5D7HA

X-ray crystal structure of l,d transpeptidase 2 from mycobacterium tuberculosis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
350
structure length
350
Chain Sequence
LVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNENGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 90
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5d7hA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d7hA02
4QRAA 5D7HA 3U1PA 1Y7MA 4QRBA 5DU7A 3VAEA 3ZG4A 4HUCA 4ZFQA 4A52A 3TURA 4QR7A 3VYOA 3VYNA 3ZGPA 4K73A 5E51A 4Z7AA 3U1QA 3VYPA 3TX4A 4JMNA 4A1KA 4LPQA 4HU2A 5E5LA 5E1GA 2MTZA 4LZHA 4JMXA 4GSQA 5DUJA 5DVPA 2HKLA 5DC2A 4QTFA 5DZJA 1ZATA 4GSRA 5DCCA 4XVOA 5E1IA 4A1JA 4A1IA 5K69A 5LBGA 3ZQDA 5DZPA 4GSUA 5LB1A
chains in the Genus database with same CATH superfamily
1MZYA 3T6ZA 4H0GA 5F3BB 5TF1L 3VXSA 1Q9LB 4FULA 4PRHA 4RIRA 5E00B 3VFTB 7PAZA 4I3GA 4H25A 4JM4H 3LOWA 3BGFB 3C2SA 1I8IB 2AJSL 4PWFA 4JPSA 4LAQH 3FO0H 4CSZA 3BSZA 2YGOA 2PWFA 2ODIA 5I75B 1UXSB 2NOYA 1GGYA 4HUUB 3TL5A 3VFNA 3KDMB 3HE6D 3IGAB 2YXFA 3PJSB 3C08H 4JHWL 1PW3A 4R4BB 3V6FA 1X5JA 3WO3B 2XZCL 4KUCD 4HPYH 2DJ4A 3EZJB 2WTPA 5JA9A 1A9BB 1PLGL 3HB3D 5D1ZD 2WN2A 3QWQB 5G5DB 3B1UA 3OZKA 5K39A 3LQZA 4PJGF 3K8KA 4DN4L 5EUKA 4TSBL 2YAEA 3PGDB 3MXWH 3NIDE 4B9JA 2BVYA 2W59A 1KXTA 3TN0C 1XIWA 3O6LL 3FZUD 2XBTA 4W9JC 2AK4B 5DD0H 4OD2B 3KYMB 5BO1L 3ZDYF 4ZXBC 5ESVA 3PABA 3Q44A 4PYHA 1J1OH 4F93B 3FTSA 1OCOB 4QWWC 1NFIA 3T4YA 2WBJA 2X6UA 3MRHB 2AF2A 3POHA 4BHUA 4BKTC 4G9FA 4W9EC 3WLWD 2AFNA 3RVXD 4KZDL 3DJZA 4QT5B 3VFSA 2ZNWA 4Y16C 2E9BA 1KB9J 3QUZB 4LLMB 1XSKA 4WHYH 4ONHA 1ZLVK 2D7OA 5HJDA 4AGLA 3SYCA 3MRRA 1XF5A 3H42H 5C0CE 4HVBA 1UD6A 3QDGE 1IKNA 2CLRA 1YSOA 4D0CA 1ECYA 2CE6A 5I8EA 4AMXA 4I0PB 3UYRL 2J21A 1DO5A 1G5AA 3VVVA 5C2BL 4QHKI 4PGEA 1YNLH 3MX0A 4NDMA 2IG2H 3PWPB 5FHAL 5CR1A 3UDWC 4N68A 4NM4L 3GGWA 2BNQA 4P46A 1AQKL 1QAWA 3V6OA 3IMWA 1E3XA 5D93C 3WO4B 3NSXA 1KOAA 4HV8A 1ZLSH 1NLBH 3MUJA 3WU1A 3B9EA 3GZQA 1N0LA 3POCA 4GEIA 3J2PA 4PWHA 2H2SD 4P23D 2ZUQC 1KN2L 2AEPL 3LIZL 3TWCL 1A14L 2EKSA 3HE6C 3D09A 5JQHC 4R4FL 4ONGH 2R15A 5I1DA 3AS1A 2R2HA 1ZVNA 2YJLA 3MRFA 4JHBA 4LVNC 1CI5A 2A6IA 3D51A 3LNFA 4CC1A 4N25A 2HH0H 3CFKB 3HB3C 1M3IA 1IFRA 5D1ZC 5K93A 1LDSA 1ET5A 4F7TA 1GIGH 3IDYC 1TZGH 1EZSA 1U92A 1IE5A 4I3RL 3IJYB 4OFYA 3BEWA 1UZ6E 1N6UA 1MWAB 3QFJD 4FFWD 3VCLA 3MLSH 3WFCH 1RZKC 4ODHH 5T8IA 2APBA 1PKQB 1TTFA 1LMKA 4H26B 4P9HH 4X9IA 1PQZB 4X4YA 1UT9A 1EUUA 1AOZA 1BHGA 1HAWA 3UYOD 4IBZA 1CLCA 4ZW8A 1INEH 1FZMB 4ICWA 2XX1A 3VTTA 4UMGA 3O81A 4HLEA 4H8HA 3O11A 4FYQA 2NQDA 4LCYB 4QF1B 2XZAH 3FQUB 2V7NB 2O72A 2GHWB 1PMYA 3BOVA 4OZHF 5L8KB 1BVLB 5HDBB 3FU6A 2X05A 2MPAH 3NSDA 4IKJA 2RIKA 1JGDA 2JELL 1QHPA 3K6DA 2FLBT 3MU3A 2H41A 3FSOA 2IPUG 1AHWA 4YBQC 3TOPA 4HIPA 4P9ML 4QHMB 5L7XH 4RMVA 2D7MA 4AITA 3WL9A 5AVVB 3K80A 2X4QA 4YE4H 4ZZKA 1QI3A 4NCC2 2Y1ZA 5GIRA 4KRPB 1OPGH 2J1WA 3O2DA 5TE7H 3N1QC 1T83A 1FFTB 1HC1A 3BZ4A 1YY8B 2ERJB 3M6DA 4ZUUB 3HC4L 4A55A 4PJDA 2Z8SA 4XXDA 2ILLA 1MNUL 3OF6D 3PNWA 4UYPA 5ECJE 4Y9FA 2O6CA 3QB7C 5EDXA 3KNBA 1Q9WA 5J11C 2YZ8A 3QARA 4P23C 4HC1H 4JG1H 1OANA 5DJ0B 2DM3A 5LG1A 4FADA 2QPSA 3FO2B 3QJHA 4E9SA 4HBCH 1MWAL 2CM5A 5ES4B 3I6KA 1F13A 4UINL 1BPVA 3MDJA 3QQDA 3IKCB 1VSCA 3HI6L 4C58B 4JPVL 5FYLE 3FQRA 4RGOL 1U3NA 1FPTL 3U6XS 5H2BB 2Y7QB 3PWLA 3N04A 1JZGA 3TV3L 3GBNH 2PW2A 4X80L 2F19L 1XTMA 4Q8BA 1KN4H 2R2BA 1AOHA 3WUZA 2HTLC 2GTWA 2FJUB 3DX3A 2YD7A 2CO6A 1SHSA 3VFMB 4Y5YC 1O7DE 5C0JB 4CILA 3FT3A 2YAQA 5DWPA 4AUYA 4WKXA 5D71L 4AVHA 3G9VA 3HRZC 5CINH 2HJLA 5HHMB 4PJHF 4G6ML 5PCYA 2GYSA 3B3IB 2OSLA 1USQA 1SEBB 2PXYD 3GZOA 3D18B 1OAXH 1P84K 2FSDA 1DFXA 4DCQB 1JNHA 5BRZE 1AQDA 2C9XA 5DQ9A 4CADA 7FABH 3W37A 2KI6A 2VSKB 4LKXA 1SLWA 2XWBA 1N19A 5A2FA 3ASWA 3QUYB 1H3GA 1K2DA 1P53A 4LCWA 4BJLA 2V6HA 3KCWA 4OUUB 1M7XA 2FBJH 1TMQA 2DMHA 5D2LB 3CPLB 3S2CA 4QJ3B 2FYVA 4E2OA 3QFGA 5JPNC 4XMKH 2YPLE 4FLRA 1TQUA 3IJSA 3CE1A 3HZKA 4GINA 5DHXB 1XCTA 2DMCA 3NABH 2D73A 3CZGA 3T4AA 1TT6A 1DJYA 1TQBC 2I5YL 1OXYA 3MNMA 1OW0A 2RCSH 4ZYKB 2F7IA 3HG5A 4XPTH 1SXAA 2ZOKB 3L95A 1YPZA 5FM5O 4DKEH 4F80A 3SE4A 4HIXH 4YSOA 1MHEB 3QULA 1AJ7H 1IB5A 4L8BB 3BWAA 1XH3A 4XP9L 3CBJB 2ROYA 1CF1A 4N6RA 5HYEA 1T0MA 4Y0GA 2GJ6A 4EZMA 5ECGA 4ETQB 5D7JB 1A2YB 5KYYA 3C60A 4BH8B 3MV9A 4PGBB 2ALWA 4GAGL 4NUMA 3MNVA 3OAYH 4BCYA 4LDLB 1RH8A 1N7ML 2G60H 3MNWB 3EGDA 1O6TA 1NEZA 5F1IB 1N6QH 4M8QA 4FA7B 4ZD3H 4QHLA 4GG6E 4F7KA 1MCQA 1QG3A 4NP4H 4KRNA 5K9QI 3OMZA 4IRJB 2R0LH 4PLOB 4X0KB 1R3LB 3DX7B 4LSTL 1F4XH 2OP4L 4EDXA 3WTSA 3QJVB 5AL8A 4XAWH 3WHE1 4EZLA 5D7SH 4LDOB 2J73A 4K9EH 3BQUD 5KJRL 2HPOA 2OQJA 3G5WA 4PJ5A 3VWKB 4PRBA 3S36L 1R5VB 3QEGL 3TF7C 4PCYA 4YXLH 2PR9A 4JKLA 4PWKA 3TPUB 1AGFA 4U3SA 5DS2A 3V0EA 3IDMA 2J88H 2EIDA 1KB9K 3VFOB 2V0AA 3VFGH 2WO4A 2IH1A 2GBUA 5AAWC 3Q3GB 6FABL 2QPUA 4JUSA 2CLVB 3L4ZA 4UNUA 3QRFM 5DUML 4QHNB 5L9DL 1HKLH 3I2CL 4LEEA 4OJFH 5IJDC 2O5XH 4GMSH 2YPVH 3TJHC 1NMAL 2PPAA 3B37A 3WN6A 1ID2A 2WCPA 3D07A 3NJIA 4G8FA 4JAMA 2MCMA 2FJGB 2H6PB 2YGNA 1S7XB 1JDDA 5DJXA 5IKCB 1J12A 1JD9A 1SFHA 3QXWA 4JREC 4PEEA 5J3HD 4Z7WB 1IARB 4IMKC 5FUOL 3OKDB 4I87A 5HHVL 3ARGD 4LHUB 3N1MC 5C8JA 5DJ8B 1JZ7A 2AQ2A 4ODTH 3HZ3A 1RY7B 2YLHA 4M5ZH 1JYXA 5HYSB 2Z0BA 4GBXB 4ANWA 4L4TA 3GRBA 5EF2A 3MRQB 4PWJA 3X1GA 1MN4A 5KYNA 3R0MA 4MDIA 4MCYB 4OCWL 4DGYH 1PGRB 5KANI 2V2TA 4WO4C 4PS3A 3F6LA 2FT6A 3KPSE 3KM2A 3AT0A 3UJTH 4JK0D 1QSFA 5FYJU 2ZT9C 1P9MC 2JB5L 1QUNB 3BP4B 3FQ1A 1D5ZA 4LGSB 4PG9A 5E08L 4JHUA 4N0UB 3BYYA 4OGAC 1EPFA 2FECL 3X13A 4HJEA 1UZGA 4D9QE 1S6NA 5AVSB 2CDGB 1OE2A 4U6HA 1G7JA 3T8XA 5IHLB 1S7TB 4NUGL 5T1LA 4HH9B 4FXGC 4U7KA 1ZA3A 2P3YA 1JGEA 2F74B 5E9DE 1FL6B 3WGUB 5C86A 1OAUL 4KROD 3EGXA 3IMRA 1PEWA 4UB0L 4CN6A 1I7TA 1HE7A 1MAMH 4N8PA 5GS2D 3D52A 3BQUC 3ULUF 3C2AL 4AZ8A 2GCYA 4PLKD 3WJLA 3MCKA 3L8QA 1GL4B 1N59A 1JERA 1YQVH 3A6BL 4JKWA 4CN4A 4GEJA 3P2TA 1I1FB 3PAUA 2WJ5A 4MJIB 4Y19B 1ES0A 3U7YH 1QA9A 1E4HA 1FNGA 4LPWA 1G9EA 2P24B 3L5XH 4WY7H 5HHNB 3TBSB 3GSVA 5F70A 3WS6C 2XACC 2WXFA 3LRSB 4NN5C 4L9DA 3NTCL 2A9AA 5D6CA 2F15A 3MFFA 4AQZA 4FKKA 1LEKB 3ATDA 3BKYL 4NQSA 1YECL 5ISZA 2JJUA 4A37A 2UWEE 4WWOA 1O75A 1NCOA 1IC7H 4TOYL 5DRNA 4PREA 5EEYA 1S7QA 3V4PB 4F5CA 4QRSA 2WWKO 5IBLD 2EE2A 2HRGA 1IQDA 1NCAL 3IMBA 2KL6A 4QCIA 5D2NB 1VHPA 4FZEL 3V7AE 4FYTA 1MFVA 2V2WA 3IWUA 5JHLL 1Z66A 3BIKB 3UL4A 2G3NA 1VPOH 2GIMA 4EXPX 2NT1A 2K7PA 1E42A 4Z78A 5DRWB 5D5MF 4UQAA 4QXGL 2WQWA 4LCIL 4LSRL 1Z9OA 4ZMAT 2NRDA 1MPAH 1QSVA 2VLJA 4YN3A 4D0BB 2XN9B 3S88L 2C1PA 5FGBC 1F42A 1UH3A 4S1RL 4PJEB 3AXLA 3K5SA 1EHLH 1BD2A 5IOPB 3L3JB 2XUWA 2BMKB 2PP8A 3STBA 1ND0B 3QJQB 4NHUB 2ESVE 5I73C 4K8RL 2OFQA 3IJHB 4H8WH 3FQWA 4JQVC 4XHJD 3BPOB 4KQ4H 1RUMH 2WK2A 3MBWB 4XWOD 4HG4J 4FTDA 4X5LA 3G6AB 3LS5L 5CZVL 3ZUCA 3O9WD 2COQA 3GBDA 4PJGA 4PJCE 3RWHB 2NT0A 2VM9A 4Q0XL 5D7LA 3MQIA 4X4XB 4MDJB 1KPRA 4L0YA 2DIEA 1CTOA 4FABL 3MCG1 1A6WH 4FQXC 5TE6H 5JNYB 2CD0A 4L4VA 3ZG4A 5IK3A 4RBPH 4WUUD 3ARYA 1LDPL 4ZFGL 3RE0A 2RJMA 2ZYHA 4HU8A 1NKOA 3UTZA 1G1YA 2WWKT 2G2RA 2HKHL 1L9TA 1MJ8H 1XSOA 1T1WA 2A1WH 2K8QA 4L5FL 2OMVA 1WK0A 5DJ6A 2J4WL 2KPNA 3A22A 4N5EC 3O3AA 4IJ3C 3THMH 1NFAA 4K55A 2A9BA 4MA3A 1PG7L 3TT3L 3WFBH 4MMYA 3O6FA 3LVTA 3B2VL 3K6OA 4IRSB 3FN9A 1NEZG 2BRQA 5JW4Q 2G3MA 5C0BD 1KPVA 5LAXA 4LSUL 4K7PL 4MRCA 1UM5L 1MLCB 2R29A 3MTXA 3QIWA 4GPVA 1G9MH 5I6OA 3ARBC 3VB9A 3TO2A 1ZA6A 4E9LA 3KPRA 4XMLL 3VWJD 1OGAA 2ZWNA 2YN5A 3FB6A 4P2RD 2NY0B 2R4SL 1UA6H 2ZQKA 3J07A 3K4DA 4ZO7A 2DWEB 5A16B 2ZSVB 3KPPB 3NCMA 1T4WA 5SWQA 3JTSA 4YVUA 1JVLA 1MOEA 4LL1A 1WT5A 1LK3H 1H15B 4HK0B 4AV4A 4Q9RH 3OG6B 1XGZA 1QWNA 4HWBL 2B5IB 4XWOC 2WLNA 1J11A 2QQKH 4S1SL 4J12A 1LEGB 4XCNB 5DXWA 1CGVA 3SJVD 1AIFA 1KPUA 2AAAA 3GT6A 3DUSB 1CI3M 4G70B 1IO4C 3UIYA 4HW6A 1C5CH 3NSJA 4NN7B 2YEQA 4HJUA 3TO4C 5CKAA 5I1IL 3MLZL 3N91A 2J56A 3ERXA 1DQDH 2UZPA 4ISVA 1UEYA 5AKTA 3FU3A 1BBJA 2EXTA 4IIQC 4LIQL 1NAMH 3FQXB 1HCZA 3ZGPA 3VFPA 1T4KA 2YD4A 2RD0A 1CFMA 5I18L 5KYXA 5HHPB 1N18A 1F6AB 4OZHA 3UROR 1EX0A 1VB9A 4AJWA 1AO7E 3U30B 1OHZA 3V10A 2XN1A 4KUCF 1NMBH 4OH2A 4OCXH 5IFAH 4MNQD 1GC1L 3FCBA 2QVFB 4BSVA 2YO3A 5DMIL 2WY3B 1HVXA 3BIAX 4GO9A 5EOQH 3ELQA 4CC0A 1URLA 4DGIH 5KSAA 2EVJA 1CIUA 3RIFK 3HZVB 4XN5A 5I0ZA 4ZS7H 4POUB 1NUNB 2DQIL 4EKJA 3NFPA 4G9DB 1FRGH 4WFHD 2VXVL 4ZX3A 3EO1A 1BMWA 2GJZB 4DEWA 5DJ2B 5EU6D 4FQ2H 1CXKA 2Z8RA 3L5JA 3NSFA 4PY7A 3VD2A 3EDKA 3K0YA 1AGCB 2D4FA 1GPOH 1G1CA 2DW5A 2VKXA 4HWZA 3PF2A 5FYKL 4IM8A 1XXFC 2KDGA 3ILPA 1F8TH 3L3DB 5T1DH 4K2UL 2WZPD 1MH5B 5CJ5A 5B4MD 1C08A 2XRAH 4XVJL 4LPVA 2PCFA 4XE0A 2QVMA 4HFWB 1MFDL 3RZWA 4D3CL 2DQCH 4P49A 4NWUL 4WEBL 2HVKA 2X9XA 1H8NA 4LPQA 4QRRD 4U1IB 4YDNA 2DIBA 3RB7A 2X4RA 3PL6B 3PAZA 3OM3B 1DN0B 4DSYA 4JMXA 1FBIL 3FRPA 1K5NB 4ODXA 3FN0H 1YMHA 2FB4H 4J3TA 2VR4A 3C6LB 3OG4B 3DO7B 4EOWL 3ULVH 3IJ8A 3FT2B 4R7XA 2F9BT 4IBSA 4OCSH 1ERNA 2D31B 2VUYA 4LKCB 3IYLW 5DSCB 4KK6C 2Z31B 4KK9D 4U2ZA 5BCAA 4ZS6D 4PJHA 3GBML 1G7IB 4OI7A 2ITCA 4X6EA 2DQEL 2V5MA 4IEFA 1C1EH 4PB0L 2BNRE 2ZOTA 4M6MH 3VSQA 4HIJA 4FXKC 3ZDWA 3FT9A 2ARJQ 2BP5M 3BKML 4K3JH 3L48A 1F4WH 1CICB 4F8LA 2CR3A 3GSRA 1L0YA 4J6IA 2OK0L 4H8WC 1TKWA 1PZ5B 4Y1AE 4JB9L 4GKSA 4NAJA 5FK9A 2BY2A 1NPJA 3RAJH 4D7PA 2PWGA 1ZGLM 2AQRA 3SKMB 4JFHE 4DTGL 5JW4R 3JZYA 4UDUA 5DD5H 2X9ZA 3UTTE 1RUQH 2N7AA 1A4KA 2WLYA 5T5FH 5CBAA 3BKCL 4BFNA 4G7QB 4XO3A 4FQHB 3NQIA 5F0PB 2CAKA 1AS7A 2QR0A 1IM9B 1FVDB 1P5UB 3DURA 1T22B 2IAMD 4EN3C 1V5JA 3ZVVA 3NZHL 4DKTA 5E1QA 5GS0C 3O8XB 3HHRB 1U58A 2EECA 5IW1B 3DXAE 3GLDA 2NY1D 3BMWA 4LLQA 4AYID 3GMMA 4G7SB 4RDBA 5FKPA 1J0IA 1HQRB 4WHCA 1QLFA 3GK8L 4YR6A 3KPNA 1DLFL 1HXMB 4MLIA 3KWUA 1T2JA 5EU5B 1XEUA 5T1KB 1BF8A 3L3IB 3WFEH 5DURD 4HLJA 4JFFD 1MDAA 4UILL 4W9GC 4XPBH 2WWOA 4HSQA 1U30A 2F7RA 1FO0A 1YYCA 2ED6A 4Y4HD 4G8GE 5CIPA 4OQ1A 4F2MB 4N2IA 3VSUA 4HG4K 3WIHA 3RVVD 1S9WA 5CN3A 4KTGA 1VGKB 5FOBB 1YJDL 3QJTB 1BYPA 4IMLA 3SYQA 1UWXH 1UT1A 4F1ZA 5JLZA 4WUKL 3H9SA 3FFDA 5E99H 5MEOB 4UIMB 1EXUB 1CLYH 1G9MC 1IGIL 4PH8A 5JR1H 5LDUA 4QYOA 4FG6D 5E8OA 5MEQB 3KJ6L 3PGCB 1NLDH 2X3CA 4G6AC 4KK9C 4A6YA 4APXA 4BZ2H 2J1YA 3AWEA 4ZMNA 1BAWA 2DJUA 4L3EE 5CP7A 3MLUH 2BXZA 1OLLA 3FPYA 1YNTA 2FNBA 3LRKA 4OVUA 3VXME 2YAHA 5D1QD 5EPMA 2NY2C 3UC0H 3WEAA 4Z7NB 3KXFE 4IJTA 2BS8A 3QNFA 2EIMB 3ZO0A 3JWOH 5J1AA 3SGKA 3WTXA 1PD0A 1AACA 2BIMA 3G04A 3U7WH 4XNZB 2LVEA 1DBJL 4HS6A 1TMCB 1XCQB 3WNIA 4KHTH 4AL8L 4A2DA 4N1EA 2D0GA 3N5AA 5MI0C 5AYUL 5FKAB 4YHIB 5E5MB 3AY4A 3ZJAA 4PLJC 4LSDA 2K0RA 3RWGB 2EO1A 5H94A 2ENJA 1ODAA 2HFGH 4O2EB 2VLLA 4NQCD 1A0QL 3WNLA 4XBGA 5JHDE 3MLPA 1A7RH 4NQDA 2ZWZA 4ZRGA 2X2JA 1XEDA 1KJ2A 2IAMC 2PWHA 4Z5RB 3ULVD 1BZDA 3MXVL 5AKSA 4RGMC 4CMMA 2CA3A 4IDLA 1H3VA 1H6TA 2XPGB 3D25B 4BYHA 4DN3L 2BSRA 5TQ2H 1QRND 4JFZL 1UHVA 4BZ1H 3BXNB 4ECNA 4O51A 4V1DB 4QEGA 4O02H 1XDTT 3ECUA 3EYUH 4MAYC 4YLQT 1ZJAA 4AJYV 3INUH 1A6ZB 2Y07H 3QAZC 4K3EL 4HGWA 2WANA 4XCEA 3SGJA 3WFDH 3D69B 4J4PC 3WIAA 4FP8L 2JJWA 2DYSB 4DKFH 4BXVA 2JF1A 1N26A 32C2A 2JKJA 3EOTL 5HJBA 1I8KB 5C0DB 5KG9B 3IRPX 1F3JA 5MHSD 1LYQA 3DGGB 3PQYB 4WSJA 3Q8EA 4NQXB 1DYZA 4FTVD 4OFPA 3ISRA 2Z35B 2MIZA 5EZOL 4DQOH 5LGKA 4WJG3 3NJHA 4XZUA 1R9FA 5E6YA 3LQAC 4FNSA 1JK8A 3P69A 1U3HD 2IBBA 4MQ7A 4AYDC 4YSDA 3T0EB 3LJ3A 3GMLA 2EH7H 2UZXA 3MRDA 5FFOA 3LPWA 2QHRL 1MRCL 4I77H 3EGSA 3ALPA 2EDHA 4LEOB 1PSKH 5L2JB 3BE1H 3BT2H 1TZOA 1MCIA 5D1QC 1E4KC 5KUKA 1E7VA 3CFEB 4QTIH 4QRPE 2NSXA 2QKSA 3T65A 5L2KA 1H5BB 1M57B 4QOKE 4J3WA 5GZNC 2O61A 3KLHD 4NAQA 1PLBA 4NJAL 1BMZA 5F1KC 3EFDH 5FO9B 1RHHA 1GZHA 4OQTA 4GW1A 3QCUL 1K3ZA 1MDTA 3MV01 1UJ3C 1EFQA 4XMTA 3H3BC 1F4HA 4YHLH 4WDIB 3JZ7A 4EUPH 3AT8A 4KJYA 3S96A 1X5LA 3KYKL 1ASOA 5F7DB 1R34A 3O4LD 1K8IA 3FH5A 3NAAH 4NO3A 5FYJD 2HVJA 2J6EA 1MCRA 3ULVC 3FRPG 5D9SB 5C9JB 4PRDB 2H45A 4D8OA 4OM0H 1FDLH 2VITB 3ES6B 2OMNA 4XXWA 1JPEA 3BO8B 2XZQL 3AS2A 3RWIB 1SN2A 4YE0A 1IGML 5DD1H 1UFUA 5D5MA 1HHIA 2PYFB 2ZNXA 2EE0A 2OMTB 3L2MA 4KUZH 4OD1H 4Z3FA 4X5WB 3O45B 3PYCA 4JG5A 3VXNA 2Y6SD 3GSUB 4BFEA 4M7ZB 3RWJA 3SBQA 2CXGA 1FZKB 2VMJA 4J27A 2OXGA 1U6AL 3X14A 4X50A 5MEND 1B3JA 4N0FB 4ANXA 4Z7VB 2JH2A 5HGHA 3LB6C 3OMNB 2FH6A 3QEQB 3QO1B 3UTPD 4JFOB 1XF2B 3L3KB 1ICTA 5FECA 3EYOB 4PYGA 1EEQA 2EYSB 1TETH 1IGCL 2WBKA 4N2DA 5FIEA 5CEZE 3DV4A 3VE0A 3MRLA 3BP6A 1FNHA 4L4JA 5DJCA 3SDDD 2ZUTA 2VM4A 3OR7B 3FCSA 3R8QA 2NR6D 1VAHA 2ZF9A 3P0YH 5KW9L 1XCXA 2PCYA 3BZDA 3ARXA 2OSWA 4IOSD 3NGBC 3O41B 4R26H 1JPGA 4N9GA 4Z0BL 3CLEL 3MV7E 4NPYA 3HMWL 2HX9A 2WXJA 3MR9A 4D8PA 4N90E 2VDKB 3UAAA 2LTQC 2NXYC 3OKNA 4OTXL 3U4AA 3ULSB 2B4CH 1QABA 1MI5D 3D39D 3BCDA 1CK0H 1T6BX 2AJXL 1FNEB 1U8NB 2BERA 3SYAA 1Q9KA 3VM5A 3OZ9H 3VXUD 3H3PL 2Y24A 3MKGA 4NLHA 5CJXC 3FOLB 4NRZB 4NC0B 1FN4A 2DKSA 5CJ8A 2XXGA 3GSQB 1QW8A 5JPMC 2XWCA 4OLWH 4YXHH 2DYRB 3F84A 4YHPA 2VDNH 3QW9A 3TNMA 1A4CA 1RJYA 3TIDA 1CL7H 4U6XA 1MF2H 2ALAA 1AD9B 2FX7H 4LDCA 1UC6A 4ABQA 4BFIA 4B9ZA 2MSPA 2PMZA 2FWOB 4S0HA 1HOEA 3TN0A 1UXLA 1MEXL 1J18A 5A3IC 4X6DE 3U4BH 2GUOB 2ICWI 1OF2B 2CLZA 3VI4B 2ZCHL 4ZXBA 3JWOC 4ZTEA 3FQTA 3I6GA 3A67H 4UOQA 5J6SA 5ACZA 1OZUA 3MAWA 4QRTB 5CN1A 3B5TA 4AQEB 3LCYA 1UGNA 4Y16A 4RMWA 3GXTA 2CRYA 3W11C 3HNVL 4YDIL 1HWGB 3HCVA 1FZJB 2BIPA 2KQNA 4LF3B 1U91B 4WW2C 5TGBB 4TYUA 4M62H 3HG4A 2R8SH 1E8XA 2UVEA 1MFCH 2PCPB 3TA3B 1KMGA 2YEZB 2B15A 1YMME 3DOSA 4BELD 3DTXA 3SQOH 2WQSA 2VDKL 3SDDC 1A65A 4EE2A 5FYLH 4MQTB 1IC4H 5GSRA 3QG7L 5E2VH 2XYCA 5IMLA 1M9SA 3UDWA 2WM0A 3KPOB 2N3JA 2XJLA 2BSSB 3QDGD 4UM8B 2YD3A 2GUYA 4WQOA 1X3DA 4OW6A 1KDJA 1SM3L 4GO8A 4XNYL 3NJFA 1A6VL 1R3KA 1T1YA 4MZ2A 4RETB 3W2DH 3DYPA 4HCGA 1AY1H 3HE6A 5BZWA 3AGVA 4PJ7E 2HXAA 4PGJA 1CL7I 1T03H 2YAPA 3MZTA 3LKRA 4HEMA 4ZK8A 3X12B 1Z5LB 2E6PA 3IJ9A 4FC3E 5C0AB 4ELMA 1JZ8A 2ZSWA 4FQLH 4HUCA 4AYBA 3QRBA 4Z7OB 5D1ZA 3A23A 2JQZA 2Y7NA 4TUJA 2L7EA 3J8F7 2K8MA 3KDPB 3WXWL 4TTGA 1R0AL 1OM3H 2CGZA 1FL3A 4UV4H 5TDNB 2DQJL 1U95A 2YUZA 1ZLUH 1IM3D 5JIQA 5DZVA 1AD0B 1G7MA 2IXQA 4L8SB 5AZ2L 1S78C 2BH0A 3EH4B 3NIFE 1I82A 4PWEA 4X6CE 3HE7B 1NDGB 3APCA 3HAEH 5KJ7E 1TQVA 4ANKA 5EF3A 1GYWA 1WAAF 5JIPA 1E9OB 5B8CB 5CEXA 1DVFD 1XGQB 3GJEA 4GUPB 4KKLD 2Q7AA 2C9SA 2QKIB 2VH5L 2D2OA 3K3QA 4MX7B 1EIBA 1HWWA 3LKOA 1CVSC 4JO2L 3EG9A 3B56A 2WKOF 2BC4A 1IU1A 2BFGA 3FK3A 4ZMVA 3GHBL 5BS0D 1QFWI 2PYEE 3UJJL 4G8AC 5EB9A 1FYTB 4J6RL 4A2MA 5C0FA 1OARL 3OGCA 3IE9A 1CXLA 2HZHA 3MLYH 4M3HA 1JP5A 4N2BA 4L37A 4XMUA 5HI5C 3CHOA 1ILSA 2ZAIA 4N0RA 2BHZA 4D0DB 2OJEB 2DOCA 3HPJA 4QKTA 4NN6B 3ZHLA 1D5XB 3AACA 4U0RC 4MNHA 4FS0A 3EJPA 3TZVD 4H88H 1RIUL 4LARL 3VFVB 1T5KA 3DC0A 2P5EB 5F0JB 3TBCA 5IIEA 1DTUA 3RTQC 3ZDZB 5C0GB 2EDLA 2OAAA 4P23A 3FUIA 1JHLL 1S7UB 1HNYA 3ILEA 1JHTA 4A1IA 1W0WA 4JQIH 5DA0B 3BUTA 4ES8A 2W60B 1JWSA 5CJQL 3ZL1A 2R69L 1SGKA 4I8DA 4NHCL 2IANE 3L4CA 3L5WA 1U8PB 4QHUB 2MTAA 5AW0B 4E9WA 1AANA 3MYJA 2OW7A 1YEFL 3VXSE 4PRHE 1RK1B 3K2KA 1GGIH 1ITCA 2C1OA 2F08A 3FF7A 5HDLA 2AQSA 3I9IA 5FCUL 3EUUA 2A83B 2NLJB 3T09A 1OVZA 1Z5YD 2MNJB 1EHAA 1PY0A 1C8PA 4Y5YA 4NQEB 2EEFA 4G6KH 5EA0H 1F11A 1ZVHA 3RWCB 3QORC 3HRZA 4GO6B 1HWHB 4KKLC 3MKKA 3CQPA 2N0KA 3QQ4A 5IR1A 1BQ5A 5LAPA 4L5FE 2EEXA 1REIA 5EO9A 4UQDA 2VZ3A 1ID5I 1UKQA 1ONQA 2DQGL 3HUJB 3T3PE 1EGJL 2E7HA 3F8UB 1X5YA 4CVXB 5E51A 2Q87A 3S37X 3SO5A 1ED3A 5I17A 3V5DB 3IDIB 3RZCB 1LHZA 4QXUL 5KUMA 4IGBC 1BVKB 2RFXA 5DEFA 2BDNL 1WH0A 3GSNB 5DQDH 4K3DH 2QADD 1HNGA 2NZ9C 3DOHA 2VXUL 4ZG1A 4OGYH 5GPRA 4PJ9B 3VDCA 2BIQA 3E1F1 1D5MB 2KH2B 3A47A 4L9LB 5B7FA 3DUUB 1KTKE 2EEAA 3VG9B 1EFXD 4QUOA 2V5SA 1EJ6A 2N56A 3PP4H 5H35A 3TZVC 3HFFA 1N5AB 2XNAB 3OF6A 4YGVA 3JWDL 3P77A 2PO6D 4LZHA 2F8OA 4OSUH 1OSZA 3QPXL 4RFNB 1BQLH 4UZSA 1AR1B 4Y2NA 4JCLA 4PJAF 1Z9LA 5EBLB 3ZE1E 4XX1G 3MOAL 4A7TA 5LCVH 4UYQA 1COBA 1ZT7B 3HS0A 1LP9B 1INDL 4L05A 1L5GB 3TEWA 3EYFB 3QRGH 6TAAA 4KO5A 1H3TA 4UUJA 2OMUA 3CFTA 3ARDB 4GKNA 3IT8D 5C0RH 1MJJB 2GVYA 4KVCH 4Y8DC 2HT3D 3BDYL 3NJKA 2CGRH 3NJNA 3GKWL 4KXCA 1P7QD 5IZ7A 2P9RA 4HF5H 5TK2A 3MV8B 4F7PA 3UGUA 5EUOB 2NNAB 3L3GB 4B95C 3FPXA 3L1OL 4POZC 2VN7A 5DVKA 4JVWA 4LIQE 4OLYH 1G6RB 4CVWA 1W0VB 3A24A 3M17A 3FAWA 4W6YB 1DLHA 3MN8A 3L54A 1ZPLA 1VCAA 1DVXA 5DZAA 3GSNL 2AXGA 1AGEB 4MDRA 3SN6N 4JM2B 1CU4H 2XXFA 4P5KB 1IGFH 2ZXBA 3IDJA 3QWOA 3WTUA 4QRQB 3ASOB 1O7DC 5D96C 1CGSH 1I7ZA 1LO2L 1UZ8B 2HT4C 4M5YL 3UERA 3O3EB 2Z7YA 1ZVSB 4XPGH 3LRLA 4ZX4A 2GIYA 5CP3H 3F83A 5DK2A 5BXFA 1K85A 3S98A 3QFDA 2VXQL 2P7TB 1E9PA 2QADC 1T80A 2NTSP 5K9OA 5AAWA 1NPNA 4R4NC 1ZHNB 1Z3RA 4RESB 1F41A 1EO8H 1FIEA 2Y3AA 3NMEA 5IMOB 4DIXA 4BFRA 4W6WB 4G7YL 5E8DL 4TPRL 3EYQC 4AENB 4PVMA 3DROA 3SPCA 4R97C 5JW5A 2AZUA 2IF7A 2AV1A 3AC0A 3MCYA 2EUZA 2J1XA 1ACYH 4GKZA 4Z77B 1GS8A 3CSPA 3TONA 1KV7A 3DI2B 4NFCA 1JV2B 4IMKA 2PO6C 1CT8A 3B7TA 4O00A 2MTZA 4BQBA 2JCCF 1DJGA 1X5ZA 1FAIL 2YGQA 1WAPA 4NQVA 2JKXA 1UYWL 3MRIA 4U05A 3WIIH 3V55A 3RIKA 4OGZA 3AITA 4JFED 3PG2A 2F5BL 1G6RL 4WO4A 1KBGH 3OHXC 4WHTA 3V4VB 5CCJA 3BZEB 4KK8D 3VJ6B 1RP9A 3VH8B 4KXZH 2EH8H 4KO7A 2GT9A 4A68A 2EDTA 1P9MA 1UURA 2QLVB 5IUCA 1P2CB 2ZE0A 4U4IA 2I32A 1FIGH 4HX1A 4TRPH 5CGBA 1I3UA 5GISL 2VLRE 3IETA 1WAEA 2CJUH 5GRWA 3FFOA 3F7VA 4MJ5B 4TVUA 1ZEAL 4XGZB 3BQUA 3W5NA 2H26B 3TCTA 2WXMA 2XG4B 3OR6B 3BH9A 3QNXB 1QSZA 4B97A 4HPOL 1GYAA 3KVPA 1SXNA 3RQ3A 1CFTB 3LEXA 3VSTA 4Y8AA 5BO0D 5JXEC 5LQBH 3DO4A 4R0LC 4HSAC 1E9QB 1M7IA 3UMTA 4XCFH 5I6XC 3WS6A 1HTYA 2KHAA 4I5BB 1QNZH 4WAFA 4GG8B 4R90H 1I7RB 1CWVA 3IVKA 1YAIA 1QTYT 4RQQA 1IQWH 3N9GL 4GRMA 2OL3L 1G9NL 4E0RA 4ZTOH 2FJHA 2VERN 3BGMB 5D72L 1X5KA 4Q9QL 2O93L 1V3KA 3VFRB 3E6HA 2BNUA 2ZCLL 4XNXH 3VD1A 3ULVF 2JKSA 5HHOE 4D9RD 3V4VL 4Y4FD 5ID0A 1DQQA 1BF5A 3ARGA 2LABA 2UY7B 3RJQB 5AVZB 4D94A 4NRYB 2LOEA 3CPUA 5I5MA 4FQJL 5I6LA 1JV5B 2NYYD 3D2UD 3HI1A 3EJCA 4PRIA 1GSKA 4OUOA 2I60L 5FHBH 4ZMOA 1NH6A 4S1QL 1Q1PA 3O6MH 1UXWB 1EO7A 1OO2A 5FM4A 5I9QB 3CFJA 5E0FA 4LBEB 1MHHB 1ET7A 3APMA 2BINA 1FI8C 5DEGA 5FGBA 4WU5A 1Q38A 1E40A 4NQTA 2G0LA 3EFOA 1A9VA 4Z7QF 3SBWC 3FSZA 4AE0A 4C56E 5CILH 1G7PA 1NGYA 1TVBA 3DPBA 3ME0B 1LL1A 4AVIA 2DS4A 3WN5B 1BIHA 4KKPA 4PJFF 5AG9A 1QSED 2D3LA 3AUVA 1OAKL 1B4JL 2YAFA 3JXAA 1ZKAA 4JQVA 1DBMH 3D34A 1YPZE 3AZUA 5DT1L 1A47A 3H0TB 5IF0A 5HPOA 2K6YA 1QFOA 5KS9E 1SOKA 1YYML 4L1LA 2YXMA 3WHE0 2P8LA 3VRLE 3SPVB 4MSWB 4EQ2A 3D85D 4Q58C 3CFBA 2W9DH 5AWNL 4M5SA 3GB7A 3CSGA 2ZYIA 3PGFL 5H4ZA 1KIRB 3N44B 1ZGLA 4MCZA 2GTZA 4Z3JA 2JSFA 2Y2YA 4R5TA 4UQEA 1D9KB 3RL1B 3W39B 4N0YH 1OOAA 2CXKA 3HHSB 4J5VA 4GUQA 3QH3B 4OCMC 5KVFL 4TSCH 5KSBB 4WHYG 3QWRA 2RALA 5IB5A 3NCJH 2UZYA 1OHQA 3VMOA 3GWJA 5E6RB 1M6OB 4HOZA 3UAFA 3B7RL 5AD0B 3ZL4H 1GZQA 1UB6A 1OZTG 5F1NA 5FF6B 5JDSB 4X9FA 4GYBA 3RL2A 3MJ6A 4BCXA 1THAA 1OM9A 3WKML 3VB8A 3QUMH 2OMWB 4L2LA 2VQ4A 4K7PY 4AQAB 3CDGB 5TF1H 1ZIAA 4O9HL 5FUZL 2ZXCA 2R1XB 1A7QL 5SWSE 4DZ8A 1JGUL 5LO7A 4FYSA 1RJCA 4M1CC 3QJOA 5IBTL 3RDJA 3QJFA 3V0HA 1T7YA 3HKZA 4UAHA 3CCHA 4ZMYA 3ET9F 2ICES 4QY8B 1DZ0A 3LHAA 4JHWH 3AW5A 4K23L 3IBEA 4WW2F 2YPVA 2XZCH 5KVMC 4KXAA 1V3MA 1PLGH 4L4TE 4C55A 1IIKA 3O9WA 4OZ4A 1UWEL 3GYRA 4TM9A 3GS4A 2HWZH 5DHMC 1NGXA 5C0EA 5K9KB 1T21B 4AT6B 2EVHA 2H9GB 4NBYB 5I0VA 3DX1A 3TO4A 1WAAA 4DN4H 3KS0J 4AI7A 1OWWA 2Q2LA 3FS9A 4TSBH 4RRPA 3WBDA 2A9ML 5FB8A 4YIQB 4YQXL 4WUUA 2R4RL 4JG0H 4M02A 5FGCB 5KBPA 2CR0A 1WFMA 5BO1H 4OD3L 5GRUH 5IHHA 3QA3A 3DSNB 3QHFL 5C3LD 2WINA 2OULB 2WKOA 5GGSA 3DIFA 4OV5B 3D4ZA 4U3XA 3G6JE 1S46A 4OCNC 4JPWL 3Q8AA 5F7LB 1U8MB 3QUXB 2X28A 3I02A 3WHXB 1AYOA 5D1XD 5C7ZA 1L0XA 3K72B 4P2OD 1H3PL 3W38A 5HVGB 3ARZA 5INDA 2YRBA 1PG7X 3ML9A 1U4EA 2IDFA 5C0BA 3MRNB 1PZCA 5B7EA 1XAUA 4M56A 3UYRH 1JWUB 2GSIB 5C2BH 4K7PX 4HJJL 4XBPB 4EI5D 2EQDA 5FHAH 2CO7B 4NM4H 4WWKC 1I3GH 3MV11 1C5DA 5ANME 1AQKH 4J2XA 2NUTB 4R7NB 3U79A 1HSAA 2NY5C 3MGAA 1OAJA 4OIBA 3VXPB 1X4YA 2IFFL 1VACA 2IOIA 3H8NA 4ODVL 5IREA 3JV4A 1RCYA 2UY6A 1UUNA 2IBZY 3NIDF 3NK4A 4M8VA 4WGKA 2AHIA 2ADGB 4P5TB 3EXLA 5BZDB 1KLGA 5EC1A 3E9TA 5I0YA 1DUZB 2Q6WA 1KN2H 2AEPH 1CE1L 3LIZH 3TWCH 3JT2A 5CGYD 3HG1D 1XF1A 4R4FH 4TLSA 5C08E 4YUEH 1J5IA 4LCCC 3IM1A 4J2QA 4DGVL 3MRPB 5CF3A 5CHNA 1XGUB 2E5EA 5EBWA 2P5WE 3BH4A 3QG6B 3RB5A 1U8CB 3LKPB 3QDMB 4JFUA 3QO0A 3E8UL 3FU8A 2X42A 4AIOA 4I3RH 4ZAKB 1HJCA 4Y5XC 2OXHA 4NUJB 4R2GC 1G5GA 2Z93B 4ZBJA 4MJ6B 5C2UB 4JRYE 3QEHA 3HVDA 4GP5B 1HKFA 3O3DA 3M88A 3DX4A 2APSA 4HGMA 4FXKA 1F3RB 2EDYA 3UPRA 3KLAB 4JE4B 4JE0A 4J8RB 5K9QG 1Q4NX 1ZATA 4P4KD 3QDJB 4JLRB 4UQ3B 2DN7A 4DFIA 4DP0X 1MSPA 1O6VA 2MOVA 3LHPH 4A7QA 2Z92A 4H7VA 3VXTB 1PG7W 3UTSB 2JELH 3GEFA 4OZIB 2FGZA 5IM7A 5B1BB 4L4VE 5F9JA 2P1YA 3MRBA 5AVYB 4DP7X 3AS3A 4Y5VC 2VSCA 3C8DA 5E94B 2A6DA 1R6VA 4P9MH 4Z7VE 1ZLWK 2WXGA 1OTSD 1UA7A 2ZX8A 1JZDC 3D9AL 3PRZA 1UXMA 1PAZA 1X9RA 3QQXA 3V95A 4YHNB 1R3IL 2I26N 3NSYA 4OZGB 4R7DA 4RIRB 1HI6B 2Y4SA 4EN3A 4FNRA 1X5MA 3TYFB 5AW9B 3PP3H 1UM4L 4K94C 4Q89A 1UZ6F 3FO1A 3EYSL 1MNUH 1NM4A 3BPLB 4U1LA 1WWWX 1F56A 2IBZX 3VFNB 1JZ2A 1X7QA 4LHJB 2WZPA 1HCYA 1AE6L 3V6FB 2EXSA 3DHMA 3JYBA 4OFIA 1MWAH 3B2UC 1WC7A 3KGUA 1NCBL 2B3RA 3WFHA 4UINH 3RYMA 2NDGA 4RWYH 1BQSA 3MLVH 3HI6H 3U9UA 1ZOXA 1CB4A 4QRRA 5IB1A 4JPVH 5JUEH 1BOGA 4FFYL 4RGOH 1W8OA 1FPTH 3A4EA 3HTLX 1ZIBA 2EE9A 5K39B 4RMRA 4PJBB 2FEEL 3TV3H 1KYDA 3ZKXC 4AQ1C 4X80H 5EUKB 1YEDA 2J8UE 3M7FB 5C09E 4UU9A 1KXTB 3FUHA 4NRXA 5DZNA 5KANG 4IYKA 5D7IE 3VD9A 2WUBL 4G8IB 4TLKA 2IV9A 3PABB 5ESVB 4ETYA 1IKOP 1YA5A 3QCVL 3ZKQD 5D71H 2ZKYA 4YDLB 3W5MA 1TTRA 1A21A 1UWFA 4G9FB 5HHQA 4G6MH 2MQGA 3ZK0A 1QMUA 2WLKA 5DC2A 1RULL 1DJIA 2DLFL 4ONHB 1QO3A 4Z7UE 5F3FA 1GGCL 2BWIA 5F7NC 2WLZA 3MRRB 1XF5B 5I71B 3IDUA 2X6MA 2CLRB 1I75A 1RZ7L 3CVCA 4D0CB 5I8EB 1FLTX 1OV8A 4MJHA 3JWNH 5HYJA 2XFGB 3I9GL 1Q9OA 4PGEB 2AK4D 2CK0L 3MX0B 4NDMB 3SKUD 4I2XA 4F8QA 5SWZE 1XZWA 3OLIA 1A5FL 3GGWB 2BNQB 4P46B 1M05A 2IAMA 4W1TA 2APWA 4ILDA 4WSGA 2DY2A 1I85A 3G5VA 4YDKL 1N0LB 3SE3C 3Q0HA 4F8TA 2FEDC 5TPWL 1NAMA 2JCCA 5JOPD 2W38A 4KMTL 5FYKU 2YS4A 2XLLA 3RP1A 2I5YH 3RVWD 4PWGA 4RRPG 3S5ZA 4KBPA 2EKSB 2C3WA 5CEZH 5F21B 5IBUG 4MAYA 1J5HA 3PDGA 5I1DB 2FO8A 1BCIA 2OMYA 1VJSA 3MRFB 4JFFA 3RWEA 3QEUA 1M53A 1MVFA 1OQOA 2G75B 1A1MB 4E41B 4I0PD 4OLUL 3D1MC 4LQ1A 3I3BA 1KGWA 3W82A 5CMAA 3RWFB 4Y4HA 3S8GB 3PWPD 3OX8A 4AV0A 2YQBA 3FNKA 3BEWB 3TBWA 4GAGH 2FBOJ 3VCLB 3PU7A 1T6WA 4LE8A 2EXWD 4PW3A 1GS6X 1N7MH 2G2PA 3OAUL 2A9DA 4X4YB 3ZE0E 4KJQC 2ZOWA 3KJ4B 1GMIA 2YD5A 3FYIB 2OTWA 4FEMA 2OP4H 3MUHL 4X83A 5JQIB 3E9UA 2V3FA 5D1QA 1E4KA 2BCKA 2YUWA 3V8CA 5T33L 3S36H 3UCRA 5F9WB 4DJMA 3NCEB 5GZNA 4XAKE 4ADJA 2Y7LA 1TQSA 4BKLA 1JGDB 4JJ5A 2KDYA 1RK7A 4PU2A 4K5MA 3BVVA 2P42B 3KBFA 1J0HA 4YXKH 4BFOA 1ZWIB 6FABH 3BW9A 3FXIC 3WL9B 1YEJL 1O5DT 2X4QB 5L9DH 2ENSA 4NQCA 5GIRB 2F7QA 3WJJC 3O2WL 3LRHA 4EIZC 1NCCL 1FYTE 1F02I 1EZLA 1T6VN 2Z8VC 3IXTA 4IRZH 4PJDB 1AXSA 2RMNA 4M03A 4XXDB 3PNWB 3EDJA 1KEGL 2HLFD 1HOCA 1SJMA 1T5WA 3KNBB 4LLUA 1Q9WB 3B9KB 1QRNA 2IPUK 4JFDA 5FUOH 4KKCD 1YVLA 3QJHB 3BX7C 5HHVH 4W9HC 3QNZA 3VI3E 1T20A 3NEOA 1MCJA 4M43L 3I6KB 3LZPA 1NIEA 3QQDB 3VW3L 4JFQA 4I0PC 3FQRB 2FUTA 2X4TA 1P6FA 1KGYE 4OCWH 3VTAA 4GP4B 4KRPD 4E36A 2PW2B 2ENPA 3NN8A 2R2BB 1WJ3A 4BGLA 1CFSA 4HAKA 1YZZA 2GTWB 3BP7A 4C4BA 4DP1X 4PJFA 3QXVA 3PDDA 2JB5H 2EXWC 2ZKMX 3P3UA 4WENB 5T5FA 5E08H 1U3HA 3I3EA 3W9DA 4OLVL 3HS9A 3P11H 3D0VB 2E74C 4NUGH 4ZFOA 1WBXA 2HJLB 4G2AA 4F8PA 3VG0H 3OKEA 1KDIA 1BJ1J 3S4SA 1OAUH 5IB2B 4UB0H 5D55A 5AOIA 2OSLB 4A2EA 2VLKE 1EHXA 1DVTA 3C2AH 3N40F 3FB5A 4TULL 2KKQA 5CS7A 1JNHB 4X4MA 1AQDB 3O2DL 4CADB 4M3JA 5EN2B 5I1GL 5E8PA 2XWBB 4OBSA 1DUYA 3G08A 1K2DB 1MG2C 4LCWB 5AZEL 4UOJA 5KVEE 3LZOA 5CFAA 5IV2B 3NTCH 2KMWA 3UMNA 3BKYH 1WA1X 1YECH 1BFVL 3O4LA 1TR7A 1KBBA 5HHMD 5CJXA 3IJSB 1FQ9C 3HZKB 2Z65C 4TOYH 1XCTB 1YEIL 4RFEA 2B08A 3L6FB 1E6OL 5JPMA 1I53A 3W1ZA 3C09B 1QYGH 4A7UA 4EZKA 3MRMB 4BZ2A 3EHBB 2E86A 1NCAH 5BQDA 5MERA 2MEJB 1IEHA 1X5HA 3ZE2F 3B9VA 3L95B 4FZEH 5E9NA 1O6SA 3FFCE 2CMRL 3KAAA 3QULB 4HKBA 5JHLH 2X88A 1FNFA 3BVTA 3RGHA 1GGBH 3BWAB 1XH3B 4DKDC 4JG9A 4KV5E 4N6RB 3I74A 1T0MB 4QXGH 3IU3A 1L6XA 4X5QA 2GJ6B 4QXVA 4LCIH 4LSRH 4CUCA 2JXMA 4JY6A 5KYYB 3C60B 5IB3A 5I23A 1UATA 3MV9B 3MNVB 4NYLA 4YHYC 2F2HA 2VWEE 5MENA 2ERJC 2B1AL 2NNRA 2OR9L 2RB8A 3IFPA 1KJVA 1LP9E 1NEZB 1HE8A 1U8KA 3CIQA 1SF5A 4M8QB 3U2SA 3VUAA 4WW2A 5F0MB 5DD3H 1KGUA 2G0KA 4RZCA 1L4IA 3QIBD 1J8HE 4MMXC 3SBRA 3OWRA 1JZ3A 2PPEA 3KL5A 3SDDA 4YSAA 3V9EA 5CZVH 4JVUA 2W65A 4PJ5B 4PRBB 2NR6A 4Q0XH 1BEYL 2ITDA 4XTRC 1Z9SA 2HCZX 1TU2A 2EILB 5D7JD 2EDRA 4CU7A 4U3SB 1TZIA 3QQ3A 1YMMD 5BOJA 5LXGH 4HGKC 2ODHA 2E7LC 3EDFA 3NJJA 4PPTA 4XPAL 1S9XA 3IJEA 1LDPH 4EO5A 6PAZA 2WQ8A 4ZFGH 1XGTB 4U3HA 1UCTA 4FYRA 1MI5A 3D39A 3K1DA 3CWGA 3RPIA 4CMHC 2HKHH 4HCRH 4IRJD 3FAXA 4K9JA 4L5FH 4MS6A 3VXUA 2O26U 4Z7IA 2VRQA 4NNXA 4G8FB 4JAMB 4AIEA 4M1DL 3UP6A 3U6XA 1S7VA 2H3NA 2VOTA 5DJXB 3VWKD 1ML0A 5L2KE 2DH3A 2Q3ZA 2YXVA 2I7SA 3MPCA 2WUCL 1ZT1A 3IMVA 3ZSTA 3B2VH 4LVHB 4QJ4B 4FNLH 5IJVA 5C8JB 3MJ9A 1BFOA 1WUZA 2O6DA 3RUGB 4JFVA 2CBTA 4LSUH 4K7PH 3SOBL 4G1MA 4GXVL 1ZGLP 1UM5H 2O5YH 3MRJA 1I1YA 5DJAA 4J7RA 4AEFA 4X7DC 4AXWA 3T6QC 3K46A 4MDIB 2V2TB 3BAYA 4PRPE 4PJCF 3WE1A 4JDZA 5F89B 3UABA 3V6ZA 2N59A 4ZNCD 1T0OA 4AH2A 4YHML 3LD8B 2VLME 1D5ZB 4PG9B 4K3GA 4GQ9L 2QMJA 2TSAA 2VMEA 4JDEA 1FG2B 4LGRB 3X13B 2F68X 4ACTA 3T8XB 1SMDA 4EUPA 3QYNA 4V2BA 2LE9A 2W91A 4LHUD 3QIBC 1RSFA 2ZUVA 4P3DA 4GUCA 3BVWA 3X17A 1I7TB 1V7ML 2A0LC 4GBXD 4S1SH 3VSVA 3WUWA 4KJPC 3KR3L 3MCKB 3T0XA 4Q97A 1PZUB 3GXNA 1N59B 2AXFB 4YX2H 1UJTA 1A02N 2EZ0D 3O6KH 4JZJC 4OCRL 3VYPA 3FOMA 4EAEA 3OC8A 3M45A 5C0CA 3QDGA 3HEIB 3S3JA 2CUMA 1FNGB 4DW2H 5HYQA 2VCOA 3MLZH 5I1IH 1NQBA 1RVFH 2UUDK 1DVUA 3GSVB 3LZRA 4Y2DC 4PJXB 1CQKA 2VDOB 4X6BA 1CCZA 3RTQA 4LIQH 5EOCJ 5D6CB 5AQ0A 2APVA 3MFFB 3KLLA 4HJ0C 4NQSB 2GSGA 4L1TA 3P4MA 4HSCX 1ESOA 5I18H 4OB5L 2GAZB 3RJOA 4PVLA 3ABMB 5GGTH 2DB8A 2MWCA 4PREB 4GW5A 5KVGL 3D4CA 3NJLA 3U36B 4PIRF 2LFGA 1IBBA 2ICWA 4QRSB 4TMPA 1I8MA 1VEPA 4K8RD 1GC1H 5FGRA 1DE4B 4AQ8C 2BX5A 3T2NL 4LGPB 4CW1A 2V2WB 5G4MA 2NSMA 4QGTA 3U6RA 4ZPVB 2VIRA 4B7IA 4P57B 1WWAX 3AY2A 4Z78B 3ZHFA 2DQIH 3M8OL 3BSGA 2XT1B 1LEIA 3S4SG 3WTVA 5ENWB 3MODL 3QORA 1AGBB 2MHAA 2VLJB 4GFXA 1D5IH 1MHCB 2EC8A 2QTEA 3LV3A 2NX5B 3OXSA 3VXQA 1FFOB 2QTVA 1AGDA 2R83A 3AXLB 3MFGB 1BD2B 5CNHA 3NP4A 1V05A 5JIDA 2KS0A 3NRFA 3DJRA 3GTVA 3IXAA 5EG6C 4M61A 4K2UH 2P48B 3FQWB 3CX5J 3CDZA 4IGBA 4XVJH 4A1RA 2YKLL 3CAFA 4WJKB 3STZB 3FU7A 3NZ8A 1MFDH 3E6FA 4WEBH 3MJ8A 5DVOA 2WXKA 2VDOL 4PJGB 3ZUNC 3ARVA 3KBHE 3HLAB 4KPHL 1R47A 5D7LB 3WE6A 2DQHL 1QRKA 5BRPA 1FBIH 1KPRB 2C7UA 3QIUC 5C1MB 3F7RA 4CDHA 2WWMD 2XN9D 1KG0A 2EDNA 4V11A 4YLBA 2OR7A 2PW1A 3ZDYB 3TZVA 4XN9A 1JCVA 4EOWH 3WJMB 1OAZL 3ZDXE 2D3JA 3UTZB 2FQFA 2G2RB 3GBMH 2K7QA 2NY6C 3FB8B 5T3ZD 1T1WB 3DDGA 2DQEH 3MACH 4DERA 4MD5A 1L7IL 2OMVB 4XPHH 1S8DA 1ZV2A 2NSQA 4LSSL 5DJ6B 2JNZA 1NGPL 3AQZA 4PB0H 2B59B 3O3AB 4F58L 3TH3T 3TESA 1RZIA 4U6VL 1UB5A 2ZD0A 4JN2A 2P44B 3BKMH 5D4JA 1NGQL 2G3XA 4XB7A 5C71A 3KMDA 1VFOA 4MMYB 5EU7E 1RERA 4FQ1H 2H1XA 4U2YA 2OK0H 4FXTA 4ZPTB 1FZOA 4JB9H 3TBTA 1KPVB 1MELA 1QP1A 2AJ3B 4NZTL 3IF1A 4XNQA 3Q9QA 1U21A 5FA3A 3NCBB 3D2TA 1MQKL 2LVCA 3VGFA 3TO2B 1KTBA 1P4BL 1GZPA 4FG4A 3KPRB 1OGAB 1QOKA 2IH3A 2VL5A 3FB6B 4MVBD 4UZGA 5FO2A 1P1VA 1S3KL 4RFOL 4LVEA 4ELME 3VQLA 2XU9A 3NZHH 2Z9TA 3KYOA 2CZNA 4NQUA 3ZLQC 1MRFL 1TYJA 1KIPA 4U1SA 4QXTA 4MCNA 1XAKA 5I74B 4HDIA 1G0DA 2FGWL 3GK8H 2AV7A 4XCYA 5IQ7L 3LVEA 3GTNA 1DLFH 1VENA 3AADB 4KO6A 1SDDA 5F9OL 5J6HA 5K9JL 3R8BB 1UVQA 2VR7A 2B2XL 3F12B 3OJVC 5AVQB 3QXDB 3APNA 5BRZA 2HG0A 1C16A 1QFPA 4UT6L 5TFSH 1OK8A 2NY0D 5E4EB 1EFXA 5EIIA 1RP8A 1YJDH 4PHZA 4WUKH 1SXSA 1XIWC 4ISVB 3WENA 1GYUA 1QWUA 4FJZA 1ETZA 1IGIH 1T7XA 2ZIDA 4GRLD 4L2YA 4E9TA 5IFJA 5C0IB 3U2JA 3IRZA 1IVLA 2PO6A 3VFPB 3PREA 1R5IA 5ALBL 5LNDA 5G4OA 4X7CC 5KYXB 4OF6A 2A6JA 3MCLL 3TT1L 4OZHB 3SE9H 1CTNA 5TE4H 4G80A 1DSWA 3CK0L 3FCUB 1G84A 1DBKL 5FYKD 3PV6B 2X44D 3FHAA 4IBLT 5AW8B 4F9LC 1UKTA 4W9CC 1YCSA 1UQSA 3PAVA 5JXAL 1DBJH 2Z0UA 1IKNC 4AL8H 5I1AB 5KSAB 1YY9C 5AYUH 4J3OH 3RJDA 4EUPG 1ZXKA 3BZFA 1Z3GH 3NFPB 5T3XL 1LM8V 5JIKA 1AQMA 1BXUA 4ZFZA 5HJ3A 1BVNP 4JZNA 2FEJA 5A6MA 3WUWG 1J1XL 4PY7B 4EF3A 5AVUB 4NBXB 1B0IA 5F7BA 3WEOA 1NDMB 1VFAA 2GJRA 3MXVH 4HWZB 5IMMA 4N8VA 4L3AA 3T0AA 1K72A 3EDDA 4GUOA 2GBTA 2HT2D 2VLRD 4PJ8C 1WQVT 1CLVA 4DN3H 1A3RL 2BK8A 4KRMB 4OZFG 4Y9EA 1MKFA 2AJUL 3UG3A 1C08B 1XGPB 3C6SA 4R3SB 4HAFA 1MCLA 3AB0C 1U8IA 5GRXG 3QFJE 4R0LA 3T08A 2X4UA 4K3EH 2HVKB 4EI0A 3BAEL 1WYJA 5JORA 5JTWA 1AXTL 3QC5X 2QGCA 4FP8H 4IBYA 3ZIYA 4GRWE 1IUZA 1GCFA 3GIZL 2IWKA 4HUVB 1SJHA 3EOTH 3FRPB 4ODXB 3SIKA 1GC1C 1NC4A 1YMHB 2W07A 5FO7B 3RI5F 3IGLA 3G5YA 3UAJD 2ZOLA 5EZOH 4FI6A 1XO8A 1F1DA 2IDSA 1D6VL 4PI2A 1EBPA 4GRLC 1N8OE 4E9XA 4PJHB 4WVRA 1QKZL 4O2CB 2HKFL 1ZDQA 4AYEC 4IEFB 3ZU8A 2VABB 2QHRH 1F4YH 1MRCH 4YK4B 2R0WL 3E2HC 3NA9H 4HIJB 3US1A 3QUGA 1CGUA 2JJSC 2NW3A 4JY4B 2SEBA 1AIZA 4U33A 5DZ9A 3BUIA 3BYTA 4GP8B 1WITA 4LRIA 5LGYA 4JFEA 3ZTDC 3ZHKA 5FXCH 1TKWB 2IAAC 4GKSB 1MW3A 2EYRB 1AHWC 2JKLA 4P05A 4R96A 3SBWA 3SKOA 3ZT5A 5JDJA 3D08A 1AHMA 3QCUH 5CR8A 1J48A 5CXPA 5CBAB 1CLOL 2ICEC 1WICA 2B8OT 2VQTA 3WNJA 4UWQB 2Z31D 3DRTA 4YNYB 5HGDB 2Q9OA 3DURB 3KPSA 5BVPL 3LZQA 1OP3H 5DHDA 5C6TH 2IBGA 3TCLA 4HUMB 1KLUA 3QQ9D 5BZXA 4OAWA 3BAIA 5H8DA 1U58B 3UACA 4GKLA 4LLQB 1NMCB 3GMMB 3AFLA 1JGVL 1Z32X 4MS8D 1QLFB 4JJHA 4DP8X 4YR6B 3KPNB 1WD8A 1CICD 4FQPA 3ZZQA 1U8HA 2OCCB 2RA1A 1SLXA 5BVJB 5E9DA 3L9EA 1IGMH 3Q6FA 2WHVA 3ROOA 5LCVA 4E5XA 2ZAHA 1EAPA 1C5BL 2D0FA 3IU4L 1FO0B 5ESQA 1Z1WA 2BS71 4M7JL 1M3JA 1S9WB 3CVDA 2IMMA 5ADOL 1I4FA 1QR1A 4DK5A 1TDQA 1I9IH 4IMLB 1CLZL 3O8XD 5JLZB 3H9SB 4J3OD 3FFDB 3GFUA 5IHZB 1A6AA 3KW7A 3VYNA 3LQMA 4XP5L 5DHVH 4QYOB 4AJVA 4PJIE 5E8OB 5EO1B 3PPEA 4BGDA 4A6YB 4HU2A 4P99A 3W57A 9PCYA 5T1KD 1S7SA 2LLLA 2E76C 2AJYL 3KYAA 2O6EA 3EJUA 3TFKD 3GC3A 3D2UA 1SHWA 4WGWB 2F1EA 3CSBA 5DJZA 3GMNB 4M3KB 4UOZA 5D7HA 3C87A 1Y7MA 4BUHA 1TENA 5CP3A 3V0IA 1U42A 4Z0BH 3E8VA 5I6MA 3HMWH 2FJFA 3MA9H 5H94B 4OTXH 4AQOA 5CZRA 3CMOH 4H5SB 4XXCA 2VLLB 5HHXL 3WMSA 2WYTA 5B38G 2AJXH 3AQYA 3TFBA 3DMMC 3K91A 1QSEA 4J3SA 4BFFA 4NQDB 4ODUA 5E8NA 4QI3A 1KJ2B 3H3PH 1D7BA 1FFRA 2X4OA 1YJDC 3FJTA 4DVBA 4P3WA 1A4JB 4CMMB 4EI6A 2HTKD 3S35H 4LL4A 1FO0L 5EIIG 1WSST 3QYMA 2M1KA 3WIHL 2E9GA 4AK1A 1IKFL 4OCLC 4UQBA 1ETA1 1TTGA 4KVNL 5JOEA 4P4RB 1TZ8A 5E6IB 2ZCZA 43CAB 3VA6A 4HGWB 1MXGA 4XCEB 4UM9D 1TZAA 1MEXH 4M4PA 4PJCA 5ID1A 1G4MA 5AB2A 2ZCHH 2OYLA 2ZP9A 3UYPA 4Q14A 1F3JB 3VRJA 1Y7VA 4DT2A 4Z76B 1P5UC 1WE5A 3BVDB 4PD4K 4AL8C 3BKJL 1XB8A 3EUDA 4XZUB 3EO0A 4B53A 3HBQA 3ILQC 4NCDA 5I1HL 3LH2L 3HNVH 2BP3A 4MQ7B 4E41E 3B7YA 1A7PL 1T1ZA 5F6HI 1A64A 3MBEC 3LS4L 4HUWA 3L5IA 3GMLB 4V1DD 2UZXB 3MRDB 4FFZL 4XMVA 5AB9A 1P6WA 1JZEA 4PBVC 1PAMA 4IKLA 1TZHB 4JKPH 2D7NA 4A38A 2VDKH 2BP8A 4QRFA 3GMPA 4ONFL 4M7LH 2YAMA 3QG7H 3T65B 4HKXA 2J1ZA 3P4LA 1KLFA 5TTRA 1VCBC 4I18A 5IEHB 2O61B 1OAQL 2EIKB 4FNQA 5F8RC 3PQYD 1MJ7L 1F2XK 2OA9A 4GW1B 2QQLL 1SM3H 2HKAA 2DLEA 4N2CA 4OI9A 4XNYH 1A7NL 2CBMA 1A6VH 3OHMB 3FQNA 4WFFD 4MFHA 4PGCA 5HGAA 2ZKWA 4X6DF 4KJYB 3T0ED 2WO2B 1S7RA 4XZ4A 1BZ7A 4IK7A 2DIAA 1K8IB 3MLXH 1KEML 4MXVE 5IVXE 2WVSA 4LCCA 4KVPA 4NO3B 2HVJB 1NUGA 5EORL 1HHGA 1L7TL 4LQFL 1EJ8A 3HZMA 5JMRA 4AV5A 1CD1A 3GRWL 4PRNB 1R0AH 3FUJA 2R2EA 5DWUL 3M07A 5IB4A 4G5ZL 3K1KC 2BZ7A 3P30L 5D5MB 5AZ2H 1HHIB 3OJDA 3MOQA 5ERWA 1KIQA 4NOFA 3VXNB 4KOCA 4KKRA 3II2A 5I82A 4DUXA 4G11A 3K5RA 4I4WA 2OSYA 2OXGB 3X14B 3FCTA 2V5RA 2VH5H 1AKJA 3GXFA 4JO2H 4J23A 4JRYD 4JRXE 2XICA 4CSPA 2OI9C 2O5NA 3GHBH 3OWEA 5FECB 1L6ZA 5IJBC 4XP1L 3UJJH 1V7NH 3NQKA 4J6RH 5KVDL 5DO2D 3DV4B 3VE0B 2WW8A 3C9NA 3FC8A 3BP6B 4PJ7F 4Y5VA 1HK6A 3I85A 4YAQA 3T8MA 1AO7A 2VDLB 1RIVH 4W9IC 3ECQA 3V5KA 4EI5A 1AZNA 1R3HA 3ARSA 1EAJA 5KSUA 5LXVA 1OCWL 1EEZB 4WV1C 3U25A 1NEUA 1T7ZA 4QTHA 1GVIA 2P8PA 2Z7UA 3BRGC 4N9GB 5FUCE 4NPYB 3DJTA 3ECVA 3MR9B 3U1SL 1XZ0A 2ATPA 4D8PB 4LARH 3WAKA 3OKNB 2C3GA 3NIFF 1XSJA 1R5WA 2DQMA 4X6CF 3T8VA 2XOTA 3QEQD 4X7SL 2ZXEB 5I1KL 2BVQB 5IVZA 3R4RA 2R39A 1JHLH 4UQ2A 1Q9KB 5CU9A 2FTAA 3FL7A 3HG1A 2M2DA 2PNDA 2R69H 2VDRL 4V2CB 3GXIA 5E70A 2YD1A 4MA1C 1IAOA 1T2QL 2CNZA 5DK0A 5IMKA 1BOYA 2H2PD 2N4IA 3FRUA 4PWIA 4TSAL 2L7UA 1YEFH 3ARWA 1JUFA 4YHPB 4HCIA 2F54B 3TNMB 1RJYB 4AQ1A 4U6XB 2VR5A 2F5AL 3LKQB 1DANT 2XFXB 4K7FA 5FCUH 4AKOA 2O5ZL 3DX9A 1FHGA 1DVSA 2P28B 1PVHA 3QUMA 3TN0B 4ADGA 1F86A 1JPSL 4ZDHB 5CD5D 5EZPA 5I1LB 4ZXBB 1MY5A 1BSIA 3DHUA 2N7BA 4TUKL 5J12B 2R59A 3BAJA 4LSVL 5ACZB 3HI5L 4N2KA 3RGVC 1EXGA 1YC7A 3R06B 4WK2B 4FDWA 5I8OL 5DD6B 4HS8L 4MXQD 2RTTA 4Y16B 2VDLL 4MA8L 3VTMA 1EGJH 3V7AG 1S9KC 2PP9A 3HCVB 1GXEA 2ZG1A 4ZOEA 1AZCA 3HN5A 2BY1A 1FL5A 5LWYL 4QXUH 2HAZA 5K1JA 2BNRA 4KJWD 2BDNH 4RX4D 3DOSB 5A2LH 3PIQA 4URTB 3SDXE 1YHPA 5GSRB 1UD8A 5IMLB 1LNUB 4LOUD 3SQBA 3GLZA 1PS3A 1UA3A 2OTUA 1FVEA 3M7OA 1ZPUA 2LU4A 5D93B 3D50A 3FO9A 4KAQL 4GQRA 4POYA 5JOFB 3UTTA 3SOTA 3SE3A 3IFNL 4KY1L 4WFGE 4DOHE 1JN6B 2UXGA 1SMOA 5ABDE 4N85A 2K4AA 3JWDH 2ZUQB 1I1AC 3HE6B 5BZWB 3QPXH 3BP5A 2XHNA 43C9B 5C0BE 3TA3D 4DUVA 4LVNB 2AJZA 5F7FA 5B3NA 3RBSA 3SPGA 4HD9A 1ADQH 4Z3HA 1INDH 3L7FB 1MLBB 5D1ZB 4LAJH 5A2JH 5LUMA 4TUJB 3ZW3A 3QWNA 1XB3A 1WCBA 1TUPA 1TTBA 3IDYB 3O6FC 4DK3A 1FL3B 1UT2A 3T3PF 1U95B 3GKZA 4P2RE 4UI2A 3BDYH 2NYKA 4OIIH 1G7MB 2IXQB 1ZHKB 3GKWH 3SB3A 1DDTA 3QIWC 3UADA 2MMXA 1DSFL 4NT6A 3BVXA 2WSKA 5A43C 2Y2TA 4G8GA 5ICUA 2Y5TB 5CEXB 5CD5C 2EKJA 4HYTB 3GLEA 5DK3A 2AMGA 3KDMA 4LLYB 3F7YA 4PBDA 2YK1L 3PJSA 3B2XA 4NXSA 2HRPL 1ZJBA 1S5HA 5C0AD 1I3RA 3N06B 4DEPC 3GSNH 1PTZA 2R23A 5LVEA 3EG9B 3MLRH 1AH1A 1XXDC 1MCOL 2BC4B 4MXQC 4JFSA 4M9OA 3SJVE 1WT5C 4ORGA 4F57L 2HJFB 5M94B 4M5YH 4L3EA 3LIZA 3TEXA 3OGCB 3QJUB 4QRBA 3MMEA 3U9PL 3UBHA 2WQVA 4KJWC 5IHUL 3HE7D 4L37B 1SJXA 1OWRM 2OMZA 3EJTA 2UZIL 3KXFA 3ZE1F 3X3FL 1JXJA 1IILE 2AK4A 3TVMD 4OD2A 1D7FA 3HPJB 3KYMA 1KGIA 2WQUA 3DYMA 4DO5A 1A7OL 2IJ0C 5CLYA 5FWRA 4G7YH 3MTRA 2BHFA 2F53B 4KZ0A 1WV7T 4MNHB 4Q6IC 4TPRH 4X8JA 5E8DH 2GC7C 3B5GA 4A63A 2WNWA 3AXIA 2PLTA 4QT5A 3W56A 2QHLA 3BAWA 3VNYA 2HG5A 5J11B 4P23B 4MNQE 2AKRB 3M86A 4N6QA 1FYTD 1HZKA 3CN4A 2A73A 3NA4A 4GAAA 2PR4L 1JWSB 3SGDH 1FAIH 4W9KC 1RZKL 3L5WB 3EBHA 3L17A 1UYWH 4I0PA 2AABH 4ZSOE 1GJIA 2GBAA 4PUBL 1U3JA 3MRGA 2A77H 4WFHE 1TYEB 2F5BH 1G6RH 4R84A 2X9WA 5CN2A 2ATAA 5EU6E 2V33A 4GIPD 2C1OB 1JXGA 3OTTA 2R56L 4AIZB 3UIZA 3DNKA 2BCMA 1F45A 1PNDA 3ASNB 3Q6GL 3Q01A 4Y5YB 1DN2A 1S9YA 2P5ED 4K71C 1OSEA 5GISH 4KHXL 1IAIL 1F11B 2X5PA 4KXDA 3HRZB 1DDHA 3ARRA 3K81A 4QHKJ 3QQ4B 1QZ1A 2QDVA 2ZXAA 3NCFB 4X8CA 1QNIA 1HYSC 2J1KA 3BH8B 2JLPA 1SOXA 3BD4A 1ZEAH 1J0KA 1ONQB 5ALCL 1AZBA 1ACXA 1A6TB 1ED3B 5I17B 3IMSA 1NL0L 2N1TE 4HPOH 1J7VR 2J55A 5F7EL 3SD2A 1Q90A 1Q0XL 2WXPA 3BFOA 5DEFB 3H9HB 3QP3A 2KT6A 4ZODA 5AW7B 2NX5E 2N1KA 1G7QA 1UTDA 4XE5B 2V3DA 4HEPG 4QRPA 1WGOA 5IQ9B 5L88L 4NQED 4QOKA 4JMNA 5DA4A 3TVMC 3WNMA 3ALXA 5JPNB 2J8HA 1J5CA 1FH5L 1JPTL 3SGDI 1KTCA 5H35B 2AEWA 3N9GH 1VLXA 2OL3H 1G9NH 3X1FA 1OF0A 3WSQL 4TUUA 2BLFA 5D72H 4Q9QH 3L08A 4CVZB 1TQBB 2IPTL 5LBGA 2V7NA 3P77B 4AENA 2R0KL 4GSDL 1OSZB 1A7BA 2ZCLH 1N3NA 3RZCD 1B2WH 3V4VH 2B9BA 4R6UA 5DJDA 2KLSA 2IDTA 4PIBA 3FU0A 3R19A 1VRSA 2E4FA 4FQJH 3WNKA 4GKNB 1E8YA 4EDWL 3VGAC 5SX4H 1AHKA 4S1QH 3RIAF 4Y4KC 1DANU 3OAZK 4BE5A 1KV3A 1BXVA 2GKIA 2XX0A 3QRLA 4NSKA 1OCZB 3ZKNC 1L0QA 4LVOC 3E7JA 1YY8A 4ZUUA 4F7PB 1RPKA 3H9YA 1DEDA 4MXWL 5GJSL 1F6LL 4QAWA 2EDQA 2JTDA 2X0UA 4JO5A 1CXIA 1AR1D 2A7BA 3HBZA 3N40P 4MMXA 2EDMA 4U1HB 3NP3A 3FO2A 3ETBF 3C6EA 4PS7A 2AXGB 4JFFE 5DT1H 3VA2C 5I30L 3IDJB 3QWOB 3DETD 3X1BA 4XVUC 4BWWA 1I7ZB 3ARDD 3VACA 3MRCA 3UCQA 2K3TA 2WVUA 4ODSL 2V4LA 5H2BA 1NKRA 2X0WA 5KJ4A 5I1EL 3FT4A 3I50L 1CBJA 1LTXA 5DK2B 2E7MA 5AWNH 2E7LA 2CJTA 3QFDB 3MXWL 3PLYA 2VDPL 3P9MA 4HJSA 5I2IB 1A25A 5F2FA 5E5UB 1UH4A 4RWHA 4M5TA 5AVWB 1KXHA 2E56A 2B1OA 3KE0A 1J1OL 1ACCA 3P4OB 3ARFC 1G7HA 2D2CC 2YUXA 3MV7A 5KVFH 2WYIA 4JM2D 5JW5B 4ESKA 4J1UB 1ZLWH 4W70A 2X1WL 1BP3B 3N0AA 2BHUA 3HNTL 4G42A 1SEBA 4JREB 1FV1B 1JFQL 4ATWA 5SX4I 4QTFA 3D18A 4F7CA 1T1XB 4YSSA 1MFEH 3LNIA 3IN2A 4Z95L 3GBLA 1RU9H 4LNRA 2ZKXA 1I8LC 5EEZA 1SOQA 4NQVB 3FHEA 4P3CL 4N8CL 2WGXA 3MRIB 2IWGA 5ILTL 4U7MA 1MIEH 3WNOA 1Y1DA 2XDHA 2IGFL 1BWMA 1IC0A 4X2UA 5F97E 4OUUA 4X42A 4WO4B 4WHTB 5KS9F 4O9HH 4L48A 5FUZH 3IN0A 3L3HB 5I19L 3HZYA 3Q5YA 4XX5A 3VRLF 2GT9B 5T1MA 3AY4C 1JGUH 1NLBL 4X6DA 3FKUS 5IBTH 1AZUA 4HKZA 4HX1B 3OXRB 4FZ8L 5CU5A 1QRNE 2DM4A 5J89A 2NDFA 4FXGB 4K23H 3MBXL 3QIBA 4ONGL 4X4KA 4DESA 3F7VB 2VWEC 2OMXA 2ZXQA 2VLMD 4IRZA 3VDBA 1MHEA 2CO4A 4XOAA 3BQUB 2NXZC 3H4HA 1FGNL 3DETC 3BH9B 2BOLA 1DJHA 1UWEH 2JI2A 4JZJA 4JL1A 4F3FA 1FORL 3D05A 2BVOA 2I9LB 3COOA 1HZHH 2L3BA 4YO0A 5D7JA 3TJEL 4ETQA 3MA7A 4BQCA 5MHSE 4K5LA 1MCPL 4BH8A 2AJVH 4FTVE 1YMMA 3NJXA 5DCCA 4GSRA 1N6VA 3FH8A 3KEDA 5FA4B 4Y2DA 3SGJC 2AP2A 4ODHL 2HLAB 4U6TA 2YGVA 1T3FA 4YQXH 2R4RH 3T2QA 5J5EA 4OD3H 4AM0A 2KZ1B 2WXIA 3QI9B 3QHFH 5F0LB 3IVKB 3QZWG 4OM1L 5PAZA 4P2QB 4X0KA 3SCMC 1DQTA 4JPWH 4E0RB 3B9DA 2OZ4L 1NFDB 1DJZA 1QTSA 2FJHB 3EH2A 2ETWA 3A3YB 4G71B 4UTBL 1PZBA 1R5VA 3E6HB 2BNUB 3VGDA 1OGPA 4AEIL 4PJ7A 2MPAL 1H3PH 5ID0B 1DQQB 2Z1PA 4AQ8A 1JNJA 3OKKA 2YBRB 1PIFA 5DO8A 2C3VA 1VFBA 4PRIB 4K07A 2CLVA 3O3UN 4R7VA 3CFJB 1N8ZA 1V55B 1XVSA 3LZNA 5DEGB 2JKNA 3B5HA 4WU5B 4X6CA 3QZPA 3IAQA 2J6WA 4PCKA 5FYJE 3PWVB 3EFOB 3VXRB 4U1JB 2O6FA 5E7BA 3QUKB 4J8QA 2Z4QA 3DPBB 1B0WA 2IFFH 4ODVH 2H6PA 4ZO8A 3SO3C 1AI1L 3RVTD 1J8RA 1P6AB 4QRUA 5I73B 4LOFA 5I6NA 3ECBA 4GQQA 1CE1H 5DZPA 3OKDA 5ICZA 1RUKL 4ENEC 4FAAB 3F64A 4HBCL 4HIQA 2IPKA 3JV6A 5DJ8A 2HUHA 4DGVH 4F15C 1KGJA 4XNMA 2R1YA 1YYLL 3G6JF 1M6UA 4RMQA 2JJVA 4NZFA 2Y6TE 2ORBL 4NS0A 2X0VA 4XXWC 2PYEA 1VKXB 3HN3A 4G6FB 4HHGA 3E8UH 4HALA 5INCA 3QIUA 1BQRA 1KCSL 4FQXB 5C0ND 3CSYA 3BPNC 3OSVA 3CFBB 4M9PA 1SNRA 2WLMA 4S0TD 5DZLA 1JIBA 3T2LA 3GB7B 5CD3A 5MENE 5CLWA 4LPTA 2AI0L 3RKDC 1Y6MR 4JBSA 5JHLA 3A21A 2BP0A 4MZIA 2ISDA 2EABA 1ZGLB 5LBSA 2GTZB 3LNHA 1UENA 3UTPE 2VMDA 5DRZA 5EZLB 1E27B 3AG2B 5CINL 3BHBA 4YC2C 4IJ3B 4QYAA 2P52A 2P5PA 5BUPA 2X1XR 2KC0A 5HI3C 5IB5B 1UEMA 2UZYB 3GNMH 1JD7A 1J8KA 1DQLL 3AAZB 3VXOA 2HA1A 1GZQB 1UB6B 3HA0A 5F7WC 5F1NB 3ZZLA 2F58H 5BV7H 1CE6A 5I15L 2FCBA 3RL2B 3B8YA 1Y6NR 3NCWA 4XRCA 3T2OA 3B43A 2IANA 2R9HC 2XQBL 2D7QA 3EIFA 2WD0A 3TBSA 3FONA 3ARBB 1MFUA 2HB0A 4GRWH 3D9AH 2BSDA 1MI5E 3D39E 3W0WB 1D9KD 1R3IH 2JK5B 1Z6JT 1VADB 4PI0A 3VXUE 1XGYL 4DZ8B 1UM4H 4QPEA 3CIAA 3VVWA 4JDVA 5J13C 3EYSH 4L3CA 1L9RA 3CXHK 3QJFB 4TQPA 4DUWA 2FIKB 2Y36L 4WWNA 1TIUA 2EDKA 1X5IA 3CCHB 2CKBB 2A9CA 2NY7L 3FUNA 4AYMC 1JZ6A 4HCRA 1AE6H 3S3CB 1SRDA 1MZZA 5D2NA 2ZUYA 1NCBH 2EJ1A 2WAQA 3EJZD 3OQRA 2HLEB 2X89D 3VD3A 4OZ4B 5DRWA 3CXDL 4PTTA 2W0LA 4FFYH 1LWJA 4LLWB 5C0EB 3EOAA 1ETB1 1KWKA 2HFFB 1HH9B 1A1OA 1IBGL 4GY4A 3TO4B 4D0BA 3LEYH 4KRLB 5FAAA 5C0NC 5JZ7D 4PJEA 2ZUUA 5FB8B 2W94A 2ARJA 5IBUB 2QV2A 4IIQB 1N6QL 4TNGA 1XF3B 2BMKA 5H37H 1ND0A 1TFHA 3GMOB 4JDTL 4QDGA 4P2YA 1M56B 3QA3B 4Z7VF 4ZD3L 4NP4L 3QCVH 2J12B 2WINB 3BGAA 3Q8CA 4KFZC 4KI1A 2BPBA 1HCVA 3DIFB 3SDCC 1ZMYA 3U7AA 2CDEA 5DI8A 3MBWA 2WKLA 1UOLA 2NCMA 2Y06H 3I02B 1CFQA 4HIHB 1EEUA 1R33A 3MROA 1LO3L 3RWHA 5D6DC 3SDAC 1RULH 3N41F 4F9LA 2B0SL 3ZX1A 4BSWA 2DLFH 4UQCA 4X4XA 4FL4C 5INDB 1GGCH 1CDHA 3NK3A 1PEZA 2FLRT 3CFCL 1GKOA 3K71A 1RZ7H 2EUWA 1EHNA 1VERA 4FMFA 1HHHB 3H55A 2CK0H 4FLHA 2PABA 3WY3A 1AAJA 4BXSV 2CKBL 1HKLL 5EU7C 2RAMA 4HCFA 3BCFA 1C5DB 4YWGL 3WIFA 1YEKH 4PY8I 2YPVL 1HSAB 3EBAA 4I85A 3V0VA 4FKEA 1N5YL 1P7KA 2CU9A 1FVCB 1VACB 4YDKH 1SZNA 3QUXD 2FATL 2AZAA 2UY6B 3GSWA 2J8UF 2XV2A 4M93B 2QSQA 4PJ8A 1OT2A 4M29A 2BVPB 5LN8A 4KMTH 1KLGB 5D7IF 3P1VA 5EC1B 4OF5A 4N3TA 1IGTB 1NAKL 3CC5A 4OLXL 3WY1A 1PZSA 4CSTA 1AZZC 4DPBX 5KVDE 3K2MC 3VFUB 3ZRSA 3NZSA 4WCYH 1AR2A 1ORSA 1XD0A 4TL5A 5GGTA 3ZYOA 1Z5HA 5CHNB 1MLCA 5EIVA 5GXBB 5A2CA 1JNLL 3V4UL 4OLUH 1DSYA 2W9LA 2G5BB 3QO0B 1V27A 2H32H 4JHZA 4EXKA 4KKZA 4NZRH 1GCYA 1PCSA 2X2YA 3BEVA 5AEAA 1CR9L 4Z7UF 5AENA 3RLSA 2NY4B 5A16A 3KPPA 1XFPA 3OAUH 2MFNA 3FZUC 1BFSA 1PU0A 1PZ3A 4GRLA 3QEHB 4X8GA 2E9IA 4OLEA 4P5TD 4WTQA 5BS0E 4AMKH 4IHOA 3D8MA 4QAMB 5GGRB 3H1ZA 4AUJA 5L6YL 2CCLA 2V9UA 1B0GA 3S37L 3S7GA 4HK0A 1NCJA 3WLWC 1KXQA 4FXKB 3RVXC 3QDHA 2JJSA 4BA0A 4XVTL 3UPRB 1MAML 4EQ3A 4FX5A 4FNPA 4HA1A 5T33H 2FNWA 3M46A 1SN5A 1ZV9A 3QDMD 1YQVL 4NO2B 2CHWA 2PF6A 4Z8FL 2MOQA 4ZAKD 3U7YL 3LXCA 2VNCA 3GZKA 2XIIA 3P9LB 5IM7B 4ZX5A 5F9JB 3MRBB 4ODBD 1QBLL 2A6DB 1EEYA 3PWJB 2ICEA 4PR5B 5AVXB 5TDOA 1UADC 3DBXA 3KLKA 1YEJH 5B1JA 1QPPA 4R7DB 4ZUVB 2HFEB 3O2WH 4EN3B 2KUTA 3B4NA 3D3VB 4UV7L 4KTDL 4MNGE 1IC7L 3P0VL 1F6AA 1MFAL 3FO1B 1HEZB 1D7CA 4MD0A 1FYHB 3QDJD 4PJAB 4U1LB 2VLRA 1KEGH 2H2SC 2Q5BA 3ALWA 2YSTA 2WMPA 3ATAA 5DJYA 3ZE0F 3ABKB 2OZNA