5D7HA

X-ray crystal structure of l,d transpeptidase 2 from mycobacterium tuberculosis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
350
structure length
350
Chain Sequence
b'LVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNENGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 90
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5d7hA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d7hA02
5DZPA 4QR7A 4A1IA 4GSRA 4LZHA 3ZG4A 3VYNA 2MTZA 4QRAA 3VAEA 4Z7AA 3TURA 5DZJA 5DCCA 4GSQA 3VYOA 4A1JA 2HKLA 4QTFA 3ZQDA 5DUJA 4QRBA 3U1PA 5E5LA 4ZFQA 5DVPA 5E51A 4XVOA 4HUCA 5DC2A 5LB1A 4A52A 5E1IA 1ZATA 5DU7A 4JMNA 4HU2A 4GSUA 5K69A 4JMXA 3TX4A 4A1KA 5D7HA 5E1GA 4K73A 3VYPA 3ZGPA 5LBGA 1Y7MA 3U1QA 4LPQA
chains in the Genus database with same CATH superfamily
1L6ZA 1MVUB 3QIUC 1OAZH 3FC8A 4XE5B 3S34L 2W9EL 5GGUA 4LZHA 3UPRB 1JHTA 2VLME 5I0XA 1I3RB 3INUH 4M93B 2VMDA 2CMRH 2CR0A 1NMAL 5LDSA 3V6OC 1M56B 1U4FA 2XDHA 3GSVA 3QUYC 5HHPB 2MCG1 3U79A 1GTFA 4RFNC 3EJUA 3CN3A 3DUUB 5DMKA 3VFNB 5ETUB 5DJDB 4ZG1A 1RZ7L 1M2VB 5D6DC 4WUUA 3QUYA 1H19A 1SYSA 2VO8A 1BZ7B 3V4PL 4FZEH 1YMMD 5DEGA 2XJLA 1YDPB 1S8DA 3FQUA 2RCSH 4AC4A 2NY5L 3NVQA 1L6XA 2FLMA 2OMZA 1S3KH 2BCKB 1NOLA 5DQDL 5HDLA 1T4KB 4YHKH 3N44F 5F89A 4JFEA 3R8BB 4W9IC 5T8IA 3RIKA 3ZZ1A 2Q8BL 3G5YB 1SMAA 4JO1L 2CDEB 3NJNA 4K3GA 3MU3A 4HA1A 3NP4A 3X1BA 3CFJA 1U8JB 1I7TA 5DFVC 3CHPA 5L9DH 4J3OC 1QPKA 2R0LL 5GQBA 5F1KC 1B4JL 2RHEA 4OIAA 2FB4L 4JY4B 4RZKA 1XCQB 4FQCL 2GTZA 4UTAH 4KUCF 2YBRB 1HEZA 4FQHA 1H0DA 1OAXL 4NKMA 4GMSL 4HGKC 2Y7NA 1MIML 4WQOA 1DANT 4RQQA 3SKJH 4H1LH 2PYEE 4HXBL 1K4DA 4MA1B 5TDPB 4FNLL 5CUSH 3ABMB 5E6ID 2UVEA 3F2LA 3PDGA 3T65B 2VDOL 2FD6H 4EIUA 1TIUA 2OP4L 1I4FB 1CT8A 2VUOA 1BQHG 1LDSA 1K6QL 2IQAA 3CFEA 2GK2A 3T71A 5DR5H 2QHRL 2WBJB 1WFJA 4ERSL 5HYFA 1ZAGA 2QLYA 3HG1B 1HN1A 1DJSA 3BPNB 4QUOA 3RVVC 3T1FB 3MRKB 4EOWL 5DUPH 2HXAA 2ITEA 2XXFA 1LQSR 3ARSA 1HS6A 3MV11 2IXQB 4J28A 5TF0A 1AHWC 3SE8H 4M3HA 2JKSA 1A1OA 1IKOP 2DKSA 3QFDA 3U25A 43C9B 5KS9B 7CGTA 4GUPA 4JB9L 2JJUA 5IB3A 1TJGH 3KBEA 4TUJB 2ITDB 3TBVB 4E42A 3QJTB 4JFOA 1FLRH 1T0MA 2FSEB 5DQJB 5EOTA 4H8WC 5FB8A 4CC4C 1ZPLA 1M7IA 3TJPA 3GM8A 1IB5A 4F7TB 1FV1A 4XCEA 4JO2L 4H26A 1ETJA 1LK2B 2JCCA 4MAYA 4ZDHB 2F7PA 1XIWC 5L8JB 3U0TA 4XO3A 1U8LB 5BXFB 1KB5A 1D2OA 3CN0A 4U7KA 4N4YB 2YGQA 5DHVA 1XIWA 1I3GH 1J1PL 1MFCL 1AR2A 3NZSA 5DK2A 1NANI 5AW6B 5DFAA 5FPIA 3MNZB 1IGYB 2EDWA 1P84J 4R2GB 2TRYA 5JYLA 3QH3B 1HJCA 5FFLA 3MFFA 1DUYA 3DTXA 1U8IA 1HE8A 1CFMA 3K0YA 1QUNB 3ILDA 4XBMA 5LDUA 1T21B 3CZUB 1AP2A 2YAEA 2VMEA 3ABLB 3ARGA 3NG5A 4Q2ZA 4R9HA 3OLGA 5CHNA 5EOCJ 2E9BA 1MJUL 4Y16D 4X6DF 4FNUA 1NGQH 4ZO7A 4W93A 1OAKH 3DIFB 2VLJA 2JTDA 3UTTD 1MFBH 4GXVH 3UTZA 1FCCA 2K0RA 3AG3B 2GIMA 2IQ9H 3CXHK 4PV9A 1N6UA 3ZDYB 3ABGA 1K5WA 4HUMB 3D85B 4U1IB 3KPQB 2EICA 2Z7WA 4PTUB 4TQEH 2ZXCA 3C8DA 5B1JC 4ENEC 4KJPD 5EFIA 3QJVB 3H2QA 4KGJA 2BX5A 4X50A 3RZWA 2CHNA 1PLAA 5DZPA 4GQPH 3HKFA 1ZSHA 1PFCA 2WXKA 4NOFA 2RAMA 1MCEA 4JJ5B 4KRNA 5IEKA 2C3VA 1GHFL 4OZFH 1RZIA 4QAWA 1EAOA 5GISL 1S46A 2AJYL 2QKIC 5BRZE 1JPSH 2P80A 5JOPE 5HVHC 1JPFA 1D6EA 5T5FA 4DCQA 5JPMA 3K1DA 1IFHL 3NA4A 1YC8A 1DSYA 4QI3A 2VDPH 4PY7B 3VFMA 4U1JB 4D9QE 4IGBD 1ET5A 5IEHA 1QEWB 2MQGA 2VC2H 3CFTA 2J8OA 3QXUA 4G7VH 1A6VH 4MJIB 4GRWF 4KX8A 5FLVA 1K8IB 1FRGL 3HN5A 3GHEL 5DHDA 1HL5A 1J8KA 3T4AC 1KC5L 1KJ3H 2FGWH 2DQMA 1KJ2A 1MFVA 7PAZA 5IFHL 4JM4H 5GS1C 4BRJA 3MX0A 5F7EL 4AYEC 1TU2A 2DQUH 3KXFA 4MD0B 4AJWA 3RB7A 2F08A 3OJVC 1KYOK 2OMXA 4AK2A 5AAWC 5C0RH 5F3BB 3RFZB 3DUSB 5GS0H 4P5SA 4CMHB 1Y7MA 1BZ9A 2NRDA 1IGIL 3QUHA 5FUZH 2COVD 3Q5OA 4N0YH 3ZDXF 2V9UA 4LE8A 1W0WB 5D7LA 2J20A 1F6FB 4GT0A 5L2KA 3S88H 2J72A 3KGUA 3CLEL 4M00A 3VAEA 3WL9B 1S5HA 3PDOB 1REIA 5SX4I 4WEEA 3CJJA 3CXHJ 3WNJA 5I9QC 3FT4A 3WDJA 4HIJB 3F00A 5FO7A 3THMH 5IVNA 1JXFA 1N59A 3P4NB 2WNWA 1XB3A 4N2BA 3II1A 2V4LA 2ZXAA 2ZUQC 3TVMB 3L9YA 4YDVA 4NN6C 5IV2B 4G6JH 5B3JE 4MDJA 2B7DT 4KK9C 4G8EA 2VAAB 1B0IA 4FQ1L 2WXFA 3QIUD 4JFPB 3P0VL 5I6OA 1THCA 1UUSA 4B6ZA 1UWXK 2R7EA 1XGYL 5TGBA 1KF9B 2AXHA 5ID1B 4FQXC 2X1QA 4PVLA 5I19L 1QA9A 5C08E 4WWKB 4GMTL 3SGDH 4FLHA 4WHYG 2I9TA 4XNQB 4DW2H 4LL9A 3E38A 3LD8C 3GMPB 3QEUB 4HKXB 3OHXB 4BDVB 3BISA 3K72B 5E1IA 3CSPA 2AMGA 4U1HA 3D18B 2BSCA 4JZOB 4MGXA 2HUHA 5DJ2B 4PJ5A 5CZKA 1BD2B 3RTLA 2R2BA 4APQB 1AAJA 2EIZA 2NSMA 1FAIH 4PH8A 2BOCA 2BRRH 2PP9A 2XX0A 4JO4H 4ZT1A 2HJFB 5CD3A 4NSKB 4FAAB 4D0DB 2R23B 2DQHL 2WUBL 3EH4B 2OTWB 4APXA 2IPTH 4G8GD 2UWEA 4NKDA 5DFVD 4PLKC 2RALA 4JHAL 4J3OD 3BVNA 2WCPA 1I9IL 3TH2T 2G5UA 3GSOB 2AJXL 4J3OH 5ADOH 5HHNB 4K73A 4PJ8B 1RUPH 2ALWA 2HG5B 4KQ4L 1GSKA 4M1GL 5FK9B 3SYQA 3UO1H 1TO4A 1JWSB 3CZNA 2HWZL 2I60H 1GZPA 3NZ8B 3VFUB 3WKYA 2J4WH 3QXAA 1IAMA 1A3LH 1OAJA 3DC0A 4XPAH 3T0EC 3RTQA 2F0CA 3K2MC 2WQ8A 4W9LC 4AEFA 2XWBA 2NZ1A 3U0WL 1TMCB 4PGJA 1I8MB 1LMIA 2XWCA 4JFFE 2ZP9A 3VXMB 1PFOA 1EZVY 1YUKB 2CNZA 4G42A 5E2VH 1P4BH 1MJ7H 3M8OL 2LW3A 3VQ1C 2R2EA 3TONA 3WJMB 2A9BA 5AVRB 1FVCB 3ISWA 1EDHA 2GSIA 3LHPH 5JXEC 3A3YB 1FC2D 4TLSA 1OCWH 3RVVD 1KG0B 3QAQA 2WTPA 3X12A 2R4RH 1JWMA 4JRYE 32C2A 2IPKA 3KWWA 4AIZA 5EBLA 4HS6B 5LG1A 2PXYA 4ZQTA 3BFQG 1CGXA 1LK3L 1A6AB 2NW2B 2WJ5A 2YMOA 3IDJA 2B9AA 4QD2E 3EZJB 5CEZD 3PXLA 1ASOA 1NEZA 3DJ9A 3UBXA 2ICWA 3FXIC 3O3BB 5GGRA 2AQQA 3WV0A 5IKCB 4H8WH 1T0OA 3PGFH 1LL1A 1ZTMA 3S3DB 5C0CA 4LEXH 2P9RA 4OM0L 4K3EH 1ZWIB 3P73B 4FHBD 1KB5H 4LGPB 3IU3B 4JUTA 2B3RA 4UQDA 3H6AA 4F58H 4FE9A 4L4VA 4HF5L 4X7TB 5ISZA 3MV9D 5EUOE 1BVKB 5H35A 1J48A 2WUCL 4BINA 1U91A 2WXOA 4X4XA 2BVTA 4YQXH 5ICXB 5KYUA 3MJWA 5GGVY 3UZQB 4OZIE 2OR9L 5TDOA 4NO0B 4OAWB 3DK2A 3U7WH 2KYIA 1X7TA 2K3TA 4MD5A 2YAQA 1DCLA 1KLUA 3DECA 2Z8WC 3HZYB 3CC5B 2FQEA 4XHJC 2JIXA 2G5BB 2A77L 4E9YA 1IAIL 1R6VA 3TT3L 5FS5A 1KTDB 4YLBA 4MQ7B 3PLYA 3SDCD 1IBGH 3H3BC 3V4PB 5HYSB 2WVSA 4I88A 4XBGB 3TWCL 5MENB 2J12B 2LOEA 4Y1SA 5IZ7A 2FATL 5HP5A 4NNYB 3WG7B 2AAVA 3IF1B 1KLFA 2CO1A 3JWDC 4ENED 1IM9B 1YYML 4J3SA 3SPHA 3FQWA 3LMJH 3W38A 2I32A 4UV7L 1XF4A 5D8JL 3O6FB 3LZFL 2WMPB 1EJ8A 3TU6A 3LN4A 5MI0C 2ZNWA 2Q2LA 4XNXL 3FQNB 5JMOC 1A4JA 5I71C 3CU1A 3B5GA 4FXGA 4UINH 3JTTA 1DJHA 3D3VB 5T5FH 1WWBX 2D0HA 4OD1L 3UP1A 4NQXB 3WIIH 4I48B 3N2JA 3DJRA 3H85A 1WZMA 5D1XE 1RJCA 1G4RA 1KXTA 3I6SA 3BSZA 5C8JA 4KH2A 1RSYA 3I9AA 5I82A 3LIZH 4J1UB 2Q6WB 1NZRA 5KSVB 25C8H 1CJYA 2OMVB 5FO2A 4NQDE 1NC4A 1KJ2H 3K6SA 3G5WA 1IFRA 5DJZA 3I6GA 5IFJA 4NC0B 2OYPA 4C56E 1O6VA 1PDKB 3AS3A 1Q94A 3LKPB 4IS6B 3OR6A 4PJEE 1N5YL 1SY6H 5T33H 1XGUB 1AY1H 1XR9A 1AZUA 2RTTA 1J0IA 4BIKA 1BA9A 4A37A 4B3VA 2P8MB 5TQ2L 1G4MA 3GRBA 1JD9A 4XVJL 1M05B 3B9KB 4OZGE 4WTZA 3KM1A 4ZPVA 1T03L 3EZ8A 2WINA 5I6NA 2C3XA 4K23H 3BGAA 2BFGA 2A9ML 3V5KB 4Q6YA 3IJYB 1M6OA 3TO2A 2VN6A 2VQ4A 2WQWA 4PUBL 4DZBA 1CLOL 3PABA 4MASA 5B7FA 1AOZA 4H2CA 5J4MA 2Y23A 3GPSA 1YN6A 2X4SA 3WEAA 3C2AL 3PYCA 1XGRA 5T1MA 1AVAA 2OKMA 4P3WA 5D70H 3MRJB 4NQEE 4BSWA 4U7SA 4OBRA 1CDUA 3T0BA 2IANE 4GP8B 4JY6B 1BZ8A 4KNSA 1C7TA 2F68X 2ZPKH 1Q90A 1EGJA 1UG9A 4KK9D 3RZCA 3AB0B 5E70A 4LT7A 2HLFC 1QRND 2PUQT 4AGQA 1Q1JL 3BP7B 4UDTB 5JR1H 5D72H 3T0WA 5J9PB 2HKFL 3FULA 3MYJA 4LF3B 2I7OA 4GLRH 1MELA 5IT2H 1P0SE 4MXVE 1ZY9A 5C09A 4N3TA 1NCBL 4FI7A 1G5GA 3BAEL 1WHPA 4W6XB 3MXVH 3VXUD 3L5XL 3C5ZC 4ZOAA 4DN3L 4PW4A 1U93A 2NY6B 5L88H 2OMUA 2CLZB 2KZKA 3BKCH 4DQAA 2FR4B 4JDVB 4I0PC 4UI2A 1G7IB 2CHZA 3RAJL 3OMZA 4YNYB 2BHYA 4MAZA 2MH4A 3TESA 5IVXE 3DXAD 3KYNB 3S3CB 1T7YA 3MODH 4LKXB 1EHAA 1KV3A 3GMNA 3M86A 5I8CB 4MMXC 2ZXDA 5DTFA 1YG9A 4NRYB 1NM4A 1E2WA 1DQQB 3SSGA 4QOKE 3UEZA 4A2LA 1CGTA 3B3BA 3JVGC 2DRUA 4ZTEA 3FFCE 3PF2A 3WXVL 4PLKD 4ZOBA 3MXWL 5JNYA 4R3SA 3ULVL 5LNDA 2GJZA 2XNAA 5FO8A 5E8EB 1UWGH 1CXEA 4UT9L 2EUVA 3WKMH 4B9GA 4ZW3A 4GKNB 5EWIH 3HNTH 5FYKE 5IR1A 4K5MA 3LKSA 4P9ML 1ZHBB 1WAAE 1NCDL 2DQIH 5D7SH 3VFSB 1BBDL 3FRPG 4ZSOB 3N43B 4Y9FA 2BCMA 5C92A 4G6FB 3VXSA 4HPOL 3RWFB 5B3NA 1SZNA 4TTDC 2FECI 3DX9A 4KTEL 5EBWA 3C08L 5ES4B 2JKIS 3C6EA 1UH4A 1ZA6A 3X2QB 1GA2A 4XCFL 3ZL2A 5JXED 1CBVL 2X4QB 1TQBB 2F53E 2HCZX 4NX0A 1MCSA 3ILPA 2CIKB 1L9PA 2BP8B 2Q7YA 4YSTA 4BQCA 2R8SH 4XOEA 1QI5A 2EDYA 1OGTB 2DMGA 4NJAL 1HEJC 3B2UC 4HUUA 1HZHH 3GB7B 2YMXH 2ZOOA 4LPVA 4HPYL 3FNKA 2ERJB 1B0GB 3MUY1 4BZ1A 2CRZA 4JVUA 4TSAH 3QWQB 3VFWA 5DDHA 5ICZB 3F7YA 3K4AA 5IHUH 4GAJH 2F5AH 4XO5A 4LHUA 1DEEA 1L7TL 2MKLC 3HB3C 4PJGF 2LQRA 2XQBL 1KGCE 1IBZA 1T4WA 5CINH 2GVYA 1I9JL 4Y0GA 2DI9A 2XWJB 4B96A 3BRDA 3SDDC 1G7HB 3WJJC 4L8CA 4RIRB 1S9YB 4P2QA 3NT0A 4M4RB 5T3ZE 1JUFA 5FM5O 1KNOA 2V9TA 3WFDL 4EI5B 1JYXA 2HKHH 5C0BA 4YDKH 3SDDA 1QRKA 1JV5B 4Q9QL 2W1NA 1D3CA 4I2XE 1W8NA 5FW8A 3LN5A 3QAZC 1IKFL 1DSFH 3S8FB 5TE4L 4JFHE 1C16A 4QRQA 3QEGH 3H6JA 2LHAA 3NABL 4JPKH 3QRFM 3AC0A 1VGKA 2I5YH 2IDQA 4U31A 5E6YA 5EUKA 5FGBA 2Z7UA 4XHJD 5IIEA 5ELIA 4LAQH 4ZUSB 1ICTA 2EVIA 1TTBA 2BNUB 1MQKL 3DETC 3KPRA 2DKUA 4QRRD 2UXFA 4M5ZH 2ORBH 4GRLC 4G9FB 2DLIA 3BLPX 5C1MB 1NAKL 3SCMB 1Q9KB 3TPKA 5EU6A 5DVMA 3GNML 1RFDH 1QMUA 4LSVH 3WIHA 1BGXH 5FUCE 3CUPA 3P77B 1F6LL 3IJEB 4FKKA 1BVNT 1ZLDA 4FYRA 2ICCA 4WFGE 3TBBA 1HINH 5ILTH 1NCWL 1BVLB 1A8JH 4LLWA 2VLMD 1IAIM 3SYPA 3PGDA 4FFWD 4CJ0A 3ARQA 5B39B 3GF8A 4JCWA 1JI2A 4PJXF 3TBYA 4KBPA 3PG2A 2K70A 4ZXBA 3SQOL 1MI5B 1ZLUH 3S35X 1FL5B 4JFDA 2YEZA 3QEQB 3QA3A 3PHOA 4LPXA 4Z77B 1F97A 3IMBA 3AUWB 4L5FE 4LL4A 3BWAB 1BF8A 3BSZH 4TTGA 3D5OF 4UM8A 4ZUTA 4BZ2L 2Q86A 2LU5A 3BT2H 4WSKA 4G1MA 2ADGB 1SOQA 3QWOA 4OZHF 1FL3A 2IWFA 1A6UL 1LWJA 3EJJX 4E41D 4Q14A 5CSZB 2XZAL 1AO7A 2X89D 4XMWA 4POYA 2KPNA 5IG7A 1TQTA 3U2SB 2MQCA 4L1TA 2OMNA 4FDWA 5B38A 3NACH 1F8TH 5AW1B 3SBWA 3VTAA 3PE9A 4G70B 5FA3B 5KSBB 3TC9A 4X6CF 1QHOA 1YPZB 5IROC 3SDXE 1H3GA 2XG4B 4WF7A 4LKCB 5C2BL 2YBGA 2PWHA 4NPKA 5FKAB 1HL9A 1SLWA 4Z3IA 4DP1X 1M42A 1SDYA 3DHJA 3EFFB 3NUKA 4I85A 4NI3A 2R2CA 4O4YL 3A6BH 4NUMA 4BK8A 4CSTA 2R9HC 5MERA 1A7RL 4HDIA 2CH8A 4Y1AB 1AHKA 1I82A 1OKEA 4WHDA 1UM5H 3BUTA 1L0YA 2WB7A 4L8DA 3FDWA 5EPMB 1CR9L 1F1GA 1UJ3A 3KJ4B 5EU4A 4D3CH 4JDEB 5C6PB 1DBAH 1EZVX 4F8OA 2DWYA 2W5PA 2IV8A 1PZAA 3JV4A 5D71L 2YUZA 4YWGH 4KKZA 3Q8EA 3ARPA 4J2XA 1TVBA 3TH3T 3NSXA 1EMTH 2OSLB 1EGJH 3VNZA 1DTUA 5GIRA 3RX5A 4E9XA 2AQNA 3MOAL 4IBZA 2F5BL 2AEWA 3QUGA 3VWJA 2NR6C 4F8TA 5JO5A 4MMYB 4NP9A 1BLNB 1I1FB 1UATA 3D69A 1INQA 3OXSB 4UU9A 1ZIBA 2A7BA 3RU8H 1QSEE 2IJ0C 4D0CA 4J2QA 2BFVH 4AM0B 1ADQA 5GSVA 4JQVA 1A6PA 3PJNA 3ZR6A 4BKLB 2ISDA 2GK0A 3KPTA 4L4TD 5E5RB 4H8HA 1MLCA 1UD6A 3C5ZD 3RWIA 1WHOA 4IKJA 2JI1A 2APBA 4H8PA 2F74B 5IVOA 2VZ1A 1MLBA 4XNAA 4HQQL 4I0PD 1Q0XL 3TIDB 4MA7H 4YJZL 5IGXH 2DQCH 3G5XB 1OP3H 4ES8A 3U1SL 5JW4M 5LWYH 1D5ZA 3UZEC 3R1GL 4IHOB 1OVZA 3DLQR 2D31B 1V54B 2Q9OA 2F6AA 2W60B 2JMRA 1KN2H 4OR1A 4XWOD 2O5XL 2A6DB 3LPPA 4P3CL 3RX9A 4ESKA 1CVRA 1E4XH 2A38A 2NPLX 3BPCB 1D7BA 4O58L 1CLZH 1AR1C 3KH4A 6TAAA 5TE7H 2DEWX 1M9SA 3G6AB 3QPKA 3TYGH 3ZO0A 3QG7H 2C5DC 3SGKA 4JFSA 3WTXA 3NBNA 1CE6B 5AOMA 5T3XD 3V4UL 3IFOA 3OB8A 4MNQB 3EBHA 1UZGA 2AQSA 4JQIA 5LXGL 5T3XH 4YS4A 3JWOL 3NCYS 3QHFH 4G9DA 1PD6A 1CB4A 4NAMA 1C8PA 3L3GB 3EADA 4NM4H 2JB5H 5KYYA 1M53A 2X4OA 3AACA 4IIZA 2Q3ZA 5LBSL 3US0A 2HFEA 3PQYB 4QHPA 1W8EA 5HHVL 3EH2A 2OK0L 1ES0A 1HQ4B 4ZMTA 4ODWA 3RDJA 3B7TA 1I53A 5HGHB 1L9NA 4TTDD 3ZOAA 1FGNL 4AKOA 4YLCA 2AQ3A 3TT1L 5F1NA 3REVA 1JE6A 1R9FA 3QNYB 3SODB 2PW1B 5KOMC 4GW5B 2CCWA 1LILA 2NTSP 2ZKMX 3FQTA 1ZE3C 2VCOA 3IN2A 1FNEB 4F7EA 4YL9A 1QTYT 3SBQA 3U83A 4H40A 5JHLL 1A25A 1HFUA 1EEZB 5FOBB 5BV7C 3B2UD 4PAZA 1ZDQA 4BZ1H 4FI8A 1KGYE 3U6RB 2XA3A 4GKLA 3BSHA 1HXYB 3C60B 4GKZB 4K9JA 3CDYA 2HSIA 3GK8H 3KWVA 2QQQA 1V3JA 3A67L 1G9NL 4CW1A 1D2PA 4LEEA 3HB3D 1R3JB 3L9BA 1QSVA 3P9WB 3D7PA 4LSQH 1ORQB 1IC5H 2NY2C 2O6EA 2H0JA 3QCUL 5L8KB 3SGJC 1LP9E 4DP4X 4MTMA 3SHSA 4RLDA 4ZK8A 3RDTB 2XV6B 3TV3L 1EHLH 4GBXC 1KTLA 1V55B 5EF3A 4LSRL 1UOVA 4WTQA 1TOXA 5M7QA 4N2CA 3K1KC 4OCSL 3MNWB 4GBXA 2VXVH 3MREA 5FHAH 3LEYL 5FECA 3VMOA 1J0KA 4FABL 3WHE0 3BAXA 4N0UE 2R4SH 3TN0C 1A7PL 4LIQH 3VXRE 2ZYRA 1AHMA 5ACZB 3EDEA 2Z35A 2OMTB 3E0GA 3G6JA 3C09B 1F6AB 2I24N 3VFOA 1C12A 5K33A 3DETD 4K7PH 1EFXD 1TEGA 4EN3C 3MRHA 4IEFB 5J1AA 2EIJB 3U9PL 1FNGA 4DPCX 4GRLD 1DVZA 4IKNA 4Y4HA 2F2HA 2QPUA 5T1DH 2PF6A 1IT9H 2JKXA 4RMQA 2W65B 3HZMB 4F5CE 4KOCA 3V0VA 5AEAA 3NRQA 4IMKA 3ZDZB 4PJFF 4OFQA 2I7SA 4OCRL 4JX0A 1D5XB 5ENWA 4Y4KA 4UIKH 5AYUH 2IDUA 2VW4A 1DE4B 2EXTA 2JB6B 4PJ7B 4PJBB 4LASH 1LEIB 3MZGB 4NT6B 1DVFB 5EA0H 3Q8CA 2VQ1A 3APFA 1E28B 3HLAA 4FFTA 3KYMB 3HN3A 2ZXWB 3OXRA 4G6KL 4KXBA 5AB0A 1LO2L 1G9MC 2OLDA 5CSGA 3KPPB 3KDMA 3QJOA 2F19H 2KDGA 2GT9A 1W0VB 5TTRA 4FA6A 4D8PA 4JREB 2IPUG 1K3IA 4YPJA 3QO0A 2ZOKB 3UYRH 1D5RA 4WI8A 1S7VA 4KZEH 1H3WM 4WTXA 4XOAA 3WNLA 5K69A 3BPOB 1P5UB 4HWBL 3AREA 1AXTL 2BIMA 1FDLH 4BKTC 3BIBX 4XPTL 4ZFGH 3RBGA 4M6MH 4IIQB 4P2AA 1S3RA 2QV2A 3DGGA 3E9TA 3L4VA 4ES9A 2D7TL 2B20A 1LVEA 5E8OB 3QFJA 2ZSVA 4PS7A 1O6SB 3TLRA 4YDZA 4PRHB 4FLQA 5DS2A 2GCYA 2WOYA 3LV3A 3DO7B 2NDFA 4OZ4B 1FZKB 2Y7QA 3MRDA 3WD5L 4FD0A 3EYFA 4E9SA 2R9HD 3CZGA 4OLXH 1SJMA 1WBXB 2L7JA 3CLFH 1JF1B 4LMQE 2NLJB 4B5ZA 5CLWA 2UZYA 1TLKA 4TOYH 2R0WL 1TTGA 3RVXC 1KPVA 3GI8H 4JFFD 4LAJH 2P5EE 3NEEA 4P23B 1GGTA 1RJZA 1NPNA 4WGVB 3GXDA 4FXKB 4NQQA 3IJHA 2VABB 5DYFA 1LE9B 1UM4H 2QSVA 3ZGIA 3KPNA 3NA9H 5H37A 1E0OB 3WNIA 5LQBH 5EIIA 4XP6L 2AXWA 2NY7L 2ZAIA 3ECBA 5DHYB 2N7AA 5EEVA 2XFGB 4X2UA 2NR6D 3WIFA 4HK3J 1XXFC 5E2JA 4AWJC 1C5CH 2Z65C 4JRYD 1V3MA 1B4RA 1ADQH 1AGCA 3BUYA 1AZBA 3FCUB 2FEEI 3WGUB 4JZNB 3AFLA 4XBEH 1G7LA 3LDBB 4MNGA 1UM6L 3QBTB 1ZA3B 2D7MA 3ZIYA 3MLZL 5TFSH 2GEEA 2OM5A 1SQ2N 1DVQA 2OR8A 3DHPA 3H9HB 4P5TA 5KVDL 4L8SC 3F01A 3FTSA 4DIXA 4B9JA 3TA3C 1MJ8H 1JVLA 1RD6A 5H8DA 1EO8L 3ROLA 2YFOA 3DUHA 3U4AA 3VI3B 3MCLH 4TUOB 4UAOC 3GWJA 4NKOB 5HGAA 3N5AA 43CAB 3GT6A 4RRPA 1KPUB 2DJUA 2VXUL 4AENB 5LCVL 1P7KA 1XFPA 2ZX8A 3MBWB 5IW6B 4F2ME 2YKLH 3CK0L 3L3DA 5SWZA 1SUJA 3TBTB 3VRLE 1VCBC 4WENB 3EO0B 1QATA 5I5IA 5IF0A 2X4PB 1Z32X 3SPJA 3U48A 1E4KA 3BQUB 3PPEA 4JFXA 1NIEA 5BS0B 1U8QA 3MUJA 5C0IB 4DP9X 2RH0A 3TCLB 1AR1D 4LRIC 1JTOA 4N8UA 4U6YA 1B0RA 4YEFA 1BYOA 1MF2H 4MNHA 4JQIH 3KWTA 4ZZFA 1MHHB 4OLYH 1JS4A 5IHZB 4DO6A 4HH9A 4IQHA 2JXMA 4IBSA 1GIGL 2XWDA 4Z7UE 3N41B 3OGOE 4CRPA 5DJ0B 3HHRB 2YXMA 1TVDA 5HDBB 2R51A 2BNQE 4NQSB 3PV6B 5AZ2H 3VFPB 5I24A 1JPGB 4BKSC 5JHDD 3QO1B 2YZ8A 4D9LL 3MUGB 2QADB 3S4SA 5FUCC 4AVIA 1DQML 2AI0H 2XT1B 3EH3B 1MNUL 5CGTA 5F93C 1BX2A 1MDTA 1U8KB 3PWNB 3ATDA 4TULL 2AXGB 4Y16A 3TIEB 3VMNA 3UTTA 4JR9H 1B9ZA 2XTJE 5D1ZC 2EH7H 1JL8A 4MQXC 4KVCL 4X9GA 2AV1B 2N1TE 4ZPTB 1AZRA 3S5LG 3G6DL 4J3OF 1OAZL 5EEUA 1CDJA 5D1ZA 2KDYA 4LP8A 1ZLVH 1J8HA 5F9OH 1QLFB 3INUL 2CMRL 3DKHA 3PP3H 1T7ZA 5MEQA 5AUMB 5DJAB 1F13A 3AXLA 1VSCA 2AVFA 1MCCA 5BV7H 3A6CH 3MOQA 3KHOA 4U1SB 2XPGA 1XTLA 4LVOB 3ATFA 3PAUA 1KJVA 2VDKH 3BP4A 1TUPA 3FQ4A 5FO9A 2UYLA 4N22A 4UOQA 3U46A 3P4OA 4QT5B 3GSXA 1Z5LB 2GY7B 2YD3A 4ZNEE 3PJSB 4Q0XL 1EAPB 5DYOB 4Z78B 4P9HL 2NY2D 1GPOL 1QFUH 1S3KL 4JCLA 3T77B 1H5BB 2VW6A 1R75A 2N7BA 3DX1A 1P5VB 2EACA 3P4MB 3B9EA 1X9RA 5EIVA 1EZUA 2E3VA 3T5WA 1BFOA 1OPGL 3SIKA 4BM7A 1DVTA 4Y2DC 1RUKH 4EDWH 2MSPA 3SE9L 3TP4A 4I4WB 5CWSA 4P49A 4HGMA 4PEEA 5I30H 5L9DL 1XAUA 1A7NH 5C07E 4PJAE 2Y24A 3LH2H 1GS8A 2Q3AA 4RX4A 2HJKA 1UC6A 4YHZL 4UQ2B 2XBDA 1HOCB 4UTAL 3BZFA 2OI9C 5ERWB 4ZAKB 3X13A 2UX7A 4TVPD 4XAKD 2DI8A 3D50A 4OT1L 3N1GC 4EN3D 4HHAB 4Y2LA 3PNWA 5DA4A 3SKJL 3TJEL 3WJLA 1KEMH 4D7PA 5FGRA 2NNCA 5HSFA 1U2CA 5CUSL 2W07B 2DLHA 2DLGA 2V5TA 2FD6L 5I8KL 4OM1H 4FERA 1I1YA 5D2LB 4RAUB 1UB5A 1ED3A 3GIVB 4ELMA 4FFZA 5DD5L 3SD5A 3ARBA 2J2ZA 1R5VB 3TBSA 1HNGA 1Z9SA 1GW0A 3B37A 3NIGB 3WNMA 2FL5B 5I16B 3OBAA 5AOIA 1M7DB 5JLZA 1JZ2A 4V1DB 2PW2A 4WVRA 4RGMC 3F7KA 4J4PC 4WV1C 2J1KA 2ICES 2YPLD 3ALPA 3SE8L 4P05A 4Z7WE 3BD5A 1GZQA 3CXDH 4Z76B 4ZX4A 3QJFA 5DF0A 1TZIA 4HGWB 5JA9A 4ZFQA 1IM3B 1G9MH 1SJEB 1QZNA 3TEZA 3S2AA 1FLRL 1QNIA 2J8UA 2C1PB 1SF5A 4FN0A 4QRTA 3TPUA 4MDIB 2V8MA 2OYMA 4FTVD 3AWGA 1W2KT 3OKEB 1I8LC 3ZHNA 4KO7A 5GRUH 1G7MA 1T22B 5DWUH 2ETWA 2BK8A 1EHXA 4IKLA 4QOKD 4R5TA 4U33A 4PVMA 1YJDC 4KDTC 1XH3A 4Y5XC 4KHTH 3RE0A 3BW9A 4LSTH 4RISH 3Q2VA 1GGCL 5FOJA 3ZDWA 4BFIA 2DMKA 2HFGH 2W81C 1U8MA 4P0DA 4XXWC 1NL0H 1I3GL 2YAOA 1D9KC 4Q74A 5SWSD 2DS4A 4DP2X 5HDQL 1R24B 1U41A 2AV7A 3CQPA 4UOW0 5E5UB 4KJWC 4QO1B 5F3HA 1X44A 3PL6B 4WHCA 5FYKD 4L48A 1UD3A 4G8GA 5GSRB 1OF2A 5E5MA 4TSCH 5C6TH 3SJVB 2P44B 4LCCC 3WO4B 2NUPB 5GZND 4FQIL 3RVXD 3NCEB 4OFIA 1OAKL 3M17A 3JWNH 3UTSE 1S9WB 1TT6A 4W68A 1JZGA 1MFBL 4YBLB 4MQSB 5H37H 5HPMA 4CC1A 3HPJB 2NUTA 1SUHA 3GMQA 4AYDC 4BFEA 2IQ9L 4QRPD 1TO5A 5CJBA 4H0HB 5IBUB 4K3JH 5FGCE 1P4UA 5I1AB 4GRMB 4DEWA 4TQEL 1BOGA 2CBOA 2XN9B 3EOAA 4JRXD 4NAQA 1BFVH 2BSTB 2ROXA 1JHKH 2YPKB 4G8FB 3MJ7A 4KRPC 4PU2A 5E7FA 3TOPA 2AJ3B 3QUKB 3RWHA 3WBDA 2H1XA 2YS4A 4KKNA 3QJSB 2ITCA 4YHPB 4EE2A 5BUAA 2AJVH 2CCLA 3CH1B 4K2UH 4K9EH 5IMOB 1TR7A 2Y07L 3A4DA 4PY8I 2FT7A 3EUUA 5DJCA 4M93C 5FA4A 5HYJB 1CS6A 3TA3D 1BFTA 3CIQA 3UPRA 1KGCD 5H4YA 1I3RA 2VDPL 4EAEA 4B50A 3KLDA 4JGJA 2VC2L 1RQ5A 2J1WA 4G7VL 3RUGE 2P24A 2CJ3A 2VDNH 3DUUA 2NY0B 4GG6E 3QDJE 3VFNA 1DFBH 4C58B 2X6BA 1JNLH 1DSWA 1M2VA 3WTVA 3GBEA 3M7FB 1BEYH 2FGWL 2GIYA 5ESVB 5KVFE 1BZ7A 2WLMA 3FSWA 5FYLE 2H6OA 4RAVB 1YDPA 1VFOA 3S37X 2OX5A 1ZT1A 3EJCA 4OKVA 4O00A 4YHIB 3QS2A 4HOMA 2VN5A 4KO9A 4CVWA 2BCKA 4HUWA 4Q9RH 3ASNB 1T4KA 3C5JA 2FWOA 4ZUVA 4UV4H 4KMLB 2MCPH 2XKSA 2Z31A 4AGLA 1CQKA 2ZUUA 1YN7B 4UM9A 3G5YA 4Y1TA 3QUXC 5GS0L 2CDEA 4N0YL 1R0AH 1OTTC 3HLKA 1KXQE 1U8JA 5B4MC 4Z3JA 3PHQB 3S88L 3QYCA 1LO0H 3A23A 4JPVH 2Z1KA 4M3KB 2EYSB 4QMEA 5IW1B 2A73A 2FLRT 4R8WH 5IM7B 2N4IA 1CURA 2GYSA 3THML 3E7JA 2J3SA 4JY4A 1XCQA 1ZT4A 4OH2A 4WFGD 1ILUA 3UYOD 1P7QB 1NMCC 2G3MA 4MA1C 1TG8A 4Z7IA 4YHNB 1EHKB 5DUBB 3SDCA 4GSUA 1SQMA 1YNTA 2R56H 4G6JL 3I9GH 4L3EB 4MQXD 1WGOA 4AOFA 2IEPA 3CVHH 4UNVA 1DQTA 3L5JA 4UZGA 3L2MA 3MR9B 2WBJC 4V2BA 1N2RA 2C34A 1JDCA 3O41B 5E6ZA 5GGSA 2BS71 5G5DA 3MMEB 5BRPA 4QYOA 3BPNC 5G4NA 4GUOA 4DP5X 4PBDA 3EHBB 2AZAA 3KLQA 2WBJA 1ETZB 1K8DA 1HQRA 1W80A 4DW2L 3DX3A 1GYCA 4YOKA 3EJZC 1RJLA 3IPEA 3JYCA 1QFWI 1ZANL 3F7VB 3MCKB 3F65A 5B39G 4JM2A 3C5SB 4KHXH 4XP9H 2WTRA 3IGKA 4LDEB 1A5FH 4AQ1B 3TCXA 5D6CB 5I15L 2CGRH 1R3KB 2VLLA 4BD4A 2V2XA 5IUSA 2R15A 1FAIL 3V2AR 4I77H 5K59E 4JO4L 2BRRL 4JRLA 3CIAA 3TBVA 2BVYA 5CR1A 3CCHB 4JPWH 3FOLA 5GJSH 2E8ZA 2FSEA 4N87A 5E6RB 4OF0A 3VXPB 4PJIF 4Y2DD 3WTYA 4F2EA 2QHLA 3OLEA 4PJCF 1D6VH 5AAMC 1EQWA 4BZYA 4HZ1A 4XRCA 4C83A 1J5IA 3L6FB 3B2VH 3QORB 4NUQA 2QV4A 2GHWB 1LO4H 2AJSH 4W9CC 2VWEE 5C7XH 4K94H 4NN7B 3FYIB 3QDME 3Q9PA 4OCWL 1WS7A 2IBZX 1LHZA 3FMGL 3HHMA 4KROB 3UO1L 3PUCA 1WYJA 1RULH 1VZHA 2QSQA 4X99B 3ARDB 3T3MB 2I60L 1QBBA 2J4WL 3MNZA 2CD0A 1A3LL 1EJOH 5DVLA 4UTBA 4XPAL 5K9KB 1QI4A 4N28A 5HJDA 1I85C 3N85H 3FTXA 2Y7SA 3NCFB 3P0GB 1QUNA 1RURL 3QIBB 4FFZH 1AZNA 2GJ6B 3BSGA 5E2VL 1QSED 4OUUB 3AWEA 3DIFA 4Y5VA 1MVFA 4X4YB 3LHPL 4CA4A 1OCWL 5G55A 3WKQA 4G7RB 1EFQA 4J4PD 3QWRD 2R4RL 3B6SB 5C3IA 3KPQA 1FYTB 5KSUB 4XOBA 1FFRA 2G9HB 1LDPH 3EGSA 4M8VA 2J8HA 2MCAA 2QVKA 3O4LE 4M56A 4OJFH 1Z9OA 1YNKH 2A6JB 2E6JA 1BQUA 4QNPF 4KKLD 5IOKA 3P9LA 4FTDA 2YQ3A 4JGMA 5T1KD 3GSRB 5BQ7B 4DKTA 5IJCC 2Z91A 3QNXB 4JJ5A 1GJIA 4X7EC 3OGCA 3PGFL 3QJXA 3WENA 3BKYH 4LEXL 1I1AC 5JQHC 4LCYB 5MP6H 1KBGH 1P1ZB 1KB5L 2A99A 5I8OL 1Q8MA 2GB2A 4O5LL 2M26A 2QQKH 4XC3H 4CBPA 3D4ZA 1D9KD 4NPYB 5CBAB 4YQXL 4G82A 3LZQA 1QBLL 2ZUYA 1ACXA 4YFLI 5I1HH 3S7GA 1AQDB 1T6BX 3W9EB 2VN7A 2WXHA 4BWWA 3H55A 3U7WL 1EO7A 3C6SA 3MGTA 4HAFA 2CA4A 4YC2C 1MDAA 2C9UA 2OMBA 5J7CC 6FABH 4Z7VF 3ZTEA 3KYAA 1TZOA 4JPSA 5JHAA 2ED7A 1HHHB 4G7SB 4TKWA 4NUPA 3EYVA 1IBGL 2QLVB 4M8QA 3RFZA 5DZ9A 1JFQH 3JYBA 2XTJC 1RZKC 1R1CA 2B39A 4GQQA 3FAWA 2O5ZH 3LMJL 3OC8A 4LBAA 3BIAX 4TQ8A 4KRPD 1MFAH 4K5OA 3TVMC 4AV5A 3D51A 4UYPA 2JKWA 1XEUA 3LZLA 2VJ8A 2FH8A 3QIWC 3RIFK 1AGEB 1AKJD 4GQZA 1LO5B 3TVMA 1XF5A 3WKPA 4P4RB 5JDSB 4ABVA 4AYFB 1VEPA 4NO3B 4YDLB 3FO2A 5T5FL 5KWYC 1U3ZA 2VAAA 5CCHE 2EEAA 1LNUA 4WWKC 3WIIL 1GGIL 2ATKB 2OW6A 2DI7A 4FQ2H 3L2LA 3V79C 4G7YH 4PWIA 1GGYA 1MCPL 2XKNB 3LEVL 2W92A 3OHXC 2APSA 4H1LB 4DGUA 1CDHA 1ZHNB 2XA8H 1N3NB 4MA3B 1OD9A 1J05A 1KJ2L 1XF2A 4LPYA 3DNKA 3BN9C 1IL1A 1S7RB 3K4ZA 3D18A 5KJ4A 3VFTA 2NY4B 4YDJA 5TPWH 4ADJA 5DJ2A 1BD2A 2WBWB 1IAOB 1OAYH 2XN1A 2Q1EA 3PU7A 3QG6B 4APQA 1LQBC 3WFBH 3VXRD 1AY1L 5CLTA 1ZS8B 2GABA 4J8QA 2HJFA 2KHAA 2WN2A 4NSKA 4G43A 4GKSA 1ZGLP 2IDCA 4CSPA 2YSSB 1QLRB 2R23A 4D0DA 4K23L 5F9AC 3ZE0F 4DOHB 3QUXD 5ITFB 2D3VA 2Y5EA 3L2NA 2H47C 1KXVC 1OTTD 3FU3A 3BEWB 4PJ8C 5B4MD 2B08A 4KMTH 4MBRA 3GXFA 4WZ9A 4NIKB 4F7MB 1HDMA 4A2HA 1EDQA 3HE6B 2COQA 3FCSB 4DGIH 4HS3B 5D70L 2HG5A 3NCJH 4NDMB 2GUYA 4K7PX 4IRJB 3VXOA 1ZTXH 3CFNA 4RCAA 3HS0B 5FF6B 3K6OA 3KCPB 1YUHB 3CSBA 3VFUA 3HAEA 1H6UA 1QQDA 1KELH 5AOJA 2ZPKL 3AADB 1E4WH 4OB5L 2BDNL 5DZOA 3II3A 3H7BB 4HZLB 2PPFA 3W39B 3BESR 4YFEA 4NN5B 4YFLF 1V3LA 1LWHA 5D72L 2NCMA 3HG1D 3AS1A 1OSYA 4X5WB 1EIBA 4MCYA 2ZOTA 1P4LB 2ZWSA 3ESOA 1FVCA 3Q6FA 1UWFA 3MXVL 3EJYC 4TN9A 3OB0K 3EJZD 4CVXB 2Z3FA 5AAPA 5I74B 4ZS6C 5GHWH 1A7OH 1KG0A 1M3JA 3QR0A 4RBPK 1AGFB 4PHZA 4WW1B 1OGAD 3P1VA 5CP7A 3UYPB 1KDIA 3G04A 2DBJA 4HS6A 1IV8A 3MJ6A 4EZLA 1JGVH 2CBMA 1J0ZA 2NW2A 1TQWA 3BAWA 1OAUH 1MUJB 2WVTA 1TYJA 4ZW7A 1B3JA 1RZ8A 1CICD 1NWOA 1MG2C 1DVSA 2IDTA 4P2CG 4XX5A 4RGNE 4HWEH 1N18A 4XCYB 5TK2A 2FIKB 2QSTA 3CHQA 3IN0A 5CEYA 4U6TA 3F58H 5ANMB 4AUUA 3IU3A 2B1OA 4PR5B 4XXDA 5HGBB 3GUTB 4LCWE 1UWGL 4X5XB 2MPVA 4CC0A 4N0CC 2VM9A 2FX8H 3O11A 4OZFB 5D5MF 5D7IB 2P5ED 3BDXA 3IJSA 2I9LB 4DK5A 5I6LA 4PJDB 4BFRA 1RK7A 4UTBH 5EDXA 5EWIL 3HNTL 2DBLH 5ICXA 3VH8B 3FO1B 3SKOA 5D7SL 2JKJA 4W1TA 3IAGC 3FU0A 3PCYA 3KPLA 4ALAH 2ILLA 4A1RA 3HZYA 2SODB 3P3TA 3LNDA 2PYEA 3KPSE 1QTSA 2G5BA 1U6AL 1Q0YH 4P48A 5EO9B 2NY5C 2VMFA 4PRIE 2PTTB 2LT9A 1IC7L 1YNLH 3CVDA 5BZWB 1GGUA 5GZOA 1DBBH 3STBA 5F0JB 1PZ5B 4FMFA 2R8SL 1ZT7A 2YD7A 4X6DE 1UXSB 4NOBA 3NDZE 3K5RA 1IMHC 1HZHL 3MGOA 3DARA 2YMXL 4I9WE 4LZKA 2GJRA 1ZCRA 3O6FA 1JF5A 4XBPB 4TSAL 5ANHA 5FDYA 2TSAA 4HUCA 3DURB 4OBSA 4WFHE 4GAJL 1UZ6E 4BGLA 2F5AL 2GBAA 4IOSA 3VM5A 4B3EA 1TTAA 2WWKO 1LE5B 3RILA 2APFA 1I1AD 5CINL 4NQXA 5JW3L 1JXKA 2CKBB 3B2XA 4ORGA 1R3IH 4MJID 1U8HA 5KAQG 2AK1H 1DVXA 3EFOA 1E9QB 5LAXA 2Q6WA 4A2FA 5K93A 4JQXA 2O4EA 3U2IA 2DF3A 2XVLA 2E75C 2GQHA 5GGUB 1JHTB 2OMVA 2XIBA 1DSFL 3QEGL 3ELQA 4JPKL 2BNQD 2I5YL 3GSVB 4FQLL 1PDKA 3LKPA 1SXZA 3LKQA 1ZVHA 1NBZB 4GRWE 5DMKB 5C6WH 1E5BA 4LAQL 4IBTA 1XGUA 1NCTA 2NYYC 4UB0H 3T0XA 1SYSB 5AL0A 3WN5B 2XWXA 2P8MA 4XP4H 1KIQB 4DP7X 2G4GA 2ORBL 5MHSD 1M05A 2Z34A 3B9KA 1S8DB 2H0PA 3FQUB 3A5VA 3I2CH 3RIAF 3LSOA 2XTJD 2OMZB 4KOBA 4HCIA 4JW3A 3QRGH 2RR3A 4WO4C 5IB5B 1BAWA 4P2OA 1RZKH 5INDA 4X80L 1A66A 5JIDA 5F89B 1HINL 3ALXA 2YZ1A 5DSCA 2H3NA 2JCWA 1U2HA 3VRIA 2X88A 3NCBB 3ZDXE 3IETB 3CFJB 1KYFA 2ITFA 1I7TB 3MRJA 3QIWD 1JOIA 1EJFA 2BXZA 3AB0C 2MKWA 4JY6A 4OI9A 4XNYL 5CKGA 3QI9A 3UX9B 3OKLA 1OY3B 1RI8A 4ZFZB 2GTZB 4TSBH 3SBRA 3A0OA 4A7SA 4PGEB 4WWKD 5LG6A 1HEZB 4FQHB 3BP7A 3BSZL 4NKMB 2BVOB 5BRZA 3UMNA 3DX2A 1OCRB 3W0WE 4H13C 1TJMA 4B9CA 4C55A 3EDKA 3HJ0A 1K4DB 5HVGB 3GSNA 3QULA 4LLVA 2XC8A 3HNSL 4LLDA 1JJUA 1SVBA 1N0LB 3ISRA 1AFVH 1EAJA 1VAHA 5HHMB 3CFEB 3Q06A 2CLZA 1T0PB 4M5TA 4JDVA 5C0NC 1G7IA 3NACL 1NCAH 1F8TL 4YNYA 4JL2A 3CZFA 3KYNA 4WW2A 3UZVB 3OKYA 3ULUH 1WK0A 4PRDA 1JG9A 5FYJD 1IEBA 1E43A 3SDAC 1A3RH 4HW6A 1D7CA 5FYJH 1A1OB 1RIUH 5CZRA 3QFDB 2X3BA 1DQQA 4G8AC 3DA0A 3ERXA 2J73A 2N0MA 1T66C 2X12A 4GUPB 3S8WA 3H3PH 5IB3B 3OR7A 3WMQA 5EZLB 1UM5L 1UQSB 3ILQC 4PJ8D 4E42B 4JFOB 1T0MB 3HS9A 5EOTB 4JFQA 5CZXD 2VSKB 5FB8B 3M07A 3AITA 2JJVA 3D9AL 4HALA 5LBVA 4D3CL 1DBAL 1FV1B 4H26B 1AIZA 3ZKMD 5BZZA 3VFGL 5C9KA 2JCCB 4MAYB 2XCMC 3ZSSA 4PJHF 3CDZA 1EMTL 1EGJL 1IGCL 1H6EA 4GSXA 1HC1A 1KB5B 4FL4C 3VFSA 3BRGC 4ZSOA 4DTGH 3VXMD 4ABWA 5DHVB 5E2UH 4AQAB 3WELA 2WTOA 5I6XB 1TCRA 2LLNA 2OTUB 3B8SA 3RU8L 4XXCC 4F3FB 3CFDA 4HOXA 4RWYH 4BUGA 2JFCA 5DK2B 1MAMH 1BECA 4A7GA 3MFFB 1DUYB 3DTXB 1U8IB 3OPZL 2ADYA 3EJYD 5C08A 1EX0A 2X4QA 3F12B 1Z0NA 1AP2B 3ARGB 5CHNB 4ZS6D 4BHUI 3CSFA 4R7DA 2X70A 3GTTA 2ERJC 2EDKA 2EO7A 2VLJB 2C1OA 3KYOA 4MA7L 2R59A 2EDQA 4HJIA 1XD1A 3GB7A 5B8CA 5E9NA 2J57A 4YHLH 4H0LC 2E7HA 3KWUA 5LWYL 3TFKC 1B0GA 5HY9B 1YAIA 1NDTA 4UT6A 5AENA 5DRXB 3R19A 4G1EB 4NGHH 3X3FH 1KN2L 3N91A 4NP4L 2XACC 5EFIB 4YSCA 4JZJB 5E4AA 3UROR 4LP5A 4PCTA 3VI4F 5I1GH 2Q8AH 1E4XL 3DSFH 3KL3A 3FCBA 2AK4B 35C8H 3SGEI 5CCJA 2PCYA 1E9PA 3GO1L 4TVSa 5TE7L 5FIEA 4C54A 4EI5C 2VXTH 3TYGL 2XFXA 3ALWA 4N1HB 5K1VA 3PIQB 2KI6A 4X0KA 3ZLQC 3QZMA 5IEKB 3MLPA 4RIRA 5I73C 1L9OA 4I0KA 3MLYH 4CVZB 3QDGE 4OVVA 3QRLA 3MLUH 5D96C 4N0CD 3P11H 1T1ZA 2P8PA 3ARWA 3IPFA 1KZYA 4NO0D 1QACA 1JPFB 1D6EB 2WAHA 4DCQB 2WSDA 5JPMB 4NWTH 3MVSA 4HKZA 4NM4L 4R0LB 3VFMB 1C5DA 2DJ4A 2ZCZA 3WY2A 5IEHB 2PP8A 1CTNA 5FLUA 5JIHA 4P2RE 3TL5A 4OLVH 1IBDA 3CPLB 4ONHA 4UCFA 6PAZA 2CU9A 4Y4FC 3HVNA 3SCMC 4JFFA 2D03H 1GMIA 3BDBA 3AQYA 1IBYA 1KJMA 5SV4A 5MEND 1KJ2B 1XAKA 3V5DA 2XV3A 4G9FA 3MX0B 4Z3HA 5J8OA 4U2YA 1RERA 3CVBA 1IM9D 2NY5H 1YEDA 1JN6B 3KXFB 4XR8C 4OLWL 2BO0A 5IBUG 3P77A 4QRAA 3S3SA 4IDLA 2DQ6A 1RP9A 2WYTA 4BZ1L 4EUPB 3MRIA 3RY4A 2UZIH 4JO1H 1BZ9B 5BO0D 3OV6A 2D4DA 1WIPA 4WEBL 4DH2A 5D7LB 4F2FA 1NIAA 1JDAA 1R5WA 3GK8L 3D3VD 4U7MA 5L2KB 5I1CL 3GXIA 2VLKE 3T6QC 2F58H 4BSJA 3MLWH 2ICEC 1MI5A 5TE6L 1B4JH 1FZOA 3D34A 3GHPA 4UWQB 1NGXA 3PP4L 2FB4H 4FQCH 2X1WL 4LSQL 4Z77A 4DT2A 1WFMA 1IC5L 4X8CA 4BSVA 3BWAA 1KGUA 1BLIA 3VD9A 4CSSA 2PWDA 4GMSH 4HK3N 1Y0LB 3HUJF 3ZL4H 3F83A 1EHLL 4MDJB 5DS8A 4G8EB 5KEZA 1FA4A 2ADGA 4FNLH 1KT2B 3PUUA 3LRMA 1WAPA 1Z9NA 5EUOA 5CSZA 4QCIA 2YD0A 1T1XA 2VXVL 3NFSH 1ZDSA 2Q0ZX 5TGBB 4P5KB 4I3RH 1ID5I 1QA9B 1ACYH 4OZIA 1SLVA 4GAGL 4LIQL 1CO1A 4ERSH 1UURA 5DT1H 5IVXF 1JZ6A 3JVFC 5FA3A 5KSBA 4LSPH 4NQCE 2NYYD 4R4NC 2JKLA 4U1HB 2XG4A 4K7PL 1W9XA 5FKAA 2A3TA 3AU1B 3OKKB 2CR6A 3EFFA 1JSYA 4PJ5B 4Z7QB 5KVEL 2NY1B 2R2BB 3WIHL 4ANUA 2EIZB 5T1DL 3EFDL 4A39A 2Y5QA 3D4YA 4WO4D 2YA2A 3KJ4C 4EIBA 4Y1AA 5CD3B 2B15A 3L3OA 2V7NA 4HS8L 5D1ZI 2C26A 5EPMA 4W9GC 4UIKL 4APXB 5F0MB 5HI5D 2UWEB 2BPBA 4ANKA 3DTUB 3HE7A 4NKDB 3SEPA 1KBPA 3NCYP 1DHKA 4ATTA 1ONQA 2HJLA 3HN8A 2OSLA 3F7PC 2MQ0A 4MMYA 4DPBX 1J88A 1BLNA 1I1FA 2CUAA 4BE6A 2GITA 2LLLA 1J1PH 4NZTH 4P3DB 1MFCH 1U0QA 4IBQA 1W72L 1GZPB 1H8SA 3UYRL 3QXAB 2ZAGA 5GGQH 3DJTA 4BKLA 4KZEL 3RTQB 2OCCB 1VFBA 2EEBA 5D1XA 4ZFGL 3MV7E 1HVXA 1P6FA 3WEXA 4M6ML 3WU1A 2N59A 3US9A 2JKTM 2R2EB 3D1MC 1Z6JT 2OPCA 3IWVA 3NEOA 2ZZUT 4NQDA 5C0ND 3RIAK 2GSIB 3TIDA 5A2JH 3O8XA 2F54E 2CGZA 3LCYA 4A6YA 4XC1L 4C56A 5ID0A 1UA6L 4IHOA 4PJEA 3RP1A 3X12B 2NYZA 3QDMD 5LGKA 3WO3B 1J5DA 1XTMA 32C2B 3SDAD 3LRSB 3QJQB 2W60A 4TUKL 4CBZA 4AIZB 2GEQA 5EBLB 3QNFA 1T66D 4WU7B 1F58L 4OLXL 4OZGA 1JMXA 2A83A 1NEZB 3CX5K 3G6AA 3ILQD 2ICWB 1WT5A 4IRSC 3UBXB 3CTTA 4TOYL 3V52L 5KSAB 5GGRB 2BHFA 3KH3A 2BMKA 4YLQT 1GR7A 2AJYH 1KOAA 1CFTA 1X5MA 1ET7A 1SBBA 5C0CB 1JHLL 4FYTA 2BP5M 4PG2C 3NA9L 3DPBB 3L3GA 4G6FD 2O1AA 1IFHH 4NQEA 4LNRA 2PPCA 1KIRB 2IANA 3ARFA 3PQYA 2XZQH 5JW5A 2OXHA 4X8GA 5H35B 1C5CL 1HQ4A 1G1CA 3TS8A 3GKZA 4H8QA 2BY3A 4X4XB 3KYKH 2N7SA 2J5WA 1BQKA 1PMYA 1CGVA 3U30B 1ASPA 3WI9A 4GSRA 4XBEL 4AQZA 2IWEA 3QNYA 4DFHA 2L8AA 2A4CA 3KGTA 1KLUB 5TFSL 4GW5A 4MD4B 2GSGA 3LAFA 5F7EH 2JIXB 3UG5A 1JYNA 4QXVA 1VACA 4GQRA 3C60C 3L7EB 3VCLA 1EEZA 1MKFA 3FAXA 3MCLL 2OBGA 4ATWA 3QXDA 3EYOA 4UT6H 5F6IC 4OFDA 5DJYA 4DUWA 5D9SA 4GKZA 2YKLL 4TLKA 1P69B 4YXKH 3BKMH 2HTLD 4X9IA 4NIYE 1TFPA 1KLFB 5HTSA 3CLEH 2XQYA 1JV2B 3MO1A 3FQWB 3GRWA 1L4IA 1SFHA 2IWGA 2MNUA 3TBCA 2EVFA 1XF4B 3RDTC 3T6XA 3LN4B 4RA0C 1KBKA 3UJTH 1MF2L 2WJ7A 3QCTH 3OLIA 4GIAA 1A4JB 4JQIL 4EVNB 4OLYL 3FFCA 4FXGB 2OV0A 1CZ8L 4PJGE 3JTTB 3W37A 1HKLL 1LWRA 1LJMA 1NCJA 4WWNA 3CX5J 3P0VH 3B2PA 3MNWA 5AZ2L 1HH6A 1KXTB 2X6MA 5I19H 2I25N 3C09C 1H3TA 1C7SA 1WAAA 4Y2OB 5C7ZA 4UOZA 2O6DA 1BSIA 2AQ2A 3EJRA 2ROYA 1F2QA 2ESVB 2BSSA 5GZNA 2HVKA 3K6SB 1F6AA 3CXFA 4Y4FD 5E0FA 5DJZB 2Y4SA 5IFJB 1HK6A 3TNNB 4HK0A 5FM5M 5J6HA 4AJVA 2CLRA 4P8QA 4IBYA 1PU0A 3GJFK 2MTPA 3X1FA 1R3LA 1XR9B 2XHNA 1NJ9A 3TO4A 3HZMA 3WEBA 2F53A 3MACL 1KTCA 3CHXA 2VQTA 2DQHH 1DVFC 4ZPVB 1D5XA 3PP3K 2WINB 2FGZA 3C8KB 1KPRA 3D52A 3A6CL 2OMWA 1DE4A 4PJ7A 1M6OB 3TO2B 3ULVC 3AY2A 1PKQE 3I6LE 3ATAA 2VDKL 3QEQD 1HSAA 1I9IH 1ZMYA 5KTEH 1YN6B 3KDPB 3KL0A 4CDHA 2BINA 3FKUS 1QSZA 1CCZA 5T1MB 4BELD 5A2FA 4I87A 3GXUB 1VEOA 3KJ6L 4KQ4H 2XBZA 2EO9A 4M1GH 3KPPA 3ATEA 1USQA 3GS7A 3BPOC 4XMKL 1P5UC 3WS6C 4DKDC 5E6UB 1N6QH 1R4XA 1W0VA 2HWZH 2RA1A 2BZCA 2ZOKA 3LRKA 4EZJA 2ED6A 3RZCB 4KXDA 4IIQC 3FTGA 4ONGL 1CL7L 4EDWL 3EO1A 3O6LH 4ZMQA 3OWRA 3QFGA 1NCGA 4H1LG 1KGJA 2ZTBA 3MYJB 1NCNA 1JYWA 1A7NL 3M8OH 5GS3A 5C09B 1E7VA 5FFGA 15C8H 3VSQA 5DHXB 2WQUA 4ISVB 4F15B 5D1QB 5E8OA 4LDCA 1O6SA 1CFQA 2KQMA 4L29B 4FQQA 2F7IA 3WTUA 2X40A 2DKMA 1QSFE 9PCYA 2OMUB 4PRHA 4R4ND 2UXTA 3SE4A 3DO7A 4OZ4A 2ZX5A 5KYWA 1KEML 4M7ZB 4MRCA 1INEL 5D2NB 5HJ3B 5FYKU 1A9BA 3MJ8A 1LK3H 4X6CE 3HI6L 4P23C 1WBXA 4EKXA 1JF1A 1XH1A 2K45A 2NLJA 1WZ1H 3GMNB 3QJHB 4M6AA 3RI5F 4Q52A 2HMIC 1UUNA 4HOWA 4CJ1A 2ID5A 4FXKA 3K46A 1Z5YD 4F57L 1A47A 1JZ3A 2HTKD 4PRPB 5I1DB 4Y5YA 4R3SB 3V4VB 2GJZB 4CGTA 2XNAB 1WZKA 1RK1A 3O9WB 4N2IA 2EUWA 3CXDL 3S36X 2BM3A 1YEGL 1YLBB 2JJWA 3LDBC 3MV8E 2WUCH 3NFNA 3RVUD 5SWQB 1SHMA 2Y6SC 2JLLA 4RMVA 3ZW3A 4JZNA 4OGQC 4AXWB 4RSYA 1Q38A 1ZA3A 2XIDA 3N40F 3VXSB 2WIMA 3H9HA 3GBMH 1JZIA 3D8MA 1HH9B 3B2DC 2GTWB 1CXFA 2IMNA 2J21A 3TA4D 2BVQB 3GFUA 3LZNA 2EDTA 1IAIH 2QKSA 2V6HA 5EBWB 3SD2A 1JZJA 1EBPA 1KLGB 4KHTL 4OI7A 4RISL 4A6YH 1ZA6B 5HHOE 2IAAC 3AQDA 4UNIA 4L4JA 43CAA 2HFGL 2EXSA 3QE5A 4XCCL 4UDUA 1NL0L 3AY4A 3MBWA 3ILPB 1NC2A 3TWCH 3UAJC 4QHNA 4HEPA 5HI4C 4LCWD 3Q01A 3S5ZA 3PWPB 5FM4A 2DYSB 1SFDA 3NJJA 3RWEA 3JV0A 4LMQI 2X4PA 3NH7H 3SDXA 3H9SE 2JK5A 3BQUA 4UV7H 5BJTB 2XYBA 3D39E 5D8JH 1DDHB 4MNQD 5C0IA 4TSCL 3TCLA 3VFWB 5DDHB 5EZJB 4IRSD 4HUVA 4HHWA 2NNRA 4XNXH 2BVEA 1U36A 3C87A 3NIFB 5MEOA 1FFTB 4UQCA 4R4FH 1PZDA 1TZGH 4OV6F 5DJ0A 3V0FA 4K3JL 4OZFG 3DTDA 1PCSA 3DX0A 3N6YA 3ZSTA 4L8CB 3VFPA 1OB0A 3VH8G 1BFVL 1JUFB 3O0LA 1KNOB 4JPQA 3QO1A 3WHXA 3MUGA 5C0BB 3KEHA 4M02A 1YEEL 3Q7JA 4B97A 1YMME 1U8KA 1OGSA 1QSEA 4LU5H 4K2UL 2Q87A 3TIEA 4YO0A 2E46A 2LGNA 1VGKB 4TMPA 4J7RA 5EUKB 3EBAA 4GAAA 4KZCA 4ZPTA 5IIEB 2QGDA 3NCWA 3E6FB 2ZP0T 3KR3H 4CDGC 5E99H 4RAHA 2FDBP 4IKKA 5F9WB 5F7UA 3VGAB 1RUAH 3ESNA 1QLFA 2VN4A 3C60D 3KPRB 2IAMA 4XVJH 2CO7A 5AUMA 4LCIL 1FSKB 2DLEA 1WQVT 4XVTH 1A14L 1W0YT 4HCRA 2G75A 3CUPB 1JNLL 3GRWH 4TQPA 2O72A 2WLLA 1OAQL 2YD4A 3L08A 2WWMC 4LLWB 5DFTA 3RY6C 1H5BC 1WA0X 2X4TB 3PJSA 4X5RA 2WZPA 3OF6A 1XEDA 3CDGA 1JXGA 3TBYB 5I18H 4P4KD 1OM9A 2V2WA 4Q9RL 1ZVNA 4LXFA 1DN0B 1EERB 1P5VA 4ORZC 3P4MA 3OAYH 5DUML 3QA3B 3PHOB 1S7SA 2YEVB 5GRVK 2MCPL 5KS9F 2PPAA 3MLVH 2CQVA 4I4WA 1Q1JH 1R0AL 1KB9K 3T4YA 2IFFH 4UM8B 4POZC 4ZUTB 2Q86B 1LO0L 4XMVA 5BNXD 1NCCH 1W72B 1J0YA 4G1MB 4MS8C 5DMIL 4A7UA 3BAEH 4P46B 1S9XA 4R8WL 1FL3B 2I27N 2BS9A 2MIZA 1AC6A 4A2GA 2TAAA 2QDWA 1AO7B 4HJ0C 1XT5A 5ERWA 4ZAKA 1XZWA 3KNBB 4KTDH 4N2HA 1TNMA 2HFFB 1RY7B 3TZVA 1WFTA 2CO6B 2E9WA 4I8DA 4N2FA 3I9GL 4B9ZA 3E3QE 4HSAC 4XB8A 2ODIA 2D9CA 3IMSA 5E2WL 3RVTC 2W07A 2F1BA 5I6PA 1PZSA 4MSWB 3T0DA 1UOWA 3FQ2A 3UJIH 1IU1A 4RAUA 4OQ1A 2PCPB 1DVFD 7TAAA 5GXBB 2E47A 2MCMA 4OI8A 2DM7A 1YEKH 2DIAA 4HDIB 5DZVA 2JF1A 1CGUA 4BFOA 4D2NA 5I16A 3ULVD 2VUYA 4PJFE 3MXWH 2DV6A 4R90H 4IJTA 4X4ME 4KHXL 4EI6A 3JWOC 4XP9L 1AGDB 5E4EB 1IZKA 1UJ3B 3EOYG 3ESVF 1A5FL 2OSYA 3U2JA 3GTNA 2HH0H 5INCA 4XNDA 1TQSA 2CGRL 2DIBA 2D2OA 4YIQB 1OT1A 3C6LA 3JV4B 3QP3A 4OQTA 4ILDA 4NXKA 1HHIA 2PETA 2W91A 3A47A 4XAWH 2W94A 3FB7B 2X2HA 4JPWL 5GJSL 3TJHC 1NCDH 1G87A 3NJKA 4IDJL 3VWJB 5T3ZH 1LP9A 3D69B 1INQB 4HPOH 1IKNC 2WQAA 2WY3B 1D6VL 2H1LM 3O45A 1T22A 5F7NC 2IH3A 4KX7A 5GSVB 4AZ8A 1T6VN 1E27A 1JRHI 1TEFA 4MCZB 4O02A 1LO4L 1OB1B 4F20A 4OFYA 4K94L 4XCFH 3ZKSD 2P52A 1KB9J 3FT0A 1CBVH 4N0UA 3RWIB 4AVHA 3FN3A 3A4EA 4NRXB 3LRHA 1R24A 5KZCB 1YVLA 1MLBB 4NJAH 4WDIA 3KVPA 4QO1A 1EJOL 1L9TA 3BE1H 1XQ4A 3PL6A 2VB5A 3N85L 4E9WA 4BBWA 3AZUA 4P23D 5AVQB 4FFZL 2C9VA 1MCNA 2Y22A 4YBLC 5F7DA 2HMID 4EZMA 1G9NC 4F5CA 2VKWA 3NAAH 2H45A 3GM0A 1L7TH 3QXTA 3PWLB 5F71A 4UANA 1NFDE 2XQBH 4FYQA 3WFEH 2WNKA 2QQLH 1I9JH 1PY9A 4N2OA 3P3RA 3Q5TA 1NLDH 3IFOB 1N4XH 1OLLA 3RURA 3N42B 3QVAA 1H8NA 4G8FA 3V0EA 1XX9C 4OJFL 1YNKL 3M1OA 2Y6SD 5FM8A 4PJXB 5KYYB 2X6UA 2X4OB 3VQLA 2HFEB 4OCYH 4YHYB 1D7FA 5IMOA 3HRZA 3PWUB 1ES0B 4N2NA 2KLSA 4PVNA 3K0WA 5T1LD 4PRAA 3T0AA 4RH4A 1OSEA 4JFYB 5HYJA 4BCZA 5F1NB 3REVB 1KBGL 1AQKH 4HP5A 4Y7MA 3LEXB 5ICUA 2A1WL 1ODUA 2NY0C 5EIQA 4NC1E 1J9QA 4HT1H 2L7QA 3NN8A 4LOUC 3L3IB 1NAKH 4OZHB 1W6WA 5EZOH 3MFGB 3M1BA 3RI5K 3UAJD 3GNMH 3D0LB 4LGSB 4DERA 1BAGA 3QDGD 5E9DB 1OHZA 1FYHB 2JH2A 3CZJA 3HEIB 3HMXA 3RPBA 5I1HL 5I28A 7PCYA 4QRSB 4TRPH 5ACLA 1A22B 3WY1A 3DO3A 4Y19E 3QDAA 3L4UA 2VYRE 1BZQK 1L3NA 3V9FA 4KFMA 1AXIB 4RMTA 5A6MA 1AXSA 4I5BB 3II2A 2XTSA 4YHIA 3WCYA 1F56A 4HG4K 2KH2B 5CCKH 3IWUA 2G2PA 4FS0A 4CW1B 3SQOH 4JHWH 5KN5B 3RYMA 4PTTA 1WWAX 1A3QA 3NJHA 2P5EA 1I7ZB 1J7VR 1N0XH 2UZPA 1VIWA 3V6OE 1E8WA 1CLVA 4WUUE 4DEPB 3BRFA 3PHQA 5D93B 5KUKA 4LEBA 2JNZA 2O5ZL 4WWID 1KTLB 2EYSA 3RX8A 5JPNB 5E1HB 3BH9A 1MFAL 5IM7A 5AVXB 3WNOA 1T20A 1HI6B 2EABA 3OX8A 4G6ML 3MREB 3GXNA 1PD0A 1J18A 1HNFA 5FECB 4LLMA 3H9ZA 1N8OE 4Q6IA 5KBMA 5KVGL 2Y7MA 4JFEE 5DEZA 5DUBA 4L3EA 2JJTA 3ESMA 2Z35B 2IGLA 1MCKA 3G6JB 2R29A 4HUXB 4NLHA 4Z7OB 1AQ8A 3EHBC 4WWOA 1KTBA 4YDIH 3MR9A 3SDYH 4XVSH 4MYWB 3ETTA 1C12B 4IU3A 3O41A 3VFOB 2K9FB 4FQ2L 5C2BH 2X2YA 3MMEA 4G7YL 3IBOA 2XOTA 1BDYA 3L5HA 4HCRH 4X8XA 2KERA 3OL2A 1ETZA 2XUWA 3F85A 1X5YA 5E94A 4AQ1C 3MUHL 2FO4A 2MRYA 3F7VA 3MCKA 4M9OA 1F4WL 3S96A 4F2MA 5DLMH 3C5SA 4Y4KB 2WWMD 4Z7WF 1ODAA 2ZYIA 4YSAA 4PYHA 3ZHKA 3WFBL 4X5QA 5E5LA 3IDIB 5L4FA 2VQUA 1UD2A 2IALA 3B43A 3FN0H 2FJUB 2YPVA 4ZOCA 3BVTA 3MOAH 3OXRB 2F5BH 5IMMA 1XZ0A 5EO0A 5E1GA 3QORC 3RLSA 4M5SA 4Z7UA 4HG4J 4EDXA 2P26A 4D8PB 1SNRA 4RWHA 4AH2A 3QO0B 5BOPA 1LD9A 3L6FA 1XSOA 2LFEA 3FOMA 1S7VB 4MS8D 4XWGH 5DZJA 1NCIA 2WYHA 3GZQA 4PMEA 2FWSA 4GSQA 2X28A 3ARDC 4URTB 3EYQC 2KKQA 3GC3A 1KMGA 1N5AA 4HJ0D 1G7QB 3B7RL 4N8CH 4N9GB 4AC2A 3T3PB 1BQLL 3JTSA 3PAVA 2EIDA 2QDVA 1Q0XH 3QIBC 1KELL 2Z92A 5CEZE 1E4WL 3BHBA 3QFJB 4Z5RA 4JFWA 3ZZSA 3HNVH 1OW0C 4F37F 2XI9A 5DD0H 3RVTD 3R1GH 3MLRL 3S36L 2DD8L 2GCYB 3LV3B 3NDYE 2CRIA 1WITA 2X41A 3IFPA 5LGJA 1ZLWH 3T2OA 3VNYA 4GFXA 1UT1A 3WKNA 4OUUA 4V1DD 2B59A 2H0EA 5F1SA 2CLVA 5J11B 3EYFB 4QF1A 2WSPA 4X4YA 2ZCLL 2X38A 4XPGL 5GHWL 1NGZB 1A7OL 1OE2A 2UZYB 1JFHA 3MV9E 3V4UH 1KPVB 3KBHE 5LNGA 5KSUA 1IM3D 4F7PA 3N50A 5LXGH 4R7XA 4OQTH 5IP4A 5J12B 4ZQKB 3CZKA 3IJHB 3VG9B 1MCWW 6PCYA 1OOWA 1JGVL 1OCOB 2V9RA 3FCTA 4ZNEA 2AP2A 1OAUL 2WLHA 3DIVA 2A6JA 2F54D 3UBGA 4TF4A 3ECBB 3TBWA 3TJHD 4FJYA 3I6KA 5BQ7A 5FXCH 3WIFB 5HHVH 2FTAA 2OTPA 1M1XA 4WFEE 5E6IB 5EV7A 1V7ML 4FHKA 1NIBA 3K2IA 1BPVA 4AEHH 1FGNH 5JZ7C 1P1ZA 1SRDA 3F58L 4MNGB 3R7QA 4Q56A 5CFAA 1YC7A 1L0QA 4P5TB 5C07A 4PJAA 2FX8L 5IQ9A 3OKNA 1FFQA 1S2EA 4GG6F 3QPQC 4UTBL 5JHLH 2DBLL 1JGDB 4LLQB 3SE3C 3K7UA 4LLAA 3P0YH 3EXJA 1AQDA 5HGAB 3LN9A 3SJVD 3BUQA 4FG6C 4KKRA 4ALAL 3DX6A 3LPWA 4L9LA 1P7KB 1BQ5A 1I8KA 3GEFA 1HU8A 5IF0B 4JNXA 1NEZG 3A67H 3UBXG 4JFXB 3US1A 1S5IH 4P9HC 1U8QB 5A2IH 4U1MB 2CAKA 2XN9D 4XMLL 1YNLL 4PMFA 1XCXA 2BNRD 1AQHA 4J23A 5AW3B 4ZODA 2ZKHH 4HH9B 2VXSH 2JXMB 3HPLB 3I3DA 1SOXA 3MN8A 3TV3H 1JAEA 4CKQA 3ZE2B 5DQ9A 4WY7L 4Z0XA 4Z7NB 2QVFB 3BWUC 5IW3A 1RUML 3EDFA 3IBEA 4CKVX 5F7YC 3PXHA 3LEYH 2NYKA 2XTLA 4XPHH 1A7PH 5JDSA 4AYFA 2H7WA 1H9DA 1BX2B 2BHZA 2O93L 1NBQA 4PGBA 1DR9A 4Y16B 1EK3A 3H0TA 4GAYB 4ZW5A 1R3IL 3UTTB 1VENA 5DO8A 2NY0D 5A2CA 1IO4C 4HETA 4LOUD 3BEVB 2V17H 4ZO9A 3NIDB 5HVFB 5IWLA 2WGXA 1J8HB 1ZHNA 2Y36L 1JIBA 4MA3A 3FUHA 1G43A 1PZ2A 4OCRH 1PY0A 4PG9A 5MEQB 4OTXL 2NQCA 2D7NA 2D4FA 4I89A 2BC4A 2K6WA 3KBPA 3L16A 2XPGB 3MI6A 2E8YA 1IAOA 1OTSC 5E03A 3MA9L 3IYLW 1KJVB 4UB0L 3BP4B 4B41A 5K59F 5FO9B 3SBPA 2UYLB 1FG2A 4P59H 1ZS8A 3ARXA 3P4OB 3GSXB 2B4CL 4U3SA 4XP4L 4DHLA 1QLRA 1NDGB 3KEDA 3EG9A 3I2CL 2IGTA 2NXZC 1LO2H 3UTSA 1IFGA 3BN3B 3ZE1B 5ITFA 3QRGL 1SJXA 3VUAA 2DOCA 1T83A 2ZCHL 3HE6C 5BCAA 3HC2A 4IGBB 3LY6A 1IGTB 3D06A 4QIRA 5C86A 2DN7A 2PTVA 3AT9A 3VXUE 3ARZA 1P7QD 3LZRA 4IRJC 4FI6A 3ARTA 4A2DA 1AXTH 1KIPB 1OEZW 1T2QL 5CWSB 1ZPUA 4XPTH 3IGLA 4KH9A 5AG9A 2W59A 4Z8FH 3HS0A 2AEPL 3DXAE 3LNEA 3LH9A 4CNIB 5C97A 1IUZA 1F45A 1YUHA 5F0LB 3I6LD 4A04A 2R29H 2D7TH 2VLRE 3FTUA 2HJKB 3UADA 4PS4H 2IPUK 3H7BA 3W39A 3G3LA 3BZFB 3Q6GL 5DEJA 3EHBD 1UA3A 3B9DA 4R4BA 4QXUH 3RKPA 1KCSL 1E90A 3PNWB 5I74C 4F92B 4YR6A 4WTZG 2OL3B 5SX5H 3IDXL 5CS7A 1VFMA 3SPVA 3ET9F 1KUMA 1I1YB 3OMAB 3R0NA 5TF1L 3RUGA 4JE0A 3AU0A 4ELMB 3ROOB 2FRGP 3DVGB 3QDJA 4WW1A 3O3DB 2J2ZB 1VA9A 1GJWA 1OARH 2BZDA 1Z9SB 2XG5A 2PO6A 1PX3A 4A66A 4JL1A 2YPVH 2PW2B 3QC5X 3T0EE 3ULUL 4WKZA 1MUJA 4XP6H 3FPYA 3MRPA 1A3RL 1XH2A 2J88H 4JEGB 4NNPH 1RIUL 2X0WA 1JBJA 1QSFD 3PJLA 4F8LA 2IWKA 2WANA 3QIUB 3QORD 2Z7YA 3E9UA 5A1AA 2VNCA 1UFGA 2DQEH 4LPQA 3CFQA 4XCYA 2FIKA 3NOIA 2J8UB 5ANMA 1OM3H 4QRTB 1PX4A 4KJQD 1KXQA 4PJIE 3MLZH 2B1HL 2LABA 3IS1X 2R0ZH 5HGBA 5FCUH 1G7MB 3EYQD 4PJCE 2C3WA 1MFDH 1GAFL 1H9VA 1FP5A 2I9LA 2GAZB 4PJDA 3RNQB 1XH3B 2YC1A 5KBKA 3BW9B 3FO1A 3O2WH 1B2WH 3QIBD 4X42A 4UF7C 1MJJA 2GJ6D 5DK0A 4F24A 1U8MB 2AS5M 2OSWA 4QRFA 2VXUH 4FNPA 4J6RH 4NM8H 5E2UL 3RHWF 4OGZA 1W16A 4NRZA 4RWYL 2AV7B 3CK0H 5I1IL 2AHIA 3N0AA 4AQ8A 4FA7B 3MV8D 4QWWD 1QWHA 5F3HB 5CZVH 5ESAA 3GS4A 4L4VE 3FYEB 1DQVA 5ISZE 3MNVA 4MXWH 1MY5A 2IC2A 1RU9L 4G8GB 1OF2B 1FYTD 1V05A 4PIRF 4I3SH 2XX1A 5E5MB 4EXKA 5I1EL 5BZWA 1SHWA 3RKDC 4UQAA 1PZ5A 1HHGA 1S7UB 4CN6A 5F1OB 1A4KA 5GS0C 1A7QL 1GIGH 3GLAA 4NI6A 2NUTB 5D7HA 3FZUC 4AK1A 1PTZA 3LNFA 4XMXA 5EORH 5HHOD 3WEOA 1BZDA 4XBPA 2D2CC 2BOLA 4NGHL 4N5EC 3VD3A 3K4DA 3X3FL 4LRNH 3DURA 1PVHA 4PWFA 4DKFL 3U9UA 1RHHA 3MJ7B 2Q8AL 1MCOL 1DQMH 2H8PA 35C8L 4QHKI 1KYAA 3RWHB 1KTJA 2EXWC 4OY9A 4QNPE 1QG3A 4QRRE 1DJGA 4YPGA 5DVNA 2CKBA 3UCRA 3FO0H 2ITCB 4YGVB 5JZ7D 2NNAA 4PM1A 1WTGT 2E7MA 2L04A 1DCEA 1UT9A 2EDDA 3MLYL 4KVCH 5DJCB 5FA4B 3AJ7A 1J9CT 3F5WA 3M46A 3S35H 3P11L 3U6XA 3VA6A 3G6DH 3QDMA 3MLTB 2PPDA 4NWTL 4JGUA 1AHWB 1K3ZA 1NGWB 3MRMA 1AYRA 3UTOA 4FG6D 1G0DA 1O7DE 1SYVA 2P24B 2DLFH 3GLDA 4OLVL 3RQ3A 3K91A 1NBZA 2BY2A 2QGBA 4YZWA 2BIIA 2D03L 3OC5A 4NFCA 3WN5A 3CQQA 1KIQA 4KKPA 4XNBA 4TNGA 4Q0XH 4LHUG 2OX5B 1ZT1B 4OKVB 3VD5A 4EPSA 2NDGA 4P9HH 1HCYA 1CFSB 4QR7A 3EYUH 1GPOH 4Z7VE 5IB5A 2W95A 4HUWB 1YPZF 3C5JB 5CKAA 4E41E 4JKLA 2L4OA 2FWOB 3MV9B 4AYSA 2GI7A 4ZUVB 2B14A 2Z31B 4U1LA 1OPGH 1OTUC 2UZIL 4EQ3A 4UM9B 2ZSWA 1X6NA 3SE9H 4FNSA 3IETA 1HL4A 2X5PA 1X9QA 2WQXA 1OF0A 1U8CB 3O4LA 2F58L 3MLWL 2A73B 4KK6D 1SMOA 3FSOA 4MXQC 1WP6A 1P84K 4YHZH 1ZT4B 5CP3H 4ZFZA 2DM3A 4M1DH 2QPEB 3DDGA 4PGEA 2DYPD 4JN1H 3R8QA 3MBEA 2YLKA 1MIEL 1BF2A 1IQDA 4QGTA 4OT1H 2EXYC 2BVOA 1GKEA 4YE0A 3SDCB 1YNTB 4ZI8A 3ZL4L 3TJEH 3B5HA 1CDIA 4QDGA 2HG0A 3NMEA 3PREA 3DRTA 3B9VA 3H56A 4M48L 1UA7A 1E3FA 2VH5H 1N2RB 5I8KH 1N0LA 5GGSB 5G5DB 3HR5A 3NFSL 5J89A 1MY7A 1NEUA 4QYOB 4I3RL 4A52A 3UTQB 1E4JA 5AVVB 1ACYL 1IGMH 5DD5H 2MHAA 2XY1A 3GEWB 1K8DB 1HQRB 2ENJA 4AW4A 2A74A 5T5NG 5DT1L 1RJLB 1OTSD 4WJKB 3UZVA 4LSPL 3BXNA 2Y7LA 2RFXB 5FUOL 4JM2B 5LN8A 2WTRB 4EQ2A 1N10A 2CRMA 2QKIB 2VLLB 4GNKB 2AZUA 2H6UA 2NXZD 5IQLA 2V2XB 3QQXA 3LQZB 4RETB 2K6YA 5EZLA 3HE6D 1UQSA 3FOLB 4L4TE 1MFUA 4IRJD 4MAYC 1UCBL 1CN4A 1BQRA 2XBTA 3ZE0E 4AGMA 1IILE 5DI8A 4FG4A 4QRUA 2WZAA 3A22A 1MCLA 4XRCB 1CDCA 1U3JA 4C83B 1KN4H 5I6XC 4L1SA 1PG7W 1N70A 4JFUA 5AB1A 4BK5A 1GGCH 1X4YA 1ZVSA 3F7LA 3FN9A 4KMQA 5B38G 2Z0BA 5ICYB 4HXAH 4AQAA 4KK5C 2OTUA 3I9PA 4NZTL 4F3FA 5HDQH 4M43H 5GS2H 1U3HA 3SY0B 1KIUA 3GSNL 5GGQL 2FO8A 3ARGC 2BS8A 3B56A 5T3XE 3F12A 2MTAA 2KBGA 3AM8A 4FQIH 3FUMA 2F7QA 4Y5VB 5KVFH 4LVNC 5FYLH 5EOCH 2DQTL 2G0KA 1RV6X 2W88A 2FWLB 4HJSA 3Q13A 2EZ0C 5HY9A 4IJ3C 5DRXA 3ZKNC 4G1EA 4NNXB 2ATAA 1GCFA 1UZ6F 3E1F1 4JZJA 3EGSB 1KWGA 3EXLA 1QRNB 3NJLA 2AK4A 4H8UA 4FULA 3FB8B 1CFBA 5LNEA 3P9LB 4YVNA 1NDMB 4QXTB 1BG9A 3VYNA 4KRMB 5J13C 2Z91B 3PIQA 5L8LB 5JPMC 2Y07H 3AWFA 3OGCB 3TM6A 4CADA 4CVZA 4JAMA 4ZX5A 3EOTH 2VZOA 1D5MA 1MRDH 1U3NA 2WZ5A 1OL0A 4R0LA 2E74C 3EW3B 2XWEA 1OPOA 2EEXA 3NJFA 3TNMB 2XZQL 3OHMB 2CK0H 5D5ME 1MG3C 1OZTG 4MJ6A 1QD0A 3KYKL 3CPLA 5I66A 1P1VA 4LVHB 4TNFA 4BFGA 3K5SA 4P2QE 3C6SB 2XPZA 3MGTB 5L6YH 5DVOA 5I23A 4OJEH 3FQRB 2AANA 4KKQA 3GS0A 4GXUM 1F4AA 3BH8A 3OM3B 4MFHA 5JIIA 3RKDD 1JN6A 2VMCA 4DEUA 2WQRA 4OF7A 4IOIA 1Z0MA 5GS0D 2EIMB 3EYVB 1SXAA 2HT4C 4M8QB 4UT6L 1LXMA 5ECGA 2E9GA 2XXCB 4EUPA 5JORA 3FZUD 4I3GA 4OIFA 1TXKA 5FAAA 4YXKL 5TK4A 3BKML 2W8CA 2V7HA