 4XAWH 5EUOF 3GSUB 5JW5B 4ZAKB 2P1YA 3MOBL 4PY8I 1KELH 2DD8L 3B9KB 1LE9A 4ODVL 2HJKA 1HHKA 1KPVA 1GCFA 3W2DH 1TQCB 3D85B 4X6EA 4PJAF 2GY7B 5J6GA 4P4KB 1JWSB 2HVJA 2H2SC 4LVNC 4PJ7F 4ZO9A 5GRUL 3EDDA 3D25A 4GAYA 5J6GB 5ILTL 3U0WH 1ETZA 3LS4L 3FQRA 5HDQL 4GRLD 2YK1L 1F3JB 1BFTA 4X7SL 2UWEB 4KHTL 4F15B 5IB3B 5A2KH 2GUOA 3U82B 1A14L 1QUNA 4M4RA 2XI9A 3CSPA 4HJJL 1J0ZA 1SY6H 3H9SE 5F7LB 3U7YH 4TUKL 1YQVL 1FBIL 1GH7A 4PJAE 1NAML 4XI5D 1NGZA 4C56E 4ZPTA 3ULSA 1ZTXL 3CFEB 1H9VA 4KUCD 2GTWA 4HXAL 3WDHA 4M61A 5DI8A 3NN8B 2EIZA 1DR9A 3GSQB 2F5BL 5C3TA 3BPOC 5IHLB 1HH6A 5ILTH 3MROB 4P59L 1J1OH 3BISA 4OJFH 3EYUL 1WICA 1U0QA 5AUMB 1FYHB 3UTSB 1TVHB 4HKBB 2AK4D 4U1KA 1GC1C 1U8PB 3E6HA 1EJ6A 4ZFZA 1MFEH 3OHXB 3T8XA 4GRMB 2DJSA 3PABA 4NQED 2JIXD 4C55A 1CLZL 3R4DA 1IM9B 3MOAH 3S5LB 1JGLL 5BRZA 5DSCB 3QB7C 3A6CL 5T5FH 2VITA 2VDLH 3X3FH 2AXGA 2L0DA 3OXRA 2XV6B 5TQ2L 1E28B 5F97E 4BELD 5HHOE 3LHPH 2NY3C 5I19L 4NN5B 3T1FB 3VH8B 3IFPB 1T5XB 1I7RA 4LOUC 5K59F 4LGPB 4X4YB 1YPZE 1CDCA 1QYGH 4KRPC 5DI8B 4NO5A 3D87B 1UWEL 4J3VA 5CMAB 2HFTA 3MRFA 2CK2A 2B1AL 5AD0B 1B4RA 4HGWB 1CFNB 1C08A 4P3WA 5C08E 3C5ZC 2XQBH 3KG5A 4BSWB 1MFAL 1G0XA 4MNQE 3VD9A 2EDEA 2HA1A 3CC5B 1S9YA 4XGZB 4AM0A 3RVVD 2EO1A 4F7CB 5JQHC 4GG6B 1V3LA 4K3JL 5I2IB 5K9QG 1U8PA 2H6PA 1DVFA 5IK3A 3BN9C 3C6LA 4LKCA 5E8OA 3TVMB 4X8JA 4YDKL 4WI6A 3LH2L 4CVZB 3MNZA 4I3RL 3BZEA 2XRAH 3CFCH 4HUWA 4EDWH 1L7TH 5FKPA 2HLAB 4YGVB 3GSNH 1N5AA 3HAEG 2DQEL 4P23C 3MXWH 3KS0J 2ADFL 1KCLA 3AS1A 2ICWJ 4BYHA 1MRDL 1KYOJ 4NKDA 5DQDH 3EZJB 3GSXB 3ZYOA 3LQMA 2V17H 1BVLB 5DEFB 1W8NA 4RMSA 2IBGA 4M7ZC 1UZ6F 1LP9F 4ORGB 3BHBB 3TZVD 4HS8L 4N68A 2B5IC 1U36A 4OM0H 4E42B 2CDEB 4P3CH 1U9KA 1UKSA 3GJFB 3O6FD 3INUL 1CVRA 4ELMA 4LOUD 2XZAH 4YX2H 1ORQB 1A1OA 1QLFA 3QZWB 2UZIH 4MLSA 3ZDYF 5E8DL 1P84K 3OX8B 2ZJSL 3P4NB 5DTFB 3BQUC 2EC9U 3QDGB 3C09B 3HPLB 1T21B 4LPUA 4NUGL 4WV1A 4M7KH 4LFHD 3GSOA 4MNGB 4OD2A 1LP9E 3L3OB 1NFIA 3UBXB 2VXTH 3W39B 4L3EA 1CQYA 3EOBB 3WN5A 1T83C 3FQWB 4LLAA 4M7LL 3ES6A 3OJ2C 3NOIA 2DM7A 3DMMD 3WXWL 3KJ6H 5T1LD 1RZKL 2Z4QA 4PJBB 4WHTB 4WRLA 4CN6A 4TVPD 1FN4A 5IMOA 3I6LD 1SVCP 4WHYG 1XCQA 1PGRB 2EDFA 4OTXH 5I1EH 4NNXB 3FAXA 4I5BA 4IRZL 1T2XA 3I3EA 3DX9A 1YEGH 1HHIA 4PJEE 2QEJA 1YNTB 2I26N 3LPWA 1NEUA 3FB7B 3LKNA 1JGDB 2EH7L 2PXYB 4E0RA 4NQCB 1T1WB 3MRGA 1WCBA 3F7QA 4W6XB 5I8EA 2IQAA 4PJGF 1JRHH 1H15A 5EC1B 1N8ZB 5DEGA 3O3BA 1TQBB 4JZJA 43CAA 1MCPH 1I8IA 4OCRH 1Q0YL 3GBLA 2FLRT 3T77B 1M7IB 3LN4A 5JW3H 2AJYH 5EZJA 5JW4M 1ZT4A 1KENH 2BVEA 5DJCA 4D3CL 4M5YL 5DO2D 2BSSB 3DMMB 1EHNA 2P5WD 4FS0A 4X6BA 3QCVH 3IDMB 3EJZC 4XH2B 1RUQH 2MCPH 1HOCA 4K8RL 4MSWB 4IRJB 1S3KL 5IR1A 2NY6C 2EIBA 4DK3A 3GDBA 3GSRA 2DQTL 5BMFH 2FLBT 3MROA 3ZSSA 2FECL 2KKQA 1YY9D 2G75A 1IC4H 4NYLA 4Z78A 3OKMA 1HSAB 4YXHH 4PTTA 3G08A 3VG9B 1CGYA 3KNBA 4OZHE 3O2VH 1A5FL 2AJYL 2NX5E 1ADQL 4JFHE 4BA8A 1NGQL 5KANI 4FQ1H 1KJVB 2YD2A 1GAFH 3BE1L 1FLRL 1RUQL 2GJ6E 3HZMB 3VXNA 1FVDA 4QHKI 3HUJF 3B2UC 4WTZG 3QDJE 5EUOB 4Y4KA 3RGVD 1CGSH 1CG9A 5EA0H 3TYGL 4JY4B 3MFGB 1QFUH 1Y0LA 1T0NB 2DKMA 1BWWA 4QWWC 4N90D 1XF5B 4MLIA 5C70A 1MJUL 1HKLH 5DR5L 2VN7A 2RFXA 4NQEB 1AGDB 4XC3H 1RMFH 2HJKB 4FQ1L 1JUFA 2Y4SA 1U8NB 3HZYB 5E70A 2AK4B 3FB8A 1CF8H 2HJFA 3KXFA 1JV5B 3MYJB 3DURA 4MX7B 3W82A 3AS0A 4Y4FB 4U0RB 2ZCKL 1OAZH 2NW3B 5CBAA 5I1LB 3KR3L 4JM4H 3G04A 2XN9E 2YC1A 4MB5A 4B50A 4NM8H 4HZLA 4HEME 4PLJC 4BQ6A 1ZAGA 1PLGH 4XHJC 1JN6A 1AJ7H 4NC2B 4YHLL 1I9RH 4F37F 3BPOB 2F5AH 4ZQKB 5IFHL 1ZV5A 1CK0L 3MRDB 4KK9D 3G5ZA 4AG4H 5C9KA 4S1SH 1CDIA 3UJIL 4E9LA 3K4AA 4UOW1 3HE6B 3WHXB 5IFAL 3QUML 3BGAA 2QADC 5CJ5A 4TSAL 3CIQA 4HXAH 3F12A 4GBXA 3F65A 4PRIB 1MREL 4HAFA 4JPVH 1NAKL 1IGML 5IHUL 4MXWL 4P46B 5BVPL 4JFOA 3S3PA 3O6FC 5J11B 2EXWD 1EFQA 4LLWB 2VQTA 3ARFC 1HOCB 1NC2D 3FRPA 5CGYD 4HWNA 1IKNC 4KI5E 3BVNA 3O4OC 2Q20A 4KK8C 3WUWB 4S1SL 4GT7A 3DRQB 3P73B 1QLEH 3X3GH 5IB2A 3B9DA 1U8MA 5EO0A 4CMMB 3SE4A 3D9AH 2G60H 5CKGA 3JVGC 4G7YH 2A6KB 4Y5VB 3N50A 4XNMA 2HT3C 4Q2ZA 3SY0A 1IGTB 2IQAB 2HVKA 2J6EL 3KYKL 4UDUA 3K4ZA 1ED3A 3TNMB 2CXKA 3QEHB 5C08B 2XZZA 4RA3A 3S37L 3I3DA 1ZLUH 1JPGA 1Z5LA 3O3BB 1ZXQA 3OAUH 5DJYB 3CZJA 4X6DB 4BFIA 3GI9L 2QL1A 4PGJA 5FECB 3VD4A 3QQ4B 3QO1A 3ISWA 2HRPH 2VC2H 3MLWL 5ETUB 3SO3C 4JJ5A 3OKLA 5J9PB 2FGWL 2IANE 4FQQA 4X7TB 4YXHL 1UACL 4YK4B 3DURB 2BCKB 2C7UB 3UYPA 4NWTH 3VD3A 1R0AL 5HGAA 4KAQL 4XWGL 5FYJD 4APQB 1DBMH 3BMVA 5I71C 1GYAA 4XCFH 3UDWA 1J8KA 4D9LH 2JK5A 1ZVSB 2YRZA 3TIEB 4XMKH 4RAHA 1OARL 4BM7A 3AFLA 5EA0L 5HJ3A 1T22B 1XGPB 1N2RA 2VKXA 1B0RB 2YD9A 1LVEA 3CFCL 2FGWH 3GSNA 4RGNC 5L2KD 4B7IA 2XN9A 4NZJA 1TJGH 4N8CH 4NWTL 4WEBH 3DVNA 3A6BH 5KVGL 1J7VR 1G7JB 4N8PA 4V1DD 4I0PC 1A7NH 3CK0L 3LIZL 2VDPH 2DQFA 1LHZA 5J56B 5IB5A 5LVEA 1CR9H 2OXGA 4Y8DC 2Z91B 1ZT7B 3E6FA 3UTZA 1XF1A 2ZZUT 2Q86B 1TCRB 5HHVH 1P6FA 2L7JA 1LE5B 3O0RH 1XR9B 1INEL 1FPTH 2OTUB 1O0VA 4WUKH 4EOWH 3O6KH 7FABL 1ETZB 4P3DA 1CXLA 4UQ3B 4Z0BH 5DQ9A 4P2QA 5EZJB 4K7PL 1EO8H 4XPTH 4WIQA 1M7DB 2ID5A 4PGDA 5IWLA 4ODBD 1UWXH 2QKIB 4AH2B 3OG6B 1IEAA 4PJ5E 3HC4H 4G6AD 4NO2A 4QXTB 5T1MA 3RIAF 1FZJB 2XY2A 3PP3H 3V4PH 3LD8B 3HS0B 1C08B 4BZYA 2NY0B 3WLBA 1MVUA 5SWSB 2YUWA 1IAMA 4KJWC 3V0WL 1HILA 4RMQA 2FEEI 1VFUA 1MJ8L 3QRGL 5ADPH 1WLHA 2R23B 1YN6B 5IF0A 4XP5H 1MLCB 4M6OH 4E41B 3HNTL 1PY9A 2XTLA 3DSFL 1RJYB 3N1PC 3GGWB 4M8QA 2BVQA 2FJHB 1KCRL 5J8OA 4P2OC 4L3CA 5F7KC 2XYCA 1IGTA 5I75B 1U93A 5CBEB 4R97B 4RISH 4J2XA 1FCGA 2YPLB 2CLZA 2PF6A 2BVOB 4LPWA 3O45B 5MEPB 3LKOA 3UX9B 1EJOH 4P48A 1T66D 4F7EA 1HH6B 5ITFB 2FO1A 4NQSB 3BVNB 1RIUH 5F21B 2EIZB 4YPGB 4X7CC 5AUMA 1J8HD 4R8WL 1J5OH 1T89C 4FTVB 3SDAB 3MUGB 2UY6A 3T2NL 4U1NB 1N4XH 3ARWA 1CFSA 3QXDA 2R2HB 3KPSD 1MHCB 1VGKB 1FNGA 3H3KA 2MKWA 4UINL 2APVA 3KDMA 5KSBA 4A6YL 3PDOA 4NC1C 1C7TA 3QUKB 1K8DA 2X42A 3CVHA 5IEHA 3HI5H 4PRPD 1F4YH 4LSSL 2AJUL 5BW7A 5DJ0B 4I1NB 4TOYL 4M6MH 1E4WH 3KPLA 4QRPA 2NY7L 3W9DA 4NN7B 2YHGA 1K3ZA 1UM4L 1QRNB 1UH4A 5F9AC 1SYVB 3FFDB 1DUZB 1BOGB 3TA3D 2BMKA 4Y5XB 3R8BB 3ZT7A 4G42B 3SE8H 3KPLB 4YHMH 2SEBA 2VXUL 3PHSA 2EDBA 1GOGA 3H0TA 4JN1H 4MAUL 4NKMA 5D1XC 3D85A 4KH2A 4X6EB 2FR4B 5DJDB 5DS8B 3TBWB 3P4OA 5KW9H 2X9WA 3TESA 4DKEL 1EHLH 2H32A 4Y5YC 1YEKH 3OKNB 2XKUA 3T65B 4EIGB 1L6XA 5D7IE 4MWFA 1T0NA 4DVRH 3QA3A 4XVSH 1CFSB 1JGEB 2DQDL 1FLTX 1T3FB 3GJFH 3QXAA 3UCRA 4M1GH 1BPVA 5JOPD 2IGFL 3GMMA 4LEOB 4AMKH 3EO0A 3BN9D 4Y19D 4LCUA 4V2BA 1QP1A 3LDBC 2F54D 2AXJA 3FKUS 3SE3C 5F6HJ 4JY5L 1NDGA 3QI9D 3I50L 4LSRH 3FQUB 3DVGB 1A6AA 1PAMA 4X4XA 3EYVA 1GZQB 1CTNA 3IJSA 3BDYL 1OCWL 4LVHB 4M48L 1CXHA 3H9SB 5H35B 1Z3GH 4UBDD 5CD3B 4PJAB 4LBEA 1NCCL 3IVKA 5TFSH 2F53E 1GZPA 3U36A 2FD6H 4QOKB 4PJXE 5FB8A 5KVEH 4G5ZL 1JGVH 5I17A 1Y6KR 4GS7B 1NFDA 1NC2A 4N5ED 2PYEA 3ALWA 1JTPA 2Z35A 3E8UH 2ITDB 5C07E 5HHOA 3I50H 4NQUA 1G9ML 1NGXA 6FABL 5J06A 5FK9A 3FZUD 2XOTA 3AS2A 4FA8A 5BJTA 3MGOA 3B2VL 5JMOC 1IFHL 3AY4A 1KLGA 2BVYA 4DKAA 5CJ8A 3LKQB 4PBVC 2J12B 4YUEL 4AEHL 4WENB 1AGEB 5C0CB 4Y19B 4H25B 4I9WD 1GGCH 2KZWA 4Y1AA 4R2GC 2F54B 4JQVA 2EDTA 1BVKB 2AJZB 2HFFB 1MCBA 4MQ7B 3I75B 3O4LD 4OZGA 2UY7A 3EOTH 4MVBD 3TYGH 2DD8H 4JGJA 3OKEB 3T4AB