2VXQH

Crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
213
Chain Sequence
VQLLESGPGLVKPAQTLSLSCAVSGGSIRSGGYYWSWIRQHPGKGLEWIGYIYHSGNTYYNPSLKSRIAMSVDTSENKFSLRLNSVTAADTAVYYCARLDGYTLDIWGQGTLVTVSSSTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords POLLEN ALLERGEN PHL P 2
publication title High-Affinity Ige Recognition of a Conformational Epitope of the Major Respiratory Allergen Phl P 2 as Revealed by X-Ray Crystallography.
pubmed doi rcsb
source organism Phleum pratense
total genus 41
structure length 213
sequence length 216
ec nomenclature
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH01
1KTDB 4NQEB 1WZKA 5IW1B 4DZBB 4P99A 2AV7B 2FJFB 4S10A 5F21B 5L8LB 2Q20A 4LDOB 5ISZA 4JEGB 4G7YH 1BECA 4MWFA 1IAOB 2VDRL 3N0PB 4PJ5D 4S1QH 3N1QC 5D71L 5E1AB 4EI5D 3B9KA 4GRMA 4PRPD 4UB0H 4Q9RL 4MGXA 1JPSL 5IBUG 5DRWA 3MRCB 1IGYB 1KYOJ 2PO6B 5GGRB 5I75C 3FQWA 5BVPL 4NO0D 1SEQL 2APXA 2R69H 3GMRB 3L3DA 5DT1L 3D2UB 4FQ2H 2D4DA 1FE8L 2FIRT 3UTZA 4WFFE 4CMMB 5KSVA 1XF3B 3WS6C 2X1WL 1OD9A 5IVXB 4OFYA 3T77A 2DQTL 3I84A 4AG4L 3O2DL 2UY7A 4AM0A 2H8PA 4CDGC 4YHNB 2RCSL 5IB1A 2ICCA 3BVNA 1DBAH 3AU1A 4NPYB 5FF6A 1EXUB 4QRSA 1MRFH 4K7FB 4NDMA 3CFJA 4Z5RB 2G5RA 3OZ9L 4HG4K 4GG6F 5JQ6L 3ARUA 3IT8D 1SJHB 1KPRB 1D5MA 1XR8B 5AD0B 5E0QA 1ZLWH 5L0QB 1S9YB 2V17H 4K55A 4YDLB 1W72A 2I5YH 1T1WA 4WFFD 5H94B 1PEWA 3IJSB 1IAIL 3TBWB 4PLJD 3QR2A 2J8UF 1G9EA 4KMQA 1M6OB 3V4VL 2X44D 1A3LL 1YPZF 2BVYA 1PGRB 5CZKA 5FO7A 5B39B 3SQOH 4WV1B 1N6QH 4TULL 1AJ7H 4OCSH 2BVPA 2W9EL 1V05A 2WAHA 3U6RA 5L8JB 3L3KB 1HSBA 1SBSL 1TFHA 3LH2H 1NEZG 3W39B 3F8UB 3GK8L 1D5XB 2AAVA 3T2OA 1NDMA 4C83B 4MNGE 3TGXA 2NY6C 1IEBA 1CE6A 2DM7A 3VA2C 4G8GE 2FEEL 3QDGE 3TV3L 4RMQA 5I8OL 2EECA 3P77B 3EYQC 5FUCE 5JOEA 1XF4A 3DLQR 3DHMA 2CRYA 3KS0H 2ZNWA 3D69A 4HUUA 1T0NA 4M5ZL 5CJXC 2BSTB 1ZSDB 4PJEF 5BV7C 1NEZB 3W11D 3TYFA 4X5LA 3AB0B 2AXFA 4LF3B 1DE4B 3AREC 3DPBA 1S7TA 1U92B 5GRXG 3WFBL 5ACZB 3NZHL 2DS4A 3DVIA 1YY8B 1IGTB 1ZA3B 4MJ4A 1UB5B 4Q6IA 4O2FA 5GS0C 3EJZC 2A1WH 2HKFH 5E9DB 1RZFH 2FD6L 4D2NA 2VE6A 1P4LA 3ZTJH 2CK0H 1U95A 4X6EA 4Y5XB 3SE3C 2E8ZA 3ARFA 2R0KL 2W0KA 1JFQL 3EYOA 3QA3A 3IXAA 1YEKL 2VDML 1OP5H 1JMXA 1P84J 5FUZH 3W0WE 1J1PL 1PY4A 4XP9L 5KJRL 1I3VA 4JFED 3L7FB 2I60L 5B38B 3U36B 3FAWA 4PREB 3ARDC 4OTXL 5FA4A 4LSSH 5HI5D 3RI5F 1CU4L 3UPRA 3ZZ1A 4UNVA 2DICA 1V3JA 1S3KH 4QHLB 5DI8B 5ERWB 5IEKA 2ZUUA 1CD8A 2HWZL 2ZSVA 1DQLH 4FQJH 5EZIL 3TBVB 1JHTA 1WCQA 1RK0A 4AL8H 2B0SL 5A2LH 1IKNA 1ORQB 1F5WA 5C08E 3D85B 3W0WD 4NP4H 4U1HA 4RMWA 1S7VB 4IRZH 3KYKH 15C8L 4YQXH 3WIHA 4CADB 2EXYD 3IFLL 4LEOB 2ZUWA 4D3CH 5I15H 1E4XI 1OTSC 1D5IH 4OFPA 4FFYL 2VLJE 5GHWH 4G6KL 3MJ7A 4IIQB 4J12A 4U1GB 3GUTA 1QO3B 4Z95L 5C9JA 1OGAB 1A9EA 5A3ID 1IGMH 5AAMA 3O6KL 4ZO8A 4EDXA 4BZ2H 2OM5A 1H3GA 1I85C 4PP2A 3GGWB 3MUZ1 2HJKB 3M17B 4LHUB 5DDHB 3H6JA 4XCEB 1KCVH 5DJ0B 4RZCA 1IQDB 3SJVA 2EC8A 3VMNA 4LLUB 1KTDA 3U9UA 4OJFH 5IW1A 5EU6E 4M6OH 4XAWH 2AV7A 2D3VA 2FJFA 2NXYD 2VLJD 1PYWB 2GKIA 4MS8C 3C5ZD 3WSQH 1BGXL 3EBAA 5E1AA 4LLYB 5IESH 4LNVA 1KJ2L 1G7MB 4N0FA 1WF5A 3MRCA 3RKPA 1IGYA 2PO6A 1RY7B 3MX0A 5GGRA 1MSPA 4POUB 4G9FE 2EKJA 3GMRA 3D2UA 1PD6A 3SO3B 3NAAL 2VYRE 4CMMA 2AVGA 1OLLA 1XF3A 4WI5A 5GRUL 3ZT7A 3AGVA 3ZKNC 5I1IL 3S4SG 3AS2A 5I30H 2GITB 4X7DC 5D7JB 4ISVB 2NY0C 4NKOB 4JR9H 1KB5B 3L3HB 3MOQA 4J4PD 1WT5C 4Z5RA 1NC2B 1N2RB 3W82A 4UU9A 1KENH 4G9FD 5ADPH 5I1JL 1ZXQA 2AQ1A 3MRQB 3ARQA 3EW3B 3RZCC 1K3IA 5H94A 4PB9L 5D1XB 3GHBL 4MJ6B 1ZHLA 3TBWA 1AFVL 5M7QA 4ZSOB 2VUYA 1MCJA 4M6AA 2APFA 3TWCH 4FQXC 2EDXA 3K4DA 1LK3H 2PCPB 4HK0B 1OP3K 5GGVY 4XC3H 4HSQA 3IXTA 1KCSH 4WWKA 5IB2A 1RVFH 3DMMD 5JIIA 2Q76A 3SQBA 3ARGB 1AHWC 5C0BB 1F4XH 1K5NB 3UTQB 1FL3A 3L3KA 1MHCB 2R9HD 3KHOA 1VENA 1MHHB 2GTWB 1LE5B 1D5XA 2R0WL 4S1DC 5GS2D 5IQ9B 1AXTH 2NY2C 4KKBD 3UYPA 4DUVA 5BS0E 2DM2A 2X89A 3HUJE 3OSKA 4WU7A 3QH3B 4X6CE 3ZT5A 1YMMB 1RJZB 2IFFL 4EBQL 4RISH 4S1RL 1QLRA 3EFFB 4TSAH 5FECB 4P4KD 3U7AA 3VD5A 3KXFE 3MSPA 4J8RB 2DQGL 4GH7B 3WMSA 2BSTA 1FFNA 1S8DB 1ZSDA 4UV4H 3LPGA 1NEZA 1PG7L 4LCCC 4NBZB 1DE4A 5HDBF 1P5VA 4YK4C 4ZS7L 3A67H 4F8QA 1U92A 2P24B 4FMFA 4QXTB 1IGTA 1Y0LB 1ZA3A 2Y5EA 4C4KT 5AYUH 1UB5A 4IJ3B 3QWRD 1Q1JL 1FBIL 2FJGA 3HPLB 3FB8B 2W91A 4HWZB 4MA1B 1RD6A 2YD8A 3TN0D 3TJHD 4OCXH 4Y5XA 3KXFD 1YEDA 1NFDE 5IW3A 5TDOB 2OXHA 1KC5L 3L7FA 4HGKC 5B38A 4OGAC 3F6IA 3U36A 2AXGA 3ETBF 2AK1L 2FGWH 2GHWB 3S37H 2YPLB 2R29L 1RZJL 2W0PA 4P9HH 1KIQA 1GXEA 4PRHA 5DI8A 5ERWA 2Y4SA 1Z9SA 3WBDA 5IFHL 4TRPL 1VPOH 3TBVA 5DK0B 4WI6A 1JMZA 3MLXL 1L7IL 3MMEB 4ONHB 4WFEE 5GGTA 1ORQA 3D85A 5E5UB 3V5DB 5MEND 1INQB 1J1OH 2OCFD 3GRWL 4GG8B 5FYJE 1U58A 5F6HJ 4LEOA 4MD0B 1RQ5A 4MHHI 5E2UH 4XCCL 3RU8H 3QNYB 4JRXE 4GSDL 1BVZA 1FFOB 1VFUA 1UB6A 1NDGB 1QO3A 5C0NC 5FEBA 1Q38A 3QUYD 1YC7A 5SWSB 4NJ9L 2X1PA 4G9DB 2ZKHL 4CW1B 3GGWA 3RPIB 2HJKA 3M17A 2YRLA 4WFED 3CXDL 5DDHA 1CTNA 5GGVL 4JFDE 3RWHB 3LKPB 4YHOL 3MNZB 3D5OF 3ARVA 3NFSL 4LLUA 5FYJD 3RHWF 1JZ2A 2QR0A 3C2AL 1IAMA 3MRGA 2FCBA 3TP4A 2J7LA 1PYWA 3PIQB 3KPTA 5B8CC 3BPLC 3QDMB 4G8FB 1TQBB 3L7EB 4LLYA 1FAIH 1G7MA 1WIOA 2UY6A 5D2NC 1BAFH 1T3FB 3O45B 4B50A 4YHPB 2A74B 4R9HA 2HVJA 3KGRA 2JCCE 4Y19B 2E9BA 4JFDD 1WC7B 5BVJB 4LPTA 3S34H 3BKCL 4P2OB 3VXMB 1T80A 5BW7C 3UAJC 2GITA 5D7JA 5SWZA 1MCPL 1YEIL 2VMFA 4KKCD 1W8NA 4M7ZB 1EHLH 3CGTA 4NKOA 1KB5A 1KLGB 5CZVH 4F33A 4PJ9C 1EO7A 4ZXBD 4AIXA 4Z76A 2R1XB 4EQ2A 4XXCC 3IDJB 1NC2A 4JB9H 1N2RA 3RWEB 3SBWA 2P5EB 1MI5D 1BBDH 1F6AA 3MRQA 1LO2H 4UQ2A 1QSFB 2Y7QB 4I0KA 3FJTA 4LOUC 4F7MB 3CVIL 2Y5TB 1MF2H 5D1XA 1CXEA 4MJ6A 1F4WL 3S4SA 1MY7A 3L95B 4ZSOA 3WLBB 3RWJB 5JOPE 3WN5C 3O6FC 1PKOA 3GIZL 3ESVF 5D7IF 1F97A 4FNLH 1TZHA 2BHZA 2AJVH 2PCPA 4M7LT 5HGDA 4U7MA 4NQXA 1AC6A 3EYSL 3MLSL 5DEFB 4DVBB 4JO4L 4OZIA 1E4WL 3ARGA 4LHQB 1IZKA 4GMTL 3ARBA 1K5NA 1JJUA 3UTQA 1C5DB 1MHCA 3S96A 1X5IA 4NZDA 2GTWA 5DWUL 5IQ9A 5DJDB 4Z7WA 2AGJH 3MRRB 4X7EC 5J8OA 2YR3A 2YA2A 3HE7C 3AXLB 3QH3A 5B3JE 2OJEB 1YMMA 1RJZA 2O93L 1G6VK 5DD3H 1OAXL 4I1NB 1T7VA 3VXQA 3FT2B 3WS3A 2NY1D 2WNGA 3FHAA 3EFFA 3GSNH 5FECA 4HGWA 4UTBL 4KV5F 4J8RA 4OCRL 1S8DA 2YD7A 3ZSSA 5T3ZH 5D1ZD 1MCNA 4RWYL 5ITBL 5LBSH 3GBML 1AGBB 3QEUA 3QPQC 3X17A 4M5YL 4AIOA 3NH7H 2P24A 5DJ6B 3BKYH 4QXTA 4DTGH 1Y0LA 3O11B 5E4EB 2H2SC 3O2WL 4JM4L 2GCYB 2Z31B 4LSPL 4ZOAA 1VSCA 3LY6A 5F9JB 4G8IA 4UDUB 4LCWA 3HPLA 2IQ9H 3FB8A 4HWZA 3AMKA 2QQLL 5L2KE 1GGCL 5HGHA 3C60A 3O0RL 4J3SA 3H9HA 4BUHA 5DURB 2G5BB 5CKAA 4X7CC 5TDOA 2MQ3A 4S0TD 1IVLA 5FM4A 4YZFE 4ZTOH 4N8PA 4APQD 5GRJH 3S88H 4F15B 4KK8C 5EZLB 1CLOH 5KN5B 1MUJA 1KCUL 5HHPB 1HKFA 4JPKL 5KVDH 2YPLA 3VDAA 5JO5A 3QPXL 4KI1A 5MEPB 4MJIE 4IHOA 1FLRH 5HHMD 3W5NA 4ZTPL 1FNAA 2CGRL 3TNNB 3DOSA 3ZE1E 5CFHA 1OAYL 1DQDH 2ZJSL 3V52L 2QJDA 1JIBA 3EDJA 4ORZC 4WCYH 5E2WH 3MMEA 4ONHA 4NZUH 3JWNC 4F37K 5IEHB 5INDB 1Q9KB 1DQJA 3V5DA 1INQA 5CEYB 4I48B 3S5LG 4I8DA 4MAYA 4GG8A 1NAKH 1A7QL 4HFUL 4O02L 3MRDB 4MD0A 3ZKMD 4KK9D 1URLA 3QNYA 2B8OT 2DDQL 1U8OA 4FG6D 4O2CA 4U2YA 4MJID 4GS7C 1FFOA 3ULUL 4Y4KA 1S7RB 1NDGA 3MOAL 5IF0B 2ARWA 1FGVH 4NKIH 3VU2A 2Z8VC 4MCZB 4LSQL 4PS4H 5F9WB 4NQSB 4G9DA 1YYLL 1FP5A 1DQMH 4X4YB 3RPIA 3U9PH 1DSFH 3RI5K 2VDPH 2OI9C 3CMOH 4S0SD 5T1MB 3BDXA 1CD0A 5IWLC 1XCQA 3RWHA 3LKPA 3MNZA 1GHFL 4KMTL 4PY7A 3IS0X 4CN1A 3KLHC 1A6WH 5EO0B 1N3NB 4K23L 3CC5B 3PIQA 1ZVYA 5FV1L 3VWJD 1LK2B 3MOBL 3QDMA 1XIWC 4HC1A 3WIIH 5IV2B 4P5KB 2JB5H 3OX8B 5DD1H 3ORJA 4ODTL 5EORH 1IFHH 3MXVH 1S5IL 3MCG1 1T7WA 2A0LD 3O45A 4WFHE 1FL6B 4YHPA 2A74A 1AGCB 2NMSA 3JSSA 4Y19A 4Z8FL 1WC7A 4OCWH 4P49A 5BVJA 1JUFB 4WGWB 3MLTA 3RVVD 4P2OA 3VXMA 4YFLI 4Z7VB 2IQAB 3WO3B 2DLHA 4OFVA 5ISZE 1KLGA 1HYSD 1CDGA 3KJ4B 1KPUB 4X0KB 2EH7L 2R1XA 5E2JA 3IDJA 3RWEA 3BYTA 1G7PA 2B5IC 4WFHD 3SDDB 1CXHA 2LQRA 5ID0B 1F45A 1QSFA 2Y7QA 3VJ6B 4F7MA 3MLUH 5D9SB 1RMFL 1DANU 3RWFA 2ILLA 3N9GH 4C55A 1W72L 4N1EA 3L95A 3WLBA 3RWJA 4U1SB 1GIGL 5F1SA 3TBSB 1CE1H 1UFUA 4MNQA 4UBDD 3L3OB 1CICB 2JELH 5E4IA 3QAZB 4J3OC 1WQVT 3B9KD 4PRIB 5EC2B 2VISB 4TTDD 4DVBA 5GISL 3BZFB 1J88A 1NQBA 5T3XE 4LVHC 1OPGL 1MQKH 1ADQH 3WJLC 5CJBA 2EO9A 2EIZB 5I8EB 5D6DC 1XAUA 4XC1L 4L3CB 4GAYB 1LDPL 1NGPH 4HWUA 3OPZH 4OFYD 3MRRA 2CR3A 4KI5E 4GRLD 4MQXC 1DVFB 1UZ6F 1XF2B 2B2XH 2NY4C 2O5XL 3U4BL 2VXVL 1JF1B 3AXLA 3QQ3A 3ILPB 2OJEA 1TXKA 2EIBA 1BD2D 3OG6B 1U8IB 4H88H 2HTKC 1YEGH 5ALBH 3EAKA 1MPAH 3ZDXF 4I18C 2E9IA 2NW2A 2W38A 1HCVA 4L8DB 3AY4C 5KANI 3K8KA 5A40E 1AGBA 2VZOA 4YFEA 1BQLH 1RUKL 1SY6L 3GJFB 4ZD3H 3ZKQD 3GMMB 1S7WA 1OTUC 1IQWL 3RVTC 3KPPB 1AY1H 1F6FB 5SX4H 4P9HC 4NNYB 4YHML 3HLAA 4PUBL 4P48A 2Z31A 1NPUA 3UTSB 4UDUA 2NLJB 5TGBA 3UP1A 1BX2B 2MMXA 3X12A 3ZO0A 4ZAKB 3WL9B 3KR3H 5TH2A 2Z35B 4F7EA 1I9JH 3WXVH 2FL5B 3A6CL 2XKNB 5C6PB 1BZQK 3KYAA 4LAJH 3VWKB 1MWAB 3DIFB 4GAJL 5D70H 5EZLA 5KN5A 4C56A 32C2B 3QQ9C 2P42B 1P9MC 2V9TA 4HW6A 1AGFB 5MEQB 4HS6B 3IETB 4YXLH 1TQCC 5DFVD 5T1LB 3QIUB 2F53E 1QSEA 2RIKA 4U6VL 2DKUA 4BQBA 4LL9A 2UWEB 1CFVH 2J2ZA 4LIQL 1U8JB 5CUSL 1NAML 4IRJD 4XNQB 1C8PA 2MSPA 5KW9H 3QB7C 3UYOD 1I3GH 1GC1L 5E2TH 4EDWH 1FYTD 3WKML 3MRDA 4PYHA 2JTDA 3CX2A 3GM8A 2CUIA 1S5HB 2ADIB 1LGVA 2DWEB 5HDQH 3MCKB 2YRPA 4KZEL 3VFUB 2NY3C 3VGEA 5IF0A 2F53D 4N0CC 2MCG1 3OJ2C 1INEH 1IGFH 4MCZA 4Y5YC 3FO1B 3BAEL 4NQSA 3ARFD 3TZVD 4X4YA 2DQDH 4O2EB 1KPVA 3DXAE 2CD0A 5E6IC 3ULUC 3BDYH 4LVOB 4J6RL 2NPLX 2EE9A 4JY6B 1NH6A 5DUBA 3VG0L 5EO0A 5T5NG 1N3NA 4P2QA 3E3QC 4XPFH 5HPOA 3CC5A 1FNHA 1Q0YL 1KUMA 5IV2A 4KU1A 3BPNB 2XKUA 4P5KA 4CVXB 5FKPA 3OX8A 1NSNH 4LKXB 4ZFZA 4AIZB 3NGBC 1EJ6A 4NBXB 5C0EB 4YH6A 4M7JH 1NBVH 4XNMB 5DR5H 1UCBL 3N06B 4YDIH 2FLRT 4JGUA 1FL6A 1LEKB 2X4NA 1BLNB 3DXAD 1AGCA 4LPWA 3WFEH 3FQXA 1IC5L 5DA4A 3OKKB 1JUFA 3SJVE 2WK2A 2AP2A 1JGVL 3L9RA 5GGSY 1YUHB 4DGYL 4Z7VA 1T2XA 3UDWA 2IQAA 3HCVB 3W2DH 1KOAA 4YHKL 4BFEA 2GY7B 4NUGL 3P9MB 3FCTB 1NMCC 2B1AL 1EGJL 1T1XA 2I9LA 4XX1E 5KSUB 4GQ9L 4P5TB 4Y4HB 4GG6B 3TCXA 3KWWA 3DJ9A 3RHWK 4OM1H 3SDDA 1CL7H 4J1UB 2OX5A 2VABB 5LJYH 5ID0A 3DX7B 4HXBL 3VJ6A 5DD6B 5KTEL 1EEYA 1EUUA 1BVKA 3SJVD 5KSAA 1CGYA 3E8UL 1GGYA 2ZCKL 3NN8B 5I1EL 5GRWA 2YKLH 1WZMA 3TYGH 4U1SA 1YPZB 3FRPG 2A9NL 4K94H 3L3OA 1CICA 2BVQB 4N8VB 4H26A 4OZ4B 1CF8L 2XI9A 3CK0H 1A14L 1NBQA 5EC2A 4R8WL 1MVUB 3QIWA 4X7TB 1OW0A 3BZFA 3T0VA 1QBMH 2D0HA 1GH7A 4WO4B 3EGSB 3RIAF 2HMID 1CFTB 2ADJB 3WD5L 2EIZA 5I8EA 1HH9B 3MBEB 1I8LA 1T7YA 4OM0L 1N7MH 1KN2L 4NIKB 3BRDA 1UACH 2UZIH 1QZ1A 4OLWH 1UWGL 1DVFA 4HHAA 3FQNA 1JF1A 2GT9B 4JO1L 3VG9C 4HKXB 5I8OH 5CP3H 1SVCP 1U8IA 3OKDB 5KZCD 5KSBF 1N5YL 5JDSB 1AP2B 1BHGA 4JY5L 1T1ZB 2ZUSA 4WY7L 1MRCH 5LWYL 4PJEB 1DLHB 1KEMH 2UYLB 4L8DA 4G6AD 1IE5A 4NFCA 4ZFOA 2VKXA 3FZUC 2HTLD 3GJFA 3H3PH 3GMMA 5I71C 4QHMB 4XPAL 5JIPA 2OMNA 2ZPKL 5ILTL 4TVPE 1T66D 2COQA 4MXWH 2ZNXA 3I50L 4NNYA 4Y5VC 5JW3H 4CVZB 4MD5A 3Q6FB 4NN6B 1V8HA 4ODWA 3UTSA 3DROB 3HC4H 3X13B 1WLHA 2P8PB 4WWKD 1SYVB 4MDIB 3KPSD 4ZAKA 3WL9A 3MV8B 2Z35A 1ZGLM 4DN4L 2FL5A 3HI5H 5L7XL 1Q9LB 2R0KH 2OK0L 1L0QA 3S97C 1WAAF 3CPLA 3D39D 5DTFB 3VWKA 1HQ4B 3DIFA 3GIVB 1I3UA 3N1FC 2H2PC 5IMKB 1GRWA 3MRBA 2ZOKA 4QTHB 1X5HA 2AI0H 43C9B 4HIJB 4UT9L 1AGFA 1DBKL 1AE6H 5MEQA 4LLMB 1TJGH 3IETA 4JFHE 5T1LA 3RY6A 1FFPB 4ODXB 1EH9A 5KVGH 1TCRB 2UWEA 3QI9B 1U8JA 1K6QH 4YXKH 3V0WH 1BWMA 1AD9B 3CVHH 4JN1L 1VADA 4RQQB 1CDIA 4KKNA 4XNQA 4AJ0A 3FN3A 3DGGB 1G9MH 1QLEL 4NSKB 2IPUK 1CBVL 4P9MH 3THMH 3S8WA 2O61B 3E1F1 1CCZA 3V6ZB 4JDTL 2DM4A 2ATPB 1RIHL 1S5HA 2YBRB 3K74B 2ADIA 2DWEA 5EUKB 3DRTB 1XGYL 3MCKA 4PJFF 4K8RH 1QFPA 3VFUA 2A77H 4NHUB 1NLDH 4PRHE 1VGKB 4JFHD 2W07A 5CGYD 2RAMA 3FO1A 5DJYB 2GJ6D 3ULSB 3STLA 1R3KA 5K9QG 4JE4B 3BEVB 3FRUB 4JKPH 4HUKB 2X2YA 3LVEA 3M8OL 1VFOA 3OAYH 3GSWA 5DRZB 5HTSA 1QHOA 3P40A 2C4FU 2X4OA 1S9XB 5F8RC 4CVXA 4PRHD 4X6DE 1YEHL 2AK4B 4LKXA 4M1CC 4AIZA 2OR7A 5C0EA 3FFCA 5DA0B 4XNMA 5LVEA 3K4ZA 2MKLC 2FIKB 2WUBH 3H9ZA 5C2BL 1BLNA 1QQDB 4WU5B 1U36A 3EO9H 3J7HA 3O4OB 2R8SH 3D85D 3IFNH 3OKKA 3B43A 3BOVA 3PGCB 3SCMB 4HS8H 1IC7H 1YUHA 1B90A 4Q58C 3HCVA 1I9RH 5GS2H 3P9MA 2NXZD 3FCTA 4CNIB 1NLBL 2J8OA 5KSUA 4P5TA 4Y4HA 3SDCB 4JZOA 2R56H 2AEWA 1L9MA 4OLZH 35C8H 1UXSB 2CDFB 2NNAB 2VABA 1KULA 3DX7A 1MCOL 3GKZA 2VN4A 3T4YB 2VL4A 1WBXA 5DD6A 5KVFH 5SX4I 1KACB 3UTPD 2EEBA 3ARWA 4MNHB 3LMJL 3NN8A 5F7WC 5E95B 1YPZA 2BXZA 3ZSTA 3P9LB 5SWZE 3FOMB 4IRSB 2Q6WB 2HLAB 4OZ4A 3TO4B 4X8JB 2KL6A 3CSPA 1MVUA 4X7TA 5JLZB 2XWTB 3BKMH 4OLVL 4WUKL 4WO4A 2IH3A 3EGSA 4TSCL 4Y16C 3VFNB 3L5IA 1FNSL 4KFZC 3MBEA 1ZGLB 1U6AL 3TCLA 1FAKT 4AEIL 1CDCA 3CNKA 4ZSOE 4GT7A 2ESVA 2L0DA 3FRPA 3K2UL 4O5LH 5SWZD 1J8HB 1B4JL 3U1SL 1U8QA 3UCRA 2GT9A 1LP9A 4KK5C 2BX5A 4HKXA 3HR5B 2NCMA 4JPWH 3FOLB 5JDSA 3H3BC 4EBQH 4MA7L 1AP2A 1GGBL 3QZWB 1T1ZA 3RVXD 4OZIE 5ELIA 1NMBH 1DLHA 1JNNL 2UYLA 1WEJH 4ONOA 1FN4B 5I18L 2AS5M 1FZOB 5E00B 5E8OA 2DD8L 5DVMA 4K9EH 5FOBB 3RUGA 1T0MA 1KIRA 3F6LA 4QHMA 4Z7WE 1NBZA 1NBYB 4JQXC 4Z7QE 1UH4A 2HA1A 1HI6B 1JN6A 3HHRB 1MFCH 4PJGB 4CVZA 1OT2A 3MRPB 4KZDH 1CZ8H 1DUZB 3DROA 2VLRB 4O4YH 5EA0L 2ZUTA 3KPRD 4ZMAT 2P8PA 4MDIA 5J1SC 4PJCB 5CCKH 2VR4A 3ARBD 4R26L 1Q9LA 1ACYL 4TNWF 5KG9B 1W8OA 3NCEB 3TA3C 4IOIB 3VXRB 1HQ4A 3X3FL 3GIVA 2XTJC 3T3ME 4P46B 2J1KA 2QHRH 5BMFL 5F7EL 3HNTH 5FHBH 3S35X 2GI7A 1HILB 43C9A 4HIJA 4P5MB 5FYJH 4DOHE 2ATKA 1YN7B 4BH8A 4LLMA 1V3LA 2IANE 4LCWE 1FFPA 4FXKB 4MLSA 2X9XA 5TQ0L 1U8NB 4ZNEA 1TCRA 4JHWL 2VDKL 4RA0C 3VXUB 5KVEL 3BZEA 4LP5A 3QI9A 3MJGX 2CUHA 4G43B 3QXDB 1BZ7A 1AD9A 2H32H 4RQQA 4XNUH 1JNLL 2GIYA 3F7YA 1ZEAH 3DGGA 5DMIL 4NSKA 1Y6MR 2BOCB 4W4OC 5GJTH 3V6ZA 4NCC1 4PLJC 3C08L 2ATPA 2J12B 2YBRA 2YPLE 1J12A 1YNLH 4RAVA 5FM8A 1CL7I 2QLVB 2IAND 3L5HA 1VGKA 4LCWD 3P11L 1H15B 4RIRA 1ZWIA 5DO2C 5DJYA 5TQ2H 3C60D 5FGBC 4BSWB 4R4BB 3BEVA 3FRUA 1AKJB 1CLYL 4Q7DA 1OF2B 4XB8A 4L3EB 2P5WB 2FECL 4Y4FB 3O3DA 2VJXA 3LKOB 2A6IB 4MX7B 4KTEL 1NCBL 1FSKC 4NM8L 1R3JB 2YPLD 5AYQA 1NC4A 1S9XA 3ZKXC 2K7PA 4EUPG 5DFWH 2Q8AH 5IMLB 2AK4A 3UTTA 3RWIB 2OJZH 1KJVA 1OL0A 4LSUH 2DQFA 5F1KC 2NY5H 5IHBA 3IDNA 4U0QB 1MJ7L 3TFKD 4Z0XA 2CLRB 4L3AA 4A6YL 4L4VD 1NANI 1QQDA 3G5XB 5JHLL 4B0MM 3LEVL 1DQTA 1Q0XL 3QRFM 1UA6L 3CFKA 2X4RB 2P45B 3PGCA 3W11C 4MAYD 3BXNB 3QUZB 3D18B 5FAAA 4K94C 5L9DL 4MYWB 3VGAC 4QXGL 4EUPB 3EOYG 4PG9B 5DJAA 2NY7H 2F54B 4Y4KD 4CNIA 5D8JL 2HFGH 2QADB 2EE3A 2GEEA 2J88H 5FUCC 5CEZL 1FV1B 1UXSA 4F2MA 4DK3A 2CDFA 1IM9B 2NNAA 2NZIA 4Y2DC 2BSED 2VXTH 3T4YA 5GGUB 3B5HA 3QUMA 4JZJB 3CVIH 5F7NC 1J7VR 1ND0B 4KHTH 3VXME 2PETA 4MNHA 3NCYS 3S3PA 5HGAA 2HG5B 4KH2A 3TPKA 3QULB 1QOKA 2IMNA 3P9LA 3FOMA 3WDHA 4OBRA 1YEJL 3AC0A 1A6TB 4Z7NF 1OAQH 4KJPC 4L4TA 4HX1B 1OP3H 4X8JA 5B4MD 5HI5C 3NIFF 1F11B 1IL1B 2P4AB 2XWTA 4HWBH 1RHFA 1JRHH 4RSVA 4XVUD 4LFHG 2FO1A 4WUUE 1IKFL 1CXKA 5H35B 3VFNA 1QSFE 4F80A 3DETD 1FZJB 3L5WB 4ODHL 3MRFB 1T2QH 1ZGLA 3IVKB 4P2OD 4CMHB 3VXMD 2Z92B 4YFLF 1N59B 1WWAX 1LO0L 5JXEA 3OB0K 1J8HA 2HYMA 4X7SH 4MNQE 5I1KL 3C5JB 4WW1B 4JRYD 1IEAB 2C1PB 3FOLA 1YN6B 5JMRA 3QZWA 3FFDB 3RIFF 4OV5B 1FVEB 1JE6A 2BFVL 2F19L 2YEZB 5JQHC 4WUUD 2H26B 4G6JH 2DLTA 1FN4A 3CFDB 5E00A 4PJAB 3QCTH 1SHMA 1AIFA 4RGND 3QCUH 1P7QB 1BPVA 4JVUA 4XPBH 4L9LB 3CU1A 2UZYB 3MLYL 1BM3H 1NBYA 1QEWB 1PJ9A 5E8EB 1R3HA 4PJDF 2Q7YA 4EEEA 1HI6A 5EUOF 4MNQD 3RIAK 4PJGA 3BMWA 4OLXL 1DUZA 3HE6B 2H1PL 2NXYC 1X5AA 3P73B 3C5ZC 2ZWLT 2WUCL 4PJCA 3AM8C 5TE7L 3TT1L 2EC9T 1EEZB 2A6KB 5KG9A 1R6VA 5HGBB 4DEPB 1G9MC 2ENSA 3LPWA 1A6VL 3VXRA 1KGCD 2BY3A 1G7IA 2MHAB 5HI4D 1JBJA 1V7NL 1CT8B 1ZS8B 3VI4F 4FXLA 3AS1A 5E1HB 4JKMA 2FX8H 1DLFL 4X4ZA 4K8RC 1T0PB 3CFCH 3I9GL 1V7MH 3ALXA 2HN7A 1P4BH 4B53A 5I73C 2OLDA 1UJTA 3KLAB 1MCFA 2E7BA 2O5YL 2R1WB 4FXKA 4WI4A 3ZE2F 1U8NA 4J4PC 4KGLA 4I3RH 3OXRB 3H42H 3K46A 3QDJD 4G43A 3VXPA 4KXZH 4KTDH 3QHFL 5DJXB 2BOCA 4ZFGH 3EHBD 1FIGH 5K9KB 1A7QH 5TJWK 4C56E 3MLWL 4MDJB 4GMSL 5I9QB 1TETH 2Z31D 2CKBL 4L8BB 1H15A 1JHKL 1QSEE 4I77L 5IQ7H 1MFNA 1VB9A 5EZOH 3QQ4B 1GPOL 1I1YB 2ZG2A 1BVLB 1U0QA 1S7XA 4R4BA 2WP3O 1NCDL 1XGTA 3DMMC 4M8VA 3SGJA 3ZDYE 1E28B 1AKJA 1OF2A 3RDTA 4UV7H 4L3EA 2P5WA 2IBZX 4Y4FA 4WDIB 4K7PX 2R9HC 4MX7A 3F5WA 3HNVH 4J3WA 5E2VH 4C56D 4WI7A 1XGRB 1R3JA 3PGFL 3PGDB 4KGJA 3Q6GH 2FH6A 4KKBC 4ONFL 4HQQH 5F1IB 1EHAA 3FKUS 1QSED 3ULUF 5F3BB 3MRJB 1RUQH 3OAUH 2HRPH 4M62H 4J7RA 3G5XA 4QRPB 4BK4A 2N56A 4P4KC 2VSCA 3ARED 2X4RA 4HIIA 5C1MB 4OQ1A 4JLRB 3QUZA 2C4XA 4P2QE 3FO2B 3LQAL 2YHGA 2VTFA 3OQ3B 4P2CG 4EUPA 2HT2D 2VQUA 5I75B 1J0JA 2ED8A 4LLWB 3U2SA 5C2UB 2F54A 3TO2B 4R90L 2MCPL 2JJUA 1IEHA 2K7QA 1FV1A 4KDTC 1IM9A 3JWOH 2OR9H 2ICEB 3G5YB 4RRPG 5GGUA 5T3XH 1DBMH 4JZJA 4M1GH 3ULVE 4JG1L 1ND0A 5BZWB 3F62A 2VZ1A 1CQYA 5E94A 3X11A 1W72H 4P2QD 4Z7VE 2HG5A 3QULA 2XQYK 1OSPL 1NGXA 2FSEB 5I8CB 3N50A 2DRUA 3KLDA 2NZ9D 4PG2A 4HX1A 3CSYB 1AI1H 1C7SA 1IGCL 1QRNB 1F11A 2FH8A 3QJFB 2OTWA 3NABL 3CX5J 5DJZA 5CJQL 3HZKA 5H35A 1CDYA 4GXUN 3TM6A 3X14B 1FZMB 1FZJA 1PKQB 3L5WA 3MRFA 3BP5B 3QQNA 1ZLWK 1MJJB 4QEGA 3T3PE 1RUAL 4JHAL 4HT1H 1N59A 4NQDD 4HK3J 4N0UB 1DDHB 2OL3H 7FABH 2C1PA 5AZ2L 1MCIA 1TLKA 2DLFL 1OY3B 3CCHA 4OV5A 1FVEA 3D87B 3WFCH 2NY6B 3SDDD 3MRKB 3QUYC 2HJFB 4PJAA 1P7QA 1A21A 4JDVB 2AQ2A 2P47B 5KSAD 1J1XL 4L9LA 2CDEA 4ZUVB 5HHVH 3KJ6H 5E8EA 5IJKC 4IOFD 2AABL 3TJEL 1H9VA 4ONGH 3DVGB 4YGVA 4TQEL 5BV7B 2PKDA 5I1CH 3HE6A 5JXAH 1XGUB 1MJ8L 3UZEA 3QIWD 4O9HH 4JFZH 4QHKJ 3LDBC 3WXWH 1IAIM 2CDGB 2A6KA 1UC6A 5HGBA 2ZCLL 5AZEH 4R3SB 1GZPB 1T6VN 2KQMA 2MHAA 5C0CD 1CT8A 1ZS8A 4OIIL 5CBEB 4HGMA 1MWAL 1PQZB 1DVFD 1HZHH 1WZ1L 3W9DB 3O9WA 4XVSL 1TPXC 1JL8A 2NY0D 4HPYL 1A02N 3UTSE 1DZBA 3KLAA 3M45A 1C1EH 4Q0XL 1H3PL 3PWUA 2C3HA 2R1WA 5CHNB 3VXSA 2J4WL 3CDYA 4N0YL 1GOGA 1JZ5A 4XMLH 3LKRA 1D9KC 4ZXBC 4XP4H 3ARDB 5FYLE 4WEBL 1FG2A 4LAQH 4Q9CA 4WHDA 4GKSB 3LPFA 1JI1A 4NWTH 4CL7A 3AUVA 3OHXA 5DJXA 3S3SA 5LQBH 4LVEA 5EOTB 2R4RL 3MA7B 4FQXD 2W59A 4MDJA 1KELH 5D1QB 3WIHH 4TNWK 4Q9QH 5D7KD 5IFAH 2NY5C 2FATL 3NIDE 2C5DC 3O4LD 1A7OL 1J0ZA 1YECL 3QQ4A 2UWEE 3GDBA 3GBNL 5I1HH 3GJEB 2FWOB 1WIUA 1U3YA 4OD3H 4R7NA 3V4UL 4F58H 5E08H 4DKEL 5D5MB 4UILL 1F00I 5EOQH 1HINH 4WDIA 3C6LB 3SE9H 4KJQD 1XF5A 1XGRA 3BEWA 3HAEB 3RTQC 3PGDA 3AS3A 1JRHI 3MPCA 3PP4H 2AXHA 5J11B 3V7MA 3U7YH 3IGAA 4NT6A 5F1IA 4M02A 5T1LD 2P8LA 1T03H 5F3BA 1H3UA 2IGFL 3MRJA 3ZYOA 4F9PA 4NZJA 1FO0B 3O6ML 4U6XB 1BIHA 3LV3B 3TVMB 5GZOD 2NY1C 1BJ8A 4QRPA 1R5VB 2WP3T 1GCFA 4PIRF 4CDHA 3S35L 4M43L 5D1ZC 4LHJB 4XPTH 2WQRA 4YE4L 4JLRA 2B4CH 3ARTA 1I4FB 4PR5B 4RDQF 4WI2A 2XZZA 3FO2A 3M07A 1ED3A 4LLWA 3U7WH 3TO2A 5IW6A 3T0XA 5GJSL 1INDL 4OD2B 3FFCE 4AEHH 1KXVC 5FKAB 4M7KL 4V2BA 4OUUA 3VD4A 4N68A 4L4JA 3G5YA 3EDFA 4S1SL 3KPLA 2DAVA 4XXDB 5BZWA 1VGEH 4OGAD 4K2UH 4N9GB 1R0AL 4JM2B 2FSEA 2EEDA 2ADGB 1YJDL 2XXCB 1FCGA 1A5FH 3OR7A 3CSYA 3RZCB 3MGOA 5DMKB 1QRNA 4RBPH 3FFCD 3RA7L 2EKSB 3QJFA 5LAXB 4BSVA 4LKCB 4LLDB 4AEFA 2APTA 2XY1A 1QBLL 3QDHA 4GW1A 2VO5A 3MODH 4RRPA 4L5FL 1IT9H 4XMKH 3X14A 1FZMA 4M6NH 2UUDH 1PKQA 4HCRL 3BP5A 1XGQA 2PYFB 5B22A 5D4QA 2AJXL 5FGCB 3BO8A 2EIEA 4RGMC 1HXYB 1YPZE 5DK2B 4N0UA 1MJUL 3O3EB 4GBXB 4TVPH 4KK9C 4N90E 4K3DH 5SV4A 5KSBB 5D93C 2DTSA 4KXZI 4EZMA 4P57B 4MXQD 3ROLB 4H20H 1IGJB 3BJ91 4QOKB 1AGDB 3MRKA 4WY7H 1A0QH 5F7HA 1EO8L 4YBQD 1FL5B 2DJSA 3SGKC 2F74B 4YDKL 3WJJC 4TPRH 1N64H 2P7TB 2XNAB 1U8MA 4XPAH 2ESVE 3O6LH 1NCAL 3DVGA 5CJXA 5H37G 1LP9E 2PYED 4DGIL 1EJOH 4N90D 1CWVA 4LCCB 3QCVH 3EFDH 4D0DA 4I3SH 3VWJC 4YK4B 3RGVD 6FABL 4OSUH 1FORL 4KQ3H 2B20A 3MLRH 2A0LC 1A3RH 5IM7A 1T7ZA 3RUGE 3MLVL 4R3SA 3STZB 4YUEH 3FMGH 5LCVL 4OZGF 1A3QA 2ESVD 5CBEA 3JVGC 3VFWB 4ZPVA 5CD5D 1MNUH 3W9DA 2IBZY 2VC2L 1PEZA 5DLML 4CUCA 4PJ9D 5IIEB 4OQTA 3MXWH 1N26A 1ITBB 3ABZA 5CBAB 4GKSA 3SE4C 1MHPL 1WJ3A 3CUPB 4ZOCA 3O41B 4S2SB 1HIML 3MV9B 5GGTH 4XPGL 5BO1L 2DQUL 3MA7A 1AR2A 5I76B 5D1QA 5JW4Q 2P1YA 3DVNB 2XA8H 2YPKB 2Q86B 3EYUH 4ZNEE 2F9BT 5C0JB 3LKQB 3B9KC 3JUYA 3DECA 4NRXB 4TTDC 3GJEA 2FWOA 2PR4L 3LOWA 5E8DL 5D7LE 2IEPA 3P4MA 1NFIB 5D5MA 3NCYP 1A7NL 3C6LA 5DD0L 1MREH 1JPTH 5AEAA 2ICWJ 4G6MH 1G1CA 4FZEL 2RR3A 1EMTL 1WSST 4LCIL 1Z0NA 1RU9L 2JLLA 1JGLH 3LAFA 3GBLA 3G9VA 2WZPD 2JJSA 3QO0B 2DTMH 1FO0A 4U6XA 1VDGA 3LV3A 2LU4A 2JIXD 3TVMA 3JWOC 3AMLA 1R3LB 3ZTNH 4KPHL 4YWGH 1Y18B 4GJTB 5CINL 2IPTL 4ORGA 1I75A 5D7LD 4UT6H 4X6FB 3BPLB 2SEBB 4BZ1L 1Q72H 1MFBL 3IDXL 1EV2E 2VL5B 1I4FA 2DQCL 5K93A 5D2NB 2WW8A 2G60L 4KI5C 4NN5C 5JA8B 1DFBH 5SWQA 3ISWA 2AK4E 3UTTE 2CO7B 3PJSB 1KJ2B 2XN9B 4UI2A 1VACA 1BWWA 1KB5H 2Q8BL 4LEXH 5ANMB 4P2RA 2VR5A 3CAFA 4N9GA 1SM3L 3LMJH 2NX5B 3O2DA 4JM2A 3T0EA 2BNQB 1NC4D 1QLFB 4EOWH 5BXFB 4HUWB 2A38A 3UTTD 4GOSA 5DMKA 3RZCA 1KLUB 4ERSH 1FPTL 2EKSA 3V4PH 1PVHA 3C9NA 4LKCA 1RIUL 5DFVC 3LIZH 3WN5B 3O6FB 3NMEA 1LO4L 3WIFB 2Y07H 3SO5A 3OKMA 1FGNL 3VFMB 1J0YA 4YDVB 4KY1H 2CMRL 2PYFA 1SMOA 4IRJC 1KXQE 1LO3H 4NCDA 1NCNA 5DK2A 4R0LB 2EDWA 5D72L 4GBXA 1V3MA 3G6JA 4RFOL 3FO0L 5KSBA 4MCYA 3JUZA 4L4TE 4NNXB 4Q6IC 4HEME 3V6FB 4Y8AA 4P57A 3ROLA 4X80L 3O8XB 4X83A 4LGSB 1IGJA 4QOKA 5FA3A 1AGDA 5I66A 1OAZH 4RMRA 5ADOL 2FHCA 3ARFC 3HE7B 2VIRB 3TZVC 1U91B 1FL5A 1Z5LA 3WFZA 1MIEH 4ELMA 1EUTA 1S9VB 2YZ8A 5JHDB 2XNAA 1QFWL 1VERA 1J8HE 5I1DB 3C6SB 1XIWD 3CLFH 2D7QA 4L4TD 4UT7H 5LGHH 2VDOH 3H3KA 5EOCJ 3D1MC 4N1CA 1Z6JT 1XF1A 4WHCA 1A2YB 5IBLD 4UNTA 3ZE0E 5DD5L 1M7DB 2VDNL 2YUZA 4EVNA 5TDNA 3I2CH 3RRQA 1ACYH 5JZ7D 3B6SB 4PGEB 1X5LA 1T5XB 5C7XH 1IKNC 1I9IH 3FN9A 4OCNC 5JXED 5A1AA 1J8HD 1XR9B 3MNWB 4WHYG 3SE8L 3RL1B 4M1DH 4PJGE 2E8YA 3TIDB 3VRJB 5CWSA 3MA9L 3I75A 2AJUL 5IIEA 2H6PB 3PHSA 4HUXB 4PJCE 4MMXC 5IBTL 1A6AB 1U3ZA 5CBAA 1YZZA 4GAGH 1PLGL 3CUPA 4FQQB 3VXRE 2FGZA 2GW5A 3O41A 2XQBH 4S2SA 1SJVA 4HEPG 2M1KA 2VRAA 3T0AA 4FABH 4O51B 2DIJA 1N0LA 4Y1AB 3VFGH 3QXWA 2ICES 3RAJL 1HHHB 2CO6B 5I1LB 2F15A 3CH1B 3QIBB 3ZHDA 4JKLA 3H9SD 2JE8A 3BDBA 3JWDL 5GGQL 1IGIL 1KCRL 4LARL 5C0JA 2LAAA 4KRPB 3Q3GA 1EHNA 2PO6C 4HPOL 1A6UL 3R1GH 2XWBB 3I85A 1HHGB 4FOMA 1J5OL 5F7LB 1MLCB 2B4CC 1RJYB 5BRZB 4ZFFA 2DYPD 4LLAA 4XP5H 3LZFL 3MC0A 1K2DB 3BSZL 4R2GB 1T5WA 3FTGB 4WI3A 2I27N 4D9QE 4POYA 2OTUB 3PQYB 3VD3A 2DLGA 2OI9B 2YD6A 3OKEB 3DSFL 1JK8B 4HC1H 2MPAH 2OZ4L 5D6CB 4AY0A 1Y18A 5H2BB 3HG1B 1MCLA 1YQVH 4P23D 4G6AC 2SEBA 4L3EE 3T4AB 1D3CA 1SJEB 4G42B 1DBBH 5L0QC 1ZHNA 5K9JL 2VL5A 3IU4H 2DL2A 1ZK9A 2HTLC 5D2NA 5JPNB 5IFJB 4L1HA 3QEQB 4D9QD 4X9FA 1EA9C 4MAUL 1T66C 3MUY1 5KAQF 1CN4A 3PJSA 5D8JH 5K33A 4LASH 4GUPA 1KJ2A 4FHBD 1OLZA 2GK0A 2BY2A 2AERT 3FB6A 5DQ9B 4K71B 1OARH 4WWKC 5ANMA 4ZNCD 1KB9J 5B3NA 4PJHA 3EJJX 3RDTD 3D9AL 4HDIB 2RJMA 1WITA 5EU3B 4K3EL 3RVWD 1JYWA 4Q2ZB 3HUJF 1CD1B 1S9KC 1FFQA 2W9DL 4X6CF 4AMKL 2GFBB 2DF3A 2P43B 3HC3L 4U1IA 4PJIB 1C5CL 3BW9B 1QLFA 1ZKAA 2EO1A 3KDMB 3SPVB 5BXFA 4HUWA 2A9MH 2MWCA 2ZUYA 2RB8A 2X4UB 3IKKA 1EO5A 1OM3L 4LPUA 2QSVA 3WN5A 1ERNA 1MHEB 3WIFA 2Y36L 12E8L 3VCLA 3VFMA 5A16B 4EN3A 4YDVA 1MAKA 1ZHKA 4KVCL 2YS4A 1RURL 3EJYD 3UROR 4BSJA 3AB0C 3V5KB 5IK3B 2V2WB 3HI1B 2QQKH 5IR1A 4R0LA 5MHSE 4LVHB 4TOYH 1B2WL 4QT5B 4DW2H 3MRMB 3J8F7 4Q9BA 4NNXA 2XPGB 4N0CD 1NGYB 2ID5A 4MXVE 3V6FA 4HKZB 1DBJL 3O8XA 1NFDF 1KXTB 3EYFB 4PGZA 1UADC 1AXSB 3IU3A 3MCLH 2NY4B 1WGOA 4PGCB 1MY5A 2VIRA 1F3DJ 1U91A 1R24A 1IC4L 1YEFH 1S9VA 2I24N 3SDAD 5JHDA 4PJDB 1O7VA 4OGYL 5EUOB 2IG2H 2YMXH 3C6SA 5DUPL 3H7BA 5BJTA 3FO9B 1L6XA 1G6RL 2FR4B 2IAMA 3BKJH 1M7DA 5D2LB 1FNLA 3TT3L 4PJAE 2ZCHL 2BP3A 3NCJL 5C0GB 4H1LG 4FTVD 1H0DA 3B6SA 4PGEA 3HC0A 3BHBB 4MJ2A 5DZNA 3VXNB 1HQRB 3FN0H 1G0DA 3MACH 3MNWA 2CLZB 3U83A 4NQVB 3BQUB 3EO0B 3VRJA 3TIDA 4I0PA 3PL6D 4F9LA 3EZJB 4ODVL 4ALAL 1R3IL 2NXZC 4G80A 3GMNA 5CJ5A 4H25B 2DMCA 2E3VA 1QYGH 4LFHD 3TBTA 2F8OA 3MUJA 4HUXA 1XH3A 1YMHB 2A83A 5C0FB 1A6AA 2IADB 3WHXB 5I8KH 4H1LB 4LSVL 4Z0BL 5GRVK 4FQQA 3MLPA 3WE6A 2C1OA 3FT3A 1A1MA 3ZL4H 4OT1H 2AW2A 3GFUA 3M1BA 2VXSH 3WV0A 5K59E 4O51A 4K07A 1CGSL 4Y1AA 2BCKB 3T1FB 3I6KB 2R23B 1QFUL 4NOBA 1NL0H 3LN4B 5GSRB 1HHHA 1TVBB 1JP5A 3VXSE 3QIBA 4QRRD 2BRRL 2JCCF 4XCFH 5JW4M 5TE4H 2X4TB 1TIUA 1DN2A 4JG0H 1NCDH 2FHFA 1B6DA 2NY3B 1ZLVH 1JYVA 1RJYA 5BRZA 3GRWA 1BQSA 1J86A 4LMQI 4Y5YB 1K2DA 5MP6L 3QT2A 2HFFB 3P9WB 4U0RB 3O9WD 5TPWL 2OTUA 3PQYA 3UJTL 4AEEA 3BE1H 5E6IB 3PWPA 2EDBA 3OKEA 3VXSD 3L3JB 2K9UA 1JK8A 3HMWL 5D6CA 3WO4C 4F3FB 5JA9A 1TENA 5H2BA 5F3HB 3RX5A 4I3GA 3RVXC 3SBWC 5CD3B 1TTFA 3FZUD 3T4AA 1OAKL 1SJEA 3HRPA 4NGHH 1QP1A 2CR6A 3NGBB 4JFFB 1T4KB 5D1XC 4DFHA 5HYJD 2ICWB 2AXJA 1LQSR 5IFJA 3UYRL 3QEQA 3A6BH 3ULVH 1L6ZA 2V5MA 1IMHC 4MVBD 3VRLE 1GGTA 2D03H 4YEFA 2OP4L 3IDMA 2VKWA 4V1DA 5HPMB 4JO3L 4QGYA 3CIQA 1F2XK 1UM6H 3U0WH 2FO4B 1HOCA 4QRPE 3VGGA 3QXVA 4PBXA 3ARGC 2EYRA 2X70B 1QPXA 3ARBC 1NMCB 3GSXB 4HDIA 4MQTB 2PN5A 4Z7UB 1QPPA 5EU3A 1U42A 4D9LH 5F6IC 4Q2ZA 1CD1A 3BUTA 1CFNB 5B3JF 1FIEA 4RFNC 4PJIA 1NCCL 3DVFA 1C12A 3GI9L 4L8CB 2CXGA 4D0CB 4XWOD 5EBMA 3PWNA 2F58H 5HYQB 4MJ5A 1CIDA 2X4UA 1NMAH 1WFOA 4KHXH 2YSSA 4QY8B 4NRZB 3HI6L 5A16A 3LS5H 2AEPH 3ZYZA 2E6JA 4XMPL 4WRLA 4ZUTA 1X4YA 1B0GB 4HS3B 3BIKB 4F7CB 3V5KA 2D7TL 5IK3A 2V2WA 3HI1A 3GSNB 5EN2B 3SEPA 4W6WB 4PJ7B 2EYTB 2ED7A 3SOBL 4YX2H 2WBJD 4XZUA 1BQHG 4QT5A 4HULB 3MRMA 4XPHH 1QRNE 1NGYA 4PBWD 3PV6B 4HKZA 2EDLA 5I6XC 1FNGA 2FB4L 2V2XB 1SJXA 5HJ3B 3BWAA 1AXSA 3GKWL 4YZFF 1JZ3A 4PGCA 1PKQE 4UIMB 4YAQB 3C60C 3GNMH 3NFPB 4P59H 5I19L 1J1XH 1UZ6E 1OCWL 3GJFH 4N0UE 3OJDB 3B2VL 4HMEA 3REVB 3FO9A 3P30H 4XBEL 3AY4A 5IOPA 3UBXG 2XZQH 4GXVH 5BV7L 3ZE1F 1KG0B 4NQCB 1IM3B 5I71B 3I6GB 5D2LA 3OKYA 1F90H 4DKFH 3UJJL 1U3HA 3QFJB 4WTWA 4Y5VB 5C0GA 2C3XA 3GHEL 4FXGA 3B2UC 2A2QT 4PJ8A 4XVTH 1NCWL 2VDQL 5FYLH 3QFDB 5IHUH 5GS0L 4E42A 1H3TA 3VXNA 1HQRA 4MAYC 5C0AB 4HF5H 5DJCA 3BQUA 3EO0A 3NA9L 1WBZB 4P3DB 1ZLSL 5J12B 2VB5A 3QUXB 5IT2H 4H0HB 4CGTA 3X3GL 5I1GH 5L88L 1CXIA 4Y4KC 1FDLH 1BFVL 1XGPB 1UKQA 1YMHA 4KUZH 4JPVH 5C0FA 2IADA 5F9OL 5EIQA 3WHXA 4H1LA 1GL4B 3OXSB 1UYWL 2PUQT 2DM3A 3W9EB 4JFOA 3SY0B 5F7DB 3T1FA 3HMXL 4JFQB 4A2MA 3LN4A 3B3IB 4PV9B 4X9HA 5DVOA 4QTIL 4K3HA 1JGDB 1MFDH 2HFTA 1TQBC 5GRYA 2XZCL 3QWOA 5B4MC 4FQCH 2X4TA 1FNEB 4KVNH 1PZ5A 1JWMA 3GBNH 1NAMB 2YWYA 3IFPB 4RX4A 3PHOA 4DKEH 1WBYA 2VLKB 3DETC 5IB3B 1YEEL 2EICA 4RDQG 4P2OC 4E41B 2HFFA 5I17A 3S36X 1DQQA 4TSBH 3KNBA 4XNYL 2EH8H 3OBAA 2A73B 3PNWB 4U1LB 4AK1A 2ZUQB 3L3JA 4OLYL 3QRGH 5LKNA 1CDJA 1KFAL 5JR1H 4PY8J 3E6HB 2W0FB 5FYKE 3BESR 4NN7B 3D3VB 3MV7B 5F97E 1JCKA 1TZGH 1UENA 3T2NL 1OB1A 4JQIL 4L8SC 4M7LL 5D5ME 3L5XL 2JK5B 4JFFA 5FFLA 1T4KA 1I1RA 3HS0B 4H8WH 5DUMH 3UTOA 2ICWA 2WBWB 3OAYK 1E4XL 3QNXB 4HIHA 1JGUH 5FGSA 4YHLH 1V3KA 2BY0A 3LCYA 1S7SB 3MJ9L 3D25B 1S9WB 2DQEL 1RFDH 5HPMA 3P0VH 4FQPA 3SDXA 1I1FB 3I3EA 3O81A 1HKLL 2FO4A 2J6EL 1U9KA 3NTCL 1J0IA 1S78D 1RZ7L 3NACH 2X70A 3CLEL 5DHVB 3TA3D 2YN5A 3GO1H 3DYMA 4FQLL 1F8TL 2EDOA 4KI5F 4Z7UA 4KROD 4M00A 2XTJD 4NZRH 5DQDL 3GZKA 4JJ5B 5HHNA 4UTAH 1CFNA 4PBVC 3MROB 5EO1B 5HI4C 4ENED 2BVOB 1RHHA 5IMOB 4G5ZL 5EFIB 4D0CA 4LDLB 4RA3A 1YJDH 3S3JA 5HYQA 1CGTA 2X42A 2YK1H 5FCUH 1OTTD 5C07A 4XAKE 1EVUA 4ZS6D 4ZOEA 2X09A 3TVMD 2VQ1B 5B39G 4NRZA 4ODSL 5C71A 1K8IA 1TCMA 3ECBB 4OGXH 4P2RE 4L5FH 2DB8A 2V6HA 4OV6F 2DKSA 4HBCL 1B0GA 3RWDA 3BIKA 4F7CA 5F96L 1GGIH 1T83A 4M6ML 2E6QA 2CJUH 3C8KB 4PJ7A 3TH2T 3T0EE 2EYTA 5F93C 3EHBC 3MBXH 4Y16B 1RUMH 3MRNB 3NCFB 1NUNB 4HXAH 1UZ8B 1F4YL 3PV6A 2Z31C 4XAKD 5I2IB 2V2XA 5DO2D 1XMWA 4F57H 4P2RD 3WFHB 5E8NA 1YY9C 4YHZL 5CSZB 1AO7B 3IJHB 4X9GA 3OJMB 2BNRA 3DTXA 4FQ1H 4FQIL 1P2CB 3Q1SL 2GJZB 2MJWA 3BP4B 5F1NB 4XWGH 1VEPA 4JM2D 3T0ED 1BQHA 5HHXH 3OJDA 1NCAH 1C5BL 3CD4A 2XZAL 3DUHA 3G6JE 3REVA 4F15C 1CVRA 3GI8H 4UIKL 5CKGA 5KSBE 3LRHA 5J3HD 4C4KO 1YYML 4E5XB 1U8HA 4NQCA 5EPMB 1UQSB 5ICZA 2JKXA 4OB5L 5C09A 4DQOL 5IHZB 3I6GA 4X9IA 3OGCB 4IS6A 2D7NA 2FX9H 4POZD 2X7LA 2EDTA 1A4JB 4Y5VA 1FVDB 1UWEL 2XRAL 1CDBA 3IDUA 1SY6A 4OZGB 4ELME 5F70A 4DUWA 3QFDA 3RJDA 4XBGA 4PJ5B 4TNVF 5FUOL 4GRWB 4EI5B 2BHUA 4PRPB 1WBZA 4MSWB 1ETZB 2ZZUT 3UBXA 1PAMA 5B38G 3QUXA 4G8GD 2HT2C 2ORBH 3QDGD 2AJYH 4NO0B 4JVPA 4F37F 2YUXA 3LHPL 1GAFL 1XGPA 2KUTA 5FHAL 5L6YL 3PWJA 1RULH 4Y2DD 5KS9E 2GSGB 5F9WC 4N8CL 3OWEA 4FP8H 4UINL 4ODUA 3W9EA 1E27B 1QNZL 4JO2H 3SY0A 5IB4B 5F7DA 1U3JA 3WNLA 2O5ZL 3UO1H 5AUMB 5TE6L 5T33L 3UC0H 3B3IA 4QHUB 2G2RA 4PV9A 1BFOA 3VW3L 4KJPD 3MLZL 1XCTB 3E2HC 1S7QB 1JGDA 2D7PA 4AQ1B 5GGSB 1U8KB 2NZ9C 3QEGH 3VD9A 5TFSH 3JTTA 4OLUH 4HJJL 1FNEA 1KBGH 4NQTA 1NAMA 4BA8A 2FJHA 4LQ1A 1P7KA 5C0IB 3OKNB 3VRIB 2VLKA 4UNUA 4G7YL 3BP7B 2F8VA 4S1QL 5IB3A 3V0VA 5DGRA 4LHUG 1ZT4A 1KEGH 3ULVC 5ICXB 2X9WA 4UB0L 1ZANH 4V2CB 4E41A 3BD3A 2R39A 1MCCA 5T5FH 3UDWC 4XRCB 2A73A 4U1LA 1U8PB 1UWXH 1J11A 2R69L 1X5ZA 4ZUUA 2DN7A 3KHQA 4FQ2L 5HGGS 4JHBA 1I1AD 4ZODA 2W0FA 4ZPTA 4Y0GA 3D3VA 2DQJH 3MV7A 5HD8D 3SDDC 5DXWA 1RZKH 1DBAL 4YPJA 5C08D 1MRFL 5AWNH 5KSAC 1JI2A 4RWHA 4WTZG 4QXUH 3NPSC 4NQEA 1G7JB 1S7SA 4IOFC 3D25A 4DZBA 1Z9MA 3ESUF 2HH0H 3V5HB 1CICC 5AG8A 2V17L 3WFDH 2I5YL 2Y72A 1IAOA 2VLLB 1LILA 4DN3H 1QR1B 3QIWC 1X5GA 1OW0C 4MNGB 1A64A 3WNOA 2GK2A 5DHVA 2PXYB 1RJLB 4XP6H 1G9NH 3SQOL 1I8LC 4YPGB 4DK6A 3QUMH 3MROA 3F58H 3KPOB 1AJ7L 1AXIB 5IVXA 4K8RD 4XB7A 5IMOA 5MEOB 5EU6D 1E6OH 5EFIA 1D5BB 1DVFC 4S11A 2ADFH 1EGJA 2FBJH 4NYLB 4YHNA 1I7RB 3BD4A 3LH2L 4NPYA 3UMTA 1EAPB 1EXUA 2VQ1A 1KSRA 4K7FA 4URTB 4H0GA 2ZUXA 3SGDH 4JFEB 5ANME 4BQ9A 3ECBA 1LO4H 4PJHE 3BZDA 2YA0A 1SJHA 2W9LA 4K7PH 1KPRA 1XR8A 4TUOB 5AD0A 1S9YA 2PTUA 2Y06H 4LNRB 3IJSA 1CFBA 3C8KA 1Z3GH 1TJIH 2Y25A 3B83A 1M6OA 3CFEB 4OI8A 5B39A 5I2IA 5TDPB 4WV1A 1OHQA 3G04B 2MKWA 3MYJB 3EOTH 3HB3D 4YLQT 5MI0C 1MAML 1TITA 3WFHA 3P4OB 1F58H 5CSZA 1AO7A 2IMMA 3IJHA 4OD1H 2V5RA 2A1WL 2HKFL 3K2MC 1P2CA 3W39A 2AJZB 1RZFL 3VWKC 1CFQB 2GJZA 2XOTA 3BP4A 4PLKD 5F1NA 4C83A 1T7XA 2CK0L 4KJQC 2DJUA 2DBLH 4NCC2 1KCLA 2DL9A 3KYOB 4IOSD 2W1NA 5EPMA 3P77A 1RIVH 1CGXA 1UQSA 5FUZL 2IF7A 5IHZA 3RY6C 4JQXA 3GSUB 3OGCA 2AJSL 5F72S 3AS0A 2PTTB 5EU4B 4EN3D 1A4JA 3INUH 3LN9A 3ARXA 3B9DA 5GZOC 2K3TA 4LSSL 3OKLB 5F6HI 1TJHH 1A1OB 5LXGH 2VLJB 2J8HA 5JHDE 4LF3A 1S3KL 3C5ZB 4PJ5A 4EI5A 1DQLL 4PRPA 4FQJL 4MSWA 1ETZA 2R1YB 5ACZA 1N6VA 1YY8A 5BS0D 1HYRC 4AL8L 4NO0A 4QCIB 5E9DA 4MQ7B 4NP4L 3ZKSD 4IRZL 1JYXA 3KYKL 4YQXL 2GSGA 4D3CL 5I15L 3CDFA 4XGZB 3HKFA 1D5IL 4AT6B 2APVA 4O58H 3JV0A 5GHWL 3FL7A 3EDEA 4LVOC 4ETQB 4OF0A 1IGML 4X6DF 4PREA 4QHUA 4XTRD 4BZ2L 2W92A 5IHLB 3RAJH 1QRKA 1XCTA 1S7QA 4G9FB 1KCKA 5GGSA 2DI9A 1KCVL 2IAMD 4U3CA 4QHLA 3RFZC 3O2VH 1L7TH 2E27H 5L2JB 4OJFL 4M6OL 4I4WB 1KTLB 4XAWL 4Z77B 4XVJH 4HUNB 4I0CC 5C0IA 4E9LA 4KKLD 2JB6B 4QYOB 4RAHA 4H8WC 3BP7A 4GKOA 3LQZB 3WSQL 1B0WA 5ESVB 5IESL 4HWEH 1S7VA 4Y1AE 2X05A 4CADA 5DJ2B 4I0PD 3DMMB 4XRCA 2QSCH 4XNXH 1JPFB 1UT9A 3U82B 2P46B 5GPRA 3T0BA 1YNKH 4IIQA 4OGZA 1A1NB 1OQXA 3F12B 2VXQL 3LKNB 2AJ3B 4P5TC 4Y4HC 5ALCH 1OGAA 3R0NA 4MXQC 5I30L 1BQUA 3T04D 4YDJB 1CLZH 1NGZB 4LHUA 2ZSWB 2R4SH 4JR9L 5BRZE 4YBQC 4XCEA 5DJ0A 1IQDA 1WTGT 1I8MB 4Z6AT 1G7JA 5CGTA 4DGVH 3PQYE 4D0BB 1KENL 1GJIA 4P4KB 5ADPL 3PWPE 4JRXD 3RNQB 3V5HA 4EUPH 5F7KC 3EYVB 2VLLA 2E7LA 2B1HH 4A6YB 4XCYB 4HIXH 3IRPX 3RGVC 5IGXH 3TWCL 4WO4C 2PXYA 1RJLA 3BX7C 1LK3L 4P0DA 3DO3A 2X4QB 3MBEC 4X6CB 3QUKB 4YPGA 3QG6B 4WTZA 4XC3L 3O3UN 4JQVA 4R2GD 1UJ3C 3QEQE 4PD4K 3KPOA 1KCSL 5CP7B 1RVFL 5CILH 4UUJB 5MEOA 1DEEB 3TN0B 5CD5C 1F4XL 1MCRA 3PWPD 1EAJA 3KXFB 4OZIF 4ISVA 4NYLA 1X6LA 4V1DE 2YD1A 1I7RA 4PYGA 1HHKB 1EAPA 2QBWA 3L3HA 1BEYH 2ZG3A 1QKZH 2QQNH 1D9KD 1MCWW 4JFEA 1HDMB 1T2JA 3QG7H 2VWEE 1QD0A 2D9QB 4LSRH 4Z7WF 4Z7QF 2DMBA 1RURH 4TUOA 1VESA 4X98B 3S36L 4RISL 4LNRA 1Y6NR 5ETUB 5FDYA 4PJIE 1MFAH 4Z7NE 4TSAL 4G7VL 3CSBA 4QRQB 2EIDA 5KOVC 4RMVA 4UV4L 5C92A 1JVKA 1VEOA 4V1DD 4RGOH 1NFDB 4HIEB 4NN6C 5FIEA 3F65A 2FX7H 1SEBB 4HK0A 5TDPA 1A7RH 4AH2B 1KN4H 3G04A 5MENB 3A67L 3MYJA 3T0WA 3P4OA 1RUPH 5C0BA 5AYUL 5EWIH 2BJMH 1J0KA 3FB5B 3B9AA 1MHHA 1LE5A 1CFQA 3EDKA 4WHTB 3RTQD 4D9RE 3QUYB 3DWTA 4WI8A 3KG5A 4OCXL 5JOPD 1ZOXA 1B6UA 3VFOB 3KYOA 5FM5O 1ES0B 4CVUA 1W0YT 3MYZA 2E7HA 5DMJB 5EU4A 5EBLB 4IMKA 2R0LH 3QI9C 2FGWL 3S37L 3OKLA 4P9HL 3IRZA 1A1OA 4U4BA 5IKCB 4NWUH 3C5ZA 1H5BB 3B9EA 3LDBB 1VPOL 2FYYB 2R1YA 4CVWA 3OJVC 3BFOA 1OD7A 4QCIA 5K9QI 4MQ7A 1HNFA 2IC2A 1J1OL 4JFDB 5D2LE 2WINB 1WWCA 3BPOC 5E2UL 4AT6A 3RU8L 1TPXB 2PW2B 4M48H 5T1KD 4ZYKB 4ETQA 3A0OA 3PXHA 4FFWD 4LVNC 5EC1B 5MERB 4YHYC 1HK6A 2W0LA 4KQ4H 4OZHB 1NGQH 1MI5B 3CU7A 4OKVB 2JCCB 1ZTXH 4W6YB 3VI3E 2QV2A 2VH5H 2IALB 4TNVK 1IBGH 1OGTB 1U3HD 1XEDA 5L2KD 5DK0A 4I4WA 1KTLA 4LK4A 3GSRB 1RZKC 4OIAA 5DHYB 5F89B 3UJIH 3CZFB 4Z77A 4PJ8D 5C6TH 2IJ0C 5JIKA 1N0XH 3HNSH 4PB0H 2JB6A 4QYOA 4PJBB 3O4OC 3G6DH 4G3YH 5ESVA 3KAAA 1FAIL 2EDNA 4TUKH 3CMGA 3K8LA 1BAFL 2UVFA 3GEWB 5DJ2A 5HDLA 4X5XB 3SGDI 1FH5H 4XP1H 2CKBB 2MQCA 2F5AH 1E4JA 5F88B 4NHCH 1A1NA 3F12A 3LKNA 2AJ3A 3S34L 3DYPA 3MV11 7CGTA 5SWSA 4QRUB 1EFXD 2QQQA 4YGAB 1CD9B 4CW1A 1G9NC 4FZ8H 1NGZA 1QG3A 2ZSWA 1EHLL 4CBPA 4F7PB 5CZVL 1GOFA 1CK0H 4NJAH 5J56B 1G0YR 4JB9L 2NY1B 3QHZH 1VKXB 1BBDL 4JKKA 2QHLA 4P4KA 2VSDA 3ULUE 1LO2L 1A8JH 5I0DA 5D1ZB 4U6TA 3NCCB 1MF2L 4G8FA 4GLRI 3L7EA 4A6YA 4NFDA 1T3FA 4LQFH 3MR9B 5IBLC 5ABDE 1JZ8A 1AQKH 3IDYC 1E6JH 3QXUA 4KTYA 5A2IH 1QUNA 4FNLL 3DRQB 2AJVL 3SDYH 4JFFE 3T8XB 3HTLX 1ODAA 3QUKA 5JZ7C 4Z7OE 5C0RH 4HUVB 5CP7A 4HLJA 2EDRA 3UZQA 3I02B 1CG9B 5JXEC 2AEQH 9CGTA 3TN0A 4ZOBA 1A7PH 3MJ6A 1HHKA 3SDXE 2BMKB 1A6ZB 25C8H 2N1KA 4APQB 2AGJL 1W0VB 2IPKB 3LEYH 3L1OH 2YPVH 1HE7A 3CXHK 2P5EA 5JUEH 3BIAX 1N4XH 4EI6B 3ALWA 4Z7UE 4X98A 5DD3L 4MZ2A 2Y5TA 3PP3K 1JV5B 5HHMB 1Z2KA 2CXKA 3ARSA 2FHBA 3GSNL 1FVCB 4QRQA 3BUYB 5CJOH 5T3ZL 1K3ZA 1QFOA 5M94B 5C07E 5ISZD 4RBPK 3NH7L 4EKXA 5MENA 5DEFA 1XZ0B 4LSTH 2YRZA 1PY9A 3BKYL 2G75B 2X5PA 4DTGL 1Z9OA 2XFXB 1UXWB 1BFTA 2UUDK 3HFMH 4OCYH 3T2QA 5D93B 1HCFX 1C5DA 4CKVX 2LVEA 5DRNB 3FB5A 1IJ9A 5F1OB 5TF1L 3UPAA 1TVDA 4KAQH 3N85H 3P0YH 1MCEA 4U3HA 4WW2C 2IQ9L 4WHTA 4PJ7E 5DJDA 3QUYA 1KJ3H 1DTUA 1L9NA 4FFZH 3VFOA 4HWNA 2GTZB 5C07D 1YC8A 4ZO7A 1ES0A 1UGNA 3MRLB 5GS1C 4ZTOL 3G9AB 1MH5B 3FT2A 5GRJL 4HAFA 3S88L 3HZMB 4IDJH 2MNUA 5EBLA 4UDTB 5T3XD 1CLOL 4YC2C 5KVDL 5I0ZA 2BNRE 4IMLB 3U30C 2XT1B 5T1DH 2VDQH 1YDPB 4P23C 5IKCA 2B7DT 1FLRL 4MQSB 4DVRH 1H5BA 2FYYA 3MQIA 4KI5D 5DJ6A 3FB7B 4LU5H 1DQDL 4WJ5B 3O11A 5E2WL 4WCYL 3PWVB 4NZUL 4NQCE 1FG9C 2GCYA 3CDGB 1D6VH 2DQHH 5D7SH 5C09E 5F9JA 5HVHC 3SKJH 1KTRL 5EOCL 3ZDYF 1RZIB 1NAKL 3QYCA 2WINA 4HKBB 5C0DB 3S7GA 4OQTH 3WUWB 4YJZL 5DYOB 3EKCA 2BNRD 2PW2A 3SGJC 2G5BA 4ZYKA 3FQRB 1GGUA 3RDTC 1SYSB 2NW3B 3NCBB 4Y4FC 1FGVL 1HN1A 1DANT 4NKIL 3RVWC 4PS4L 1ZA6B 5EC1A 1DQML 1RPQA 5HHPA 4OZHA 1MI5A 4OKVA 3U9PL 1DSFL 5CIPB 3DX6B 4P3CH 3CMOL 5FK9B 5MEPA 5C09D 1Q94B 1WFTA 5KOMC 2IALA 1HSAB 2DBJA 2VNCA 4PTUB 2XZCH 3RX8A 3TNNA 1OGTA 1A6WL 1HNGA 5DHYA 5F89A 8CGTA 5FYKH 4PJBA 3WIIL 2JB5L 1Q8MA 3BZ4B 5INDA 5IEHA 1Q9KA 5DD1L 2Q3ZA 3EJYC 5CEYA 1NUDA 4I48A 1IFHL 3MXVL 3B9KB 1HEZB 1P4IH 4GRMB 5EU5B 3QUZC 3JTSB 4X5XA 2EDKA 5IP4A 2CKBA 4M4PA 3S6CA 1UG9A 5F88A 4OLYH 1RJCA 1U8LB 1S7RA 1BBJB 4OCWL 5IROA 2QADC 2Z91B 1E4KA 4QNPE 4LIQE 4WWID 1FO0H 3ULVF 4NNPH 4U1JB 1UM4H 4PGJA 4GRLB 4YXHH 2DQIH 4KUCD 1T21B 4Z7VF 2VLKE 2NYYC 4BQCA 3L5XH 5T1MA 3BT2H 4XT1C 3BVNB 4OKDA 1BD2B 4E41E 3SDAC 4LRNH 1OQOA 4R6UA 3RQ3A 1VKXA 1O5DT 2XG4A 4U1NB 1NCUA 1EZVY 1LK2A 5D1ZA 3HZVB 3MLUL 4PG2C 3AFLA 3N9GL 2VDRH 4HJ0C 5D71H 3D3VE 3MV7E 3WNMA 3MR9A 2EXWC 4Q9RH 1JPSH 3T3PF 4XHQA 2N7BA 1CE1L 1RZ8B 2WQ8A 2JELL 4M3KB 5BVPH 3BGAA 1NUGA 3T8XA 1SEQH 5DT1H 1FE8H 5CZXD 4CMHC 4HUVA 1AR1D 4NQEE 2YD4A 2DQTH 4AG4H 1MQKL 3O2DH 1ADQL 2VDLL 2BVPB 3PL6C 1HSBB 2RCSH 4N8VG 2BMKA 4RMUA 1KPUA 2C3WA 2D9CA 4X0KA 1NGPL 4APQA 3CFIC 3OPZL 1NDMB 1W0VA 1UH2A 2IPKA 1IEBB 2Y9RT 2OL3B 3OZ9H 2XV6B 2B2XL 4LPYA 4EI6A 5JQ6H 4JFYB 3KYNB 3GSVB 1VEMA 4H88L 5D9SA 2J8UB 1VFBB 1YEGL 5ALBL 1MPAL 3WHE0 1B88A 1IAIH 2VZTA 5IVXE 4NQED 1FVCA 4HUUB 1OAUL 3TBSA 3BUYA 3V4VH 5HHQB 3L6FB 1A3LH 3TYFB 1BQLL 3HE6C 4IRJB 5E8PB 1ZHBB 4ZD3L 2CRIA 3U4EB 4PRIA 2VISA 1XZ0A 2V5TA 3P4LA 4TULH 4U2ZA 2EE6A 4EJ1C 1AY1L 2G75A 2PO6D 4RMSA 1RK1B 1FYTB 3TH3T 3BPCB 1UKSA 4QHNB 2W9EH 3D2UD 4JGJA 1EK3A 4Q6IB 5DRNA 3V8CA 2FDBP 4NKMB 1SBSH 4L3CA 4GAYA 3GK8H 4F8TA 1NANH 2F53B 3CFBB 1P4LB 1J0HA 3KR3L 5ITFB 1I9JL 5GRVL 3WXVL 1XF2A 3ARFB 3TZVB 3O9WC 5C3TA 5DRXB 2GTZA 3ILPA 3QA3B 4M9OA 5HY9B 2BDNL 3TV3H 3SGKA 3MRLA 1MH5A 3G5VB 3HZMA 5D70L 4UDTA 1WFUA 3G5ZB 3IAQA 4XNZC 1AO7E 3OF6A 4M5ZH 4IMLA 3TBYB 5C86A 1G7QB 1YDPA 2FLBT 4YXLL 1D6EB 5GXBB 4NO5B 5HHOB 4UAOC 4BQ8A 1I8IB 2V5SA 4KK6D 3T08A 5DS8B 3KPPA 3FB7A 3P0GB 4WJ5A 3NIDF 3WFBH 1QBAA 3MZGB 3NZHH 5H37H 4MVBC 3PWVA 5I9QC 1MCSA 2UWEF 3DXAB 3CDGA 5KW9L 3LB6D 1I3GL 5DF0A 2NLJA 3JVGA 1BX2A 2FD6H 5E2TL 4EDWL 4HKBA 1H8OA 5HDQL 2XKNA 2JJWA 1JFQH 3FQRA 4LCYB 4UINH 1SYSA 1YEKH 2VDMH 3PDGA 3GUTB 4LCUB 1HH6B 4PJ5E 1MWAA 1J1PH 3V2AR 4GRWE 5KJRH 4XP9H 4PRPE 5GRZA 1IGFL 4TVPD 2I60H 1ZA6A 3U4AA 3LRGA 2DQDL 4EDXB 3SE4A 3EUUA 2X89D 32C2A 1ZLUK 5CIPA 4OTXH 3DX6A 3BDYL 5J13C 4XWOC 5E9DE 4HZAA 4HS6A 1CU4H 3QIUA 3LEXB 4PTUA 3SJVB 3VMOA 3U9UB 2HWZH 4XPFL 5EZIH 1QFWM 5IMMB 3BZ4A 2B0SH 2OQJB 1NSNL 4NUJB 1HEZA 5EU5A 3W81A 4M7JL 1NBVL 5DR5L 3JTSA 5ESQB 4YDIL 15C8H 5GZNC 4N0FB 3IFLH 4OFDA 2IBBA 3VGHA 2WBJC 3WFEL 4FFYH 4BFBD 5E9DD 1U8LA 4G6KH 1BBJA 3REWB 2Z91A 4Z95H 3GSQB 1GOHA 2QKIB 3O6KH 1VFAB 5DZOA 4U1JA 5T5NF 3W2DL 4GRLA 4O2EA 3EO1B 2I9TB 1T21A 2YXFA 1YA5A 3DI3B 1BD2A 5F7UA 5KZCB 5IBUB 4JY6A 4OM1L 5LGKA 1CL7L 1C7TA 4U1NA 4UU9B 3WHE1 3RVUD 3HZVA 1WWWX 3IJYB 1OGAE 1BGXH 2EE2A 3KYMB 1ZHLB 1K85A 3IF1B 1KJ2H 2YKLL 3TYGL 3WKNA 1LEKA 1RZ8A 3Q5TA 4K94L 2UV3A 3CK0L 3NAAH 3DARA 3BN3B 1K8DB 5F8QC 5GRUH 4L1DA 1M7IB 1QBML 3IXTB 1BIIB 4WWKB 3V7AG 5IB2B 2Q76B 3KPSB 4JN2B 5I1IH 5ESAB 1FL3B 1IRAY 1OGAD 3D39B 1N7ML 4GG6A 3C09C 1UACL 2UZIL 4OLWL 4KRMB 2OL3A 4J1UA 1JWUB 4LHUD 4JFYA 3KYNA 3GSVA 1KYOK 4WU7B 5DFTA 5I1JH 4CU6A 2J8UA 3T2PA 1LP9F 3W5MA 4PB9H 1VFBA 3GHBH 1QLRB 1T22B 1AFVH 1MRCL 3ZDZE 1KEML 5J6GB 3R4DA 2D7MA 1FFNB 5HHQA 3F7RA 2BVQA 3C8DA 4N8VA 3L6FA 3HN3A 4IRJA 5E8PA 1ZHBA 3H3PL 3U4EA 1RZGB 4JFEE 3RUGF 1RK1A 1FYTA 1MAMH 3BPCA 3QZWG 2PXYD 4MXWL 4HCRA 5JW3L 1CFTA 4QHNA 2ADJA 1HH9A 3HC4L 1DUYB 3IFOB 3ARYA 4NKMA 1T89C 3GB7B 4A2LA 2R0WH 4QF1B 2F53A 2FJGB 3CFBA 5FCSH 5ITFA 5D7JD 3HI5L 3TZVA 2GJ6B 4M3JA 4LMQE 4YBLC 5DRXA 1YEDB 5HY9A 2C4FT 4M4RA 4BJLA 3G5VA 3OKDA 1A4KB 2IFFH 1NC2D 4S1RH 2AJSH 3G5ZA 2AXGB 4PJEA 3VXOB 3RBSA 2AI0L 5C0BE 2XICA 2DQGH 3TBYA 1AE6L 1G7QA 2LU7A 1PG7H 1TJGL 1KIQB 5D1XD 1D6EA 5EULV 2BHYA 4NO5A 5HHOA 4PRHB 1I8IA 2FEDD 4Q6YA 1NCTA 1ZAGA 5DS8A 5KVGL 4ZS7H 1DEDA 4YXKL 1K6QL 3K4AA 3V0WL 3CVHL 3DXAA 5D1QC 1YMME 3Q6FA 1G9ML 3X13A 1Q1JH 4P9ML 3THML 1FBIH 1SYVA 1PX3A 4TVSa 1U58B 3ARGD 3MV8A 5C0BD 3LD8B 2BSRB 1S78C 4K8RL 4LCYA 2E9JA 2A77L 1NLDL 2NXZB 3LS4L 1F6LL 4LCUA 1HH6A 5DTFA 1UB6B 4X6DB 1O7SA 4KROC 1KC5H 3C6LC 4FQHB 1WZLA 5IMKA 4WHYH 4QTHA 2Z9TA 4CN4A 4ENEC 2AK1H 3OTTA 5J11C 1TMCB 2BC4B 3NA4A 1YMMD 4JKPL 2R29H 1RZJH 3DO7B 5FV2A 2YC1B 3LEXA 2JJSC 4ODXA 1OTTC 4MB4A 4ZS6C 5IFHH 3TVMC 4TRPH 5J57B 4LLVB 2QR0B 5IMMA 4KKAD 2M8XA 3MRGB 1JNJA 1N5AB 3MLXH 1L7IH 4MB5A 2X6MA 2OQJA 5FO9B 1FC2D 4NUJA 1P84K 2O61A 3GRWH 5ESQA 2WUBL 4JREB 1B0RB 4WVRA 3EO9L 5EUKA 4XCCH 3DRTA 3MZTA 2HVJB 2R8SL 3IFNL 4NHUA 3REWA 4GSDH 2APBA 2VXQH 3GSQA 4HS8L 2QKIA 1IC7L 4NOFA 1VFAA 4NJ9H 2ZP0T 3ULSA 1I9RL 1IAII 3EO1A 2I9TA 5SWZB 2ZKHH 4QKXB 3CXDH 1ZLVK 2R56L 5GGVH 2HLFD 4YHOH 4F33B 3VGBA 3WO4B 4OLZL 35C8L 4Z76B 2DJ4A 3NFSH 5DRZA 3P2TA 3P3YA 4JM2C 3T0EC 3C2AH 4EIZC 4NRYB 5KVFL 1BJ1H 1F6AB 4UQ2B 3IJYA 1II4E 5J3HC 4X6BB 5HI3D 1B4RA 4OBSA 3KYMA 1MQ8A 3IF1A 5SWSE 5JORB 3S4SB 2FIKA 3IYLW 3B2UD 4WU5A 4POZC 5JNYB 4BQ6A 1TZHB 2L7JA 2FEEI 5HGDB 2MFNA 4NQXB 3SCMA 1K8DA 3BKCH 3BKML 3KPRB 1M7IA 4NQUA 1BIIA 1EFQA 4OZIB 3K8MA 3KPSA 4JN2A 5CMAB 4GBXC 3ARBB 1MCPH 2WMPA 3QDME 2WBKA 5ESAA 1YEIH 3S96B 2C3GA 3HRZB 3SDCA 3D39A 5F6IB 3FONB 2LTQB 1NKOA 1OVZA 3PUCA 5SWSD 3GMOB 4Z7WB 4RFNB 4O5LL 3IDIB 1JWUA 4MZ3A 4Y19E 4JPWL 3S36H 1A7BA 2D31B 2H3NB 3VXQB 3WS3B 1F4WH 1T22A 3I3DA 1NMBL 5D7IB 4CRPA 1WEJL 4HGWB 5J6GA 4G7VH 4E0RB 4UOW0 4IRSA 3BGFC 2Q6WA 3GIZH 3ZE0F 2HLAA 3QDMD 4BUGA 2R2CA 4K9EL 5F7YC 3TO4A 3H9YA 3QEUB 5K9OB 5DGQA 5DZLA 5CEZE 2ENYA 1RZGA 2R2EB 5JLZA 3EYSH 3MLSH 4PGBB 4JO4H 3V6OA 3L3GB 2P5EE 1DCLA 1MFCL 1E4WH 2H41A 4GMTH 3OR6B 4Y19D 3CZJA 4DOHB 4KZDL 1CZ8L 3BWUC 3ET9F 1DUYA 3IFOA 4O4YL 4PJGF 4ZUSB 4BFIB 4KRNA 2C7UB 2IANB 4G8IB 4LCWB 3GB7A 5DWUH 5I6XB 3T65B 2X1OA 4QF1A 3DX9B 4L9DA 1QR4A 5CCKL 3SN6N 5HGHB 3C60B 2GJ6A 4PJCF 3H9HB 1EHXA 3HR5A 2IPUG 5CEZD 2HP4A 4ZDHB 1OAXH 1A4KA 4U05A 5MENE 2QHRL 1I1AC 4NKQB 3HNTL 5FHBL 4WW2F 2P5ED 3VXOA 4PJXF 1MUJB 4UTBH 1XT5A 4OCRH 5HD8C 5FYJL 1QSFD 5FYKU 1FZOA 4RWYH 5FOBA 5ITBH 3GBMH 5JO5B 1X9QA 3S9DB 5CEXB 4IHOB 4M5YH 2IBGA 3B5GA 3JV4B 1LEGB 4HUMB 3GJFK 1F13A 5CS7A 3VDBA 2EZ0D 4L4VB 3C5SB 3HPJB 3BI9X 4XNUL 1G6RB 3MRPA 3O2WH 1ZEAL 4JM4H 2VLRA 4EXPX 4LSPH 1DQJB 3WYRA 1CS6A 4MAYB 5GJTL 4I5BB 5F9AC 2QQLH 1TDQA 3I6LE 3UPCA 1GGCH 2BSRA 1VFMA 2V7HB 4HKJB 1YNLL 4CU8A 3O0RH 3BRFA 4H1LH 3O3BB 1F3JB 1U8OB 4O2CB 4IOIA 4Y4KB 3RPKA 4X6DA 3IS1X 4P46A 4FQHA 2QTEA 4Y88A 3Q2CA 4HJGB 5TQ2L 2VITB 3BD5A 1HILA 1KCUH 4P5MA 2BC4A 5A2KH 4JPKH </