1DQTA

The crystal structure of murine ctla4 (cd152)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of murine CTLA-4 and its role in modulating T cell responsiveness.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CYTOTOXIC T LYMPHOCYTE ASSOCIATED ANTIGEN 4
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqtA00
4BM7A 4IDJL 5KSVA 4J4PD 5I30L 2HKHH 1NL0H 2VC2L 4XCFH 5DMKA 3ARPA 3G6DH 2NZIA 2EZ0D 3GSXA 2VLRA 3SDXE 1U95A 3QULA 4BSVB 3E1F1 4PD4J 2Z92B 4U2YA 1PZ5B 4TSAH 1EZVX 5GRUH 3TN0D 4FQPA 4OZHA 3I2CL 3OAYK 3X13A 1XGQB 2JJUA 5DSCA 3OKLB 3FOMA 4JG0L 4R3SA 3VA6A 4RBPH 1KTLB 5H37G 5F6IC 3I3BA 4JRYD 1MY7A 3HNSH 4YHIB 5ESAA 3U9PH 4Y4FB 1HKLH 2MKLC 4G6AC 4M5ZL 1RIHL 4IEFB 2R9HD 2CK2A 1BVKB 2EXWD 2FX9L 3CDCA 4UT7L 4P2CG 4P46D 5AYQA 2VUYA 3TT3H 4P23A 1CFNA 1J0HA 1Y18B 5F7NC 3Q5TA 1R5VB 3T4YA 1V3JA 3LPWA 2VABB 2KPNA 5FXCH 1P1ZA 4MDIA 1HYSC 4PJEF 4NKDB 3BT2L 4Y4HA 2DLTA 1UYWL 1W2KT 5D70H 1KJ2L 1HHJA 3I6KB 5GJTL 3KGRA 2PYFA 1SBBA 4RMUA 1XAUA 4PIRF 1I1RA 2GCYA 1BM3L 1OT1A 4FNLH 5DD5H 3WHE1 5E9DE 1BWWA 5FK9B 3QXWA 5J13B 4G8IA 3DTXB 5IVZA 5F9OH 1JUFA 5C08E 3WS3B 5LG1A 1IQWL 1JNLL 1YMHB 5TQ2H 2VXTL 1KLGA 1JGLL 5IVXA 5KSUB 5F96L 2Y25A 3SDCC 1DN0B 5HYEA 2YEZA 1JZ7A 3RDTB 4MA3B 1N59A 1ZGLM 2BNRB 5IFAH 1NCDH 5I17B 3LY6A 2ORBH 4Z6AT 4YHYB 4Z78B 3MV8D 4K7PL 3LD8B 1S3KH 2DDQL 3L5WA 4JQVC 1FG2B 1D6VL 2HFFB 2CLZA 2OJEA 2DWEA 3ZKXC 4BK4A 1DE4A 3UBXI 4PRIB 2OI9C 4Y16D 3WHE0 4ZD3H 1YEKL 4KDTC 2R1WA 4LRNL 4G7YL 3TVMB 4LLVA 5J12C 4QOKA 5HD8C 1I9RL 4KHTH 1K3ZA 5D9SB 2IG2H 3KPNA 4Q58C 3T2PA 3Q6FB 5FIEA 3THMH 1VKXA 3MRPA 3AS0A 3RVTC 1IC7H 2JELH 3H3BC 4KKLD 4LVNC 1MFDH 4L8CA 1TPXC 3PNWB 5CJOH 4KKAC 3EZJB 4PJ9A 2VDML 4NQXB 1I9EA 4ZOEA 2GIYA 2H32A 5AZ2L 2XZQH 3ZE0F 2WZPD 5JHDB 4NC1C 3RIAK 4YXLL 1VPOL 3BH8B 1S7SB 1M7IB 3GM8A 3MREA 3O41B 5BS0B 2ICEA 1RUAH 5I1IH 2G75B 2GTZB 2LE9A 2YKLH 4EDWL 1F4XL 3EHBD 3GO1H 4L4VB 1MPAL 4Q0XL 1QBLH 2OSLA 4MS8D 5I2IA 3PWPB 5HYSA 2LVCA 3L5XH 3T0VA 2WSKA 5D1XA 5FYKH 4Y19D 2PUQT 3MRFB 5A1AA 5AUMA 1EEQA 3QA3A 3BXNB 1OGTA 1SM3H 5JQ6L 2QEJA 5B3NA 5L2JB 4AZ8A 3BRGC 1Q8MA 3ARGC 3MYZA 4LASL 3X3GL 2IAMA 1IGTB 1XGYL 4JPIB 1U3YA 1FHGA 4JM2D 1FVDB 4OLWH 3G6AA 5I8CB 1NLDH 5HDQH 2WAHA 3DX6B 1V3LA 3FONA 3QDHA 4P4KC 4YHLH 1H0DB 3L1OH 4KTEH 4NYLA 3PWPD 4H20L 1HHHB 3EOBA 2ADGA 4XCCH 1DQML 3TNMA 3GK8H 3OKEB 1OP3K 4CMMA 4JAMB 1KB5H 3VXRB 3C6LB 1VESA 1WWBX 1HQ4B 2C26A 1N8ZA 2X44D 3RWEA 3ZT6A 3N1MC 1CU4H 2PO6C 1REIA 2NY2B 2AEQH 2AXGA 4U49A 4YWGL 2H6PA 3S88H 5K33A 3VD7A 2EIEA 5HI3D 3JWDL 1I8IB 1U91B 4PJIA 3R1GH 5K9KA 1KJ3H 2X4UB 2AAVA 4ZUWA 3AROA 5GGTH 4K71B 3MYJB 1EGJL 4OIIH 4PRPE 5TFSH 4NOFA 4WRLA 2J8UF 1RUQH 3NIGF 3S96B 3D0VB 5I16A 2OM5A 5ESQA 4G9DB 4Y19E 4HIJA 5LQBH 1BZQK 1MRCL 2FATH 5KS9E 3B4NA 1UA6H 2Z91B 3GB7A 2HJLB 1JYNA 1M7XA 1BQHG 3OXRB 2FO1A 4BSJA 3LRSA 1YN7A 2VKWA 3MRQA 2BVPA 2E7LA 3WFEH 2P47B 1FN4B 1S9WA 2ICWA 2EE3A 3EUUA 1NGWA 4MAUH 4OCWH 3OHXA 4MQSB 4YPGA 3PJSA 1AR1C 5F1SA 4ZOBA 4DAGL 3TBYB 1OB1B 3DO7B 1QA9A 4UMGA 3JTTA 3OKMA 3W2DL 5EO0B 3U9UA 1G7QA 4M62L 4ZPVB 4IDLA 3DV4A 5FDYA 4O2FA 1B0RA 1WFNA 3WE6B 4HWUA 2B7DT 1MI5E 1GCFA 4NNXB 2ESVE 3GJFA 4EI5D 1BFOB 3OKYA 4XRCB 4OUUA 1KPUA 4Z7VF 5GRVK 5BMFL 5MI0C 4UDTB 5EOQL 1I1AD 2DQIH 1Y18A 2YZ8A 3CUPB 1QSFA 2Q7YA 3HC3L 2V7NA 5IHBA 2Z8WC 5C0AE 3ZHDA 5ICXB 4YHPA 2JJSC 4MXWH 2XQBH 2JIXD 2DF3A 4MNQB 1DSFH 2HT2C 3L3KB 1J88A 2VXQH 1TENA 4KGLA 4N0FA 2P8LA 5GSRA 5H37H 3G6JF 4LAQL 1OL0A 1F6AB 2ZKHL 4RFOH 5IF0B 2EDQA 4JFZH 4ZNCD 3RDTA 3GI9H 1A1OB 1N59B 3EJZD 2FGWH 3BP7A 3H3PL 4LSQL 4NRXA 5HHOA 3GSXB 4JFFB 2DQTL 1T03H 3MODL 1EAPB 4NQUA 4NZUH 4WUKL 1DLFH 1EHAA 4NZDA 1R5WB 1UJ3B 3V0AC 4LGSB 3L5IA 4JM2B 4DUXA 3QUKA 1CD1A 1XGPA 4QCIB 1QLRB 1IL1A 2N7AA 5F6HJ 3VGHA 1GAFL 3T2QA 2A6IB 4K3EH 5C0IB 4WJ5B 4NOBA 5DJCB 1VFBA 2Q86B 3MUGB 5F7EH 3TCXA 2I9TA 1OPGH 3BKYL 5FUCE 1YY9C 2M8XA 4V1DB 1FVCB 4NWUL 1TZGH 3SGJA 2AJYL 5D93B 4BZYA 3P2TA 2W92A 2VABA 3PQYD 2GSIB 1U92A 2ZUQB 2IFFL 4KK8C 1DLHA 5J89A 2BRRH 1FNFA 2O5XL 5D1ZC 1XIWB 5HYJB 5ID1B 4LLVB 4QRSA 3U7AA 3T0AA 3Q5YA 4NQVA 4NZTL 5DK0A 1EUUA 2VR5A 5C07E 4IIQB 2GTZA 2ENYA 5E70A 4WO4D 4L4VA 3LEVH 1AGFB 2NX5E 1TZHA 1G1YA 3SDDD 1CG9B 1MVFA 1N0XL 3QYCA 2W59A 4KZDL 2OL3B 3KLSA 4OF6A 4EIGB 1GGIH 4OQTL 1MLBB 4G9FB 5EUOB 5AUMB 3MMEA 3MV11 5I6XC 4XAWH 3QDJD 4OBSA 3WO3B 2AJSL 4Z7VB 2VQUA 4FFWC 1I85C 4QY8B 5ENWB 4NC2B 3WJJC 2PYED 1BECA 4LSSL 3RP1A 4LQ1A 1D5ZB 3HNVL 3MLVL 1X6NA 4KHXL 4Y5YB 2WUBH 1IGTA 4MXQD 4W4OA 4HUWA 1RUMH 1EFQA 1PLGH 4L9LC 1DUYA 4GAGH 4PP2B 3WV0A 5K9QI 1FNLA 1A1MA 4WEBL 3QEGL 2FCBA 3R8BB 4A6YA 3NCJL 2MCG1 4FFWD 4HQQH 3O6LL 2YRLA 4M61A 3RU8H 3O81A 4CMMB 4M8QA 3EOYG 1JPFA 4H8WL 4UV4L 3OJDB 3CH1A 5T1KD 3CNKA 1BF8A 3OAYH 3V8CA 2H9GA 3CH8A 2FR4B 1JNHB 1E4XH 3IT8D 3AFLA 3LN4B 1NDGB 4URTB 1X9QA 2ITCB 4CMHB 2VAJA 5FCUH 4JFYA 5ESVA 5HPMA 3GJFK 5T1MB 4U4BA 4P57A 2VXSH 3MRKB 5C7XL 2VDLH 4XNMB 4F58L 3HUJF 4LMQE 1EXUB 1ZLVH 5H8DA 1TITA 3X14B 4KTDH 5DLML 4D94A 3VFSB 1Y0LA 5D7LE 1MRDH 3QCTL 4U1LA 4HPOH 3CFKA 4N0YL 5DDHA 4HXBL 2Z91A 1HXMB 4HIEB 2BVYA 4RGND 3RAJH 3RUGE 1S7SA 1KCUL 4TULH 3BEWA 1MIEL 4AK1A 3S34L 4MQXC 4X8JA 1N3NA 5GJSH 2COQA 3NTCL 2BNQA 3PWLB 2B2XL 4R4FH 1JHKL 3TV3H 3ALPA 5J1SC 3O2VL 2NY7H 4APQA 1FZOA 1IZJA 2CO6B 2I9LB 2YA2A 4CU7A 5DR5L 2I27N 5HDOA 4QLRA 4WFFE 4XTRD 5DHVA 4YXKL 3VFOB 5L7XL 1CLYH 2EKJA 1MCFA 1KIUA 3G6AB 4V1DD 4LLUA 4LDLB 4WGVB 3TBWB 3AUVA 3MACH 3SCMB 1TZIB 2YXMA 3ARBA 3RPIB 4K3DH 2CRYA 5KBNC 1QHOA 2EH8L 4ODXA 3SE4A 1IM3A 4F37K 1XIWD 3BFOA 1P84J 4HKBB 4FQJH 4BZ2L 4YHPB 5J0BA 3FAXA 1G7QB 5FDWB 3BI9X 5EFIB 3O3BB 1GHFL 3O8XA 3I6LE 1I7RB 1F11B 3DRQB 5DGQA 4LIQE 3U9PL 3SKNA 1MELA 1R3JB 4U6VH 4XRCA 1RZFL 1H3VA 3VGGA 3DUSA 3MC0A 5DVLA 4HUUA 4IRJB 4K94C 3L5XL 4M7ZC 4U7MA 4RWYL 3VCLB 2EIZB 1F8TL 5C0DB 1EUTA 1D5MA 1T2JA 2CSPA 4C83A 1VHPA 3IDYB 4TSBL 2IBZY 3U46A 2XI9A 2NYYC 4NO2B 1IKNA 2GAZB 3F7VA 4UT9H 1DVFB 3H2WA 1I1CA 1FRGL 1XZ0A 1XGYH 4XVJH 3EYQC 5EZIL 4JG1H 2ZWLT 1ZANL 4W4OC 3ZKND 4MX7A 3ZSTA 3DO3A 2V9RA 1QEWB 1J0IA 3ULVF 5MP6H 1EO8H 1YN7B 4R7NB 1LGVA 2BVUA 4AM0A 1VENA 3FFCD 4NQCE 5L9DH 4N1HB 1GC1L 5EO1A 3TO2A 1HHGB 1M6OA 1GZPB 5DXWA 2VZ3A 1G9NL 1S7TA 4XPAL 1CFBA 1R5WA 4LPXA 1R3LA 2OR9H 5TE7L 5DEFB 4K3HA 1NGQL 5SV4A 4Y4FD 2GSIA 2GY7B 5SWZB 3DMMD 4JHWL 1CICA 4N0UA 2A6IA 3OKMB 5C0IA 1C5BL 1HXYA 1JPST 5GGQL 1J86A 5T1KA 4U6HA 4UNUA 2UZIL 1LO4H 5I8KL 2I9TB 3V2AR 1BQHA 1DANU 3UYPA 4RDQG 1X5XA 3GNMH 1C5DB 5IK3A 3UJTH 5HGDB 1CTNA 3VXSE 4PJEB 1U36A 2OL3A 2QQQA 1UXSA 1RK0A 1NSNH 2QKIA 1JI2A 2V7NB 2H3NB 5D1QC 1DDHA 5SWZD 3KPMB 4TUKH 2NY5H 3QNZA 3HZVA 2FJHA 3TPUB 3HRZA 5BZDB 3OJ2C 1Y6MR 4AIZB 2A0LD 3ZE1F 4FTVA 5E2UH 1N64H 5CIPH 2DM7A 4FRWA 3ARBD 2BY1A 2JCCB 1OY3B 3T77A 1EPFA 3Q1SH 1BOYA 4H20H 4ZNEA 3S35X 2IG2L 4AENA 3MRJB 1YZZA 5F7DB 1CG9A 1J7VR 4I13B 4CN1A 1VGKB 3FB7B 3TO4D 1JZ3A 3LRGA 4PJ7A 3DX8A 4XNUH 5CBAB 5T3XL 1ZTXH 1FH5L 4L1DA 1IEBB 1W0VA 2OTWA 4H26B 3BH9A 3NGBC 5DURD 3RNQA 4M7ZB 4M1DL 4LSTL 3BKMH 5F96H 1FFOA 3WLBB 4HC1A 1JF6A 3BQUD 5I15H 1BGXL 3P9LB 2Z31D 4HG4J 1CWVA 4MQ7A 3UYRL 3QPQC 4L9LB 4TUOA 5D1ZA 2V17H 4JZNB 4ZAKA 4QKXB 3LN4A 2W9EL 4U1HA 2P5WD 1GPOL 3TJEH 3P0YH 4OV5A 2C1PB 1V05A 3SGJC 3QG7H 5IKCB 1IAKB 4QHUA 5I6XB 2MNUA 3FOLA 3H42L 3IDIA 3LS5H 4UTAH 1QSVA 1DEDA 3LN5B 4EEEA 4JEGB 4NQEE 2F54B 5KSVB 1Q9OB 4R96B 5IV2B 5EC2A 4MD4A 5IMLA 3IB4A 3QJHB 5IBUG 3FN3A 1JZ5A 2D3VA 4UILH 5TPWH 5HPMB 2AK1H 2R2HB 4HJJH 4NKIL 3VXQA 5DWUL 5JPNB 1YA5A 3IJYB 4P2YA 3K8LA 2IQ9L 4JFQB 1U8PB 5BS0D 5FHBL 5AG8A 1PY4A 1IC4L 3Q5OA 2PTTA 3X13B 2D03H 1AI1H 1ZLSL 5DSCB 1DBBH 1N2RA 5GS0H 1P4BH 1G6RB 3DHMA 1JI1A 12E8H 4OTXL 4ETQB 2R15A 4HUVA 3TT1L 3P9MA 4YHZH 5IB1B 3WFHA 3EO0B 3MNWA 4HGWA 2GKIA 3SCMA 5B38B 4JO4L 3WSQL 2C3VB 2IQAB 2HP4A 4OGXH 1BX2A 4P2RD 1IILE 4JFPB 4QNPE 2ICCA 2BVTA 2VXVH 5GGRA 4KZEH 3G5ZA 1SY6A 2ED8A 4KKCC 2EC9U 1YY8B 1S7QB 2BSSB 4NJ9L 1QFOA 1ZOXA 2R8SL 3L1OL 3T0EA 1YMMA 5SWSA 1LEKB 5GRVL 3MFFA 3GSOB 1G7JA 4QXUH 5ICZB 2A6DB 1K4DA 4OAWA 2YPLD 3RBSA 5C86A 4GSDL 4U6XA 1GGBL 4P9HC 1XF1A 1F58H 2MHAA 3N85L 5FYKE 3SCMC 4PLJC 4DZ8A 1QSFE 4FABH 1BZ9B 1UWEH 4PBXA 2EXYC 3WXWL 1I4FA 5C9KA 1HHJB 3I6KA 4KVCL 1HOCB 1HXMA 4R97C 4NGHH 2HFGL 2D31B 3SE8H 5DD1L 5ACMA 3NPZB 4HX1B 4OQTA 5BQ7B 4I2XE 3G08A 3VCLA 1TZGL 3U79A 5ECJE 3EDJA 1S9VA 2GW5A 3WXVH 3W0WE 5D1XD 2R1YA 5E8NB 5EB9A 4NDMB 2CLRB 1WT5C 4U1SA 1N7MH 3D5OF 5GS3A 5DUML 3VRLE 4FFZL 3KPRE 4P5TC 1LP9B 1F4WH 2PO6A 4KRPC 2Q3AA 1AGDA 4YFEA 4HFWA 1U93B 4ELME 3L7EB 3MRPB 3MO1B 1GGIL 2LFGA 1T03L 4OCXH 1IQDB 5C0BB 1UWXH 3F8UB 5AD0B 1U3HC 3WEXB 4CVXA 4F58H 1DE4B 4J6RL 3GBLA 4PJ8A 1T0PB 1EHNA 5KOVC 2YS4A 2VWEC 4Y2OA 2OTUB 4DOHB 1O5DT 4NQDB 4NWTH 1BD2A 3O6FB 1ES0A 5I71B 2JF1A 2IGFL 4XI5D 5D9SA 4WI3A 4B53A 1MJ8L 5FYKU 1YPZB 5D71H 4Y2DB 1YNTB 3DURA 1E0OB 1OPGL 1U41A 1JPGA 3HS0B 4MNQD 2ZOLA 3MQIA 4R0LA 5C0BD 1UH4A 3CFBB 1VFOA 3ABZA 5HI4D 5BW7A 4UV4H 3QXDA 1A6VL 4PY8I 1IJ9A 1HHIA 3D18B 3ZDYE 3CVHA 3S6CA 3WS3A 1DVFA 1LP9E 2ICWJ 4JREB 3JV0A 2XTJB 2IH3A 3RQ3A 5LXGH 4C56B 2NPLX 2PW2A 3VXTA 1QRNB 1BWMA 3GI9L 3EDFA 4WV1C 1HIMH 1IGML 1RZKC 3SDCA 1YNLH 4MA3A 4NM4H 4ZAKB 5CD3B 2C4FU 4R4NC 3UDWC 3IRZA 5DJ8B 4MMXC 1IGYA 1KPVB 1CFSA 5D7KE 3HZKB 5IR1B 4PR5B 1RJZB 3P4LA 4ODWB 4DVRL 1LE5B 1L6ZA 2XWJA 4ZUTB 1KPRB 3BH9B 1S7TB 1A7RL 2MQ3A 3DWTA 3R0NA 1HQ4A 4PTTB 3FOLB 2OJEB 4HK3N 4HXBH 1GHFH 1ZKAA 2AK4A 2X41A 1ZS8A 1G7MB 3ARDC 3D87B 4NRYA 1OAYL 5IIEA 1HHHA 4K2UH 4BH7A 1GVIA 1ZLUH 3K0WA 5EZJB 4OFVA 2BY0A 3V4VL 3T0ED 4LVHB 3BJ91 4HQQL 4NKMB 5KSBA 3MRNB 4DEPB 4TNWF 3FFCA 4WU7B 1NDMB 2PTVA 3E8UL 5ISZA 4LVNB 3IJSB 4LHUD 4KJQC 3SDDB 1WZ1L 2X70B 1INQB 4G7VH 4PP1D 4GG8B 4DUWA 4X98B 5J6HA 1GOFA 1F5WA 3QJFB 1MJ7L 1UT9A 3U0PA 3RUGF 1NL0L 3QIUA 4XCFL 4G6FB 3JUZA 2X1PA 2DBJA 2FZ3A 3O2DL 1NGXA 4LKCA 5F1OB 4D8PA 3KXFD 5CGYD 5HPOA 4Q9QH 1BX2B 1RIVH 2NXYC 3QA3B 4NJAL 1P7QD 1DUZA 4PJXA 5F3HA 4MB3A 3WDJA 4RIRB 2UWEB 4HS8H 4L4VD 3WLBA 1LO2L 1FL6B 4HGKC 2D7OA 4PY8J 5K59E 3WE6A 5C09D 3MLWH 2J8OA 5I9QB 4OIBA 5DZNA 1D3CA 5D1QD 4GKZB 3RVVC 5GRYA 1TQCB 1XR8B 4LSPL 2ZOKA 5EZOL 5T3ZH 4OAWB 2WUCH 3MXVH 1T0MA 2WBKA 3LEYH 5HHNB 1AR1D 3P4NA 4G8EA 1OARH 2H41A 5HGHA 1BQSA 3CSYA 4OLYL 5GHWH 3NZHL 2IWGA 4FG6C 4IRSB 4ODTL 3TYGL 1T1XA 2QSTA 5C09B 3W9EA 5M95B 3RX8A 5DJ0A 2J2ZA 1K4CA 3RUGA 4U1JB 3FZUD 5TDOB 3TBVA 3UTTA 1T4KB 3E2HC 3G04A 4ONGL 1YYLH 5EU5B 4PJAF 4GW5B 4MAYA 5ABDE 1CXEA 1X5ZA 1DQLH 4S0SD 3QIUC 4JHWH 4MSWA 3AY4A 2BCKB 3QCUH 4MYWB 1QLRA 2V7HA 2P8LB 2VDOH 1PY9A 1DQQA 2DL9A 3OZ9H 3I02B 3AM8C 1HYSD 1ONQA 2V5YA 4OD2A 1GXEA 2NZ9D 3MLRH 3CIQA 4D0BB 2AK4E 5I18H 3IDNB 3C8DA 4Z5RA 1U93A 1I85A 1PW3A 3QISA 5A2LH 5FO9A 1MH5A 1TPXB 1Z2KA 3D2UD 1M7DA 5DQDL 1I8KA 4PJ7F 5GGSY 1AIFB 2Q76A 4TOYL 1DQJA 5EZIH 1OF2B 4ZDHA 3ZKSD 5JHDE 5FHAL 1ES0B 4O2FB 4NKOB 3T0EB 5F9JB 4Y4KB 1YECL 1FVCA 2NQCA 1AGFA 3QUZB 1GIGL 1CQKA 2SEBA 5J6GA 4LLDA 3VXSB 3QXDB 3S35L 3F5WA 3B9DA 1NGZA 1MAKA 2EDXA 1QQDB 1JMZA 4S1QH 3ARTA 1UQSB 1BGXH 2IH3B 1RVFH 1EEYB 1SYSA 3BKCL 1QR1A 1MLCB 1F6AA 4NHUA 3FHAA 1XCQB 3ZE2E 5IM7B 4LNVA 4PP2A 4LCYB 5EOCJ 3TZVD 5C0AD 2JCCE 4U3HA 5DJ8A 1MNUL 4LCCA 4Q97A 4NN6C 2A1WL 3QHFL 4ZUUB 4R0LC 2AABL 2GYSA 3WUWG 5LBSL 1MHEB 3BPLC 5I1AB 2IPKB 3KHOA 4Y1AE 5T5NG 5GGUB 2CK0H 4F7TA 5ISZD 1CN4A 1FFNB 3PWNA 5T5FL 2WBJA 4HSQA 4NPYB 1L6XA 3MUZ1 4YZFF 4OZGA 1WBXA 4NCDA 1NDGA 3QWOB 4NUGL 3FO9A 1I8MB 4AEIH 1K5NA 5HD8D 4LNRB 3V7AE 3T0EE 1A5FL 3GK8L 5JNYB 4UOW1 2ERJB 4LLMA 1I3RA 4MS8C 2PTUA 2DM2A 1EXUA 1JGUH 4JJ5B 5FB8A 4OZIF 1WQVT 1FYTB 3ME0A 1DLHB 3BKML 2YD4A 5ISZB 1JTTA 3B6SB 4PG9A 3HMXA 4X7FC 4ZFFA 4M6OL 3SDXB 1MQKH 4FQIL 2HFGH 1AGBB 4Z18A 2AJ3A 3IAPA 4OGXL 3IF1A 5TH2A 4GKSB 4D8PB 2CJUH 2G5RA 4LHJB 1AJ7H 4I2XA 4NC0B 4LCUB 1J10A 1QNZL 3LS5L 3CCHA 3FOMB 4UNVA 3HMWH 1JHLL 1KJVB 4LVOB 5AWNH 4K8RL 4Y16B 1DFBL 3EOTL 1YJDC 4CBPA 5DQ9A 3RIAF 3U4EB 5B3JF 3EW3B 2OR7A 2VE6B 4K8RC 3V6BR 5IB3A 5E2TH 1BD2D 1JPSH 2RCSL 3VFNB 2DBLH 3ESVF 5TPWL 4FZEL 4OFIA 3M1BA 5D7IF 1A1MB 1XR8A 2GITA 3MR9A 3DLQR 5EORH 3SY0B 2CLVB 4HKBA 4R3SB 3TNNB 4MAYD 4XAKE 3B2UD 1AI1L 4FQLL 4XVUC 4UU9B 2K9UA 2Q7NA 4YX2L 3QFJB 3NFPA 5GGVY 4ZNEE 1L4IA 4GW1B 4Y4FA 3SDDC 4GMSH 1FNEB 2FX8H 3P73B 1KULA 1VADA 4XP6L 1KUMA 1DVFD 4O00A 5DD1H 4YC2B 4OCYL 5DUBB 2AI0L 2GJZA 3BIAX 1FGVH 5EN2A 1ERNA 4OM1H 4ONFL 1S7WB 2VDPH 2ICES 2ATKB 2E7LC 3FQUB 2BVEA 1BFSA 3D9AH 3FRUB 3FFCB 4OLZH 3QIWD 1JF1B 4HLZH 4DN3H 1OQOA 1DQQB 3CFKB 3W9EB 4PJIF 3U2SB 3LOWA 1FIGH 2FEDD 2NCMA 2XWTA 4HHAB 5C9JA 2PYFB 4PV8B 4U1GB 3DUSB 2BNUB 1JZ2A 3UTTB 3W0WD 1MUJA 5DFTA 1A9EB 2BNQB 3PWLA 4IRZH 3T3MF 5CP7B 1FG2A 5E0QA 1VFAB 2E9JA 3RTQB 1A6WL 3O11B 4IJ3C 1JWUB 2ED7A 1A02N 1MF2L 1XGQA 5TF0A 1A4JB 5LCVH 4YXHL 1IC5H 1ND0A 4JGMA 4MX7B 2X7LB 4JREC 4R9HA 4FFYH 4JFDE 1P4LB 3WIFA 2CMRL 5I75C 3KNBB 5CJ5A 3I84A 5CZXC 1WWWX 2CKBL 2X42A 1S7RB 4DKEL 5C0AA 1D5XB 3TC9A 3PP4L 5IFHL 4E0RA 4PD4K 2RFXB 2CH8A 4RAUA 1OAXH 1MJJB 4WWID 1IM3B 4KUZL 5A2FA 3QFDB 5BO1H 2ARJA 4HFUH 4M00A 4XMPH 3JTSB 4LCWE 5B38G 3BE1L 5GISL 5FO8B 1CD0A 4D0CB 3TIEB 4B0MM 3SCMD 3QEHB 3K4AA 4QHNA 2EDNA 2IAMC 4IRSA 2APVA 2N4IA 1WGOA 1KIPA 3FN9A 5BJTA 5IK3B 4HIHB 2VO5A 4IM8A 2Z31B 3SO3C 4CVWA 1AXSA 4JQVA 5DMJB 4MD0B 4N90E 5MHSD 2OYPA 2BXZA 3KPMA 3T1FA 1D9KA 2NXZD 4FXLA 1YQ2A 4YBQD 2O5ZH 1QQDA 2HWZH 1DBKH 3CZFB 4YHOL 2VLRD 4YDLB 3ULUD 3HFMH 1UACL 1IE5A 1MLCA 1RPQA 2IGFH 1LO2H 2YD6A 5FM5M 3QQ4A 2VN4A 1V7ML 3LIZL 2NXYD 3S36X 3JWOC 5D1XB 2DWDA 4JM2F 1C5CH 4WGWB 5F1NA 1CR9L 3BVNA 4FQQB 4U1NA 1OAQL 4WEBH 4EI5B 5JO5A 1CFTA 4TVPH 1DCLA 2Y6SC 3TWCL 5I1AA 4OT1H 3RNQB 3U4AA 1NBVL 5FYKD 4L4TE 5BV7C 5DEGB 3RIFF 5F89A 2R4SH 5INDA 5I8CA 3SKOA 1FVEB 4GUPA 2CDFB 1T3FB 1NCBL 5I30H 4FFZH 1HKFA 1MJ7H 4ONHB 1KJ2H 4LCWB 4OZGB 3QCVH 3PGFH 3IXAA 1UM4H 4H0HB 3GHEL 3O2DH 1XCTB 1R3IL 1C5DA 2ZSWA 5FYJU 5C0NC 4GLRH 4NCC1 3UPCA 2KQNA 1W72B 5H94A 3SKJL 1A2YB 3IAGC 1T5XB 5CEZH 3MJ8B 4JFEE 5IEHB 5IHZA 2NY2D 3AM8A 3O3UN 3UJJH 1P69B 3TN0A 2M26A 2XZAL 5DJAA 5FGCE 5DFWH 4EBQH 2FLBT 3GSNL 5C2BH 3QXAA 1NCAL 1QR1B 3TESA 3WKML 3HI6H 1RZKH 2FHCA 3GHBH 1IKFH 1MIEH 1BVLB 1QKZH 5B38A 4L8SB 3RDTD 1MVUB 1WWAX 2QLVB 4JFEA 3OB0K 3OHXB 5FM5O 4XZUB 4G8GB 4QWWC 2PTTB 2OTWB 4JO3H 4GAYA 1FV1A 3QDGE 1NC2D 4XWGH 4Z0XA 3JBG7 2VDNH 1ZK9A 2AEWA 2IAMB 3OXRA 4LRNH 4DN4L 4WW2B 5FF6B 3AS2A 4PV9B 3P73A 2DLGA 1YEDA 3E6HA 1G9EA 4NHCH 5DUPL 4Z7OF 4FA8A 4Q7DA 3U82B 4FXKA 2I5YL 1UJ3C 2YUWA 1W72L 2B5IB 2CIIB 3V6OA 4BFBD 2YPVH 4ORGA 4OZFH 4RDQF 2MHAB 5EU6E 3JTTB 4AYFA 3H0TB 1PX3A 4HWNA 3CVHL 3IJHB 2EDRA 1LEGB 2VXUL 3UXFA 5TGBA 3B9KC 3O8XD 4FQHB 4ZO9A 3K8KA 1IZKA 1CFQA 1NCDL 1Q38A 1J1XL 3CK0L 3L3GA 3V52H 4PV8A 5IV2A 1UGNA 4PJCF 5CZVL 4QRRD 1R0AL 2FECL 3KYAA 2F5BH 4JQXC 4WDIA 3MX0A 2GFBB 2E6QA 3KPQB 4JVPA 5E8NA 5GRJH 2ZSVB 2JIXB 2R56H 2AERT 2J4WL 4N8CL 1FNSH 5A2JH 3QUXD 2GK0B 4XCEB 1LO5B 3JWOL 3HR6A 1HDMB 5HY9B 3AB0C 3S36H 4YHLL 1HHKB 2E5EA 4CVUA 1MUJB 5MP6L 2X5PA 4EIZC 1FE8H 1FG9C 3O6FD 3MV7E 1G7LA 4DCQB 3BP6A 2VDMH 3OXSA 3RGVD 4I3RH 1HCVA 1N6VA 4MLSA 3FAWA 5JOFB 1QA9B 3CFIC 4YLQT 3EOAB 4ZUVA 4D0CA 3PHOB 5HGAA 5B3JE 2WINA 3CXHJ 1HSBB 1F4XH 1FNGA 1QG3A 3GI8L 3VGAB 4XP9L 4FQCL 4S0TD 3LQMA 3MO1A 4OLXH 1LEKA 5LKNA 3MLPA 1MNUH 1B4RA 2YUZA 1KPUB 4H1LH 4XHQA 1LK2A 4KMTL 4ESKA 2I26N 2VH5H 4P2RE 1ZV5A 2IANA 4PJDB 3TA3C 2OK0H 3VRIA 1U8MA 5GIRA 2HJKB 2ATKA 4KJYB 2CK0L 3P4MB 1QNZH 4I4WA 5FGRA 2DQCH 2VDKH 3D48R 4O2CA 2IBBA 3MRMB 2FSEB 5HDQL 4JFOA 4MQTB 5AWNL 4JJHA 2R0ZH 2EXWC 4P9MH 5TDPB 1XR9A 4KPHH 4PRDB 1U6AL 1U2HA 4IOIA 3FB5B 4JANA 4YE4H 1E4WL 2NTSP 3QXUA 4MD0A 1JGEB 2FJFB 1V5JA 5H2BA 4M48H 2V5SA 4Q6IA 4M02A 4TQEL 5DHYA 2JJWA 4K94H 1P2CB 4KK6C 4XMLH 3BD4A 1MAMH 4XX1E 3IRPX 4GKNB 4Y5YA 5CSBA 2X2YA 4GBXB 1E6JL 1D5IL 3RPKA 1I7ZA 3FQWA 2EE2A 2CDFA 2VLME 1ND0B 1M4KA 2E27H 5D7LD 2UZXB 2B1AL 3F12A 1VFBB 1OWWA 2VL4A 4PJ8C 1WWCA 2W65A 2XV6B 1GOHA 2X4QB 1U3HA 1S3KL 3MJ9L 5IMOB 4JZJB 5KTEL 2Y23A 5ESVB 1EJOH 3MA7A 4HT1L 4HKZB 2R2CA 1BFVL 4NKMA 5ETUB 2PR4H 4IRJD 4Q9CA 3MZTA 3MBEC 4XPTL 3OWEA 5CP3H 5JXED 2GJ6A 2H9GB 2FR4A 1JGVH 2IFGA 5DMIH 5F44A 3MRLA 1TJHL 1X3DA 4NRYB 5DJAB 3CFJA 5ALBH 4CN4A 4O4YL 4MA1B 3VA2C 3H3PH 1CDIA 5D5ME 4JFYB 4L3EB 2OMBA 3VWJA 4CNIB 1MWAH 4OCWL 4P5MB 3VFUB 3WNOA 1BQUA 4PRBA 2X4TA 1V7NL 4KAQL 3O45A 1UB6A 3MMEB 4DGIL 1C7TA 4PJEE 4JFFD 5HHMB 4OF5A 3EYVB 5D1QB 3IJSA 5LGKA 1EO7A 4M62H 3OB0H 3U7WL 4PJDE 4XNZC 1Z9MA 3VGDA 3X12B 2DQJL 2FX8L 5CGMA 4YHZL 4DW2H 3K46A 2EDOA 4M1GL 1NMCC 1HI6B 1MWAB 4H8WC 3EAKA 2DQGH 1JWSB 3BN9C 2Q8AL 5K9JH 2E6PA 4QRPA 4HEPG 1BBJB 1AJ7L 2YN3A 4IMLA 1QHPA 3T0EC 3DBXA 3QDMB 3K74B 1NCWH 5DEGA 3LV3A 3O3BA 1RZIA 1U8LA 2YK1L 5CS7A 1YEDB 3E6HB 4LCWA 3SKNB 4JZOA 5FM8A 1B2WH 1A6ZB 3ZKNC 1P53A 1T1WB 1AHWC 3WIIL 3CC5B 2VITB 3E3QC 1ZHLA 5DMGD 4RRPG 1DZBA 2C7UA 1CFVH 1VEMA 3O6KH 4C83B 5HYQB 4HBCH 4XAWL 4AMKL 4NQCD 3SGDI 1WICA 3IDYC 2DQEH 4R8WL 1IC1A 4G9FD 1LEGA 4JO1L 4GQ9L 3PL6B 4U3XA 2C9AA 4DGVL 1DBMH 1JNNL 3V5KB 3C8HA 2YR3A 3BKYH 5HY9A 2GY5A 3QXAB 3PXHA 5EH1A 2CKNA 3OR7A 3IDJA 2AJYH 4L8SC 1NGXB 1FGVL 3PP4H 4NN5C 4PFEA 4MDJA 4CRPA 5I76B 3LKOA 1HH6B 3TZVA 3MJGX 4CMHC 2ATPA 3FKUS 1MRCH 1QBML 1IBGL 1YEJL 5IVXB 5A43C 4F7MA 2AJVH 2UWEA 3EFDL 4ZDHB 4Y89A 2IALA 1ZLVK 1RI8A 5JW3H 2IADB 3OAZH 2FL5A 3DX9B 3LZFL 1GZPA 4KC3B 1EEUA 3SGEI 1TCMA 3GSQB 3QFJD 4DAGH 1R5VA 3QWRA 1W0WB 2NW3B 2DLIA 3PQYE 3LS4H 1U8IB 3HE6A 1JFQL 4ORGB 1A6WH 3F5WB 4XHJC 2J1KA 1NGZB 1B0GB 3UJIL 1MI5D 3KWWB 1MFCH 3MPCA 3IJHA 3T0DA 1J0JA 1F11A 3DRQA 2DYPA 1KXTB 5C2BL 1TNNA 5IJKA 1K4CB 3ULUE 3DYOA 5FYJE 1O7SA 2F5AL 4TNVK 4HWBA 4Z8FL 3ARRA 3E3QE 2FJFA 3DPBA 4G42B 5C0DA 3A0OA 1ZEAH 1J11A 5FK9A 1W0VB 1XGRB 5GIRB 5FGBA 4KJYA 3VFTA 3KR3H 2GAZA 3F7VB 3H3KA 1UENA 5FA4A 4IS6B 1T7VA 4ODVH 3JWNC 3RWFB 2FD6H 2DRUA 1M7IA 3MREB 5BS0A 1FLRL 3STZB 4DN4H 4LCIH 4G6KL 2W9DH 5I66B 4TUOB 4NBXB 4G6JH 4X7CC 1KTKE 4EUPA 1RFDH 3MRGB 4LCYA 3MRFA 4UAOB 2PXYD 2NY1C 3NIGE 1AXTH 2CUHA 4PJBE 3FO0H 3IDMB 5E2WH 1M6OB 3QDMD 3DROA 4MCYA 1C8PA 1SHMA 2J6EL 1I9JL 1RHHB 1LNUA 1OSPH 3BGMA 4BZ2H 1J0ZA 4PUBL 4K8RD 1FFNA 4QRPD 3FQNA 3QRGH 3TLRA 1EH9A 2R1WB 5J1TC 4X8XA 3PHOA 5HGAB 1H0DA 2WINB 2CMRH 3HZMA 1FIEA 1SJHA 4PLNC 4OGZA 2G9HB 2ORBL 1D5BA 1C5CL 1QRNE 3TNMB 4L3EA 1CXFA 3OKEA 3MOQA 4GRWH 1PJ9A 1DBAL 3AXLB 4YUEH 1CLZH 1T80A 3TWCH 4GG6F 1HWHB 4WUUB 2SEBB 1SJVA 2GJ6B 3VE0B 3GSWB 1U8MB 2IPUK 1I7UA 4XH2A 3RVXC 2FJHB 4OZGE 4YXKH 3W81A 3RZCB 2KH2B 1DEEA 2XFXB 4QWWD 1T22B 2EC9T 2HG5A 3CFJB 4KJQD 3ET9F 1QOKA 2ICEB 1JV5A 3HG1B 4U6YA 3QHZH 4XVSH 3IDXL 2AP2A 1I1YA 1N0XH 2VAAB 4ERSH 1OLLA 3HHRB 2CKBB 3QDJE 2UY6A 2X10A 3O45B 3VG9C 4I2XB 3UPRB 2ZUQC 5AZ2H 2XNAB 3CCHB 4P23D 4X4MA 3D39D 3NABH 4JG0H 4GKNA 4PJHE 3RHWK 1L7TL 4PB0L 3FTGA 5GGQH 4ELMB 1WUNT 2ZJSL 1WBYB 4HCRA 4X7EC 4RMQA 4U6VL 1YMMB 4F7EA 3GO1L 2WLZA 2IQAA 4M5ZH 1QBLL 4YEEA 5CZKA 3M1BB 4UT7H 5EIVA 2WBWB 4P23C 2AJXL 4WFGD 1KB5B 3VH8B 1NSNL 4HKZA 1DTUA 3KJ4C 4WI6A 1B90A 3SJVB 1I3RB 2WUCL 1KNOA 4UT9L 4OGAD 5EO0A 1AP2A 5F72S 4HEME 5DEZA 1F6FB 1A1NB 2P7TA 3WJLC 3LN5A 5CSZB 4C57C 2PXYA 5E2UL 4ODTH 3TYGH 5I75B 3E6FA 4X6DF 4JZOB 2C3WA 1G7JB 1T6WA 5EOTA 5EC2B 1JHTA 3BEVA 4APQC 1A7BA 5BV7H 4N5EC 5EN2B 2JCCF 2OCFD 1ZTXL 4JCLA 3FO2B 4JFQA 3FRUA 4QRQB 3P77B 3EYFB 2GEEA 4U05A 2DTSA 3IAQA 4HIJB 4PRHA 4LSTH 1FPTL 1MCJA 2APWA 2JLLA 3JV6A 4NDMA 3RX7A 4C4KT 3SDYH 3UJJL 4U1SB 4MNGA 2GUOA 1N2RB 5CJQH 3SKMA 1CF8L 5DJDA 3OKNA 2UZIH 4R4BB 3V0WL 1MCQA 5IT2L 2NY2C 2BERA 4N9GA 4XP9H 5DQ9B 3U4EA 2YWYA 3LRSB 1NFIA 3ARFC 1RQ5A 4OLXL 3V52L 1ED3A 5CD5C 2NY0D 2C3VA 1NC2B 7FABL 5C0BA 4YPGB 2VB5A 4MNGE 5F71A 4QRPB 4PBVC 4ZO8A 1D6VH 4RBPK 2ADFL 3V6OC 1G7IB 1Q9WA 5GRJL 1BIIB 2DQCL 4Q9RL 4PREB 3BIBX 3DBXB 1N64L 1KCLA 4ZPVA 4CU6A 2BSSA 2ZUTA 4K23L 1OP9A 3PDGA 3MACL 3KNBA 2QR0A 4QT5B 1RD6A 1AC6A 3GJFB 2RAMA 3DURB 1BEYL 3GSOA 5CZXD 3IFLL 4NZRH 3HPLB 1PG7L 2XKNA 5J8OA 4RSVA 1OGAD 1U8IA 4LEOA 4K94L 4DGIH 3CZJA 4HIIA 4PRPB 4X0KA 1NBYA 4N90D 5MHSE 3JTSA 3VFTB 4AY0A 5CCKL 1X6LA 3GMOB 1Q94B 3WD5L 2LAAA 1JF1A 3RWFA 2NX5A 1TIUA 3QNYA 12E8L 4C56A 3TVMC 2EE6A 1FC1A 4RQQA 3TT1H 4PJHA 3Q48A 3WJJA 1M05A 5KZCD 4OZ4A 4HIHA 4EUPB 1U8JB 5J3HC 3L3HA 2P8PA 4HV8B 5FAAA 3B5TA 3PHQA 4UTBL 2A73B 2R1XA 3TA3D 2VJXA 1F2XK 3H9SA 3MLTA 4LCWD 4PRIE 3U36B 5EBMB 4PRPD 3MV7A 4F8TA 1HH6A 2R56L 4UTAL 3V5HB 2DLFH 1N0LA 3L5JA 3UTPE 4X4XB 3VD3A 3EDEA 1ZS8B 3MV9A 4HG4K 2FBJH 5KZCB 5E8DL 3D39A 3DYMA 3ARVA 3WIFB 2VZOA 1KN4H 1CS6A 1WTLA 2ZG1A 5E2JA 2GTWB 4ZUTA 4GRWB 4NT6B 1BD2E 2OL3H 4X6BA 1F58L 2D7TH 3N85H 4ZFOA 5C1MB 2WQRA 3VFWB 2FWOA 3PGDA 5E1AA 5JW4M 1XIWA 2APBA 1DEEB 5D5MB 5GRZA 5ID1A 3O6FA 1WEJH 3JWDH 2EDBA 5CWSB 1CGVA 4XT1C 1DR9A 3WFBH 3CDGB 3C08H 3S37X 1YPZA 4XXDB 4D9LH 4WHCA 3FCTB 3MCLL 4YHKL 2WWMC 3K8MA 2X1QA 1EJOL 5HVHB 3S4SG 3CLEH 4FQXD 4KZEL 4TUKL 2BC4A 4YK4C 3T0XA 1DUZB 5F3HB 3VE0A 1KTDB 1NUGA 2ADIB 4U1LB 5AG9A 3U0TB 4GRWE 3CZFA 3RY6C 3QWRD 3ARWA 1AGEA 1A9BA 1RJLA 5CJBA 1TJHH 1FL6A 1LK3H 1QBBA 1U6AH 4PGZA 3WIIH 1HSAA 2XA8H 4XWOC 1G9ML 1FDLH 2ZZUT 4NO0A 1HEZA 3DJ9A 4G8GA 3SEPA 3QUZD 4LMQI 1T0MB 4GQPH 3OJDA 1JFQH 3HB3D 5HHNA 4JN1L 2IMNA 2BNRE 2W0PA 1NAML 4JDZB 2C3GA 3GSVB 2LAGB 1MCLA 4P5TA 4KKAD 4F7EB 2MSPA 4PJFA 5IQ9A 3QPQD 1FFQA 4OZHF 1B88A 2Y9RT 2EIBA 1LDPL 5EC1A 4XP4H 3F7RA 2CDGB 1CLOH 3VH8A 3RVVD 3AXLA 5DD6A 4KI5D 2GFBA 4JY6B 2G5BB 2A74A 5AAWA 5LQBL 4LBEB 3MV8E 2HRLA 4OCNC 3VFSA 4I0KA 1WZMA 4LARL 2ZCKL 5GPRA 1RU9L 4F37F 4LPTA 4TRPL 5DUMH 3RGVB 5D8JL 2Y36H 3SKMB 5I8OH 4KJPD 2HG5B 15C8L 2DMKA 4KWUA 2WMPA 2V2XA 1B2WL 4FTVD 1S78D 4W70A 5DWUH 5ITFA 2XPGA 4APQD 3FO0L 3ECBA 3CSPA 3X3FH 2EEBA 4PJXB 4UQ3A 3KJ4B 3O0RH 3ZE1E 1M7DB 2G60H 1P5VA 1Q9WB 3E2HB 5D7IB 3ZDZF 4MNGB 3VI3F 5HYJD 1NCCL 3TIDA 4K3EL 3GMRA 5IFJA 1KJ2A 3L3DA 1XF2B 2MOVA 4YNYA 3HB3C 4PV9A 4MWFA 1U9KA 1FAKT 4QTIL 5EBLA 3VFRB 1FBIL 3S8WA 4GAJL 3S5LB 3DI2B 1CLZL 5HDBF 3KPSE 5F3BA 5DRZB 1KB5A 5MERA 1BQLL 4PJDA 1PX4A 1Z0MA 4HIIB 4PRPA 4DK3A 1K8IB 1TQCC 2BRRL 1TNMA 1T21B 1TTUA 3PGCB 3MRMA 2ZKHH 3GMLB 4JRYE 1CXKA 1CLYL 3QUMB 2EEAA 3ARGA 4PJHB 1KEMH 4JPKH 4JQIH 2E6JA 4HPYL 4PRDA 1S5IH 3RUGB 2HRPH 4J1UB 4GS7B 4KI5F 4HKJA 1U42A 1CGYA 2H3NA 1D5MB 1A7OL 1I7TB 3MLZH 2JB6A 4X0KB 2BOCA 5JW5B 3P4MA 4HIXL 3MBXL 1WBZA 3K2UL 4ZFZB 2NY4B 2FSEA 2ZSVA 5KVMC 3LHPH 1SYSB 3PWNB 1FJ1B 1LD9B 2G75A 2HVKB 5EUKB 3S9DB 2UWEE 4JB9L 4RFEA 3NFSL 4QOKE 3SDCD 4NFCA 5JLZB 3QWOA 1B0WA 4Z0BL 5JIHA 4IHOA 1XIWC 5DRWB 4C55A 5C3TA 5JOPE 1IEBA 2AJXH 2XZCL 4CJ1A 3VW3H 2H2PC 3MOBL 2O5XH 3LPGA 5T1DH 5IQ7L 4DFIA 1DJSA 4NZTH 4ZUVB 4KDWA 1BJ8A 1AIFA 2AK4D 3G6DL 4HS6A 4XVSL 3LEVL 3MSPA 1VERA 4LHQB 3RY6A 1FO0H 1IGIH 4WENB 4I0PC 5T1LD 1WIUA 1AGBA 5FUCC 5JW4R 4OGAC 2YA1A 4PJAA 3QI9D 4X80H 4ZQKB 1KCVL 1KSRA 3NCYS 5ETUA 3PNWA 1LK2B 2J8UE 3BO8B 2OR9L 5IMKA 3UZVB 1PEZA 1DDHB 4YFLF 2EO1A 3DUUA 2BNQD 5E6YA 4WUUE 2V5MA 1N5AA 1TJGL 4KROD 4AIZA 4ORZC 4P49A 8FABB 3EJYD 1VB9A 1YEFL 3TFKC 2XKSA 4FTVB 2NX5B 4M7LL 4AEHL 5CJQL 3D25A 1EFXD 2AJZA 3ARDB 4MMZC 2UZYB 3NACH 3FCTA 3GRWL 1Q72H 2OR8A 2EH7L 1AKJD 4P3WA 3VFNA 5C0RH 4IJ3B 2LU7A 1NJ9B 3R8QA 3RL2B 1ZEAL 4GS7C 5ESQB 4PS4L 4JFFE 1HEZB 5LWYH 3PP3H 5I1KH 2HFEA 3MCG1 4LF3B 4JKPL 1TJIL 2DN7A 1UCTA 4FN0A 1TVHB 1CDGA 1LHZA 2B1HL 2X4SA 4NYLB 1OOAA 3KDMA 2E9IA 2W65B 3OB8A 4M4RA 4NHCL 4XC3L 4XPHH 5DUPH 3GSRB 1T7XA 3LSOA 3PQYB 3CMOH 4OLEA 1TVDA 1OWRM 1JN6B 2BVOB 5GQBA 3OL2A 1BBJA 4C59B 2J6EH 5FGSA 2NLJB 2OX5A 4AH2B 1FPTH 3ORJA 3MNZB 5HHVH 1AY1H 1FYTA 4FS0A 4KJPC 3VRLF 4O58L 3GSVA 2Z8VC 4WNQB 2KBGA 3U2SA 2QHLA 4D0DB 5IFAL 4PRNA 2R4RL 4AT6B 3PWUA 4GG6B 1AD9B 2VZ1A 2VITA 1KN2H 2W0KA 3CUPA 5EC1B 1XGUA 2APTA 4YHMH 2A77H 2ENSA 2XKUA 4UIMA 3ARGD 3HUJE 3IF1B 5TH2B 2PYEB 4BFIA 5DD6B 1MQ8A 1IAIM 1GYAA 4MNQE 4MDJB 2VUOA 1UEMA 4WHYH 5I76A 4MNHB 1VFAA 1A3QA 5JIIA 3KPRB 4MHHG 4M1CD 3UYOD 5IF0A 1RIUL 3RL1A 4L3ED 1MCKA 1NUDA 5CAYB 1Z9LA 1JYVA 1RJLB 4PPTA 5IB1A 3P9WB 3MRQB 5ALCL 5EBLB 3IDJB 3O2WL 1Q0XH 3W0WB 4PBWD 3O3AB 43C9A 3VXOA 3ISWA 5B4MD 3WUWA 4LSUH 1GC1C 4O5LH 3ES6A 3OPZH 2C3HA 2UV3A 5IVXE 2ATPB 2CLRA 4HS8L 3KPRD 3PHSA 3DMMA 2DIAA 3ZKMC 2IADA 1JL8A 2YN5A 2DI9A 2CDEA 1NMBH 1KIPB 1JPTL 4Y5VC 2H1PH 5EA0L 3VFRA 3U6RA 4H0IA 1S7RA 5IESL 2AXJA 1T1WA 4H88H 3V7AG 5JQ6H 4ZFOL 4YBQC 5MERB 4KMTH 1GZQA 5F3BB 3OGCA 4JHZA 4CJ0A 3QZWA 1JWMA 1LQSR 3QFDA 3BYYA 1XGRA 2BOCB 5JW5A 1OARL 4NRZB 5I1LA 3KWWA 3ULSA 4ZOCA 4Z77B 4N1CA 3PGCA 2AKRA 4G8GD 4I8DA 1NLDL 5I1CH 1I9IL 1CD9B 2HLAB 4L4JA 4NFBA 3C87A 3LCYA 3VJ6B 2PXYC 2IAMD 2DS4A 3HMXL 5KVDH 1XF3B 1AXSB 2EECA 1A5FH 1FDLL 4H5SA 5JO5B 3BPLB 1BZ7A 4HAGA 3TO4C 2HT2D 4TUJA 5FFLA 4D9QE 3QDME 2A83A 3QUKB 1F90H 2VDOL 1XGPB 4QCIA 2FEEL 3VXSD 1C5BH 1KENH 4JN1H 5L0QB 4FQLH 4ZTPH 3WD5H 2ADJB 5INDB 1INEH 5TDNB 3VFMB 1OTUD 4WJ5A 3ULVE 2F53B 5A3IC 5ITBH 5JLZA 1WAAF 2B1AH 2PO6B 1EFXA 1ACYL 1AGDB 3UJTL 5SX4H 4EN3D 7FABH 1X5YA 4D2NA 3VMNA 1JPFB 1EVUA 1CK0H 1KPRA 4I48A 1RMFL 2VMFA 3HG1D 3BRFA 2QQNL 2WIMA 1JBJA 4Y88A 4MGXA 5F70A 1BF2A 5MEQA 2KZWA 4JRXA 2I24N 4EQ3A 4Z7QE 2DD8H 4YJZL 5K59F 5DMIL 4ONHA 3TN0B 1N7ML 4GH7B 4OF0A 5D2LE 4NC1E 4WIQA 3U48A 2AJZB 2OP4H 1MHHA 4Z76A 3BOVA 2DBLL 3SDAC 4HJ0C 4S1SH 2JKXA 4MAUL 4WHTA 4BYHA 4KK9D 1OHQA 4X9HA 1G0XA 3SDAD 1MLBA 4G9FA 5EUOA 2P8MA 1EGJA 3LPFA 2X4NB 4X4YA 2FYYA 5KAQF 4QRRA 5I1JL 5IEHA 1IM9A 1I3GL 5D2LB 1ZLWH 3EJJX 2OQJA 4MXVF 3KPTA 1NUNB 1FZJB 1NCCH 4WW2A 5FF6A 3SJVD 1Q0YH 1YEHH 4KFZC 3BEWB 5IJKC 1H5BA 4K3GA 5JDSB 2E9WA 3LQZB 1N3NB 2VAAA 4OFPA 4CGTA 3ZTNL 4QTIH 3P0YL 5T3XE 1CIUA 4WFHD 4GRMA 4M7KL 4U1NB 4UOW0 1JN6A 2BVOA 4EI5A 3ZLQC 1OD9A 4M93C 4B50A 1QFWH 3KPPA 3HC0B 4NM8H 4Z0XB 4PJXF 4I0CC 3VDAA 5JA8B 2LU3A 3D85A 3V0VB 3VD5A 3TBTB 4TRPH 3FQNB 1F4HA 1TVHA 4JFZL 4UDUB 2PXYB 4DUVA 2L0DA 4N0RA 1FGNL 3H9SD 1LK3L 4L3CA 5EO9A 3DGCR 3ULVC 3B9AA 4XCYA 3JWDC 4LFHG 4BH7B 4FXKB 2BX5A 3V5DB 1DANT 3HCVB 1OSZB 4OV6F 3MLXL 4HZLA 3ARXA 1FORH 1MEXL 4HBCL 2D9CA 1A3RH 3REWA 5KW9L 1ZLSH 3D3VD 4FABL 3QUXC 4WO4C 5F9WB 1NAKH 1G0DA 1I7RA 4OTXH 3LHPL 3ULUH 4OD3L 1YEGH 1A6UH 4IRSC 1UM6L 1L9MA 1YJDH 3EO9H 1VACB 4X6CE 1UKQA 1PGRB 1HK6A 2NTFA 4LP4A 3UMTA 1T4KA 4IMKA 2Z35B 4M4PA 3MFGB 3RWIB 2PYEA 1S8DB 5J9PA 3HE6C 4LPWA 2NXYB 4DWHA 2MPAL 5T1LA 2A9NH 5IOPB 5CIPB 4OKDA 4ODSL 1F4YL 3F65A 4WWKD 5JOFA 5JZ7D 3E8UH 3KJ6L 1UFUA 1O0VA 3QIWB 1AHWA 1QLEL 1RV6X 2WQ8A 3TH4T 3FTGB 4OCMC 1QPPA 3TEUA 2UYLA 1HSBA 3QCVL 2QR0B 3IFNL 1F4WL 1JPSL 4FQXA 1GJIA 2ARWA 1L9NA 2PCPB 4P2RB 3G5XB 3TO2B 4M6AA 3EYSH 4P23B 5FUOL 4KK5C 4ZOAA 1G84A 3TZVC 2HKFH 3SOBH 5K9OB 4L3AA 2CIIA 4AIXA 4NJAH 2O5ZL 2N7BA 1BIIA 4WWKB 4IMKC 3P4NB 4F57H 5J7CC 4YAQA 4BA8A 1M71A 3AB0B 4P2QB 4Y0GA 4NCC2 2CDEB 2CD0A 3GSNH 3ZSSA 2R69L 3BN3B 1M05B 4RAVA 2O5YL 1HKLL 2X4RA 1U8JA 4WO4A 1PQZA 5FO7A 1JHTB 4NUJA 1FBIH 1UXSB 4G8GE 5EWIH 3QQ9D 5T3ZE 1MCPL 4DEPC 3WL9A 2VDPL 3BZFA 3JUYA 4UT6H 2AEPL 3AAZA 3L3IB 3CDFA 1GGCL 5JUEL 3NIFF 3VRIB 1NBYB 3FO2A 5L6YH 4LSRL 4JM4L 4OM0H 1S9XA 4Q2ZA 3P40A 1RU9H 1BIHA 1IGJA 4JRXD 4ODVL 2NYYD 4IDJH 3W9DA 3EO1A 2JCCA 3T77B 3KYOB 3C5ZA 1PDKA 2ED9A 5SWQA 2HA1A 5KS9A 4IOIB 3F12B 1T5WA 1ORSB 5I17A 3DECA 5C0GA 2K3TA 5EIIA 1NCUA 3DX8B 4XTRC 4ZUUA 4Z7VE 1RUPL 5EO1B 1YMME 1ZGLP 3GSUB 5CMAB 3Q3GB 5JIPA 2PF6A 3FMGH 3DVGB 2YPVL 1RY7B 3ALWA 1CICD 4QYOB 4BH8B 3MBXH 4X4XA 2FEDC 2JJVA 4JRXB 1TXKA 1W0YT 2WBJB 1WTGT 3VFWA 3MNVA 4JZNA 1BOGB 3GSNB 1KG0A 4HS3B 1OTTD 5I71C 2NY0B 4OB5L 1ZVSA 4OLVL 4Q9BA 4WW2C 3NACL 3FO9B 4JB9H 4I3GA 5CEZE 3CK0H 3MRHB 5A3ID 4XXDA 2AXFA 2XICA 1QTYT 1IAKA 4PJCB 3HPLA 4LLMB 2DDQH 2VN7A 4QF1B 4WU5B 1XF4A 1JCKA 3EJYC 4QRRB 4LHUG 4BFGA 4LCCC 4R2GC 3DUHA 4O2CB 5E24E 4BUGA 1ORQA 5BVJA 4J8RA 3CXHK 3GBNL 3O6FC 1I9RH 4XVUD 5DMYA 2Q87A 4PGCB 3S36L 3QIBC 5IM7A 3IDXH 5DQJA 5HYSB 5HHPA 5CILH 2WNGA 5FKAA 3WS6C 2R0KL 4TVPE 1MFDL 1S7VA 2R1XB 3MBEA 5KN5B 2VLJD 4PJ7B 5CBAA 3LAFA 2FYYB 1IAOB 4TUJB 5GRUL 5CEYA 5DHYB 4PJIE 1AGEB 3NABL 1UACH 3D85B 3V0VA 2J88L 4F8QA 5E4EB 2B4CL 3DX6A 2BFVL 3EO0A 3MNWB 1E28A 3NIDE 1MIML 3O6ML 5DHXB 1CD8A 3CPLB 1A6ZA 3VFVB 3LKRB 4JFPA 4R7DA 5IMOA 5IEKB 1KIQB 2QHRH 2GTWA 1NBVH 1QP1A 1MCNA 4JGJA 4HWZA 4IOSD 3KPSA 2VERN 3I50H 4HW6A 3QFJA 4G7YH 4JFDB 1ZANH 2YSSB 2R0LH 1DL7L 2FWOB 2NY1B 1YNKL 2DB8A 3MROB 3MRLB 3PE9A 1MCOL 2VZTA 1NEZG 1I8IA 1U91A 4PJIB 3NAAL 5JHLL 3AVEA 1Q9OA 1ZT1B 2B1HH 1OM3L 3ARSA 3KLHC 2YC1B 5EZLA 3O4OC 4WHTB 5HYQA 1BM3H 4FNLL 5CJOL 5ITFB 3AY4C 4P5MA 3VFUA 1CYGA 5JPNA 2NX5D 4KXZH 2Y4SA 4LCUA 2F19L 2N1KA 3ARDD 4MA7L 1TJGH 4WW1A 4PGDA 3RNKB 1CQYA 3RGVA 2OQJB 3NN8B 2XWTB 5C9JB 1FZJA 1J1PL 1KJ2B 3L3DB 4Y16A 1RZKL 4WI7A 1IKFL 3GNML 4C54A 4FQXB 4ZPTB 3NCBB 5B4MC 4ELMF 3B3IB 5CJXC 3X11B 25C8H 4B41A 4XNYH 2Z92A 3GIZL 4LOUC 3WIHH 4XPGH 3DRTB 3SY0A 4GRLB 2YBRB 1Y6KR 5D2NE 3LEYL 1AO7D 3TBYA 4XWGL 4F7MB 1TCRB 4U1MB 1UYWH 1YEKH 2FATL 1NEZB 1UZ8B 1JHLH 2GSGB 3SKUD 4YHIA 2MFNA 4GW1A 4UDUA 3DX9A 4JRXE 2OZ4A 3EZ8A 3VFPA 2D4DA 3C6LC 5KVDL 1NH6A 2MQ0A 4XCCL 3GRWA 5IHUL 5C0AB 1BEYH 2NR6D 3B2VL 5DUBA 4NNYA 4J1UA 5TF1L 1QSFB 1R5IA 2VDRL 1W0WA 5DRZA 5T3ZD 3AAZB 4L8DA 4QHMB 5HI4C 2D7MA 3S35H 1QR4A 2XACC 3UBXG 3LN9A 1JGLH 1MI5B 1VPOH 3L3KA 4KK6D 2ZNXA 4JRWA 5IBLC 1PBYA 1I4FB 1OAUH 5CEXB 3C5JB 1BLNB 5I66A 4YBLC 5I1IL 2Y07L 2XN9D 4OJFL 4F15C 1ZSDB 4HULB 1JPTH 4NSKB 4M1GH 3AGVA 2V2XB 3GMMB 1TDQA 3GKWL 4HT1H 5BMFH 5E99L 2F5BL 3EJZC 3IS1X 5IROA 4HGMA 4BSWA 3L3IA 3WHXA 5D7IE 4HK0A 5IBTH 1ODAA 5M7QA 3QHFH 5EDXA 4ONFH 3DVGA 3CFDB 3MJ7B 4LSVH 3RTQA 4MB5A 5HVFB 3L95B 4G43B 1U3ZA 1IARB 2Q8BL 2FH8A 3F58H 3GJEA 2KQMA 4YC2C 3STZA 3KLAA 1KEGH 3AU1A 3JWOH 5DD0H 4P2OB 5T5FH 1YEIH 1U8HA 5KS9B 5SWQB 1KG0B 4BQ8A 3DVFA 5D1ZD 1P4LA 3BPCA 5E4IA 4YGVB 1IGYB 3MUJA 1U8KA 4ZMAT 2P5WA 2B20A 1MHPL 3U1SL 2F58H 4KAQH 4KQ4L 3DXAE 1CFVL 1A3LH 1LO3L 1RHHA 2CR6A 4AMKH 3G5VB 1HYRC 2VNCA 3SKOB 4NBYB 4NN6B 4XH2B 4ZTPL 1T0NA 5EIQA 4NQDA 1KGCE 3FO1B 5C0EB 1RZJH 1OCWL 5DJ6A 4OI7A 1JNNH 1D5BB 2NMSA 3WSQH 5FYKL 5EZJA 4LU5L 4HUKB 3IYLW 2EYTA 1EVTC 2DQIL 4L4VE 2CO7B 2C4XA 3BWAB 2ZOLB 3M8OL 1W72A 4CADA 1SM3L 4PRAB 3WDIA 3T2NL 3DUUB 2JB6B 5BW7C 4J3WA 5CEYB 1INDH 3RVUC 4HFUL 1RJYA 4I0PA 5DJXA 2J3SA 1I9IH 2XIDA 2NNAB 2VL5A 1MY5A 3QJFA 3NBNA 2PW1A 3VXTB 4ZS7H 1FGNH 2H2PD 1QFUH 4KU1A 5I1EH 2IPUG 3AREB 2V2WA 5L2KE 5GGTA 3KPLA 5C0GB 3C60D 5BRZD 4R6UA 3BXNA 4KZDH 1KPVA 3NIFE 1CFTB 1XF5A 1IGFL 4WFEE 2HKFL 2W9LA 1MAML 3L6FB 3OG6B 4JFXB 3GM0A 4AH2A 2LU4A 4PTTA 3I75A 5ACZB 3BZEA 3W2DH 2Y1VA 1SY6L 3LKNA 2QSQA 1S7UB 3REVA 3IKKA 1TTGA 4FQIH 1KYOJ 4XP6H 5HBBA 3QDAA 4HUXB 5EOTB 3IXAB 1DVFC 4NWUH 4Z7UA 1H3PH 4UUJA 3ZTJH 4PJAB 2O61A 2DMCA 2QQLL 2AEPH 4WTZG 3MRKA 4HWZB 1WIOA 3HLAB 4QF1A 1A7PH 4YFLI 1TTFA 4ZSOE 3V8OA 3JV6B 4F15B 5INCA 5DDHB 2GUOB 1MRFH 1CFQB 1Q9LA 1DFBH 3EOTH 5DD3L 3BW9B 4X98A 5J6HB 1QSEB 1MREL 3VI4E 3IFNH 5DMKB 4WI5A 5DFVC 2Q6WA 3UBXB 4XAKD 5HHPB 4OF3A 4LKCB 4MZ2A 4EI6A 3D0VA 3OJVC 1V3MA 3NCCB 4XZUA 2VDLL 3VWKC 1IAOA 3BN9D 1KJMA 1MCCA 4LSSH 3ROLA 2XNAA 1A3RL 3OJMB 5IBUB 5KW9H 4MA8L 5KAQG 3QCTH 3RL1B 1TQBC 2HJLA 1YEEL 2FJGA 3AS1A 4R4BA 2XZAH 1KT2A 1XT5A 1MFBH 2EIDA 1OTSC 2O5YH 4OLVH 3PV7A 5L8JB 3VFPB 4G6ML 3QXTA 4QRPE 1WT5A 2F5AH 3B3IA 1X5IA 4KMQA 3ARBB 3RPIA 3LEXA 3BX7C 4NNPL 1HN1A 4LEOB 3RGHA 4L5FH 4N68A 4OCSL 4PRID 1AP2B 4FQ1L 4WHDA 3ULSB 4Z77A 5FDWA 4G8EB 1HZHL 2VISB 3BE1H 5GISH 5HHOE 5TQ0H 5BVPL 4XP1L 2E7HA 4NM4L 1FLTX 4FQHA 3QI9A 1J18A 1YYMH 3A67L 4Y4KA 5DJ0B 4HWBL 4AT6A 4U6TA 4GG6A 1ULVA 5TDOA 5TJWK 3BDYL 2VIRB 4RMSA 4Z7WB 5C08A 1FORL 3OGCB 3FMGL 5JW4Q 3WHXB 4BFIB 5EU5A 3LKPA 1NMAH 3MV7B 1OGAE 2AW2A 3DTXA 4M7JH 4NRZA 3V4PH 4I4WB 3DVIA 1T66D 2Y5TA 1KELL 1MFEH 1IVLA 5E5UB 3LKQA 3QEUB 4XBEL 5D7JD 4HF5H 4RMWA 4D9RE 4P2OA 1XR9B 1LO5A 5DJDB 1K6QH 3ZL4H 4J7RA 4D0BA 3JVGC 5HHXH 1KTRL 4Z78A 4AL8L 4YGVA 4Z5RB 4PB9L 2J6EA 2HH0L 1R3HA 3BPNC 4R4FL 3FB6B 1J12A 3VGEA 3K2MC 5FO9B 4LGRB 4WY7L 3VW3L 2CLZB 1CDYA 4NQTA 5SWZA 4CW1A 3QEQD 2P49B 1A8JH 3UAJC 2F53A 3SQOL 2GSGA 5DJ6B 3K7UA 1I1FA 4P46C 1CE1L 5IW6B 1JJUA 1L0XA 5DC0A 3S7GA 4XPFL 3MA7B 3M17B 3U6RB 1MAJA 1O7VA 2JE8A 4NNYB 4JKWA 1R5IB 4X6BB 2P8MB 3QPXH 1NGQH 4HK3J 3UJIH 4I3RL 1KACB 5ADPL 5D5MA 3RJDA 3SDXA 4CVZB 1A7QH 1RUML 3UTTD 4UIKL 1SMAA 5E8PA 5T33H 2PW1B 2YD2A 4AEHH 3C5JA 4GAGL 4Y8DC 2QV2A 4AENB 2XWBB 5E5MB 4GRLC 3GHBL 3W5MA 3L3HB 1Q72L 3LQAH 1XF3A 1HCFX 2X4TB 1AKJA 3O6LH 1ZHNA 3WFDL 3BAEL 2YD7A 2BSRA 2Y06L 5CGYC 2ZUUA 1KTDA 4Z7VA 1IGCL 2E3VA 2NY5L 5D2LA 4S10A 1D5ZA 2P42B 2VDQH 3X12A 1NC4D 1RAMA 4J3SA 3B8YA 1TJIH 5DC4B 3V7MA 3EYUH 2F8VA 3NAAH 5JHLH 5CJ8A 1S7UA 1U8HB 1HSAB 2WBJC 1U3HD 4NQED 3TFKD 4GRMB 2IJ0C 4Z7UB 4UQ2B 4LQFH 4DGYH 3DSFH 2KUTA 2DKSA 3SKJH 5DLMH 1J87A 4ODHH 4RRPA 5MI0B 1HWGB 3U7YH 2XRAH 3QRGL 5IP4A 3MUY1 1P4IH 2GK2A 2H26A 1D5IH 2BHUA 3N1QC 5E1AB 4RCAA 2HTLC 4O51A 5E9DA 4GT7A 4DQOH 1MCWW 5H35B 2HJFA 2NTFB 1KB9J 4K7PY 4A2LA 1FYHB 4TYUA 1TMCB 1JHKH 5GS1C 4HZLB 3TV3L 1S7WA 4GKSA 2QHRL 2W0LA 1IKNC 3QG7L 3V79C 1U8PA 3ARFB 4JO3L 4J3VA 2AEIT 1UADC 4XPTH 5F7UA 2C1OB 5D7IA 4N0CC 5I19L 2VWEE 4I0PB 4XHJD 3BZDA 2GJ6E 3Q1SL 4M1CC 3RVXD 4QHLA 5BXFA 1FFPB 2VE6A 2V9TA 2J12B 4UZGA 4LAJH 3C9NB 4NQDD 2CQVA 2XY1A 3STLB 1GIGH 4UILL 4Y4HC 2EDTA 3VXRD 3TH3T 2VYRE 1MHPH 3U1SH 1KLFA 4KQ4H 3TGXA 1G9NH 3PJSB 1CBVL 3OPZL 1X5KA 4GRWF 3FB8A 1AFVH 3UTSB 1L7TH 4GXUN 4RA0C 3ARBC 3QDMA 4PYHA 1FSKB 1P4BL 2CPCA 3BKCH 5ESAB 4KKCD 2EDLA 5JORA 2A0LC 3O9WB 1FNEA 3DHJA 5I73C 4G8FA 2PCPA 3GKWH 5D5MF 4XP5H 3OX8B 3IFOA 2X09A 3WCYA 2VIRA 3CSBA 4RAUB 3T3PF 3SE3A 1I7TA 4OGYL 3HE6B 1F3RB 5IB4A 1KCRL 2YD1A 3KS0H 4YEFA 5C0CA 3GMQB 1PKQE 1BZ9A 3TIEA 3REWB 4XPBH 6FABH 2OBGA 1DL7H 4N8CH 4F3FB 3FFCE 4P2QA 2X89D 3L9RB 2DYPB 2UUDH 5INCB 3QUMA 2FBJL 3KYOA 4BQCA 3QEQE 5BJTB 32C2A 1UWGH 4PJCE 3N9GH 4HHAA 5DMGC 5IW1B 5F9WC 4WO4B 2KDGA 2YRZA 4G5ZL 4IHOB 3QZWG 4JFFA 4YE4L 3T08A 5EIIB 4Z7WA 3MV9D 3KPSD 3TCLA 2ZCHH 3UBXA 4XPAH 4F9PC 3T1FB 5J9PB 3AC0A 4RZCB 2D7NA 2KZ1B 4M48L 1UJ3A 3QFJE 5HYSG 2D03L 4ALAL 2O93L 5CUSL 4PJXE 1A4JA 1SY6H 3S98A 4RFEB 5D7SH 5IFJB 3EFFB 3FN0L 5I8KH 5D96C 1EHXA 4MWFB 2DKMA 4LHUB 2YXFA 4FQQA 3C6SA 3I6LD 4PJ5A 4HXAH 1JMXA 4XNYL 5JIKA 1R3LB 2R2BA 4E0RB 3LKSB 3OAUL 5DVMA 2NW3A 1ROWA 1I3UA 4XMKH 5A2KH 3HMWL 3DVNB 4KDVA 1CL7L 4GUPB 2OTUA 1I75A 3F58L 2Q8BH 4LARH 3WO4C 4QRSB 3QP3A 3I3DA 1E6OL 4FHBD 4HWEH 4F9LA 2QADC 4WV1A 2RCSH 3QBTB 5E6IB 2AXFB 5IHUH 2XWBA 5E5MA 3B2VH 1TZHB 3ZYIA 1NJ9A 1UCBL 3KPOB 5C8JA 2C4FT 2VDRH 4R0LB 1FH5H 2HLFC 3HI1B 1ZT4A 1WAAA 5DK2A 3BO8A 4WU5A 1A2YA 1XF4B 4JO2H 5FA3A 2E7CA 3GSWA 4EZMA 3D18A 2Y5TB 1I3GH 1CIDA 1MCBA 4F7PA 1B6UA 2MCPH 5FYLD 2XTJD 4U6YB 4PRHD 2BNRD 3SE8L 1MFBL 4PJGB 5CD3A 5JR1H 2X4OB 2BSTB 3KYKH 1VGKA 1LDPH 2OI9B 1NFDF 3Q6GH 3TJEL 1T7ZA 2FB4H 3A6BH 5AZEL 1X5FA 4A6YB 2DQGL 5IROC 4OIAA 3BRDA 2VXVL 4OLZL 1BQLH 1LNUB 4XXCA 3ZE0E 3RRQA 4QYOA 4BH8A 1JGVL 3B9KD 1R24A 1T1YA 4CW1B 3PWVA 3B5GA 4ZS6C 1FVEA 3HZYB 1E28B 3GSNA 3HZMB 2GJJA 1LO0H 2AK1L 3HE6D 4OV5B 3ZKQD 5IEKA 2XG5A 2LTQB 4X6CB 3SE3C 3SHSA 1D9KC 3K4ZA 3BPNB 1A7OH 5KSBB 3RWEB 1GGBH 1RULH 3BUTA 1JRHH 1I9JH 2G60L 3U4BL 2IPTH 5JW4N 1Y0LB 2C1OA 2BMKB 2H26B 2ZPKH 4WNQA 4FXGB 3VI4F 4UINL 5IB2B 3KS0J 3WFBL 2ICWI 4J8RB 4MD4B 5IMLB 2EKSB 3HG1A 2NY4D 1DQDL 4YZFE 4I18B 3ZL4L 1Q1JL 2R2HA 3VXQB 4P9HL 2PO6D 43C9B 3ELAT 2IBGA 5BRZE 1A6VH 4NO3B 2XZCH 3V95A 1BJMA 2BSRB 3QUYD 1INDL 1S7XB 4YPJA 4CAGA 4GAYB 5T3XD 3BYTA 3OF6A 4KKBC 3UTSA 5GS2H 3QUZC 1HDMA 1MRFL 1I3VA 2ZUYA 4DVBB 4JQIL 2EDWA 35C8H 1CE1H 1S9WB 2ICWB 5I1DB 4HMEA 2OLDA 4MJIB 3BDYH 4JPVL 4X80L 2H8PA 4OCXL 3FRPG 3MLSH 5FUOH 1H3UA 2DM4A 5L2KB 5LVEA 1J8HA 1GGYA 1KCSH 3IXTA 4MDIB 3BWUC 4L8DB 4QHMA 1YY8A 2PKDA 1W8OA 2DQDL 3H0TA 4FP8H 3K4DA 4JO1H 3PP3K 4YHNA 1UZ8A 4PJGE 4I3SL 1IEAA 1T1XB 3I6GA 3NFSH 1EHLH 3MLYH 1R3JA 4LSDA 4S1DD 4N9OB 4MJID 2X9WA 1OAQH 4BZ1H 1H3PL 1AH1A 5DYOA 4M3JA 3TCLB 5EZOH 4OZFB 4L8BA 5LAXB 1L7IH 4GW5A 3MXWH 3QQ3B 4MSWB 2AJVL 4YO0B 4X4ZA 4FQ1H 2JIXA 2E7BA 3QNYB 1F97A 5HGGS 4RQQB 5D8JH 5E03A 5KANG 5D70L 2GT9B 5SWSD 1ONQB 2W9DL 4POZC 1KV3A 1GSMA 1UM4L 1MFAH 1QEWA 1A22B 2M2DA 4HWBH 3PHQB 5GXBB 1E4XI 1ED3B 3VFGL 3TO4B 3CMOL 5L8LB 5F1IB 1S9VB 5IGXL 1XGTA 4IOFC 2WWMD 1OW0A 4HUNB 2OMNA 1OTUC 1MFEL 3GJEB 1F6LL 5ILTH 1IQWH 1JNLH 1A6PA 5TQ2L 5HHVL 1HXYB 4PREA 3RI5F 3SDYL 5FKPB 4EBQL 3ZYOA 4O58H 5KVFH 1G6VK 3MUGA 5HHOD 4NO5B 1FNGB 1HH9B 5IT2H 1PD6A 4OF8A 1KIRA 4YHML 3RZWA 5DRNB 2E8ZA 4L8CB 4JZJC 5ICYA 5AD0A 4YUEL 4ZFOB 4XGZA 1IGCH 4PJ8B 2BP3A 4KUCF 4MJ6B 4P3CH 3DVNA 1HZHH 2D9QB 5F6HI 4RGOH 4TTGA 5C6PB 5DFVD 3L9RA 4MXVE 5GGVH 3VJ6A 5KVEL 3OKKA 5TDPA 1ZLUK 2FIKA 4YDLC 1ZSDA 3B5HA 1YECH 3CU7A 2BSTA 5F7DA 1P6FA 5JMRA 3FB7A 3MOAL 3C5SA 3ZTJG 5KSAA 1ZT4B 5E2WL 4I1NB 4WFGE 1RIVL 1BZ7B 4A6YH 4HK0B 1CXIA 3EYVA 5D1QA 2ADIA 1DQLL 4P4RA 2EXYD 3U0TA 5GGUA 2VQ1B 1AY1L 4KVNH 4I9WE 1I7ZB 4P2OC 4JFHD 4W6XB 1OAYH 1CXLA 2VZSA 2Y5EA 5T33L 4MLIA 3LQZA 2W60B 2YKLL 4EDWH 4EDXA 5C92A 3DX7B 4AL8H 1AC0A 4W4NA 1A47A 2P44B 3QEQB 1CDHA 4KH2A 4Z95H 4EVNA 2HTKD 3HCVA 4NP4H 1N4XH 4I48B 4JFXA 4A2MA 2YPKB 4MJ2A 2AGJH 3VGAC 3IDIB 4P2OD 1OT2A 5FB8B 3L3JA 4QXGH 4EOWH 2VDQL 2Y72A 3B6SA 1WZKA 4F33B 1T04B 4GOSA 1QVOA 3DGGB 5D72L 4N5ED 5CWSA 1EMTL 4U7SA 5ALCH 1QO3A 3C2SA 1MHHB 4Z76B 4X6CF 5C07B 1FO0B 1KCVH 4UUJB 2CDGA 4KQ3H 4WFED 4GG6E 1S8DA 3S4SA 1ITCA 3QDJB 3HI1A 5DK2B 1T7WA 3GDBA 3V9FA 3VXUB 4K9EL 4Z7NE 4Z7QF 4ODHL 3P3YA 5GRWA 1H15A 4MA7H 3K80A 1ETZA 1KENL 4LLYA 3T65A 2VLLA 3BGFC 3OG4B 5ID0A 4ETQA 4S11A 3P9MB 4V1DE 3R1GL 3PWJA 1RJCA 3KVQA 3VD9A 4N5UA 3RA7H 4KDTA 1HI6A 1WIPA 3O8XC 3HN3A 3TPKA 4EI6B 3KPLB 4MJIA 3ECBB 4XBGA 4NO0B 4RISH 5BZWB 2GITB 2DLHA 3IDGA 4WWKC 4XPGL 1BMGA 2PNDA 3OAUH 3MRBB 4IMLB 2FGZA 4YDKL 2C3XA 3I75B 4WCYL 5ACZA 4UAOC 1R24B 1UA6L 2YD3A 3LDBB 4Y19A 1KGCD 1B0RB 5GJTH 3BP4A 2RIKA 1C08B 4HWEL 1IRAY 5F88B 4P5TB 3G5XA 3WUZA 5FM4A 5I1DA 4WUUD 1QPXA 5EUOF 2VLRE 2YPLA 4S1SL 4UDTA 2ZOKB 3HRPA 4QGYA 1G9MH 1P7QA 4MAYC 3LVEA 5IMMB 5B39B 1QLFA 3RZCD 1AE6L 2XZQL 3U7YL 5I1JH 4Y4HB 3V6ZA 3OZ9L 3S88L 4X9GA 2BMKA 1ZLWK 4POUB 2E27L 2V2TB 1OAUL 5SX4I 1MCEA 4X99A 3B9KA 1NFDA 1OQXA 1QSEA 1BREA 4R97B 2EKSA 1NGYB 1ORSA 2OZ4H 5HYFA 5J57B 1A0QL 1RMFH 3VXUE 2XT1B 1C16A 2XPGB 3O4OB 3SE4C 4FMFA 5CP7A 3F62A 4Y4HD 4EJ1C 1JWUA 5KSAD 2CGRL 3MBED 5E8OB 1BJ1J 3OKDA 2WP3T 4QO1A 5EUKA 3CAFA 2X7LA 4M6ML 3BQUC 4LLWA 5CINH 5DJCA 4JFDD 4KTEL 4NO5A 1CGTA 4PGBB 4YR6A 2AV7A 4J23A 3GSUA 5CMAA 4LSUL 1V7NH 3T04D 1A64A 3OV6A 4M6NL 3LEXB 1WZLA 3BIKA 3WEXA 1H3TA 1MJJA 1AFVL 1P84K 1CICB 1U3JA 4KK5D 1LP9F 3T09A 4NN5B 4IIQC 5DURB 2IC2A 3V6OE 1B0GA 3RVWC 2I25N 5JDJA 4GMSL 4HS6B 1ZVSB 1N5YL 3F7PC 2YMXL 4QEGA 4M5YH 4JGUA 5BV7B 3FN0H 4IIQA 4Y2DA 3OKKB 4KMLB 1IT9H 5DQJB 1BAFL 5FO7B 1RK1A 1OGAB 4YHKH 3T0WA 1KCRH 5IMKB 1S5HA 4KI1A 1IAII 2Z4QA 1MCSA 4MJ6A 1D9KB 4NQEB 5ANMB 4K71C 3HRZB 3VXPB 1S9XB 2IMMA 4OLWL 5DJYA 4LAQH 3K1DA 5B22A 1EEYA 4N8VG 4R2GD 3ZT7A 1NGPL 2HVKA 4Y5XB 1UWGL 4ZS7L 1QFHA 1E6OH 5C2UB 1G7HB 4E41B 3DETC 3CX2A 3KAAA 1ZWIB 4YGAB 3VDCA 4WI4A 3RX5A 3PV6B 5DRWA 1S7VB 1EIBA 2XA8L 4OQTH 5D2NA 3TO4A 4F9PA 4R90L 1P7HL 1MHEA 3FB6A 5C0CE 2VLJB 3WNKA 5EORL 3HTLX 1R6VA 2X9XA 2VTFA 2YPKA 4R8WH 2HVJA 4ZS6D 2AEQL 4QXTA 1FFOB 5F89B 1INEL 1QYGL 3BSZH 1WK0A 3QO0A 4Y8AA 3WKNA 4XNQA 5FKPA 3MROA 4YHYC 5J4MA 3K1KC 1MQKL 4KJWC 5TE4L 4OCYH 4BUHA 4M43H 2G9HA 4OIIL 5HYIA 5IW6A 4P9HH 4L9DA 4PLJD 3W11D 1FYTE 2MPAH 4KI5E 5IW3A 2VOTA 4P57B 1GGCH 1X7QA 1F4YH 2VSCA 1NDMA 1T5XA 1X4YA 2AXGB 3H9SE 4JFDA 1VA9A 4EUPG 5IQ7H 3GJFH 5HXMA 5E6IC 4K8RH 4YDVA 2X70A 4GG8A 1QVOB 1CL7I 3DGGA 3NMEA 4K7PX 1NAMB 5C70A 2Y36L 3VWKB 2QSCH 1ZHKA 3MTRA 3WO4B 4JPVH 3EYSL 2ESVA 1F3JB 2NY6C 5KSAB 1GL4B 3LS4L 3EGSA 1NUFA 4P3DA 3MBEB 4TVPD 4JO2L 1OAKH 1P9MA 2NY3D 3MRBA 1ETZB 5DHVH 4KHXH 1G6RA 5EOCH 2HFEB 3M45A 4NN7B 1Z6JT 5LCVL 3QDGA 3RAJL 4QHLB 1QBAA 4UINH 3PWJB 5BXFB 5SV3A 4S1DC 3P4OA 4ZPTA 1DQDH 2FH6A 2CKBH 5EWIL 3A6BL 1Q1JH 3HC3H 3GSRA 3LSOB 2EYRA 4NBZB 3TH2T 3BPOC 2EDKA 2ITDB 3DYPA 1NLBH 3KLDA 1KNOB 5D7KD 4G80B 1OAZH 3B83A 1Z9OA 3DOSA 3MNZA 5I9QC 1MI5A 4JKPH 2AXHA 4F3FA 5CBEB 4WI8A 5I8OL 3QIWC 4KRLB 5EU7C 3RDTC 4G8FB 1T04A 1YYML 3A67H 1FC2D 3KYNB 3GHEH 3JZ7A 3HPJA 2F53E 2A6DA 2EDFA 3S3SA 4WUKH 4K3DL 4PJ5D 3RVWD 4UIMB 1BBDH 3VRJB 5J13C 4WDIB 4XCNA 3AREC 3ZT5A 3QNXA 4QNPF 43CAB 1KCSL 4DZ8B 3ARQA 4FQJL 3P77A 3V4PL 3HAEB 4G43A 4HPOL 4WI9A 1J1OH 3KYMA 5DS8A 3F7QA 1KFAL 2RB8A 3CLFH 4PGDB 1YDPB 5KVFL 5I73B 4BQBA 1RUKH 1K6QL 4NN7C 3BPCB 2BHZA 3MRCB 4Z0BH 1F4AA 1X5JA 1KN2L 4PJ5B 2B2XH 4YR6B 1AD0B 2O26U 3O4LB 3RWGB 2NY6B 3UTZB 3WUWB 5KSAC 5BZWA 3NCFB 3IDGB 4B7LA 3TBSA 2YBRA 4GRLA 3P0VH 4WY7H 3VI3E 4PJHF 5IB5A 1G7IA 5MENE 3QG6A 3OKDB 4LLAA 4RGOL 3H9HB 1T0NB 3DSNA 5DT1H 3LRHA 4O9HL 5HHMD 4C56D 4MVBD 4HJ0D 1A4KA 4OLUL 1IGIL 4RX4D 1D5XA 1Q0XL 1W72H 1OGAA 4GXVL 5JZ7C 4PRAA 4O5LL 5J6GB 2BHYA 3CFCH 1QLFB 4WEUD 5FA3B 3PGDB 3MLVH 5C0CB 4PB0H 1N6QH 3RBGA