1DQTA

The crystal structure of murine ctla4 (cd152)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CYTOTOXIC T LYMPHOCYTE ASSOCIATED ANTIGEN 4
publication title Structure of murine CTLA-4 and its role in modulating T cell responsiveness.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqtA00
2AV7B 2VZ3A 3PJSB 3MBEA 4PJ7B 4OLZL 3HE7A 4MCZB 1XGRA 1FNGB 1J1XH 2F53A 4HIXL 3VFWA 4XPHH 5J9PA 1E6OH 2B1HH 1MIEH 4K8RC 2OTWA 3D18B 1TETH 4YIQB 1YDPB 1BX2A 1RPQA 3O2WL 3QDGB 4PP1C 2W0KA 4PJ8A 2VYRE 4OB5L 1A6UL 5KSUB 4NZRL 1QRNE 2Y07H 4ORZC 4Y16C 4CRPA 4FFVD 3UTSA 2VJXA 4S2SB 3HG1B 4LKXA 3RGHA 1KUMA 4WI5A 5CJXA 3JWOC 4JB9L 5DS8A 2VZUA 1NCBL 1OQOA 3MV11 2LTQB 4GG6F 3FT3A 1OAZL 1QVOB 2NY5L 3AMKA 3QYCA 5IM7B 2AI0H 1NEZA 1HXMA 5C0RL 1P9MC 1NKRA 2J88H 4U1KA 1TLKA 4G6FB 1JPGA 5EDXA 5DD3L 4RRPA 4Z7WE 4Y4KB 4EDWH 3O2DL 1HKLH 2IF7A 4F15C 3C2AH 3OHXB 2R1WB 4U6YA 1KN2L 5C08E 1LE5A 2FEDC 2WAHA 4OZIE 1GGCH 2DWDB 3BO8A 4AEFA 2AEIT 1H5BA 4MAUH 2OJEA 5JLZB 1QSFD 2FX7L 2Y06H 1OTSC 1LDSA 1NDGA 2N7AA 4RAHA 4XPTH 1F2QA 2ENYA 4PS4H 4NQEA 4X7DC 2XRAL 3QWQB 4K3DH 4PJXA 3MXWH 5B4MC 1U58A 4TTDC 3UJIL 3PWPB 3ULUH 4ONGH 4XPAH 2FSEB 3BQUC 1FZOA 5CINL 5SWZD 3RWEB 1F6AB 2R2EA 3DSFH 5DI8B 3SKMB 5AYUL 5EU6A 4MCYA 1WVZA 1A1OA 3NTCL 4NM8L 3P77A 2F15A 3FFCE 5B38G 4I18C 3MV9E 4IRJD 4DEPC 3PDGA 2RGSA 3MNVA 4HFUL 4LVNC 1M71B 3RQ3A 2J12B 4YDLC 1LGVA 5DJCB 4OV5B 3QH3A 4S1SL 2VLRA 5E8EA 1KNOB 4WDIA 5C09A 1S9XA 3VJ6B 2X4SA 4HUXB 4K3GA 5BVPH 5HBBA 1ETZA 2IPUG 2MTPA 2BHZA 5FO8B 4XI5C 2IADA 3A6BL 1RUMH 5E6ID 3FFDA 5TDPB 4U6VH 4BZ2H 4PY7A 4CAGA 4Y2DA 2W9DL 3QFJA 4N0CC 3MJ9L 4FRWA 1FCGA 4UZGA 4Y4FA 3BFOA 2GSIB 4K9EH 1HI6B 2D31B 1WLHA 4QTIH 1M7XA 1FL6B 3QUMB 4JFXB 4OZHF 5IQ7H 2BVOA 2CUIA 1YYML 2VLKA 3VFUA 1S5IH 5E5RB 1Z3GL 1KIPA 3F7YA 3RWJA 3CC5B 4R2GC 3KNBA 1ZSDA 1OAYH 1EUTA 1Q9LA 3LD8C 5JORA 3HI5H 4PV9B 3WD5L 3K2MC 1P7KB 3TIEB 4MJ2A 1ZHNB 4M61A 5ABDE 2IWGA 3BPLC 3S3JA 3PV6B 1PLGH 1NAMB 3L1OL 1GPOH 1INQA 4Y8AA 3BMWA 3MV7D 4M6NH 1YPZE 1MVFA 4F7CB 3B8YA 1LO4H 3TNMA 3V4UH 1LD9B 1QLRB 1LP9A 5J3HD 4Y4HA 3IXAA 3LN4B 5D70L 2VSDA 3OXRB 4ZTOH 1MHCA 3PWVB 2AXGB 2AAVA 3IDJA 2YRPA 1G6RH 4CDHA 4I3SH 1YEKH 3VD5A 2CKBB 2FYYA 1T7WA 3GNMH 4OTXH 3RTQB 1CXLA 2HFGH 2DKSA 4KPHH 3BZFB 1ZLVH 1XH3A 1JZ2A 3MRLA 1N0XH 2CMRH 5BXFB 3ARED 2EDOA 3GBMH 3GSNA 1TZIA 3CSGA 3WNKA 1UH2A 4JVWA 1XIWC 3SDDD 1AC6A 1CFSB 4MA3A 5EFIB 4GW5B 1HHIB 4MDIB 1U8JA 2WSKA 1GC1L 1F8TH 3QEUA 4NUJB 1DN0B 5FB8A 1KCRL 3DROB 4WW2C 2VXQH 1I8LA 3B5HA 4I0CC 1HSBB 3JBG7 3O3AB 4LDEB 2AJVH 4Z7UA 1UJ3C 1QR1B 3HLAA 4HBCH 3FKUS 4PRAB 3T3ME 4JRYA 2VDMH 3BZDA 3FB5A 4LCYB 3SHSA 3V7AE 1J87A 5H35B 4GKZA 5JHLH 2P48B 1C1EH 1NGQH 3EDFA 4G8GA 3M1BA 5LAXA 3WYRA 1QBAA 1KJ2B 2X44D 5E5UB 5M95B 1Q9OB 2VDPL 4F15B 4XBPB 5FGCE 5I30L 4LSDA 3DUUA 2DQFB 3OKLB 2YMXL 4CMMB 4O2FB 2OL3B 1DDHA 4JPWH 4L8BA 1FFPA 4MMXC 3BVNB 1C08A 4R7NB 2QKIB 3BP4A 3ES6B 4HUNB 1M1SA 1MF2L 3B3IA 4LLUB 3VRIA 3EOBB 1N26A 1YNLH 4JFEE 2XKUA 4LASL 4MA8H 4OLUL 1CDUA 5CLTA 4NBZB 3ZTNL 1I4FB 4KRNA 5ALCL 4MB3A 4LCWB 2AS5M 3FONB 4X9GA 5CUSL 4R4BB 1QBMH 3IU4L 2APWA 3P9LB 3PQYA 3QAZC 4H1LG 1B4JL 3MLPA 4LVNB 4QCIA 5E4IA 1VFOA 1EHLL 2EO1A 3AXLB 4HS8L 2RFXB 4P5KB 4P59H 3QCTL 5TDOB 1DQDH 4L8CA 4PRNA 1J1OL 1R24A 4DAGH 5BMFH 3LKQB 4DGVL 3OKOA 2FGWH 1JNHB 2ADIA 1V7NL 1L0XA 3LRHA 1NFIA 4HV8A 5FIEA 1JHLL 1FN4B 2EDLA 3GIVA 4FS0A 1FG2B 3NIGF 1V3MA 5C0IA 5KSBB 3O3DA 4IOFD 2YK1H 1QR4A 3DBXA 5MEPB 3QIUB 1A2YB 3DI3B 2J8OA 2DQEH 3MV8A 3DRQA 4Q9RH 1N2RA 4KWUA 4J4PD 4C56E 1CGYA 3ULUF 4XB8A 4X8JA 3P2TA 3CX5K 4FOMA 4OFPA 5C0CE 5TGBB 1NUGA 1EDQA 4R2GB 1I9EA 1ZEAL 3GRWL 5TQ0L 3U9PH 1C5CL 4LLMA 3LD8B 3KPQB 3T2NL 1YMMA 4XVJL 3BN9C 2JELL 1KC5H 4WGVB 2AJ3A 2QBWA 5D7KD 3WE6A 1WZLA 3IJHA 4GBXA 1DLFL 1U8IA 4EOWL 2O5YL 1H3XA 3GM8A 4Z0BL 3VD7A 1HHKB 5EU7E 5FM5M 3FT2A 3QI9A 4JFFE 3E1F1 5EZJA 2PYFB 4BSVB 2H1PH 1TJHL 3TZVD 1C16A 4K3JH 5GZND 3K8KA 3RWDB 2WBJD 2AXFA 5IWLA 2V7HA 4LSUH 1JIBA 1AGEB 1S9WB 5BVJA 1JYNA 1ZWIA 3ET9F 4KKBC 3UTPE 3MZTA 4HUVA 1EV2E 3FOMA 2VE6A 1JGVH 2V2WA 1QZ1A 2J5LC 4ODUB 1QACA 3NCEB 5I8KL 3LAFA 3QCVH 3MREB 1JK8B 4N8CL 3DUSB 4KI1A 4HZAA 5HHOD 2FB4H 1G7LB 4YDKL 5IFAH 1OLZA 4PRPA 2P5EA 5ICXB 1FL3A 1I8IB 5C7XL 4ZG1A 4G5ZL 3CXDL 4NZUH 4NKMA 1URLA 3WIHH 1KPRB 3U0WH 5ADOH 3ARBD 4G9FA 4H0GA 4HULB 3AU1A 3CXHJ 4WW2B 3BH8B 4PP2A 2JLLA 4O5LL 3L5XL 3EOAB 4X0KA 3DTXA 3D0VB 2JJWA 1UJ3B 2YPKB 4WUKH 5E5MA 1EUUA 3EJZD 4XCFH 4RCAA 2VMFA 4XNYH 3SKNA 4PB0L 4PJCA 1CE1H 2HA1A 3RZCB 5L2JB 5BZWA 1DQMH 1FL5B 4S1RH 5CWSB 1PJ9A 1ND0A 1CFNB 4PGEB 2AJUL 2R0ZH 4OFYD 4YE4H 4DN4H 2BY2A 1IRAY 4TSCH 3CAFA 5KS9B 3R06A 5CGYC 4OGZA 3F12B 3BXNA 1E4WL 1HQRB 3RVUD 1IZJA 5A2LH 4WJ5B 1BQLH 3BEVB 3TBSB 4HGMA 4JDTL 1T1ZA 1T6VN 2PW1B 1TJIL 1EGJL 2I9TA 1W72B 1RHHB 1WF5A 1UM6H 4W68A 1S9VA 2YBRB 4PRID 3CVHA 3QO1A 5HXMA 1CD1B 4GS7C 1FLRL 4JFHE 4JVUA 4MJ5B 3VRLF 4DKEH 4CVWA 1D6EA 2RR3A 3EO1B 3BE1H 4Q6IA 4K71C 4KU1A 3U48A 1H0DA 4WUUE 3UXFA 3GSNH 3SPVA 3FO9B 2B0SH 1NGZB 4LSRL 4X5XB 1U93B 3LB6C 1OW0A 2AJYL 2EDJA 3C08H 2IC2A 5E2WL 4ZFOB 4APQA 1VEOA 2GT9A 5HHMB 5D7SH 3QEQE 1A4KA 1LO5A 3VD9A 3I9GL 4LSPH 5MENE 3RVVC 3DURA 3JWDH 3B9KA 3NABH 2GJ6B 2QSCL 3IF1B 4TVPL 4QT5A 4LSTL 1ZT7A 4RZCA 3B6SB 2VDOH 5DJ8B 3ZE0F 1LNUA 5IFHL 4ODWA 3D25A 3VXNA 2BRQA 1RIUH 2EDRA 4XWOC 2D7NA 1F3RB 3B5GA 4GG6B 1YA5A 4QOKD 3TBWB 2HWZH 4S0TD 4CNIB 3UTTE 3HPLB 5GS2D 5HHXH 1N5AB 2X41A 4U1SB 3OKNA 3GBNH 3D48R 3KJ6H 1KEGL 4R3SA 1JZ4A 4F2MB 7FABH 2WK2A 3NCYP 4FQXA 3I02B 2DLTA 2UYLA 2W0PA 3GHEH 4ZMAT 2JIXB 4H0HB 3KPMA 4CJ0A 3QCUL 1VADB 5ALBH 2VN7A 4XP6H 1UENA 4LPWA 3BHBB 2SEBA 1EEQA 4PJ7E 3ECBB 3KPPB 1J9CT 4UU9A 4C56D 1A3LH 4YR6B 2A6DB 4UQ3B 5C0CD 4RMSA 5E2UH 3UPRA 5EOQL 2BFVH 2Y5EA 1C8PA 5E24E 3ZYZA 4BKLB 3QDGE 1DBBL 2XPGA 3VFPB 4LLDB 4LQFH 1X4ZA 3AS0A 2GAZB 5BRZB 4U0RB 4QRTA 4HJ0C 2P5WB 5D1XD 1OP5K 5I2IA 4R0LB 2Q86B 3HG1E 1G7HA 1DQLH 2CK0L 3DNKA 5LGKA 4PBWD 1Q72L 4JFFD 2D03H 5T1LA 6CGTA 3W9DB 3BEWA 4HIIA 5GGRY 3RVWC 4XP5H 3IJSB 2DQJH 1KOAA 4HCRL 4Z5RB 3OKYA 3ZKNC 5FV1L 2EO9A 3G6JA 4NQUA 3PWNB 3QIBC 1FIGH 5DD1L 3NIDF 1F42A 3H9YA 4ODTH 5IB3A 3KPLB 3NACL 5JR1L 2EYSB 5JXED 3GGWB 1IGYA 3J7HA 4H25A 1YECL 4OSUL 2HG5B 4YHLL 2I24N 3FRUB 4M3JA 2F74A 4HC1A 4GKNB 2FL5B 3GB7A 1ZT1B 4OM0L 2YS4A 2V7NA 2O61B 4OZHB 4G9DB 3P9MB 2JJTA 5FOJA 3ULUC 2DAVA 4P23A 4Y5YC 4MNHA 3FTGA 1DEDA 3EFDL 3ARGB 5LBSL 4HH9B 1ITCA 1KCVL 3DETC 3PWPE 3G08B 2Z8SA 4KI5E 4WEBL 4ZOAA 1KLUB 2NY0C 5EOCL 1A0QH 1V3KA 3EOTL 4MQ7A 5ITBH 4WTXA 4CVZB 5C9JA 1HILB 1OP3K 5JOFB 4LIQH 1OAQL 4AEHH 5MP6H 3L3HA 1B0GA 3P4OA 3RWGB 4MB4A 4PTUA 3PNWA 2YD8A 3LRSB 1KIRA 4Y7MA 5LQBL 1IEAB 2ZSWA 4FQ2H 1SYVB 3QDJD 1UXWB 1J8HB 4DGIL 4PJIF 1AE6H 3UC0H 2BOBA 1N5YH 5TQ2H 3IDXH 1YN7B 3DMMC 4UTBL 1CIUA 5EUOF 3OAZH 2VISB 3JSSA 4WV1A 1AXSA 3IKKA 2OMNA 4Q0XH 4GS7B 5D71L 3OZ9L 4K71B 3P0VL 1S7VB 3HC0A 4WVRA 4P4KA 3PABB 4YHOH 3VFTB 1GGBH 3RWIA 1IGTA 3Q0HA 3LKSB 1O7VA 2VH5L 35C8L 4AEEA 2QEJA 4OBSA 2AJXL 3U4EB 3L5JA 4NOFA 5D1QC 1KELL 4WUUD 4XXCC 4PD4K 3UBXA 5B8CC 3BPNC 2WW8A 4XMKL 3WS6C 4N8VB 1X6LA 3EZ8A 3PXJA 3QEQD 2UWEF 5IB5A 2BNQA 5MEND 2HT2C 3RWHB 1KLGA 5GS0L 1Z5LB 3WFBL 3U46A 3CMOL 3TVMC 1XF2A 5FGBA 3M45A 1F02I 1WAAF 3KLSA 4HKXB 5CBEB 3G5VB 3O9WA 2LVCA 2W65B 3MCKA 4YUEH 5GRJH 3SO5A 1KJMB 4X9BA 3DV6A 3KPNB 4PRHA 1MCFA 3D39B 4NKIH 4HPYH 3HI6H 4YHMH 3ZHDA 1T7ZA 2F54A 2V5RA 43CAA 1DJSA 1S8DA 1Y6KR 4LCIL 2ADJA 1IBGL 1NCWL 3QPQC 1VGKA 3JTTB 1ED3A 4LP5A 4WI9A 3F7PC 2HLAB 4NO0B 1UWEL 4QNPF 4N5UA 1Q38A 2WIIB 2NLJA 3FQWB 4PJGF 4G8FA 3VFRB 3CVHH 3O6LL 3FQRB 2UUDH 2YD1A 3QISA 3HNTL 5I8EB 4MXWL 1FFRA 2VL4A 3ILPB 1FV1A 2W38A 1F58L 1HYSD 2OCFD 3RY6C 5DQ9B 4ODBD 1K3IA 3M17A 2IG2L 4KUCD 3UDWC 3EYFA 4KDWA 3UJJL 1E27A 4JN1H 1MFEL 2VXVH 1AD9A 3QDGD 3VW3L 4KVCL 1AR1C 5T3ZE 1PEZA 4NM4H 3NIFE 1BEYH 4DZBA 4JY5H 4QHNB 3QNYA 5DUPH 4LEXH 4PREA 3TBTA 3O0RL 4MJ6A 1GSMA 4F9PC 3OX8B 1K5NA 2I9LB 4ZUWA 4O2EA 3NZHL 3D0LA 4HWBA 4JRWA 2BSTB 5FECB 1CXEA 1S7SB 3FQNB 5ACMA 3VXQB 1QBBA 1S5HB 2H3NB 3CUPB 3STZB 1B6DA 2EKSB 3CK0H 5GISH 3HAEA 4NCDA 5D7JC 3WO4C 2CLZA 4UIKL 2ERJC 2FEEI 4X7FC 3GMMB 2JE8A 4XXDB 4LRNL 4HS3B 3L9RB 1FNSH 4CADB 3O8XA 2ICES 5GGQL 4UT7H 4DCQB 1S7RA 3MBEC 3HE7C 5HYEA 3VFVA 2LU3A 1QLEH 4ZPTB 4Y5YB 1RIVH 1ZVSA 3GBLA 4OM1L 4OD1H 3U9UA 3REWB 3TO4A 2B5IC 1KJ3H 3BGMB 4XBGB 1OD9A 4CVUA 2DYPB 4J3OC 2R4SL 4LCWE 3P4LA 1H3GA 2E9WA 4NQCA 1DQQA 1T89C 3V6FA 4AENB 2PXYD 2OP4L 4HKBB 3QUZD 5JTWA 5TH2A 2V17H 4HMDA 1JRHL 4GG8A 5EO1A 2W9LA 1OTUD 3HUJF 2CRYA 1LO3H 4Z7OF 5CP3H 4YFLI 4F8TA 5CJXC 3ARDA 1MJ7L 3I6KA 5AD0B 5E2TL 1U92A 5I1AA 1JGEA 3RAJL 3CDGA 3HI1A 1UB5B 4OLWH 3PUCA 3PGCB 4M48L 1FE8H 1ZVYA 2R4RH 2GJZA 3WIFA 5BOPA 2CDEB 1F4XH 2YA1A 4E41B 4HUUB 5K9OA 4KKCD 3DMMB 1BLNB 5FK9B 4NFBA 3MNWB 4NHCH 4IRSD 6FABH 4L29B 5KSBE 4TSBL 2ADGA 4HUWA 5JIKA 1GOFA 2FRGP 3PWJB 4S1DD 5EO0A 1NCAL 4YNYA 5JMRA 1RK0A 3ALPA 3H3PH 3LH2H 3MLSL 3LKNA 1H5BC 3BZ4B 4DKFH 2QSQA 1XR8A 2IBBA 4HAGA 4TVSa 2E8YA 5F89B 5LVEA 1IGFH 4XP4H 3TV3H 3ARFA 3NFSH 4JDZA 1MCKA 1FYTA 4ONFL 5D1QB 3KLDA 5IOPB 5B8CB 4RBPH 3MRGB 3EW3B 3L6FA 5B21A 5H2BA 4JFOA 4Z7QE 5EU5B 4Q6YA 3QG7L 4MD5A 2RB8A 3PGFH 3PP3H 1CL7H 2DQGL 3QUKA 2B7DT 3TVMB 4J3SA 2XTJD 5TDNA 1W0VB 5ICYA 1WFUA 3GMOA 4EXPX 4X80L 2F9BT 1G6RB 2X89D 4WHYH 3MBXH 2X4TA 3D5OF 4FG6C 3WMSA 2FX8L 2OZ4A 4MWFB 2NNAB 3R8BB 3ZTJG 1T03L 3D2UB 3WNMA 1TVBB 1OQXA 1G9ML 2PYEA 3DPBA 3OKEA 4F7TB 3KAAA 4U1JA 4BZYA 1C7TA 5BW7C 1LVEA 4LSQL 5D9SB 1U8MB 3HPJA 3CFBB 3MOAL 4OIIL 1I9IL 1RIHH 4KY1H 5ISZA 3GKWH 5IHUH 1G1YA 1PEWA 1FGNH 4Y4FC 3G5ZB 4URTB 2HT4C 5K59F 1FSKB 1DFBH 3G6DH 4JO1H 5HHQB 4N68A 4ZNCD 3X3GH 4K7PL 2XACC 2A0LD 4U6TA 4O02H 3IU3A 1YC7A 2G60H 4PJCF 3V5KA 4OLVL 5GGTH 1GZQB 1QFWL 3CDCA 2HKHL 4PJAF 3F62A 3SEPA 1R5IB 3E6FA 4HPOH 5GGSY 4RDQG 4I3RH 3O41B 5AUMA 1BJ1J 1CDYA 3DWTA 1I3GL 2X1WL 3H3BC 2R1XA 1UCBH 4ALAL 4WI8A 4Y19D 4HBQA 2E27L 3WO4B 3V2AR 3TPUA 4QRRB 4UDUB 3SY0B 4Y4HC 3K8MA 5AG8A 4L3AA 2ERJB 4LOUC 2IQAA 5KS9E 5J11C 2H2PC 1HIMH 4LCUB 3RJQB 2AJSH 4YXKL 1YN6B 3MRQB 4U3CA 3WHE1 2E7CA 2L0DA 3MGTB 3H9HA 2X40A 2FGZA 3W0WD 4NQSA 2DL9A 3EO9H 4IRJA 5DSCB 1DL7L 4Z9KB 1PVHA 3BJLA 2P47B 3MBEB 3CD4A 3NAAH 5I1CL 4KAQL 4BUGA 1NSNL 4N9OB 3STLA 1T1XA 5IR1A 2MPAH 3OR6A 1ZA3A 5F8QC 3PDOB 3GSWB 4DW2H 1YMHA 1KTDB 5GS0D 3KPRD 3VWJD 5DRNA 3MR9A 2XY2A 2RAMA 3SQOL 2Z31B 1JGUH 1OOAA 3V6ZA 4L3EB 4NP4L 3JWDC 4LKXB 2Z0BA 5E8DL 3BRDA 4M6OL 4U05A 5DS8B 1I8LC 4LCWD 5ESAB 4MAYD 2AERT 3QPXH 5HHME 1CXHA 1WBYB 3LKRA 4HHAB 3FT3B 1L7TH 4TNWF 5BO1H 2XQYG 2GJ6E 2A6JA 4BQCA 4Z0XA 1MCIA 4N0UB 1NEZB 1CFQA 2AK4A 4QRQA 4HWBH 1Z9MA 4KFZC 1FRGH 2HFTA 4HJGA 4AM0A 4UILL 5L88L 4HT1L 4OCSL 4GG6E 2YKLL 4QHUA 4P2RA 1P84K 3O2VL 5FF6A 4UT6H 5IHZB 3GSXA 4X9IA 4H26B 5JDJA 3HAEH 3C60A 8CGTA 3BO8B 1H5BB 3HCVA 1FJ1A 5GSVA 1DBJL 2A73A 3MV7A 5CD5C 1KB5L 2WNGA 4I4WA 1NDGB 3VFNB 3RU8L 3QIUD 4NQEB 3ZT5A 1GIGH 3O3UN 3L5WA 4Z76A 5FUCC 2VXUH 3EHBC 1OAXL 2CQVA 2EH8H 3MRRA 5D1ZD 1G0DA 3GMQA 3MPCA 3WEXA 4RFOH 4MCYB 3CFCL 5FYLL 5HDOA 3UTZB 3LZFH 5CZXD 5BRZE 4JFPA 4ZFFB 5DVMA 1ZLVK 4KMLB 1MELA 1K4CA 1X5FA 4N90E 1CCZA 1F4YH 2P5WE 5E08L 3RKPA 1PX3A 5F7KC 5C92A 3V4VL 3SDDA 3GIZL 3AM8A 4NFCA 4PGCA 1NGXA 3QXAA 3SKUD 4WI2A 3MUY1 5IEHB 3MLVL 4ZAKA 2LFGA 1YNKH 5EBGA 1ZGLB 5GGUA 1U8OA 5ACZA 3TA3D 2E7MA 1P7QD 4KROC 2BCKA 5IIEB 1QRNA 3NN8B 3SE9H 3ZYJA 1A6AB 4WNQB 4PY7B 4PJIB 1AIFB 1FZMA 1BBJB 4Y4FB 4WI6A 1N64L 1TVHA 5EUOB 5DK2B 5CMAB 2D0HA 1RUPL 4RMRA 3I50L 1QNZL 2VLKB 2NR6C 1EO7A 4U1IA 1A7QH 1QPPA 1CGSL 3GMLA 2R15A 3RWJB 4EN3A 3ISWA 1IGJA 2CDGB 4OBRA 1D7FA 1RVFH 4KK5D 4OZHE 3MRIB 3VH8G 4D0DA 4BQ8A 5IK3A 2CR3A 1TTFA 1IM9A 4H5SB 3RVTC 1ZK9A 4M61B 4Z7WA 3EJYD 5SX5H 3DXAD 4QRUA 2MCPL 4GBXC 5IMMA 2DRUA 1IJ9A 5C9KA 2M1KA 2D7TL 5C08A 1CGXA 3QI9C 3G5XA 4P0DA 4OZIA 4WO4C 3QHTC 5FOBA 2XY1A 1MSPA 4Y4HB 2J8UF 3BMVA 2UWEB 3IXAB 5IWLC 5BZDA 3HKFA 5EOCJ 1CBVH 1CGVA 3Q6GH 3TF7C 5EN2B 1EAPA 1D5BB 2A6KA 4UAOC 3VXSD 5DD0H 3GSQA 3RZCD 1MY5A 1QG3A 4M7KL 4NKDB 4NJAL 2XZCL 3MJ6A 1UGNA 1BBDL 4PRDB 5DUMH 2OZ4H 1QBLH 5J8OA 3O6KL 1J8HE 3VU2A 3CU1A 3N1QC 5E6ZA 4RNRA 3MRHB 5HTSA 2AV1A 3FFCA 1FFNA 2XQBL 4KRPC 3MV9A 1TZIB 2XNAA 3QHFH 4I0PB 2ICWA 4Z77A 5K9QG 3P9WB 4MA3B 1ODAA 5F21B 1SBSH 2ICEA 1OCWH 4GXUN 4PJGB 5T3XL 3VCLB 3RL1A 3QEUB 1HCFX 5FB8B 2JF1A 3O6FD 4R4FH 4R26H 4G7VL 2MWCA 4Z7UB 3BPOC 4PFEA 4TPRL 1JZ6A 2FH8A 1SJHA 4PJFF 4K23H 3C6LA 2ID5A 3BKCH 2N1KA 4UBDD 3P40A 3S3PA 1MREH 4KHTH 3WIIL 4R8WL 2QQLL 4XX1E 2W91A 2QJDA 4YDVA 5HHMD 3MXVL 1GGYA 4ODHH 2X4RB 1A3QA 5JW4Q 3MTRA 3CLFH 4XCEA 2Y4SA 3SDXF 1YUHB 4ELKB 5IKCB 1KCSL 2P8MA 3HZKB 1U3HD 4L8DA 5E95B 3SKOB 2Z93A 3DX9B 3LPGA 1BM3L 1DDHB 3KLAB 4R97C 2UZIL 1FFPB 3D39E 2FJGA 2X5PA 1OARL 2VDQH 4RWYL 4K2UL 2HMIC 4QLRA 3TZVA 2X9WA 4XH2A 2ZCKH 2BDNH 4JM2F 4DVRH 4HJJH 3S35H 1ROWA 1BQHB 1YPZA 4JZJA 1P4LB 1VEPA 5FYJH 1HDMA 4XAWL 4Q6IC 4CN4A 4RA3A 3U0PB 4NQVA 3C09C 2E7BA 4U1MA 5BOZG 3MUJA 5HVHB 1S7WA 1ZGLP 4P2CG 4APQC 3QIWA 4OGXH 3HC4H 4L5FL 1WIPA 4G6KH 5C2BL 4ACPA 2BVUA 2XFXA 1FDLL 1JZ8A 2CLVA 3K80A 3C8KB 4EUPH 1IC7L 5GGSA 1T2QH 3HUJB 3ZKXB 2GHWB 4U3HA 1CDCA 4P4RA 3VXRB 4N90D 3ARBA 1X7QA 2BVPA 2XZZA 4KROB 5I1IL 2WP3O 3F65A 4FQ1L 3WNOA 3DBXB 1D9KD 4Z78A 5ID1B 4MVBD 4LKCA 1ZHLA 5DXWA 3L3GB 2C1OA 5GRUH 5C07B 3V0WL 4EJ1C 2XXCB 3AB0B 1HSAB 1T5WA 4HGWA 2J6EL 2X7LA 3MRFA 4FQXC 2IBZY 1RZFL 4I2XB 2BOCA 3JV4B 2F8VA 4XPGH 3L3DB 3NIGE 4XC1H 1IEBA 1DQJA 4PJ9D 2C1PA 4D3CL 5E0QA 4GRMB 1Z0MA 1U91A 4LLMB 1X5GA 3NCJL 1YMMB 2N7BA 1OWWA 3ULUE 5HI5C 2DMBA 3FB7A 3GZKA 2AJ3B 3ULVH 2WUCH 1EEYB 5A2FA 4LGSB 5C6WH 1I7TB 1NJ9A 2GUOA 3SKJH 4DKAA 2B1AL 5DJXB 4NNYB 4Z8FL 3FT2B 4UUJA 3U2SA 4WO4B 4ERSL 4XNZC 2ARJA 4JHAL 5I8OH 4JGMA 4XP9H 3U6RA 2V7HB 2ZUWA 5I1EH 2ZZUT 5JW4N 5HHNB 4UAOB 1NC2A 4YDJA 1ZWIB 5I75B 1KG0A 2FBJH 2OR8A 4HUVB 1YEHH 5DFVD 2HRPL 4JFEA 3O4LD 3GSRB 4ZSOE 1BHGA 4U33A 4M62L 4RFEA 1F3JB 4XP1L 5GS1B 3T0VA 1BFSA 3UO1H 2Y5TB 4JM4H 1RUQL 4Y2OA 4QYOA 2DOCA 4E41E 1KULA 4LAQL 2OSLB 4I13B 4PRPB 1M05B 4OFKA 1AP2A 1QKZL 3L95A 5F7NC 5FYLD 3SCMD 3QFDA 1JGLL 4KK9C 3MRNA 3N85H 2CRIA 1MQKH 2G2RA 3S34H 3UBXI 3GJEB 4G9FB 4OF6A 4UINL 2WIMA 1BAFH 4GAJH 4PP2B 2YD4A 4MSWB 5FKPB 5J0BA 1XF5B 3DTXB 3BPOB 4KJYA 1NFKA 1MRFL 2JJTC 3ZHLA 5F3BA 4P23C 1VFMA 3N9GL 4O4YL 5JO5A 4PJCB 2CIIA 3D9AL 4BFEA 3DJ9A 4FTVD 5BZWB 2HTKC 1QLFB 1CR9H 4PJAB 3KS0H 3IFNH 4DTGL 1MFNA 4K3HA 4W6XB 2A38A 2DQCH 4C56A 1F4WH 2MQ0A 4DWHA 5C0CA 4F7EB 4N0YL 1IGCH 4NNPH 3GI9H 2R2BB 5J56B 5DMIL 4YWGL 1OGAB 1KF9B 2WUBL 4R97B 4ENEC 1T1ZB 3C5JA 4GRLD 3RWFA 4ZXBD 4FN0A 1WZ1H 1CD8A 2LV4A 1BZ9A 4J7RA 4AG4H 5AWNL 4JDVB 4BYHA 3WNPA 3S4SA 1P4BL 4IEFB 1ZTXL 4NQDD 1LK2B 1S9VB 2VXTH 4OGYH 5JNYA 4F57L 1U95B 3QO1B 4JFFA 4GMSL 1UA6H 3P73A 5DZOA 4MJIB 1HEZA 4P46A 4QXWA 3E2HC 3L3OA 4Q6IB 3IGAB 4Z95L 5KW9L 3I75A 1KN4L 4OLZH 4M7ZC 4N9GA 4HIXH 1X3DA 4NO0D 1WFOA 4APQB 1UACL 1F13A 2VAAA 3VRLE 4MXQC 1E4XH 1A4KB 4RGNC 5JXEA 3VE0A 3O2WH 5D2LF 1Q0YL 4E42B 4QT5B 4OB5H 5I16B 2A9NL 5DEGA 3BDYH 1FG9C 4LAJH 4PGBA 3EKCA 5EU4A 1YEGL 5H8DA 4JB9H 3B2UD 3EO0B 2OJZH 5KTEL 3A6OA 1R0AL 3CFDB 5FGBC 4LLQB 5C70A 3P30L 1OAZH 4MD4A 3ZE0E 4CJ1A 2NY5H 4QRRE 4DGYL 2MHAA 5T3XD 1EHNA 2DQIH 1U8PA 2C7UA 3EDDA 1N6QL 2BRRL 1RUAL 4NQXA 1F3DH 5KVFL 3KPMB 4HIHA 5DD3H 2X4PB 4NPYA 1NGYA 2VDNH 1RMFH 3OJDA 2F58L 4LCCB 1S78C 4XNXH 2OI9C 1VGEL 1KN2H 1PG7W 3DI2B 1G7QB 3HR5A 1A6VL 4KK8D 3VXPB 4ZS6C 1CICA 3MMEB 5IG7B 3UPRB 5C0AB 2HYMA 2OQJA 2XPGB 5E00A 2PR4L 4QRTB 2WWMC 1XF1A 3QBTB 2ZG2A 4R96A 4L3EE 3QWOB 5I2IB 3OAZK 2VZSA 3MACH 1G7HB 3NA9L 4F33B 1MRCL 4GW4B 2IPKA 4PLNC 2R2HA 5CKAA 2DYPD 5CINH 5GZOD 1G84A 3LY6A 3HZYA 5I1HL 4NM8H 3SE4A 5EUKB 1GVIA 4RQQA 5C0JA 4LFHG 2I07A 4N0UE 1QFUL 4HFUH 4XNQA 1UXSB 3FCTB 3JV6A 1YYLL 4HK3J 1MUJB 2DIJA 2AK1L 1MAML 4WUUA 3MO1B 4O9HL 5DLML 4L8SB 5D5MF 4ZUUB 1IGYB 1IC5H 3B5TA 1EFXD 5TF1H 4B5EA 4XVUD 2F5BL 3GHBH 3QEQA 1MHPH 2F74B 3HFMH 5MENA 3NIDE 4KMQA 3GB7B 3A6BH 3O8XC 3QA3A 4XCCL 1CTOA 4D2NA 2C3XA 2NYYD 5D8JH 3MJ9H 2J7LA 5HSFA 5JXAL 4P23B 3QDHA 5T1KA 5KSVB 4HF5H 4YXLL 2QV2A 4LSSH 3QUML 3G04A 3UTTA 3FRPA 4CBPA 1HH6B 2OMBA 4M1CC 1IAOA 4X6DF 2CUMA 1A47A 1FGVH 2NTSP 3HHRB 3QXVA 4M43L 4MQ7B 5C9JB 3EYOA 4KJWD 4EZMA 5IW1A 1QO3B 1A4JB 1B0GB 1D3CA 2AJZB 2XWBB 3ARDC 5JW3H 3PNWB 2AV7A 2UUDK 4KJQD 3L1OH 1CT8B 2J8UB 3DGGB 4MCZA 1FNGA 4JY4B 2EXYC 3QUXC 2BOBB 3D18A 4A6YL 1SBBA 1YDPA 4YIQA 1A22B 3V52L 3QDGA 1ZV5A 1T83A 5D70H 1BQSA 2X9YA 4NN7C 5KSUA 5F93C 1AXSB 3S36H 3WCYA 4NHUA 3E2HB 4LU5L 3QHZL 4PJIE 1MH5A 4JJHA 3HG1A 4GXUM 1A1NB 1WEJL 5EUOE 1IAIM 3S37H 5T1DL 1RZIB 4P3CH 4E9LA 5J1TC 1WICA 4P5MA 3BH9B 3C5ZD 5F97E 3Q1SH 5E99L 3VA6A 1LE9B 4NCC2 4K8RL 3VXMB 5I1GH 3MJ7A 4TNWK 3K2UL 4OQTL 2F8XC 5TJWK 5IM7A 4ORGA 3Q5OA 4HDIB 5CJ8A 5SWSD 4WCYH 4LHUG 5IV2B 2AQ2A 1GC1H 4Y4KA 1K9TA 2CPCA 4PG2A 1AXTH 4PJFB 3OHXA 1KCRH 4FXKA 2R1WA 2I5YH 4KXZH 4WI4A 3JWOL 2X1PA 2V6HA 3KDMB 4M7JH 5CILH 4ZTPL 2DWDA 5CJQL 1NGPH 4ODSL 5JLZA 1BGXL 4KTYA 2UWEE 3IAQA 3IJYB 4PRHB 3Q48A 2PXYA 4AQOA 4FFVC 3SDXB 1WAAE 3Q3GB 1RURL 4XAKD 2OI9B 3PWPA 4AEIH 4MB5A 2FSEA 1F6AA 5DI8A 3KPSB 5C6PB 2YMXH 3SKMA 2CK2A 2R0WH 5D7LD 3QRGH 3ZT6A 3FO1B 4G43B 15C8L 4JM2B 3QEGH 4S10A 5JHDD 4Z18A 4UTAL 1JZ3A 4JHWL 1CZ8H 3ABZA 1M71A 1GCFA 4QNPE 1LK3L 4MD0A 2IAMD 2JB6B 3RNQB 5DC4B 4NQTA 4PJGE 4WGWB 5T33H 3VXOB 4LASH 4OV5A 2K7QA 1KNOA 1VCAA 3ZTNH 4OV6F 3EAKA 4BQ9A 2H26A 1SHMA 2VC2L 1BVZA 4TUKL 3VJ6A 3HMWL 3S6CA 4XVSH 3TBTB 3TCLA 4POUB 3GK8H 5FHBL 5DRWA 2Z31D 4MJ6B 2E6QA 1K5NB 4HK0B 5FO8A 1B4JH 3D0LB 1QD0A 1MJ8L 5I1LB 5IQ9B 4HLZH 1LO2L 4E5XB 2A83B 5IESH 2FCBA 4DFIA 2NY3C 5TDPA 1G7PB 1EHLH 5TPWL 4J6RH 3ILQD 2GSIA 2VOTA 3HAEB 2D31A 3QCTH 1FL6A 4JFXA 4YHNB 1J1OH 3SGEI 3D69B 4RBPK 5FHAH 2NY2D 2P8PB 3WFCH 3S88H 4DGVH 3WFEH 4G6AD 1X5KA 3CC5A 5KZCD 1UJTA 1JHLH 1AGBB 1E4KA 3PP3K 4IRJC 4CU6A 2XV6B 4PV9A 1S7RB 4GMTH 3TIEA 1ZHNA 5HYSG 4L1HA 4GH7B 3PV6A 4XT1C 1NAMA 4P3WA 1DVFD 4WHCA 3E6HB 2M26A 4K7PY 2DLGA 4HD9A 4F7CA 4XPBL 4KKAD 1QPXA 5D6DC 5HI4D 1ZEAH 4U1LB 3BW9A 4C83B 1T2JA 3EYUL 3LN4A 4P9HL 5E6IC 3IDNB 3OXRA 1A3RL 4RAUB 2AXGA 1EMTL 3HNSL 3BP5A 2P24B 3VMPA 1P69B 3I6KB 5I1AB 2DJUA 4NFDA 4EOWH 4Z0BH 3RTQA 3CDGB 3HI1B 4YJZL 1A6PA 1YEFL 4D9LL 1JPST 1BF2A 2X10A 3HUJE 3BZFA 4Z7OE 3QUXB 2GJZB 3VXRE 3WIFB 1IAIH 5BXFA 4GSDL 5B39B 3GUTB 5CJOL 5E7FA 1XGUB 4NN7B 1W0WB 2H2SD 2MQ3A 4U7SA 1CFSA 1PSKL 1KGCE 4GW5A 2R0KL 1HHIA 4MDIA 1MCDA 5C07E 1FO0B 1BP3B 4JGUA 1EZVX 2I25N 4NUJA 1DN0A 1N4XL 3C60C 2YPLD 5CSZB 5I8KH 3LKNB 2ITCB 2VZOA 1TQCB 4I2XE 3UEZA 1HSBA 2FO4A 3HC3H 4N8CH 1QR1A 3ZDZF 5HGDA 4YDKH 5J3HC 4MQTB 4PRAA 1BIHA 3ULVC 1BJMA 4JFQB 3C8HA 1YMME 3WDJA 5H35A 3CXDH 1A7NL 5L6YH 4LPXA 4E0RA 3ARQA 3ARPA 3W0WA 1J5OH 1KJ2A 1Q9OA 2M8XA 4XBPA 5KVMC 1A6ZB 3T0BA 3IVKB 5MHSD 3QUKB 1AD0B 3E3QC 4O5LH 3L5XH 5TE4L 5BV7B 2DQFA 1MFAL 3OKLA 5E70A 5JPMB 4O2FA 5FO7A 5TDNB 4ZYKB 4MXVF 2OL3A 4UV7L 5MEQB 1U2HA 2IH1A 2X4TB 3F58L 4R7NA 3KPRA 3ES6A 5GGRB 3SDDC 4TNVK 4N1HB 1G7MA 4JAMB 1EJOL 4LLUA 5DUBB 1HN1A 4EI6A 1RK1A 2VUOA 3EOBA 1X5JA 4R6UA 3WXVH 3RWCB 3FQTB 1A6TA 2ICWI 4U1JB 1I4FA 2VNCA 4HSQA 4JE4B 4OCLC 2YD3A 3ZZ1A 3PGDB 4LCWA 3FONA 2DQHL 4LQ1A 1E4WH 1E4XI 4EBQH 3P9LA 4PRPE 4GAGL 5J13C 3FMGH 3K7UA 4PLJD 1EGJH 1XGPA 4TQEL 3MLZL 3AXLA 3S3SA 2RFXA 4P5KA 2GITB 5D6CB 2LU4A 5TDOA 3VDBA 4G9FE 4C58B 4EN3C 3TJHC 4FXLA 1FLRH 4I0PD 3MA9H 5K59E 2VIRB 1IC4L 2W0FB 2PKDA 1QSFB 1FN4A 4XX1G 1TDQA 5AUMB 1RFDH 1G0YR 5KSBA 3VI3F 2FECI 4PJCE 5D2LB 4MX7A 1VERA 3PDDA 4JG1L 2YA0A 2DKUA 4QXTB 5MEPA 5ITFA 3QIUA 4PJAE 3I9GH 1A2YA 1NCUA 2DI7A 1CLYH 3TPUB 1UKSA 4LSTH 9CGTA 4KK6C 3A67L 5SWZB 2EC8A 2Z4QB 5L2KE 4H1LH 5TGBA 2UVEA 4G3YH 3LHPH 5C0GB 5IFHH 4IMLB 2NY7L 3RI5F 3H9HB 4F8QA 2C26A 1OGAE 4J3TA 4NWTL 3KPQA 5LWYH 1R3IL 4HUMB 1PKOA 2DBLL 2GTZB 2X4QA 1KEGH 2GK2A 1F2XK 3STLB 1T1XB 4XB7A 5IR1B 5IF0B 5J6HA 1D5XA 1ZA3B 3OJVC 4KZDH 1HHKA 1YMHB 4DN3H 2PYFA 5CKGA 4BSVA 4MJIE 3KR3L 5DRNB 2R69H 3PL6B 2BERA 2LAAA 3D6GA 12E8L 3RWDA 2JCCF 2HH0H 2OR9L 4W6YB 2H32A 5E6IB 3T77B 2BNUB 1S9WA 4WY7H 4IOFC 1DN2A 4EUPB 3VFGL 5I6XC 1AH1A 5E6YA 5EOQH 2E7LC 1C7SA 1XAUA 1X4XA 3LKRB 3OG4B 4ODUA 3C6LC 4Y5XB 4LDOB 2QQNL 1ES0A 4R90L 4DZ8B 3MCLL 2XZQL 4PLOB 3DUSA 1NLDL 1G7LA 4JQIL 2FATH 3TH2T 2DD8L 2FEDD 5ICXA 5IUSA 1TVDA 1DBKL 3EYQC 4DQOL 1I8IA 5FAAA 4GQ9L 2NY5C 2CK0H 2DLEA 5JPNB 1I3RB 3R0MA 3ROLB 3BZEA 1KPRA 2A6IA 3E0GA 3VG0L 3DXAA 3VMNA 3KGRA 1J8KA 4HCRH 4NT6B 5DJ2B 3HCVB 2A73B 5D5MB 3L3KB 2WQRA 3D0VA 5B4MD 1UJ3A 4I4WB 5TE7H 2YR3A 3TZVC 3W5NA 1R3LA 3NH7L 3BQUD 4QGTA 3KYKL 1OB1B 43C9A 3NACH 1NAKL 5DR5L 2I60H 3FAWA 1ADQA 1YECH 4HXAH 4YHLH 2B4CH 2YD9A 4YBHA 5F9OH 1S9YB 3RZCA 1UM5L 2Q8BL 2E6PA 5L2JA 4J23A 4JZJC 1Z2KA 1FL5A 3MRRB 4TSAH 5CWSA 1RJZB 4QHKJ 1CFNA 3GMQB 3WEXB 4PGEA 1B88A 5C0AE 2EDWA 1MWAB 4KTEH 3O45B 5KS9A 4ONHB 4NZDA 4L3CA 1F11B 3F12A 3LQAL 1HQRA 5DYOB 3ZE2F 1U42A 4X6DB 2WM0A 3AREB 2VZ1A 4WJ5A 3T0ED 3BEVA 3QIWC 2XIDA 4LFHD 4AL8L 3OXSB 1H3VA 1KCVH 1W72A 4WEBH 5HD8C 4FZ8L 5EOCH 1P5UA 1H3TA 3EOTH 1JNNH 4D94A 3ARBC 3QO0B 2YBRA 5HVGB 5B3JF 1C12B 1OAQH 4XGZB 1CGTA 1U8HA 4MJ5A 4Q9QH 5HHVL 1MI5B 1BREA 3EO1A 3WDIA 4PY8I 3EJZC 2PN5A 5FKAB 3BX7C 5LQBH 1FZMB 3RZWA 1ZANL 3FO9A 4X5XA 3W5MA 1U93A 4ZFOA 3Q2CA 3L3JB 3MFGB 3VXUD 1FVEB 5DURD 2GJ6A 3CCHB 4NBYB 3IF1A 4QHMA 2AEWA 2FO1A 4NO5B 3B6SA 3WFHA 1BZQK 5D71H 1LDPH 3RDTD 4D0DB 1MFBH 1R3HB 2EXWD 3MJ8B 5IK3B 3RVUC 1IARB 3G6AB 4K3EL 3LPWA 4L4TD 3KLHC 2IH3B 3TBWA 1UKQA 3DSNA 5F6IC 4CNIA 4PB9L 2ILLA 1WFNA 2ZUXA 3HPLA 2IAND 3WS3B 3AVEA 1N5AA 5IB1B 4EQ3A 35C8H 3G5XB 2AJXH 1KJ2H 2VLLA 4F2MA 2O93L 2B8OT 1II4E 1WFTA 5FOBB 3I02A 1KELH 3OKMB 5CSGA 5HYJD 5TF0A 1IGIH 2BMKA 3S35X 1EH9A 2JIXA 4IS6B 3H9ZA 4KUCF 1D5IL 4XMKH 5KSAD 4P2YA 5CP7A 1VADA 2OL3H 1MCOL 1FFQA 3GSQB 4MNQD 5GQBA 3BHBA 4XRCB 5GS0H 3ECBA 3FN0H 3KPPA 2J8UE 3D3VB 4ZUVB 1VKXA 3CMOH 4FQCH 2A6DA 4UQ3A 5L2KD 2L7UA 1RUKL 4ZPVB 4C54A 1OD7A 4C4KT 3KYOB 4P5TD 4ZD3L 3VFPA 4MZ2A 2EZ0D 5BRZA 2GAZA 3BWAA 2IFGA 2ICWB 4Z77B 3CVIL 5ICZB 3T1FB 4R0LA 2HFEB 1A5FH 4XPFH 1E6OL 2KDGA 3LMJH 2B1HL 1A21A 1IBGH 1MIEL 3HRZB 1NPUA 1TETL 3SQBA 5J6GB 1J0IA 1UWEH 1IQWH 1J11A 2WWKO 5I6XB 3W9DA 2K9UA 2XXMB 1PX4A 2QADB 2Y07L 3VXME 3IJSA 4Z5RA 3O6LH 1GC1C 4OD2B 4RGOL 4R7DB 1XCTB 1M6OB 3PWNA 5KOVC 1F58H 1RZ8B 5T1MB 2HAZA 2IG2H 1I1FB 4YDVB 3UJJH 1PZ5B 4LP4A 1MFEH 3KPLA 2EYSA 4OLXH 4PJFE 1SEQH 3VW3H 2HG5A 1ZE3C 4NC1C 4XCEB 3FRUA 3MGAA 3O0RH 5JZ7C 2FHBA 3L7FB 5SX4I 1ZT1A 5FUOL 2J88L 1RHFA 2O61A 4PRHE 3DX6A 4OZHA 4G9DA 5MERB 2D2OA 2C9AA 1AR2A 3C2AL 3INUL 3P9MA 4IJ3C 1RJLB 3QWRA 5DQDH 3SDXE 4X7CC 1AI1L 2WBJB 2R56H 2YRZA 3V4PH 5C1MB 1QFWM 1EX0A 4ESKA 3ARGA 5JIIA 4HH9A 1GGCL 4K55A 1R5VB 1A64A 1P53A 3G08A 3OGCA 4M7LT 2Y06L 5EU7C 5K33A 3KPSE 1WCBB 2C3VB 3O3BA 4U1GB 4P46C 3O4LA 1SM3H 1NBVH 4CVZA 1HILA 3BGAA 5JOFA 4PS4L 4KZEH 3NGBC 4OKVA 2G75B 2RBLA 3RWGA 1IT9L 1IAII 5HHOB 4ONGL 4XPAL 5DZLA 2H32H 4JFDD 1FNLA 1JCKA 3DSFL 1XGQB 1IEAA 1UH3A 5JXEC 5DRXA 5C0AD 2XFXB 2D0FA 4C55A 2R4SH 1UXWA 1J8HA 1GYAA 5GGSB 2VZVA 3RVXD 1UWGL 1YN7A 5CEZE 1B9ZA 4P4RB 2OP4H 5FGSA 2MOVA 1NEZG 3ARBB 1JRHH 3OF6A 4JCMA 3VDAA 5DFTA 1VA9A 4MS8D 4RRPG 2Y6SC 4DFHA 1S7VA 2R2CA 3PABA 3VFTA 3TJEH 3I6LE 5BVPL 2X7LB 4M48H 3PE9A 4K94H 3LKSA 4I0KA 1QFPA 1ZHBA 2D7QA 2D4DA 3U4EA 4U6VL 4BZ2L 2ZG1A 3MUZ1 2BC4B 3HE6B 1UYWL 4TSBH 4K9EL 4QWWD 4QTIL 5ACLA 4H20H 4GJTB 4N8VA 2X4UB 1PD6A 4WHTA 1UB6B 3TBYB 1CICC 3RWHA 1Z5LA 5F6IB 5DD6B 5E94B 3S96B 2GUOB 1OAYL 1WQVT 2VKWA 5CBEA 4UUJB 4X5LA 2W65A 2EYTA 3O4OC 4PRIB 4LL9A 3KPNA 4Y8DC 5F88B 5BQ7B 3D39A 5ETUB 5BS0D 1GPOL 1TCMA 4M6NL 3VFSA 3V4UL 5DDHB 1CXFA 2DQGH 2WLZA 2HLAA 4NO0A 2FHFA 3FQWA 4LVEA 3D85D 2YUZA 3ARWA 4HWEL 3VFRA 4I3SL 3FQRA 2X4NA 2IFFL 4JANB 1YEKL 3SE8L 3B9VA 1G7JB 5DGQA 2FX8H 3EDEA 5I8EA 2BHUA 4O2CB 1A7BA 3ILPA 3HB3D 3GNML 4OTXL 4Q9CA 2HFGL 5DQ9A 1Q94B 2XT1B 4JO2H 3F7RA 4KPHL 3OKDB 1HINL 4J8RA 1LEIB 3BGFC 4QOKB 1UZ8B 3I2CL 3GBML 4QHNA 1X6NA 2X2YA 3CFEA 1I7RB 3MOAH 4OIIH 2CDFA 3OX8A 2I9LA 1FORH 2YN5A 2BSTA 5FECA 2ZCHL 3P3YA 3FQNA 1F8TL 1V05A 5JO5B 3VXQA 5JMOC 1S5HA 2H3NA 2CIIB 4AH2B 2V2TA 3CUPA 3STZA 4K7PH 2EKSA 1TQBB 2EDKA 3IRZA 5I15H 2AJVL 3KPTA 3TT1L 3O6MH 1RZ7H 3RHWF 3GMMA 2VDML 2XKSA 4G80B 4C56B 1QFWH 4J3WA 4XBEH 1DANT 4I8DA 4HS3A 2HKHH 4ZOEA 5C0CB 3L9RA 1N59A 4CADA 1HOCB 1C5BL 1C1EL 4DCQA 4YBQD 4ALAH 3F5WA 4HMEA 4IJ3B 4ZPTA 3X12B 1TJGL 3NFNB 1BZ9B 5D1XB 5EULV 4L4VD 4BSWA 3QQNA 1RZGB 4FQHB 4RISH 3FQUB 1HQ4B 4RMTA 3REWA 4U1HB 3S4SB 3BGMA 4XBGA 2DYPA 4LSVL 4LMQE 4JPWL 3O3EB 4YEEA 3SGJA 4AENA 4OI7A 3LS5H 1HEZB 5F3HB 3KXFD 1H3WM 3L3OB 4BH7A 3B4NA 3EBAA 1DL7H 2WMPA 3DVGB 3I75B 5C0BD 5ILTL 1YNLL 1UKTA 3NGBB 1CE6B 2ZG3A 5DVLA 1NSNH 2NX5D 5DEFA 3WLBA 5AD0A 3WUWA 5A2KH 2VLJD 3X3FL 2LTQC 5JUEL 3VE0B 2JCCB 2ORBL 4ZSOA 1UB5A 1QBML 3E8UL 8FABB 4YQXH 2J1KA 4X6BA 1J18A 2CDEA 4QRPD 2GTWB 4HUUA 4E41A 2R29L 1NBQA 1BLNA 3DMMA 1QSFE 3MNWA 4Y4KC 5F7DA 4PG2C 4L29A 4CW1B 4P59L 5D2LE 1DQDL 3HRPA 4KQ4H 4JRXD 3PWJA 2DLFL 3KYMA 4FP8H 5B38B 4Q7DA 5CEZD 5M94B 4MD4B 3BZ4A 1L7IH 5GGVH 1E0OB 2P44B 1VHPA 3DO7A 5SWZE 5F89A 4JKKA 1Q1JL 2YK1L 2PXYC 5DJAB 1J10A 5AZ2L 4UILH 4JPIB 5L88H 5F9DC 3QUZC 3I6GB 2YKLH 4JLRA 1OTUC 5EO9B 5IOPA 1MEXL 5B8CA 3OJDB 3MRGA 4X6EB 1A7RL 5I74C 3WS6A 4Q9RL 4KI5C 3P11H 1T1WA 4OCWH 4KQ3H 4YC2C 3ZKMD 2X70B 4WFGD 5CIPH 1R3KB 4RSVA 3U9PL 1KB5H 2OQJB 3BOVA 3QDJB 3WNLA 2Z35B 3BYTA 1W0VA 2FEEL 5FYKD 3RU8H 1KC5L 2VTFA 1G6RA 1JP5A 4KKCC 2Q76B 1H3UA 3RVWD 5CCKL 4FXGB 2PCPA 2R2HB 4MWFA 2NNAA 4S1DC 4QKXB 3S36X 4HX1A 3QIBD 1BD2B 1CLZH 5FYLH 5JW4R 2HTLC 4K3JL 2CGRH 3TNNA 5D9SA 4LSUL 3S37X 2NXZD 5E08H 3JV6B 3HA0A 1H3PH 3LEYL 1WTLA 5EORH 4OUOA 1TPXB 2IPTH 2GSGB 5I19H 1QSED 3UTQB 3W2DL 5HHQA 3FL7A 3WV0A 3QCVL 5HDQL 1L0YA 2BVYA 1MOEA 1UZ6F 2H6PB 2CR6A 2XTJC 1GZQA 5D5ME 4OF8A 2B4CC 3DETD 1R5IA 4NZUL 4QO1A 4OCXH 3O41A 1N64H 3U0WL 4ZOCA 1WWCA 5IMKA 4XMLH 1RUPH 1QNZH 3MRPA 5E1AB 3HNVH 4QF1B 1IAOB 4XC3L 4NZJA 2L7JA 5DJ0A 5FCSH 4UDUA 4Y89A 1KB9J 2EC9U 4WUKL 4LNVA 1JFQL 1OF2B 4LCUA 1GRWA 4XNYL 1P4IH 1YN6A 3MRQA 4OLYH 4PRBB 1WITA 2PTUA 5F6HI 3MGTA 3RI5K 4X6DE 2ZOLB 5DSCA 4S1RL 4V1DE 2MCPH 4JO4H 5A2IH 3RTQC 4YE4L 2R0ZL 4DN4L 3NMEA 4TSCL 2PUQT 1S7XB 3CH1B 1JF1A 5EH1A 2A0LC 4CN1A 3ROOB 2DI8A 1YJDL 3IS1X 5GHWH 3PDOA 3GSWA 1BQLL 1KTDA 4ZQKB 5M7QA 1T89A 2OBGA 1MI5E 2Z31A 4NHUB 1CFVL 4LLWA 4M7KH 5DZNA 5ESQA 4NJAH 4L3EA 1MH5B 2XZCH 2AEQH 5CJ5A 5C2UB 1I9JH 2XA3A 1UM6L 3IAGC 5ESAA 2HRLA 1WBYA 4P5MB 4HHAA 4CKVX 1GGIH 2XQBH 4J3UA 3MJ7B 3BE1L 3CLEH 4N0UA 1A02N 4ORGB 1T04B 3GSNL 4W70A 1XR9B 5DEZA 3D1MC 5HPMA 1R5WA 1P6FA 4BM7A 5T3XH 3TBVB 3TM6A 5D7SL 3HS0B 2DLHA 3H9SB 3OTTA 4FXKB 2UZYB 3PWLB 1P2CA 5IHZA 3U36B 3OR7B 4H26A 5K9KB 4HW6A 2EH7L 4H1LB 5HJ3B 4PJHA 2VDOL 1IKFH 3CJJA 4JO3H 2H8PB 2QR0A 2YPVH 4HWZB 2KZWA 1Y18B 5CGTA 3WIIH 5GS0C 2QQLH 1CU4L 3C5SB 5D4QA 1R3JB 3FHQA 4OCRH 2HWZL 2VRAA 4YFDB 3VFNA 2PXYB 3MXVH 3QUZB 1IVLA 3KJ6L 5T5NF 1AY1H 5DQJB 4XNUH 7FABL 3D3VE 5I74B 1BZ7A 3TN0B 2RCSH 1KCSH 1VFBB 4OCYH 2YD2A 4YC2B 1BM3H 4FFYL 3UTZA 5ALBL 4XP6L 1OARH 1T20B 4ZFFA 4RWYH 3P4NB 4K2UH 5FM5O 3G5YA 2HJFB 2DM2A 5JDSB 1S9KC 4MD0B 1A3LL 1JRHI 4IRSB 3THML 1CD9B 2BFVL 3BKYH 4ETYA 2Q20A 2H26B 5IEHA 3NCMA 4LQFL 2UY6A 5DT1L 3TCLB 4X4YA 1K6QL 2B2XH 3PL6D 4PGJA 5DRWB 5EZOH 1MCEA 3UTOA 1ZGLA 4NDMB 1H8NA 5DJDB 5BW7A 5D7JD 3H2WA 2EDFA 5IIEA 3EDKA 1DQLL 2EICA 2ATKB 3NN8A 4JR9H 1A6AA 4WNQA 1SEBA 4PJIA 4WI3A 3WIHA 3T4YB 5JOPE 4L5FH 1AIFA 3QIUC 1BBJA 5IVNA 4LPUA 5I9QC 5C0EB 2AABH 1FDLH 3BAEL 5EUOA 5DK2A 1UCTA 2D0GA 3LSOB 5CMAA 1IC7H 2DQJL 5GRVL 3TP4A 4KMTL 1GAFH 5D7KE 5MI0C 5D1ZC 4B41A 2F53D 4O58H 2CDGA 1W2KT 5ENWB 5CZXC 5I1IH 5EC2B 2XTJB 2APXA 3MRIA 1NMBH 4OT1H 4FQ1H 1MLCB 2I27N 4PJ8D 5I73C 3GSUB 2PETA 4DOHB 4H5SA 2QQQA 4KV5F 1IQDB 1WWBX 3QUYB 5TFSH 3UZQA 1PW3A 5C0ND 1TCRA 4CL7A 5JA9A 5C0DB 1JZ5A 4HIJA 5A16A 4AMKL 4D3CH 3BW9B 4WU7B 2UWEA 3TIDA 1AO7D 3TA3C 4NRXA 3CFJA 4PPTA 2GYSA 5EN2A 5EZLA 1D5BA 3PHQB 4L9DA 5HHOE 1N3NA 3BP5B 3MNZB 3PHSA 4NKDA 1WAAA 2ZUQC 5EWIH 1I1AB 4PRDA 1FVCB 1OAKL 5KVEH 4GKSA 5ITBL 2K1MA 4LIQL 2RJMA 5MP6L 5J7CC 2IBZX 4ERSH 3MRHA 2YXMA 3CU7A 4PBVC 3DHMA 4XZUA 2XA8H 3Q5TA 5INDB 4V1DD 2A1WL 4I0PA 1L0QA 4KK5C 2GJJA 2KQMA 4NGHL 5D96C 5LCVH 3KYNB 4K94C 4JQVA 4PJGA 2AEPL 2FJHB 2HRPH 1AE6L 3EJYC 3UC0L 3VCLA 3MOBL 1FZJA 5DO2D 5TQ2L 3IDXL 3K74B 5IJVA 2Y1VA 1BVKB 5HI3D 4XP1H 3BUYB 1ZGLM 2FO4B 1F97A 4Y19B 3AGVA 3QJHB 1I9RH 1MI5D 4Q0XL 4U6XB 5HGDB 1X5XA 1MFDL 2KZ1B 1MCSA 1QKZH 4YHZL 3VGAB 2X4OB 1D5ZA 1B2WH 4YFEA 1QFWI 3MQIA 1JGLH 1GGBL 2O5XH 1CLCA 3RZCC 4E0RB 2FBOJ 3ZDZE 3W0WB 2BNRD 5H94B 2X4RA 3WJLA 5HDLA 4DVBB 4XCYB 2NZ9D 4FG6D 4ELKA 1YUHA 5IKCA 1M7DA 2VLRD 3HZKA 1MRFH 1YEDB 4WHYG 5FO7B 3SKOA 1S7UB 3DX9A 4PRIE 2IH1B 4MLIA 3KLAA 2XTLA 1B0RA 3SBWA 4O4YH 5KVDL 3KPRB 3VWJB 2YWZA 3D9AH 4RDQF 3BPCA 1G7MB 4NO2B 1T7VA 4EI6B 1RK1B 4DTGH 5KN5B 2VB5A 4MXVE 1WBZB 5DTFB 5D7IF 4Y2DD 3QFJD 1BQHA 1A6TB 1SJEB 5KG9A 32C2B 5L7XL 5IJKA 1P4LA 4MAYB 2EDNA 4BA8A 3HI6L 4YHML 4YWGH 5A3ID 2NY4D 1YY9D 3U0PA 2AGJH 2WUBH 4UBDC 2HVKB 1Q9WA 3D3VD 5C8JA 1XGPB 2P7TB 2CLRB 2EECA 1FVDA 5AWNH 3MZGB 3VXTA 5IT2H 3MRJB 3DOSA 1G7IB 3DIFA 1EXUB 3H8NA 1T7YA 5LGHH 3LOWA 1P4BH 4QOKE 1ZTXH 4S1QL 1RULL 4F57H 3H42L 2QHLA 3C8KA 3HUJA 1NANH 3CVHL 5SWQA 2YUWA 3ORJA 2J8HA 1GZPB 2QQKH 4Y1AB 2G5BB 1KT2B 3VXRA 1U3HC 3PWUA 5JOEA 3QR2A 5KW9H 4U1NA 3SN6N 5HYQB 3UBXG 1KN4H 4S0SD 2WQ8A 1WJ3A 5KANI 1JN6B 3OSKA 3GJFH 4JN1L 3T1WA 3BRGC 3KG5A 1VPOH 5ID1A 2HT3D 4LOUD 1UACH 2AXHA 4MX7B 3L3GA 5C07A 1LEGA 1K8DB 4NM4L 5ITFB 2QADD 5DUPL 1HSAA 4LEXL 2W60B 3RKDD 5I9QB 1NLBH 3MODH 1QA9B 2A9NH 4GRWH 4I2XA 4NC1E 3JV4A 3TWCL 3L3DA 4M03A 4EVNB 3VI3E 5MI0B 5D1ZB 3FO2B 3N1PC 3MYJB 5JOPD 1PZUB 4GRMA 3V95A 2PTTB 3CK0L 1V8HA 2YXFA 3MFFA 5I73B 2X4QB 3P30H 3T0EA 3TH4T 3MA7A 2WLYA 4DGYH 1NCDL 1JYVA 1EEYA 1WIOA 3RIFF 5J6HB 1I7TA 1D5XB 4J12A 5DJXA 1N6QH 4NNYA 4X99B 1RUAH 4U0RC 4RGMC 1A9BA 1U3YA 4WO4A 4EQ2A 2J3SA 3UPCA 1YY8B 4R0LC 4OAWB 2H32B 4M6ML 1E4JA 3TA3B 1P7QB 4JRYD 5HHNA 1ITBB 2D9QB 1TZGH 1KJ3L 1D9KC 1JPFB 2VSCA 4MVBC 3JWNC 4W4OA 3P0YH 3RPIB 2ZUQB 5HY9A 1JV5B 1IL1B 1CDHA 1N7MH 2JCCE 3ARXA 3DHJA 3GSRA 4G8GD 3ZDXF 1K2DA 1ES0B 1F3JA 1IGML 5GS1A 5J89A 2Y5TA 2PR4H 4WU5B 1LO3L 5F96L 5L9DH 1MAJA 3VXUA 1FQ9C 3NCCB 2OSLA 2VN4A 1M05A 2Q8AH 3NA9H 1PYWB 3JVGC 1Z0NA 2EDBA 5D96B 3BISA 1U6AH 3QZWA 3RDTA 3HAEG 5I1HH 4MZ3A 1SJVA 3BZEB 2Y72A 1FE8L 3ZE1F 2A6IB 3DXAB 1F4XL 3GJEA 2VDLH 3KWWB 1DUYB 5J57B 4NHCL 5ID0A 3T0WA 4MSWA 5FKPA 1XF5A 5EPMA 1YYLH 5DFWH 4IOIB 1R3LB 1MAMH 3WXWL 3ESUF 5JA8B 2BVEA 5DLMH 4LPCA 1VEMA 43C9B 3SJVB 3DYOA 3ARGC 2GKIA 3H3PL 3LH2L 1KYOJ 3VXSB 1VSCA 1QLFA 1RQ5A 1FCCA 2YZ1A 4MNQA 3MRCB 4PJAA 4HC1L 1G9EA 5DFVC 1IGFL 4XP4L 5IEKB 3RHWK 1A7OH 3PP4H 3HE6D 3QDJE 4WFED 5L2KA 4F7EA 2R8SL 4L3CB 2Z91B 1EBAA 3UJTH 4EIGB 5JXAH 1I3VA 3EUUA 2R2BA 4P5TA 1OGAA 3IETB 5A2JH 1PDKA 4NC2B 4IIQA 3PG2A 3QXDA 3O11A 1MIMH 3PGFL 4PJEA 4U6HA 3JTSB 4JDVA 1BD2E 3ZE2E 1LK2A 1U95A 4FFZH 3MBXL 1SJXA 1U8HB 3O6FB 3MV8D 4MJIA 4D9QD 1P7HL 3NVQA 3DX8B 2IQ9L 5DHXB 3IGAA 4B0MM 4RA0C 3MRMA 5B3JE 4YO0B 4K07A 1FBIH 3CIQA 4A6YH 3GKZA 2X42A 1RIHL 4KY1L 2VABB 5IHUL 4E42A 4QHMB 3I85A 5I16A 1RU9L 3MROB 3WFHB 4U2YA 1RY7B 3RX7A 4LU5H 1U3HB 1DFBL 3G6DL 4JO1L 1NDMB 3K0WA 3B9DA 4OI8A 1WEJH 4PV8B 1P1ZB 2IEPA 1UC6A 3EIFA 4GRLC 5T1DH 5K9JH 4O02L 3EO0A 2XOTA 3OKKA 3CFDA 1D6VH 3L5HA 4LLQA 1YEJH 5JW5A 4M6AA 2GY5A 2VLLB 3K2UH 4KKLC 3ZT7A 4N0FA 1INDH 1VESA 2YUVA 4EI5B 3V6OA 4HPOL 2BMKB 4I3RL 5CP7B 1UCBL 2D7PA 2PTVA 2X4PA 4FQLH 4FQIL 1PG7H 4LLYA 4LCCA 2NPLX 2E9IA 4QXUL 1VKXB 4KRPD 2P5ED 1G7QA 2BY3A 4NUGH 1U2CA 4JFDA 3VXPA 2AJSL 3T0XA 3B9AA 3MMEA 5IG7A 4ODSH 4HUKB 2GFBA 5C0AA 2ESVE 2ZUSA 1RZJL 1EO5A 2JB5H 4M8QB 4D9RD 1KLFA 5CP3A 3BWAB 3IB4A 4RGMB 3IDUA 1FNEB 5I71C 1J05A 4Q97A 1MCQA 3NAAL 5E03A 3BUTA 2P46B 3QWOA 1RURH 2XG5A 1JHKL 4NC0B 1LWRA 4F33A 4GW4A 3BP7B 4QHLB 2MPAL 3B2UC 4LRIA 2EIZB 3OB0H 3VGHA 1CXIA 1D9KB 1U8LB 2P49B 4I48A 4BFIA 1AQKH 2JTDA 3FZUC 5EUKA 4BQBA 2Y7QB 1JGUL 3HMXL 4GRWF 4TOYH 1UXSA 3UZEA 4CU8A 1JPSH 3FCTA 5HGGS 5F7WC 4PJHF 1MUJA 1LK3H 1UEYA 4PJ9B 5JQ6H 5JIPA 3MO1A 3QPXL 4L8SA 3H9SE 4ZUUA 1L7TL 4TVPE 5BO1L 4UNUA 3LEXB 3EOYG 5DMYA 2ZCLH 1JNJA 1MJ8H 5IFJB 4Z7VF 1FRGL 3JXAA 3V79C 1HE7A 3DX6B 1DBMH 3U0TA 25C8L 3C9NA 5KSVA 3AY4C 2VDKH 1HH6A 5CIPB 5GZOC 3OGCB 3ARYA 1KB5B 2W9EH 1F90H 3SGJC 2R9HC 3O3BB 2RIKA 3O4LB 5IB4B 3MRKB 2VDRH 1EO8H 1U8NB 1QO3A 5DRZA 4X6FB 3B9KD 1GIGL 1A4JA 3VGDA 2AJZA 4JGJA 4OKVB 5MEOB 2XWBA 2VXUL 5FDYA 3IDGB 2EH8L 4N0RA 5SV4A 4BFGA 1J0HA 2OLDA 4EUPG 1CT8A 2J8UA 5DRXB 3DGGA 3SCMB 5EA0H 1X5AA 4F7PB 4JY4A 4XVUC 4XPBH 1XGTB 3BSZH 1BFVH 1YEEH 4X7TB 3BKJL 3EYUH 2HFFA 4P9HH 2P45B 4JN2B 1F4YL 1X5HA 3TGXA 1A3RH 1AJ7H 3DX7B 4FQXD 4P2OB 1BWMA 1UH4A 2NYYC 3ARZA 4OGAC 1A1NA 1BD2D 1ZS8B 1YEFH 1RZIA 1CDIA 4FTVB 5A1AA 5GGTA 3BH9A 1QQDA 1LE9A 1ZHBB 5CJOH 5FCUL 3VXMA 5HI5D 5J4MA 4K7PX 3SE9L 4UI2A 4YHYB 4KJWC 2ZKHL 2XTJE 4HDIA 2JK5B 1WWWX 2R0KH 5IV2A 1EAJA 1NL0H 4DOHE 1FAIL 1CWVA 2FX9L 1N4XH 4WHTB 4PJFA 1UQSB 4KJQC 3RBSA 4GRLB 4IHOB 4ZXBB 2XZAH 4RMWA 2ZOKB 3KDMA 2XICA 3IFLL 2EYTB 5T1LD 4NQDB 3IJYA 1F5WA 4UT9H 4NIKB 4JCLA 5DK0B 3FOLB 1MPAH 4NN5B 1HHJB 1GGTA 3SDXA 1ZT4B 3VFSB 4EDXB 3Q3GA 4QEGA 5C0BA 4N1EA 1ZHKA 2IALB 3KPSA 1MFAH 1FIEA 4HQQL 3Q6GL 2FIKB 2FR4A 3FO1A 1NFDF 4G43A 4JM2A 4U7KA 2X4NB 2CRMA 1HNGA 4AQ1B 1NC4D 1NANI 1KTRL 1MAKA 2IMNA 5D7IB 4JKWA 3VG9C 1FSKC 2H9GB 5BCAA 5DUML 3GO1H 5I71B 2OZ4L 3DGCR 1QBLL 2JB6A 3RNQA 1MCPL 5I1JH 4J8RB 3VXOA 2ESVD 2DQHH 4ZS7L 1I75A 3WUZA 4XCNB 4Y19E 3CFEB 2CDFB 1SY6A 4HK0A 1B90A 4GAGH 4KTDL 5IQ9A 5I1LA 1JMXA 1OCWL 4E5XA 2A83A 4TQEH 1G7PA 4JY6A 5FDWB 2V2TB 4OZFH 1T22B 4R4FL 4YZFF 3W0WE 5FFLA 1YEIL 4RFNC 1HXYB 1V3LA 2A2QT 4YHNA 1AQDB 5E8OB 2FHCA 1RZKL 3D69A 4K23L 2ATPB 2P8PA 5IBUG 4KHTL 1IC4H 1MCWW 4UOW1 1N59B 4OI9A 1LO0H 1M7IA 2BHYA 4FQJL 1AGBA 4KGJA 1OHQA 1BIIB 3H9SD 3KPRE 4TVPD 4JG1H 1T3FB 3K8LA 3F5WB 3CLFL 4X4XA 1T66D 3DYPA 4BSWB 4F7MB 1QTYT 3A67H 4P4KD 2ED8A 3E6HA 4U31A 4ZUSB 4HFWB 2Z31C 4U1LA 4C83A 3U1SH 4PUBH 4NWTH 4BH7B 3IDNA 3RGVD 4LARL 1WC7B 4RGND 2BDNL 2NW2B 1R3IH 4RAUA 2BSED 2ZJSL 4HJJL 2DBLH 4M5YH 3S35L 5H37H 3SDAD 2P24A 2MNUA 3TN0D 5DEFB 1JF5A 3WLBB 3WUWB 3ILQC 2DQDL 2NY6D 1FH5L 3QQ3B 5ANMB 2DWEB 5FYJL 5CD3A 3G9VA 1AHWC 4ZSOB 3Q5YA 2APFA 1EFXB 2NY2C 5KAQG 3QUXA 4Y1AE 4X6BB 3CZFA 4G6AC 3S97C 4POZC 5B39A 3GUTA 4HXBL 4NNXB 5EBWB 1XGUA 4OGXL 1JWMB 3HC4L 3O9WD 5F7DB 4HG4K 1W0WA 4G6KL 1S3KL 3QDMB 4OF3A 1KIQB 3BESR 1FO0A 4M1DL 2EEBA 1B0WA 3KYMB 1OPGL 4NWUH 5FO9B 2FZ3A 5CSZA 2QQNH 2ITCA 1XGYH 5E8NB 1DVFC 2F54D 3HN3A 4R90H 4RMQA 1HHGA 1ORSB 3KPOB 3DO7B 1X4YA 4OKDA 1PKQB 2EDEA 3PV7A 4KKAC 1TIUA 4TULH 1OVZA 3KYAA 2F5AH 4BZ1H 4M02A 3B2VH 4GQ9H 4JFQA 3IAPA 4JLRB 3ZKQD 1CFTB 2OTPA 1L9NA 2VQ1B 3LS4H 3IFOA 1CXKA 3MUGA 4LVHC 4HKJB 4MQXC 3WDHA 5IW3A 4DJMA 1T1WB 2WWMD 1WUNT 4Z7NF 1A6ZA 4MDJA 3IVKA 1AD0A 5ESVA 1D5MB 2KUTA 3K4DA 2V2XA 4KVNH 2FD6H 5JPMA 4ZYKA 1I7ZA 3NH7H 4UB0H 3MLWH 5MEQA 3KYKH 2UV3A 4OZGF 1NAKH 2AKRB 3OAUL 5DR5H 3QUYD 3ULVL 4PJDF 1Y0LB 1YNTB 2LQRA 4M1GH 5EOTB 1I85A 5GGRA 1UM5H 2K3TA 1ZXQA 2PCPB 4JAMA 5DUBA 4HX1B 3BN3B 3RWCA 3IYLW 3UCRA 3FQTA 3ARUA 3PGDA 1JGDB 2YC1B 3TNNB 5I8OL 2BZDA 3LQAH 5F71A 3C5ZB 5E56A 1BWWA 2E5EA 3K3QA 4HKZA 1I1AD 2DIAA 2FBJL 1YEHL 3O8XD 4YX2H 3VG9B 2QLVB 1XF4B 5SWSB 4JPVH 4H88L 4FZ8H 4MNGB 4OF5A 2CXGA 2GITA 2XN9D 5D6CA 4UIMA 3DXAE 2DQTL 5J12C 1WIUA 1BFOA 1NBZA 4YPGB 4JZNB 4WENB 2X9XA 2VIRA 3TO4D 2D3VA 2W0FA 3MGOA 3OAYH 1QSFA 3LDBB 2ZPKL 3B9EA 3V7AG 3SJVE 3IKCB 1UZ6E 5D2LA 3T8XA 1MQKL 5IMKB 3S34L 4S11A 4PJBF 3VXSE 3MRPB 4QXTA 4JFZH 4M9PA 1JPTH 1BAFL 4GAJL 3S8WA 5DJ0B 2FDBP 3ARDD 2R23B 4RFNB 5C6TL 3UYRH 4X9HA 1U3JA 1FZKA 5SWZA 2Z4QA 4UNTA 4JKMA 4PJEF 4RWHA 5HDBF 1KENL 2BP3A 4IMLA 5C0GA 4K3EH 5D7LB 3R0NA 4WTZA 3TFKD 1DSFH 4PB9H 5JHDB 3H7BB 1KACB 1NUNB 2GTZA 3EYVB 1XCQB 2DQCL 2IAMB 1VACB 1VFAB 1F4WL 4W81A 1JF1B 5IF0A 1MJJB 1IGCL 1AGCA 4NNPL 3GI9L 5CHNB 4V2BA 4I0PC 1D5IH 1K85A 4R9HA 3BD4A 4M7LH 5D2NC 3PL6A 4JKLA 5D6DA 3MLTB 4JQVC 4LLWB 1WZ1L 5ESQB 5E6IA 3T77A 4AG4L 2BNUA 3ARFD 4F58H 4PTTB 1FYTD 1TMCB 2VXTL 4JKPH 4EUPA 5I18H 1RUKH 4JQXA 5F1NB 4U2ZA 5F7YC 3O81A 2P8LB 5DJYB 1S7TA 4Y5XA 1AHWB 2GCYA 4DZ8A 1QYGH 1HZHH 2NY2B 3CVIH 3RUGA 3GJFB 4FFWD 5CEZH 3WN5A 1SY6H 5HPMB 2N56A 1R5WB 5KZCB 3VD4A 2NZIA 4X6CF 3MLYH 1E4XL 5IVXF 5A43C 3WJLC 5JPNA 2N4IA 1I3RA 4F3FA 1P2CB 3ROLA 4GRWB 1CN4A 4Y1AD 1IZKA 4PJHB 5GPRA 5DHYB 3BDYL 4PJ5B 4NT6A 2QR0B 1OLLA 5DJ2A 4CN6A 4RGOH 4LF3B 1DVFB 4P57B 1U9KA 2PYED 5D5MA 3SBWC 3L3KA 5L8LB 2A9ML 5D72H 2Z8VC 3STBA 2OK0H 4FNLH 1IAKB 2OJZL 3BWUC 5CZVL 1MRDL 1T80A 1OB1A 2BSRA 3T3PF 1AO7A 3U7YL 5ISZD 3IXTB 3HZVB 1S9YA 4ZDHB 4Z7VB 5FYKH 1BZ7B 1QSZA 2DQIL 4LVHB 5IJKC 3S4SG 1RJZA 2FECL 2BY1A 1WCQA 5FUOH 1MWAA 5FA3B 1X5ZA 3O45A 4HIEA 3OPZH 4ONHA 3CSYA 2VDNL 1RMFL 3INUH 1HKFA 5F9AC 4G8IB 1F11A 3G5YB 4XNXL 1JHTA 5HVHC 5DYOA 3WJJA 1AI1H 4X6DA 3AREA 3QEHB 1OTTD 3GMNB 3OXSA 4V1DA 4BQ6A 1A1MB 1Z9OA 4KRMB 4J3XA 5FYKU 3ZKXC 1JNLL 2NY3D 4X4YB 4R4ND 3QO0A 2YPLB 4HLZG 5ADPH 1DE4B 1FHGA 2V5TA 2NQCA 1C12A 2F19H 4OUUB 4CMHC 4XGZA 3EZJB 3MACL 1IT9H 1MI5A 4P9MH 1QEWA 1SEBB 5FKAA 3L3IA 1CDGA 3AB0C 1B3JA 5GSRA 4J1UB 2NXYD 2NCMA 5CS7A 1J1PH 4ZO8A 1F6FB 1FO0H 3L3JA 5IGXH 1UWGH 3NZ8B 4OFIA 2BNRA 1FVEA 3EYSL 3CCHA 2ZSVB 5J12B 5FYJD 4NO5A 4FA8A 2XI9A 2M2DA 1IC5L 1R3HA 3MJ8A 4GFTB 3G6AA 4DKDC 5TF1L 3T0EC 1MCHA 2IH3A 3GHBL 1I8MA 1MHPL 3U7WH 3HFML 3SDYH 4LVOC 3WS3A 5CEXB 1SVZA 1ORQB 3TCXA 2XKNA 2VWEC 1ZA6B 2PO6D 5IB1A 2O5ZL 1TCRB 2CIKB 4HIJB 5DD5H 5A16B 3B43A 3O4LE 1EA9C 4M4PA 5D8JL 1Y6NR 1KPUB 1LQSR 1W0YT 3OKMA 2E6JA 3F7QA 4KV5E 1UYWH 3TIDB 3SJVD 4NRXB 4IS6A 3CFJB 3LQZA 4HF5L 5BV7H 4LSSL 1N8ZB 3HZMB 5EZLB 4P2QD 1N3NB 4JVPA 5C0FB 4W4OC 5I75C 2AK4D 4XRCA 3QXWA 1FGVL 4G6ML 5FYLE 1OT1A 3D3VA 4ZUVA 3IDMB 4P9HC 5IBLC 4GKSB 5GS1C 2V9RA 2CXKA 4TRPL 4ZPVA 4P2RD 3D87B 3KYOA 1A14L 2HJKB 5JW3L 4XZUB 5DJ6B 1Q0XH 3HTLX 3ZSTA 1ACYH 3C60D 1JI1A 2VXSH 3MLXH 1L6ZA 4FMKA 5D2NB 3RDTC 1J0YA 5ICZA 1DANU 1WBXB 2EXWC 3T1FA 1T21B 5E9DD 2EC9T 2HFEA 4MA7L 1AGDB 4XNMB 4A6YB 1FZJB 3HRZA 1NFDB 4NSKA 5J6GA 3GJFK 1NCCL 5IJVB 3ULVD 5AAWA 4FTVE 3AFLA 4RAVA 3WHE0 3TT3H 2DDQH 2E7LA 3S36L 4HWEH 2IGFH 5DC0A 2ENSA 2IFFH 4JG0L 3SE8H 3W11D 3DRTA 4J4PA 4OD2A 4R7DA 1XCTA 1M6OA 4IMKC 1D5ZB 2DBJA 1RZ8A 5T1MA 4GOSA 5KSAC 3S37L 1HINH 1I1FA 4P3CL 1PZ5A 4PR5B 3FRPG 1U8QB 4TUOB 2C4FU 3Q1SL 3I2CH 3U4BH 5I1GL 3ELAT 1QUNA 3H0TB 4O51A 4G6JL 1M7DB 3L7FA 5EZIL 4KUZH 2MKWA 5GJTH 4WCYL 4Y16B 2ZCHH 4P5TC 4NQDE 1J0KA 3O2DA 2EZ0C 4ZAKD 3QRFM 1B0RB 5MERA 1AXTL 4IIQC 1UVQB 1RJLA 3WSQL 2I5YL 3BPCB 2WBJA 4M7JL 1QRND 2Y36H 5F9JB 1CGUA 5CILL 4MHHI 1AFVL 3J8F7 3TT1H 4N5ED 4NBXB 1R5VA 3BDBA 1NGPL 2ZUTA 4EI5D 1EJ6A 4YDIH 3X13A 5KG9B 3QXTA 3EFFB 1WCBA 2C3VA 2IJ0C 1CLOH 2C3GA 4G42B 5T5FH 1C5BH 3VFMB 4PGDB 5I1KL 3ZDYF 4AT6B 2V5SA 3LV3B 4OJFH 5D7IE 1Q9WB 1U3ZA 4EN3D 5C8JB 2G75A 1TJGH 3TJHD 5HHOA 4AEIL 1FVDB 2GQHA 4N8PA 4NJ9L 5EBLB 3VXTB 1XGQA 3DIFB 3LEVL 1E6JH 3VWKD 5GRXG 3UAJD 2R0WL 1IM9D 1CF8H 2VQTA 1X5IA 1EIBA 4LSVH 3QRGL 4XHJD 3S5LB 3SDCD 5SWQB 4NCC1 3QEGL 2V9TA 3ESVF 3ULSA 3TO2B 3PWUB 3S9DB 1MHEB 1CZ8L 4U1NB 5C08D 5T3XE 4CMHB 5T33L 5ILTH 3A0OA 3FN3A 1A9EB 1FP5A 4KK6D 2XWTA 4OZ4B 3ZL4L 2R1YA 3BQUB 1LEGB 2R0LH 3SGKA 3X3FH 4XVSL 1YQVH 2DQUH 5JUEH 2FJFB 3GK8L 4NZTH 2ORBH 5I1DB 3E8UH 4I18B 2G9HB 3V6OC 4DEPB 5AZEH 5IESL 2ED9A 2R29H 3AAZB 4I9WE 5IB2A 4WW1A 3MJ9A 4OFYA 4YDLB 2ZWLT 4JZOB 5LGJB 2BC4A 4J6RL 3EGSA 3HE6A 1CL7I 4LCCC 1E28B 3FFCD 3MFFB 2DLFH 3MV9D 2X4UA 5FHAL 2EDHA 3T0EB 3WFCL 3S88L 1UB6A 3TBYA 3WFEL 2W07A 3MA7B 3FJTA 3GEWB 4LVOB 1KBGL 1OAUH 5DD6A 5E94A 3S96A 1WT5C 4M00A 3RVXC 1Q1JH 4GMTL 1A9BB 2OX5A 5AZ2H 1MWAH 3ALXA 4PRIA 2FH6A 3VGEA 5F88A 3B8SA 5BQ7A 1MEXH 3QNXA 1A7RH 1P6AB 1I7UB 3C6LD 1Q8MA 5ETUA 4MS8C 4LRIC 5ANME 2Q6WB 5HY9B 5DDHA 3BKMH 5HHPB 4H8WH 4OZGB 1K2DB 1T0NA 3EYQD 4PJDB 4YEFA 1INEH 1EZVY 3VXUB 5DURB 1UM4H 4JANA 2CJUH 1G7JA 3BPLB 3WFDH 4L8SC 4UNVA 5CCKH 1CTNA 2DJSA 4O2CA 4QWWC 2YA2A 1OM3L 3ZDXE 3QDME 1JWSB 3QZWB 1Q94A 4GXVH 3RDTB 1BF8A 1C5DB 1RJCA 4BH8B 3OKDA 1LEIA 4L4TB 3RNKB 2BJML 2WP3T 4PLKD 5J1AB 4QOKA 2NTFB 4XVTH 1IAIL 1UZ8A 3QQ9D 3BJ91 2IANB 2W0LA 3Q6FA 1I7RA 5ID0B 1PKQE 4AZ8A 3CFKA 3DECA 4P2OD 4AJ0A 4DUXA 5EPMB 1S7QB 1JJUA 3LEYH 1I8KB 4FZEH 4ELMF 3ZE1E 5HYJB 2WBWB 1MLBB 2P4AB 4ISVB 3W2DH 3RY5A 5KSAB 4AH2A 5HDQH 4YGAB 2P42B 4HWUA 4MNQB 3HC3L 1H15B 3BT2H 4MA1C 1PG7X 3N06B 3QIWD 4G80A 1MFCH 3MLRH 1RJYB 1G9NH 5L2KB 4XMPH 1U41A 1XIWB 4PJBB 1HOCA 5HD8D 2FWOB 5L6YL 4P5TB 4F80A 2EE2A 1J5OL 2BVQB 2HN7B 3HB3C 4IIQB 3X12A 4XC3H 3QXDB 3O11B 3NFNA 4PJEB 5D1XA 4U6HB 3LQAC 1RZGA 4FQHA 2Q3AA 1HQ4A 3FQUA