2VXQH

Crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
213
Chain Sequence
b'VQLLESGPGLVKPAQTLSLSCAVSGGSIRSGGYYWSWIRQHPGKGLEWIGYIYHSGNTYYNPSLKSRIAMSVDTSENKFSLRLNSVTAADTAVYYCARLDGYTLDIWGQGTLVTVSSSTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLLEN ALLERGEN PHL P 2
publication title High-Affinity Ige Recognition of a Conformational Epitope of the Major Respiratory Allergen Phl P 2 as Revealed by X-Ray Crystallography.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 41
structure length 213
sequence length 216
ec nomenclature
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxqH01
5HGBA 1KN4L 4ODTH 3WSQH 4LCUB 3W0WD 4M00A 3CVHH 4J4PD 2PN5A 1Q9LA 1S9VB 2UWEF 4YBQD 3WLBA 5F6IB 3BPNB 5HYQB 4ODXA 4F7EB 4ERSH 3EO9H 8FABB 1HI6A 2Y07H 3P4NB 1E27B 3S37L 1QQDA 1Z0MA 2GJZA 2X5PA 2NPLX 4DAGH 4JPIA 1CE6B 4P57B 1YEFL 4MJ6B 1C1EL 3LKRA 4JG0H 1NBYB 3GMOB 3M8OL 4Z76B 5I1EL 3B3IB 4C56B 1FPTH 1AR1D 3RIAK 4ZNCD 5TFSH 4F9LC 4AIXA 1FZMB 2X4TA 3BGMB 1T7XA 4YXKL 3SDAA 2NXYB 3QFJD 2AXJA 3LRGA 5DUBB 2J2ZA 2VLKD 2WIIB 3PIQB 4MB3A 1EPFA 4QYOB 5HDBF 1EMTL 4HKBA 4I13B 1AC0A 3QHTC 2VIRB 4LOUD 1F45A 4Z7WB 5GRYA 5TF0A 2AI0L 5TDNA 2VRAA 3QWQB 5DMIL 1MJUL 3QIWA 4CBPA 3CX5K 1ZA6A 2ITCA 3VXNB 5HGAB 4LGPB 2NZ9C 1BZQK 3PG2A 3MRHA 2WINB 4JDTH 2QJDA 5IMOA 2Z8RA 4PRBA 1TZGL 4KKBD 1JV5B 3MFFB 3TPUB 1PEZA 4PREA 3VXQA 5L2KA 3LV3A 2D03H 3O6LL 5HI3D 2F54D 3O81A 3IAPA 4QHNA 2M8XA 5HVGB 4GUPB 3X13B 1T20B 4P46D 3W9DA 2Q3AA 4PR5A 2G2RA 2Z8SA 3KYNA 4HJ0D 2GYSA 4S10A 3QISA 4HJGB 4X8JA 3KXFD 3RGVB 3WL9A 1W2KT 1IC4L 3D0LA 2D9CA 4LMQI 1UM4H 2LV4A 3DMMD 1DDHA 4IHOA 5MEOA 3BE1L 5DMGD 4KDVA 3ARSA 2D0HA 5C3TA 3HNVH 5K33A 1ZT4B 4WI6A 3ARQA 4KZEH 3FO0L 4WTZG 5ENWA 2Q8AL 1AE6L 3E3QC 5GSRB 2P5EE 4NWTH 1QD0A 3QEHB 4KI1A 2DD8L 4H88H 2XZQH 2R1XA 3KYMB 1CE1L 3BKYH 1A1OA 3FQWB 2FATL 4YH6A 1ZHBA 2I07B 4UQ3A 2P8MA 3VFGH 1CLZL 2COQA 4JRXA 2VISB 5BZWB 5GS0H 2E27L 1WBZA 5GS0C 2XFXA 2DLFL 2XYCA 3ARDD 3UJIL 3DX9B 4Q9QL 3UJTL 3LEYH 4ELMA 4URTB 4D8PB 4B7IA 3A6BH 5FDYA 2FJGA 3G6DL 1INQB 1NDMA 3B9DA 4KJQD 4PRHD 3L7FA 2V5YA 3KNBA 1PZ5A 4LSVH 1AGFB 1XF5B 2FEDD 1KPRB 3C8DA 3DHMA 2BSTB 3TYFA 2W59A 1VDGA 5IHZB 3VFSB 5D9SA 3X3GH 4GAGL 1BJMA 2EIBA 1DUZB 5J06A 1CG9B 4TUOA 1TITA 4C56D 1OT1A 3ARFA 3WNOA 1OAUH 1KJMA 5DQ9B 5EDXA 3ME0A 2WNGA 4X98B 2NXYD 4S1DD 4Y5VC 2FYYB 3PDOB 4JFFE 1U91A 4IMLA 4N1CA 3O2DH 2KPNA 4HXAL 1TXKA 4JEGB 2NY1C 1B9ZA 1BMGA 1LO4L 1YJDL 5TQ0L 3G6JF 3MXWH 1SVZA 2JTDA 4L8BA 5T1KA 3IAGC 4H20H 4NWUH 4X83A 3IDNB 4XNMB 3VFOA 2P45B 1KG0B 1G7LB 2VUOA 3V2AR 1YQVH 1NGPL 3AREA 4XCEB 5FKAB 3U7WL 3HRZB 1FLRL 3OXRA 3GIZL 3BESR 4NOBA 1NFKA 2GCYA 4YFLF 4U2YA 4HF5L 2J88L 4YGVB 5CBEA 1T03H 4Y5XC 3HUJB 1QR1B 4Z7UA 2VXUH 3DWTA 1OAQL 3IJYA 4MAUL 1JGLL 1HIMH 3FKUS 5C92A 4GKNB 4L8SC 4EJ1C 2AV1A 2GQHA 2Y36H 3MRPA 4OD2B 2XZAH 4RFOL 2B0SL 5C2BH 4YZFF 3RGVD 1Q72H 3MMEB 3QQ4A 4S1QL 4V2CB 2WWMC 3UTQA 1A7OH 2X1WL 5KVGH 3IDIB 1N0XL 5IESL 5HGHA 1P9MA 2GSGB 4P3CH 5BQ7B 4LLUA 5GGTL 5E95B 4LAQL 3RNQA 1IC1A 5C0GB 1J0HA 2X7LA 2HN7B 4JFFB 4BUGA 5JO5B 5B38A 1S7TA 5CZXD 2F8XC 3PABB 4XVSL 3WMSA 1MFDL 3GSWB 5TDPA 1H3TA 4HPYL 3OKKA 1EGJL 4FFYL 1HHGB 3QXTA 15C8L 5T3XE 1JZ8A 1OW0A 1QSZA 3FB6A 3OG4B 2AK4A 5CGYD 5MEND 1E6JL 1A6WH 1T22B 3IB4A 1J1OL 3NABH 5LG1A 4DKEL 5LQBL 1BVLA 3C2AH 3VXME 4X4YB 3IRZA 5J4MA 4MJ5B 4PJHF 1NLDH 5JA9A 3STZB 1QYGH 2P5WE 1QFWL 3DGGA 3FMGL 2BSRB 2YRZA 4JKLA 4L4TA 5JIKA 3RHWK 3GJFA 4JKPL 3NFPA 1A1MB 4OB5L 4N0CD 2HFEA 5KZCD 2LAGB 3P77A 2VLRB 4PJ5B 4YFDB 1PSKH 4N9OB 3MBXH 5DHVB 4HHAA 5JQ6H 4NM8H 3TBVB 2IQ9L 2DI8A 3N85L 1FYTA 4PV9A 5DD0H 2F9BT 1M05B 2EH7L 3C60B 4JZJC 3O9WC 3BPCB 4IDLA 5IK3A 3K8LA 4X6BB 3WFBH 1BP3B 2MHAB 3QUXC 4HIJA 5DJXB 3HCVB 3U1SH 4YHLL 1CTOA 2UY6A 4R96B 3VXSD 2V17H 2KZWA 5DS8B 2EYSA 1CQYA 3QNXB 5FCSH 3HB3D 4P23B 3P11H 1XCQA 3VCLB 5HHQB 3KPTA 3PWPE 4JM2C 5FECA 2YA2A 1VEOA 1NGXA 5DFTA 1U8QA 4TNVF 3ARBA 1TENA 3QXAB 4GRMA 5HTSA 1CGWA 1J0ZA 3DBXB 1ZS8A 2GJ6A 4Z7VA 3QHZH 3SDXF 1TQCB 3PWNB 2EE2A 2E8YA 4G42A 2NX5E 2P5WB 4QRUB 5I1AB 5GRJH 1CFSA 3S4SG 1AKJB 4V2BA 3SDDA 4DGIL 3WUWG 4HXBH 5INCA 1YZZA 5C7XL 3H9SB 4DTGH 5IEHB 2JJTA 4CVXA 4XGZB 2EO9A 3N1MC 1YEGH 1N5YL 1UH3A 4OQTA 4WUUA 4PJAA 4XAWL 2AQ1A 1UEYA 5GGVH 3MUGA 1KB9J 1MCWM 2FHBA 3QIUC 2OM5A 43CAB 2OMBA 5J3HD 2BVOB 3QA3A 3DI2B 1X5GA 5EIIB 2AXGB 1KIPB 3RIAF 3PGDA 4DN3L 4Z7OF 4HZLA 7FABH 4MS8D 5ETUA 5EZOL 3MRNA 1MLBB 2D7OA 3RVWC 4BUHA 2ICWI 5J13B 1RZGB 4NP4L 3BKMH 1C16B 3NFNB 4XP4L 3VI3E 1YMME 3NCEB 4DKAA 2FHCA 4OZIB 1KT2B 3EOBB 2VLLA 1BGXL 3PWPB 3SPVA 1HILA 1TTFA 3O3AA 5E9DB 1F4XH 1ND0A 2VXVH 2B5IC 5ISZB 5K9JH 2OJEB 1KTLA 5IF0A 4NBXB 2HFGL 1IGJB 1A22B 2J4WL 3PWUA 2DQDH 1N59B 1RK0B 2Q76B 2XRAL 4HUVB 3G04A 1TVBA 1EBAA 2ZUWA 4NPYB 1KJ3L 1NGZB 4XC3L 2VLRD 3IXAB 4PJ5D 4ZAKB 3WD5H 4HS6B 1YNKH 4GW5B 4M1GH 3KVQA 2A73A 2RGSA 4HMDA 4PGEB 1D3CA 4L4VE 5AYQA 1ADQL 4ZUVB 4UDUA 4RFEB 2D7TH 1UJ3C 4O58L 4I9WE 2GY5A 3BGAA 3BP5B 1OF2B 2C1OB 3F58H 3DV6A 4OT1L 1S7XA 5CMAA 1CT8B 5HYEA 4PJEB 2AJZA 4LCYB 1EJOH 4MA1C 4XMLL 1HHIA 3EYQC 3C8HA 4B53A 1KLGA 4HPOH 3MLPA 5B8CC 2DYPB 4P23D 5K9OB 3UTSA 4CAGA 1JMXA 4I1NB 2Z31A 2XQYK 1FH5L 4OGAD 5BO1H 2Y5EA 3IU3B 1F58L 3QJFA 1T83A 1BQHG 1YNTA 5T5FL 2RFXB 3O0RH 1YMMB 4S11A 5KSBB 1IZJA 5I1CH 2JJSA 1VESA 1TJIL 1XCTB 1KPUB 4NN6B 4XBPB 2GTWB 1KENL 3EYVB 2HJFB 3TV3H 3S5LG 5LWYH 4LU5L 3QEQA 3RTQA 3PQYB 1ZGLM 7CGTA 5KVFH 5DQDH 2CRMA 2GFBA 1MIML 4D9QE 1RIHL 3H9SD 1IARB 4JAMB 3TN0D 1DQQA 4PD4K 3QEUA 4EVNA 5CS7A 2OZ4L 3CVIL 3G6AA 5E56A 3GK8H 3LEXA 1WAAE 2OTWB 2BSED 3VWKA 2A6DA 4XNZC 1UXWB 1SJVA 4PBXA 5DT1L 6FABH 5E2VL 3NA9H 5L2JB 3K80A 4MA7L 1Q94B 3OJDA 1NCBH 2EKSA 5IQ7H 1EEZA 2VAJA 4JHWL 1EX0A 1U3HC 3HPJB 5D7LA 2V9QA 1VPOH 2D7NA 3BP7B 4KMQA 4MD5B 8CGTA 3VW3L 4OGZA 3C6SA 2NTFA 3LQAH 4PRIE 3LQAC 5DD3H 3QULB 3PHQA 4MJIE 1A02N 5E9DD 4OLYH 4JFPB 1UADC 2QHRH 3IFOA 5ISZD 3CDGB 5KSAC 2E3VA 3H3KA 3IDMA 4NJAH 4WWKB 1WC7A 5GGUA 3MCKA 4LLDB 2JCCB 1KCSL 3LD8C 2GUOA 4DUVA 4Z6AT 1P69B 1XMWA 4JY6B 4Z78B 4Y4FB 1RAMA 4ZFFA 5JOPD 2NZIA 2WK2A 1E4WL 3QG6A 4ZAKD 4DQOH 3MROA 3PXJA 4CADA 2R0ZL 1MFEH 3QEGL 5ICYA 3QG7H 4Z0XA 4PJDA 4PG2A 2D7MA 4CU7A 4EN3A 2R69H 4Y4KC 2A0LC 2DWEB 5I74C 4ZS7H 5J11B 1RVFL 3BSZH 4FQ1L 1FSKB 4D3CL 2IALB 2ZCKH 1GHFH 2DMBA 4WHYG 4JRYE 3ULUD 1OGTA 1P2CA 35C8H 2EECA 2GW5A 4LEOA 1II4E 2EE9A 2DYPD 5J8OA 4P5MA 2JIXA 1IJ9A 3OAZH 3J8F7 3KYKL 2AEWA 2I27N 4PV8B 4WJ5B 5HSFA 1K8IA 4HWBL 3MRRA 4W4OC 5D1XA 1DSFH 1NBZA 1KTRL 2CUIA 2ZOKA 2BMKA 3JV6B 1T7ZA 4QTIL 1G6RA 2DQCL 4PPTA 1CL7L 3FO9B 4EZMA 2CKBB 1U9KA 2NY6C 3MRLA 5DVNA 2XXMB 2X89A 4QOKD 1CFTB 1QSFE 3TVMA 2IANA 1QKZL 2R0WL 4EUPG 4S2SA 3PQYD 3S37H 1VGKB 4IRSA 5F70A 3HFMH 4XCYB 5DGQA 2BXZA 5JOFA 1JUFB 4R90L 1IM3B 1JGDB 1YEFH 4P59L 1KC5L 1RIVH 5I1EH 3M8OH 4O00A 1CXHA 1DBJH 3V5KA 4JFXB 1NUNB 4UZGA 4YAQB 4N8VA 5HHPA 2Z4QB 5TE4L 4MXQD 5HHVL 5IVXE 1EMTH 5E24E 5DHYA 4JVUA 3NZHL 4JRYB 4R7NB 4G6KL 4RISL 2AI0H 3RUGA 1Q38A 3BUYA 4X9IA 1MRCL 2R2HA 1DQMH 2H2PD 5I8CB 1U6AL 1FL5A 4RNRA 1A7PL 4WDIB 1EBPA 3KPRA 3FHAA 4YHOL 4YDIL 4ELMF 1C8PA 3E1F1 3VFTA 4CVZB 1TZGH 2WP3O 1ORSA 4WWKD 5FUOL 3QI9C 4K2UL 5JTWA 3CZFB 4L5FH 1DL7L 4Z95H 2FL5A 3O6LH 1PX3A 2GIYA 3BD5A 4I2XE 4HJJL 4XNQA 4WWID 4Y4FD 2RB8A 1QSFB 5IBLC 5H94B 5IW1A 1T4KA 3LKPB 2OR8A 1VKXA 1YN7A 2W0FA 3VGGA 4D9QD 3O11A 3V6OC 1IC4H 2IAMA 1OL0A 4PRPB 1C08A 3BE1H 4FQXC 1XT5A 5D5MA 1MAKA 4I18B 4WV1C 2YUZA 4OZHB 3FO0H 2VLME 1SJEB 2Q8AH 1AE6H 4Y5YB 5FGRA 1G7PA 1VFAA 2F53A 1CDUA 4KQ3L 1UCTA 1T0NB 3DX7B 3L95B 1EUUA 3P40A 1MRFL 1CE1H 1X5AA 2EXWD 3GSNH 4NUGL 4CMMA 2V2XA 2V7NB 4FS0A 2FATH 4G7YL 2NMSA 3T4AA 4E41A 1MCQA 1CLZH 3HC3H 2EDJA 4QRSA 5KANG 2BDNL 2DTSA 3TM6A 1GRWA 2KZ1B 3LCYA 2E27H 3CD4A 3E6HA 1YMHB 1UENA 5EU3B 4Q9QH 1UH2A 5BJTB 1CFQB 3UJTH 4Z7UF 1MCSA 3VXUE 1NBQA 3G6DH 4WW2A 3ZHDA 4F33A 2HKHL 1NFIB 1J11A 4HUXB 5BV7L 2WWKO 4G8EA 4EKXA 1PY4A 2BY0A 2PXYB 4B41A 4V1DA 1J5OL 3KPSA 4J3VA 4I2XB 1OP9A 4QHUA 3ULVL 3R0MA 3WN5A 5ADPL 1P4LB 4GAGH 1J05A 2YA0A 5E1AB 1BD2B 3AS2A 3T2OA 4YEEA 4OV6F 3B9KB 3Q3GB 5AZEL 4GMTL 4LSUL 2RAMA 2I5YH 1X3DA 2XKUA 3SDCB 3VWJD 2A6IB 3D39A 4A2LA 3NCJL 3V4VL 3MSPA 2R9HC 1KCUL 4PJIE 1KB5B 3BPLC 3MOBH 1B0RB 1LO4H 1YJDH 4HKZB 5TQ0H 3FQNA 1OTTC 1YJDC 1FNSL 1JNNH 1R3JA 4ORGB 4PJGA 4UILL 2DQJH 3JZ7A 4P9HL 5JZ7C 4YHYC 3IS1X 3VDAA 4ZMAT 1NGPH 1RUPL 4YX2L 5KSUA 3P4MA 1HSBA 1J10A 5FA3B 1R0AL 3U7WH 3BZFA 4GBXC 1NMCB 3ZSTA 3L3GB 4FXKA 1BLNA 5HGDB 4HF5H 2J88H 3P0GB 3D18B 1W8NA 4HAGA 1OAQH 4RFNB 3VXUB 2E9BA 4MAUH 3DXAB 5ESQB 1UB5A 5FGBA 3G5ZA 3MNVA 5F96L 4WFHE 4TPRL 1AGEA 5GJTL 3DROB 5CWSA 1FZOB 3U0PB 2FX8L 3IDJA 1ZTXH 2B0SH 1PG7H 4RFOH 3BI9X 4ZXBB 2JJUA 4S1QH 3WDIA 3QHFL 4NSKB 4LSSH 1ITBB 2V6HA 3PP3K 5FIEA 4PRPD 5ID0A 3JTTB 1VCAA 5IESH 2UZXB 3ECBB 5GGTH 2F74A 4QRPE 1SYSA 4F15B 2UYLB 1GZPB 1S9WA 3FAWA 4OUOA 5KS9B 4LAQH 4LHUG 2YWYA 4PJ8B 5F72S 1HWGB 3IXTB 1BM3L 3O6FB 2PTTB 4GG8A 1AO7A 2AV7B 3S35L 4D0DA 4MB5A 4HPYH 4UAOB 4HDIA 5D1ZC 5E1HB 4FFYH 5F88A 3VXRE 15C8H 4MAYB 5JIIA 3HR5A 1YEIL 3UTZB 4ZUUA 3NIDE 1E6JH 1I7TA 5IOPB 4LNVA 2FZ3A 4R97B 3DVGA 1J1OH 4NYLB 4DKEH 3TBYB 4O2FB 3HE6C 4Z7VF 3WCYA 5JMRA 2RR3A 3PF2A 4K71C 1LE5A 4PP2B 4HG4J 3FMGH 2FIRT 3EJZD 4FZ8L 4YHKL 3FTGB 4HX1B 4I48A 1OY3B 1VHPA 4IBLT 5DI8A 3LY6A 3QZWA 3MRFB 3TNNA 1OT2A 3VXOB 2ITDB 5IUSA 1BD2D 4IRJC 2EDWA 3MV9A 4PJAF 1KYOJ 5DJ0B 1T5XA 2IQ9H 3B9KD 3N85H 4MQXC 3I6KA 5TH2A 5CJOL 4DFHA 2EH7H 1JWUA 1ZLWK 1Q9OA 2X70B 4HFWA 5A2FA 4QY8A 3EFFA 5EB9A 2WUCL 1CD8A 3OF6A 5CJXC 2XTLA 4QRPB 4D9RD 2P42B 3H7BB 2OP4H 1BIIA 4YHLH 1XGPB 5K93A 2VSCA 4JR9L 4MA3B 2IH3A 2V5MA 3VD4A 2QTEA 1DN0B 4RAHA 1BF8A 4Q9RL 3ZHLA 4NN7B 1F11B 1NMAL 3EOAB 3UBXI 2ZPKL 4O02H 2HP4A 3HAEH 4YDVA 5H35A 1V8HA 3ULSB 1W0YT 5JNYB 2P24A 1A6PA 3RWHA 4Y4HD 3S36X 4WHTA 1LO0L 4MLIA 3X12B 3FQUA 1C7SA 3DXAD 4X7TA 2BVTA 5M94B 4LCWB 3RX7A 3FZUC 4Y19E 3OQ3B 4MDJA 3B8YA 2QSQA 1QBBA 1ZHKB 1R3LB 4DGIH 5AG9A 4U1MA 5KG9A 4ZXBD 3CFEB 1P5UA 2BRRL 3SQOL 3QXDB 1XF4B 2BY3A 4TUJB 2PW1B 1M7IA 5F1IB 5F7EL 5HYJE 1WIUA 1Q0XH 3I6LE 4XAWH 1AXSB 3KWWA 1PZUB 3NH7H 4Q9BA 4R26L 2W60A 2YN5A 5F89A 4OV5B 4PJ8D 2MTPA 4ONGH 3HR6A 3K46A 3KPOB 4QCIB 4DN3H 3BWAB 2VABB 3SKNB 3V7AE 5EZOH 2IGFL 1NCTA 2DQUL 1LP9E 4MAYD 3FOLB 4NP4H 3BQUC 1ZKAA 2R2EA 4XP4H 3QUYC 4Z77A 1NEZA 1ZOXA 2BVEA 1BGXH 4LKXB 3HPLA 4KH2A 3K1DA 4LCCB 1AD9A 2AEQL 4KGLA 3OKOA 2K1MA 1DUYB 3C5ZC 4UDTB 2ERJB 5I30L 3RVXC 2HFGH 1BBDL 2HMIC 2J4WH 2AW2A 4H8WH 4H8WC 4OM1L 2BCKB 2LTQC 2XRAH 4KRPB 5DMKA 3VFWB 4X6CF 5C0EB 2CIIA 2V2WB 5B22A 1KJ3H 1NC4B 4TTGA 4XC3H 5BVJA 4LPYA 4TVSa 5D7JD 2DLGA 2UVEA 3VD5A 1RK1B 3TA3C 2WBJB 1XF3A 4OCSH 5JORA 1ADQH 3QCUL 2XZCL 2ZOLB 5HI5C 5CZVL 4QWWC 3NIFF 3FCTA 3IJHA 4Q74A 1N6VA 5HYJB 5E8OB 5EBLB 4IJ3B 3LRSB 3CSPA 3K81A 4YDKL 4OT1H 4KTDL 2HJLB 3MR9B 2OR7A 4OUUB 3HZYB 5DYOB 4EDWL 4WI2A 1OAYL 4XMLH 4C59B 1AD0A 3ROLA 1QLRA 3VG9C 5I1DA 1BVKB 2UUDH 5CGMA 3H0TA 5D8JH 2C5DC 1EHLL 1HCVA 3VMPA 3MCG1 2BNQE 1Q9LB 3WLBB 3VXPB 4U1GC 1T3FA 1OTSD 1TJIH 1XIWA 1KJVA 3QRGL 5I17B 1CFNA 5D6DC 5IG7B 4U6VL 3QSKB 4DKFL 3EIFA 1WSST 1WT5A 4LCWD 3TJHC 2ADJA 4JREB 1MWAA 4YQXL 3VRLF 3ULVE 1MUJA 4JPIB 4G8GB 4PJDF 3D9AH 4YE4H 1GZQB 3QP3A 2VDOL 1LK2B 4PGBB 3O3BB 1RIHH 4X5XA 5DFVC 5GGQL 4ZFOA 1QP1A 2EXYC 2GAZB 2OZ4H 3CVIH 5DC9B 2X4TB 3WFZA 2ZZUT 4JPKL 4YIQB 2EDYA 3SDAB 5ESAA 3MBEB 2GK2A 1BWWA 2WV3A 3QRFM 2C3VA 1SVCP 5IFHL 5DT1H 2PKDA 2PW2B 3MPCA 4AENB 3FT4A 4JQVC 4MA7H 3T2PA 1JYXA 5EPMA 1ZA6B 2ITCB 3VW3H 2BFVH 1IQWL 4J4PC 1MCNA 3MYZA 3AB0C 3UTPE 3T0EA 5IM7A 3TP4A 5IMOB 2EIZA 1T1ZA 2CLVA 1E0OB 3RY4A 4PREB 5EOCJ 5FM4A 4BM7A 1IAKA 5DD6B 3WS6A 1EDQA 4OBSA 1EEQA 3Q6FB 5GS2D 4NQUA 2VLJA 1T66D 4QHNB 3NFSL 5JDSA 4ZYKA 4KRPD 3MUHL 4J3SA 3W9DB 4PR5B 1V7NL 2H8PA 2VXTL 1E4WH 4X8JB 3QEGH 3WL9B 3ZHKA 3UTTE 3D0LB 1GXEA 4IEFB 2YD1A 5MEOB 5L9DL 3NACL 1MNUH 3QUMB 3AROA 4HH8A 4MA8H 1RVFH 2EH8L 5HVHB 3D3VA 4FQ1H 2PCPA 4GRLA 3OKEA 4AEEA 4CU6A 4QHLA 4D3CH 1IAOB 1PAMA 1NFDE 5ENWB 1JBJA 4LRIA 1FO0B 5D7IE 1HE7A 1IBGH 3BN9D 1RZ8A 2DJUA 1ZHBB 3UTOA 1NQBA 3KYKH 2P7TA 4M43L 4HWBH 4LP4A 3T8XB 4KKBC 1HYSD 5LJYH 1LD9A 1ZHNA 4JY4B 4HBCL 2DBLL 4QTIH 4R4BA 4DFIA 5JXEA 3S98A 4F7TA 1FNGB 2JLLA 3WIHL 4NUJA 2WSKA 3GKZA 5HI3C 5JXAH 3O3UN 2FJGB 3HNSL 1NDMB 3PGCA 1BZ7B 1JYWA 3CXDH 3LN9A 3EYUL 4QNPE 1WZ1H 2C3WA 3ZYJA 4O9HH 5D72L 1W0VA 1IGML 1S7QB 4M6ML 1A1NB 5A16A 2VITA 1QKZH 2R0WH 1OSPL 1I3UA 5D9SB 4G8GD 2BOCA 2CO7B 2E7HA 2G5BB 5BS0A 4FFVD 3DMMC 4MQSB 4Q58C 5FM5O 1DQTA 5BMFL 1XR8A 4NO0A 5I75C 3LH2L 3UTTB 2MPAL 2C3GA 3CCHA 3SDAD 5D5MF 4KRNA 3GJEA 2FJHA 5TE4H 5FYLD 4OCMC 5HHVH 1YC7A 4PGZA 1SY6L 5C71A 1LVEA 3NZHH 4L8BB 3QIWD 4RMWA 5D7IB 3NA4A 3SJVA 4G6KH 3NCYS 4PJ7A 1MRCH 4LFHG 4FFZL 4NO5A 1QPXA 4RMTA 5I1KL 3ARDC 4BFGA 4G80B 4L3EE 3D85A 5F6IC 2Z35A 3VFNA 5EU6E 2X41A 5DJ8A 3NPSB 4PLKC 1A7PH 2ZUVA 2W0LA 1EXUB 4KJQC 5FGCE 3TWCL 2GCYB 5C09E 4C55A 4KKAD 3NBNA 5L2KD 4U6TA 5FUOH 4WW2F 1NAMA 4K2UH 2Q3ZA 5HI4D 1DL7H 3NCMA 4O2EB 3W39A 4IOSD 4GAYA 4X6DE 4P2QB 2FLRT 2OL3A 5GSVA 4XPBL 2EO1A 2V7HB 5D2NE 5B4MC 2MMXA 5FK9B 1G9NL 1XGUB 4E9LA 3EOTL 4NRZB 3TFKC 4BKLA 2NXYC 4S1DC 1T0MB 2Y6SD 5HGHB 3GO1H 5CEYA 1GIGL 2BNRB 4JCLA 4PJCE 1A6ZB 4XCFL 3T65A 3IETB 1M7XA 2X7LB 4LL9A 4LVHB 2X42A 1CD1A 2C26A 2NYYD 4NQCE 4DEPC 1KN2H 3DRTB 4AM0A 3OKKB 4KQ3H 1X44A 2CK0L 2ZSWA 1MRFH 4M7KL 2Z93A 4KJPD 5CEXA 1HXMA 4G7YH 1KNOB 4ZUTB 5GISL 1CR9L 1UZ6E 4H1LH 1I9EA 1WJ3A 3HC0B 4L3EB 1I9RL 2R15A 5HVFB 2BDNH 4PJXB 5EU6B 2NXZC 4M7LH 5DHXB 4Z0BH 4JN1L 5C09B 4DOHE 3HZKB 3CNKA 2H1PL 3NZ8B 1FC1A 3QR2A 2Y1VA 1A4JA 5BV7H 5BV7C 2PYFA 1AGBA 2HFEB 3SCMC 3P77B 43C9A 5TF1L 3RVVD 1J5OH 1JZ6A 5EO1A 5IIEB 4NNPL 3QNZA 5MEPA 5FUCE 1JNHA 4LARL 3ULVH 2YK1H 32C2A 4AIZB 3ULVC 4HIHA 5ADPH 2P49B 3PXHA 3ARFD 5IB3A 5D96C 4PS4L 4R2GB 3MRQB 4JFEE 1F5WA 2BSSB 2DL9A 4WNQB 4ENED 1I8MA 2VQUA 5D2LB 3MV7B 2ICES 3CH1B 5AZEH 1J12A 2V2TA 3OKMA 4HIJB 4GMTH 5CZXC 4LSUH 3U2SA 1TETL 2UVFA 4XVJL 5JUEL 3R1GL 1G7JA 3T0WA 2WZPD 3NCJH 3V4VH 4M8VA 1KCUH 5T1KD 2E5EA 4IS6B 4WU7B 5E6IA 4J3WA 1H8SA 2RCSH 1CXLA 2YD6A 4CNIB 1MJJA 1FNSH 3QT2A 4UILH 2DLTA 1NGXB 4I0PC 4U1NA 3QXUA 3SN6N 3V5HA 1TZHA 1RPQA 3WIFB 4P9HC 5CJ8A 3HNTH 1RUPH 4YX2H 4GRMB 4PTTA 1R0AH 5LGJB 2VYRE 1ZLSL 1OPGL 2BVQB 4N0CC 4U1HA 1RJLB 4G8IA 3NN8B 4P2QD 5DUMH 5I1LB 3AMKA 3LRHA 1UZ8B 5F96H 1DBAL 1I8IB 4TPRH 5GJTH 3MJ9A 3MODH 1U8LB 5JLZB 2FX8H 2G60L 2BJML 3PDGA 5GHWL 3QHFH 4HCRL 3DRQB 2BNRD 4NFBA 5TQ2L 4Z7NF 3T09A 1XF2B 3P30L 3RNKB 2FR4A 2NW3A 4K7PX 3QA3B 1R5WA 1XGQA 2EC9U 3PGDB 2ILLA 4J23A 4CW1B 3HB3C 1WITA 4FXGB 3CFJB 1C5BL 3MRNB 1BM3H 3JTSA 2J7LA 1Z9LA 3FONA 5FO7A 5AEAA 1EV2E 3IFLL 3V8CA 2ID5A 2AK4D 2HTKC 1CXEA 4KZDL 2VLLB 1ZWIA 3LAFA 2I60L 3BT2L 2BOBB 1M71A 2FEEL 3MRBB 4FQCH 5JHDE 5EU6D 4OZGA 5F3BB 1KPVA 5C0DA 5A43C 1AGDB 5IW3A 1KTLB 4ZFGH 5E5RB 4GG6A 2AJYL 5BW7A 1ZAGA 2W9DL 3GSOB 3L9RB 3ARWA 2ICEB 4L4TD 3G04B 3OAYH 1R3KB 3DIFA 4RAUA 4HWNA 3KGRA 5EUKA 1FCGA 4KROC 4FZ8H 4YHKH 3RBGA 3DSNA 2AGJL 2I9LA 4M9PA 1SJHA 5EUOA 3GFUA 3FT2A 4NKDB 2E6PA 4U0RB 1D5ZA 2MJWA 1MHHA 4R2GD 1X7QA 3MZTA 2DF3A 2HTLC 3KLAA 3QDGB 4HFUL 5SV4A 2AQ3A 3MV7D 4P5KA 5CJOH 3UC0L 5L0QB 3DUUA 3EJYC 2XN9A 3CPLB 2HT2D 1SBBA 3DV6B 1BEYL 2WUCH 3GBNL 5CMAB 1UM6L 1KLUA 2A38A 2AJZB 5DTFB 1HHIB 5EORL 3UXFA 1FNFA 4RGMB 2UWEE 4MQTB 4JR9H 4K7PY 2CKNA 2Z31B 2R1YA 2GKIA 2M26A 2PUQT 4TUKL 2VLKA 3BEVA 1BQLL 5F7FA 5KN5A 5CP7A 3S9DB 5C0FA 1K8DB 3RGHA 4NQDE 4Q9RH 1NMAH 5E08H 4DZBB 5JHDB 3GMLA 1F3JB 3S34L 3RWFA 3OR6B 5MI0C 2VXSH 1RUAH 3MUZ1 4PGCB 1LO0H 2E7MA 4QXTB 5CIPH 3RTQB 5FA4B 1VFUA 4NC0B 2IBZX 4QF1A 1DR9A 2GFBB 2WAHA 1J0YA 3P73A 4NQSA 3MRGA 4PRAA 3MRIB 1DQQB 5HDBE 4EVNB 1BFOA 4MGXA 2BRRH 3SQOH 4U1SA 2F54A 5D2NC 5B39A 5HXMA 3G6AB 4WUUD 5DK2B 4HIEB 5ILTH 1KXQE 1QZ1A 5F7EH 4P46A 1DVFB 3AXLA 3LKOB 4YWGL 2Y7QB 4POYA 4R26H 3KXFA 5D7KD 4GXUN 4N0UE 3OJDB 2IPUG 4FABL 4U1IA 4PJ9C 1AQKH 4LIQH 5D7LB 5FB8B 1EUTA 1OARL 4OGAC 3STLA 4G43A 4MCZB 2IGFH 2DQUH 4M5ZL 3DETC 1EZVX 4K94L 4D0CA 2XWJB 2H3NB 4BH8A 2R56L 5DEZA 1MCOL 2QV2A 2BVYA 4MD4A 1TQCC 4XPFL 1FRGL 1V3LA 2AEQH 2YZ8A 2HFTA 3MCKB 5I30H 1NCAL 4LCUA 1QEWB 4X8XA 4OM1H 2E6JA 4ZFFB 4OLEA 3SGEI 5ACMA 4OZFB 3TN0C 1F2XK 4GW1A 5HYQA 2K9UA 4P9ML 1H3GA 4F7EA 1ZSDA 5DURB 1OSZA 4B0MM 3P4NA 1E27A 3SGEH 3QDGD 1QRNB 5FHAL 3QCUH 2IBZY 5ANME 2XZCH 5FUZH 5F7WC 1CCZA 2VR4A 1JWSA 2DIAA 1CE6A 5IP4A 1OGTB 1RU9L 2ESVE 4MJ6A 2FBOJ 5C08E 3HI6L 3GMOA 4Z76A 3B3IA 4YDKH 4KTDH 3H2WA 3P4LA 3ZKXC 1J8HE 3BP6A 2P8PB 4N0UB 3WE6B 4AQ1B 4LSRL 4EDWH 1OAYH 3BGMA 3FO2B 3MJ7B 1E6OL 2JIXB 4TQEH 1K8IB 4GRWB 2Z31D 3MRRB 5DUBA 2WIIA 3PIQA 2BMKB 4X7DC 4QYOA 1HHKA 1FFPA 3HAEG 4F57H 2JJVA 1YEDB 1SQ2N 5FXCH 3FFDB 5FO9B 3JV0A 5EOQL 3S6CA 5DD1L 1EA9C 4PD4J 1QA9B 4RWHA 4KKCC 3UBXG 3VXNA 1RUKL 5CJ5A 5EFIA 1U8IB 5F6HI 3MZGB 5HGAA 1EZVY 1R3IL 1YEKL 2WINA 3HS0A 3GSQA 4DKFH 4S2SB 3RTQD 4PRDA 1WWBX 3R06B 2OXHA 3QCTL 1RULL 4UV7L 1UACL 3MFFA 3OHXB 3TPUA 12E8L 4JFDB 3VD3A 2VZVA 1WQVT 3U82B 3TT1L 1JGVH 1NGWB 5GZOD 4KV5F 5FV2A 5A2LH 1J0IA 3X13A 1T20A 1HDMB 4UT7L 4JPKH 1EVTC 1DANU 5ANMB 1ZT1B 4HJGA 1WBYB 3RGVA 4LVNC 4G6ML 4Q6IC 5DHYB 5IFHH 2NY2C 4N90D 2ESVB 5D7LD 2DMCA 5C08B 3B9EA 4JZJA 3O9WA 3RUGB 3BUYB 3ZE0E 2R2HB 1J8HB 3FRPA 3NIGF 3CFCL 4RNRB 1IQWH 5GSRA 1RZ7L 3TYGL 2Q8BL 5L8JB 4GQPH 2RHEA 4NZJA 4NN6C 4OI9A 1DCLA 5D1QB 3QFDB 3KYMA 1S7VB 2K7QA 1OAXL 2WW8A 3FQWA 3NGBC 5DJZA 4OIIH 2I07A 5BRZE 4ZFZB 3HKFA 4YZFE 3MNZB 4J1UB 4NC1E 1NL0L 2VISA 3NFSH 5EBWA 1G7HB 5C0BB 3WJLC 3FFCE 3DX9A 1QFUL 1V7NH 1N26A 2VXTH 4D8PA 3SGJA 3SOBL 3CJJA 2W0FB 4EN3D 4F9PA 1INQA 3QH3B 4G9DB 1YEHL 5DURD 2IAMB 1UYWL 4U6YB 1T1XB 4WW1A 5CHNB 5IVZB 1C08B 1QRND 4JGUA 2DIBA 3NACH 1HH9B 3E2HC 4L9DA 1J18A 5FYLL 5L9DH 4XH2B 3BOVA 1KPRA 2GT9A 4LLMA 2EH8H 4MXQC 2BSTA 4HMEA 5FKPB 3VFSA 4NQVA 1QBMH 2GK0A 1DUZA 4BSJA 1CG9A 4OFVA 1GGIL 2F53B 1W72H 2H2PC 4LSQH 2H32B 2Q86B 4HBQA 4MXVF 2JIXD 5DQ9A 1QO3B 1X5ZA 3D2UB 4X98A 4CMMB 5MP6L 4PJ7F 1MFBL 4HGWB 5FEBA 1I4FA 5J12C 1A7NL 3UX9B 3MX0A 2HFFA 3PNWB 3QQ9D 4PTUB 3JV4B 2P5EA 2DBLH 4HBCH 2OI9B 2IFGA 5GZNC 2A1WL 4DGVL 4GT7A 4E42A 3IDNA 3TVMD 4PGJA 1QBLL 2BHZA 3EYUH 1KG0A 2AKRB 3B6SB 1G7LA 1KTDA 5D72H 3D6GA 4IRSD 4M6MH 3HRZA 4YHNB 2AXFA 1OSPH 2WIMA 3I2CH 3EBAA 4JFDD 3FFCB 1A3RL 4PJFF 3TGXA 1CGUA 5B3NA 4YGVA 5SWSE 2YPVH 3HUJA 1QR4A 1QR1A 1J05B 2EDEA 1AI1L 2E9IA 1C5CL 2X4RB 4UIMA 5BMFH 4L1HA 1VEPA 3LH2H 5IWLA 5SX5H 2WLZA 3JVGA 3VFRB 3MJ8B 3EDEA 2QKIB 4OD2A 4P4RB 1CTNA 4NQEB 4YBLB 3REWB 2NNAB 3PL6B 3IDIA 5BQ7A 3FQNB 4ODWB 1FL6A 1OGAE 2R0LL 4I3RH 4MZ2A 3K7UA 4PJGB 5C0GA 2MSPA 1CICC 4M6AA 2CKBH 4XBGA 1AIFA 2HN7A 4FFZH 4JFFA 5I1KH 3KPRD 1X5HA 5E4EB 1FJ1A 4A6YB 5GS1B 4YK4B 3PABA 3I50L 1BLNB 4PFEA 2APFA 1KB9K 3TZVC 1EFQA 1YY9D 5C0BD 1JNLL 3G5ZB 2OTPA 3MNVB 4M7LT 1T22A 4D9LL 3BIKB 1JPTL 1NUFA 1U58A 4X4YA 4MJ5A 1G9NC 2IAMD 2A9NL 4KUZL 3EOTH 2CQVA 2VZTA 2BSRA 2B2XL 4Z7OE 5HY9B 1A1MA 1GIGH 4KKLD 3VWJC 4ODBD 4XCFH 4IIQC 1NGYB 2VLRA 4PJ5A 1U8KB 3BKJL 1JHKL 3RKDD 5DHVA 2IQAB 1HCFX 3L3OA 4JQIL 2F53D 4GG8B 1AO7B 3P0VL 1UKSA 4OAWB 3GKWL 4D0DB 3C60A 1QSEE 4F37F 1KXTB 4ISVA 3CFDB 2CK0H 3BPCA 3O4OC 3QWOB 3MRKB 3OB0H 4X6BA 4M7KH 2ZCLL 3SGKC 2MHAA 2NLJB 1YDPA 1DLHA 2APTA 3EHBD 4RMRA 5GISH 4ZUUB 1CR9H 3FQTB 1XFPA 4R96A 5DS8A 3RX5A 2FZ3B 4UBDC 4LSPL 4OFIA 5AD0B 5KBNC 1MI5E 3HE7B 3O8XC 1BWMA 3AS3A 4P23A 1CF8H 3VCLA 4JN1H 5HHQA 1LE5B 3N1GC 2V5SA 1HWHB 2CRYA 2H1PH 1BOGB 2WBWB 3NCYP 4KDWA 4Y8AA 4YBHA 5DK0B 5F7DB 2ENYA 4UUJB 1O0VA 1T7YA 2E9WA 4ZODA 1I1FA 5CEZD 4PRNB 4YNYB 5KSAA 4EDXB 5TF1H 4OM0L 1IEAB 4L9LC 5DI8B 3DBXA 4LCIL 3EYOB 3N1PC 4NNPH 1VA9A 3QUKA 3MV9B 3VXMA 1A4KA 5F7KC 1Q0YH 5GRVL 3PWNA 4I18C 2YMXL 3HN3A 5J1AB 4PS4H 2P5WA 1DZBA 4QRUA 5I1AA 3GSRB 4QY8B 3EFFB 1AKJA 4NQED 1AC6A 5E00B 4ZTOL 3D39D 4U1LB 3TEUA 1CYGA 1N3NB 5IEHA 4XVJH 2VDNL 4YFLI 1T89C 4XGZA 4M6NH 4JFHE 1DQJB 3QO0B 4OGXL 5KW9L 3EAKA 1U8PB 3V7AG 4KI5F 4NNXB 4M5YH 1QSEB 1FCCA 2EICA 2BVOA 2E7CA 2DLEA 5EIIA 4R0LC 2AXGA 5DJ6B 1Y18B 4OZGF 5BOPA 2OMNA 1U41A 1WCBB 3RY6A 3RIFF 4BQBA 4XMKL 1MLBA 4GG6F 3WV0A 3KS0J 1KJ2B 2P46B 1ZLSH 1JIBA 3EZJB 1C16A 1OPGH 1X5YA 3NFNA 5BXFB 4ACPA 2L7JA 3AS1A 4KMTL 4OZIA 1WFNA 3PWPA 3P9LB 1IAIL 4OF0A 4NC1C 5EUOF 1XF1A 1F3RB 3S36L 4Z7QF 1DBAH 2Z9TA 5IT2L 4EIGB 1IGJA 4YC2C 1AP2B 1S78C 1N59A 1RK0A 2BJMH 2Q76A 4HUVA 3EDJA 1M7IB 4EXKA 2DBJA 5GHWH 5ADOL 5CLWA 1NBVL 1S9XB 3LMJL 4NPYA 3VRIB 2CXGA 4C57C 4JPVL 1I1YB 3IXAA 1A3LL 4ZAKA 4HS6A 1F00I 4MMZC 4GW5A 3OKLB 3MA9H 4MMXC 2R2BA 4YXHL 1AO7D 5GGSA 2X9XA 3T08A 1JZ3A 2ORBL 1G7QB 3WLWD 5LBSL 5FCUL 4PJBB 3G5YB 4IM8A 3RPKA 4H1LG 4YHPB 3BP5A 1OF2A 4Y16A 2C1OA 3IFLH 4PB0L 2Y5TB 2GHWB 4Z77B 5DUPL 1CT8A 3BD4A 2I60H 4G3YH 2D4FA 4NHCL 4Y4HC 3HE7D 1U95A 5K9OA 1ZLVK 2AJYH 1K3ZA 3BW9A 1TCRB 3AC0A 3SKMB 1TMCB 2RFXA 2NW2B 1YMMA 3MV01 3QQ3B 5KSBA 2ZKHL 3AY4C 5L8LB 2OR9L 5FOBA 5EU4B 2HAZA 4CDGC 4ERSL 3EO9L 1KPUA 2OLDA 5FAAA 2QSCH 4XBPA 1OB1B 2LU7A 4WFGE 1MCJA 1TIUA 2PYEE 3MV9D 4CL7A 5DGRA 2HJFA 4PY7B 1L0XA 5JIPA 4R3SB 1CLYL 2PO6A 4WUKL 1UXSB 4HFUH 4R4ND 2XTJE 3VDBA 3GB7A 5FYKD 4M3KB 5DMJB 4OJFH 3UC0H 3OF6D 4EOWL 4JG0L 2HWZL 5F7NC 3S4SB 3PGFL 3S3JA 4JAMA 1FPTL 1BEYH 1F4WL 2A83A 3GBNH 3RZCC 1UM6H 5IV2B 1WWAX 4L4VA 3FB5A 4Z9KB 5EORH 1AD0B 4MAYC 2OTWA 5I1DB 1RURH 1OTUD 4TUKH 2W9LA 4U33A 2VSDA 3U0TB 5ITBH 1BQLH 5L2JA 2MQ3A 5LXGH 3F6IA 1CDIA 1SM3L 3NTCL 1Q94A 3C6LC 5MERB 1BZ9B 2P8LA 1T3FB 4ODVL 4YHML 3I9GH 4M61A 3MGAA 1B90A 4FG6D 4H5SB 3BP7A 4MD5A 2X4UB 1ZVSB 1MHPL 1I1RA 1D6EB 5IBUG 2DM2A 3QULA 1PGRB 2ADJB 2B1HL 1MWAB 1IC7L 2W0PA 2VQTA 3ARRA 4JFPA 5D7JC 3F12A 5I71C 4AK1A 4HKXB 3CDGA 2DQFB 4YDLC 4X5XB 1N6QL 5C70A 3ZKQD 2XG4A 2M2DA 4LLDA 2JCCA 4Z78A 4Y4FA 3VXTA 5ESAB 1UT9A 4MVBD 1MCWW 1VACB 3K8MA 3RKPA 4YWGH 3RI5F 1ES0B 1UM4L 5KOVC 3FT4B 1OAKH 2DWEA 4YEFA 5BCAA 4FABH 4NKOB 3ZT6A 4ELME 5JW4Q 4CN1A 1Q9WB 2IALA 5I6XC 1K6QL 1WAAA 4NWTL 3T0EB 2AAVA 3ALXA 4M5ZH 5D71L 1MREH 4H88L 4Z7WF 1OTSC 4K94H 4HUUB 1MCIA 4K94C 2ARWA 4XMPH 6CGTA 1EIBA 4EI6B 1JN6A 1IAKB 1MCOH 4WJ5A 3AMLA 2ZUQB 4XPFH 1FRGH 2VLJB 2AK1L 4ZYKB 3JV6A 3ARPA 4PRIA 2X4PB 1BQHB 1JF1B 2H8PB 3LEYL 1AH1A 1R3HB 3FO9A 4JY5L 2CXKA 2X4OB 4P9MH 1KULA 5EA0L 4Y1AE 1RJYA 2XKNB 4X4ME 1F6FB 3CX2A 3S5LB 2PCPB 4GRLB 3OKEB 5FHAH 4XCYA 4N68A 5JW4R 4QRRE 4XTRD 5ALBL 4CGTA 1IM3A 1E28B 1JGDA 1NC2A 1RU9H 1IT9L 2CPCA 1D9KB 5IR1B 3CFKA 4OGYH 1GYAA 1WTLA 3QIBC 1DN2A 3BD3A 4JFXA 4MSWA 3OKNB 4BZ2H 1MLCB 4LSRH 3LQZB 3VMNA 2DJSA 4MNQE 1CK0L 4YAQA 2P7TB 3O2DL 4LHQB 2Z4QA 1N2RB 3D25A 3EDFA 3DYOA 4MD0B 1ZHNB 3QPQC 4WO4A 3DPBA 3F62A 2F5AL 4JRYA 3U30B 5GS2H 4TVPL 4P2OA 5EOQH 2QBWA 4YO0B 2W65B 5DD1H 1FIEA 1N5AB 2FRGP 2YKLL 1EGJA 5I8CA 1RUKH 1YQVL 4P49A 3C5SA 5A16B 1PKQB 1YEKH 4NN5C 2VITB 4KVNL 1FLTX 5LKNA 1VFBA 1E4KC 1BFTA 3QCTH 1RULH 4UV7H 4CVZA 5BS0B 5JOEA 1C12B 4G6FD 1UACH 2EDQA 4K9EL 1V05A 4Z18A 4NO0B 3ARTA 5C6TH 5IHLB 3CCHB 3M1BB 4Y1AB 3T1WA 1QSFA 4WU5B 1H5BC 4FNLL 3U7AA 5LVEA 1MPAL 4LLQA 2DLIA 3LKPA 1CU4H 2FJHB 1MCPH 1F97A 4QRRB 4U6HB 4NHUB 4IRJA 3BN9C 4G6MH 1CDHA 1H3UA 3OAUL 5CFHA 2DQEL 4PRPA 3QUZB 1G6RL 2OTUB 3CAFA 1QTYT 5CJXA 3T0ED 4OZHA 4MNQB 1JZ4A 1SJEA 1MFCL 1RZ7H 1HHJA 3P9MB 5I76B 5IVXA 1RHFA 1T0NA 3WO3B 1R5IA 3DX7A 3L95A 3LB6D 4NT6A 3T0DA 3J7HA 1G0DA 3WS3B 2V7NA 2VLJD 1C7TA 1AHWB 1KCVL 5C6WH 2EEDA 5HD8D 2P43B 2HJKB 4OF3A 3EO1A 1NL0H 3NABL 2YD2A 4FFVC 2OL3B 3KR3L 3VGBA 1YMHA 2R1WB 2QADB 3C2AL 5EU3A 1T0PB 3X3FH 1CFQA 3NCCB 3VGAB 1KCKA 2G5RA 4L4JA 1NLDL 3HUJF 4AMKH 1JK8B 4WEMB 5E6YA 4XCCL 2EC9T 5HHXH 4IRZH 1NFIA 3SDAC 5EU5B 2NY4B 4K07A 4HUXA 2IBBA 1UYWH 1KGCE 5CEYB 1Z3GL 4XCNB 1FG2A 3D3VD 4GRLD 2PXYA 2B39A 4EUPB 5FYLH 1PSKL 4I2XA 3T1FA 1QRKA 3RPIB 4RDQF 1LO3H 1D5IL 1IL1A 3LS4L 5JQ6L 3QIWC 2XTJC 4HUWA 1JRHI 5E1AA 1BD2A 5DD0L 3C87A 2CUMA 2E8ZA 1GGIH 4PB9L 4AM0B 3H9ZA 3B9KA 1FGNL 5T33H 5E7FA 4K8RL 5MP6H 4ELKA 4HG4K 2A74B 3DYMA 1MFBH 1CGVA 2J5LC 5C07B 3BISA 2GJ6E 4Z7VE 3L5XL 3SDCA 1JRHH 3WO4B 1JTPA 4ZNEE 5I16B 4KKAC 1CD0A 1UH4A 1KB5A 1NKRA 5DJ2A 4YPJA 4HKZA 2Y06L 2VO5A 4ZPTB 5HI4C 1KYOK 2OQJB 4EI5B 3EGSB 2A1WH 1QLEL 1QBLH 5AZ2L 3WKNA 3F7RA 4PJAE 5FA3A 3E8UH 5BS0D 3L3GA 2I26N 2Y6SC 1A3RH 4HIHB 3QHZL 3D18A 4NO0D 5IJKA 1AI1H 3VXUA 1C5CH 3DXAA 5ESQA 3W81A 1SMOA 3DROA 1FZOA 5C0JA 4PGDA 4QRRD 5I1GL 4ZXBA 3LDBB 3GMRB 1G7JB 5TDOB 4N9GB 4YDJB 1G9EA 1UWGL 1RMFL 4Y2DB 5GGVL 3JTTA 5LAXB 3OJVC 4HD9A 2PNDA 3ECBA 2IPUK 1TZIB 3LKSB 5E8PB 2DM3A 5KS9A 1MJJB 3D85D 1DEEB 4PJ8A 1O5DT 4ONFH 1I1AA 1L7IL 3IXTA 4I77H 3RAJH 3O6FA 4PTTB 1VEMA 5CCKH 2AV7A 3HHRB 4OZ4B 5DRNB 1YUHA 3V95A 3I50H 3HMWL 1NDGB 1PX4A 3HMXA 3CXHJ 4J3OC 4U1HB 3CVHB 1FZJB 1YEJL 4P5TC 3UTZA 4X9BA 2J8UE 4CU8A 4JKMA 5IOPA 2AVGA 3ARFC 4NYLA 3TBYA 4O2FA 5E8DL 1JPTH 2WQRA 5ITFB 1I9IL 3B5HA 3ZDXF 1JZ5A 4ENEC 2NY4D 3P4OB 4PP2A 4YPGB 1UWEH 2A9NH 4KUZH 4TSBH 4ZUSB 2B2XH 3FTGA 5T5NF 5CD5C 2FR4B 3BP4B 1YNKL 2NW3B 4HX1A 3BX7C 5KVDH 3UTSE 3B9VA 2IFFL 4NZTH 5J1TC 2YOCA 3MRFA 1JHKH 1X4YA 1DJSA 3ARGC 2ITDA 3VXOA 3GHEH 2D7TL 4JQIH 5DJ0A 2HRLA 3FONB 3E3QE 2VKWA 3P0VH 3UZVB 3GKWH 3AREC 4XXCA 1OP3K 2GITB 2YHGA 2X70A 4LMQE 4LF3B 5C07D 4LRNL 2ZCLH 4QRPA 1ZWIB 1LO5B 1XGPA 3ZKND 2YUVA 5C0DB 4TSAL 4X6CE 4DUXA 4OSUL 3WFEL 5DRXA 4LSPH 5EC1A 2XA8L 3DI3B 1DN0A 1HQRB 3IF1A 2W07A 4OZIF 1CIDA 3O0RL 1F11A 4NNYA 4RAUB 3EOAA 3VXRA 5EUKB 1A6UL 2Q20A 3ULSA 4DK6A 3NIFE 5EUOB 3FT2B 3WEXB 1P9MC 2YRLA 3IDXL 4OM0H 3PWVB 4LCIH 2D3VA 1MHHB 4WFFE 3X12A 3UAJC 1KTKE 1X7QB 3RVUC 4LCWA 5DQDL 1H15B 1KGCD 5BZDB 1TJGL 3UJJL 3D1MC 4X99B 4NBZB 1ZHKA 2FD6L 1F4YL 2ZUXA 2YPLB 2EDTA 3CFIC 4ZTOH 2J1KA 3O45A 2FLBT 1XF4A 3GK8L 4I5BB 2PW1A 4KJWD 4Y2DD 1DFBL 1OW0C 1MOEA 4W6XB 3RJQB 1LWRA 4OGXH 5C0ND 5KW9H 2VL5B 4AEIH 1T6WA 1AXSA 2R1YB 5C9JB 4N5ED 3ROOB 6FABL 4W68A 5CP7B 1PQZB 4OV5A 2Y9RT 3HTLX 3ULUF 4LHUB 4B50A 1QFPA 1NGQL 3OBAA 4TVPE 4X0KB 3RWCB 5F7LB 3LPFA 4QCIA 4LDEB 2D0FA 3BWAA 1IAII 2VABA 3VRLE 2YUXA 2OJZL 3SKNA 3GJFH 2AXHA 4XMKH 1DQDH 5FYJD 4WI9A 4PJDE 1TPXC 4DJMA 2DQIH 3FOLA 5L6YL 4L29B 3VI3F 5KSBF 2GJJA 3WNMA 4JKWA 4LKXA 1IAIH 3U4AA 5DA0B 5C0AE 4LCCA 5JR1H 3G08A 3S36H 1DUYA 3VGEA 3L3DB 1BFOB 3GZKA 2QQQA 4U1SB 1HNGA 3NVQA 4G9FB 1XZ0B 2QQNH 2HT2C 3VFWA 5ADOH 5C0EA 3LMJH 1NC4A 3QG7L 1EVUA 1CFBA 4JPVH 5LCVL 1MCKA 4P48A 4Y19A 3RWJB 2OS7A 3SO3C 1IKNA 4ZS7L 1HINL 2WBJA 3IAQA 3OXSA 3ZT5A 1U36A 2HLFD 1HN1A 4YXHH 2ZOLA 3IFPA 1GHFL 1UM5L 2ORBH 4G43B 4RZCB 5HYJA 5LBSH 5EBLA 5FCUH 3U9UA 3ARBC 3LRSA 1JPSL 2NY1B 1ITCA 4PB0H 2AS5M 2IANE 2HJLA 3CGTA 4IDJL 1CVSC 5DUPH 4OUUA 5DYOA 1FYHB 1D5XB 2DL2A 1TVDA 4MD4B 1LHZA 4X4ZA 5F8QC 4NHCH 3I02B 3BH9B 3S37X 4K7FB 1KEGL 2EZ0C 3RVTD 1FZKB 5E5MB 3SDDC 5HDOA 2A9ML 1ZGLB 5GRWA 3VXPA 2JJTC 1A7BA 4GW1B 4OQTH 4PY8I 2ZKHH 4Y5XB 2HG5B 2OR9H 4NFDA 3OTTA 5C0AB 1ZSDB 5I17A 1VADB 5IG7A 1OSZB 1L9MA 4L8SB 2JCCF 4WFEE 1SYVB 2QSVA 3HFML 4UOW1 1FGVL 1ZXQA 2XN9D 1CLYH 1JWSB 4WUKH 3WNPA 4G8GA 2YPLD 2VDKH 4EOWH 1GZQA 2HWZH 2XZZA 1LK2A 3PGFH 4PGBA 1RIVL 3TBTB 3O3BA 2NY3C 1DBJL 1F4WH 3LS5H 4OFDA 5LGHL 1IM9B 3BP6B 2GAZA 4OCYL 4M1CC 4YIQA 1EFXB 3MBEA 1WAAF 1HK6A 3QPXH 1HHKB 1FFPB 1FN4B 4FXLA 3OX8B 4LHUD 3G9VA 5F71A 2PW2A 3O3EB 4AENA 1I1CA 1SM3H 3NTCH 2HVJA 3O4LE 4ODVH 4YHMH 1DQML 2ZG3A 5EFIB 1MHPH 2BVPA 4M1DL 3HS0B 3JBG7 3GSQB 1UFUA 4PRDB 2B1HH 3MRCB 2AERT 1IC7H 3IJSB 4U1JB 1X5JA 3MGOB 4L5FL 5DD6A 4Z95L 2VERN 5IROA 3Q6FA 4G9FD 1N6QH 2VUYA 5KAQF 3BIBX 1UWXK 4G6JL 5DEFB 2ADFL 4BK4A 2IC2A 5JPMB 5EOTB 4TOYH 1RJCA 1JTOA 4IOFC 5GGSY 3ZO0A 4J8RB 4E41E 4XNYL 3L5WB 4M3JA 1KUMA 4U3HA 4GS7C 3TH3T 4KDTA 4JZJB 3O9WB 3QUMA 3X11A 1NPUA 1T83C 3PWLB 3QUXB 3JUYA 1A47A 1Q1JL 4APQC 1IAOA 1T7VA 4RMSA 4PBWD 2NY7H 5F9WC 1K6QH 2JJSC 1FO0A 3NOIA 3S3PA 5D71H 1S8DB 2R4SH 3GSNL 4V1DE 3KPSE 4XC1L 5T3ZL 5DJZB 5EC2B 3O4LB 5D6CB 3RTQC 4OLUL 3HC3L 3TBSA 4U7MA 2AK1H 5EBWB 3KPLA 4JY4A 4ZFOL 4MNGE 1FNGA 3LOWA 1HZHL 4JY5H 3THMH 1BZ7A 4YHZH 1EHXA 4K3DL 4JG1L 1HNFA 3NPZB 5EA0H 3VWKC 3QDJE 4WW1B 1S7QA 1A1NA 1ZHLB 2GT9B 4LLMB 3PJSB 1KIQA 2FWOB 1JF6A 1OVZA 3HRPA 4AJ0A 4YJZL 4NQVB 5ALBH 2G5BA 2GK0B 2WWMD 2FBJL 3QWRD 5CKAA 5I1IL 4LVOC 3RWGA 1IM9D 1IT9H 1FNLA 3UTTA 3MACH 3MLTA 4NRYB 2ED8A 3QIUB 2O5ZH 5CSGA 2I5YL 4UTBL 4Z5RB 1CK0H 1I4FB 4OZHF 2QL1A 5FYKU 4HT1L 5B21A 2HFFB 3O41B 3M17B 5IVXF 1KXVC 2P5EB 3MOBL 2QR0B 4LNRA 5IKCB 3PV6B 2F5AH 5D7IA 1RD6A 4TVPH 4LLWB 1JNNL 1JHTB 3CLEL 2CR6A 3ZYOA 2DQJL 3ETBF 4HIXH 4E42B 4K3HA 2YKLH 4UQ2A 4OCXL 2IPTH 4PBVC 4G80A 1KTDB 2E7LA 4CRPA 4H0HB 1AGCB 4KVNH 1F90L 4PG2C 2B5IB 2ZUUA 2AXFB 1EXUA 4EN3C 4MNGB 4ZQKB 3LKQB 2ARJB 4F58L 4QHKI 4K9EH 4UIMB 3T0XA 4K9EC 4O2EA 4Q0XL 3KJ4C 4P2QA 3QDJB 3UYRL 1IAIM 4HGMA 3QAZC 4FNLH 1ZTXL 1PG7L 1KEML 1MPAH 2IBGA 2V7HA 3OSKA 3DNKA 5FK9A 4QO1A 2R2CA 4KMLB 4LSSL 1PG7W 1XGUA 4NRZA 1I3GH 1T0MA 1UJ3B 3O9WD 5D1XC 4XRCB 2BNRA 1FL6B 3OAUH 1A6ZA 2DQEH 3QUXD 5DFWH 2IJ0C 1G6RH 2VMFA 3LVEA 4GQ9L 3QQ9C 3IETA 4XBGB 3DYPA 1AIFB 1F6LL 5HPOA 1FJ1B 5C9KA 4MA1B 1MFCH 3MLXL 3VI4F 5B8CB 3TVMC 2OSLB 3DRTA 3VRJA 4C54A 3TNMB 5D70L 4IRSC 2DQHH 5GRZA 1D7FA 1IVLA 1KNOA 4WY7L 4ZUTA 3ZDZE 1KCVH 1V5JA 3MUJA 1UQSB 4HMCA 3D69B 4OCRH 3HC0A 4L3EA 4PJXA 4QGTA 5EU6A 3KR3H 3REVA 1X6LA 1FAKT 1U58B 4I0CC 1WIOA 5C09A 3HZKA 2BNUA 3NZ8A 3ORJA 4XCCH 5F9OL 1WVZA 5F9DC 4XP1L 1Z3GH 4P2RE 1MCRA 4FN0A 5HYSG 4X6DA 3PP3H 1XGRB 4OIBA 4OBRA 5IIEA 3U79A 4ETQB 1D5IH 5F9AC 4AIZA 4Y8DC 3LS4H 3L3OB 3BJLA 3DX8B 2WM0A 4KVCL 4C83A 1U2CA 1S3KL 4XHJC 5FHBL 3T0VA 4ZD3L 3MRQA 1K3IA 2AEIT 3QIUD 2FB4L 4ISVB 2BSSA 4PB9H 4WNQA 1FGNH 5T1DL 3VG0H 5D2LA 3MV7A 3EUUA 4N0YL 4XNZB 3CH1A 5KS9F 4K8RH 3SE3A 4PJCA 2CIKB 4K8RC 1BREA 1YDPB 2OP4L 1DLHB 2EDFA 2HLAB 1A6AB 3L5XH 4UB0L 2I24N 1U3HB 1NAML 3ZTNL 2P5ED 1H8NA 3V6ZA 3MOAL 3RVWD 5DJCB 4IS6A 1R5VA 4PG9B 4P2CG 4WU7A 3V0WL 4NQCA 2Y06H 2ATKB 4CNIA 5CSZA 1JHLL 1REIA 2GSIB 2MFNA 4M48L 1WBXA 1QLEH 1ZANL 4O02L 5HHME 5AZ2H 4FA8A 3WIFA 4XBEL 1I1FB 4U7KA 1BF2A 1BFSA 5KSAB 5J89A 3Q48A 4DZ8B 3BKCH 3KPMA 5LGJA 1TQBC 4XWGL 3QUKB 3LD8B 4XX1G 3W9EA 3VXMB 1A4KB 2BVQA 3WNLA 1RJLA 3RQ3A 3NN8A 3QDJD 3BDBA 5I1LA 5F21B 3KPPB 1UZ8A 1I8IA 4P2RB 3RDTC 2MNUA 1U8LA 5JLZA 3C9NB 4AZ8A 3V0VB 4Y4KB 5I1GH 5I74B 4X6EB 3IFNL 3DRQA 5DSCB 1Q0XL 5IHUL 1UWGH 1RMFH 1JGUL 3F5WA 3NH7L 3QO1B 1XF2A 3RNKA 4JFEA 2Z91A 3CH8A 1DBML 4JFFD 4UOW0 1A8JH 3MLSL 4ONGL 4QGYA 1AXTL 3EYQD 1T04A 4CW1A 1GPOL 4FXGA 4WW2C 1L7IH 3CFJA 1QVOA 4OLXL 4KK5D 4JVWA 3HMWH 1UVQB 5CEZH 4K3JL 2G9HB 2VE6B 4XPHH 3KJ6L 4L8CB 3WN5C 2JB6A 3MRBA 1YEJH 2BOBA 2BY2A 5F3BA 1AGDA 4N0RA 5E8NB 3T3ME 5CILL 5E8DH 2X09A 3KLSA 3GSOA 3L9RA 4H8WL 4EQ2A 1I9IH 3WNKA 2ICEA 5DXWA 3HA0A 1R3KA 1KBGL 2DB8A 4KKNA 3R8BB 2NX5B 1N8ZB 3OZ9L 3V6OE 3LN5B 4TN9A 4NKDA 2IFFH 2R2BB 2YR3A 4HW6A 4OCSL 3BJ91 1P7KB 4WEUD 1ZE3C 5GGSB 3C60D 4B5EA 3QDGA 5E4EC 3CPLA 1M6OB 4Y16B 4C4KT 4LRNH 1RZIB 1FQ9C 3Q0HA 1NCUA 2V5RA 4C58B 4BQ8A 5DTFA 5T3ZE 4WTXA 3QDHA 4OKVB 1U95B 2VR9A 1BAFL 4TSAH 4OSUH 3WFEH 5D8JL 5FGBC 5E94B 5FDWB 3BW9B 3SKOB 1FNHA 2XA8H 1I3RB 1HSAB 4LFHD 3MJ9L 5T3XD 2ADIB 4NO3B 1Y6MR 3ZDYE 1K8DA 2LVCA 1CBVL 4JGMA 1MH5B 2MQCA 5KSAD 3EFDH 2YBRB 5MHSE 5FOBB 1A6UH 4F3FB 5IMLB 4DZBA 3QI9B 5JHDA 1F3JA 3OR6A 3VXMD 3IDXH 2FH6A 4KK8C 4RRPA 4WIQA 4PGCA 4OF8A 1NJ9B 2P5WD 5M7QA 4QXTA 2PO6B 5FA4A 5ICZB 3BZ4A 1MQKL 1AKJD 3E0GA 3GB7B 2APVA 3D9AL 4YE4L 1TJGH 3UJJH 1U8HB 1VFMA 2FD6H 3FQRB 1F4YH 4Y4KD 3MRIA 2A83B 1BIHA 3OJMB 5DK2A 4L4VB 3FB5B 4FQXB 1GGCL 4HIEA 4MQ7B 1DFBH 4LEXL 5C0CE 2W0KA 1Y6NR 2FGZA 2EE6A 1DVFA 3LKOA 4H0GA 2XI9A 2Y7QA 3ARXA 4LPUA 3AFLA 4P3DA 1NGQH 2P8LB 1PYWB 4GKZB 4AYFA 2X1XR 4M61B 4UT9H 3K74B 3GSNB 5FB8A 2BFVL 4YFEA 2AJ3B 2XY2A 3GUTB 2OJZH 5F3HB 4UT6L 2APXA 4MCZA 4X7SL 4KTEL 2APWA 4OLVH 3W5NA 3TO4C 1AR2A 3PWPD 5L6YH 4KV5E 2XWJA 2H3NA 2J3SA 3F12B 3WIHA 3FN9A 4BQCA 4NJ9L 4R4NC 1QEWA 3MC0A 5FYKH 1I7RA 1KCLA 2BX5A 1U0QA 3VXTB 1MCFA 3UZEA 4U3CA 2NX5D 2YEZB 4OZFA 5E5UB 3KDMB 5LCVH 3B83A 1FORL 5E03A 1MNUL 1HINH 4MA8L 1OTUC 1OP5K 1QRNA 1L6XA 1UM5H 1P4BL 1ZK9A 4Y16D 5HHNA 4XAKE 1IBGL 2YC1B 2EDXA 3BPLB 1JPSH 4FG6C 4IDJH 2PETA 4JFQA 4XVTL 1SY6A 4WGVB 2P8PA 4N0UA 3WE6A 1JN6B 3FO2A 3MJ7A 3TJEL 1ULVA 1FVDB 1Q9KA 1K2DB 5ERWB 3MV8E 4YHYB 1KEGH 1CDGA 4KGJA 2C3XA 3OKYA 1CDJA 4PRIB 1YMMD 1YEDA 2A9MH 3FFDA 5FO9A 1F6AB 4GBXB 5JXAL 4MJIB 5ESVB 1QA9A 3CXDL 1WZ1L 3LQMA 5F1NA 4O9HL 1RJYB 1U8IA 3TZVA 5HJ3B 2WP3T 3OGCB 1MY5A 2C1PB 5DK3A 4EXPX 5B38G 4MVBC 2PO6D 2BERA 4GKOA 3GIVA 3R06A 3SJVE 2IEPA 4NGHL 4MXVE 1FGVH 5EZLB 3OHXA 4JFDA 1NC2B 3DGCR 1LEIB 3RHWF 1NGWA 2V5TA 3CFKB 4S1SH 4ZOCA 4L4VD 4FQXD 1JGEB 1LEKB 4MSWB 5LGHH 4JANA 1HDMA 4OCYH 1OQXA 4G6AC 5ANMA 2K7PA 1ZT1A 3D25B 4PP1C 4I9WD 1WBYA 5KTEL 4X80L 4WO4B 3FOMB 4FQJH 2ESVA 3HG1E 3QDME 4P2OB 4POZC 3SDYL 5C08A 5J0BA 5D1ZB 2BC4A 4FTVE 3DECA 5SWQB 1J8HA 5I73C 1GCFA 2ZP0T 4PJFE 3BGFC 2ZSVB 5ECJE 3UROR 3C5SB 1EO5A 4M1DH 5I8EB 4M6OL 3MV8B 1VFBB 3MRMA 4XWOC 5EN2B 4LQ1A 3QFDA 4GJTB 5D1QA 1S7VA 3O8XA 3WIIL 3HE6B 1U92B 3IDGB 1OD7A 1J1XL 3FRUB 4K71B 4ZFZA 3MNZA 5DO2C 4J1UA 5FYJU 1H3WM 4X5WB 4JKKA 5JPNA 2FGWL 2BXYA 4XTRC 1G7HA 5C0BA 1IGFH 3KLHD 4G6JH 4JDZB 2ADFH 4E0RB 4O4YL 4MX7B 4LLQB 2WWKT 3RWIB 4L3AA 2FO4B 5HYIA 3TCXA 5DWUH 4IRJB 1F3DH 4NKQB 3QH3A 4G9DA 4XNYH 3R8QA 1UJTA 3GO1L 4U6YA 3KPNA 2H6PA 1T1XA 3DUHA 1CVRA 5CHNA 5IVZA 1HH9A 4XH2A 3ILQD 5KSVB 5FKPA 5IB5B 5E2WL 1Q1JH 1QNZL 5I66B 3TCLA 4JHZA 1HHJB 1XIWC 1IEHA 4NZRH 2X4NB 5IVXB 3U36A 1KN2L 4UNUA 1S7UA 2LU3A 5D7IF 5MEQB 1R5IB 4NT6B 1CGXA 3GMQB 2H32A 2Q86A 5FOJA 1QO3A 3D2UA 1EEYB 4XC1H 5D7SL 4MNHB 1MWAH 4HGWA 5T3ZH 1T21A 1MEXL 3V5DB 2FX7L 2DDQL 5I9QC 4OLUH 3K1KC 4FTVB 1IKFH 4ONHB 3EO1B 4EQ3A 4PRID 3PNWA 3HAEB 4N0FA 1JNJA 4PTUA 3DUSB 3JV4A 4MJID 4M7LL 3VJ6A 4Z0BL 1ZT7B 1PJ9A 1SMAA 1HZHH 3K8KA 4J7RA 2VDLL 4XHQA 3UBXB 2AKRA 3B6SA 4K3DH 4QNPF 4JG1H 3NMEA 1FG2B 5SWZE 4BFIB 4YHNA 3T1FB 5F7UA 2YK1L 3FFCA 1IL1B 1NC2D 1MHCB 4HUWB 1ROWA 3SBWA 2FBJH 3VFVB 5I1IH 2X4RA 4HEME 1WLHA 4HCRA 2VB5A 1MY7A 3FJTA 3AGVA 3VFRA 3MJ8A 4ELKB 2QKIA 3U6RB 4P4RA 4NQEA 4UTBH 4HT1H 3AVEA 4TULL 4WO4D 3LB6C 3REWA 1J87A 2FHFA 2NNAA 3PL6A 4JRYD 1AY1H 4L3CB 5DJ2B 1BBJA 4P2OD 4MDIB 2DI9A 1S5IL 5D1ZD 4ODWA 3ES6B 5L7XL 2RCSL 5HD8C 3CLEH 3BQUB 1R24B 3QUYB 1KELL 2F58L 4OCXH 3VFPB 1I7ZB 4WTZA 3MV8D 3HNTL 4A6YA 3VGFA 5GS1A 4PJXF 1K4CB 4EEEA 1F90H 3UDWA 2UZYB 3DTXB 3C5ZB 2C4XA 1EAJA 2MCPL 4RGNE 4F58H 4QHMB 1ACYL 4H0IA 3MLWL 1EAPB 5DUML 3MLYH 1QSFD 1TJHH 4Q0XH 4LRIC 4XPTL 3UYRH 3BIKA 1Z2KA 3MODL 1JPGB 5C0JB 4J6RL 4KI5E 4PGDB 1KEMH 4IRJD 3TA3B 1KIRB 1V3JA 3KHOA 1S7WB 4LQFL 2KDGA 3P2TA 4TRPL 2W1NA 3S35X 3L1OL 4TTDC 4OZGE 4CJ0A 5CBAB 5HY9A 5D2LF 3HI5L 4DVBA 1S5HA 1G9MH 4DVRL 5JXEC 1NGYA 4GG6E 1BJ1H 3OB0K 3GI9L 1U8KA 2P44B 2W92A 4GQ9H 1L6ZA 3U30C 2IQAA 4JPWL 3RZCA 3W0WE 3LN4B 1I1AB 2FX9L 5ID1B 1BECA 3MLXH 3VG9B 4OAWA 4LSDA 1FVEA 4PJIB 1YUHB 1JL8A 3BO8B 3CFDA 3QWOA 3MRKA 3MTRA 3E6FA 2EEBA 5CJQH 2NLJA 1EEUA 5D70H 2YZ1A 3F65A 3BXNB 1RJZB 4WY7H 4FQCL 3FQTA 4U1GB 5EU7C 2I9TA 4QT5A 1S7SB 4ZFGL 5KVEL 5AD0A 1HHHB 3HE7A 1TTUA 5DLML 4OFYA 3Q5YA 5BOZG 1BOGA 3FZUD 5DK0A 5F7DA 3RP1A 1I9JL 4FFWD 2PXYD 2RIKA 5F9OH 4JN2B 4UUJA 1U8OB 5H8DA 1I85C 4XP1H 3T77B 3U7YL 4PRNA 4YNYA 5JW5A 4JQXA 4EDXA 5C6PB 4RBPK 3QFJE 4S0SD 1IEAA 2BY1A 2VLKE 3EYOA 3JWNC 3IDUA 4HV8B 4KVCH 1A9EB 1G0XA 1S3KH 4NKIL 5FHBH 5J1AA 2NY0C 4ZD3H 5L88H 1FP5A 1UB6A 3GSRA 5T1DH 2FB4H 5FM5M 4N0YH 3MJ6A 3GSUA 5CZKA 5E00A 3SDCD 1OWRM 4U1LA 1N3NA 4GAFB 4LGRB 5KJRL 2XV6B 2VLMD 1YN6A 5I8OL 4UB0H 1P7HL 4W6WB 1NAMH 3ZTNH 3MOAH 1DQJA 3VH8G 3QO0A 2CSPA 5DRXB 1U8PA 4U6XB 5EC1B 1YECL 2ZWLT 4NNXA 2BVUA 3BQUD 3V0WH 3AB0B 3IF1B 1QSEA 3K4DA 4L1DA 4NNYB 3VXRB 1JHLH 1QBAA 3IU4H 1NCNA 4M48H 5DJ6A 1ZANH 1Y18A 5E08L 4XBEH 1WCBA 3C5ZD 5E70A 1NUGA 4BYHA 3GSXA 3MGTB 4D2NA 3RVXD 1J86A 3OB8A 2VXSL 3V9FA 1KJ2A 1RUAL 3KXFE 4XWGH 3W2DL 5BXFA 3VXUD 1UKTA 2O5YL 1FAIL 1K4DB 1J1PL 3P9LA 4IMKA 5JW4M 1MCHA 1KLFA 1SEBA 3O45B 1AP2A 2JE8A 4HKJA 4JM4L 4ZO8A 5HI5D 4QRTA 5ILTL 2CDGA 3IFNH 1HOCA 1S9XA 5IHUH 4OF5A 3VRIA 1JGUH 1CGTA 3WO4C 3BRDA 1I1YA 1RHHB 2HT3C 2M1KA 3EJJX 2H9GB 1JZ7A 3OKLA 3ZKNC 2GTZB 1DBMH 1SEQH 3MLSH 1I1AD 4KUCD 5ACZA 1AQKL 4LIQL 1AXTH 1LNUB 3O6FD 1LEGA 3QIBA 5T3XL 1GPOH 1CXFA 1G7QA 3O6ML 3VD9A 4U05A 3B2UC 4PJBA 5JQHC 3G5YA 4OLXH 3GSVB 2JELH 5K59E 4YHPA 3T3PE 4PRHE 3QQNA 2Y5TA 2X4QA 1S7RB 4K3JH 2OX5A 3KJ6H 3HLAB 3AAZB 3PE9A 4RMVA 1MAML 3N1QC 1GC1H 1MQ8A 3G08B 1GC1C 3BFOA 4N8VG 5DEGB 5CILH 4JHBA 1TCRA 1FVCA 4L8DA 1FL3A 3H42L 3SKMA 4C56E 1KBGH 2NW2A 2O5XH 3IT8D 3QQ3A 1HH6A 3DMMB 4WFHD 4WHDA 3OZ9H 4Y19B 5EU4A 5DFVD 1QFOA 2VZ1A 1OB1A 2R23B 5I75B 4F7CB 1CI5A 5E6IC 3OXSB 2ZJSH 4Z7WE 3PHSA 2CLZB 2ZUTA 4Q6YA 4PY7A 3IFPB 5FUZL 4N5EC 4R3SA 4OCLC 4OFKA 1UXSA 5IMMB 3U9UB 4QRPD 1JYNA 3S4SA 1G0YR 2VZSA 4NZUL 4KU1A 3TF7C 3WUWA 5H2BB 4HLZH 3QCVL 5FYJH 1W8OA 4HS3B 2XQBL 5IV2A 2LQRA 4TQEL 3U9PH 1X6NA 4HAFA 1RZFH 1BAFH 3ARDB 4F57L 2ZUYA 2C9AA 3BRGC 3VXRD 3U0TA 3MJ9H 5GRUL 2D2OA 1LP9B 3V4UH 5F1OB 4CMHC 4PRHB 5EG6C 1CBVH 5MERA 1BZ9A 1PKOA 1CDBA 3A6CL 4H5SA 3H9HB 2X4UA 1ZVSA 2IH1B 3BHBB 2IPKB 1D6EA 4KK6C 2IF7A 5I19L 1YQ2A 3TO2A 3RJDA 2DTML 4RGNC 1HKLL 4M7ZC 4FQLL 1MQKH 4CKVX 3BZDA 4HKXA 3P9WB 3FB8B 1JGVL 2DQFA 3QNYB 2HLFC 3SQBA 3B5TA 3TLRA 4I4WB 4KI5C 1MF2L 4F7PB 1B88A 2PYEA 4NDMB 3ULUL 4YHIB 1GGCH 4OD1L 5ICXB 2ZCHL 4LEXH 4M8QA 4UINL 2HH0L 1VACA 4RQQA 2XPGB 4BQ6A 4X5LA 1FFRA 1ES0A 4WCYH 5BW7C 4DEPB 2XOTA 2HVJB 4P4KC 4YLQT 3BZEB 1BQUA 5MENE 4NKOA 2NR6D 1JWMA 1JF5A 1MHEB 1KFAH 2IG2L 2VZOA 3RVTC 4GRWF 5DD5L 1Q9WA 1JE6A 1JPST 2BVPB 4UT6H 1EO8L 4YBQC 4X7SH 4KTEH 1FDLH 4H1LB 4NFCA 5CP3A 3P3YA 3HC4H 3V6BR 2NXZB 3BMVA 4HUUA 4I3SL 2BNQB 2ED9A 4EI6A 4OIIL 3DURB 4OLZL 4XI5D 4NBYB 3BUTA 4M93C 1LMKA 1DBBL 4NJ9H 2PTVA 5BV7B 3SCMB 1FHGA 4BQ9A 4DW2H 2X4PA 1BQHA 1JF1A 1NC4D 1R3HA 2VR5A 4Y19D 5I18L 5B3JF 2XNAB 1N4XL 2CDEA 1AR1C 2X4OA 3SE4A 3S88L 3ESUF 4X6FB 1FFOB 5D96B 1WZKA 2WBJD 3LKNB 3MFGB 1JPFB 2XKNA 1FORH 3H3PL 2X6MA 3VXSE 3X11B 5J7CC 1E4JA 4HIIA 3S5LA 5HYJD 1A64A 3DJ9A 4LOUC 3I6LD 1QBML 1P4BH 4RWYH 3QBTB 1E28A 3CUPB 3CDYA 1W72L 1INEL 1D9KA 4LSQL 5IR1A 3RUGF 1F8TH 2ATPB 3MLUL 4XVTH 3H6JA 4ETYA 3OKNA 4AT6A 1MLCA 3LQZA 4TSCH 5MENB 3TJEH 3HUJE 4I0PB 3TBSB 4PLKD 3KPLB 1N2RA 4MD0A 2NCMA 4BK5A 2J6EA 3UPRB 4YO0A 2W65A 1N5AA 3IGAA 3PWJB 9CGTA 3BVNB 3BPOC 1WCQA 5KZCB 4P46C 3HI1A 4JJ5B 3IS0X 4HJ0C 4P5TA 5FM8A 5IBUB 1PKQA 4LAJH 1KIQB 3WDHA 3I2CL 5B4MD 1S9YB 5JMOC 4NGHH 4QTHA 2YPVL 1C12A 2YXFA 3DV4B 3TFKD 5IW6B 3GRWA 5DMGC 3KPQA 3RWGB 4ODHH 3FT3B 4M62L 3MLTB 3M1BA 4Y1AA 5IVOA 4X4MA 4WU5A 3MBED 1FIGH 3VXSB 1NMBL 1OLZA 4HUMB 1U93B 4KC3B 3G9AB 4ALAL 4OLWH 4U6HA 4QRRA 4NHUA 3ARGA 3K4ZA 5FO8B 2MWCA 1NFDB 4RMUA 5KTEH 1MFAL 4X80H 4LNRB 3FO1A 3U46B 5J6HB 4GOSA 4I3RL 3HZVB 3QUZA 4M9OA 2OTUA 3SDYH 5J9PB 4UQ2B 3ZE0F 2CKBL 5E2TL 1LK3L 3QZWG 4MNQA 3BPNC 5EO9A 4FQ2H 4GO6B 2NXZD 4M6OH 3DO3A 5I76A 3P9MA 1RZKL 2BNQD 3U4BL 4JO2L 2YSSB 2VLRE 1A9BB 4HC1A 4PJ5E 4WHCA 3RL1B 4ZPVA 4FQIL 3WIIH 2EC8A 3FL7A 4NQTA 4R7DB 3WS3A 1J1XH 3VDCA 2FEDC 1AHWA 3SCMD 2HJKA 5TGBB 4KROB 2FGWH 1BOYA 4LHJB 2AP2A 3UYOD 2R1WA 3JWOL 1V3KA 3ULVD 4O4YH 4LLYB 2CH8A 3KYOB 1JK8A 2DI7A 4X7EC 5EU5A 1INDL 4P3WA 3SGDI 3CMOL 4XCNA 1D6VH 2F5BL 3CXHK 1RUQH 4EUPA 4HWZB 3RPIA 2X40A 2VKXA 4JLRB 3UYPA 1KIUA 4JRWA 4NKMB 5E2WH 4LIQE 2VH5L 4JB9L 5TJWK 3MREB 1QNZH 4HZAA 3SGDH 1QLFB 1DE4B 1IILE 1ZLUK 1JJUA 1P7QB 1X5KA 5T1MB 4RGOL 3VRJB 2DQTL 4YUEL 4HH9B 4XVUD 3IDYB 4N8CH 4PJGF 3VFMB 2A74A 5D7SH 1DBKH 1UEMA 4I0PD 5C07A 1MEXH 2FX7H 2DDQH 3MO1B 5DDHA 3ZDXE 4CVUA 3UTPD 5I16A 2HT4D 4XPGL 3REVB 3MLRL 2JKXA 1CF8L 4ZPTA 5MI0B 5FGCB 1YYML 2OQJA 4EI5A 2BNUB 3EGSA 4OTXL 3H9SE 3ZE1F 2MKWA 1IGCL 4ZSOE 2VDLH 5CIPB 3SE8L 4CUCA 5E8EB 5HDLA 3RGVC 1TVHB 4X6DB 3LHPH 2CMRL 1DLFL 3I3BA 1IFHL 5D2NB 1WV7T 1Q0YL 1UCBL 2BHUA 3S3SA 4C83B 3UTTD 1NEZG 3A0OA 3GMNB 4WI3A 2O61B 4PJCB 4KHXL 2VDQH 3CC5A 1YPZE 4W81A 1Z5LB 2X9WA 3GMRA 1KACB 4M6NL 4PJ9B 5TDOA 4MWFB 3V6ZB 4TULH 4OZIE 4N9GA 4YDJA 4Y2DA 5E9DE 5I15L 1JP5A 1R5VB 2CK2A 5LAXA 4NQCB 3MRJA 1S5IH 4M5YL 3SKJH 3Q5TA 5IFAL 1TZIA 5ISZE 5L7XH 1NCCH 3LKSA 1L4IA 2HTKD 5CGYC 5E8PA 5CSZB 3MNWB 3KG5A 2EYRB 1DEEA 3B43A 4J2XA 1KELH 1WBXB 2F58H 3SGJC 4ZOEA 2VL4A 4D0BB 4F9PC 5A3ID 4JFOB 4ZNEA 4R4FH 5JOPE 1E4XL 3KPMB 4OZ4A 5DRNA 4KRMB 3F8UB 3UO1L 1I8LA 3OR7B 3W9EB 3MV11 1NDGA 1MCDA 2MCPH 4DOHB 4KROD 1ACYH 1WIPA 3CVHA 2H2SD 1FZJA 3MLWH 4N1HB 5GPRA 1B6DA 4ZSOB 3TN0B 3QXVA 1HEZA 2JK5B 3B2VL 4XPTH 3L3JB 3MYJB 4J6RH 2DKUA 5ITFA 4DN4L 4OCWL 4LQFH 1Y6KR 3ULUE 2HTLD 4TRPH 3P4OA 4YPGA 4YXLL 3FN3A 3VMOA 4PJEE 3L1OH 1JVKA 3F5WB 3EJYD 4ZUSA 4LBEB 1KB5L 3BP4A 3HI5H 3UMTA 3VU2A 1K9TA 4JFEB 2Z91B 4MCYB 3U0WL 3MA9L 1K5NA 4DVRH 4N8PA 3GI9H 4RA0C 2G75A 1UC6A 1T04B 3ZKXB 1MJ8L 4F9LA 4JPWH 4JO1L 5J6GB 2FDBP 3ZKSD 1P7QD 1YPZB 2FX9H 4ZOBA 1QVOB 5KSBE 5A2IH 1IGIL 4U31A 3U48A 2GITA 2HRPL 4LF3A 1IQDB 1U42A 4QOKE 1LO5A 3HZMB 1QUNA 3N9GL 1N6UA 5IVNA 4L3ED 2JB6B 4G3YL 2AJXH 1T1WA 3LEVL 3PQYE 1J8KA 5KVEH 3I3DA 5C09D 5IWLC 3WNNA 3DHJA 5DLMH 3JVGC 1HQRA 1P6FA 3F7QA 2CJUL 3BH8A 5GRVK 1I9JH 1MSPA 5IJVB 4LGSB 1Z6JT 2B1AL 3U7YH 2QSCL 2VXQL 3WEXA 2J8UA 2DWDB 1VFOA 3PWVA 1ODAA 1ZMYA 3W82A 5EOCL 4N1EA 3DV