1DQTA

The crystal structure of murine ctla4 (cd152)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOTOXIC T LYMPHOCYTE ASSOCIATED ANTIGEN 4
publication title Structure of murine CTLA-4 and its role in modulating T cell responsiveness.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dqtA00
4X5LA 2G75B 5DURB 2E3VA 3BW9B 1X5AA 3ZDYE 2EH7L 2VABA 2YRPA 3UXFA 4DGIH 3ZKXC 4X6CE 5IJKA 5D7LE 1DL7L 1NDGA 1S3KH 4PS4L 1YMMB 4TQEH 4XAWH 5I6XB 4ZFOL 2ZG1A 1DJSA 3CXDH 2DQHH 1NBZA 1J8KA 3BEVA 1P53A 4I9WE 3JTSB 3DUUB 2WUCH 1NCBH 4FFVC 3HE6A 3RUGF 1AGBA 2ADGA 2ATPA 3D3VD 3OJDB 5HI5C 4E41D 1KGCE 2P48B 2CMRH 1BFVH 5ID1B 3WHXB 3S35H 1R0AL 3BZFB 4MAUL 1YEFL 5GZOC 5ID0B 3C09B 5FV1L 1KIQB 1UWXK 2X40A 1KLGB 5DZLA 4B5EA 4YJZL 5I1JH 4OI7A 2XZCL 4LSUH 1RUAH 2FECL 5EFIA 4NZUH 3WXVH 3P9WB 4EUPG 4L29A 3WN5A 4NT6A 2VZUA 4Q2ZA 5HHVH 3VXOB 4ENED 1HI6B 4NFDA 1YQ2A 4N5UA 2Z92B 1H5BB 1XR8B 2HKFL 4YXHH 3RWJA 1KUMA 4QXGL 4M6AA 4NKMB 4JRYB 1T5WB 4ZOAA 1S7WA 4CMHB 1FFNA 2X9XA 4HPOH 1KYOK 1R3LA 4XXDA 3BAEH 1F11A 3HC3H 1A1MA 4JJHA 3OTTA 4HEPG 1WFUA 4NP4L 3MROB 3D0LB 4TVPH 4QKXB 5E2VH 3FT3A 4NQDB 1KG0A 1P1ZB 4G6FD 1J18A 1LP9E 1MCOH 1S5HA 1MAMH 1VENA 4Y8DC 4NN7C 2JJUA 3RIAK 1OGAD 2RHEA 4HJGA 1N59A 1G9MH 2AJXL 2P5WE 4F37K 4H88H 3UTQA 5GGSY 1IM9B 4JFXB 5SV4A 5DK0A 1GPOL 4EVNA 1JZ6A 4X8JA 4XPHL 3P9MB 4DK3A 2AERT 1EBAA 3ZLQC 3EBAA 3QFDB 3G5YA 1NC2A 1TZGH 1T0PB 4PBXA 1FZJA 3H3KA 3CSYB 3AU1B 2VZSA 3ZDXF 1MRCH 5EBWB 3RUGE 1S7VA 2ZG2A 1BQHA 4P2RE 1F4YH 2W65A 4P2QD 1E27A 3MA9L 3IFLL 4EUPH 2R4SL 2A77H 2LABA 4Y0GA 3RIFF 1ACZA 5FO7A 2VTFA 3HZKB 4LHUD 4RGNB 2GFBA 4F8QA 1F3JB 4PRBA 4ODUA 1YEHH 1QLEL 3S4SG 4QRRE 1F90L 5ISZE 4NO3B 4ZUUB 4GKZB 4QF1B 4YDIL 4NUJA 4OLYH 1J10A 3K8LA 3WFEH 3S9DB 3L6FA 1A4JA 43CAB 3MV7D 2OXGA 5TF1H 1R3JB 4M61A 3CJJA 3PIQB 5DJAB 3CIQA 1JI2A 1CLOH 2NX5E 4LRNL 4JANA 3I02B 3W82A 3OHXA 2V6HA 3VH8G 3L3GB 1T89C 1PY4A 1EEZA 4TUOB 2EIEA 1AIFB 4MDJB 3RQ3A 1UA6H 32C2A 2VDOH 4NCDA 4O51A 3QUXB 1WISA 2DQJL 1KACB 5DJXB 5F6HJ 3G5XA 3GGWB 1U36A 2VN4A 2OYPA 3S37H 1CFQA 2GJ6B 5CJ5A 3DX7B 4U1HA 5TDPB 1MFAL 3VXTB 1T83A 2SEBA 1SQ2N 3TN0B 4QTHB 4NM8H 4RWYH 1KTDA 3EJZD 1I1AD 3WJLA 2OL3H 5DMGD 3DX6B 4XPTL 3QNZA 2UWEF 1I3UA 4N1EA 4DUWA 3GMNB 1MCKA 5T1LA 4GUPB 1PG7X 5GS0H 5DTFA 2WNGA 3ZDXE 3TH2T 1XGPB 2R2EA 1WF5A 1JPSH 4RFOL 4DTGH 4KK6D 2D9CA 4EOWH 1RZGA 1VADB 4JPIA 5AUMA 3QEHB 3H2WA 5EZOH 3EO0B 3IRZA 2ZJSH 3MUGA 2HVJB 2HRPL 4AT6A 2AJUL 1FC2D 4GKOA 3OJMB 3OPZH 3QEGH 4X6DF 3LHPH 1T1YA 2NTSP 3M8OH 3X13B 4M7ZB 2VXQH 4PRHA 5J12B 3ULVL 3OAYH 1FVCB 2QTEA 3PG2A 3GUTB 3B3IA 3KAAA 1ZHBB 1LK3H 1XF3B 2P8LB 2J12B 1Q9OB 5KOMC 2I5YL 3GM8A 4MD0A 3KLSA 3QG6A 1JMZA 2AW2A 3L3HB 1ZWIA 2A6DB 1A21A 2UYLA 3IVKA 3N1MC 3EJZC 3V6FB 3I9GH 1I1AC 1NMBH 5LXGL 2Q86A 4PLKD 5DMGC 4HKJB 2PXYB 4HQQL 3FAXA 3QIUB 2VLLB 3QIBB 3LIZL 5E94A 1L9MA 2BY1A 3L3JB 5CKGA 4NKOB 2R1WB 3SY0A 4Z78B 4JFYA 2GJJA 3QDME 5T3ZH 4N8VG 1AGDB 4KK6C 2V17H 1I3VA 5E1AB 3DJ9A 3DHMA 2VZ3A 1ZHNA 1IKFL 3LH2L 1Q9LA 2HJFA 5DJYB 3T0BA 2UWEE 5KSAD 1VKXB 1Q9WB 1HILB 3N1FC 2UY6A 1RIVH 3GMRA 3KG5A 4I3RL 4K94L 4JO2L 1P6AB 2VQTA 4X5XB 4Y19D 3IKKA 4JRWA 1I1YA 3ULSB 4BZYA 3NABH 2R0ZH 3GMLA 3K2MC 3LPGA 3V6BR 2YWZA 3DVFA 5IUSA 5L2JA 3TESA 3GMPB 5DD5L 1MJ7L 1X4XA 1G6RH 2VDNL 1NCAH 1CD0A 3FQRA 4XPBL 1VFUA 1KCKA 1QA9B 1PZUB 3KPMB 4LLVA 4L8BA 5DD1L 2ATKA 1XFPA 1MJJA 4X6DE 5EOTB 2CDGB 4RAVA 1BZQK 5DA4A 3BT2H 4MJIB 3LEYL 3GHBH 4JFHE 4PLKC 3N0PB 5JHDD 1SEQL 3T8XA 1M6OB 4NQVB 2O26U 1P7QA 4FA8A 2B39A 4UAOB 5BV7C 1CQYA 3VXSA 4ELMF 1LE9A 1XF1A 2XFXB 5J9PA 1KELH 3MMEA 1SJXA 2AQ1A 5FAAA 4D3CH 3D2UA 3WFZA 1PZ5A 1T22A 2EE6A 2NMSA 4YXLH 5KSAC 1J8HE 2YKLH 3FB5A 4F57H 1MHHB 1MRDH 4HZAA 4M62H 4ZMAT 2F19L 2OR9H 1A7RL 1G0XA 4JZNB 2QADD 5J4MA 2IFFH 1YYLL 4R3SB 2YPLD 1PKQE 1IC7L 2L0DA 2ZCHH 2OI9B 2P8MB 4AH2A 4KAQL 1QFWM 2FJGB 4TN9A 1LO3H 3H3PL 4OBRA 4I4WB 4UV4L 1KJ2L 3IS0X 4QHMA 5I1CH 1NFDF 3O4OB 1Q38A 1J12A 1C5DB 4NQCB 3U7AA 3VXRA 2ADJA 1CCZA 1CI5A 1KN4L 5DC0A 5D1XD 1VGEL 4GLRH 4P3CL 1RPQA 1CF8L 5J1SC 4PJEA 7FABL 4NQXA 1NMCC 3RHWK 4L8SC 1MWAB 5TFSH 1KT2A 4XBEH 4LDLB 4PR5A 1E6OL 1P4IH 4N90D 1RAMA 1BFOB 5KS9F 3GJEB 3EZ8A 4XC1L 4F9PC 3DRTA 5GHWH 3EYFA 2UVFA 4JO4L 5CD3B 3AS1A 3DVNB 1H8OA 1NC4A 1NGZA 2CLZA 3NCEB 4JFEA 2NXZD 3TNMB 3RZCA 1VGKA 5IVXA 4PS4H 2EIZA 4WHYG 1H3WM 2JJTC 1OTSC 1AJ7L 2X4RA 3P0VL 4G8FA 5D2LA 5BV7L 4PGCB 2PTTA 3WHE0 4RQQA 4BFBD 1Z6JT 3D25B 4WFGE 1DFBH 4XXCA 3LQAC 4OQTA 5DJ0A 1CXHA 1NLDL 4P5MB 4GQ9L 2NY0D 4I0PD 2FR4B 1MI5E 1EAJA 3RX8A 4EI6B 3OR7A 2Q20A 3BP4B 2H3NB 3LS5L 4ELME 2OK0L 1CD1B 2CUMA 2FX8L 4QY8A 1TZIA 2Q76A 1QPXA 1ZAGA 1DANU 3EFFB 3QUMB 1TITA 1OARL 2XZCH 4YHOL 3KYNA 1PGRB 1T21A 1KEGH 4QHNA 5HYFA 4LLQB 5D1XC 3NH7L 4JM4H 3KHQA 2FYYA 4IDJL 3TP4A 2HKHH 2IG2H 1IQWH 3H6JA 5ETUA 5IMOB 1URLA 1I1FB 1RHHA 4K3JL 3SEPA 4QXGH 3ULVF 4PP2A 3K1KC 3TYFB 1NFDE 5JTWA 5I1IL 9CGTA 2NY3B 4RRPG 4HMCA 1T7VA 1FL6A 3PHQB 1D5XA 4M00A 4YHZH 3O2DA 3QO1B 3W9DB 4NP4H 1EO8L 2NXZC 1FO0A 4U1JA 4IMLA 2RCSL 5F7HA 1NEZA 3I75B 5DJ6B 4L4TA 1D9KB 3MRPB 2VL5B 1PQZB 1M7IB 2X1QA 2WINB 1T5XA 5KS9E 4IMKC 4IIQC 4WHYH 3I2CH 3KPSA 4KJQD 3T65B 3MNZB 4MJ6A 3QNYB 2K7PA 2NY0C 1T7YA 4X4YA 5MENB 1S78D 1LDPL 4XPHH 4OF6A 2AXFA 4HKZB 2BVTA 3ARGA 3MYJB 4QRPA 4XNYH 3VMOA 1YC8A 2NCMA 3R1GL 1OCWL 5MEQA 4P48A 1E0OB 4LSDA 3CZJA 2P49B 3TO4B 1ZK9A 3E3QC 4OF5A 4WGWB 3MGOA 1XEDA 5K9QG 1UGNA 3MA9H 4M7LT 1F2XK 3IFLH 5MEOB 3LQZB 1FZOA 3MJ8B 4XPGH 4WEMB 4L9LC 3GSOA 1SBSL 2RQ8A 1JWSA 4NWTL 3DMMA 2MSPA 5L2KA 3QQ4B 5MEPA 2B1AL 4PUBH 5I9QC 3IFPB 2Y07H 3AAZB 2APTA 2R23B 4Z7UF 3LKOA 2GY7B 3VFRB 2YXFA 4KPHH 2BNRD 4LLUA 5TE7L 3OR6A 1T2QL 4YDIH 5DS8A 3IDMA 1QQDB 3QISA 1Q0XL 5SX4I 3ORJA 1JE6A 3ULVE 4MMXC 4ERSL 2VLRE 2DLEA 1RUKL 3KDMA 3UTSD 4Z9KB 3RWIA 3TVMD 1W0WB 5C0BD 5HJ3A 2FIRT 4JHWL 5DO2D 4NN5B 1S9KC 3T4AB 4GRMA 4IS6B 2BSTA 1S78C 4G7VL 5BRZD 5J7CC 1UWXH 2J8UF 2BNQD 2OZ4L 3A6CL 4I5BB 4GAJL 5D70L 3W9EB 2X4UB 4CNIA 4KTEL 2DQJH 3QAZC 1XIWA 4JFPA 4MAYA 1KB9K 1CR9H 1CDGA 5EO0A 1MFAH 1NFKA 2WLYA 2AEQH 1G7MA 2PYFB 1NSNL 3GSQB 1HQRB 3CUPA 5FB8A 4ZD3L 4ZS6C 2YUVA 5B39A 2YD4A 4FXGB 2J88L 4XPTH 1FNAA 4HZLB 4HWBL 4WFED 5JR1H 5A16A 5EDXA 4LHUG 1I85A 4U6VH 3VFVB 1UXWA 3TO2A 4NC1E 1UEMA 2ESVB 1HE7A 2X4NA 4RFOH 1A14L 1YNTA 3IDXL 4V1DD 2RFXB 3MV7E 5FOJA 3CCHA 2FJHB 4LGRB 4J8RB 1CG9B 1C08B 3LKNA 2EDLA 1QSZA 4R8WH 1MEXH 3W0WE 3K8MA 1KTLA 1WBXA 1M7DB 5I15H 1YY8A 1FZMA 1FVDB 3MZGB 1WJ3A 3BGMB 2X4PA 3BP5B 5BZDA 2HRPH 2NY2D 4MS8D 5HYSG 4UIMA 1T7XA 2W91A 4PRIB 4TOYL 3TVMC 4ONHB 4Z7UE 1I7UA 2AV1A 4QO1A 5DO2C 5JIIA 4J2XA 4PG9A 1N2RA 4PJBF 3RTQC 2C26A 2EIBA 4LIQL 3STBA 1YA5A 5HVHC 1XGQA 3CDFA 3GSUA 3LEVH 4CN1A 3VFOB 1HYSD 2C1PA 3X14A 1F6AA 2EDTA 3CVHL 3QH3A 1EXUA 4WDIB 5AEAA 2I5YH 1K6QH 3M1BA 1FYHB 2H32B 5SWSA 4Y5XB 3QQ3A 2EDJA 3BOVA 2K3TA 5BS0A 5DJDB 3RY5A 3HNTH 2J8UE 5LXGH 1I7RA 2ZNWA 4I18B 3MO1B 2X42A 4TUJB 2R8SL 2H8PA 4ZQKB 4EDWL 3LIZH 3NCCB 2HRLA 1F3DH 3PWUB 2CIKA 3FT4A 2Z93A 5C0AD 1FBIL 1ONQB 4J6RL 3WNKA 1OAXL 3T0ED 2P24B 3X17A 2X1OA 4OFKA 1EJOL 2ICES 2ZSWB 3EOYG 4LNVA 2I07A 2AXGB 3WNNA 1M05B 4DCQA 2H9GB 4UT9H 3CFBA 3LH2H 5E6IA 1JPFB 1JUFA 4N1CA 4NNYA 1CL7I 2NY2C 4JFFA 1ADQA 4I3RH 4F7TB 4J4PA 4JO2H 4L3AA 1X7QA 2C1OA 3L3DB 3S96A 1IGYA 2MNUA 3TH4T 3MOAL 4DW2H 4OSUH 6FABL 5FHAL 1NAKH 2WBJB 2BVPB 4NBXB 3UJTL 4NPYB 1I1RA 5E99H 5BO1L 43C9A 4UUJA 4LCUA 2NPLX 1MJ7H 2FEEL 2W38A 1QSED 2CRZA 1RK1A 1MRFH 1MHPL 1MVUA 4J3XA 5K9KA 4XNQB 1MIMH 1NPUA 3RY6C 4LKXB 4ZFZA 3C8HA 1D5BA 4LCWB 4YEEA 1JRHI 5I66B 2XN9B 4F15C 2X4OB 4PJBE 2XOTA 1NJ9A 1CD9B 4M48L 5CBAA 3TFKC 2EIDA 3LEYH 2CDFA 1DLFL 1WLHA 4PREB 5J8OA 4YHML 1JGVH 2AK4E 5IW1A 4P3WA 3MRKB 4ZYKB 2O5YL 2G60H 3UEZA 3IF1A 3I6GB 1MOEA 5DURD 3MNWB 3T0EC 4X7DC 1KULA 4X80L 4X6FB 4IRSA 4LCCA 3PL6B 1KYOJ 2C3VB 4NKQB 2ZCLH 1Q1JL 4KK9D 1YMMD 5BZWA 3BZ4A 1UWEL 5D7IF 3ZT5A 3Q5TA 1A9EB 3RWFB 1YYLH 2XPGB 1UKSA 2OCFD 4YGVA 3HAEG 1DN0B 3OZ9L 2LU4A 4PJDB 2VLJA 3U9PL 4ODWA 4W4OA 3U9UB 1B0WA 2DI9A 1DN2A 2HFEA 3T77A 1T03H 3QXVA 4O5LL 5IW6A 4UV4H 2IH3B 1KJ2H 4U0RB 5GQBA 2Y06L 3PNWB 2DDQH 3P4OA 2NW3B 3BFOA 5DJZB 4QLRA 3P4MB 5IMMB 3V5HB 1KN4H 3PJSB 1H3PL 4P3CH 1LQSR 2GIYA 3AXLA 2J6EL 1CF8H 5FO9B 2EDDA 3IGAB 4OCXL 1T7ZA 7FABH 3S97C 3V8CA 3LS4L 4X4XB 3VG0L 1E6OH 2UVEA 4PB9L 1KB5L 1YNKH 1AQDA 2VDRH 3CMOH 3VWKA 4P2OB 2XA3A 4XC1H 5E8DH 5E2JA 1JVKA 2DMBA 4JRYD 4OV6F 15C8H 3O6ML 3DYOA 4HUKB 4G9DB 4PJAA 3K4AA 3SE9L 1HDMA 1VFBB 3RPIA 1FFPB 1RQ5A 2E9JA 3B9KB 3BH9B 4Y5VC 3SDCB 4JM2A 2ILLA 5BV7H 1T0NA 2X1WL 2YPLE 4NQDD 4KK9C 1RMFL 1CLCA 1AGFB 5C6TL 1G7LB 5I6XC 1NLDH 4ZNEA 1CGYA 2VXSL 2IQ9L 1UB6A 3QA3B 5FM5M 4OCNC 2D0FA 1LEGB 4F9LA 3X12A 1A1OB 2D31B 2OK0H 1IM9D 2JK5A 1P84J 5KSUA 4GG6F 3HAEH 1NBZB 4G43B 1CXIA 1RZ7H 4HHAB 4YFLI 3NACH 5D6DC 1OARH 3V9FA 5D7IE 4Z5RB 2QQQA 3EO9L 4UMGA 1ZXQA 4OGYL 3C09C 3O8XB 3MLTB 1KENH 3NH7H 2QSCH 3DOSA 1B0GA 4J3OC 4IDJH 3WXWL 3KYKL 1DSFL 2M26A 2LFGA 5J0BA 1GZPB 1U8MA 5C0CB 3L5HA 5FGCB 2N7AA 3MRFA 4J3WA 5I1IH 1A6AB 3DI3B 1H5BC 3KPLA 4ZAKA 1I9EA 3QWOA 1DVFB 5EFIB 1T0MB 4BYHA 3DO7A 1ZT4A 3V0VB 5F3BA 4CMHC 1XF4A 4NT6B 2W0LA 4QTIH 4UQ3A 2HLFD 4JDVB 2ICWI 2X1XR 4BK4A 4RGND 1IM3A 4FN0A 1FAKT 3SDAB 5BJTA 5KW9H 1P2CA 4KMTH 4I0CC 1RZKL 4GRLA 1S7WB 3QZWA 5I73B 5LQBL 5HGAA 1LEIA 3HMXA 2OSLB 5F96L 2VUYA 4XXDB 3MA7B 4IEFB 4LBEB 2I24N 3LQAH 5IB5A 5E5UB 2DB8A 4X98A 5EU3B 1MLCA 2GYSA 3QXWA 1KG0B 1TIUA 1K2DB 5DF0A 4K7PL 1UJ3A 3I85A 3SDXB 1J1OH 3R1GH 2C7UA 3BYYA 4WU5B 3MACL 5EZJB 3CDYA 4GMTH 4YHIB 3ARFB 5IVZA 3QUXD 4MB3A 4BFGA 3KLHD 4XNUH 1KCSL 5DK0B 5K33A 4EVNB 3P11L 3Q0HA 4FXKB 5HSFA 5CUSL 3MLZH 2CIIB 4NQEA 2GJ6D 1OD7A 5EZLA 3TGXA 4OBSA 4GG6E 3G5YB 4GLRI 1NC2B 3TN0D 4WHCA 4NFCA 4LPWA 2HFFA 1FCCA 1FL5B 1HSBB 5D2NE 4I2XA 2B1AH 4GXVH 1QRNB 3FB6A 5DYOA 1EBPA 2XZAL 5TGBA 3BDXA 2BXZA 3EOBA 2LU7A 1D6EB 3D39B 3U36B 2HLFC 5TE7H 1D5MA 2W65B 3NZHH 2Q1EA 4LIQE 4RGNC 1E27B 1RJZA 4K3HA 2GTWA 3MLWL 4P4KA 3NBNA 2AEPL 4HS6B 3LSOA 2G5BA 4UT7H 2DM3A 2NY5L 3TZVA 5EWIL 3F5WB 4OGXH 4RMRA 4C4KO 4ODBD 4Y4KA 4JHWH 2YUWA 5INCA 1K85A 1CXKA 3RVTD 3HPJB 4L8CB 4GRWF 4LCIH 4G7VH 5FUCE 2VXTL 4Q9QH 4CADB 1MLBA 2JF1A 3NTCH 3L5JA 2MTPA 2W0KA 3TT1L 4O58L 4H1LA 2IF7A 1VFAB 4L8DB 4KTEH 2XKUA 5CZKA 2FEDD 3C5SA 3AB0B 1IBGH 3PV7A 4KGJA 5IT2L 4JANB 4AY0A 5DMIL 5GGQL 3QUXC 5JPMB 3KLHC 4MHHI 5GS1A 2B4CC 1NSNH 1LNUB 4YBLB 1MCDA 4FOMA 2HFGL 4L1HA 4DVBA 4IHOA 4WTWA 2BNRE 4OZFG 5AZEL 1B4JH 3TN0C 2XWBA 3D87B 2BK8A 4G5ZH 4Z76B 5KSVA 3G5XB 5DUBA 3MJGX 5IIEB 2PXYD 2OR7A 1A14H 1SJHB 5ICZB 3QIBD 3IAPA 4ORGA 4KDVA 4OZ4B 3HG1A 3CU1A 3SGKA 4HJJL 1T1ZA 5C0BE 2CH8A 4NSKA 3SOBL 5GISL 3WFHB 1Z5LA 3GSRB 2NW2B 3RNQB 4Z0BL 2WM0A 4WV1B 4DKDC 1W0YT 5BRZE 2NLJA 2WIIB 4KC3B 2OTPA 2BNQE 3MOBL 5AAMA 4OT1L 1A3LL 3GEWB 3BN3B 1A6ZB 3RVTC 1YEGL 4JPIB 3OJVC 4OZHB 3MCKA 5ERWB 3D5OF 4NOBA 2BVYA 5DVNA 5I17A 4M4PA 4ELKB 5KVMC 3SGJA 2IALB 3MRLA 4GSDL 1RK0B 4Y5YA 2FEDC 4M7ZC 4JKKA 4PJXA 5J12C 1DP0A 3WS3A 5T5NF 4FQQB 4R7DA 2YD6A 4OIBA 4Y4HB 4WFEE 4WUKL 2CJUL 2QR0A 4GRWE 4PJHA 5I1LA 3KS0H 2MQCA 3KNBA 2B4CL 1IZKA 1T04A 4N8PA 1EHXA 2D0GA 12E8L 4YIQB 3DWTA 3B3IB 3FOMA 1G6VK 5GS2D 2DL9A 3DIFA 2YA2A 4MJID 3H9SB 3C08L 4YPGA 3V6ZA 4J6RH 2PXYC 4OZFH 5ESVB 3QIUC 2R2BA 2J4WH 1TJGL 3QIBC 4W4NA 3DXAA 2YMXH 3OMZA 2UYLB 5KVGL 4YO0B 2VO5A 2ARJA 4JRXB 3RL1A 4KUZL 5GJTL 4NO5A 5E8NB 1WSST 1NKOA 2DICA 3WSQL 1KCVL 1QPPA 3BP6B 3WNOA 5E94B 3WMSA 5IFAL 4LCYA 5L8JB 1F3RB 5JOFA 1CGXA 1DZBA 3AY4A 4XP6L 3ROOA 6FABH 1B2WL 5FHAH 5DJ8A 4R7NB 3B2VL 1SEBA 4P9ML 5BO1H 4HDIA 4KU1A 2C4XA 2F53A 1JWUA 3WIFB 2HJFB 2H6PA 5D5MA 4PGEA 3LV3A 1MHPH 4JQXA 5I2IB 3L5WA 1KNOB 4LFHD 3VFTB 3EAKA 3JV4A 4FFYH 5AAWA 2HMID 3MCG1 5E24E 1MCHA 3ZKQD 4M48H 1PSKH 4NQCD 2FGZA 5C0AE 2IPKA 4YDJA 1DLFH 3U0TB 4HV8B 3UTTA 1QHOA 4FTVD 3UBXA 3HPLB 3GSWA 4AL8L 3FFDB 5JO5A 1OM3H 1IFHL 2OMNA 1X5ZA 3MXVL 3FQXA 5INDA 5F1NB 1FJ1B 2CQVA 5K9QI 3MV8A 4X0KB 4P9HL 1MJJB 3P9LB 4G80A 1AHWA 3SQBA 1WFNA 5T5NG 2NNAA 5HHQA 3LN5A 1X5GA 4MSWA 4WI4A 3U0WH 5F1SA 4AENA 5E6YA 4M4RA 3BXNA 1MAKA 3E0GA 4UAOC 4OLVH 5B38A 1IGTB 5A2KH 1UWEH 3Q3GA 4A6YH 4FFWD 1PDKA 5HHNB 1U8LA 3B9EA 4YNYA 3K7UA 3MLRL 3VWJA 3TH3T 5EU7C 2CRMA 1A7QL 1DQML 4MJ5A 2XA8L 3VXSB 4DZ8B 5CIPB 1LE9B 2CXKA 2R4RL 5K9JH 1OAYL 1I8KA 5F7LB 2VZTA 4UTAL 3WBDA 4FZEH 5ACLA 3OKKB 2OI9C 2I9TB 1KXTB 4HT1H 4HLJA 3QDJE 1L4IA 3W2DH 4HUUB 3PF2A 2HMIC 4GKNA 3O4OC 2J6EH 4IRJA 4HIJB 2YN3A 5KBNC 3BHBB 1MCWW 1AC6A 4P57A 4AH2B 4S11A 4OCYH 3ZHLA 4PB9H 1KB5H 3C8KA 4Z7VB 4YQXL 1CZ8H 4OV5A 1SVCP 2ZOKB 3KLDA 1YEIH 2XY1A 5E95B 2Y5TB 2YSSB 1FFOB 5CFHA 4WW1B 2VJXA 4G8GA 2NY3D 5AYUH 2PYEB 4LKCA 5D7SL 3BWAA 3O6MH 5H35B 4M9PA 3G6JA 1MFDH 4NQXB 3KS0J 2JB6A 1JGLH 3PHOA 4X4MA 1QOKA 3H0TA 1AGCA 3NN8A 5LGJA 4KKLD 2HLAB 4XH2B 1IEAA 4BELD 3EOAA 1UCTA 1D9KD 2PW1B 2VXSH 2IQ9H 4OIAA 1NC4B 5CD5C 4JFEB 4NRXA 4L3EB 1ZGLP 2FSEA 1UM5H 2MJWA 2X4TB 3ZKND 2XZZA 4F7MA 4WTZA 3B9VA 5MERA 4K9EL 5MEND 5FCUL 4G8FB 5LKNA 2VLKA 4RQQB 3C6LA 3O81A 4FS0A 3RVXD 4LPCA 3EO9H 5DHYA 3JTTA 3F7YB 5EBMB 4E5XA 8FABB 2NYYD 4ONGL 5DJCA 3F12B 3GK8L 4NO0D 4C83B 5J1AA 4CU6A 3KYKH 1DSFH 4JRYE 3TO4D 1CD8A 1BGXH 3SE8L 4LK4A 3V4PL 3T2OA 1TZIB 1KB9J 3IXAB 1QYGL 2Q3ZA 1TVHB 1JTTA 3QJFA 4PV8A 3PHSA 1BHGA 2IH1A 3OGCA 2IBZY 2E8ZA 3RDTA 2LTQB 3TA3A 2VQUA 1SY6A 4R90L 1D5IL 3BJ91 4PJ5B 1RHHB 1F4HA 3VXUA 1DDHA 4PLNC 5IWLC 4TRPH 5F96H 4KKLC 2CRYA 1J0ZA 1FL6B 5CINH 3FN0H 3JWNC 1QEWB 4QHKJ 3H7LA 5E56A 1FO0B 3ZKNC 3ARRA 5E7FA 4PTTB 4HKXA 4IMLB 3FQUA 2X1PA 4NJ9L 4LP4A 1NEZB 4AEHH 3DSFL 2Z4QA 3VXMB 1EFXA 3BIBX 1MFNA 3CFDA 3MREA 5HYQA 1RUPH 4P59H 4X83A 3LZFH 4O2CA 3RX7A 2HAZA 3RVXC 2A2QT 1PJ9A 2M2DA 3RJQB 1KCSH 2P1YA 4ZOCA 2NYYC 1JGUL 3P11H 4GAYA 1T4KA 1KEML 1A6VL 2Q8AH 3QHFL 5C08A 3QUML 1U9KA 4OD2A 3RNKA 1G7IB 1IE5A 1YDPB 3TO4C 1BQUA 1AY1L 4LSPL 1S5IL 1QSFA 2DJSA 2W92A 4MD4B 3S6CA 1S8DB 3CZFA 4JO1H 3AGVA 2EC9U 5C07E 1DE4A 1G9NL 5C0GA 4N0UA 5HPMA 3C9NA 2ICEA 4QXUL 2O5ZL 3MGOB 1MCQA 2NR6D 4LMQI 2C4FT 2ESVD 1OT2A 3KYOA 3HUJB 4QOKD 5EPMB 3MLWH 4IOIB 3LB6D 3EW3B 2AEPH 5DHVA 5HD8D 2DLIA 1OP3K 1JWSB 1TTFA 2BVOB 2NY5H 2Z91B 1H8NA 1OAUL 1IAKB 2QBWA 5L2KB 5MEPB 1KC5H 5FF6B 2VSCA 4TSCH 5E2UL 2YBRA 2XWTA 2E7CA 1H15A 5HDOA 3QUZB 4LLUB 4F2MA 3PGFL 4U3XA 2VXTH 2A73B 4PRID 4Y2OA 4KGLA 1XCTA 3OAUL 1YEJL 4OB5H 1N3NA 4NN5C 3TT1H 3ARSA 1G0YR 3G04A 4O58H 4QXTB 2DKMA 4WCYH 3IDNA 1MY7A 4KKAD 2GJ6E 3MRGB 4BA8A 5IT2H 3FO9A 4F8TA 2ERJB 3Q2CA 1T3FB 4ODHH 5HJ3B 4OZGA 5GGQH 5LGHL 5F9AC 4MWFA 3QULA 2WWKO 5GXBB 1QO3A 3V6OC 1N7MH 4XBGB 3RVUD 1MJUL 2EKSB 4ODTH 1HYRC 4JVUA 5E1HB 1JTOA 4S0SD 1BVLB 4M1CD 3C5ZA 1WC7B 4N1HB 4HH8A 5C86A 4LEXH 1PEZA 5IEHA 1U3JA 3GB7B 1ADQL 4MAYB 3WD5L 5EO0B 2VDLL 3THMH 2DQGL 3G9AB 3VXRE 1HZHH 4HJJH 2FX7L 2XV6B 4HJ0D 2NR6C 3MLUL 3BUYA 1R3HA 2ZWLT 5B39B 4MYWB 3SOBH 3LB6C 3P0GB 5EU5B 4LNRA 2ZPKL 3OAZK 5DC4B 5HD8C 5ECJE 2XWJB 3MRIB 4Z0BH 5A16B 2D3VA 1OPGH 3MOBH 1IRAY 3KXFD 2X4NB 3VW3L 1A3LH 1SM3H 5CMAB 3UZEA 2F74A 1YNTB 5DFWH 3UO1L 5IF0B 3SE3C 2Q7NA 5F1OB 3IJYA 1QKZH 2AJ3A 3GMQA 1ORSB 1YEGH 1KSRA 1FNEB 3QWRA 3QO0A 4Y16B 5I8CA 1EJ6A 4LLYA 4BFIB 1YY8B 3C5JA 1OAZL 2WBJD 4JZOB 1U8QA 5BZDB 4D8PA 2F54A 4KKAC 1X9QA 2XACC 2A6IB 5IB1A 3WIHH 4UIMB 4EEEA 3EGSA 2AV1B 3ARBB 1OQXA 2K1MA 1CBVL 4WUKH 4MNQA 4RFEA 4PGJA 1X6NA 1HN1A 3U7WH 2YA0A 3REWA 4XNZB 3RVUC 1G7QA 1U3HA 4LCWD 1WIPA 2B4CH 4U7MA 4NKDA 3CMGA 4XCNB 12E8H 4M1CC 4KDTA 4Y5XC 4C59B 2FATL 2EDBA 3QEQA 2C1PB 3DX8B 5DVMA 5B4MD 3BQUA 3RX5A 5ALCL 5IM7A 5GRXG 4I18C 3QCVH 2WV3A 3FO1A 3GFUA 4RAUA 3WS6A 1TJGH 5CJBA 3QQ3B 5DC9B 1INQB 1CXLA 3D18B 3GRWL 4HJ0C 2ICCA 2J7LA 4KUZH 1JP5A 5F71A 5GJTH 3WUWB 1INEH 3IJSB 3WSQH 4C56A 2BCKA 1KIRA 3PL6D 1BQSA 4M5YH 5FGBC 2Z93B 1I9RH 5C6WH 2DYPA 1IT9L 1KTRL 5HHOB 4X7EC 4XP6H 4G3YL 1XR9A 4X6CA 3PV6A 2ITCA 2YA1A 2XIDA 5BCAA 1ZEAL 5D7LA 5FV2A 4U6YB 3CFBB 3RU8L 4Z7WB 3LCYA 1EUTA 2WBJC 3V4UH 1T6WA 4ODVL 1P6FA 5F7WC 3IDJB 2DLFH 5FHBL 2V2XA 2XQYK 1RIUL 2JJVA 2B2XH 2PN5A 5I1AB 3S96B 4QHUA 5CP3H 3KPSE 5D7KE 1WV7T 1OWWA 4NNXB 3FQTA 1PBYA 4MJIE 3PABA 4DGYH 1CE6B 3DROA 4PRPA 3QHZH 1K8DA 2R0KH 3QHTC 4RWHA 1PX4A 4YUEL 4X9GA 4PJCF 4QRPE 5HDQL 4OUUA 4R9HA 5B4MC 2ADIB 1IFHH 3VJ6A 3EDDA 4F7PB 4D9QE 2V7NA 3QIWA 1G7HA 4P2OD 5GSRB 5F1IB 1NJ9B 1R5VA 1CYGA 4PJFA 1EO7A 1MCBA 3TCLB 5IW1B 3TBYB 4H0IA 5CJXA 3PL6C 3B9KD 1NFIA 3K3QA 3SDYH 3SDCD 3IF1B 1BMGA 4LPYA 3PWLB 2BHZA 2YD7A 4UB0L 4UILL 4WWKD 1UH4A 1IAIM 4IRSB 4UNUA 1G7JB 2ICWB 2LAGB 1LP9A 4Q97A 4FQJH 2OTUA 1XH3A 4HFWA 4PY8J 2BC4B 1U8KA 2DTML 4NQCE 2KKQA 4WO4C 4C55A 3O41B 1AGEA 2P5WA 1KJMA 4Q6IB 2W0PA 5C8JB 4U0RC 5C92A 4FTVE 4YGVB 1F58L 4HAGA 2Z8VC 4NRYA 4PJ8A 5GRUL 5FKPA 2HFEB 3QJHA 4Y1AB 2WLZA 35C8L 3UPAA 3O8XD 1J1PL 2AABH 2YC1A 5IW6B 2G2RA 4MA8H 2OL3A 4YQXH 3FB7A 1YEKL 2P8PA 1XT5A 2YEZA 4KI5E 3EFDH 4LF3A 3D9AL 3HMXL 1CFNB 3MUZ1 1BLNB 4L1DA 5GS2H 5C0CD 3SJVA 3RUGA 2A0LD 4Z95L 4U6HA 4ODXB 4P2OC 4P2RA 1KJVA 2VDMH 1DVFD 1TFHA 1IGML 1GGBL 1PW3A 1WZMA 1ZA6A 2X4SA 1WZ1L 1MFEH 5TH2A 4PJCE 1UACH 3KPOA 4FQXA 4FFZL 3S4SA 3VWKB 3SDAD 4LVOB 4J7RA 1B9ZA 1E4WL 4XCYB 4KK5D 4CAGA 4DGVL 3B9KC 1IARB 4RISL 4U1LB 3QXUA 3SDCC 3C2AL 3DGCR 4TYUA 3FFCB 3MJ9H 3FRPA 2FGWL 5ISZA 4PJAB 3CDCA 3ALXA 3LPWA 5BQ7A 1UQSA 4LPVA 2V2WB 3VH8A 5JW5B 1AXIB 1FG2B 5IJKC 4NHCL 3EUUA 5J6GB 4WI8A 1JIBA 4O2FA 4FQLL 4NC0B 2L7UA 1UYWH 1T20B 4ONGH 3BPNB 3MRCB 2Y7QA 5E8EB 2OX5A 3X12B 4DN3L 3ARFD 5IFHH 3JWOC 1NGWA 3O2WL 4ETYA 3KPPA 3O8XC 4UNVA 1QLRB 2BOBA 2FLBT 4YX2L 2GTZB 1QYGH 3VRJA 2LAAA 3ME0A 4UZGA 4X6EA 3ARPA 4JKMA 1GGUA 3HE7A 5C0FA 1MWAH 4XVTL 2F9BT 2A0LC 4QRSB 3HNSL 1V7NL 2BMKB 3ZSSA 1B0GB 1QRND 3DUSA 4RIRA 1DVFC 4R90H 2IAMA 1M71B 3LMJL 4K3EL 4NYLA 3D39D 1DUZA 2OP4H 3SKOB 3BDBA 1K4DA 3KPLB 5D72H 4ZAKB 3SDAC 2WWMD 3TBWB 4KK5C 3BVNA 4G6KL 2HJKB 3ULUL 3VFPA 4I77L 1XF4B 5I73C 5ELIA 1BJ1H 1ETZA 5ACMA 4MXQC 1WK0A 1MFCL 4QXWA 4UU9B 3ALPA 4QHLA 5JPNA 5K9OB 5D9SB 3MLVH 2W60A 2Q8BL 1J5OL 4HD9A 3O9WB 3D0VA 3UJIH 1G1YA 1G6RA 3ET9F 3UDWA 3M17B 5AD0B 3FO2A 4JFFE 1CICB 1E4KA 1GIGL 2XY2A 3NPSB 1KCUH 1KEMH 1V3MA 3Q1SH 3QHFH 1PG7L 3HZYA 3QUMH 3EO1B 4ISVB 1QFHA 3KPNB 3ARFC 1A1NB 1S5IH 4JY6B 3H9HB 3RWEB 4L3CB 5EH1A 4D0CB 1OTUD 2KQNA 1R5WB 1OAQL 4QXUH 3QXAB 1YEEL 2E7HA 2J8OA 1BECA 3N9GL 1OSPH 3QNXA 5IK3A 3IETA 4NQEB 2HA1A 4JN2A 4AG4L 4B50A 3JXAA 3BRFA 4LLWA 2BXYA 4RBPK 5IQ9B 3QRGL 5SWQA 5IQ7L 4N8VA 1SYVB 1WUNT 2HFFB 3G6AA 4JM2F 3VMNA 2FHBA 4WU7A 5IBLD 4JFQA 3FB6B 4MCZB 5DYOB 5IHZA 1C5CL 3GMOA 2R0WH 3PGFH 3P30H 3U4BL 5C0RH 4WW2F 3BSZL 4XPAL 4L5FL 2D9QB 2F5BL 1E6JL 3HC0B 4UQ2A 2UWEA 5JMRA 5IVOA 4HC1L 3TLRA 3MRMB 1ZTXL 2DM4A 4XVJL 1CGTA 4ZO9A 4MA7L 2V2TA 3AB0C 4Z7QF 5C0IA 1S7SA 4Y4HD 2ZUQB 1OGTB 2VZOA 2XXMB 1NCWL 1ZOXA 2GSGB 3CFEB 5M7QA 5C3TA 4YBLC 3C5SB 3B5TA 1FRGH 4HIHA 4QOKE 3T1FA 1OTUC 3W5MA 1ZSDA 5JW3H 1LO5A 3BYTA 3EYOA 5IBTH 1U8OA 4ZPVA 2FX7H 4X6DA 3H9SD 4XNMB 1GC1L 4XCCL 2CDEB 4EN3B 1MCIA 4APQA 5HY9B 1VDGA 3CH1A 4CUCA 2NY7L 7CGTA 1T83C 3VI4F 1Q72L 1J87A 4IHOB 2EDYA 4ZFOA 1BVZA 4LSQL 4E42B 4HCRH 4JRXD 4ZTOH 5DUBB 4WGVB 3IAGC 1Y6NR 5IBLC 3TV3H 1NUDA 3VFSB 3MRJB 4N0RA 4ZODA 1IC4H 3O6KL 2BY3A 4WFHE 4KY1L 4U6XA 4WV1C 5C0ND 1T1ZB 3ECBB 2Z31A 5E8OB 4CW1A 2ARJQ 1CDUA 1OAZH 3HI1A 5D1ZD 5ICXA 1Z5LB 1WBYA 2E5EA 4FABH 1J8HA 3NCBB 4HK3N 4XP4H 1NL0L 2AJYL 2I60L 4XZUA 2R9HD 5JQ6H 3X3FL 2M8XA 2AJVH 1X5FA 1EIBA 3HZMA 2PUQT 3HR5B 4ZNEE 1BF2A 1EHNA 4NBZB 1PKQA 3GSVA 1IAOB 2XRAH 4JPWH 4MQ7B 3MCKB 1E4XI 1KPUA 4Y4HC 5I17B 1ZMYA 3MYZA 5TQ0L 4M3JA 5H2BA 1NANI 2HVKB 5EULV 1PFCA 3SKUD 3K8KA 4DZBA 5KAQG 3WKML 1TJHL 5EUKB 4ZPTA 1HEZA 4M6NL 2EDKA 1JF6A 4R7DB 3RGHA 3TWCH 2MPAL 3DBXA 1FAIL 2BERA 1Z9OA 4Z7QE 1OP3H 3GRWH 3KXFE 5FECB 3KNBB 3W39B 4AEFA 2W07A 2O5XH 3O0RL 2EECA 1SYSA 1EEYB 3Q5OA 5DEFB 4YFEA 4UV7H 3DIFB 2X7LB 2P47B 4OFDA 3V6ZB 1IT9H 4Z8FL 4MA1B 5A3ID 1EHAA 3L3OB 1Z2KA 5C0NC 1ZEAH 1KTKE 3RL1B 4N8CH 1H0DB 1YMHA 3CK0L 3UJJL 1D5ZA 3VI4E 3EYUH 2D7NA 4NGHH 2D7MA 4H25B 4KFZC 4ODVH 3HC4H 2P43B 1L0QA 3KWWA 4LCWE 2B0SL 4LGPB 2MFNA 3QT2A 5FHBH 3HZVA 5F3HB 4Q74A 1N6UA 1FVEB 2IANB 2AXHA 2R9HC 2YR3A 4MA3A 2A83B 1BX2B 5ICYA 5GRWA 1C12A 4FNLH 5CEYB 5DJ8B 4ZS7L 4LARL 1U2HA 4Q7DA 4FQCH 1SEBB 5HVWA 1CTNA 1FNSL 2F53B 3T2NL 5CZVL 2GK0A 4F58H 4YUEH 5HDQH 3L5XL 2H6PB 3L9RA 5D5MB 4PGEB 3LV3B 2H32H 4B41A 2BVEA 1PKOA 4WNQB 1MF2L 3MRRA 3WCYA 5FUZL 3O6LL 2EZ0D 4K55A 1YJDL 4W81A 3OAZH 3O6FB 5C71A 5JXAL 1IGCH 5KSBB 4KXZH 4X7TB 1MCJA 2NY6B 4YHLL 5GRVL 2PYED 4JG0L 1B0RA 1XGTB 2VISA 3GMMB 3D85B 4ZUTA 5FYLL 4OLUL 1FCGA 5CEXB 5HHMB 1SVZA 3B5GA 3FONA 4OCSL 5INDB 1FE8L 4I2XE 2XQYG 1Z3GH 5DQJB 2FL5A 3MV8B 4UB0H 5A3IC 5GGVY 4G80B 1AHWB 2NNAB 5HHQB 1RJLA 2VKWA 3CSGA 4JFED 1QR1A 4L3ED 1AP2A 1IQDA 3WDIA 4P23B 3D3VA 4LU5L 3RGVD 3A67H 3BXNB 3QEUB 2GCYB 3NCFB 4E41A 1CGUA 2W0FA 4QRUA 5B38B 4QYOB 1N0LA 5KS9A 2OJZL 3Q3GB 5GRJH 3FOLB 3BZDA 2EE2A 3VCLA 3VWJB 1F58H 1JN6A 2HT4D 5A40E 1QFPA 5HHXL 2CK0L 4X9FA 4MJ5B 5C09E 5GRUH 1XF5A 5EC2B 35C8H 5DWUL 5I8OH 1I8KB 2HN7A 1NQBA 3LKSA 1YEKH 2BFVL 4KHXL 3R0NA 5LAXB 2EXYD 3FB8B 1RURH 3O3AA 4YWGH 3C60B 3MBXL 1CGSL 2BSRA 4X7SH 4PV9A 2ID5A 4TNWK 2EZ0C 2Q7YA 3WE6A 4IRJB 3ULUE 5F9OL 4PJIB 1B6UA 1YPZF 1IGMH 4P57B 4AM0A 3SDXF 3AFLA 1I3GL 3MGTA 3MLYL 1A3QA 5CHNA 5GIRA 2IEPA 2Y72A 4OV5B 1ZT7A 5CP7A 1YN7A 5DI8A 3OXSB 5E08H 1E4WH 5J11B 4DGVH 1U8HB 4PJ5D 4KH2A 2CKNA 4RISH 3DI2B 3C2AH 3HNVH 5IMKA 1OGAA 3B6SB 3MRHB 1MELA 1BOGB 1U8NB 4CRPA 3G6JB 3F7VB 2JB6B 3HG1E 4OCRL 3MBEB 1T89A 3DURA 3SDDB 1S9VA 3H0TB 4FQ1L 3PWPB 4OGAD 2MCG1 5KJRL 3LKQB 1GOHA 5LGJB 1I7TA 3QFJE 5HYJB 2N56A 5ILTL 2ZUTA 3ARUA 4FQLH 3VXMD 3V7AE 5EN2A 4W6XB 4MQSB 1C8PA 1LK2A 4NRXB 1BBDH 1P69B 2CLVB 4OKVA 2WUBL 1AFVL 4YBQC 1N6QL 3OKOB 4DN3H 5C0CE 5IKCA 1WBZB 4CN6A 2Y36L 4M6ML 1JHTB 3KYMB 3ILPB 5CBEA 4CN4A 5L0QB 1IAIL 4KRNA 1FV1A 2EXYC 2X10A 3W11D 1UCBL 3KR3L 4ZSOB 1MCCA 4E5XB 2X70B 4ZTPH 3P4LA 5J1AB 2CGRL 4M8VA 4LHUA 4RSVA 1W2KT 1T1WA 1M4KA 2JB5H 3I6LD 4N5ED 2JJWA 4O02L 3U30B 3ZYIA 2CUIA 5J13B 4AIZB 3RWDA 4R6UA 2LTQC 3LKRA 4X6BB 1OTTD 3O2VL 3RI5K 4W68A 3KPRB 3V7MA 4XI5C 4G6KH 4PGBB 4AEEA 3SGEI 3EKCA 1I1CA 3J8F7 3NA4A 1HXYB 3MV7A 3ES6B 2XQBH 4H20L 5L2KD 5DMKA 3TA3B 1YPZE 3DXAE 4BKLB 3SDXE 1MFCH 4M7JH 4S1RH 1K9TA 4FQIL 3W0WA 5HYSA 4GH7B 4HWZA 4L4VB 5I16A 3QUZD 1J5OH 5GGRY 1JK8A 4OGAC 5FGSA 3X3GH 5HGDA 3MUY1 1VEPA 4O2EA 3FRUA 4Z7UA 3I50H 3B83A 4DGIL 2PCPA 4HKXB 1PG7H 4MDIA 2PO6B 2HWZL 3MRQB 4HG4J 4S0TD 3LRHA 4KVNL 3GBLA 2DQHL 3ARDB 1I1AA 3UPRA 3D39E 1NGXA 1YEEH 3GO1H 3VE0A 3VRIB 4OZHF 4PJ7F 2WUCL 4GAYB 1NCBL 4BZ2H 3AROA 3N9GH 4G8IA 1L9NA 1HH6B 1ORQA 5EU6B 3RNKB 4AG4H 2J8UA 3QRGH 2CMRL 2AS5M 4N5EC 2J5LB 1BFVL 3IDIB 1RZFH 2VZ1A 2ZSVB 4XWOD 1U8JB 1YC7A 3UCRA 1QSVA 1N0XH 1DE4B 1TCRA 4UOW0 5C0GB 4N0UB 1WIOA 2ICEB 3C9NB 3GKWL 4RGMB 3PDOB 5I1JL 2VQ1B 5D71H 1RUAL 4NZUL 3WXVL 4E0RA 2B8OT 2Z9TA 4WJ5B 3U4BH 2MMXA 3NIDF 5HHVL 4DKAA 4JQIL 2HT3D 4R4ND 5ANMB 4AZ8A 3BSZH 3HI6L 1MNUL 5CSZA 1UT9A 1FORH 3QUZC 5IB3B 1KJ2A 1Z0NA 4Y16D 5GS0D 1Q0YL 3CDGB 4HPOL 3EYVB 2YBRB 4XVJH 1EZVY 3BAEL 2BOCB 1V5JA 3HC3L 4F2MB 3RWCB 1AD0A 1BZ7B 3NFSH 2ERJC 3ARBD 1IGJB 1KXQE 1N3NB 1NCWH 5E2VL 3G04B 3MRNB 3RFZC 1BBJA 3TNNA 3FO9B 1SBBA 3DRQA 5T3XD 1G9ML 1QO3B 1HXMA 5IEKA 4H88L 4PJBA 2VB5A 2WANA 4MAYC 5E70A 5F9JA 3C5ZB 3U2SA 4F7EB 1Q72H 2VUOA 1TMCB 2FJFB 4LSQH 4XWOC 2A38A 1JCKA 4UDTA 4LAQL 5I8EA 1MH5A 5IEHB 4KMLB 1TZGL 1ZGLA 4F7CB 4WUUE 3CFCL 4RNRA 2C3HA 1RJYB 3P4NA 5KSAA 1IVLA 4LASH 2A9MH 2BJMH 4OZHE 4PJ7E 1LWRA 1V7MH 4PJ9B 4PRDA 1MRCL 4DN4L 5KG9A 3PWNB 4G8GE 3BUYB 1R3HB 5HHOD 4L9LB 3DHJA 1E28B 1F4YL 4S1DD 1VB9A 4R4NC 2HT3C 4Y19A 1L6XA 4RA3A 3EOTH 2A77L 2IQAB 3HAEA 2JIXB 3V5DA 2I60H 4POZD 3FJTA 4Y16C 5FO8A 2R69H 1RFDL 5DGQA 4JKWA 3UAJD 1BWWA 1UZ8B 3WFDH 4CVXA 4DVRH 1ZT1B 5HI4D 3RA7H 2JE8A 4EIZC 4JFZL 2GITB 3QO0B 4S2SA 4UDUB 1QFWH 2EYSA 3NIDE 5GGTH 3S5LB 5F7UA 3ARBC 3S36H 5J1TC 2B5IB 3K46A 1UJTA 1CL7L 3WLWD 4OLYL 3WFEL 2QQLH 4XNZC 4L8SA 3RWGA 1TJHH 5FYLE 4M6NH 5CSGA 5TF1L 1CVSC 3RRQA 4ETQA 3QXDB 3MV01 1ZHKA 1FAIH 4HKBB 5JHDA 4G8EA 4OZIB 4JRXE 4RBPH 4RFEB 3BKJL 5FDWB 1HKFA 1W72B 4F9PA 1KV3A 3VD3A 4NKDB 2DMKA 3O0RH 5DT1H 3BMWA 5TDNB 1UA6L 1DUYA 1HHIB 4MCYA 2VDOL 5IMLA 3AMLA 2A9NH 4HK0A 3FO1B 5I18H 3U6RA 1XZ0B 3TIDA 2IPTH 3ILQD 4KKCD 4Z7VF 3CK0H 4RWYL 3UJJH 3MLPA 2OL3L 2YPLA 4IRSD 4UTBH 1RI8A 2JELH 4MB4A 1MHEA 4AEIH 1ZANL 1J05A 2B0SH 3JV6A 3VXUE 2HTLD 5CEZD 4POZC 4K7FB 4EI5A 5IHUH 2DF3A 1XR9B 3REVA 5GS0L 4OZGF 4HEME 3UAJC 2ITCB 4Q6YA 1JPSL 4DTGL 5D7LB 1FNSH 2VLMD 5I19L 2DI8A 5EZOL 4LQFL 3NGBB 5BVJA 3WLWC 4ZO8A 1N5AA 4Y1AD 1ES0A 1ROWA 2DRUA 3ZHDA 3STLA 4Y2DB 5D7IA 3HKFA 4QHUB 3RTQB 5FUZH 2ITDA 2F8OA 3L3IA 1A3RL 1ZVSA 4H0GA 5ACZB 1OSZB 3OPZL 1VACA 3LHPL 3PE9A 5C08E 3M8OL 4YDKH 5JHLL 5A2IH 4R4BB 3FHAA 4J3UA 2WAHA 4XX1G 4KTDL 5DK3A 4XGZA 1OY3B 3JBG7 1J0IA 1N8ZB 3GHEH 3QIWB 4MZ3A 1CFSA 3VGHA 4EXPX 2LVCA 4IMKA 1FYTB 1WWBX 4IIQA 3DTXB 2ZUVA 1IJ9A 3FFCD 3ILQC 4KKCC 2FO1A 4HIEB 4I0PA 1MCRA 3VG9B 1GXEA 4YR6B 4LU5H 2CPCA 1J86A 4EDXA 1NMBL 4IRSC 4RAHA 5B3JE 1R3IL 2FWOA 4XMPL 1EO5A 5EUOB 3SCMB 5D96B 5EOCL 1ZLSH 5J06A 5BVPH 3LKPA 4KZDL 2XICA 1J7VR 5ADPH 5HHXH 1U8PB 1UADC 4U1SA 5T3ZL 4Z7VE 4Q6IC 3PGCA 1LP9B 2V17L 1NBVL 3IB4A 2BFVH 2F15A 4KHXH 1U8KB 3UTPE 3AS3A 4NQTA 1T66D 4W4OC 3Q5YA 3PWJB 5B22A 2WW8A 4YAQB 5DR5L 2P5WB 4BH7B 2PYEE 2QQKH 4AQOA 5LWYH 2D0HA 1BFTA 1KBGH 1RIVL 1TNMA 3DYMA 4O9HH 1FP5A 4OZGE 4XHQA 1JV5A 5F9OH 1WCBB 3EDFA 2EYRA 2R1XA 3DUHA 5FKPB 1I3GH 2C9AA 2PW2B 2R0ZL 3IT8D 3MLYH 1FFRA 4GG6A 4GMSH 5IR1A 3QSKB 2NTFB 3WEXA 1G6RL 4ZUSA 1NCAL 5TDOB 4ALAH 4U6HB 3SKMA 1LMKA 3WO4B 1A6WL 2EDRA 4K23H 2ARWA 5KTEL 3VWKC 5C0DA 4LVOC 4ZAKD 1QLFA 1UM6L 4P2RB 5D8JH 1F2QA 4HULB 1S7QB 1VHPA 1ZA6B 2ENYA 4Z77B 1ZGLM 1UWGH 1NMAH 1QVOA 5DSCA 5I1EH 5ILTH 1CU4L 1DEEA 5FXCH 5ESQB 5J6HA 1EDQA 1U91A 1QUNA 5CIPH 1ODAA 5DD6A 3O9WD 5CEZL 3HUJF 3BRGC 4WI6A 4QRRB 1N6QH 5DLMH 1A7OL 3G5VB 5D93B 2D7OA 3K4DA 5BQ7B 1UQSB 3KJ6L 5A2JH 1CICD 3BPNC 2Y36H 3BPOB 3VH8B 4JCMA 1TENA 3L95A 2IBGA 1MHCA 2A6JA 1LD9A 4YXLL 2NX5B 1DBAL 3S98A 1UCBH 4F57L 1KIPA 4M62L 3PWVA 2OR9L 2DJ4A 2RGSA 4OZFA 4KJYA 5EZIH 3OXRA 2CGRH 2IFFL 4LEOB 5GSVA 1U92B 2YUZA 1K4CA 2Z8RA 2ZCHL 3QUKA 1OF2B 4N0FB 5HI3D 5GS3A 1O7VA 4PJFF 2BNRA 3T0XA 1LO3L 5GZOD 1T6VN 4U3CA 3WIIL 4JN1H 5DA0B 5F6IB 4XHJD 2Z8WC 1G0DA 4J23A 3S3PA 5AWNH 4H20H 2CK2A 3DUSB 4FQPA 3UTSA 4ZAKC 2JJSA 3IFOB 5DJ2A 2XG5A 3TVMA 3VI3F 4FQIH 1EVUA 5C0BA 5TQ2L 1O0VA 4NYLB 1DUZB 4DOHE 4NZTH 4XBEL 4FQHA 4M1GH 5BRZA 4C56E 1P4IL 4DWHA 3KJ4B 2BNQA 4HUVA 1M7XA 4Q9CA 3O9WC 1FL3B 5GHWL 4Y5VB 1AD9B 1RZIB 5SX4H 5I1DA 2MHAA 1IL1A 4CDGC 2HWZH 1CICC 1JFQH 5CGYD 1A2YA 1P9MC 3NPSC 2VWEE 3BD3A 3GSXA 3C6SB 4KVNH 3ABZA 3B8YA 3O4LB 2IPUK 1S7UA 2Y6SD 3BO8A 5FA4B 3LY6A 3FO2B 1YYML 2Z35B 4BQ6A 1DFBL 3FQNB 1AXTH 1I3RA 4GKSA 3B5HA 1JGEB 5LCVH 1JNLH 3UYRH 3SKJL 2N1KA 1I8IA 5KN5B 1CDCA 2A6KB 2IJ0C 1S7XA 2UZIL 4PRPE 4V1DA 1S7TB 4R26H 2H26B 5HI3C 1CFBA 4EN3D 4CBPA 1CT8A 5D7JB 4YHPB 2X89D 2N7BA 3GKWH 4LSRL 4U1IA 4XHJC 5TPWL 4A6YA 1DQDL 2FH8A 3LN9A 2UUDK 1KEGL 4XCFL 2YOCA 4JQIH 3U7YH 1OB1A 3GJFB 3HI6H 4CVUA 1MNUH 4JM4L 1RUQH 5SWQB 3MUJA 2HKHL 2IG2L 1IQWL 3L3KB 4JPVH 4PJFE 3O2DH 5F44A 1XGUB 1Q0YH 5CWSA 3D69A 1FO0H 5F8RC 3GMOB 3QDMB 4MX7A 3VGEA 3O11A 3CX2A 4YHZL 4IJ3C 4KUCD 2J6EA 4JZJA 3VI3E 2AI0H 4AIOA 2AKRA 4YH6A 5C0JA 2VR9A 5CGYC 2UWEB 3GI9H 5IHLB 1KB5A 4X5WB 2ZUQC 2Y6SC 4LHQB 5JORB 2IADA 2YPKA 3P73B 1MQKH 1I8LC 1RZJC 3I2CL 4HGWA 4NJAL 4JFOB 3SKNB 5E2WH 4Z7WF 1S7SB 5EC1A 5C0AA 4KTYA 4BQ9A 3T0EA 5KZCB 1NUNB 4YDVA 5B39G 4XNYL 2GI7A 2FZ3A 2C3WA 4HIHB 3K0WA 4LAQH 3OKNB 4XCEB 4DJMA 4EN3C 4WENB 3CFCH 4HWNA 4MNHA 2X09A 5DRXA 2V5RA 4I8DA 3UTZB 4ZPVB 4KROB 3SJVE 3OKYA 3VMPA 2YD1A 1TETH 4DN4H 3WO3B 3MRDB 2QHLA 3F62A 4LLDA 3WLBB 4QGTA 4PRNB 2FEEI 3PGDA 4HIXH 2EH8L 3H7BB 4KJWD 2WP3T 4TTGA 3QDHA 4XPGL 1YN6B 1JJUA 5BW7C 1J0HA 4YPJA 1RFDH 4G6ML 2HTKD 2XNAA 4X8XA 1BM3H 4PUBL 1QSEA 5E5RB 2Y07L 1JGDB 3N1GC 5EG6C 2A1WH 2IAND 4JFZH 4MJ2A 4KPHL 4YGAB 4EZMA 5DRZB 2DWDA 3ROLA 1CL7H 1L0YA 1DBKH 1J8HB 1KCRH 3OKLA 5C9JB 4XC3L 4JKLA 3QDJA 4P5KA 3SGJC 4RX4D 1HHGB 2BSSA 1FN4A 3BKJH 1RZJL 4Y88A 1KPRA 1KPUB 4R2GB 4UIKL 2Y25A 3G9VA 2G75A 4ZFGL 5H2BB 3BW9A 4P4RA 3O6FD 4DZBB 3WUWG 5JUEH 2NY6D 4ZPTB 1X5YA 1JRHH 3D85D 3L7FA 1GYAA 3DV4B 4BQCA 1CR9L 1AKJB 4KVCH 2APVA 1YMMA 5HHMD 4Z7WE 1IC5H 2AEQL 3NAAH 5T3ZE 4MA1C 1DLHB 1TVBB 1P4LB 3GI8L 3JTSA 3DUUA 4KJWC 1ZANH 3VFMB 4OFIA 4LOUD 4P23D 4G42A 5JR1L 2V7HB 3O3DB 4R4FH 1ULVA 5FA3B 4U6VL 2HTKC 5D6DA 3DVGB 1UH3A 5ID1A 3OX8A 3DETD 3WHXA 5IV2A 1AO7B 2ZUWA 2YZ8A 2HH0L 3VFUA 5I19H 3AY4C 5ID0A 2UZXB 4LQFH 6CGTA 1KIQA 4R8WL 1MEXL 1KLGA 4LLMB 3BGFB 2Y1VA 3KWWB 5I15L 4OM1H 4PRAB 1A7NL 1XCQB 4JGUA 5DZNA 2E9IA 4TNVK 4HX1B 1C16B 2KBGA 2IC2A 2WZPD 2Z92A 1MI5B 5GGUB 1H5BA 1XR8A 1A3RH 3HLAB 3C60D 4NO2B 3VGDA 2E7LC 2YUXA 5J89A 5T3XH 4NKMA 1PLGL 4JRYA 4ELMB 1T5WA 4IRJD 1DTUA 3LEVL 5JHLH 3SPVA 1NLBL 3O6FC 4KTDH 1F13A 2NY6C 3MROA 1NCCL 3D0LA 5EIIA 4PLOB 1P1ZA 1K6QL 3MFFB 5CEZE 2DOCA 5IB4B 3U4EB 1EHLH 1B0RB 4ZUTB 3HNTL 1AHWC 5I74B 3MBED 1NFDB 1R3IH 3L7EB 3VDCA 2VE6B 5JOEA 3SDDD 1FGNH 1IM9A 4JFXA 4XMPH 3FONB 5IJVB 3PWPD 4J1UB 4LOUC 4DKFH 4P23C 5EOCH 4BK5A 2OR8A 5HYJD 4KZDH 3P9MA 4Y1AE 4MZ2A 4TULL 2DBLH 3DETC 3QFDA 3R0MA 5HHPB 1NBVH 5L8KB 3VWJC 3CSYA 3AU1A 1U8IB 1NCDH 3FTGB 5DRWB 2P7TB 3LOWA 4UT9L 5TJWK 5I1KH 5KS9B 1QFWI 5EBWA 1QTYT 5DR5H 1F4XH 4YHKH 3TIEA 3E6HB 3G6DH 3O3UN 2GSIB 3OKMB 3VCLB 1S9WB 1KJ3H 3LN4A 1IEHA 3C60C 4DW2L 4OSUL 1VESA 2DIJA 3HRZB 1NAKL 2GUOB 5E99L 1GJIA 4IRJC 3HZKA 3NA9H 4PGDB 3FFCE 3ZYOA 1F3JA 3S3JA 3QBTB 5C07A 1MRFL 4NOFA 3NZ8B 1MIML 3DVIA 4NO3A 2P5EB 4GKZA 3CSBA 5KTEH 1A6WH 2CKBL 2E8YA 4QF1A 2Q7YB 3KPRD 1UENA 1UM6H 1HCFX 1R24B 4QRTB 5J11C 3UTOA 2BNUB 4OD1L 1WEJL 3VXNB 1W0VB 5CHNB 3PIQA 2F58L 1J0YA 5DJAA 3U82B 1TQBB 1ZT7B 3I6KB 2E9WA 3IDGB 3I02A 1CU4H 2BHYA 3MBEC 4IDLA 3L3GA 4FXLA 4B7LA 3SDDC 1JGVL 1OQOA 4L4VD 1A02N 4TUOA 3CXHK 3D1MC 4MDJA 3WIHA 2G60L 5CEZH 1NUFA 2DQUL 1PY9A 4XP9H 1A7OH 3S36X 1X6LA 3TT3H 4P3DB 1J1XL 2BX5A 2CRIA 3KJ6H 5FK9A 3QUXA 5FM8A 5DJXA 2VLRB 1L7IL 3GGWA 1OTSD 3OG6B 4HIIB 3VXQB 1I7TB 2ZOLA 2GJ6A 3DX7A 2ZCLL 5TDPA 2PO6D 3EJYC 3VXTA 1DBAH 3VGAB 2B1HH 3KLAB 4JDZB 4ZOBA 3TN0A 4NNPH 2D7TL 1LEKB 5F7YC 5L0QC 3ARDD 5B8CB 1BVKB 2BY0A 3DX6A 1RU9H 3CSPA 5D6CA 3GMNA 3OKEB 3QDGB 3SQOH 1CIDA 4GUPA 4MHHG 1I9IL 2XKNB 4PJGB 1T03L 5EU6D 4I1NB 5DVOA 2YN5A 3WIIH 4M7KH 1MFBH 5DMYA 1T80A 2DDQL 3U30C 4BSVA 1VADA 5J13C 1GOFA 3EO0A 3X11B 5ADOH 5AZ2H 5T1MB 1HNGA 4X7CC 1T1WB 2HVJA 5JIPA 5TQ2H 5HDLA 3Q6GH 3HCVB 3IJHA 3TA3C 2ED7A 3VDAA 3M07A 4H5SB 1YNKL 1T1XB 2VDRL 3QI9B 3CMOL 5E8DL 2FDBP 4ONOA 3C8DA 3X13A 2XZQL 5CP3A 2GJZA 5EOQH 1ITCA 4Z7NF 1FVCA 3GUTA 3W0WB 15C8L 1ZHBA 2H45A 3V0AC 3ZE1F 1CLYH 2P8LA 1VPOH 5DD3H 2E9BA 1Q9OA 5CGTA 5HGDB 1GZQA 4KWUA 2PO6C 4KKNA 4O2EB 1YYMH 2A6DA 3W81A 3D6GA 5EOCJ 4IRZH 3V6FA 3N1QC 2CR6A 1NGYB 3ARDC 4PYGA 3SKJH 1IEBB 2PXYA 4MDIB 2UZIH 2VLLA 1CN4A 3QIBA 4XBPB 3A6BH 3RIAF 2CLRB 2E27H 3L3JA 3LD8B 5EORL 1U2CA 4KUCF 1MUJA 2R1WA 4WEBH 4Z78A 1A5FH 2EEDA 1RZ7L 4HH9B 5F9WB 4F37F 2FB4H 3NACL 1AGDA 4LSRH 5TPWH 2J5LC 5E1AA 3P77A 1DQDH 4OCWL 4YEFA 5SWZB 4XCFH 1KENL 5DJYA 2J8UB 2CSPA 1Q9WA 2QSCL 1VKXA 4RGMC 3CFKB 1YNLH 3CFJB 4PJ9D 1HILA 4H26B 1F5WA 2W9LA 1K8IB 2QKIB 4RMVA 3ULSA 2IPUG 2JIXD 5HVGB 4QTIL 3GMPA 5CSBA 5JOPD 5CSZB 3VU2A 1NAMB 1GSMA 4JG1L 5KW9L 4KMTL 3D3VE 3O45B 3Q6FB 4E41E 3KPMA 4ZO7A 2JCCF 3S88L 5EOTA 5AYQA 4NJAH 2EXWD 2R0LH 4ZUWB 4MJIA 1AD0B 2DIBA 3LQAL 4Z7NE 2VOTA 4D0DB 1NCNA 3U1SH 1QR4A 3STZA 3EYQD 3ZE1E 4NQVA 1OLZA 3DV6A 1BBJB 1J1OL 1JZ8A 3C5ZC 5LBSH 3BPLB 4GO6B 3I3EA 2W9DL 3ZDZF 4GG8A 1HXMB 4GMTL 3MJ9A 1KLFA 4PJBB 4Y7MA 4RFNB 4XNUL 1REIA 4M8QB 1HINH 3ZO0A 2KZ1B 1R5IA 3MLZL 5GGSA 4ZS6D 4U2YA 4PJ9C 2EH8H 5DFTA 4JAMB 2AK4B 3BP7B 1U6AL 3P0YH 4JZNA 1ZGLB 1YQVL 5F7NC 5BMFH 4G6MH 4R3SA 4GXVL 5KSBF 2VSDA 4PRDB 2RAMA 5KG9B 2FJGA 1OGAE 5AG8A 3UYPA 3BISA 5L7XH 3ZL4L 1EEUA 4KHTL 3NZHL 4GJTB 1C5DA 4JPKL 3FCTB 4Y4FB 3BKCH 4NQCA 3V5DB 4CU7A 4XC3H 3CPLB 2R29L 5FO8B 4CDHA 3O3BB 4UT7L 3HB3D 2DM7A 2B5IC 4OGXL 2VITA 4FTVA 2GT9B 1MWAA 1RZJH 2EXWC 4M93B 4WRLA 3HS0B 4JO3H 4Y2DD 3RTQD 4OFPA 4UIKH 4P5TB 4LCIL 3L1OL 1JL8A 3V5KB 4ZFGH 3GJEA 4Q9QL 3NTCL 1A6UL 3EYQC 3JZ7A 3RWGB 1U3HC 2UUDH 4WI5A 3DVNA 2EEAA 5BXFB 4JFDD 4P2QE 2YD8A 3U0PB 3VFNB 4ETQB 5GZND 1IBGL 2JCCE 1JNHA 4G8EB 3TNMA 2CR3A 4X99B 3SN6N 5F9DC 1DQJB 3CLEL 4U05A 3QIWD 4PGCA 4O4YH 3WS6C 1FYTD 2FIKB 3D25A 1HSAB 3GI8H 4PJCA 2HT2D 2IANE 2AGJL 5DDHA 3VD5A 1HHHB 4IOSD 2YK1H 1JPST 1B4JL 4OD3L 2FR4A 1QP1A 4PJIF 4EI6A 4G5ZL 3VGGA 3BP4A 3TBTB 3ZDZE 3ZMRA 1CD1A 3F7PC 1H3UA 2HH0H 3SCMD 3EFFA 3QUMA 4BSJA 2I9LA 5F7FA 3PDGA 5L9DL 2YPLB 1MHEB 2BVQA 1TQCB 2VC2H 1J05B 1OWRM 1A7NH 4CL7A 5IB2B 4HUWB 2O61B 1HH9B 1N5YH 2VDQH 1GH7A 4EI5B 3HB3C 4LLQA 3NGBC 2ADFH 1H3GA 5KSBE 1JHKH 2VAAB 4NM4H 4K3DH 5IMOA 3UC0H 1I1FA 3MRBB 4Y2DC 1CLZL 3PQYB 1UZ6F 1PLGH 4LVEA 4FMFA 2R1YB 4IBLT 5F88B 2X05A 3TYFA 1JPGA 5CLWA 4Z0XB 2DWEA 4ZXBB 3KPQB 1NLBH 1N5AB 3PHQA 4FZ8L 1ES0B 2I25N 1WAAF 3QO1A 1W72L 3W9DA 1NCCH 2AP2A 4JREB 5F70A 3RL2B 1ND0A 1ZA3B 5GZNC 2JLLA 3EZJB 1LO4H 3QQ9D 4JQVC 4JR9L 3G08B 1S7RB 5DJ6A 1VACB 1D9KA 3MRPA 1U58B 4G9FD 2VL5A 1PQZA 3QIWC 1M7IA 5TE6H 3TFKD 3AREB 4P2RD 2L7JA 1NDMB 2FX9L 4NRZB 2D4FA 2HT2C 3MLSH 3T65A 3MNZA 3BD5A 4NBYB 1BF8A 1BOYA 5JLZB 3VG9C 5MENA 5B38G 5M94B 1XGRB 1QNZH 1CIUA 3MYJA 4TULH 5CJXC 5T1KB 1K5NB 2J4WL 3M45A 1KLUB 3BDYH 2YMXL 1Q94A 5F89B 3IDUA 3SCMC 5D96C 4I0PB 4PG2A 4QRRD 4NO0A 5FUOL 4EDXB 2EDQA 3VXPA 1BQLL 3TO4A 5D1QB 2YHGA 1BIIB 3FZUD 1F97A 1V05A 5MEOA 4N9GB 2YZ1A 4U1SB 3MJ8A 2NX5D 3JVGC 4ZUVA 3HN3A 3FQWB 3PP3K 4DEPB 1F4AA 1A9BB 1C5BL 2Q6WB 5DFVD 5MI0B 2R23A 4UINH 1MCFA 4NKIL 4HCRA 3VFRA 4GW4B 1TLKA 2FBJH 3MV9B 2PF6A 2CKBH 2A74B 4LMQE 4FFYL 2V5SA 2EYRB 3QQ9C 1RZ8A 2R1XB 3PWPE 1BD2B 1UZ6E 1WEJH 4OD1H 4WHTB 4X9BA 5HYJE 1PSKL 3WO4C 4M7LL 2F58H 2GK2A 5IR1B 1W0WA 2DTSA 3GBNL 3MTRA 1YUHB 3OBAA 1YEDA 3T4YB 3BUTA 5D2NB 1WAAE 1WT5A 4LSVH 4XTRC 3T4AA 3VFGL 4EBQH 5E9DB 3E6FB 2X4QB 4FQXC 2DQUH 1OM3L 5CZXD 3VGFA 5JDSB 1QLFB 1MVFA 4OLEA 5I71B 2FNBA 4GW5B 3RHWF 1J1XH 4I5BA 3W9EA 3BX7C 2X4UA 3V6OA 2PNDA 2QEJA 1QVOB 1L7IH 2DQTH 4Y19E 5D93C 4ZSOE 3U0WL 1DEEB 5DUPL 3BPOC 3CVHB 4K7PY 1A6TA 2FO4B 2C3GA 2D7TH 2PYFA 3FZUC 4OLVL 4QEGA 4U1MB 2W9EL 3O4LD 4OI8A 3GSQA 5J57B 4A6YL 3ZZ1A 4JY4B 1LE5B 3F58L 4HZLA 3OWEA 1FHGA 2MKWA 3GRWA 5IP4A 1AXSA 4WO4B 3KPRE 4D0BA 1I9IH 3RIFK 3VFVA 5K9JL 2ESVA 3I3BA 5DFVC 4MD5B 4QOKA 1MHCB 4FZEL 2A6JB 4S10A 4D9LL 1EFQA 2FJHA 4J8RA 1KIPB 4HT1L 2PR4H 3PWVB 4OIIH 1NBYB 3W2DL 5HBBA 2KH2B 5D7JD 1M7DA 4RGOH 5JHDE 1IAMA 5F6IC 5GSVB 1FVDA 3BGMA 3SE3A 4OCYL 1PYWB 4PRIA 2F5AL 1UVQB 1EAPB 4JB9H 1CZ8L 4XP1L 4ZNCD 4MXWH 1F4WH 1YEIL 3IXTA 2B20A 3JSSA 1QD0A 2H1PH 2XZQH 3IFNL 4R96B 5CZXC 3VFOA 3KJ4C 5AYUL 1FDLH 3QDMD 2DQIH 3GJFK 4JJ5B 2N4IA 3U46B 4CVZB 1MFDL 4L9DA 5K93A 1TJIL 1JGLL 4GW1B 5BRZB 1S9XB 2XTJB 4Y5XA 4PB0H 1F3DJ 2VABB 5DJDA 5EU6E 2NXYB 3MGAA 3UDWC 5HYIA 3MO1A 4TUJA 1UM5L 4LVHB 1FIGH 5I75B 4WW2A 1NDGB 1SMAA 5EORH 3PWUA 4QRQA 1OAKL 4HWEL 1ONQA 3CNKA 5DK2A 4TUKL 5IGXL 5KZCD 4LRIA 3V95A 2PTVA 2BVUA 3BEVB 1ZVYA 2AXGA 4OCWH 4B0MM 5L88L 4HF5H 1M05A 4GFTB 2EYTA 1KPVA 2QQNH 3HE6B 4N90E 2H9GA 4GRWB 5FGBA 3WJJA 1MY5A 1AGBB 4UOJA 2ADGB 2ATPB 5D7JC 3KXFA 1JPFA 1FQ9C 4OLZH 4YXKL 1N64H 4DUXA 3QB7C 4KROD 5DUMH 1PEWA 1BGXL 4F7TA 2UY7A 1PG7W 1Y0LA 3L3DA 5M95B 5E2TL 4JFHD 4OZIF 2WBJA 4U1IB 1A8JH 2V9TA 2G5RA 4NPYA 1L0XA 2OQJA 1WIUA 3RAJH 1IC1A 4L29B 1QRKA 3WN5B 3GSNL 4Q2ZB 1OB1B 5JXED 1FPTH 3CH8A 3ZE0F 1MAJA 4JG1H 2LVEA 4XNQA 1IILE 4IOFD 3RWJB 5CWSB 4LCWA 2BRQA 1FFNB 5HGBA 4TRPL 2X4OA 3S88H 1R3LB 3GNMH 4MX7B 1ERNA 1F11B 5CINL 4XP5L 2ZUUA 2IBZX 3FN0L 1A1MB 1QBMH 3R06A 3UPCA 4JZJB 4PREA 1RUMH 3FT3B 5C0JB 4YC2B 4OJFH 5FOBA 1S5HB 3PDDA 3E3QE 4AEHL 5JW4N 1VFMA 4XVUD 3I6GA 4R2GD 4OTXH 4YFDB 4ONFH 2YPKB 2DLGA 4HJGB 1RUPL 4P59L 1N59B 2W9DH 3LZFL 1CFVL 1DEDA 3UTQB 3PL6A 2GKIA 2C3VA 4EIGB 3K74B 4X8JB 4AJ0A 1I9JL 2MQ0A 1AKJD 2Q8AL 2O93L 1CTOA 4KROC 1JYXA 1U6AH 1A9EA 1YQVH 4P46A 2XPGA 1FZJB 5JOPE 1DN0A 4JO1L 2VIRA 2YRZA 1IGIH 4WY7H 3U9UA 3OV6A 2HJLA 1S7VB 4L4JA 1NBQA 1BQHB 1FSKB 4U1KA 4NFBA 3ZL4H 1XGYH 3FHQA 3OJ2C 4KHTH 5JXEC 1GGYA 3S5LG 2NW3A 1AO7D 4JPKH 2VN7A 5DJZA 4IOFC 2HP4A 3P4MA 5IMMA 2R29H 3V5HA 3LPFA 3PJSA 4OZIE 5FO7B 5FO9A 2GFBB 1KC5L 1DQQA 4TSCL 4PRBB 4X4XA 1V3KA 4ODUB 5C09A 4YZFF 1FH5H 2DWDB 3L1OH 1MI5D 3MLXH 4NUJB 3ZE0E 4QNPF 1A6UH 4OB5L 3AM8A 2VH5L 5EUOF 5L6YH 3L6FB 1A4JB 1WFTA 4WCYL 4XVUC 4R2GC 4XVSH 5HXMA 3QDJB 4M61B 4O00A 1P5UA 5J3HD 3PP4H 1UG9A 2BSSB 4N0YL 3OHXB 4ODHL 4ZG1A 2YRLA 1VFBA 1FFPA 3BH9A 3CLEH 3B9KA 4NDMA 3SDCA 1EEZB 1OP5K 2FHCA 1N7ML 5GGVH 4ODTL 32C2B 1MPAL 4P4RB 4DFHA 1AGFA 4WWKA 1G7LA 2DD8L 1YY9D 4XWGH 5F97E 2AGJH 2EC8A 4O51B 2W59A 3BH8A 3QA3A 4OD3H 4LEXL 3BZEA 3L7FB 1LEGA 1A1OA 1CFQB 2D31A 3QIUD 4U1HB 1HKLH 4RMWA 3THML 2AQ2A 2SEBB 4OLXL 1XAUA 1HZHL 4G43A 3UTSE 4HHAA 1KTDB 3QCTH 5L9DH 4G6JH 4KZEH 1H9VA 3CXHJ 4Z5RA 1JNNH 3QFJA 3QNZB 3OL2A 5CCKL 5T1LB 3O8XA 4G42B 3MLTA 4JVWA 5CJOH 5DTFB 1OPGL 2R2EB 3BGFC 1RV6X 4KQ3L 1FLRH 1SM3L 3OX8B 5IV2B 1MREH 2QSQA 4JFDE 1GZPA 1CLZH 1QKZL 1EUUA 1RZGB 3MCLL 3VFUB 5C0CA 2EDFA 5AUMB 2X5PA 1A6AA 4NHUA 5C2BH 1HWGB 3H9YA 3U83A 1JI1A 3MUGB 5ENWA 1DVFA 4FZ8H 1ZLUK 1T0MA 4D94A 4XAKD 4OM0H 1W72H 3V0VA 1FYTE 1U0QA 4AT6B 4JDVA 4HK3J 5J3HC 4WIQA 4U49A 5GJSL 3WIHL 4MJ4A 5EIVA 3SDAA 4JR9H 2P5ED 1T1YB 4YZFE 3U7WL 5DHXB 2VDKL 2FX9H 1R3KA 2OSLA 4PRHB 3SPVB 4QNPE 3MA7A 4V1DE 4M9OA 4LBEA 1YY9C 5EUOE 4NQUA 2WK2A 1WQVT 1CGVA 5EU3A 3E8UH 2CD0A 4S1SH 5DGRA 5EIIB 5KVDH 1TPXB 4HC1A 5I74C 1K2DA 3QCVL 3EDEA 4MNGE 4MD0B 3QG6B 3QUYA 1YPZA 4W70A 1ZWIB 4K3GA 3SDXA 1JYVA 4HGKC 2P45B 3IVKB 3ARZA 3ESVF 3GBML 4WU5A 5FUOH 1ZE3C 5EZJA 4KK8D 2Q86B 4QCIA 5IOPA 1INEL 3ARFA 2BDNL 4YHIA 1BQLH 3DX9A 5T5FL 3ULVD 1IKNC 4FXKA 2VLRD 1MJ8L 3FT2A 4M5YL 1A47A 2CIIA 1I9RL 3SY0B 4JFYB 4Y89A 3IU4H 4BQ8A 1UFUA 1LILA 1ZHNB 1FL5A 1KN2L 1HSBA 4OI9A 1C5BH 1QRNA 5A2FA 4K8RD 1Q9LB 3EYSH 2D03H 4NKIH 3QDGD 4NN6B 4G9FE 3V4UL 3TIEB 5CKAA 3KVQA 1D6EA 2DLFL 3D39A 3GMRB 3U36A 4ENEC 5JA8B 3LN4B 2B2XL 4FP8H 4YE4H 3SO3B 1BREA 2DQDH 1I1YB 3ALWA 2HG5A 4HS6A 3JUZA 5I0ZA 4FRWA 4Z7OF 4DGYL 3MOQA 4M7LH 3GMLB 3QHZL 2ORBH 3F5WA 4PBVC 3T0EE 2R0KL 3GBNH 3ZHKA 5A2LH 5L2JB 5C07B 3VFGH 3HPJA 3FQRB 4L8CA 4TSAL 1TQBC 1D7FA 4CADA 2FLRT 3FRPG 4LLVB 2QHRL 3QI9D 4L8BB 1GHFL 2ATKB 1VFAA 4L8DA 4RAVB 2DQEH 5GGTA 1A22B 1P84K 4XNXL 1FNHA 1AE6L 4KK8C 3W0WD 2UV3A 3BGAA 5DUPH 5JPMA 3T8XB 3ULVC 2W9EH 1LNUA 1P7QB 4XPFH 3SDYL 5CD5D 4EJ1C 1QSEE 1SMOA 5DZOA 3VGAC 3F58H 5FK9B 1EMTH 3K81A 3ZT6A 1MCPH 1UM4L 5B8CC 3TYGH 4Z76A 5J9PB 5IESL 3MMEB 4LPTA 5IIEA 2ZOLB 3D2UB 4K8RC 1SJHA 1PZ5B 4FQJL 4MLIA 1T22B 5ICZA 4LSSH 4D9LH 3FB5B 4OZ4A 1UH2A 4M1DL 4HPYH 1QG3A 3WFHA 2GQHA 3GSRA 2NW2A 5D6CB 3RNQA 5IBUB 3JWDC 4WV1A 5SWZD 1VERA 2WIIA 2AABL 2F5AH 4MA8L 2E7MA 4OFYD 5FEBA 4QHMB 4XP1H 2C5DC 1DANT 1TTGA 2IFGA 4KRLB 1WZLA 4WUUA 4XMLL 1A6ZA 1EGJL 3EFDL 4BSVB 3IFNH 4OZHA 4PJ7A 3VXRB 2ADJB 2YS4A 5ERWA 4EXKA 4ELKA 2IALA 4NC1C 3QI9C 1YMME 1RK0A 4K94C 2VDML 3O4LE 4PJEB 4TTDD 4Z7OE 1TJIH 4KKBD 3IJHB 1KT2B 4PR5B 4FQQA 1MFEL 2AK1H 4Y4HA 1FG9C 1UACL 4YHNA 4I0KA 1JF1A 3DRTB 1MIEH 3FL7A 3PP3H 3EYFB 2GJZB 3MJ9L 5FYKD 1NGZB 2CLZB 4YIQA 4JHZA 3RZCB 5KVFH 1VGKB 5IVXB 2EIZB 1OAKH 3H9SA 4R0LA 4HWEH 1EVTC 2X4RB 5D2LB 2EO1A 4TUKH 2JTDA 1B88A 1GZQB 5ESVA 5IGXH 2PTTB 3UP1A 1M1SA 4OCLC 4K8RL 3LD8C 4OF8A 5L88H 4YO0A 5DJ0B 4JRXA 1BEYL 1UYWL 5E8NA 5F9WC 2OJEA 4J3TA 4YXKH 3OR7B 4UT6L 3BP6A 2APWA 5CJ8A 5IFHL 3MR9A 1MUJB 4QY8B 3JWDL 1P4BL 2LV4A 3UBXI 2Q76B 5E2TH 3BEWA 5D1ZA 3U79A 1DQLH 2AK4D 4OKDA 3P77B 4R7NA 3KYNB 5KVEH 1T21B 4QHNB 4S1QH 4NQDE 3WFCH 1MWAL 3WIFA 3GSNH 5HGHA 3WKNA 3LRGA 1KFAL 2FYYB 5I2IA 4TTDC 5ETUB 1RJCA 1KNOA 1X4YA 2R56H 4KKBC 3VFTA 4PP2B 2XKSA 2OP4L 5D72L 4Y4FD 2WSKA 4XP5H 1D5XB 1QHPA 3B9DA 4YHYC 3QCUH 3U0TA 4HV8A 1HQ4A 1AH1A 4U1JB 3RP1A 3HPLA 3AS2A 3FFDA 4L4TB 4P5TD 3MLVL 5F1NA 1FJ1A 2XG4A 4X0KA 1T5XB 4M43H 3WHE1 1AI1L 3UJIL 3P9LA 3KPSB 3RKPA 1CFVH 4MJ6B 3BKMH 3RY4A 1E4XH 4PP1D 4X4YB 3BPLC 1KCUL 1NANH 2ZUYA 2AXFB 1I9JH 3Q1SL 4M6OL 5MP6H 3STZB 1JF5A 3ARGB 4QRPB 1IGTA 4C58B 3DV6B 4RFNC 4HAFA 5HHNA 2DLHA 1NH6A 1J0JA 4RGNE 4HUNB 4MQTB 4NQSA 3GJFH 5MEQB 4GG8B 4DZ8A 5CIPA 1AR2A 1VFOA 4JHBA 1R5IB 3OKKA 5GGSB 1OSPL 2V5YA 3OF6D 3SBWC 4HLZG 4WI3A 2I9TA 3NCJH 1NCTA 1FZOB 1UEYA 1WICA 4HUUA 3GSOB 3EIFA 4HIJA 3DMMB 2IWGA 3BHBA 1WTLA 5HVFB 4Y4FC 1NAML 2E6JA 3LKOB 4EI5D 4Z7VA 3V52H 2R0WL 2D7PA 2ZOKA 3OR6B 3SE4C 2X9YA 5DS8B 5F93C 5FYKL 3P30L 3IDMB 2Y5TA 4RMQA 4M93C 5C0RL 2YSSA 1FFOA 2VH5H 2YWYA 3PQYD 4M5ZL 4WW1A 1BAFH