1DQTA

The crystal structure of murine ctla4 (cd152)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
b'IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOTOXIC T LYMPHOCYTE ASSOCIATED ANTIGEN 4
molecule tags Immune system
source organism Mus musculus
publication title Structure of murine CTLA-4 and its role in modulating T cell responsiveness.
pubmed doi rcsb
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqtA00
1MJJB 3BKCL 4XNXH 3V7AG 1IAKA 4XHQA 2FIRT 2NPLX 3L9RB 35C8L 3R0MA 1MFNA 5C09A 2OP4H 2EKSB 3STLB 1T0PB 2H6PA 5F9OL 3VXRE 3K46A 1MFCL 1V3LA 4GRMB 1R3IH 4XXCC 2ZOKB 1QFWL 5T1LA 2O5ZL 4ZSOA 3PWNB 5F88A 1BFOB 3LN4A 1B0WA 3LAFA 4DW2H 2NX5D 3QBTB 4R4FL 2MCPL 5C0DB 5INCA 4FNLL 4WUUE 1RIUL 1XR8A 3BO8B 3QHFL 5TF1H 3C6LA 3L5WB 3QPXL 3VA6A 4TOYL 3K0WA 3HE7C 4LGSB 2YZ8A 1JZ3A 3RDTD 4E5XA 1F42A 3ES6B 2HAZA 2B5IC 4L8CB 1IQWH 4GKZA 3O11B 2BDNH 1OLZA 3G6JE 2P48B 1VACB 5E7FA 4MQXD 1TPXB 4WV1C 3MLYL 5FA3A 1NUGA 4CNIA 3T4YA 1RZJH 4J6RL 5J1AA 5IMMA 4ZUSA 2ITDB 3E1F1 2QADB 2WP3T 1UXSA 3U36B 5BMFH 3RU8H 1U91B 1FVDB 1WJ3A 3QDMD 5DJCB 5CWSA 3GZKA 2OZ4L 5GGSY 4OV5A 1ZA6B 4ALAL 1G7LA 4JR9L 4KQ4H 3VWJC 1BECA 2QR0A 1JIBA 1I9IL 3MA9H 1ZSDB 3C2AL 1XF5B 3U7WH 1S9YA 3BP7B 2X4OB 3EDKA 2R2CA 2XWBA 4NQCD 2HVJB 3QIUA 1FGNH 1RULL 4GJTB 2F58H 3WLBA 5HHPA 1IARB 4B5EA 1NUNB 2X70A 1P7KB 1TZHA 4BH8B 3NIGE 4Y19D 5L7XH 1MJ7H 1U8OA 4AJ0A 4WFFD 4PG2C 5DHYA 3P3YA 3S96A 5CILH 3HCVA 1E27A 3IFOA 3B3IB 3E6FA 3TN0A 3RX7A 2E3VA 1IAIH 4WHTA 2ZUTA 3HCVB 5I18H 3L9RA 3VJ6A 1SQ2N 1FQ9C 3W0WB 2G60H 1MNUH 3LD8B 3CSYB 2CRZA 1KTLA 1KCLA 2NY3C 3CSPA 2LAGB 2DQDH 3MZTA 5D7LE 3WXVL 4JFEE 1T03H 2BSSB 2A9MH 4ALAH 2AK4D 2NTSP 2FIKB 3CX5J 1X5HA 3SKNA 4H5SB 4WTZG 5K9KA 4C56E 3NTCL 3MACL 3AY4C 4WTWA 3VG9B 4NWUL 5DK2A 4JHZA 5E03A 2MFNA 5B8CA 2IPUK 5ESVB 1JGEA 4YDIH 5CBAA 3MMEA 3C87A 3ARBB 4AEIH 1FFRA 3VDBA 3O6FC 1CDIA 2VAAA 1N64H 2AJ3B 1DL7H 5CHNA 2BC4A 1AO7D 4JDZA 1AR1C 1E6OH 3O2DL 2C4FT 2AERT 4RAVB 3FOLB 4KDTA 1XH3A 5JMRA 5DT1L 1Q94B 5C0IA 5T33L 4U1HB 1YC7A 6FABH 4Y4KB 5ID0A 4LLUB 4Q9RL 4P23C 1X5LA 2LV4A 4OM0H 4DQOH 3BHBA 5E6IC 3TJHD 3DX8A 4PLJC 1OB1A 3PV7A 1P4IH 5GGSA 4NKOB 1N0LA 3L95B 3AMKA 4JZJB 2WIIB 4R97C 3UEZA 4YHNB 5EZLB 2BNQB 4S1DD 4NKQB 5JHDA 1ZHKA 3TWCH 1SEQH 4NBXB 2FGWL 4HJJH 1NC2D 4XNZB 3OF6D 4G8FA 4UMGA 4XP9H 1KELH 4YNYB 4UTAL 1CG9B 4LEXH 1QFWI 3TT3H 2O26U 5D1ZA 4FFVD 2ITCA 3L1OH 4TPRL 5KSVB 2P45B 5ALCH 1P1ZA 1XCQB 4JRYA 1RJZA 4OFKA 4ZTOH 3DUSB 4R90H 2PCPB 4HKJB 4HULB 4G6JL 5ETUB 1RJZB 4JQVA 4OZFA 4ZFOL 4JHAH 5E8PB 4MB3A 4Z7QE 4OD2B 3NZHL 4YDJA 3QHTC 2GJ6B 4J4PA 4DFHA 5ADOL 1BOGA 1QNZH 4Z78A 4XPFL 4U1KB 5IHBA 3MV9D 1CBVH 4DZBA 2B39A 1C5BL 4XVUD 2RJMA 3MLSH 1IAOA 2JE8A 1UXSB 2Y36L 1KJMB 3TV3H 3OJDA 4QRRE 2NY1B 4QHUA 5IFJB 2F8XC 1FVDA 5DJCA 4XCEB 4L4TA 4F33B 3V4UL 4ONGH 2BRRL 3L3DA 4JFED 4GKNA 4P2QA 1CLYL 3QUYB 1U3HC 5JOPD 5D7IB 3ULVD 1YZZA 2VL4A 1CYGA 2UWEA 3BPLB 3QJFB 5FDWA 1Q8MA 2PF6A 4JFFE 2I25N 2Y5EA 4MDIA 4ZOBA 4GW1B 5JNYA 4QRQA 1QFWM 5CCKL 2V9RA 1X44A 1M71B 5C1MB 4GSDL 4KRPB 5D96B 5BRZA 3N0PB 1I8IA 3NFSL 4WEUD 3RGHA 3RIFK 1A2YB 3S34H 3GSUA 3CFCH 4PRBA 1FVCA 3P9LA 4TULL 5IFAL 3C6SB 3PWJB 4NO2B 1S7QA 3AS0A 5KOMC 4XAWH 2Z31C 5BJTB 3CSYA 4IRJD 3MGTA 3SGDI 5TJWK 1DQLL 4KXZH 3TO4B 4BSWB 2ATKB 1F4XL 2JIXA 3JVGA 1E4KC 2DDQL 2X4SB 4L9LB 5CEXB 4HXBL 1K8DB 1T0NA 1F5WA 1XF3B 3FFDB 5K9JL 1IQDA 3RUGE 4QRPA 3ULVL 1I1AD 1F02I 4HPOH 5E99H 1RZGB 4JG1H 1AR1D 2ZUUA 4QRPB 1W2KT 3GJEB 1YEDA 4BQ8A 1R3HB 4Q9QH 4P46C 4X5XB 3CUPB 4ENED 5D72L 3KXFD 3Q6GH 2G9HA 2DQGH 5BV7B 4KAQL 5CJ8A 2IGFH 4AZ8A 2R0KH 4Z7UB 3WO3B 4PRPD 4LHUB 3G5XB 4KUCD 3J8F7 4UB0H 3H0TA 5DD1L 5K9OA 3QXVA 4MJ4A 3DYPA 3DVNA 1F4AA 3HC0B 5DJAB 1JE6A 3ARPA 2HFFA 5ACZB 2XYCA 3SE9L 1Z9MA 1MCLA 4D0CB 4P5KB 1VADA 1QRKA 3O3EB 1XGQB 1Z9OA 5DJ6A 3GHEH 2F58L 1R5WA 3RY6A 5AG9A 1RURL 4HJ0C 2EYSB 3MC0A 2AEPH 1F2QA 3TZVC 2WUCH 1B90A 1E28B 4P3CH 1ZGLB 4U1LA 1KTKE 3O6FD 3ZZ1A 2YD8A 5T1KD 8FABB 5T1DH 1OD9A 1NPUA 4OCLC 4U1LB 3I9GH 1K4DB 1RZ7H 3VJ6B 3MOBL 5DVOA 2EKJA 3CH1A 2WLZA 3D5OF 4FRWA 2ATPB 5DZOA 4RIRA 3Q1SH 1JN6A 1P6AB 4IRJB 2APTA 4R7DA 4YLQT 2HFEB 4YC2C 5IHUH 4E0RB 1BOGB 4LNRB 4YBLB 1J1OL 2NY3B 4CVWA 2DQCH 3V0AC 4KRNA 5E2WL 4PJ9D 2H6PB 4L3ED 5HDBF 3V5DA 4EBQL 1EJOH 4RGMB 2FGZA 1G9MC 1L7IH 4NJ9L 3ZHDA 5I1LB 4WWKB 1MHCB 1KC5L 4HUUA 4PJ8D 5INCB 3CUPA 3O6LH 1MHCA 5EOQL 5HHMD 4LIQH 1IEBB 5T5NF 4CU8A 3VD5A 3GDBA 4PJBF 4N0CD 4KKBD 1TVHA 5F71A 2CRYA 2V7NA 1JNNL 3E6HA 3H0TB 3QPQC 4IJ3B 1M71A 2FZ3A 1TVHB 1LNUB 1Q38A 4GW4B 4PJAB 3GB7B 1QSEE 3U7YL 5GGVY 4ZQKA 4MQTB 2W9EL 1T21B 1SYSA 4JFFD 4OD1H 2ITDA 1HHJB 4G5ZH 1FE8L 2GTWB 1JRHI 4MNGE 3ZYIA 2AKRA 5JOFB 5TE6L 2VDLH 1S9VA 3LMJL 4N68A 5GZOC 5HGDB 1FIGH 4NQVA 3CAFA 5FGCB 1UADC 2B5IB 5I19L 1MY5A 5HGDA 2A74B 4K9EL 2I5YL 3VXMB 1P4LB 1GCFA 4JANA 4M02A 3P11L 4U1JB 5ILTL 3E8UH 5IKCA 3LH2H 5EA0H 1PY9A 2JCCE 3SDYH 2AK4E 4TSAH 1LDPH 5L2KB 4X4YB 1CVSC 3AXLB 1NGXA 1YNTA 1BVLA 3DX6A 3OB0K 4OGXL 2ERJB 3CFEA 4OQTA 3RWHA 1MAJA 3TA3C 3BD5A 4XPGH 1LO0H 3V5HB 2GSGB 3OBAA 4B7LA 3GI9H 5HI4C 1FE8H 2OXHA 3MRKA 3P4NA 3TVMC 5DR5L 2GSGA 4QOKA 5KTEH 4NQDA 2DAVA 3NIFF 2ICWJ 2RR3A 2VZVA 3O6KH 1G9NL 5K9KB 5E9DB 5B38B 3JV4A 3NABL 2VZUA 4FQJH 4RCAA 4JQXC 2QADD 1CE1H 4P2RB 1UEMA 1IT9H 1P2CB 1KJVA 4GAJH 2FH8A 5FUOH 2Q86A 2F53A 4OLXL 4M7LL 3BIAX 4XT1C 2A73A 1TCMA 4NN6B 2JJTA 5LGKA 3F65A 5CZVH 4U33A 1TJGH 3WKML 4Z7QF 3RTQB 1HXMB 3B9VA 3IDMB 2VQUA 2Q8BH 1M05B 3WIHL 5HHOB 3U7WL 2XTJE 2VXUH 1UC6A 5DD0H 1MJJA 4L3AA 4KQ3H 3WEXA 4PY8J 2IBZX 3ISWA 3O0RL 2ZOLB 3BH8B 4KFZC 3LKPB 5IESH 4HXBH 1MLCB 3HHRB 3ARYA 4OM1H 2BDNL 1RK1A 2F19L 3MRHA 5D1XC 3S3PA 2AXHA 5LBSH 1Z2KA 5IMLB 3QUZA 1J5OL 5L6YL 2NW3B 2W9DL 2Q87A 4NQXB 1W72H 4PRAA 2OL3H 1E4XI 4NKIL 1XR8B 3TH2T 1IC4H 1KUMA 3PL6A 3QO0A 4JHWL 2NY5C 3R0NA 4N8CH 1D9KA 1OGTA 5E4EC 5C2BL 2VR5A 1GOGA 3THMH 4O2EA 2NY2B 4KKBC 4LHUA 1YPZB 2R8SL 3PHQA 3DVGA 1TQCC 2PKDA 4MA8L 5C0AB 2PUQT 4UT6H 4BFIB 3E3QC 1FYTE 4G9FE 4PJ8C 4LSQL 3ZE1E 2DM3A 4UV4L 4S1QH 4YHML 3GFUA 5F9OH 4HIXL 3SKMA 4WJ5A 2VOTA 4HS8H 5IJVA 2Z91B 2ENSA 4TNWK 5EUKA 2N56A 1EHLL 1MVUB 4B50A 4KTDL 2UY7A 2NR6C 1XT5A 3D85D 5GHWH 5LBSL 2D4FA 5FKPA 1AKJB 2X4QA 3GHBH 5I0ZA 4BH7A 4LCCC 1ZVSA 4UZGA 4DAGH 1NBZB 5D1QD 3CXHJ 5E1AA 1S9WB 5J1SC 4DN3H 4Z7WE 1L0YA 3KPLB 3ULUD 4M00A 1CLZH 2VSCA 1JYNA 4YHPA 4WDIB 1G9MH 1DLFH 3T2QA 1LK2B 5EORL 5LGJA 3HFMH 3FRPG 1FYTD 4G9FD 1YYML 1HHIB 4EN3C 4PJCF 3HI1B 1PBYA 4GUPB 3GIVB 4L4JA 4PJ8B 1UWXK 3NFPB 1FC2D 5ABDE 2HP4A 3QFJB 1MI5E 4QF1B 2V2TB 5SWZB 2QL1A 3CVHH 3OAUH 3UC0L 2V17L 3IB4A 1A6WL 1FO0L 5AAMA 5GS0D 1LO4L 1UQSA 4XBPA 3BH9A 1AXTH 5E9DA 4Q9RH 4PGBA 3ZDXF 3WO4C 4K3DL 3MJ8A 1OAYH 2EDJA 3ILQD 2FSEA 3QUMH 3QCTL 1I3UA 4X80H 4P57B 1DANT 3P4OA 1YEDB 3KYMB 4LCUB 5DQDL 3TWCL 4Y4HD 4XNYH 3SDDB 3O4OC 1KLFA 3O8XA 2UYLB 3ZKXB 5HI5D 1CICB 1D5XA 5AEAA 5T5FH 2K3TA 3TGXA 1LK3L 4PBXA 2CD0A 4JHBA 3VXOB 3UBXI 1UKQA 4X99B 5DQ9A 2O61B 3WNLA 4GAYA 4OTXH 5TFSH 3D6GA 5GXBB 1ZHKB 1FNSL 4YDLC 2QJDA 3GSRA 4U6YA 2PW1B 1YEFL 1ETZA 3MNZB 4O00A 4G8EA 4MJ6B 4UT9H 4X5LA 4I5BA 1KT2B 1P7KA 1TZHB 4LBEA 3TNNB 4HF5L 2RFXB 4U6HA 4J3UA 1KXQE 3DSNA 4K3HA 1CGYA 4X6CA 2BVQB 1OAXL 2X1QA 4JFEB 1KIPA 2XPGB 3A6CH 5IMOA 3C5JB 3UPRB 2YHGA 4P4KB 2BMKB 1DTUA 2VDOH 1UWGL 4JDVA 5SX5K 1KYOJ 1BMGA 3QIWC 3TPUB 1LO5A 3QWQB 1OTSC 3GMQB 5D5MF 2ZUQC 3T77B 4NZDA 5HHOD 1RMFH 2HT2C 1IQWL 3S6CA 4MSWB 1OT1A 3Q48A 4RGNB 4H25B 2PN5A 1AGFA 1KFAH 3HMWH 3I6GA 3BPOB 1MUJB 3VRJB 4PTTB 4DK3A 3X17A 3VFRB 4ZFZA 1EEYA 2R2EA 1XGPB 1IILE 4HJGB 3SGJA 4JB9H 1G7JB 1NFDE 4BSJA 4NHCL 1K4CB 3GSXB 2DM4A 3LEVH 3L5XL 2WBJB 2HT2D 1TCRB 4O5LL 3KR3L 3WFBL 3ULVE 3U0TB 2W9LA 5CEZE 4FQ1L 4PIRF 5FYJU 1CGVA 1YJDC 4S2SB 3HAEG 2H9GA 4XPAL 1N2RB 2MWCA 1AQKL 2O93L 1EBAA 2X4PA 1IGFL 1RJLA 3LEXA 3GSNA 4OFVA 3F7VA 2QR0B 4JZNB 4L8SB 2DQJL 3DX7A 3V6ZA 1NC2B 3RKDC 4LRIA 4X9GA 5FM8A 4L3EB 3ARFC 4CMHB 9CGTA 2COQA 4P59H 4OF0A 5BO1L 1BLNB 1HHHB 1NCCH 4S1DC 5AZEL 1V7NL 3ULSB 1ULVA 3MNZA 1CLYH 2YN5A 3UROR 2QQLH 4P23B 2YRPA 5SWZA 3GJFB 4FTVD 5DTFA 3C60A 5K59F 1XF3A 3FFDA 5FOBA 3UJJL 1BBDH 1FNLA 3DOSA 3DARA 1E27B 5KS9E 1NCBH 3JWOL 4FS0A 4PTUB 4ONOA 2UUDH 3DXAA 3MFGB 2DJ4A 2GJ6D 3TFKC 4ETYA 3OB0H 1H3PH 1NC4D 2ZNWA 5HPMB 3DX9B 5I1KH 3WNMA 3QSKB 1K9TA 4OI9A 2X1WL 3MO1A 3O6FB 4OCXL 1I8LA 4PUBL 3LEYH 3DX9A 5IVXA 3BZ4A 3B4NA 1BQUA 3D18B 4MNHB 3O9WA 3RGVC 1ONQA 1S5HB 3AUVA 4MJID 1D9KD 3D48R 2RQ8A 3SBWA 5C0BD 2PO6A 3ME0A 1S5HA 2WUBL 15C8H 5DFTA 2FWOB 3DMMB 5T1LD 5CD3B 2BJMH 3OR6A 5DD3L 3NAAH 4CDGC 4FZEH 4D9RE 2ZCLH 3H7BB 1QQDB 1S7SB 4R0LA 3W81A 1AO7E 2AJ3A 4KVNL 5GGQH 2VDMH 3UJJH 4L4TD 1MFBL 3DTXB 3QEQD 3PDDA 1SEQL 3H9SB 3QUKA 5EO0B 3HR5B 5CP7B 3IFPB 4ZUVB 2RCSL 1T20A 3BZFA 4AENB 4I0PB 3VD3A 3HB3D 4X8XA 2W9EH 3IXAA 2YD4A 3G6DL 5F6HI 1J0KA 1IE5A 2P5WB 3LKRA 4NP4L 2V2XA 2OP4L 1U8PB 3K2MC 1NANH 1XIWD 3IFLH 4XC3L 2VL5B 5HHXH 2X44D 2R4SL 1S7RA 3FO9A 2Q6WB 1EBPA 3RP1A 1I7ZB 2DBLH 5EBWB 3BP6B 4PJHA 1A8JH 1B9ZA 4JCMA 4JY5L 3RZCA 5EOQH 2VLMD 4XNQB 1Q72H 2Y06H 5CUSL 5EIIA 1GGIL 2CDGB 4M8QB 4Z0XB 1XCTB 3ARWA 4NZJA 1P7QA 3AC0A 3ARZA 1PAMA 5T1KB 4PTTA 1XGTA 4Z0XA 5IM7A 3T0EB 4ELMA 1NCWL 4MD0B 3HUJB 4NBZB 3WFHA 5HVHC 2E27L 2XN9D 4HKJA 4ELMB 1KPVA 3ZT5A 2FL5B 3HZYB 4OCWH 4RFOH 2CKBB 1UACH 3ZE0E 1G7QA 4I4WB 4P4KD 3MPCA 1ZT7A 4IDJL 5IB2B 2XQYK 3HE6D 1WT5A 1HINL 4ZFGL 1G7QB 1SYVA 1SM3L 5TH2A 5D6CB 4N90D 5I75B 3AS3A 3GM0A 1MHPL 5FB8A 3QDME 1XIWA 3GB7A 3STBA 1UZ8B 1PKOA 3H7LA 3OR6B 5T3XH 5ICYA 3IVKA 1OB1B 5GGSB 1DBJH 2YRLA 4CN4A 4F3FA 2P46B 5MEPA 4L3EA 4L8DA 3WBDA 2ENYA 3KJ4B 3QUMA 2X9WA 1OSPL 4PLKC 5D1XD 2SEBB 3OKNB 4Q6IC 5T3XE 4L8DB 2FBJH 3T3PE 2F74A 1ZHNA 3GMLA 4M62L 5D1QB 1JPGA 4XPHL 3NCYP 5HGHB 3IXAB 7FABH 4OCWL 4PJIB 4WGVB 1NFIA 2PYEE 2VLJE 1IGIL 3DUSA 4M7KL 1N3NA 2ADIA 5TQ2L 5IKCB 3E2HC 5CGMA 3VFMA 3N1QC 2NXYC 2OI9B 5JO5B 1G0YR 1NLBH 3GMQA 5FYLL 4NN5C 3RGVB 5JW4Q 2R4RH 2W0KA 4J3SA 5FF6B 1HXYA 4DGIH 1AHWC 4WHCA 4DKFL 4ZNCD 5A2LH 2VDPL 4ZS7L 4DWHA 5CD5D 3HZKB 4CU6A 3TBWA 2F54E 1NAMA 4X9BA 4G42A 4G6ML 3FFCE 4HC1A 1EEYB 2R2EB 1HI6B 1A7RH 5E8DL 5BS0E 4OD3H 2VC2L 3PGFL 1RZIB 4YGVB 5C0RH 1YUHA 4GLRH 1SVCP 4A2LA 4LOUC 4LQFL 3QWRA 3VI4E 1TCRA 2XZCH 1QO3A 4PJ9A 3I6LE 3PWLB 5FO7A 4C4KT 1OPGL 1JL8A 4BK5A 2R29L 5C08D 1LDPL 1VFMA 4QT5B 4OT1L 4Y5VB 4HS8L 3DV6A 2ZG1A 3GGWB 4Q2ZB 2QHRL 1MREL 2V2XB 5FK9B 4FHBD 4NNXA 1AGCA 1U8QB 2VL5A 3NIGF 2VLKB 3KPMB 4RA3A 4P59L 3RDTA 4YXHL 3ETBF 3THML 1BQSA 3N06B 3BUYA 4NPYA 4P2OB 2BY2A 4GAYB 43C9B 5DEFA 2CGRL 1DUZB 3O4LB 3G5YB 5DUBA 1CR9H 3EYUH 5BCAA 1DUZA 4AQOA 2FO4A 2BNUA 5GGUB 1J12A 4WTXA 2AVGA 1MJUH 3PHOA 1KB9J 5AD0B 2P7TB 1BJMA 4F8QA 3W5NA 1ACZA 4IRJA 2NY1C 1QNZL 1D5BB 4QO1A 2P8LB 5GS0H 4MWFB 4LCYB 4Y8DC 3LIZL 3EOAB 3O6LL 2D03L 1TZGH 2HT4D 4Y19A 4QHKI 2C4FU 5J06A 3SOBH 2PYFB 3OKDB 3OJDB 1QSVA 4I48B 4KDWA 3MJ9H 3OKEA 5ENWB 4NQTA 2YKLH 3ZDZF 4TVPL 3L3DB 3MV7E 4ZFFA 5EBGA 1ZLVH 3VW3L 1HN1A 2I9TA 5HJ3A 1PG7W 1S7WB 2HKFL 3SQBA 5H37H 3EO9H 4OZIF 2IC2A 1A7PL 3HB3C 5D5MA 5DMIH 1ZXQA 3AREB 5TDNA 5DRNB 4UBDD 5T3ZD 3BQUC 1VFUA 2J88H 4O9HL 5HHOE 4GBXA 1J05B 3IU4L 3T8XB 3VFVA 3BKMH 5KVGL 5BMFL 4I2XE 5F7KC 3DYOA 4JLRB 1KULA 4XI5C 3NACH 4Z8FH 3C9NA 5CJOL 4NKMB 4RFEA 2CKNA 5ICXB 5JXAL 3SDCA 2P8MB 5BJTA 1OTUD 4S2SA 3KPNB 1JN6B 1AXTL 1OGAD 4YHLH 5A2KH 1N2RA 1DQLH 1A3RL 5D1ZD 3G04B 5FYJH 1M7DB 4V2BA 4U1GC 2ESVD 1X4YA 4HT1L 3PWNA 1F45A 3QDJA 1RIVL 3P0GB 4N5ED 4Z7VA 1IQDB 5KTEL 3DNKA 4HAGA 5TE4H 3AROA 3FT4B 4PGZA 1F11B 1HHGA 5MEOA 4U1SB 3EZJB 2J8OA 1CDHA 5I18L 3H42H 3IDIA 2P24A 5HHMB 1ND0B 3TIEB 3B9KC 1ZLSL 1F4YL 1RZ8A 4OZ4B 3SCMD 3PJSA 3P4MB 4RX4A 2XACC 5JXEC 1EK3A 1QO3B 4HUKB 4LHUG 4GT7A 3KJ6L 3N85L 3IDNA 3AREC 4JRYE 1N6UA 4ZAKD 4LP4A 1MCFA 4BZYA 3RWEA 1GZPA 1HNFA 3BIKA 4NM4L 3UCRA 4KUZL 5TDOA 2Q8BL 1P53A 4BK4A 2BERA 1T2XA 1R3KB 4UINL 3VFWA 3MRKB 2I07B 5IHLB 4IMKC 3F6IA 2UVEA 3NFNA 2B2XH 3M17A 3KHQA 2IANE 2NX5B 5C2UB 4OLVL 2UZYB 3VFGL 4RISL 2H8PA 5C70A 1N5AB 1RZKC 3NCCB 4L4TE 4FQHB 2NY5H 3UX9B 4XH2A 1UA6H 3EO1A 1QRNE 5JHDD 3GNMH 2VWEC 4P4RB 2M2DA 3V5KB 4CW1B 1CFNB 4UUJB 3IXTB 4M43H 4CVXA 3GSVB 4D3CH 3EJZC 2G75B 1TXKA 2BNUB 2CK2A 4NWTL 3H9SA 3QUKB 1RD6A 4JFFA 1FL3B 1BQLL 3QFJD 3QXAB 3WUZA 3BISA 2WLYA 4OZIE 3SGEH 5I8KH 1YMMD 2YC1B 4X0KA 1WSST 4KK6D 4ZS7H 2VZ1A 2EH8H 1U42A 2PTTA 1Q0YH 4CMMB 4G3YH 5HY9B 2EO9A 2Z4QB 4PB0H 5GJTL 1B88A 5JLZB 1MCOH 4ZD3L 1XR9B 1TQCB 3HI1A 4EKXA 4P46A 3WUWG 4FOMA 5KSBB 4XPBH 4I18A 4NC0B 3MCKA 2EDTA 3QUZB 3FB8A 5E2UL 3BKCH 5MENE 5IV2A 1N59B 1IAIM 3KXFB 1CFBA 1KJ3H 4PJ9B 2AW2A 2VAAB 1D3CA 4YO0B 3D25B 2AJYL 3B2VH 1I9JH 5J9PA 3VRIB 4X7SH 5C0DA 2JCCF 4ZDHA 3U30B 2VERN 2OBGA 4U6XA 1E4JA 3L3IB 4ZUUB 4LRNH 3C08H 3GMOB 2ARWA 3EJZD 4Q97A 2E7LC 1KPRA 2Q3ZA 4G7YL 4J3OC 3CVHA 3IETB 5F70A 1BP3B 1P7QD 2D7NA 2E7BA 1MWAL 1X4ZA 2IWGA 3O6ML 3G6JF 3MREA 4NO5A 5ACLA 1R3KA 5I8KL 2BJML 2VLRE 4NNPH 1JPSH 5DF0A 1I1AB 4KPHH 3VFOB 5LAXA 2EDLA 5IJVB 2Z35A 2BNQA 4KDVA 4OI7A 1ED3A 1I3GL 2H2PD 5IMMB 1P84K 1PSKL 4Y5YA 1NAMH 1EVUA 4M5ZH 3SDDC 3JV0A 1S9VB 1HZHL 4I0KA 1AP2A 1UZ8A 3MX0A 1HE7A 3RBSA 5KANI 1R3JA 2VKXA 4XVTL 5CMAB 1MPAH 4HHAA 1CXHA 1HCFX 3KPSE 1UJ3C 5CINL 1MIML 4MLSA 1IKFH 5A16B 5TDPA 3X11A 2VLLA 1IEAB 3LEVL 1FZMB 1C5BH 4E42B 1CE6B 3L6FB 3RWIA 3GBNL 3CK0H 2AK1H 4R4FH 5IVXF 4KKNA 1UWEL 2GAZA 4WUKL 3ZE0F 1VERA 3OSKA 4XMKH 4M4PA 5JTWA 3P0VL 3LKSA 3CDFA 5JIPA 5IMOB 3BI9X 3GIVA 3REWA 5E56A 4Q0XL 4FABL 2UZIL 3VCLA 5DR5H 1NANI 3LRSB 4ZSOB 2DMCA 3MLYH 4JEGB 4P5MB 4HFUL 4UOW1 1CE1L 4HX1A 3RVXC 2NCMA 4KY1L 3NCBB 1KTDA 1I3RA 2I26N 1NCBL 2IG2H 2A73B 2HJKB 1SM3H 1JWMA 4LLMB 4FN0A 3BPLC 5CEZD 2XTLA 2VLJB 2PYEB 1JF1B 5ITBL 3DSFL 4RSVA 3T4YB 5B21A 3PWVA 3HI6H 1ZEAH 4YHLL 4IRSB 3HZMA 4NRXA 1U3YA 3OKMB 1AH1A 1P9MA 2CMRH 4LAQH 3SE3A 3B6SA 5CBEA 4ODTH 3VMNA 1CIDA 1EMTH 4D0DA 1EUTA 2XY2A 1CL7L 4G8IA 4YWGH 3I6KA 1WVZA 1YDPB 5JZ7C 4GRLD 1F11A 1HHGB 4EI5D 5KSAA 4BZ2H 4LSPH 3QUXA 4Y4FB 5CEYA 2DI7A 5EZLA 2HJFA 1YEEH 1S3KL 3BW9B 4BH8A 3IAGC 3QUXB 4QXUH 3SGDH 4JFPB 2BHUA 3GM8A 3ZKND 4WI9A 5DSCB 2AJVH 2NY6C 4GO6B 4HMDA 4AH2B 4LCWD 3BAEH 3CDGB 1SJEB 1FDLH 2X05A 4PJEE 2F9BT 4Q58C 3FONB 4RFNB 1RFDL 2HFTA 5DDHA 3P30H 3KPRE 4ZUTA 3SJVD 4JKLA 3PNWA 4TSBL 3UP1A 5DZNA 4R26L 1EJOL 1CD1A 4G80B 1DJSA 2LQRA 3BZ4B 2GIYA 5KN5B 3HE7D 3MRBA 3BVNA 4EUPB 1QSFE 4C83B 1NH6A 4PG9B 1IAOB 1PLGL 1HYSC 1WAAF 4KGLA 4M7LT 1FVEA 5GHWL 2JJTC 3PWPE 5IT2L 5AG8A 3TIDA 1KTDB 4NN6C 3KPQA 3SDAA 4TN9A 3SHSA 4BA8A 3Q5TA 2P5ED 3HC3H 4P2QB 4JDTL 3BWUC 1BF2A 1A14H 2CXGA 4QHMB 4FFYH 3DXAD 3S35H 4GS7C 1I8MB 1J1OH 4ZOEA 1YEJL 3NN8B 2DQCL 4NC1C 4NUGL 5I2IA 3FB6B 1XGUB 1A7RL 2F53E 5C07E 3IFPA 1W0WB 4ZUVA 4HUVA 1I7UB 3WLWD 4L9LC 3GSNB 4LOUD 3QAZC 3C5JA 3VFMB 5SWSD 1JHTA 2BNRA 4PJXB 2AV1B 35C8H 4OLZL 4DCQA 4IDLA 3ZL4H 1DBBL 2C3HA 1T4KB 4JFQA 1LEIA 5M7QA 4LPCA 1A6ZB 4OZGE 3BEWB 2R56H 4P2YA 4P5TD 4UIMB 5EO9B 5B8CC 3QRGL 1QEWB 3RNQA 1HDMB 4L4VB 4UNUA 4WIQA 4FFWD 4WRLA 1UH4A 3QZWG 5H8DA 1CS6A 1EXUA 4C57C 1K8IB 4PJCA 5EZJA 3LHPL 1DBML 4I2XB 2V7NB 3E6HB 5CGTA 1T89A 4OLUL 1KPVB 5E8PA 2Q7YA 4UDUB 5KS9F 1WWWX 5HYEA 1O0VA 3S37H 4HLZG 1JF1A 2IMMA 4TUKL 1OM3L 1REIA 2OX5A 2HFGH 1S7VB 2C3XA 4F57L 4WFEE 2DI9A 1WQVT 1RZJL 5C6PB 5JDJA 4RQQB 1ZHBB 4JO2L 2A38A 1D5IL 3NCEB 1D6VH 2YBRB 4PV8A 1MPAL 1YYLH 5DJZA 1NLDL 3GRWL 5IFAH 4X6FB 1HHKA 3TBSB 5K9JH 1FZMA 4LQFH 3L3HB 3S4SG 4NFDA 1VPOL 5DD5L 1NUDA 4P2OC 4E41E 1HILA 2D0GA 4KKAD 3CFJB 4EI5C 1NFDB 5D2LB 4J3VA 3SJVE 4XPGL 1XGUA 5BVPH 1KV3A 2BVTA 3MLVL 4RZCB 2YKLL 1YPZF 5FUCE 5F1OB 4WUUD 3GKZA 3UO1L 3BRDA 2GTZA 2HRPH 4FMFA 2CPCA 3EOTL 2GUOA 5CIPA 4S0TD 4HPOL 2F54B 4CMHC 1LO2H 2NW2A 4XP5H 1RMFL 2UWEF 2FX8H 5EU7E 3ZDXE 3VXSA 4F57H 4LLQA 3NTCH 1R3LB 4XHJD 3QHZH 1GYAA 1FV1B 5HYFA 4JGMA 4WW1A 1PKQA 3RNQB 1YYLL 3BZEA 3T08A 1WBYA 3EYFA 4ZNEE 5DYOA 1S78D 3EFDL 1QFHA 3FQRA 1NSNL 2YD7A 3P9WB 5IFHH 4PJ7A 1VKXB 3CC5B 4JM2F 2KZWA 2AEQH 4FQXB 3GMNB 5FO7B 3CMOH 5HYJD 1MFDL 1M7XA 4OM1L 4Y5XC 1ZV5A 2WUCL 2CLVB 2FX7L 3UBXB 3JV5A 1IGMH 4WEBH 3ZKMD 5DRWB 4QYOA 1WUNT 2J6EH 1H0DB 3FRUA 2D4DA 2ZOLA 4KGJA 2C1PB 1LEKB 4L8BB 1UB6A 4UQ3B 2DQIH 4LLUA 4OCYH 2J12B 3VFOA 2AABL 3DETC 1JHTB 5A2JH 1T21A 3NCYS 5JPNB 2DD8H 1JNNH 4MMZC 3TO4A 4XNQA 3VGDA 1KPUA 2Z92B 1PYWA 2FLRT 4Z6AT 4P5TA 5GISH 3FT4A 2NY0B 4HJJL 5EO9A 4JKMA 2VIRA 3MOAH 1XF2A 4ZG1A 3O4LA 2E7HA 1JNLL 4HXAH 3MV8B 1BF8A 1YNKL 1EXUB 1IEAA 4NBYB 1NKRA 5I73C 2AXFA 4AEEA 4HBQA 4CGTA 3OZ9H 2EE9A 1CTNA 1JBJA 1BQHB 4DEPB 4Z78B 4U7SA 1DLHB 2P8PA 5GS3A 5HYJE 2GW5A 3FOMA 4R4NC 4JPKH 4C83A 4XAKE 2FECI 3BXNA 4HC1H 4OLWL 2CUIA 4OD1L 2E6PA 4APQC 2EYTA 4NZUH 2AABH 5EU4B 1UM5H 1NGQH 1XIWB 4RQQA 4UU9A 3BP4A 1IL1B 1JNHB 1CLZL 1UG9A 3BSZH 1A4KA 4XMLH 4M1DL 5GISL 1XZ0A 3U82B 3TC9A 4LARH 4NCC1 4Y16D 3CXDH 1ZOXA 1VENA 3OKNA 1DN0B 1XGYL 1HQ4B 4OF6A 3DRTA 1ZT4A 3LPGA 4Z77A 1ZANH 1LVEA 5F96L 1QR4A 3VWKA 2F5AH 5F89A 3RRQA 1W72A 4Z7NF 2BVPA 2DQEH 1ZLWH 3QEHA 3QNXA 3V4PH 3K80A 4HIJB 4NM4H 4PJBA 25C8H 2VXQL 2JLLA 4HS6A 4JVWA 3NFSH 3SDXB 1SYSB 2A9NH 5IBUB 3DRQB 3EAKA 4H1LG 4X7SL 4HS6B 4HUMB 1LEIB 3L7FA 3QQ3B 3VXSD 1LO0L 1G7MA 3D69B 5F88B 5EIQA 1DVFA 2X2YA 3MRMB 4F15C 3L3OB 1HH9A 2GKIA 4MJIB 4UTBH 3RVUC 1JV5A 2HMID 1U8JA 4XVJL 2VH5H 3SDCC 2FEDD 4O02H 3JSSA 5B8CB 1XCQA 4HEME 4JRYB 2D9QB 4KQ3L 3GNML 1DQJB 4LLAA 4JPWH 5JR1L 3MTRA 5L88H 1JF5A 3U1SH 2XY1A 2DQHH 1ZANL 5EH1A 5KS9A 1XGRA 1AGBB 1JHLH 1Z6JT 4WFHD 1ZKAA 1MHHB 1PG7H 1KCSL 2YPLA 2YPVH 4M6OH 2OQJB 5IP4A 3I02B 3C5ZB 3CGTA 3DVNB 3HC0A 4J4PC 5ACZA 1UVQA 3PL6D 3ARUA 3DV6B 3GSNL 4DGYH 3VFTB 4QHKJ 2OL3A 1YQVH 4YUEH 2JB6B 2OL3L 3B9KA 3P4NB 2YPKB 4A6YA 3ARSA 4PRPA 5BVJA 5KW9L 2EO1A 1S7WA 1ROWA 4M7JL 1V3JA 5CJXA 4WUKH 4LSRL 1CFVL 1KCRL 2ICWI 5HSFA 1MWAA 3DUHA 2PYED 2VLJD 3WIHA 1ZLVK 3JTTA 5CEZL 5L8LB 2OLDA 4I5BB 5GGRY 3WFEL 4G8GE 2DIJA 3N1FC 4PJDE 1X6NA 4XCCH 4JGUA 2VXTH 1MRCH 1J1XH 4GMTH 3F7PC 4WO4B 4IMKA 3ARBD 4LNVA 1AD9B 1H3GA 3U1SL 1ZGLA 2QTEA 5SV3A 1P4LA 5EU3A 5IHZA 1UH3A 2FHCA 4Z7WB 3VXUA 5JO5A 4PJGB 3TEUA 1A6UH 5AD0A 3GO1H 2BSED 3FB6A 3DRQA 1S7QB 5KSBE 5DEZA 3IFNH 4EI6A 1AC6A 4QOKD 3LV3A 2ZUYA 3LKQA 3KLAA 2XNAA 3T2PA 5E6IA 2XV6B 4QXUL 3FMGH 1C1EH 1VEMA 5I1EH 5C8JB 4FQCH 5DA0B 1JRHL 2XQBH 4XZUB 5BXFB 2NY6B 1CGTA 1CDBA 3C5ZC 4YPGA 4L1DA 3LRSA 5HDBE 2CJUL 4L3CA 5CS7A 4PJHE 5J6GA 1Y18B 2CXKA 2YK1L 1FDLL 5BXFA 3CLEL 3I85A 1KB9K 5GRUH 4XPAH 1FCCA 4HIXH 5DMKA 3GJEA 3SPVB 1MCQA 4XBPB 3VGBA 1J1XL 2LFGA 1FNAA 3RUGA 2ZJSL 4M1CD 4QXTB 2B4CH 5CP3H 1BFSA 4KTDH 4UILH 3MLSL 3QCVH 4JQVC 4JZOB 5D2NE 5KSUB 4YR6B 1JTPA 2FGWH 2ADJA 4E5XB 4P57A 3U30C 5FYKL 5C9JB 1QUNA 2EH8L 3V95A 4GS7B 5I8EB 1F3DJ 3DUUB 2Y72A 3BWAA 4JO4H 4BFBD 1FVCB 4ZUSB 1R5WB 3DGGB 1BX2B 3QQ4B 3EO0B 5MEQA 5IMKA 5DEGB 2E7LA 4HFUH 1UWXH 2EYSA 1C08B 4AMKL 4KUCF 4W4OA 4O51A 3NIDE 5F1SA 4KTEL 2VIRB 1LP9B 1CXFA 4GOSA 3QI9D 5D2NC 1U3HA 4PB0L 5GJTH 3QR2A 1V5JA 4ONFH 3W0WE 3G5VB 3DMMC 5EN2A 4Z7OF 1K5NA 1BJ1J 1IM3B 1Z0NA 1JFQH 1IVLA 2AQ2A 4KZDL 3NA4A 5D7KD 4WV1A 3BN9C 3LV3B 4H20H 5HDQL 2ZCLL 1OY3B 3IDNB 1NGWB 2CMRL 5L2KA 1KBGL 2XFXA 2R56L 4F7PB 4PJ8A 1CFQA 1KJMA 1UXWA 3CFKA 4JKPL 1TDQA 1J0JA 1DDHA 3FB7B 3RUGF 3O3BA 5EZIL 3CLFL 3BDYL 4PRIA 1CU4L 3MUGB 2DJSA 4M1DH 2R1YB 4R0LB 2QEJA 4JN2B 2EYRA 4QCIA 1UACL 1UWGH 1FNSH 1EZVY 1TNNA 4ZFOB 3VE0A 2OTWB 4FMKA 3JV4B 3WFCH 1MRFL 5EWIL 5IG7B 3V8CA 2KBGA 4H0HB 1KPRB 4LVNB 2C5DC 3ARFB 3EO1B 4N8PA 2QQQA 5CZXD 4GRWE 1MHPH 3QNXB 4MHHG 2ESVA 4CVXB 1IC1A 2DLGA 4JDZB 2Q8AH 3TO4D 1NC4A 3ZE2E 3EDJA 4AEHL 3VA2C 2Z35B 3BMVA 1DEEA 3FQNB 1U6AH 3G9VA 1M1SA 1QBAA 4EI6B 3QDGD 4OSUH 5IQ9B 3AM8A 3MR9B 1LEGA 2HFEA 3C60D 5C0AD 1XCTA 4R2GC 1LP9A 2IGFL 4X6EA 2XA3A 4EVNB 3IDIB 1JZ5A 3BPNC 3FQTB 1NDMA 4AIOA 4G8EB 1BLNA 3DBXA 3NBNA 1IC4L 5JORA 1P9MC 5ACMA 4JG0L 3QQNA 3QCUL 5H94B 3BZDA 3HNVL 3TZVA 1D9KB 3KXFA 2FJFA 3EJYC 4KC3B 5BRZD 4YO0A 1OQXA 2V9TA 4ZPVA 5H94A 3QNYA 3G6JA 3TZVB 4PRAB 3MZGB 3CNKA 3QZWA 4F7EB 4M6OL 4MYWB 1LQSR 4M61B 3NOIA 4XP4H 3WHXB 3BDBA 5TDOB 4OCNC 2AXFB 1QSFB 4LASH 1INDH 4S1SL 5JIIA 1PFCA 3F62A 2VC2H 2JCCA 3H8NA 4ORGA 4P4KC 1EGJA 5C0CB 4HG4J 2FZ3B 5FA3B 1P69B 4CNIB 2R2HB 2GJ6A 2OZ4A 1WV7T 2JCCB 3ZTNH 4XPHH 1A1NA 1MSPA 3IDJB 3ZTJG 5BVPL 4XVSL 5I8EA 2YXFA 3RHWF 1IGIH 4M7KH 1V7NH 4OCXH 5LG1A 1FVEB 4LVOB 4CKVX 3MV7A 2A77H 1NBZA 2GI7A 2ZUSA 5ITFA 2E9IA 5EC2A 3V6FB 1MREH 1ETZB 2XZZA 5IVNA 1DBMH 3ARTA 4HK3J 2AEWA 4EIGB 3P40A 4MAUL 1OARL 5FUZL 1QBML 3QXAA 4LVOC 3O81A 5AYQA 4Z77B 2BRRH 5KVEL 4LSDA 1PY4A 2HFGL 3P4LA 4JFEA 3CX2A 2B1HH 5F1NB 5ALCL 3UPRA 5I1EL 3JTSA 2IAMD 4Y2DB 3MRCB 3NFPA 5CGYD 2BVOA 4NN5B 1G6RH 1JGDB 3AU1B 4PGEB 3UYPA 2NMSA 4HIIB 1BHGA 2LU3A 1QVOA 5LGHL 3QFJA 3TJEH 1IFHH 3L3OA 4PB9L 3LRGA 4PYGA 3WJLA 3BDXA 4NQEA 1VFAB 3QUZC 1MHEB 3REVA 3FZUC 4L9LA 5CEXA 2ZPKH 4KK9D 5HVGB 3PQYD 2BVYA 1K6QL 1P4BH 4YHOL 2DBLL 1PLGH 3SDAD 5D9SA 1D9KC 4JPVH 1INEH 4XRCB 4MXQC 1MWAH 3O6MH 3PG2A 4KJPC 1WK0A 3MRJA 5DJDB 1J0ZA 3MJ9L 4KJWD 4PRDA 1M7IB 4QRUB 5JW4N 5HHVL 2B7DT 1I7TB 1XFPA 2ESVB 4R96A 3CX5K 4G80A 2I27N 2A6IB 4JO4L 4F9LC 1FAIH 4JG1L 1HHJA 3G5XA 3TA3A 4HXAL 3LKNB 1N7MH 3GI9L 2H2SD 4GAJL 1BM3L 1QSFD 2X1XR 4M7LH 2NZ9D 4YHNA 1YEKH 5ECJE 3D87B 4LCCB 5BZWB 5DQJA 3T65B 5AAWA 3NABH 5I1AA 1WAAA 1S9YB 4JJ5A 4KRLB 3OR7A 4PJEF 2XI9A 1DBKH 4LCCA 1T5XB 4H26A 1X5AA 4WW2B 5GJSL 4YXLL 2FB4H 4U1NB 3SOBL 1H3UA 3SCMA 1DBAH 5F7HA 4PRHE 2Z8SA 4D94A 4UAOC 4UT9L 4P46D 5FYKD 4NFBA 2QQKL 3QNYB 3CDGA 3HR6A 3SDDD 4MNQB 4GMSH 2JB5H 4CN6A 4JFDD 1G7IB 2PYFA 4O2FB 1EA9C 3WXVH 3OPZL 3G9AB 5DDHB 4XCFL 4RA0C 4HKBB 3QYCA 5FM5O 4HKXA 1JGDA 5EU6B 3TVMB 1IBGL 2QBWA 2EE3A 2IADB 3QNZA 4O02L 4OZHE 5FHBL 3ZYOA 1HXYB 5FYLD 1JUFB 3A67L 4CJ0A 1RZ7L 3SBWC 1RV6X 4UIMA 1HINH 4HDIB 3INUL 5DFVD 3NVQA 5DWUL 4FQXC 4NNYA 1T22B 1Q1JH 2EH7L 2Y6SC 5I71C 4L3CB 3C6LB 2Q1EA 3GMPB 1EEZA 2R8SH 1S8DB 3IDUA 4NSKB 5C0GB 5EZJB 2BX5A 5IUSA 3U9PH 4C4KO 5DMKB 3RI5F 5BRZE 1DFBL 2VXVL 2PXYA 5C2BH 4CL7A 3OXSA 5GRVL 1K4CA 1A1MB 2Y23A 4YXKL 3SDDA 1IEHA 2X10A 2QV2A 1BQHG 5B22A 2HRPL 5DJ2A 2BY3A 2EDKA 2X4PB 1IC5L 2NY2C 4K3GA 3ESVF 4G6AD 5D71H 3WS6A 3BH8A 3VFGH 3BPCB 3H42L 4QEGA 4X5WB 1A2YA 1QP1A 2RIKA 2VRAA 3SKJH 5ANMB 1X5XA 2I60H 1A6PA 3HAEH 3STLA 4NKOA 1LO2L 4HUNB 1ZWIB 5IBLD 2J8UB 3FQTA 4M93B 5IMLA 4W70A 2GCYB 2NW3A 4LAJH 4ZYKB 3U9UA 4KV5F 5SWQB 4K07A 3GSNH 4DGYL 3JWOC 1EVTC 4JM2D 4S1QL 1CZ8H 4YE4H 5T3ZE 3FHQA 1K5NB 2FL5A 3HZYA 4XNUH 5ALBH 4KMLB 3GI8H 3ILPB 1R3IL 5HI5C 1AFVH 3TCXA 1JWUB 4RRPG 3D3VA 4OF3A 4HZAA 3VFWB 4JFXA 3ZSSA 3E2HB 2R0LL 5GPRA 3U2SB 5IW1B 3TBTA 2XFXB 1Y0LA 4JFDB 4KROD 1ZHLA 1IGML 3F58L 3OKEB 4QY8B 5IOPA 2X89D 3CDYA 5JIHA 2BY1A 4XCEA 2R9HD 4ZOAA 4PV8B 1VESA 1CGXA 3NH7H 4S0SD 4JRXE 1R5VB 5EUOE 4FFYL 3UYRL 4RWYH 1U8IA 5D7SL 4BUHA 1T1WB 1OARH 5FUZH 1EGJL 1A1MA 1QBMH 3CPLB 2UWEB 3WV0A 5FOJA 1J8HB 1JRHH 2Y4SA 3SE8H 2D7MA 4LBEB 2OZ4H 4OFIA 3CFBB 3GI8L 1QPXA 3FRUB 2HKHH 1FCGA 4OTXL 5DMIL 1W72B 2E7CA 3HN3A 1MELA 5F44A 2P43B 3OGCA 1NGPH 2W38A 3EYQC 1LK3H 1M05A 1FH5H 4S1RH 1OAYL 3A6BL 1A4JA 4LKXA 3WXWL 4R9HA 1T66C 5KVGH 1MQ8A 2F53D 3TVMA 3RTQD 2M26A 1WWAX 3MA9L 1NGQL 3RL1B 5HYQA 3MUZ1 3D25A 5FOBB 5FIEA 1WCQA 3HUJA 3IU3A 1U8MB 5ICZA 5C08E 3R06A 4X6DF 2MQCA 4U6XB 1N8ZB 4J6RH 4LARL 4LVHC 4V1DB 1CGSH 3QG7L 4NJAL 5CGYC 5ESVA 2BHYA 2VDKL 5IM7B 1BGXH 4NSKA 4WWKA 5C0GA 1KTRL 3CVHB 4NQXA 4WFED 4PD4J 3EYSH 1Q0XL 5E5MB 4WI2A 4TUKH 1OM3H 3TCLB 3PWPD 4CRPA 1L9MA 3BGMB 4EXPX 4PJDF 3X3GH 1ORQB 5BQ7B 2P8PB 5E5MA 3WD5L 4NFCA 1BVKB 5J7CC 1KFAL 3O41B 3KVQA 2HLAB 3BXNB 4JO2H 1R5IB 5HHQB 4ELMF 1C5CL 2HT4C 4X6DA 2DIAA 3VGAC 1ZHLB 3HUJF 4ORGB 4GKSB 2F5AL 4JB9L 3EW3B 3L3KA 3TLRA 3S8WA 3DI3B 1A9BA 2PNDA 1UCTA 1DL7L 5HTSA 1OAXH 4P5KA 4H26B 1T5XA 1ZE3C 3VGFA 4KUZH 3IKCB 3H9SD 1NKOA 4X7TB 2LU4A 1RUML 4HK3N 2IH3A 4GKOA 1HSBA 4UV4H 2A1WL 5T3ZH 4YQXH 4LAQL 5DJXB 4UILL 3SE4C 3MV8A 4KI5F 3IXTA 4F7MB 1Q9LB 2WINB 4OFYD 4X83A 2ICWA 4AY0A 1FO0A 1R24A 4N9GB 5IB4B 1I1YB 3B2UD 3MV9E 3LN5B 5ESAA 1GGCL 4AEIL 2OTUA 4MSWA 1RUAH 4U7MA 1EIBA 3D18A 4FG6D 1W0YT 2Y07L 4FFZH 1NCAH 3QCUH 3WKNA 4LRIC 1K8DA 3WFBH 1KB5A 3F7RA 5BO1H 5AZEH 3RNKB 5DYOB 3HPLA 5L8JB 3AU1A 4Y4FD 3CDCA 4Z7VF 5GGRB 4PGJA 2YEZA 4WFHE 1ZEAL 4XP9L 3LN9A 4RBPK 3PXJA 1FNFA 3PJSB 4LIQL 2YEZB 3GMNA 3VE0B 1MCOL 2VUOA 4ZD3H 1JFQL 1Z9LA 1UGNA 4WFGD 4D9LH 4LP5A 3RAJH 4RMVA 5L9DH 4XCNA 4TRPH 3DHMA 1ZT4B 3UBXA 3VRLE 3C5ZA 3FJTA 4XRCA 4PJCE 4Z95L 3GBML 4YX2L 3RPKA 3DHJA 3BPCA 1FFOB 3F7VB 3C9NB 1YMHB 3EFFB 1OOAA 3MREB 2BOBA 5HI3C 3BE1H 3QI9B 2X9XA 4NWTH 1QKZH 3PP4L 3OMZA 3P9LB 1IM9A 5J0BA 2C4XA 3ARDA 3T0DA 5LCVH 2R0ZH 1CR9L 4OZHF 3TP4A 2IH3B 1INDL 4PD4K 2ZUXA 5KANG 1KEGL 2CIIA 4UAOB 2YUZA 2FBOJ 5HHXL 3GSQA 4BFEA 2K7PA 2O5ZH 3Q6FB 5HYSG 3OX8A 1TIUA 4JRWA 3NPSC 4DW2L 2AJXH 4KRPD 2ORBH 1KB5L 4KVCH 1X6LA 5JMOC 2FR4A 1S7XB 5FAAA 5LXGL 3FCTA 2P44B 1FYTA 2VJXA 2ZUWA 4G9FA 1L7TH 5BZDA 4F7EA 1MAKA 3CZFB 4U0RC 4XVTH 3E8UL 3LH2L 5EA0L 1QYGL 4X4YA 4I48A 4QRRD 4M1GH 1G7IA 1RPQA 3TBWB 4A6YL 1OSZA 3MA7A 4Y8AA 1FZKA 4Y19B 5C0CA 5DQDH 3DMMA 5BV7L 3OKKA 1F97A 3K4ZA 3HPLB 4PJXE 3MUHL 3TIDB 4HSQA 5TGBB 2BXZA 2E27H 1DDHB 3FB7A 3MRIA 3QEGH 3L3GB 5SWSA 4F8TA 5KVEH 3S9DB 5D7IA 2WW8A 3O3EA 2OR9H 3OV6A 2DWEA 5DJ6B 4AMKH 3I6GB 3A0OA 1RZKL 4OCRH 4HWUA 2EXYD 4FABH 4PJ9C 4X8JB 1IEBA 1OW0C 1J8HA 3SQOL 5MEND 4MJ5B 1RIHH 4F2MA 1AKJD 3RX8A 4PJ7E 3HLAA 4Y5VA 3D85B 5HGHA 3NA9L 4YK4B 4D0BA 3GSVA 1DCLA 5JQHC 1NGPL 3OJ2C 3OGCB 1WWCA 3UZQA 3VXRA 1I7ZA 3RDTB 3EYQD 1QA9A 5EU6E 1KENH 2K1MA 4ODWA 2DLIA 4X0KB 2V5TA 4TUJA 4GH7B 5DD0L 1L9NA 4RMUA 2NY0D 1GJIA 2D0HA 3G04A 1A3RH 3K1DA 1FORL 3CXHK 5DHVB 3HNSL 4G42B 1PD6A 2XXMB 5F1IA 2P24B 4I18B 6FABL 2QSTA 1S9XA 4RFNC 1WFTA 2CIIB 3PP3K 1U3ZA 3CU1A 5J6GB 5F7NC 5H35B 1A7OL 3AFLA 1AXSB 1OP9A 4B7IA 3WFCL 4XP5L 3V79C 1WIPA 1JHLL 1FN4A 4X4MA 2EZ0D 2IF7A 3U6RB 3RTQC 3RWJA 2VITB 3VXNB 2P8LA 4DKFH 1U95B 3RY6C 3WSQH 1WICA 2FO1A 2BHZA 5GS1C 1X7QA 4LSQH 4MNGB 5D6CA 1NLBL 1TFHA 3FONA 3WHXA 1OSPH 4TVPD 4JFOB 1G9EA 1H5BB 2C3VA 4EOWL 4CADA 4J2XA 4I77H 3HE7A 1BD2E 1IAII 1K2DB 4AIXA 3HI6L 4F3FB 4U31A 5C92A 2AV7B 1LD9A 4JHAL 3T3ME 3TESA 3ARDB 1FG9C 2CH8A 1YECL 2AJUL 1EZVX 3QB7C 1S7TB 3UZEA 4JJHA 4XCFH 5I66A 3MRLB 4AM0B 1E4XH 4TYUA 5EU3B 1U8IB 2H3NB 5E4IA 1EO8L 1J9CT 4KROC 5EFIB 1K85A 4LIQE 1DVFC 2NY4D 5JW3H 5IBLC 1IM3A 4NRXB 5A2FA 5HHOA 2JJVA 3PGFH 2P42B 3RL2A 3L5IA 1GH7A 1MH5B 3CFBA 4BQCA 4Z5RA 1T7VA 1D6EA 3D0LA 4DGVL 4LCYA 1FPTH 3HS0A 4JM4L 5FYJD 2K9UA 1L4IA 1WZLA 4PJBE 1VGKB 3REWB 1AC0A 3QT2A 2FEDC 5IQ7H 1G84A 4C56B 2DLFL 1NBVH 3MJ9A 4Y0GA 1NEUA 5MEOB 3BW9A 2AV1A 2RAMA 1T7XA 1CZ8L 4JM2C 2G5BB 5JA8B 4PGEA 2NY7L 3IFLL 3QDJE 4ODXA 5I6XC 1AXSA 2NQCA 4HQQL 1AE6H 4P5MA 3IF1B 3QG6B 2BSRA 4KK6C 5SWSB 3CVIL 3OG6B 1BVZA 4W6WB 5K33A 5KVDH 5L9DL 3GMPA 1QTYT 2F8VA 4WI4A 3T0EA 4OCSH 3FT2B 1OP5H 2YA0A 4BELD 3AY4A 5GSRA 5IK3B 3QUML 3SEPA 4PJAA 4U49A 5FK9A 4LCIH 3WJLC 1RSFA 2WBWB 4GKZB 4Z76A 4NOFA 3VFNA 2B1HL 3HE7B 4IRSA 2DYPA 2DKMA 3VXRD 4M3JA 1FGVH 3PXHA 2MKLC 4JZNA 2JJWA 3VXOA 4OB5H 1YEFH 2GSIB 1AKJA 4ZFGH 5C08B 2QHLA 3MNVA 3MBEB 4PJIE 1CE6A 5DI8B 1DQTA 4QHMA 4X6FA 2Z93B 3WJJA 2DICA 2Y6SD 3MXWH 5DMJB 2ORBL 3OR7B 4AG4H 4ZAKC 2V6HA 4HMEA 3ARED 5D2LE 3WIIH 3KPLA 3OG4B 3QWOB 5F9JB 4R4BA 4H20L 5C0ND 4BKLA 5JXED 5IVXE 4GRWB 5J6HA 4YBLC 1CXKA 4OIAA 1MH5A 1X5GA 3FN0L 4POZC 1FSKB 2LVEA 4HZLB 4JKPH 1YEIH 4PJ5B 5JPMA 4FTVE 1KNOB 2VNCA 4PPTA 5FYJL 5FEBA 1NGYB 1YNLL 1HWHB 1RQ5A 4MNHA 1CDUA 3WHE1 4OKDA 2I60L 2V2TA 5E2VH 2OMNA 3O3DB 4OZIB 4WJ5B 2Z8RA 3HZKA 3AVEA 4R8WH 2LTQB 3T1FB 5CD3A 1A47A 3SDAC 3EZ8A 3L5WA 3FQXB 1T22A 3DETD 4LLWA 2X6MA 3P77A 4JAMB 3MV7D 1A1OA 1XGPA 4WU7A 3MCLH 3U4BH 3ULVF 1IKNA 3ECBA 4NRZA 1D6VL 4XI5D 2NTFA 1NCDH 4F9PA 4HG4K 1VDGA 1VACA 1Y6MR 3O8XB 2O5XH 2C3GA 1IGFH 3DGCR 1R6VA 1E6OL 3O2DH 3BQUD 1T5WA 2MQ0A 4MX7B 1Q94A 3JXAA 5C0IB 1KC5H 3L7FB 3QQ3A 4OV5B 1KJ2L 3MLZH 4Z7NE 5EIVA 1IAKB 4R3SA 1QSEB 3UO1H 3S3JA 5IGXH 2GY5A 4W81A 4Y5YC 2XZAH 4X4XA 5L8KB 2VLRA 4WHYH 5DJZB 5GS1B 3MRQA 3T0VA 4F80A 2BOCB 3PIQA 3KJ6H 2XKNB 3DBXB 1U8LB 2YN3A 4YIQA 4YHYB 3NH7L 4HCRA 1PG7L 3CD4A 5D1QC 4EIZC 3U0PA 1G7PB 4GG6F 1JNJA 3UXFA 5IV2B 3IFOB 3GJFA 1SJEA 1FNGA 3INUH 1F8TH 3STZA 1CFSB 2CO6B 4DN3L 4OQ1A 2EIDA 2EXYC 4JPIB 3M07A 1UVQB 1WITA 4YDKH 3PABB 5IF0B 4OZFB 1PQZA 4QTIL 2A0LC 3BJ91 1FSKC 4MWFA 1G7HB 1T0MA 3AS2A 3KYOB 4JY4B 5DC9B 1T3FA 2WUBH 3RDTC 4Y4KC 5ADOH 5I1GH 4M4RA 4D3CL 4L5FL 4GKSA 4MAYD 4M5YH 2J8UF 2DLTA 2GY7B 2WBJC 1ZA3B 1CF8H 2CDFB 4LRNL 4LEOA 3U7YH 1S8DA 3VGGA 5E2TH 5E8EB 4M3KB 4PRIE 1CXLA 3GSXA 1GGBH 3ECBB 3QJHA 4NRZB 5I16A 3H9HB 2WWKO 3PQYA 2XA8H 5AWNH 2H3NA 3IKCA 5GZNC 2VDKH 3OKLA 2DQTH 4IHOB 3QJFA 3BPOC 3PE9A 4IIQB 1W0WA 4HUVB 5EBMA 4XC3H 5GRXG 2MJWA 3TNNA 2VLME 2B8OT 1TMCB 1MEXH 2KQNA 1NFIB 1U9KA 1OHQA 4JLRA 1I8IB 4L9DA 3T1WA 2OMBA 5ANMA 5HVFB 2J88L 3DX7B 5F7DB 3T04D 3RU8L 4HZLA 2EDNA 1CI5A 1IMHC 4MGXA 4UT7H 4HC1L 4OLWH 4TTDD 1F4HA 1Y18A 4YHKH 1AJ7H 1A4JB 5A3ID 1BWWA 5SWQA 4P49A 5CZXC 4OGXH 4LPXA 1AGFB 1HCVA 2W0FB 1WBYB 3V0WL 3RUGB 4XMKL 1KG0B 1YMMB 5IEHA 1VA9A 3MRNB 4O58L 1QYGH 3PV6A 4PJ7B 3M8OH 5HPMA 3S88H 5ADPH 2HKFH 1IGTA 1EHAA 2JIXD 2UYLA 5C0BE 3SGEI 1IGTB 5TFSL 3KNBA 4FQ2L 4YEEA 1U8NB 2IQ9L 5JA9A 3U36A 4LMQI 4ZO6A 5FECA 5EB9A 1WF5A 3UTTB 3ARQA 3ZKXC 2A9NL 2DQDL 3BPNB 4E9LA 3CJJA 3DV4A 4MCZA 5IMKB 4QTHA 2AGJH 4L4TB 4NNXB 3RA7H 1N4XL 3BN9D 1DQQB 1JGLL 5DJAA 4X6BB 3V4PL 2NXZC 2IMNA 5ELIA 2GJ6E 5E8EA 5FDYA 2X4TB 2WIIA 1ZAGA 4X4XB 1YY8B 1I1FA 1CDGA 4DTGL 5B39B 3MXWL 2WANA 3RX5A 3DMMD 2GCYA 2QLVB 5F7WC 3TT1L 1CLOL 4KHTL 3W39A 2GK0A 4IIQA 5I73B 2HTLD 1H9VA 3B3IA 2QQKH 4JFPA 5F97E 5C86A 2PXYD 3EHBC 2ED9A 5DD5H 5C7XH 4ZAKB 4QNPF 4GXUM 1BIHA 1WFNA 5DJXA 5DVKA 4FQ1H 4JY6B 3BX7C 5L6YH 3WDIA 1NQBA 3NPSB 2FYYB 2AI0L 3R8QA 3D9AH 3B9DA 4PJGA 2D7TH 1NCCL 3PDOB 4UQ2A 2VR4A 4HPYL 2VXTL 4OM0L 1DLHA 4RRPA 4YGAB 2OSLB 3QPQD 1MUJA 3OKDA 3VXPB 3EYFB 4UDTA 2R0ZL 3AAZA 4HLJA 2N7BA 1EEZB 2W0FA 1CGUA 1G9ML 3MCLL 4WW1B 5FCUH 1YEHL 4M1CC 1B0GA 3U4BL 1E4WL 2CRMA 1KXVC 1G9NC 3HI5H 3L3GA 3QI9C 2BNRD 4YXKH 2QKIA 5CJ5A 4NQEE 5EOCJ 3V6OE 3IRPX 5FDWB 4EEEA 3LZFL 3DTXA 4PREB 2FX7H 2IPUG 1V7MH 4RGMC 3BKYL 2GJZA 3C5ZD 3HZMB 4GQ9H 4I77L 1CQYA 2WMPA 2J5LC 2HLAA 1EAPB 3JV6A 5EBLB 4WVRA 1MFEL 2DQIL 4OCYL 3V7AE 3H9ZA 2R23B 3HC4L 1YECH 2AJUH 4NO5B 4X6CF 2CLZB 1GGCH 1BBDL 3MYJB 4LDEB 3TYGH 4Z7VE 3M1BB 5I17B 1XF5A 1IAMA 3MYJA 4FQCL 4PP2A 2FATL 2X5PA 2XQYG 3RVXD 2HT3D 3MGTB 2V7HB 4PJFB 5DD3H 1H3PL 1ACYH 3MACH 3QQ4A 5HHPB 3CSBA 4DN4L 1GC1L 4NGHL 4Q6YA 3ARBC 4TNWF 2CDEA 4Y4HA 4YBQC 4P2OA 1TTGA 2X09A 3V52L 3B8YA 4DVBB 4AT6A 3MV8D 1HOCB 1A14L 1F4WL 1HQRB 1F3RB 4Y2DC 1CT8B 1WC7B 5EDXA 3BO8A 4W4NA 3TFKD 5EPMA 2ICWB 2YK1H 1AFVL 3HAEB 1YPZE 3C2AH 1PQZB 3MLXL 2VZ3A 4U0QB 3ABZA 5D1XA 2EECA 1S9KC 3QEUB 5TF0A 5I74C 1LDSA 3LSOB 4OIBA 2V5RA 4R0LC 3IDJA 2E9BA 4TNVF 1CICC 3BESR 1NBYA 3QH3B 4LDOB 3PL6C 3OXRB 4F33A 4QY8A 1TVDA 1UB5B 2L0DA 3UAJC 3W0WD 4N0YH 2I07A 4PV9A 3EYVB 3MXVL 5MHSE 4OZHA 1XF4A 3N1MC 5FV2A 1QRNA 5F21B 5J1TC 2ZG2A 1KBGH 3WYRA 1T1WA 3ULVH 5ERWB 1XGYH 3NMEA 3ET9F 3PP4H 3SKOA 1KELL 4C56D 4ZXBA 1PSKH 1DUYB 3HRZB 4NO0A 4XTRC 3KAAA 4UV7L 4ZNEA 3DI2B 3KYKL 4WWKD 4NO3A 2MTPA 5IQ7L 4H88L 3B9EA 4G6JH 3S37L 5T5NG 1Q72L 2Y06L 5CUSH 4ODHL 5F1NA 2VDRH 5ID0B 4PR5B 1HYRC 3E6FB 3SKUD 3TN0B 1IFHL 1DQMH 3A6BH 3NGBB 1UEYA 4HIJA 4FXGB 1VFBA 3K7UA 2DS4A 1NGZB 4YHKL 4Z5RB 4OIIL 4HIIA 3K81A 5GSVA 4GBXD 4ODWB 2ZCHH 1INEL 5LJYH 2HVKB 4Y5VC 4MJIA 1P7QB 1FAKT 5JUEL 1W8NA 4FXKA 3RPIB 1OTSD 3EDFA 1AIFA 2NY2D 4NQCE 4X6EB 3VG9C 3WE6A 4JPWL 3SDCD 1RZKH 4M62H 5FO8B 4HH8A 3U0PB 1CU4H 4EZMA 4GXUN 5I30L 5I1LA 3OPZH 2W9DH 2VXSL 1OLLA 2IQ9H 5FGCE 5T3XL 1YNLH 3GKWL 5CJBA 3F8UB 3QHZL 2D7PA 3P0YH 2ZKHL 2DQHL 1RU9H 1C5CH 3JWDL 3FQWB 4NRYA 1MHHA 1JJUA 2WNGA 1E6JH 1KIUA 4FQXD 2FB4L 5C0AA 4BFIA 3RBGA 1I9IH 2X4TA 5F7YC 1T0MB 1OAQL 4U3HA 3KPMA 2ADFL 1WFUA 1TJIH 3DVFA 1MWAB 5TPWH 4KZEL 3SKOB 4XTRD 3IAQA 5EUKB 3VXUD 4I8DA 4WY7H 5C9KA 4LSRH 4M43L 3KPQB 3SDAB 4MDIB 4QRPD 4Q6IB 4M8VA 4N1CA 4QRQB 3IS0X 4KKLC 4P2RD 4N0FB 1UA6L 4AT6B 4MB4A 3TF7C 5TQ0L 4E41D 3D9AL 4H8WL 1OAZH 1QFPA 1FLTX 3D1MC 4K71B 2ARJQ 5GRVK 1P84J 5EFIA 2YSSB 1F2XK 3C6SA 3PWJA 4NO2A 1VFBB 1F3JB 3HKFA 3KLAB 2ARJA 4S1SH 1BQLH 1OCWL 3D2UD 4MCYB 2H2SC 1RZJC 1VCAA 3MV01 1EO5A 3TN0D 2EKSA 2AJZA 3P30L 4CMMA 5I76A 2AEQL 3UPAA 4HWBL 4BUGA 1JV5B 3KS0J 3KPOB 1YNKH 3OKKB 4EN3D 2IALB 2FJFB 4ZMAT 4I0PD 1VKXA 3SO5A 4MA3B 3K8MA 2Z8WC 5INDB 3HUJE 4MXQD 1XZ0B 1BEYH 2ED8A 2AJYH 2HT3C 4WU7B 3I3EA 2DQUH 3Q5OA 2EC9U 1DBBH 43CAA 2HJKA 2CLVA 4NQSB 4U1HA 4LCWE 1TETH 4K2UL 3HE6B 3FZUD 2IPTL 2EZ0C 3K2UH 1N0XH 4D0BB 1OT2A 1AGCB 5F89B 1O7VA 3B9KB 1UJTA 2HFFB 2CSPA 3VI3F 3ARGB 3ZKMC 4DEPC 3HMXL 4DK6A 4HWEL 1EV2E 4LSVH 1JPSL 1FFPB 3RWGA 3BUYB 3T0ED 1KEMH 3W11C 1INQB 4L4VD 2AP2A 2WWMD 4K7PL 5GRZA 1G7LB 4WI6A 4QXGH 4P5TB 2NY0C 5JW5B 4BH7B 4UNTA 2VUYA 5DK0B 1S78C 1YJDH 3V5KA 2H45A 4CW1A 4IBLT 3DXAE 2R0LH 2W65A 2EEDA 3C8KA 4OCSL 2GK0B 2E8ZA 2DQUL 1T83C 3QEUA 2XTJD 4EDXA 4PJDB 3CVIH 3EJJX 1J88A 5MI0C 4D9RD 3VW3H 2G9HB 1NCWH 3S36H 5DUMH 2NXZB 1MIEH 3C8HA 1NJ9B 4FZ8H 4J1UB 4RX4D 4IM8A 4P4KA 3PWUA 3IJHA 4OAWB 5IWLA 1FAIL 3PGDB 4DKEL 3CLFH 1DR9A 2EYTB 2FX9H 4ELKB 1AQDB 4ZFFB 3VFTA 4HGKC 4HKBA 3LS4H 4XWOC 3V5DB 2GT9B 2P5EB 5HHVH 5E8OB 4AQ1B 5B38A 4OI8A 1AO7A 5LWYH 1Q0XH 5IVZB 1A5FH 1BZ7B 5IW6B 2ZCKH 1JPTL 2XZQH 3WNPA 5E08L 1BREA 3N1PC 3S35X 3PHSA 4NWUH 4NUJB 5DD6A 5GGTA 1IC7L 1IGYA 2J2ZA 5TE7H 3SDXF 3T8XA 3O4LD 3F5WA 3U4EA 4LPVA 2A83A 5EOCL 1I4FA 2CKBH 5DWUH 3VGEA 2P5WE 3F5WB 4XXDA 3RZWA 3RA7L 4ESKA 4Q9CA 4F58L 4ODTL 2UV3A 5MHSD 4XXDB 1YN6B 3HRPA 1MIEL 4JFFB 4W6XB 3WIIL 5C0FB 5DT1H 2VISA 2VLKD 2VR9A 5E7BA 2EE6A 2W0PA 2AJSH 4MHHI 5KVFL 3B6SB 3G08A 4NQED 3HS0B 5F7DA 3WLWC 1YEEL 5HY9A 5ADPL 4WI8A 2M8XA 4XNMA 1JZ4A 3OKOB 3L95A 4NQVB 3SO3B 1YEIL 1QBBA 3R06B 4RGND 5DS8A 4YWGL 5DI8A 1T4KA 1QPPA 1IBGH 2GITB 4FFWC 3C8KB 4G7VH 5F72S 5EN2B 3QO0B 1N59A 4OF7A 5E4EB 2HJLA 1LILA 3M45A 1FNGB 4TTDC 2DTMH 3PV6B 4EDWL 4MQ7B 1HIML 4HWBA 2APFA 1B3JA 4ZUUA 2OI9C 4RAUA 4RGNC 2Z8VC 2CGRH 2YWYA 3D39A 5L2JB 4XPBL 4G9DB 2C7UA 4YFEA 3WNNA 3MO1B 1QLFB 3BEVB 2MNUA 5FECB 2Z91A 4KMTH 3ARGA 4Q74A 2PW2A 5KVFH 5CILL 5CLTA 2FJGA 4R7NB 1U58A 5IVZA 3UTOA 1ADQA 4PLKD 3GJFH 1UB5A 4E41A 2V5SA 3RHWK 5I9QB 4WY7L 5HGGS 3ZKSD 2EIZA 3GEWB 1A0QL 1RHHB 4Z95H 3NAAL 4LPYA 4U6VH 3S4SA 5I1AB 3MBEA 3WDHA 2R39A 2PYEA 1OAZL 2VLJA 2VTFA 5FYKH 5TDPB 5I15H 5EC2B 2Y07H 2WIMA 3WNOA 1RUQL 3Q1SL 1MFBH 3TO2A 3KPSD 3GMMB 4XPTL 3P2TA 3S96B 1J8HE 4JANB 1WTGT 1HIMH 4P2RE 4U1JA 5LGJB 3VXSE 1JHKH 2VISB 3GMMA 3Q2CA 1J1PL 2KH2B 2PTUA 4OGAD 5FKAA 5CCKH 2ZG3A 2A0LD 1YQ2A 2BVPB 4Z0BL 4MA8H 4QTIH 2F54A 4DN4H 2WWMC 3FFCA 2NW2B 1NGWA 1G0XA 2OR8A 5D2LF 3GSUB 1UZ6F 3PWUB 3WDJA 1FZJB 5M95B 3KPTA 4XAWL 4LVNC 3VCLB 3C08L 1Z3GH 1F4WH 1AGDA 4G7YH 4J23A 4YAQB 4M5YL 2N1KA 5DZLA 1OWRM 2PO6D 3H3BC 3S5LA 2EYRB 4NNPL 5DVMA 3QUYC 5JOPE 4KPHL 1FFNB 1T04B 3HG1B 4JFYA 1CL7I 3DROB 4G6FB 2N7AA 4YFLI 4TQEL 3EGSB 4ZS6D 4GRWF 4KJYB 2KKQA 3ZTJH 1MAML 4ODVH 2X1OA 3TCLA 1VGEL 5DLML 5D72H 1G0DA 5GGVL 1JZ6A 4IDJH 1FGVL 2VLKE 1BFVH 4WGWB 3IDMA 2H9GB 4WW2F 4FTVB 4UB0L 1BM3H 1R5IA 1AY1L 2Y25A 5DFWH 5CJOH 3A6OA 5DK3A 3LB6C 2H32H 2WSKA 3NPZB 1VPOH 1S7SA 4OZFH 5ICYB 2FH6A 1T66D 1T6VN 1ZGLM 3O4LE 2PW1A 2Z93A 1EPFA 3U0WL 4Y4FA 4EVNA 4M6NL 4HGWB 1T2QL 3QWOA 3V0WH 5KZCB 1LO3L 5EU5B 4C55A 3ULUL 3QPXH 4X6CB 5CSZA 4LFHG 1HILB 1IRAY 4WNQB 5J6HB 3I3BA 3WN5B 5DUML 1NGXB 1YNTB 4WHDA 4PS4L 3HPJA 1WBZA 2GJJA 3QEGL 1SMOA 3CFEB 4F7CA 3TPUA 3BUTA 1P7HL 3MROA 2C9AA 3X13B 4ELKA 1AR2A 3D3VB 5T3ZL 3PDOA 4HDIA 4NM8L 3B43A 3D0VB 4NNYB 5D7IF 1J11A 4YC2B 2Z0BA 1N4XH 3VFRA 1B2WH 4DGIL 3BEWA 3QNZB 4PY7B 1A02N 3S97C 4IRJC 2BSSA 3IU3B 3SGKA 3RFZC 2Z31D 2YD6A 3GKWH 3JUYA 5IJKA 4K71C 3BZEB 1Q1JL 4NZTH 3DROA 3H6JA 5IBTL 1QQDA 1MCDA 1EFXB 4OZGF 5CBAB 4JVPA 1L7IL 1U2HA 1ORQA 4YQXL 4I4WA 4U05A 4RISH 4IS6B 1CDYA 2CJUH 3OKLB 4NO3B 4WENB 3T0EE 4I0CC 4GRLB 4I0PA 3NN8A 2DL2A 1XMWA 1CLOH 4KHTH 5J1AB 3LEYL 2BFVH 4M03A 2FHFA 3S7GA 3DV4B 4MCZB 3QEHB 4RMSA 4OZGB 3VI4F 4JFHE 2VLRB 2ADGA 4OKVA 2YRZA 5IBUG 3E3QE 5C09B 1T03L 1OTTC 4YHZL 3VXME 5B39A 4LKXB 1DSFL 1S9XB 4KAQH 4RGOH 3RZCB 3WSQL 4YX2H 1RUKH 3PWPB 3L3HA 4WI7A 4BSWA 1W72L 1INQA 3BOVA 4HGWA 1QFOA 4LU5H 4YAQA 4UIKL 4JQIH 4K8RD 5D8JH 4LQ1A 4NZTL 1M6OA 3F7YB 3RWJB 3GBLA 4WWKC 4NDMA 4XVSH 4Y16C 2BMKA 3AMLA 3VWJB 4JDVB 2V9QA 3PHOB 2I9LB 4JFXB 5MP6L 5FF6A 4EDXB 1ZT7B 3VXMD 4X9HA 1L6XA 4M7ZB 5ESQB 4GG6A 3MFFB 3L5HA 2PW2B 3I02A 3CH8A 3LS5H 4U6TA 1JUFA 1EFQA 5LQBL 2IANA 4HQQH 3BKYH 5FGBA 5F7UA 5L0QC 4MS8C 4CVZA 2ZCHL 3BGAA 3QCVL 5HHQA 2Z31B 4S11A 4FTVA 1J0YA 2IANB 3U48A 4JPKL 4NC2B 3ELAT 3SJVB 4I9WE 4KZDH 2J4WH 2DDQH 1T1XB 2EIZB 2D2OA 3GHBL 4QHUB 3TJHC 4PV9B 5AWNL 5HGAA 1OP3H 1ZVSB 3F58H 1DQDH 1WFOA 4UIKH 5JOEA 2PXYB 3LQMA 3L7EB 3CFDA 4JM4H 3PDGA 1HZHH 5HYSA 3VXUE 3EOBB 4TNVK 2GJZB 2IAMB 4U1IB 4Y2DD 4YHPB 1Z5LB 1B4RA 1Z9SA 4XNXL 5FKAB 4OLXH 3UZVB 1URLA 3DYMA 3P0YL 5LXGH 1VB9A 5D6DA 1C16B 5HD8D 4WHTB 1KF9B 1X5ZA 3GMRA 5BRZB 4RNRB 2L4OA 2FYYA 4PR5A 1FZJA 3SDCB 1II4E 3IJSB 2FJHB 2P47B 3JBG7 4ZO9A 2J6EA 1J87A 5JPNA 5HGBA 5MENA 5ISZB 1N5YL 2MQ3A 4UTBL 3BP5B 5GS0C 3VD9A 2OR7A 4YFLF 4P9HC 2APVA 4J12A 1CD8A 2NY3D 5KOVC 1D5ZB 1KG0A 1KCVL 4O4YH 4UDTB 1HH6B 1JZ2A 1U6AL 1ZMYA 4CU7A 4XC1L 5HHME 2R69H 1CD0A 4K8RH 2GITA 4KJYA 1RZGA 3ALPA 4ODVL 4XWGH 4RMQA 5INDA 1M7IA 3ARDD 3VI3E 4B0MM 1FN4B 4GAFB 2CIKA 1FRGH 2HA1A 2BC4B 5IVXB 2VE6B 2VAJA 3UTTA 3ARXA 1XAUA 2BNQE 1GGTA 2OJEB 3H9YA 1I8KB 3O3UN 5SX5H 1ZHBA 1V3MA 4QYOB 4X99A 5ITBH 5IFJA 4QRSA 4JO3H 1C5DB 1BJ8A 5KZCD 4OIIH 1QLEL 1FL5A 4K7FB 1QLFA 1DBAL 3BEVA 4UOW0 4I3RL 4Y5XB 5HVWA 2YPKA 3OAYH 3MRPA 4GKNB 2VN4A 1FFPA 5J3HC 4U1GB 1FORH 4GXVL 5KW9H 2KQMA 2B0SH 2NX5E 4OV6F 2APBA 4Y7MA 3WNKA 1JZ8A 1WWBX 1TPXC 4MXWH 2IAMC 2Z92A 4GBXB 3MV7B 4FP8H 2X4UB 4MXVE 2J6EL 2GTZB 2PXYC 5I66B 3SO3C 2X4UA 5D93C 2HTLC 4PTUA 5KSVA 4XXCA 1TTUA 2D3VA 4HPYH 1UKSA 2YD1A 2P7TA 4L29A 4ETQB 1UT9A 3CH1B 3O6KL 4F7MA 4H1LH 1B0RB 5I1DB 2B20A 2APXA 4BSVB 4TUJB 1GSMA 2P49B 1NMCC 4AYFA 4LLDA 4KV5E 4BZ1H 1V05A 2FEEI 5I8OH 5E9DD 2JJSA 3EUUA 5DC4B 2HN7B 2H32A 2PO6B 5TPWL 1MFDH 4N0UE 4P46B 5DGQA 3IAPA 2R1WA 4PFEA 3PF2A 1A7QL 1JNHA 3VDAA 1FPTL 1WEJL 1U93A 3MRGB 1BZ7A 3C2SA 5H37G 3U46A 4MLIA 3UTSB 5IW6A 1F3DH 1U41A 3MJ7B 2ZUVA 2ESVE 5GRUL 5DGRA 5DRNA 2IH1A 3K1KC 3DLQR 3UTPE 2YUWA 3QXTA 5KSAD 1ADQL 3O41A 1FG2B 3TO4C 1FFOA 2XRAL 1PW3A 1CFTB 3QRGH 5CD5C 2CUHA 4PJIF 5C3TA 1AHWB 2DIBA 4FZ8L 3N1GC 1JGUH 2AXGB 1C5DA 1KJ2A 1LE5A 2C26A 2NYYD 3AS1A 4TUOB 4IIQC 3L3KB 1LP9E 3IVKB 3ZDYE 4LKCA 5FM5M 2WZPD 4IEFB 2XA8L 4JHWH 2QADC 3GSWB 4NPYB 3ARRA 4P2CG 1KCUH 4X6DE 5JW4M 3G08B 2XWTB 1A6AB 3G5YA 5DUBB 5ALBL 4PGDA 2F74B 1A7PH 1MCBA 2CDGA 2XKUA 4Z7UE 1D5ZA 5E1AB 4KRMB 1G6RL 4N0FA 1AD9A 3CIQA 1LE9A 1U3HB 1A6VH 1HKLL 1K4DA 5F93C 3QEQE 1RK0A 3OAZK 1MIMH 1Q9LA 2LVCA 3KPRA 1MCPH 5C6TL 4K3JL 3OQ3B 4WWID 3L6FA 5CIPH 2CQVA 1ZK9A 3GRWH 2ARJB 2ZPKL 3KPRB 1F90L 4FG6C 1NAKL 2HRLA 5KS9B 1R0AL 4M6MH 3ALWA 4OFPA 2NXYD 4O2CA 1KACB 1A6TA 5AYUL 1DE4B 3LKSB 4S1RL 1I8KA 4K3EL 5HDLA 2VDOL 5HXMA 1FBIL 1JWSA 3HE6C 1FC1A 4Y4KD 3FN9A 2J3SA 3VWKC 2ICES 3MLWL 1SEBA 5J11B 2GT9A 3HMXH 4XWOD 3MRPB 2A6KB 3UTSA 1Q9WB 2IQAB 5CFHA 3SQOH 3PWLA 1VGEH 4PRNA 2NXYB 2AAVA 4NKIH 3Q3GA 4LLWB 4NUJA 1LWRA 2OTWA 5E2VL 1ZHNB 1FG2A 1KJVB 2P4AB 2XTJC 4Q2ZA 1XF1A 3V9FA 4GW4A 4EQ3A 1UYWL 4YBHA 4YZFF 3JUZA 5JDSB 2FJHA 2MMXA 1RZFL 3IJSA 2Q8AL 1CFVH 1KCRH 3D3VD 1L0QA 2GYSA 2R1XB 4P3WA 4IRZH 5D7JB 2ATKA 2R29H 4Y2DA 4BFGA 5DHVA 4ZTPL 4MCYA 2ICEA 1PEZA 1SJHB 4OKVB 5ID1B 1FLRL 1VGKA 1LEGB 1JTOA 3WE6B 1HH6A 2HN7A 5D7KE 1VHPA 4YPGB 3ROLB 4FQ2H 3W82A 5CEZH 1UM6L 5DA4A 1HHHA 1JPTH 2BSTA 5JHDE 4EUPG 1EHNA 4ACPA 5J3HD 1RK0B 2A1WH 1YA5A 3GO1L 3ROLA 2EDEA 3BD3A 3Q6GL 4LHQB 5H35A 1RY7B 1KIQA 1ZS8B 2YPLD 1D5BA 5DSCA 4YDVA 4HKZA 1X7QB 3KPSB 5CJXC 1MVFA 1SYVB 5I1IH 5DD1H 1N6QH 1YPZA 1NGYA 4HUWB 4D9QE 3U79A 1F13A 3DIFB 2P5EA 4GG6B 2HTKC 4TSBH 4WEMB 3M17B 4R26H 2R1YA 3O0RH 4XP1H 5JHLL 3MRIB 4IOFD 5LAXB 2MPAH 4GG8A 1RI8A 3OZ9L 3C09C 3QUMB 1I9RL 2FBJL 3SJVA 3RJDA 3QDMB 5IG7A 3Q3GB 2AK4B 4PRHA 5T1DL 3PUCA 4WFGE 4KMQA 3I9GL 4P2QE 3CSGA 5FM4A 1F4YH 3U0TA 4JN1H 1T7ZA 2DD8L 1U36A 3GUTB 2A9ML 3VD4A 3O45A 1E4KA 2HLFC 4HIEB 2P8MA 4DGVH 4YDKL 4F15B 5CBEB 3O45B 3CLEH 1NBQA 4KKLD 4BZ1L 1KSRA 1C16A 1T1ZA 1XR9A 3F6LA 5IBTH 4O9HH 2XXCB 4EDWH 2BXYA 1D6EB 3D0LB 3MRDA 3N9GH 4WW2C 2H2PC 1KGCE 5D7JC 1NMCB 2B4CL 5EU6A 2VZSA 3KR3H 3T77A 3LZFH 5IROC 4ODXB 3D0VA 4DVRH 4GRMA 4MD4B 4NT6B 3MUGA 3VH8G 3ZL4L 3UJTL 1EAJA 1QACA 4MA7H 4NQDB 2VDNL 1FFQA 5DMYA 4GLRI 3HC4H 5F9AC 1HDMA 1MHEA 3IF1A 3REVB 43CAB 3DPBA 4YDVB 3P73B 3UTQB 4QRPE 4X8JA 1FFNA 5KVDL 4AIZA 4BQ6A 2OJZL 5HVHB 4P3DB 2YA1A 3EOYG 2A83B 4KK8D 3PNWB 4QWWD 4OF8A 4AIZB 5K9QG 3S36X 1KJ2B 1LE5B 4H0GA 4L8CA 4FNLH 4H1LA 1J1PH