3A6BH

Crystal structure of hyhel-10 fv mutant ln32d complexed with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a6bH00
1XF2B 1CQYA 4LSSH 4PR5B 2UUDK 1LEKB 1SBBA 4JAMA 2Y36H 5DK3A 4NN5C 1GHFH 3P4LA 3LPFA 3V4UH 5EO9B 3REWB 5GSVB 4XHQA 5C70A 1IAIH 2WZPD 2K9UA 2B1HL 2H6PA 4EJ1C 1JNNL 3WIHH 1QA9B 5D7IB 3CDCA 5LQBH 1PY9A 2V5YA 2P8MB 4KMTH 1FVEA 4FQJL 1JPTH 5BV7H 5D7LD 3QIBA 4FQLL 5E2UL 3SE4A 3BZEB 1T0MA 3DX6B 1BOGA 3QB7C 1A3RL 4R90H 4PFEA 4JFHE 5KN5B 4S0SD 1DUZB 4JZJB 1YJDH 4D9RD 1YEHL 2EE3A 1MVUB 3B9KA 1J12A 1DEEA 3QNXA 2XFXB 5C0CB 4Z0XB 3HCVB 3N1GC 3AXLB 5E2JA 1EHLL 4HJ0C 4TSBH 4RMSA 4ORZC 2UVFA 3TNMB 2GK0B 4AEIH 1DUYB 4WHTA 4YO0A 4P2RE 3VWJA 1CXHA 1JWUB 4WO4B 4D0BB 5DXWA 2E9IA 5LGHH 2MHAA 4YGVB 1LO5A 1JWMA 3OHXA 3VFWA 2EIEA 2VQTA 4PJAF 1VGKA 4HV8A 5LXGL 5SWSB 1VACA 5LAXA 3IKCB 1YPZE 3ALXA 2FX7L 3EFDL 5HHXH 4KJPC 2R0ZL 2VKXA 3ARWA 2XKNA 3WFEL 4K3GA 4TVPL 3PJSB 2D9QB 2YXFA 1QD0A 2UV3A 5GGVH 1CFSB 1C5BL 3I02A 3PDGA 2WIIA 4ONHB 3GMLA 4JZJC 4U1LA 4QY8B 2JCCA 3G04A 3MLTA 1GGBL 2R2HA 3K80A 2DD8H 4Y16B 4LEOA 1IEBB 4ZUUB 1I85C 1J9CT 3HHRB 3ULUC 1HHIA 1IGCH 3TPUA 4PTTB 4XMKH 1TTUA 3H0TB 3MLRH 1IGTB 1A7PL 1DVFC 3CLFL 1BD2A 4OLWL 2CSPA 5CZXD 2NY1B 2PYED 3PGDA 2EDLA 5GGUB 4WO4C 3VFOA 4XRCA 4PJCF 4KQ4L 3K74B 4L9LB 4NDMB 3VFGH 3SBWC 1IGML 5BQ7A 3D2UB 1WT5A 1EGJA 1UGNA 1DLHA 5KG9B 4JFEA 3DXAD 2DKMA 3KAAA 3NCJH 3GRWL 5JXAH 4M93B 3D3VB 1NAMH 3QULB 2X4OB 3O9WA 5EUKB 5D7KE 3BP4A 2EKSB 3EYUL 4I4WB 4HH8A 2DBJA 4D2NA 3FT3A 3INUL 5DYOA 3CSBA 5T3XD 1DN0A 3GI8H 4XBGB 1FYTE 1J0JA 1WWBX 4ZOAA 5H35A 1Z0MA 4NUGH 4OQTL 1NANH 4Y16C 2VLRE 1IQWH 1VSCA 3WV0A 3K7UA 1Q9WB 2MSPA 2NY3D 3U0PA 1FGNH 3JWOC 5HTSA 4HKXA 2OTWA 1ZMYA 4DTGL 3TJEH 5L0QB 3HG1A 4QHMA 3U7YL 4LDOB 1G1CA 3VCLB 4YNYB 5JUEH 4QRUB 5C07A 1SEBA 4C83A 1F4AA 4OZIF 3MBEA 1KOAA 2QR0B 3ARDC 1KT2A 4OD1L 5BXFA 3C87A 4JR9H 1QSEE 1G7QB 1FZMB 8CGTA 2KL6A 1NGYA 4X6FA 5IOPA 5DUPL 4Y5VC 1MCCA 5ETUA 1U8JA 3LVEA 2D2OA 3OV6A 3OSKA 1Y6MR 4DGYH 1YYMH 4YEEA 4M93C 3U2SA 3F58H 3I6KB 3MX0A 3BEVB 1FH5L 1WAAF 3TO4D 3HC4L 4OIIL 2AXFA 4JPWL 4OGXH 1F3JB 3C6LC 4PRIA 4E42A 2J8HA 2R0WL 2LFGA 1PAMA 4LRNL 4OCLC 5IG7B 4NQDD 1A5FL 4HS8L 3GJEA 4G8FA 5F1SA 1C8PA 4HWEH 1NCUA 1FPTL 4BH8A 3H3KA 3DGGB 1IAKB 4IOIB 4MAUH 4EDXB 3NIFF 1ORSB 1A2YA 3D69B 5I76A 1ROWA 3HAEA 4JDVA 3JWDC 2A38A 4MLIA 4MNQD 1WSST 5DMIH 1IBGL 3H9SB 3QI9D 3K8MA 5FO9A 1T6WA 3W0WA 3O45B 4YHLH 4ZXBC 3W82A 4XPTL 1N26A 2YBRB 4PJ7E 2OCFD 4AQ1B 4OZGA 1OD9A 4I18B 5E2VH 1XEDA 5SV3A 4UQ2B 1AHWA 2P5ED 2YPLA 4WI5A 1MVFA 1UENA 4AM0A 4R97C 3LQAL 4LFHG 4U6HA 4WW2A 2VWEC 3RL1B 3JV6B 5CIPB 4WEUD 4ENED 5FEBA 3OKOB 2NTFA 1I9IH 1UJ3B 2GITB 1XIWD 2R8SH 5SX5K 4GMTH 1R3JB 2VQ1A 4EIZC 4KV5E 3WFDH 4TTDC 2VZ3A 2EYRA 2WUBH 3HKFA 4XPAH 2L4OA 4OF6A 2GY7B 3FB6A 5DMGD 3QHTC 1U8NB 1DQML 3BGAA 3LV3B 1IM3B 4JRWA 3SGJA 4U1NA 2ESVA 3VFUB 1ZT1B 1UVQB 4W68A 5IIEA 3H9HA 1W0YT 1RMFH 4G6KH 3ZE0F 2R29H 4XMPH 1H3WM 1JF5A 4WHYG 1YEEH 4HJGB 4GLRH 4MQTB 1BVLA 3Q3GA 4N5EC 1OP9A 5F71A 1CDCA 4S1QL 1CBVH 2CGRL 3HR5A 5C0ND 5JMRA 1JGDB 2BVOB 3RHWF 2KZWA 1WZ1H 4XAKE 4OCMC 1HQRA 4P48A 3T65A 4XZUA 1ZA6B 1U2HA 4I18C 4ZUVA 4Y2DB 4IIQC 4U31A 1A4KA 2VDKL 2YD3A 2CLZB 1JUFB 5KW9L 4QT5B 1UM6L 4QTIH 4TNVK 4QGYA 1XGUA 1Y6NR 2FD6L 3KPSA 1FJ1B 4APQD 1AJ7L 1K85A 3B9DA 5T1MA 1AGCB 5C9JA 2C1OA 3O8XB 5GPRA 1B4JH 3RGVB 2ADJB 3QPXL 2VSDA 3BPNB 3L95B 4PJGE 4HS3B 3MA7B 3U9PL 1T0PB 5HYSA 1P1ZB 2JCCF 1FL6A 3BP5A 4TUOB 3LH2H 3O4LB 4GRWF 5FECA 1FFNA 4W70A 4KMQA 1RIHL 1S7TB 1YEGH 4S11A 5B38B 2BHZA 3OMZA 5KS9B 1NBQA 4S0TD 4H88L 1JBJA 2R56H 5EBGA 1Z6JT 4G8GD 3X3FH 3C08H 4F9LC 4XAWL 4PLNC 2V5RA 4ODWB 3PWPE 4X7SH 1FSKC 5F7UA 1SJHA 2Y6SD 4XMLL 1F58H 2R4RL 1EZVX 3VXRD 5HDBE 5TE7H 2JJVA 3IKKA 3EJYC 3T0EB 5CZKA 5F3HB 1KTKE 3T0VA 2D7OA 4TRPL 1FDLH 2OTPA 1CD1A 2DQUL 3SHSA 2NY0D 4MQXC 1RY7B 1A9EA 4PGDB 1EA9C 3RWGA 5JPMB 1FNSL 1CE1H 3B8SA 5C3TA 5F6HJ 5I8CB 4S1RL 4NHCH 2ZCLH 5F7DA 1JHLL 2AABH 5FIEA 3BQUC 4MCYB 3UJIL 3FHQA 3WDIA 3RGVC 5MEOB 4YQXH 5D9SB 3AFLA 4BUGA 5C86A 2X09A 2W0FA 3BPNC 5I1JL 4NZDA 2FO4A 4FXKB 1BLNB 5TQ0L 1RUAH 3NGBB 5DD3L 3CSYB 3UTTE 3M17A 2EDXA 4NZTH 4KFZC 4LAJH 3RBGA 3BIBX 3I9GL 1VA9A 4G42B 4Y4KD 4EIGB 1L7IH 3ARFD 1JI2A 4N0UB 4KRPB 1RZKC 1W0WB 2XN9B 1H5BA 1MCOH 1EV2E 4OFYA 3NACH 3GBLA 2H26A 1ZLVK 4P5TD 2AXGA 1TCRA 3K8LA 4LLDA 3P4NA 3BWAA 1IKNC 1OAKH 3L9RB 1BX2A 4Y19B 3BESR 4JRYE 1C12B 2DYPA 1OQXA 5JMOC 3Q0HA 1K6QH 2A6DA 3QEUA 3OX8B 1NUFA 3LZFH 2KQMA 3FHAA 2CQVA 5TQ2L 2WM0A 1MRDH 1LMKA 3IFOA 1EAPB 1U8KA 5HI3D 3GHEH 4CN6A 1LO4H 5A1AA 1F4WL 1INEL 1T03H 2VIRB 1FE8H 1HZHL 1HH6A 5EG6C 3NIGF 5E8OA 5ICYA 1JNHB 2BCKB 2D3VA 3BJLA 1FNAA 1A3LH 1OAQH 1A9BB 2NY4B 5BS0E 4HXAL 3GI9H 2VR9A 3EOAA 3JV5A 3QEHB 3RWHB 4N8CH 4GMSL 3LKNA 1NGPL 2HTKD 3FOMA 3LKPA 3J8F7 2XA8H 3OB8A 1NMBL 5ESQA 2ZPKL 3I75B 1OARL 3LY6A 3WIHA 4JM2A 5IHLB 2AJ3A 4MDIB 1RVFH 2VAAB 4PJBB 4L4TD 1AO7A 3QJFB 4TUKH 1YECL 4WW2F 3OJDB 3S97C 4P2OC 3MXWH 3TA3C 2WBJC 3FOLA 2ORBH 4XPFH 5IF0A 4Y4HB 2E3VA 4XVJH 4GO6B 5GGRA 3FFCB 5FHAH 4KMLB 1UYWH 1WGOA 5KJRH 4OI8A 3LQZB 2LE9A 5SX4H 1JFQL 3O6KL 2EE9A 1KULA 1ZLWK 3QIWB 2OXHA 3T0WA 4XPBL 2UY6A 3CXDL 5JHLH 2HKHH 1BZ7A 3WUWA 4HQQH 4K7PX 1FORH 5J3HC 5HD8D 3BPCA 2Z31B 2XQBH 1DR9A 2VDNL 3EYQC 3RNQB 4ZFOA 2D4DA 3KPNA 4L3ED 3I50L 1KV3A 4F7PB 1XF4B 3QZWB 1QKZH 2YPKB 4XP4L 4DUWA 5H2BB 2AQ1A 3CIQA 2DQHL 2XXCB 5I1IH 1QFOA 1OP3K 5INDA 3V0VA 1ZEAH 5I8KH 1IE5A 4YHZH 1L0YA 4LP5A 1L4IA 4NP4L 1NFDB 3T77B 3ULVF 3RVTC 2LU4A 1IKFL 2DQDL 3NIDF 1SJVA 4ZS6C 5EUOB 5IMMA 3HC0A 4D9QE 2YD6A 5J6HA 4LKXA 3MRDA 5HY9A 3SQOL 3DRQB 1VESA 1KB5H 5IMKB 3OKKB 4XP5L 5IEKB 4FXGB 3QH3B 2FEEI 5KVMC 4MHHG 5T1LD 4IRJC 4P4KC 4L8DA 3CVHL 2JF1A 4JZNB 4PGCA 5DR5L 5IQ9A 1AH1A 5ITFA 1WBXA 3ARBD 3ORJA 4DCQA 5GS0C 1R3KA 4PV9A 3BKCL 4DGVH 1I9JL 2MKLC 3QIWC 3P77B 1VEOA 5INCA 1Q9LB 4MNHB 1AE6L 3SKJH 1XGRA 1W0VA 5MEQA 3BE1H 4FZEH 2FBJL 5ANME 3B2UC 3FO9B 2XZZA 1MNUL 3QISA 2Z31C 1AD9B 1DN2A 3WDHA 3FQWB 3S35L 1NCAL 1QFUL 3PIQA 1YC8A 4YLQT 4AL8L 5C9KA 2BSTB 2CDGA 1QLEH 4K3JH 4WI3A 1T21B 2J4WL 5C0EB 3DX7A 2UZXB 4NQTA 5HGDA 4MWFA 3TVMA 2OP4H 3KJ6L 3OZ9H 3BSZH 5T1KB 4WJ5A 4Z7WB 4OLEA 3G6JE 5C09E 3RA7L 1BEYH 1NAMA 1HNGA 2IALB 2GJ6B 4FMKA 1IM9D 3DBXA 1CXKA 4OSUH 3MRPA 3DURA 2CKNA 3BYTA 2VDRH 2YD2A 1KJMA 5TE6H 4P2RA 4TNWF 1ZT7A 3KVQA 2HJKB 1D7FA 3EDKA 2MCG1 1JPGB 5I18L 3L6FB 2WNGA 2CJUL 1RK0B 5FO8B 2NZIA 4E41D 2Z91A 1QP1A 4ESKA 5CEYB 3UC0L 1YPZA 3PWUA 5DMKA 3PP3H 1Y18B 4OM1H 1GZPB 3RTQD 4M3JA 1DQQA 5CJBA 4OZHA 1IEAA 3CFJB 2IH3B 4Q97A 2F54E 3X12A 4UOW1 3NBNA 2YC1B 5EO1A 3WN5B 1YEIH 2C4FT 3ARZA 5K33A 1S5HA 3CK0L 4AENA 5CP3H 3ZSSA 4CMHC 4JEGB 4NQED 2YPVL 5GZND 2OBGA 1K3IA 2V17H 2X4NB 4X6BB 5CEXA 3TJHC 1XH3B 2HT4C 5L88L 1OGAD 4P9HC 4HUWA 3GSWA 5F7LB 1E6OH 2JK5B 4EBQL 5T3ZD 5IESH 3SKOA 3DV4B 3FQXA 4G8EA 4X4ZA 1T0NA 1UWXH 4XTRC 2DL2A 3RUGF 4BFIB 4PRPB 3WS6A 5EIIB 2A83B 1I8IB 2ICWA 4JCLA 5DGRA 2EDWA 2YXMA 1FNGB 1A6WH 4NNYB 1A8JH 4N0RA 3Q5OA 1Z5LB 2IPKB 3MRLB 4QXGL 4Y7MA 5CSZA 5DJCA 1PYWB 3MC0A 4QF1B 4LKCB 1NL0L 1PX3A 3VU2A 5A16A 1S9WA 1U93B 1SJEB 4P9MH 1FCGA 1AXIB 3FONA 2X4UB 5DD6B 4F7TB 4Z7UE 2HJFA 4Z78B 3DVGA 1QLFA 4O58H 4A6YB 4BFEA 1LP9E 4XXDA 4YJZL 3TFKD 3MRBB 5D6CB 1A14H 2HVKB 5DJZB 3CD4A 3VD9A 3QNYA 1FVCB 3WN5C 3WKML 3QQ9D 1TTGA 3NZ8B 2B4CH 2W60B 3OKDB 1G7IB 1N3NA 4POUB 2FBOJ 3MLZL 1X6LA 4YR6A 5C6WH 1XZ0B 2VLRA 3IGAB 4OGYL 3HPJA 4OGAD 1RUPH 2WUCH 1X5KA 1RU9H 1Q1JL 1MRCL 2P45B 4KY1L 3PWJB 1DJSA 3C09B 5DUML 3MROB 4P5KB 2FCBA 3VXUA 1HXYA 1DCLA 4MA7H 2GSGA 4R3SA 3KXFD 5TH2B 1UQSB 3CU1A 3QNZB 3IDIB 4FFZL 5F89A 3ZT7A 3THMH 2YKLH 2V2WB 3NZHH 2D03H 4KI5F 3P9MA 2F74A 4X9HA 4JJ5B 4GAJH 2DQGL 4I48A 5IB5B 1KTDA 1XF3A 1WC7A 1UXSB 5SWZA 4FFWD 2Y5EA 1D6VL 4L8SB 5CKAA 4QCIB 4TOYH 2VQUA 1G0DA 1ZVSA 4G9FB 4NQVB 2QKIA 4RFOH 4X98A 3GIVB 3QG7L 3R0NA 4HFUH 4F37K 5FGSA 3ARUA 4C58B 2QEJA 2A9NL 4KHTH 3ZE1E 2VLJE 2YWZA 3TYFA 2BNRD 3FFDB 4LQFH 5D1ZA 4U6VH 3ZDYE 2IAMD 4PYGA 4RFEA 1N2RA 3ECBB 3F7VA 3ILQD 2Z8WC 1ZS8A 3MRMA 1YEDB 3L3OA 5EZOH 4HIIB 1FL3A 4B7LA 3W9DB 3AAZA 3T4YB 3L3GA 5ACLA 3DMMA 1OAYH 4LEXL 4XC1L 2GIYA 4Z7NF 3C09C 2BNQB 4LVOC 1ADQH 3C9NA 4PJ8D 1VFMA 3GSNL 5L6YH 3VWKA 2CRYA 3BMVA 4EZMA 4UV4H 3W2DL 3IDNA 3SGEI 4KHXH 2X4SB 5HPMB 4POZD 4PJ7A 3HE7D 1WZMA 4WIQA 4U2YA 3EJJX 5EU4B 3REVB 5E8NB 3JVGA 4MB3A 3FRUA 3GB7B 1REIA 1DANT 2DKSA 5L8JB 3VD3A 2CRZA 4IBLT 1N64H 1LD9A 2RB8A 1OLLA 1W8NA 1GOGA 3P0VH 1I7RA 4Y1AA 4JO2H 5C7XL 3BP6A 1EXUB 2APWA 2NY3C 4KAQL 3G5XA 1WITA 2ICES 5DRWA 1X5YA 4MQ7A 5IFJA 3HUJE 2F5BH 4MJ4A 1SHMA 1G7HB 3GBMH 5GS1B 4H25B 4J3SA 3T0AA 1GL4B 4NQSA 4UTAL 1IT9L 2YN5A 4DW2L 1FO0B 1IAIM 2AEQL 1WLHA 4QYOB 5ITBH 3GMQA 1IMHC 2GUOB 4BA8A 3TEUA 2H3NA 3QWQB 3BH8A 1YY9D 1U8MB 3R06B 3QA3A 5J11B 2DLFH 2NXYD 3RDTA 1J8HB 3TH4T 4OZ4B 1M05B 4NT6A 2EXYD 5FCUH 2ED9A 3FT4A 3LD8B 3ULUE 3HE6B 4HGMA 4S2SA 4V1DB 3U4BH 3HZKA 4I5BA 3QXDB 4H8WC 3Q6FA 3DPBA 3AS0A 2EECA 3AREA 1VHPA 4Z9KB 2OQJA 4OZHF 3MLWL 3QUMB 5CD3A 3MREA 3MZTA 3K2UH 3PNWB 3HZMA 1KIUA 1BIIB 1LK2B 4JB9H 4FQQA 3DROB 5IB1B 4LCUB 1R5IB 1FLRL 3OKEB 3SN6N 5D5MB 3TZVB 4UIKL 4I13B 4QRQB 3GMOB 3U48A 4R2GB 4U1KB 4PG2A 4RBPK 4PJGA 1RUMH 5IUSA 4CRPA 4J6RL 1HWGB 4LF3B 4ZYKA 3KPRB 4AEHL 3WNOA 3T0XA 2IQ9L 5HHOB 3C2AL 5GS1C 4MJIE 2Y5TB 1YNLH 1TVBB 1TFHA 3H3BC 1A1OB 2C9AA 1K8IB 5TGBA 2QSCH 4LAQL 1YA5A 3PUCA 3ARPA 4JLRB 2DTSA 1NCCL 2X70B 3MV9B 5DQJB 2OMNA 4M5YH 1MIEH 4ISVA 5DGQA 3QIUD 4XNMB 1OSPL 5EU6D 4R8WH 5CS7A 1G7MA 1UACH 2VN7A 3HI5H 5C0FB 2RHEA 4NGHH 1ZSDB 4GG6F 2FHCA 2FJGA 2JIXA 4PTUA 4ENEC 5L2JA 4JO3L 3MLSH 1FV1B 1S7SB 3ZKND 4MSWB 3VMOA 5SWQB 3ZHKA 4MMZC 3FCTB 1U8OA 2PCPB 4WCYH 3CMOH 1DQLH 3WFCH 4K3DL 4MMXC 3MO1A 2X2YA 1VFAA 4NWTH 4X4YB 1MREL 3ZTNL 2JB6A 1AGEA 4LSPH 3CCHB 4KRMB 4BSWA 4PBVC 3RWCA 4RGOH 2ADFH 5D2LB 3LS5H 1MI5D 2IPTH 3FJTA 2OX5A 3TZVC 4BFBD 2V7NA 5IT2L 5F9OL 4KVNL 2PUQT 4R2GC 4UV7L 3VH8G 1RZFH 2VERN 4KVCL 3VFRB 1BVZA 5F7KC 2HFGL 4L1HA 3UTTA 5ISZD 4E5XA 5C0NC 3MLYL 4IOFC 4J23A 1JNJA 2NTSP 1T1XA 4M48H 3ULUH 5IFAH 2X9YA 3V5HB 1U8HB 1F6AA 3EOBA 5K59F 3WSQL 3HLAB 4XHJC 1LO3H 3LHPH 4LSSL 2Y36L 1GHFL 2OYPA 3O6LH 2D4FA 3V4UL 1GIGH 4Y8DC 3QDJD 3TN0B 3VXMB 1IAIL 2DJ4A 3SJVD 3SE3C 1K5NA 1T80A 3IB4A 4CJ1A 3M1BB 3H7LA 5FF6B 2RIKA 3WIHL 1KG0A 3HZYB 4WGVB 2UUDH 1WZKA 5LQBL 4C56D 3BPOB 1AQDA 4G43A 4YPJA 3WS3A 3B9VA 4IJ3B 4FTVD 1JPTL 2VLKE 4KTYA 3WO3B 5BV7L 2VXVH 1X5FA 2OI9B 4P2QB 4RGMB 1S9YB 4WUUE 4R90L 1LEGA 2DWEB 1S9VB 1KIRA 1KPVA 1MCHA 2R69H 1YJDL 1LDSA 5GRVK 4PJDA 1LE9B 4WY7H 5I8EA 5TPWH 5LGJB 2VWEE 3GKWH 1GCFA 3VRJA 2PTUA 1N5AA 4V2BA 3EW3B 3UTSD 1S7VB 3JWOH 4TSBL 3VE0B 4AEIL 1YY8A 5EPMA 4ZFOL 4XX1G 5CBAB 1Y0LA 5GSRA 5BS0A 4M6NH 2VLLA 5LGHL 4O00A 2NY0C 4FQCH 2JJTA 2ATPA 1L9MA 1SYVB 5KAQG 3RNKA 1MY5A 1DL7H 3TN0C 5DFVD 4R0LA 5HHXL 4XVUD 1T1WB 2ZUQC 3K2MC 2EDQA 3OR7B 3SDDB 1UZ8A 3QDAA 5C0BD 4R4ND 5E94B 1X4YA 4B5EA 1NDMB 4IJ3C 5CJ8A 1CFNB 1P2CA 2VZSA 5GGVL 2OI9C 3FN0H 2PO6A 4RGMC 1C1EH 4HGKC 4PJHA 4EI5B 3L5JA 5F7YC 5GGSY 4QTHA 4NBZB 3PQYA 3WIFA 4KROB 4PRHD 1B6UA 4I1NB 4Y4KC 2Q8AH 2EDRA 1KIQB 3ARFC 2QSVA 3WXWH 4PJ9B 4ONOA 2DD8L 15C8H 5KSBE 4DZ8A 4HS6B 1CN4A 2V2TB 3V8CA 4BELD 3MJ9A 1M6OA 2R0KH 4Y4FB 4YX2H 3SGDH 4JFYA 4P5TC 1V8HA 5ACZB 2J8UB 3GBNH 1IGCL 1T22B 1FFQA 2E9JA 4KDTC 1HYRC 4XMKL 3MLRL 3U9UB 2M8XA 4JPVH 2YUWA 3JWDH 5CLWA 4ODXA 3MFFB 1I3VA 3G5VA 1IARB 1KJVB 5DRXA 1A6VH 1JGUH 4M7LT 3S34L 2P46B 3MLUH 4WTWA 3MLPA 3VFGL 1TNMA 1BVKB 4J3VA 5IP4A 2EYTA 5D93B 3NCJL 5FK9A 5EU3A 5JXAL 1D6EA 5E0QA 1NAML 3SDDC 1XR9B 4HH9A 5EWIH 2QQQA 1LEIB 3DTXA 4MNGB 3QXTA 3KYAA 5CP3A 2AK1H 2XTLA 4RFNB 5CCKH 4XGZA 1KC5H 4KROC 1OSZA 3G5ZA 3V79C 3IU3B 3R4DA 5ESVA 2DJUA 3V5DA 2NCMA 4RIRA 4NUGL 3SCMD 3C60A 4PJ9C 2W0PA 4PUBH 3SE8H 1IQWL 3UZEA 1VFOA 1UKTA 4UU9A 1BBJA 1FG2B 1FGNL 4R9HA 4D0CA 3TJEL 3L3JB 1GGYA 5BRZA 4LCCC 3MRIB 5DQDH 5JUEL 1QFWI 1BECA 2PXYD 1OPGH 2H2PD 2QBWA 2D7NA 4FZ8H 1JRHH 5C08A 3CH1A 4PJEE 3SDYH 3O4LE 1OB1B 4JR9L 4L4VE 1KTLA 5DQ9A 5F70A 3RY5A 4XWGH 4X5LA 1D9KD 5DI8A 5FDWB 1Q0XH 5TF1H 3T2PA 2B39A 3VFMA 12E8H 3QIBB 5D6DC 1T0MB 3FQNA 1BOGB 4DGYL 5CIPH 1YYML 4CVZB 3F58L 5CMAA 4ZTOH 3LQMA 4OD2A 3SOBH 4NJAH 4X6DE 5HD8C 4OGXL 3GKZA 3HI1A 1K4DA 5F1IB 5AUMB 3WDJA 3U7AA 4LIQE 1P7QA 5E8EA 4PJIF 4HWEL 2IANA 4YO0B 1ZT4B 3CVHB 1KBGL 4MAUL 4R4FH 3VXSE 5JO5B 1LO5B 3GSOA 1JWMB 5DMIL 3OHXB 2F54A 2Y4SA 1OP5K 1VACB 5LAXB 2R9HD 4YHLL 5E24E 1CLOH 2EDFA 5E2VL 5HHMB 5KANG 1YYLH 1RZJC 2IADB 2A6KA 1ZTXH 2AGJH 3S4SA 4N0UE 4OLXH 4XVTH 3MRNB 4KXZI 3UXFA 2X44D 3HTLX 4YDJA 3A6CL 4B41A 4KJQD 1MAMH 1I9IL 4Z18A 3GSQB 4YHKH 4I2XA 3EJZC 2R8SL 3TCLB 4GMTL 5DDHB 3ZMRA 3WFDL 4PREA 4U1LB 3MLTB 2R2HB 4XPAL 1G7PB 1MJ8H 1PX4A 2EIDA 2XTJD 3PL6D 5ERWA 4PJDF 1HSBB 2BSRA 3BPLB 5B3JF 5KBNC 4M03A 1U6AL 3T1WA 5L2KB 5SX5H 1F3DJ 1EFXB 4L5FH 3SKUD 3EBAA 4G6KL 1RMFL 1JTPA 4Z7UA 2R29L 1S78D 3PGDB 4XMPL 4YBLB 1YEEL 1Z3GL 1ADQA 1RZKH 1EEYA 2DM3A 1LP9A 1NBYB 1VERA 1CBVL 3B9EA 4QRSA 1BAFL 1WZ1L 5J6GB 1GAFH 5DD1H 4UNTA 3F7QA 2E27H 4PJXE 1KPRB 3AGVA 5J8OA 5JZ7D 1V3LA 4QTIL 3VRLF 3P4OA 2ZSWA 4IMKA 3TBYB 3SDCD 3BP4B 2HVJA 4LIQH 3VFNB 5D1QD 5FV1L 1CLCA 3UTPD 3MRCA 3FT3B 5DYOB 2L7JA 3BW9B 5DK2A 1DN0B 1B4JL 4PJHF 3KYOA 4UDTB 3RTQC 1JZ4A 5D96C 3UBXB 2HFFA 4IRZH 4Q58C 3LH2L 4BZ1H 4GUPB 1NANI 2ADGB 3H7BB 3HG1B 2QADB 2ZUTA 2H8PB 3BT2H 1INDH 1YEGL 4OAWA 1MF2L 3QFJA 1NDGB 3GGWA 4JPKH 2R56L 5FV2A 1JYWA 5HI4D 3EOYG 5GZNC 2MQ3A 5ADOH 4YBLC 3X3FL 2I9TA 3C08L 4AIXA 4LVHC 1KT2B 3MRJB 4X7SL 5DVOA 3HC3H 3SE9H 1F58L 1NGYB 2VLJA 4H5SA 2YUZA 5IOPB 4PJFB 3S37L 5TE7L 2COQA 2QHLA 5CJOH 4H26A 1T7VA 4FFVD 4KKLD 5CSGA 4JRXD 2HMID 1BQHG 1EH9A 1FDLL 1NGZA 2P5WD 5C8JA 3ZDXF 1EMTH 4GRLA 3WL9B 3DO7B 3G5YA 3DX8B 2W0LA 3F12A 5IBTH 2Q76A 5BZDA 4AH2A 4LCWA 2CRMA 4NHCL 3HS0A 4U1JA 3L5XH 4D94A 2AABL 1NFDE 1MJJA 4N9GA 3GJEB 4G8FB 2J1KA 1RUAL 3EGSB 5DJXA 1CD0A 3LEXA 5FGBC 3TF7C 4NZTL 1FGVH 1YZZA 1TZIA 4F7CA 3W39A 1DQJB 2AKRA 2QADC 1S7WA 3C8DA 5A3ID 1L7IL 3ARTA 1IQDB 4O2FA 1QRND 3W0WB 4FQHB 3R1GH 1XF2A 1MCOL 4WDIB 5B39B 4IS6B 4PR5A 3NACL 1LEKA 3NPSC 3MBXH 4EUPG 1U8IB 4OZGB 2W65A 5FUOH 4CGTA 3B6SB 5T33H 3JBG7 5EO9A 4OGAC 4OCWH 5JOFB 1QSZA 3EIFA 1UWGH 5DF0A 1ZLVH 2OR9H 3GK8H 3KS0J 2P8MA 4QRPD 1OF2B 5E08H 4PRAB 1U8PB 3GDBA 2VQ1B 3FB7A 1UKQA 1U95B 4AEFA 4ZOEA 1K6QL 2EYRB 3BZEA 3LZFL 3F6LA 3QWRD 5DZLA 3IDJA 1DUZA 4JZJA 4KK8D 1MRDL 3D5OF 1HKLL 4U1NB 2YSSB 5GS0H 3TO2A 2XFXA 4FRWA 2UWEE 5C0CA 3GHEL 4Z0XA 3HCVA 5B22A 3AXLA 1LO4L 4JY5H 1E4XH 1I85A 2CR6A 3TV3H 4X5WA 2O93L 2OLDA 1T03L 3AS2A 1FE8L 4Q74A 3STBA 4YDLC 5IVXF 1DVFA 3QUYD 3GSNB 3TNMA 2GK0A 4ZDHB 1DUYA 1A3LL 2DQEH 2IAMC 1OAQL 4GLRI 1I1RA 5JORB 3ILQC 3JZ7A 4NO2B 2F8OA 4WO4A 3I84A 4ZAKD 4D0BA 5A2FA 4M7KH 4N8CL 4YGVA 3WKNA 2Q87A 5DC0A 2XA8L 4XZUB 4LHUB 3SBWA 5D7LE 3MOAH 5D7JD 4NN6B 2WP3O 5SWSA 2I27N 1EUUA 4P57B 2WBWB 5GJTH 5TDPB 1CR9H 3KPSB 3C5JB 4TUKL 3MRGB 5T1MB 3IDYC 3ARYA 4M00A 4MJIA 5EOTB 2C1OB 3MXWL 5FGCB 3PJSA 3RZCD 3AMLA 2ORBL 3EO1B 2NY5C 4XPFL 2A0LC 2AEWA 3MODH 3MV8D 4XVJL 3JTSB 4E9LA 1CFSA 1UYWL 5KJRL 3CDFA 3O41B 1FL6B 1CFVH 1KLFA 5D7SH 4QY8A 1FFNB 3RWDA 4W4NA 5GJSH 2J7LA 3ZKSD 4Y16A 3JWNC 2QQLH 2VITA 1RJYB 1IEBA 2CLVA 3DNKA 4LPWA 5JHLL 2HKHL 4QHKJ 5MEND 4HQQL 2LV4A 1FORL 4F33A 4HUXB 2XQBL 4PTTA 2B0SH 3H0TA 2WLYA 4DKFH 1ZLWH 1QKZL 3OKMA 4KUCF 5M95B 4HG4K 1EJ6A 3ARDA 5GGUA 1OTTD 4P5MB 3OGOE 5IHBA 1ZEAL 2IH1B 5I8KL 4YHZL 4L9LA 1S7RB 4HDIA 1PZ5B 1UH4A 1CD1B 1SM3H 3BD5A 4Y5VA 4M7LH 4MD5A 3F8UB 1YY9C 3O2DH 4P49A 4P9HH 1KB5L 1OP3H 4M3KB 4G9DB 1TZHA 5IROC 3QULA 5F7DB 4ZO9A 5GGSB 1HWHB 5EUKA 4I4WA 1A6ZB 3OJMB 3TH3T 2W0FB 4CW1B 1P5UA 2GHWB 2FO4B 1UB6B 3C6LA 5JIKA 3O0RL 1MFDH 5IFHH 4XBGA 4DQOH 5GISH 3ZDXE 4DGVL 1WBYB 2PYEE 2Q6WB 3O2VH 3WJJA 4JVPA 1B6DA 4BK4A 4Z76A 1RV6X 4OCYH 3SKJL 2ZUYA 2ZWLT 4EDWH 4IRSB 2XT1B 1Q9WA 3BE1L 4FZEL 1KN4L 5IVOA 1AD0A 4GKNB 3EDDA 3VCLA 2N7AA 4YNYA 5I73C 4FQXD 3RRQA 2VLKA 2J5LB 4OZFG 4ZXBA 1TCRB 1QLEL 4K3JL 4WUUA 5KTEH 3O6FD 5E9DD 1I1AB 1G7QA 2OP4L 2ZKHH 4DOHB 3B9KD 3OZ9L 3BSZL 1BX2B 2I9LA 1UKSA 5T3XE 5C6TL 4RDQG 1BEYL 1E6JH 3DHJA 3QIUC 4M02A 4AIZB 1EUTA 4OSUL 3TIDB 3QHZH 1DBMH 2VDRL 4LGPB 3VWJD 5TE6L 3WO4B 1FIGH 5MHSD 3ZKNC 1N59A 5C2BH 1U8KB 2XG4A 1F3JA 1HOCA 1NAKH 2NY7H 5JHDD 1EHNA 2PYFA 4DK6A 5IBLD 5C0DA 2BP3A 3VD4A 2A6JA 4OM1L 4DKAA 3DGGA 3X3GH 4IRSC 1MEXH 4EDXA 4U49A 1ORSA 3D69A 2BNQE 3H9ZA 5HGBB 3LKNB 4HMDA 2VYRE 4A6YH 4G6AC 3MJGX 2BHUA 3ARGB 3VDBA 4EXPX 1YEIL 3O45A 4YC2B 1T89C 2IBZX 2YBRA 5FCSH 4FG6C 4JM2B 4KTEH 1I1AC 4I18A 4IIQA 4H0GA 1XGYH 2CR3A 5D7IF 2ZOKB 5KSBA 1E6OL 1Z9SA 3VXQB 3BZDA 5IESL 1ZKAA 5CIPA 5IF0B 4GQ9H 3QRFM 2E9BA 4NQDE 1RJLB 4KK6D 1UJ3A 2NXZD 1C5BH 2CKBB 1BD2D 2GITA 2GTZA 4QRRB 1A6WL 2HKFL 3WO4C 1MCWM 1I3UA 4I9WD 1BFTA 4MHHI 4BK5A 1U8NA 2QHRH 4MNQE 2XZQH 3LV3A 3WUWB 4KKNA 3BPCB 4P9ML 4JQXC 3VFUA 5JW4M 1ZT1A 3MRKB 4JFED 1T2JA 1CYGA 1XMWA 1NEZB 4X6CF 4O58L 2HRPH 4F9LA 3CDGB 5T3XH 2P5EE 3KPOB 5FYKE 3O9WD 3L3KB 1QHOA 1A14L 3F6IA 1JGDA 3ARGC 2BVOA 1H3VA 4L9DA 2HN7A 1CGUA 2B4CL 4LOUD 4YC2C 3HC0B 2BOBB 1MUJB 4V1DE 1ZA6A 2BVQB 1UEYA 1N8ZB 2AJXH 3ZHLA 2DIAA 3TH2T 4QT5A 4L8DB 1FJ1A 1RUPL 1BQLL 4HUVB 2WUCL 1RU9L 2CDEB 1EEZB 4P4RB 2X89A 1L7TH 1AGCA 1G7LB 1CT8A 1BJ1J 3QDMB 3O8XA 3RVUD 5IQ9B 4YUEL 1UZ6E 3BQUA 2WANA 3RGVA 4M1GH 3U4AA 5C07D 4MA7L 4DCQB 1X5ZA 1R3KB 5DFVC 3L95A 3MBED 4HS3A 3MA7A 1V7NH 2H45A 4XVUC 1A0QH 5INCB 2YKLL 1P1ZA 3NZHL 2DWDB 2D03L 5E6IB 1R5WA 1W0VB 3O4LA 5MEQB 1B0RA 4DTGH 4L4VA 5H94B 1KIPB 5FA3B 1N6VA 4GAJL 1P7HL 1S7TA 5B38A 4H8WH 5KS9A 4U6XB 4TOYL 2E6QA 2YUVA 2BY1A 1MLCB 2CDGB 4HFUL 4ODWA 5HGDB 3TVMB 4KHTL 3SO5A 5LGKA 5GRZA 3B43A 4LQFL 3DYPA 4U6VL 3FRPA 1X5IA 4PY8J 4RGND 4X6DA 2Q7YB 4PRID 4FOMA 3T0EA 5KSUB 1IKNA 1NAMB 2AJVH 1JK8B 1YMHB 4N1CA 5EZOL 2EEDA 5DVNA 3DBXB 3MOBL 3MRPB 5DJAB 3DURB 4LBEB 2O61B 1NBZA 5JPMA 1FO0H 1ZGLM 4KKCD 4Z8FH 4OIIH 1OAYL 4JG1H 3CMGA 1T3FB 2Q7NA 4DFIA 5J1AA 3VXSA 4JPWH 2VZTA 1RJZB 5MEOA 1MCJA 1IJ9A 1RIVL 5L6YL 5IBUG 2Z91B 4G8GE 4UV4L 5FYKH 4MJ6B 3GHBH 4FXKA 5K9OA 1BLNA 3QPQD 1YPZB 3CSYA 3RAJH 1P84K 1B90A 5FOJA 5E6IC 1DQQB 2YPLD 3PHSA 2APVA 1MCWW 1FFPA 2FJHB 4N0UA 5C0JB 4K71C 3SDAD 3T2NH 2XA3A 2BDNH 1CFTB 4POYA 5HXMA 3QUMH 1N64L 2NW3A 3RIFF 3SCMC 2EIBA 1OAUH 3S98A 4JO2L 4GBXD 4OFPA 3VXME 1KCRH 3RVXD 4ZQKA 4QXUH 1NJ9B 5IGXH 5HJ3B 3EO9H 3FQXB 4G8EB 2XACC 1T0NB 3GBML 1KGCE 3LPWA 2PXYC 2H2PC 4NNXB 1KUMA 2ESVD 4Y19A 4N5UA 3S5LB 3TA3A 1EX0A 4KZEH 3P9WB 2ICWB 1C12A 5ITBL 4ETQA 2NY2D 1QFWM 5DS8A 4MVBD 4NO0A 3OX8A 1T1ZB 3BD4A 1H8SA 4IHOA 3L5HA 2ZJSL 3LIZH 4HKJB 1KLUA 5IB4B 2DLFL 2YHGA 1AKJB 5DJ6B 2PTTA 2AJSH 1G6RH 3DI2B 1MFBH 3FONB 1EAPA 3ULVD 5FCUL 2HJFB 3BEWB 3U4BL 1QLFB 2VIRA 1KN2H 2BCKA 4JGMA 1Q0YH 1JYXA 1TQBC 3K2UL 1A9BA 4JB9L 4ZODA 3W9EA 1CIDA 2NYYC 2E6JA 4J7RA 4EN3B 1KXVC 3QEHA 3RWHA 1AGFA 2XWBB 3F5WB 2VL5B 1D5BA 1FYTB 2HFTA 4XP6H 1MCNA 1RUML 1B9ZA 1UM6H 3MRQB 1K9TA 2VLRB 1ERNA 2EO1A 4LLUB 4MDIA 5CSBA 3HPJB 2VAAA 5I74C 1KJ2H 4C54A 1YNLL 3BOVA 1MHEB 7FABH 1RQ5A 2QSCL 4IRJA 4P4KA 1HSAB 2R9HC 1NC2A 1HXYB 4RAUB 4HAFA 4RBPH 4WFFE 4R3SB 2ERJC 3QPXH 1MCIA 4UBDD 4Y4HA 5MEPB 4YDVA 4M5YL 1MIEL 5FAAA 3LQZA 2C4XA 1DBAH 1OQOA 4R8WL 1QSEB 2F74B 2DIBA 2F9BT 3QIWA 3HI5L 1BIHA 4FS0A 4NGHL 3QDGD 3TNNB 3MLSL 1KTDB 3N1PC 3R8QA 1HHHB 1LILA 3KS0H 1H9VA 2Y07H 1ZVSB 3BVNB 4GAGH 2QKIB 4WCYL 1OOAA 2Z31A 3CMOL 1DQLL 3RNQA 3WFCL 1QQDA 3T04D 4F7PA 1XF4A 2XTJC 4NWTL 3QZWA 2BVEA 2YPKA 4PD4K 3BRDA 4AZ8A 4L4TE 5HVHC 3WFBH 5JIPA 4LSPL 3DUHA 1V3MA 5D1ZB 4N9OB 3PWLB 4RGOL 2ADFL 3LS5L 2IPTL 3TT1H 1NFDA 3T77A 3MRMB 2D7QA 3L3OB 2DBLH 1S78C 1RZFL 5EUOA 5HGAB 4NCC2 3FB8B 1AIFB 1FL5A 1CF8H 1I7UB 1VENA 3DRQA 4MAYB 3DJ9A 5IMKA 1J0ZA 1A3QA 1CFQA 1MHHB 3OKKA 2ENSA 4JJHA 4M48L 3ULUL 4FXGA 3QH3A 5IFAL 3O4OC 3CAFA 4I0KA 5ID1B 4MNGE 3C9NB 3UJIH 4LGRB 1GH7A 4HWZA 1LO3L 3LHPL 5KOMC 4GKOA 4NC0B 1RK1A 4JZNA 4ZFFB 3AC0A 4PJ7B 4HW6A 3O6LL 5FM5O 3SDCC 1GIGL 5D1QC 1Q9LA 5BMFH 4MNHA 3WCYA 5D71H 3FRUB 5EC1A 4BSJA 5KS9F 3FO9A 2GFBB 4OFDA 1AD9A 4RMTA 3FQWA 3AB0B 2EDEA 3NCYP 2DYPD 2VXVL 1EO7A 3PWVA 3BP6B 2DLEA 2BSTA 1T21A 4B0MM 3SEPA 3NA9H 3ROOB 2R69L 4HEME 2Q3ZA 3QUXD 5T1KA 5F21B 4WWKB 5TPWL 4JQVC 3O2DA 2K7QA 2EDDA 4MA1B 3HNSH 1BFVH 3GMQB 4UUJB 2VDOH 4P23D 4HG4J 2GJ6A 3JWOL 3UMTA 2OR7A 4H1LH 3U82B 5E4EB 4G7VH 3QA3B 1DDHB 4L8BB 4TNVF 1UH3A 4M6NL 5FA4A 2RR3A 4FFVC 4NBXB 2HMIC 2HJKA 2DOCA 1VADA 1JPGA 2IFFH 3FT4B 4FQCL 4DN4H 1GGIH 35C8H 5T1DL 3RP1A 4FFYH 3CJJA 4OFKA 1INEH 2J8OA 4I5BB 5GS3A 3Q6FB 4WTZA 3AREB 5CEYA 1MOEA 1T04A 3MREB 1GZPA 5FOBA 3FAWA 1AO7D 3ES6B 4FQQB 1C5DB 4PJCB 3CFJA 2IH3A 1DZBA 4MXVF 5J1SC 2RJMA 5I1DA 1BJ8A 3MRFB 3FN0L 3WN5A 1C1EL 1CXFA 1OARH 5F96H 1DP0A 4JKKA 3QXVA 2Q8AL 5HHME 4F80A 5A3IC 4PRBB 4J4PD 3BISA 3E0GA 4K8RC 4KI5D 15C8L 1KFAH 4WWKC 5TGBB 3CPLB 2R0KL 2MKWA 3H8NA 4YX2L 4Y5XB 2JK5A 4JGUA 3LB6D 3DV4A 2JB5H 3GBNL 2JTDA 3V7MA 4BFIA 4E41E 1TTFA 5ALCH 5EIIA 2A83A 3P2TA 4XB8A 4G80A 1I8IA 4NYLA 1NCBL 1FN4B 3PWPB 1FNGA 5EO0A 3JWDL 1B88A 4NNYA 4EXKA 1Z5LA 4Z7OF 2V5TA 2FJGB 2JIXB 1PYWA 2EC9T 1T2QH 4F7EB 5L2JB 4QF1A 1A6VL 4Q0XH 1JGUL 4LKCA 1NCWH 3MLUL 1U93A 5L2KE 1U8OB 1WFNA 3U83A 4Q6IB 5LCVH 2X4UA 5DD6A 4LLVB 4F7TA 1RZJH 4NQEE 4Z78A 3SO3C 2HT2D 4A6YA 3T8XB 2PTVA 4CADB 5J56B 4EQ2A 1O7SA 3MRBA 5D6CA 5EWIL 3D1MC 2HVKA 3DVFA 5T3ZE 2V7NB 2E7MA 43C9B 3D85B 1FVCA 2BK8A 3NZ8A 3PHOB 4WHCA 5HYFA 2AK1L 2W60A 4J3TA 2DRUA 1NGQH 1KC5L 2VE6B 3QUYC 4IDLA 3UTTB 5J13B 4TVSa 4E5XB 3IT8D 1JP5A 1IAMA 1MWAB 4Q9BA 3SE8L 5F9WB 1XZ0A 4PJBF 4ZSOE 2D7TH 5CGTA 4ZAKC 3IGAA 1F6AB 1OWRM 1PG7H 4Y5XC 4V2CB 3AS3A 1QYGH 3W11D 5DQDL 5D7JC 3CVHH 3L7EB 4P5KA 2P49B 5JDSB 1JRHL 5DO2D 3TBTB 3BIKB 5TH2A 1UQSA 1RUKH 2C3GA 3L3DA 3IDIA 3SDYL 1P4LB 2LTQB 2V2WA 3DARA 3RHWK 4W81A 5EBLB 3RZCC 1KG0B 4LNVA 4QEGA 1N7MH 4XWGL 3B83A 1Q0XL 3U46B 4JJ5A 5TF1L 4GW1B 5IB5A 4Q6IC 5FYLD 4JRYB 1HIMH 12E8L 2X1WL 4QCIA 3V8OA 3T0DA 1RAMA 3QCTH 4NQVA 2X1OA 1KIRB 4HBCH 5DJYB 4ZTOL 4P2RD 3SOBL 3MUJA 1AY1H 4NJAL 3FFDA 5DZOA 1E4JA 1U3ZA 2O5ZH 1KB5B 2R23B 4L3CA 3ECBA 5EUOF 3LAFA 1N5AB 5J13C 5AAMA 2IBGA 3PABA 1OAXH 4WV1C 1YEDA 5F9WC 4M7ZB 4P59H 3JV4A 1OTTC 1BJMA 3B2VH 3T4YA 1Y0LB 5GSRB 4R4FL 1Q9OB 5BS0B 3DUSB 2PR4H 3JTTB 2QSQA 4GSDH 4GOSA 2N56A 2BNQA 4DUXA 2VMFA 1CXLA 3RWFA 5DFWH 1A7BA 3QUKB 3BDBA 4HK3J 4IM8A 1CLOL 2LTQC 3UZQA 3HI6H 2X4SA 5HPMA 3TESA 2NX5B 4MXQD 2AEIT 2G5RA 1T4KB 2FEDC 2BNRE 1YYLL 1CVRA 3VD7A 1ZTXL 1OP5H 2AGJL 3BKYH 3D0VB 1V5JA 4OLXL 1BJ1H 4XVTL 4HMCA 2PO6B 1MAML 4NQDA 4YHKL 4QTHB 4HCRH 2BRQA 1FFOB 4X9IA 2EEAA 1KCUH 2CMRH 3IYLW 1MCLA 3P3YA 1EXUA 4I0CC 3RVVD 5KZCD 1MJ8L 1ZGLP 5GGQH 4LMQE 3UEZA 2YA0A 4JFYB 4MNQA 3E3QC 5IVNA 1H3PH 1DBBH 3BD3A 1G7HA 4Z7WF 5GS1A 4H25A 4Z0BH 5F44A 1GJIA 4FQXC 3Q48A 4L8CB 4JVWA 1FO0A 1J86A 4L5FL 1RZ8B 3SDXE 3RVWC 4NC1E 4QYOA 3GSVB 3O6FC 4TUJB 2GUOA 4GS7B 3NVQA 1JPST 5A2IH 1JGLL 4QXGH 1RZKL 4CN1A 3AM8C 2P5EA 3B9KC 2DQIL 4XI5D 1U8MA 2M26A 2Q1EA 1BGXH 1GAFL 5DD1L 2HA1A 2J88H 2QV2A 1M05A 2E27L 3S36H 1B4RA 3A6BH 2FECL 5FK9B 4V1DA 4YH6A 3QXDA 3BRFA 3R0MA 3VWJC 2EKJA 1YMMB 1D5MB 3QUMA 1MH5B 2UZYB 3KHQA 4LIQL 3DTXB 4LSTH 1BIIA 1LK2A 3X11A 2LABA 4HIXH 5F8RC 5IB1A 2J6EH 1R5IA 2R2CA 3OKEA 4DK3A 3VXUD 3ZDZE 3TZVA 4QRQA 3G5ZB 5IBLC 1P84J 3P11L 3GMOA 5EORH 3ILPA 4U1KA 4BQBA 4NPYA 1CG9B 4ZS7H 4XPHH 4QWWD 2RCSH 4IRZL 4Z7QF 4BZ1L 3KPRA 1IL1B 3TBWA 5HHOA 1U9KA 2Y5TA 1TVBA 5ANMB 1A1MB 3BT2L 1INDL 1A1OA 5HHPB 1K8IA 5DUMH 3EDJA 2MQ0A 4U1IB 5SWZD 3MUHL 2FHBA 4JPKL 4RISH 4JLRA 5ADOL 3CH1B 2X70A 3MV9A 4HHAA 5DQJA 1H8NA 4P46D 4X5XA 5I1CH 2P48B 1G6RA 3HC3L 2P24B 1KTLB 1GC1C 3SE9L 5MP6H 1WIOA 5C0FA 1ZSDA 1FG9C 3SE3A 4DEPC 5C0AB 2FLBT 4O5LH 5DSCA 1BQSA 4KK6C 1FV1A 2NXZC 1HI6B 5CJOL 4YZFF 1PKQE 3G6JB 4MSWA 3ARXA 4OLYH 5C09B 3RY4A 3FQNB 1W72B 2FX9H 1EMTL 2PCPA 5J57B 1JZ6A 5CMAB 2XQYK 4LPUA 5IBTL 4X4YA 1NGWB 2GCYB 5KANI 3BZ4B 3DMMD 3OQ3B 2NY5H 3CCHA 1PD6A 2ITDB 4A2MA 1R0AH 1VKXB 1WT5C 1MHPH 5J89A 3L5XL 2W9EH 5BOZG 5DD5H 1U3HB 3W5NA 1NQBA 3VWKD 4U3CA 2DQJH 3UPRB 1BMGA 4EUPH 3ZKXC 1ZLUK 1KJ2A 3VFRA 5CGYD 3NTCH 3HAEG 2ZCHH 1FGVL 5EU6E 3TIEB 1T5WA 5DFTA 1JZ7A 3QQ4A 5CZVH 3KLHD 4RNRB 2D0HA 2VZUA 3V5HA 1U8HA 4LOUC 2F54B 4DGIH 3GSNH 3NCCB 3HLAA 3R1GL 4WI8A 5DJ2B 3IDGB 1CDJA 3MBXL 2OJZH 4Y1AD 5FUOL 3QR2A 3K81A 4HWUA 5T33L 1CICB 3VXMA 3TN0A 2W1NA 3Q6GH 5GXBB 3GMNB 3M1BA 5D8JH 1UWGL 3MXVH 3C5SB 4Z7VE 2OR9L 3GK8L 1V3KA 4GKZB 3MBEC 2APTA 5E08L 4UINL 3VXNB 3U0WH 4P2QA 3MMEA 3VGFA 5I2IA 5ISZE 1T83C 1S9YA 2I24N 3CFEB 4HWBH 2DWEA 3V95A 4LVNC 1S9VA 1U8LB 2BSRB 4Y4KA 4OBSA 5KVDH 3V9FA 3RDTD 1LE9A 1U3HC 2VB5A 4OF7A 5GS0L 1M7IB 5LGJA 2AEQH 3HMWH 4JY5L 1E4XL 4Z7UB 2YUXA 4PD4J 4KDTA 2MCPH 3WLWC 5F8QC 5EU7C 1S7VA 1EEYB 2HWZH 4S1SH 3HMXH 3SJVE 3VE0A 1KACB 2DQEL 1DTUA 5CBAA 5JOPD 4PS4H 4N8VB 1ZAGA 5CWSA 4C56E 4M7KL 1MJUH 5JXEC 4OT1H 2CLRA 1YNTA 4Y5YB 4FTVE 2W9DH 3MOAL 1UH2A 5FYJE 3V52H 3OR6B 2WV3A 3BKMH 5LJYH 3V4PH 2ZUVA 5E8DH 3OF6D 5AWNH 4KKCC 2FECI 2LAGB 3P4OB 5GJTL 2ZSWB 1CR9L 1YEKH 4R7NB 5H37H 4ODVH 2HVJB 5CJ5A 4JFDB 2MPAH 3D0LA 2BHYA 3IDMA 4GXUM 4I8DA 4WFGE 4BUHA 3D39B 3MRCB 4YBQC 1HHJA 3OR7A 4H0IA 5ICXB 3SDDA 5I1GL 3MGOA 5M94B 1EHAA 4Z5RB 5E94A 5HYSG 3UYPA 3VI4E 1KELH 1CFNA 3VGAC 2EDKA 3MODL 3UTSE 4EI5A 1PQZB 3MZGB 1CFVL 2IWGA 4X4XA 4TNWK 4YE4L 3KYNA 3VJ6B 5ALBL 5BJTB 5D7SL 4QKXB 5GJSL 4PJ9A 2QQLL 3SDAC 2V2TA 3U0TB 2RQ8A 4H1LA 5JNYB 1UCTA 4LCCA 2J8UA 1T22A 1LGVA 2X4PB 1V7MH 4FHBD 2B0SL 4GBXC 3U9UA 4NN5B 4D9LL 4NZJA 2C5DC 3RVXC 4DKFL 5F9JB 1SVCP 3QRGH 3MFFA 4OLUH 2VLJB 4H5SB 5CINH 5IJKA 1KJVA 5C0BE 3IJYB 32C2B 1K4CB 4H26B 5FM8A 3VGGA 4Y5YC 2PF6A 1X9QA 1BVKA 3EDEA 1NGZB 5JW5A 2HFEA 1EIBA 1SM3L 3LOWA 1OTSD 2NY2C 2A9MH 2V9QA 3G5YB 2MTPA 4MVBC 4M7LL 4PRHE 2VSCA 4GW5A 4XP9H 2Q76B 3O2DL 4P9HL 1A7NH 1J0IA 4U1JB 5CEZH 4K9EC 1UA6H 3NFNB 1MJJB 3ULVC 1LEIA 4MNGA 5D5MF 1PSKH 4YHML 2QQKH 1MIMH 3AU1A 4JM4H 1MFDL 4KVCH 5IFHL 4DQOL 5L8LB 5GISL 3UO1H 3IU3A 1TZIB 3VFVB 3O2VL 4F57H 5L8KB 5FYJH 4EDWL 3ISWA 1D5ZA 3L3JA 3HB3D 3MRIA 3QDME 3IFPA 3RU8H 1ETZB 2W65B 3GNMH 4K7FB 2FL5A 4YHNA 3OKLA 3MV7B 1MPAH 1ZGLB 1TDQA 5KTEL 3Q1SH 1OB1A 5T1LA 2ZKHL 3HUJB 1H3XA 1X5XA 5IMOB 5FDWA 1I7TB 2EIZB 1UCBH 1S8DB 1JPFA 4WENB 2VUOA 2B5IC 3Q5TA 1M1SA 2BNUB 3PDOB 3FB7B 1E6JL 1QEWA 2I07B 3T4AB 5KVGH 4MQSB 2MNUA 3RFZC 4CVZA 2DLGA 1PKOA 3QHZL 1DBML 3IDJB 3ME0A 4EVNB 2G2RB 2F53D 2CKBH 1FIGL 1RUQH 5D2LF 3TO2B 5C2BL 2Y1VA 5F1IA 3O11B 1O7VA 4NWUH 5AUMA 2EYSA 3BGFB 3RUGB 4X5WB 1NAKL 2XG5A 2NY7L 1EVUA 1J7VR 5LBSH 1DVFB 1RHFA 1UG9A 4NKDA 3ETBF 1WTGT 1T1YA 1ZT4A 3CVHA 3X3GL 1MEXL 5IW1A 5JO5A 2QL1A 4HC1H 4A6YL 1HEZB 5DUBA 3KPMB 4JHAH 3FN3A 3PQYD 1IM9A 2AI0H 4NKMB 4KTEL 4M43H 3PGFH 1MFAH 1EBAA 1I9EA 1XGYL 2IADA 4MJIB 1IGYA 3EHBD 4XWOD 3MRNA 1FZKB 4GQ9L 4KTDH 4P2CG 4AYFA 3DYOA 4DZBB 1GYAA 2GTWB 3KNBA 3EYVA 3GSQA 4YHYC 4M7JH 3TCLA 2LQRA 5DDHA 3PV6B 2YA1A 5C0IB 3RWDB 3WUWG 4QHNA 1G7PA 4LPYA 3N0PB 2VITB 4JKLA 1LK3H 1HSBA 2CLVB 2QHRL 3QYCA 4U6YB 3CZFB 2XZQL 4KKBC 2AJZB 1JHTB 1BZQK 3QHFH 3BGFC 3OBAA 4F33B 2F58L 5L2KA 2AEPH 4QNPF 1TPXB 1EFXA 1QPXA 1U91B 4D9QD 1U3YA 1WZLA 3OKMB 3OG4B 2IBZY 2AJYH 2VLMD 5JPNB 2HRPL 3ARDB 1BF8A 5T3XL 4TTGA 1NBYA 3QUXC 3S34H 4UI2A 4HDIB 1HKFA 5DRNA 1JPSH 5J6GA 1CDIA 1MLBB 3DSFH 4Y5VB 4P23C 5HHVH 1U2CA 2IEPA 5MERB 4MD5B 1KPRA 4NRYA 2AJXL 3C60D 1TZHB 3RQ3A 2XTJE 1R24B 3S88H 3TBYA 4HCRA 3VFNA 3S3PA 5BRZD 1L7TL 3T3MF 1F45A 4YK4B 3C6LB 2VDPH 3BW9A 4Q2ZB 4LPVA 2P8PB 4M1GL 4JFFB 4HUKB 1RPQA 5C08D 4UDTA 1V7NL 1QACA 1A0QL 4KGLA 5FGBA 4Z76B 3UBXA 4ELMF 5BV7C 2VXTH 1H3TA 4RSVA 4GUPA 3KDMB 1JI1A 2ADGA 3H7BA 2HLFC 2YK1H 1AD0B 2H8PA 2XIDA 4H8WL 1JGEB 2J8UF 3DETC 4XNXH 3WBDA 1TPXC 1CI5A 4UB0H 5GGTH 1NDGA 2VLKB 5DURD 1ACYL 4ZXBB 2PN5A 4WUUB 5CJXC 4J4PC 2KPNA 1ORQA 4KI5C 3MRJA 3ZE2F 3EYFB 4MS8D 1UB5A 5CILH 3CFKB 3UTPE 2P8LA 3LB6C 2I9LB 4PJFA 5DA0B 4R97B 1E28B 2CRIA 3EFFB 2AJVL 5CKGA 1JGVH 3NN8B 3X13B 1L9NA 1P7QD 4DN3L 3WL9A 3SKNB 3DO7A 1N0XH 3VXTB 2IAND 3DX8A 1GPOH 2J6EA 2NZ9C 3ARSA 1FO0L 4Z8FL 3LKQB 4JG1L 4WI6A 1SEQH 1N59B 4YK4C 4LLYB 1HOCB 3PG2A 3VGHA 5HVWA 2XPGB 1EFQA 5FYKL 3GHBL 1G9MC 2PYFB 1QG3A 3EGSA 1QOKA 5C0DB 3RAJL 2A6JB 4JQIH 1YEFH 2V9RA 5DEGB 1KBGH 4IOSD 1RHHB 1DQJA 1U0QA 1I3GH 1IQDA 5JW4Q 2CIKB 2ZSVA 3CH8A 3T2NL 3B9AA 2BDNL 3I6GA 4JRXE 4FQHA 4G6FB 4NQCB 3V6FB 3QUML 2X7LA 4WDIA 2AK4B 4IS6A 5B39A 5B8CB 1J1OH 1YN6B 5GRJH 5FKPB 2W92A 1OAUL 2AV7B 1U8IA 4C4KO 4IIQB 1KJ3H 1T7YA 2LVEA 3B6SA 4NKOA 1KCRL 4PJ5B 5E56A 3WMSA 2C3XA 3WYRA 4ONGL 4QXUL 1GZQB 5JOFA 5KSBB 3W11C 5IGXL 2N7BA 3EO9L 3DECA 3P30H 5LG1A 1OHQA 3TBVB 3A6CH 3D9AH 4KRLB 5DO2C 4KZEL 1OF2A 3ALPA 4PJAE 4OF3A 5HI5D 3JUYA 3V6OC 4PRAA 1U8PA 2BSSB 2GTZB 3SDXA 3NFPA 1U95A 4LDLB 2CPCA 4J2XA 3ZL4L 4KUCD 3LIZL 1A6UH 1YUHB 1QRNE 1U6AH 3QUZB 2AJSL 4NFCA 1G6RL 1H3UA 2YSSA 1MFBL 5E5MB 2GAZB 5ESAB 2VDMH 3BN9C 2NY6D 3D6GA 4ZNEE 1KN2L 1Z3GH 4C55A 3GSNA 2X10A 3QEQD 4JFZH 1FSKB 1Q0YL 4ZDHA 2Z35A 2MOVA 3PWNB 2YD4A 1F2XK 5JORA 4NO2A 2HN7B 4KZDH 1BAFH 1IC5H 4L1DA 5B8CC 4HIHB 4QRPE 5TJWK 2YMXH 3MSPA 4MZ2A 4LHUA 3L3HA 4XP6L 3DVNA 4P57A 2EE2A 3FO2B 4WI9A 5TDPA 3LKRB 2IFGA 1KJ2L 3C5JA 3MRGA 4PJCE 2A6IA 5DJ8A 5IROA 5ILTH 7FABL 1CT8B 5EOTA 1WICA 3K4DA 1IILE 1N4XH 3BQUB 3IJSB 3QFJD 3EO1A 3MCG1 4R4BB 4HWBA 3NCYS 1ES0B 3KPQA 2PNDA 3JTSA 4MXQC 4PJEB 4LSQH 3O41A 1R5WB 3GMRB 1DBAL 2DMKA 1B0RB 1NSNH 4L4VB 4WEBH 4QXTB 4HKBA 3QUZC 1RJYA 1MF2H 1WWWX 2VH5L 1URLA 2DM4A 3GEWB 5IHUH 2Y07L 3HMXA 1PKQA 3M8OH 4GAGL 4QOKE 4HUXA 1FAKT 3MJ6A 2ID5A 2R2BB 4GRLD 5KSAB 3RVVC 1AP2B 4I0PD 1GVIA 4MJ5B 4LCWD 3WFBL 1DQDH 4P5MA 5IHZB 1ED3A 1KTRL 4X6DB 3S37H 4X7FC 2IH1A 1BWWA 1S7RA 3TT1L 5JDJA 2G5BA 1PZ5A 4GKSB 4PLKD 3MV8E 4H0HB 2DBLL 3I6LD 2G75B 4WI4A 1KCVH 3WNNA 4K8RH 1CF8L 2APFA 4OZIE 4U1HB 1NBZB 3HN3A 4LLWA 4XI5C 2WIMA 3M45A 4G9DA 2R1XA 2AQ2A 3IS1X 5J1AB 3VXSB 2IQAB 5GGSA 3BO8A 1RURH 4UOW0 1A6ZA 2GJJA 4RMQA 4UNVA 2OM5A 5TDOA 4CW1A 4K7PH 4MA8H 1YC7A 5K9OB 1UB6A 3GSUA 3HA0A 2PW2A 3K0WA 4Q9CA 1WWAX 1M7DB 1WBYA 4J3WA 2Q6WA 3U79A 5BMFL 4P3DB 4QGTA 4X99A 1A1NB 1WAAE 2WWMC 1FFPB 2PW1A 5D71L 4IRSA 1CE6A 2Q3AA 3IU4H 4OCXH 3ABZA 1WVZA 4Z7VA 4GKNA 2NW3B 3MACH 3MCKB 5FXCH 5KSAC 4LASL 1IAOB 4OV5A 1OAZH 2CO7B 3NABH 4QWWC 1J05A 1S7XA 4HLZH 3IRPX 3MNVB 5ISZA 4ZQKB 3NA9L 2R39A 1QSFB 3NIFE 1I1AA 2DTMH 4PJFF 3FB5B 4DKEH 3B5TA 4M5ZH 1A6TB 2YEZB 5F7EH 5F3BA 4P2OB 3TA3B 1Q38A 5C0CD 2WBJB 2O5YH 4LLQB 3RY6C 2NR6D 4GRMB 3HNSL 4P46C 4ETQB 1BFVL 1X5AA 3C2SA 1CDHA 2VDOL 4AIZA 5DS8B 4NO0B 3RBSA 4LSRH 1T66D 4IHOB 2G60H 3TIDA 4G7VL 5GRVL 1KLUB 3C6SB 5ACMA 1EPFA 1HKLH 2PTTB 4WO4D 2R4SH 3CSPA 4C56A 3E3QE 2IFFL 4DN4L 4PJXB 1GGIL 5DHVH 2E7BA 35C8L 3PV7A 4FFYL 4JQXA 5SWSD 1I3RA 4CNIB 4ZFZB 2X4RB 3DMMC 3QO1B 4YPGB 3CC5B 4PB0H 1T7XA 5E9DE 2ZG1A 2DQFB 1N0LA 3W9EB 2V7HB 4UDUB 3B5GA 3MUZ1 1AGFB 3HRPA 2BC4B 5HGBA 3H3PH 1CDBA 4WW1B 2PETA 3ARGA 4R6UA 1SY6H 1D5BB 1G9NC 2Z0BA 5CGYC 1YQVH 3GUTB 1CU4H 3LSOB 1IEHA 4OZGF 5F96L 1O5DT 2HJLB 3I3DA 3UTSA 3BDYH 2H32B 4MLSA 3ZE0E 1DFBH 1U36A 2NX5E 2W9LA 4K07A 4G5ZH 3KLHC 4N90D 4EI6A 3G6AA 2DMCA 4UTBH 4PY7B 4Y16D 1KFAL 1PY4A 2BY3A 5MHSE 4MB5A 4QHLB 4IRJB 4P4KB 2ZOKA 4O02H 1A7QH 5DMJB 5DVLA 1Z9OA 1MWAH 1NC2B 3VXQA 2W07A 5DT1H 1FNEB 2JB5L 1RJLA 2IMNA 5ALCL 4KGJA 5JHDE 4YDVB 5D1XB 2CKBA 3VDAA 4QRRA 2NY1D 1BOYA 2VJXA 3LKOB 1T2QL 1I8LA 2X40A 4M6AA 1I75A 4Q0XL 3O2WH 5C0BA 1NCWL 1WBZB 2G9HB 3D2UD 5LCVL 1QQDB 3MRKA 2AJUH 5DHYA 4JHBA 1RZJL 3STZA 1NEZA 4HC1A 4PPTA 2JCCE 4JY4A 3CDGA 4U3HA 3D3VD 3KPOA 3N9GH 4GRWE 3LRSB 3L3KA 5J06A 3C5ZB 2BVYA 5JA8B 5JW3H 2XY1A 1JNLH 1ZK9A 2WP3T 2BOBA 2YN3A 1NGQL 4N68A 1BD2E 1FL5B 1MUJA 1P7KB 4LSUH 1A22B 1P9MC 2OJEA 2BVQA 1N8ZA 1CFQB 2FB4H 1YMME 4I9WE 1R3LB 6FABH 2D7TL 3NPZB 3N06B 1PG7W 5AZ2H 3ESUF 4RMUA 1PG7L 4HUVA 2CUIA 4HWZB 2CDEA 1EEZA 1XF1A 1QYGL 4P4RA 1G7LA 4WFHD 1RK1B 4YAQB 3QDMA 3O0RH 5D1XC 3E6HB 1LO2H 1RUKL 4CVXB 1WUNT 4PJIB 1PVHA 4WEMB 2X9XA 2DWDA 4KJWD 4O9HL 5E6IA 1NUNB 4URTB 5EC1B 2GQHA 5HPOA 5HHNB 1KN4H 1GGCH 1N7ML 5H94A 1KIPA 5FA3A 3RIAF 2SEBB 3H42H 3VD5A 1EHXA 4KH2A 3QG6A 4U6XA 1HIML 3VI3F 2O5XH 3PWVB 5DJDB 3WEXA 3QCTL 1MLCA 3VG0H 2CDFB 2AAVA 4CMHB 3A6OA 4HBCL 3C5ZC 5ELIA 4ZUWB 1AY1L 1RFDH 2P7TB 5C0AE 4NN7C 4BQCA 3PHQB 2O5ZL 2Q7YA 3W5MA 2UWEB 2VABB 5C6TH 4MDJB 1CL7L 1DLFL 5CHNB 5IVZB 5KSUA 2KQNA 4QHUB 1JK8A 3NAAH 4XCFH 1YMHA 2VN4A 1OAXL 4OFIA 5F1OB 2C26A 2Z93B 4P59L 5DJAA 5C6PB 4NRXB 1SMAA 4LBEA 2O61A 1Q9KB 4GG8A 3B2VL 3BN3B 1I8KA 1Q72H 4JKWA 2VDQH 2J12B 4KU1A 5FA4B 2PR4L 1T3FA 1IGFL 3BAEH 4GSDL 5K9JH 4YEFA 1VADB 1YDPA 1RJZA 3H9SD 4U7MA 2GKIA 5D7LB 2VAJA 4TN9A 4GRWH 4MJ6A 1S7QB 1GC1H 5IK3A 4RRPA 4HX1A 1FZOB 1T04B 3HI6L 5FOBB 5EU7E 4U0QB 3SGKA 1C7SA 2IMMA 4RGNE 2B2XH 4PRIE 3BKYL 2FJHA 5I1DB 4JZOA 4U33A 5C0JA 3VFTB 3SGEH 1A6AA 1CFTA 3QDHA 4HCRL 4MXWL 3D48R 1KCUL 2CMRL 4GXUN 3KLDA 4LPTA 3O3DB 3NIGE 1ZVHA 2BRRH 1OGTB 3ZTJH 5K9KA 4X7TB 5GGQL 1DE4B 3HB3C 4K94C 3IFLH 1A7OH 3T3PF 1B2WH 1NJ9A 5HJ3A 3ARVA 1H3PL 1DBBL 3QQ3A 4JHWH 4Z0BL 2EXWD 4NNXA 3T1FA 3S5LA 4G80B 4EOWH 5ECJE 4NYLB 2MQCA 5EO0B 3UYOD 4PGBA 2HKFH 2YPLE 1T1ZA 1T5XB 4KI1A 4HKJA 3QFDA 5IB4A 4M4RA 4WRLA 1BGXL 1AKJA 5DJ6A 2R15A 2J88L 4RA3A 3RI5F 4WVRA 3S36L 3A6BL 3BEWA 4Y2DD 4XNYH 4MQXD 2OXGA 5GRWA 1W72H 1X4XA 4S10A 2F8XC 1AGBB 4LSTL 3QWOB 2X89D 4HIXL 1YEJH 2J6EL 2ESVE 4EN3A 3NMEA 1AXSB 3O8XD 2XWBA 3H6JA 3F5WA 3RGVD 1KEGH 1UWEH 2VL5A 5D72H 1FYTA 5EORL 3UDWC 4JM2F 2PYEB 4ZS7L 4XPHL 1IZJA 3MRQA 2RCSL 4WGWB 4LLUA 4NCC1 4JFDE 4MA3B 3O4LD 1BQLH 3D39E 4L4VD 1F4HA 1MHEA 3MRHB 1F5WA 5AYQA 3S35X 3ULVE 4YUEH 4LVOB 1HSAA 3NIDE 4RISL 4RAUA 3DXAB 4O2CB 5D2NC 4JDZA 3L3DB 1BPVA 5MEPA 2ZNXA 5TDNB 5T5FH 5I1CL 1CZ8H 1QSEA 3SDCA 2WWKO 5J4MA 1IGIH 5MP6L 2FRGP 5D1QA 3EHBC 4XWOC 4JKMA 3TNNA 4GT7A 4O5LL 5E7FA 2DKUA 3LRHA 3LEYL 5F88B 1HHHA 3T0ED 2YRZA 4OLYL 2ED8A 4CMMB 5FKAA 2FX9L 1CIUA 3BVNA 1QFPA 2ZP0T 3HAEH 3QP3A 3KPLB 1ITBB 2Y9RT 5A43C 2GJZA 1X5GA 4CU6A 4EKXA 2NY3B 2NY5L 1AXTH 4NSKA 3PWLA 1R0AL 1MHPL 3B4NA 3HRZA 4L3CB 5F9DC 2W9EL 2GI7A 5DJ0A 5DD5L 4LSVH 2DQJL 4ODSL 3FO1A 1J0YA 3GJFK 3PABB 4JQVA 5CZXC 5HGAA 3MOBH 3JV4B 3FB8A 1AIFA 1G0XA 3NTCL 1I7UA 2ZCHL 2HTLD 4MAYA 4ODBD 1MHHA 2L7UA 3QDGE 5CZVL 4G3YL 1E4WH 3F7YB 3TM6A 3K8KA 1AR1D 3V6ZB 3FTGB 5ID1A 4DGIL 4KRPD 4ZD3H 1IGJA 1RIVH 5E2WH 3RWFB 2XN9D 1ZLUH 4JRXA 1RULH 1VPOL 5IM7B 4ZFFA 1JYVA 1XGPA 2OJZL 3S4SG 5HVGB 2IPUG 4EQ3A 3VGEA 3Q6GL 5ICZB 2H41A 3EOTH 4X4ME 3EKCA 3NH7H 1ZHNB 5D8JL 2CK2A 4YXLH 1UXWB 3MXVL 3BDXA 1UC6A 1EEUA 2GFBA 4NQDB 5EBWB 4Y19D 3FL7A 1PDKA 1XR8B 3U0WL 3MV7E 1WCQA 3N1FC 3ULVH 4HWBL 3ROOA 4OM0H 5BO1H 5DA4A 5CD5D 4R7DB 5KVDL 4MNQB 2BFVH 3D87B 4JN1H 4PP1D 4ODUA 3PGCB 3QI9B 5BVPH 4CU8A 2X4QB 5EBMA 4WWKA 3BHBB 3HMWL 1LNUB 5E8PA 3UBXI 3VW3H 4UUJA 2MCPL 1VGEH 2HWZL 4S1SL 4BZ2H 3HMXL 2P5EB 4NO5B 2ZJSH 2FNBA 1DDHA 2NY4D 4L8BA 3BI9X 4PS4L 5AYUL 1MJUL 4ODHH 5A2LH 4OT1L 4GAFB 4LCIH 3RUGE 1XIWB 4QRPA 3RVTD 2W9DL 3WUZA 3V52L 1YPZF 3W81A 3BKML 4ZS6D 3V4PL 5E8DL 5AWNL 4HF5H 3TO4C 4Y88A 5EIQA 1YEKL 1N5YH 3HNVH 4ODVL 5FHBH 2MPAL 3ES6A 1TQCC 3O3EA 3X11B 5I17B 2V2XA 1C5DA 2D7MA 4PJCA 3GZKA 1FCCA 3QCVH 2VISB 3DX9B 2OL3H 4GH7B 1KELL 4M1CD 3MRFA 3ILPB 1LQSR 4Y4HD 4NPYB 4PGZA 3FFCD 4W6WB 4F15C 1Z9LA 3QUYA 4JKPH 4N0YH 2R1WB 4XBEL 3QIWD 3TBWB 3H2WA 4PRBA 3QI9C 2GYSA 1A64A 1MCEA 3CPLA 5BOPA 4Y5XA 3I85A 5I1HH 2Z31D 4UILH 1V7ML 4QOKA 4HHAB 1JVKA 4MD0B 4X5XB 3RL2B 1FN4A 3PWPA 1E4KC 1G6RB 3QRGL 1AO7E 4F7MB 4OLUL 2VTFA 5CINL 2EH7H 4NKIH 4F7EA 3VRIB 5DSCB 5I9QC 1NMAH 2AXJA 1XIWC 1DANU 3SKMA 3IETB 2NMSA 4YGAB 3U6RA 3MV8A 4Q6IA 2KH2B 2A9ML 4LLVA 5DMGC 4XP9L 5I66B 1FC2D 4FQIH 4NNPH 1QBBA 1HILB 3DSNA 3T8XA 4OF0A 5DEFA 1A7NL 5K9QG 2FR4A 4KI5E 4X7CC 5E1AB 1SY6A 4CADA 2XYCA 4OD3L 5CEZL 4WU7A 1OCWH 1UA6L 1BBDH 4CU7A 43C9A 2DM7A 3D85A 1PSKL 2IG2H 5KVFH 2QQKL 4ONFH 5DK0A 4G7YH 3PHOA 1MIML 4G8GB 2NY6C 4JM4L 1KJ2B 4PGEB 2VE6A 3UO1L 4RWHA 1BZ9B 1T5WB 4Q6YA 4M9OA 4AT6B 1M71B 4WV1A 1MWAA 4F57L 2Y7QA 3QQ4B 2NNAB 5E7BA 3VXRB 5FYJL 1T7ZA 4DUVA 5IKCA 1BREA 4WHDA 5HGHB 3MFGB 3L7EA 3L1OH 2NY0B 3RU8L 4JFFE 5E70A 3GNML 3V4VH 5JDSA 2X6MA 1CGYA 4JG0L 3TBTA 3BIKA 1MPAL 4APQC 3VH8B 2AP2A 7CGTA 3QJHA 1P4LA 3CSGA 3Q1SL 3MNZB 3GSXB 2ZUQB 5EBLA 1PLGH 1JJUA 1QFWH 4MX7B 4LARH 4Z7NE 5MI0C 1SYSB 5T1KD 1UCBL 3U46A 1FIEA 4GW1A 1I4FB 2FGWH 4JRYA 5EOCJ 4XTRD 3MMEB 2H9GA 4BH7B 5I2IB 5KVGL 1ACZA 2GJ6D 3QQNA 3IDUA 4NUJA 1ZANH 2HP4A 2AW2A 4Y4KB 4C57C 1O0VA 3CZJA 5DJYA 3ARFB 2CKBL 1RUQL 3S3SA 1OY3B 4Q7DA 1KB5A 2R23A 4GRLC 2X4TB 3DYMA 4NWUL 4P5TB 2DMBA 4I0PC 3GIZH 4FQXA 3AS1A 5LBSL 3V6OE 2Y6SC 1FC1A 3O6FA 5E9DA 4N1HB 1Q9OA 1OW0C 5CWSB 3AM8A 3DUSA 3JTTA 4HC1L 4PLKC 2CLRB 1YNTB 2ZOLB 5FYLE 4ZO8A 1G84A 5T1DH 4YHOH 3OAYK 1XAUA 3QUKA 4PJ7F 4ZO6A 4JHAL 1MELA 3L3IB 2AI0L 4NM8H 4X6CB 4OLZH 2NX5A 3D0LB 4M43L 3IDMB 1T4KA 3PGFL 1MFAL 5C0GA 1HHJB 3UYRH 3MGOB 5A2KH 3WHXB 3WIIH 1K3ZA 1QNZH 3D0VA 5IQ7H 1OM3H 2VZOA 4YFDB 4NQCE 4KTDL 2AK4E 4PRPD 2K3TA 3IDXH 3UPAA 5JHDA 4M7JL 4KV5F 4X4XB 1FFOA 3KYNB 3GM0A 1CFBA 1UEMA 1QTYT 4PJ5E 3E6FB 3AVEA 4OZHE 3IJHB 1LK3L 1QBMH 4KXZH 3X14B 1G9MH 1FYHB 3MR9B 3QHFL 2HLAA 4H1LB 4LCCB 3OXRA 4KC3B 2DLHA 2AEPL 4L8CA 1JMXA 1ZHBB 3PXJA 3UTQB 5I8OH 3OAUH 1RZ8A 1NCBH 3GSVA 2AJYL 1IC4H 4TUJA 4L4TB 1VEPA 2XOTA 4NZUH 2YD5A 4TPRH 4LP4A 3OG6B 5JIHA 2NR6C 1JPSL 5JW5B 3RIFK 2HFEB 3WLBA 1MHCB 5I1KH 4OB5H 2DAVA 3DSFL 5HHVL 2EDYA 3FT2B 1T66C 4GW5B 1HH9A 4TVPD 3I2CH 1QBLH 1YMMA 4I3SH 4HGWB 3S88L 1D5MA 1VFUA 2ZNWA 1MH5A 5HI3C 4GG6E 4OIBA 4HFWB 3AU1B 2VDPL 3LKSB 5EH1A 4XNZB 4YXKH 4L3EB 4PJGF 4X80H 1KEMH 2XI9A 5GRYA 1JWSB 2OSLB 4O4YH 4UOJA 1CG9A 5FYLH 3QO0A 2VXTL 1KENH 3BUYB 1IL1A 1XF5A 2HTKC 1D5ZB 3TGXA 2YK1L 5ANMA 1A1MA 2FSEB 3L5WA 1HHGA 3IFPB 1U8QB 4K3HA 3RJDA 5HHPA 4XNXL 2XZAH 4U1IA 4UB0L 5GGTL 3VA2C 1WQVT 2FL5B 3RX8A 2GSIB 1J0HA 4YHNB 2X1PA 3OKLB 5IR1B 3NCBB 4G9FD 3UAJD 4OTXH 2D0GA 2JJSC 1K8DB 2P24A 5T1LB 3FKUS 5CILL 4HMEA 4PLJD 1IAII 1JV5B 1NC4A 3WFHA 5HDBF 4ZG1A 1JPFB 3CVIH 1H0DB 3BIAX 5C0AA 2DF3A 5EA0H 5K59E 1HI6A 3VXUE 4X9BA 4ZPTB 3ARBB 3G6JA 1JGVL 1QEWB 5C09A 1HQ4B 1W72A 4OUOA 2NY1C 4WU5A 4DJMA 4F3FB 4O51B 1N0XL 5L9DH 2I5YL 4NKQB 1GPOL 4RWYL 1NGWA 1T83A 2GCYA 3BZ4A 4L9LC 5I30H 4DVBA 2ITDA 1SEQL 1VKXA 3CX2A 2BNQD 2ILLA 5SWZE 4XNZC 2EYSB 1U3HA 2YA2A 2CUHA 3U7WH 4CDHA 1PJ9A 3UPRA 4E0RB 4NKDB 4JQIL 1YEFL 4XCNA 1T1YB 3WNPA 1AR2A 3TIEA 3I3EA 5IW1B 3DIFA 1I3GL 1Y6KR 2AV1B 2ZG3A 4RNRA 3KYMB 1CD8A 1HXMB 1S3KH 4HPOH 5DUBB 1MCFA 2EDBA 5IW6B 3RPKA 1J1OL 5JXEA 5GRJL 5DJ2A 3IDGA 1IM9B 4LPCA 3WJJC 5HHQB 3ZLQC 2DI9A 1L6XA 2D31B 1KJ3L 1CICA 4HK0B 1IGYB 3BZFB 5L0QC 3GMNA 1R3HB 1GRWA 5FO7A 2B1AH 3P30L 4NQUA 2GEEA 3ARBC 3KNBB 3FQTB 3EYVB 1J11A 3C5SA 3D9AL 2VO5A 1HCVA 4E41B 4GKZA 3MJ7A 4WHYH 1MFCH 3VG9B 3VXNA 4KJWC 3RTQB 4QHNB 5D96B 3BKJH 3CFEA 1QSFE 4WWID 1U8LA 5FYKD 4QRTB 1A6UL 1C5CH 2CK0H 4U1MA 3STLA 4H20H 1J8HD 3SDAA 4LU5H 3WE6A 1M7IA 2IC2A 2NW2A 3HE6D 4NQEB 2VDML 4V1DD 4Y1AE 2RFXA 4Q9RH 1JGLH 4GBXA 4LVHB 4XNQB 5HYQB 2ICEB 4JFZL 3S9DB 2DQIH 2M1KA 2CO6B 1OGAB 4AIOA 4CDGC 5DRNB 4KZDL 1IC5L 4N8VA 3WJLC 4B53A 2YMXL 1A21A 3TZVD 4Y5YA 3VFSB 4NRYB 4R2GD 3OR6A 4NQXA 2VRAA 2XY2A 1J5OH 4ZSOB 4R7NA 2V9TA 1MCBA 3KPRD 4JFDA 4M62H 1QRKA 5HHOD 4IOFD 3D39A 5ILTL 4OCNC 2IBBA 5ICXA 5ENWB 4CN4A 4Z5RA 1N4XL 4GQPH 5DEZA 3A67H 3EO0B 1JCKA 3ZZ1A 3VG9C 3P11H 4XHJD 2Q8BH 4JPIB 4ZUTA 3M07A 4Q9QH 3MV9D 1PQZA 3GSRB 5J9PA 1ZHLB 4LSQL 3AROA 1J87A 3VJ6A 5B38G 4X7DC 1MJ7H 4ZOCA 5BJTA 1NSNL 5JOPE 4WEBL 4LLAA 5DVKA 1CS6A 3BP7A 1II4E 5BZWB 5CUSH 3U0TA 1UJ3C 5IHUL 5JNYA 1H3GA 4XVSH 3M8OL 3KWWA 4LLMA 2X4PA 3NPSB 5J7CC 1ORQB 3FRPG 1KSRA 1WIUA 5F9JA 2FX8H 1UB5B 4M1DH 3ROLA 3VFPB 2P8LB 1DQDL 1G9NH 1D5IH 3BJ91 2EXWC 3IJYA 32C2A 1M4KA 4NCDA 4JDTH 1J8KA 1K4CA 5DC9B 3DGCR 1IZKA 1IC1A 1JMZA 3KLAA 2R1YA 3KXFB 2E7LC 3HPLB 1KCVL 1VCAA 4K8RL 2DB8A 4ZOBA 1FRGL 4W6YB 2OL3A 4ORGA 4LNRA 3QDGA 3TYGL 1RURL 3GMPA 2ICWI 3NFNA 2BXYA 4XCEA 5HYJE 1ZWIA 4CL7A 1KCLA 3Q5YA 4K7PL 4PRDB 4MA8L 1E0OB 5F7HA 4Y2DC 4JFPB 1DSFH 4M6MH 3P73B 1BQHB 2FEEL 3TFKC 4HUNB 1KNOB 3VFVA 4YDLB 3VXMD 3TN0D 4HIEB 2BNRB 3LCYA 2YRPA 1EO8H 3DRTB 2IAMB 3QQ9C 4X4MA 3O8XC 2ZSVB 1EZVY 4OCXL 3IU4L 3I6GB 1N6UA 1KGCD 2X7LB 4FP8H 3MACL 2C7UB 4UT7H 4CJ0A 2MJWA 5C3LD 1ETZA 1OAZL 1S7UB 3NABL 4K7FA 4P2QD 2E6PA 4BKLA 4PJIE 4NKOB 3MV7A 1WFUA 3EDFA 1ZGLA 2DTML 4DKEL 3HUJA 2H32H 4PJ8B 3IDYB 4M5ZL 4FABH 5IMOA 5F7EL 1I7TA 2EIZA 3OXSA 1S8DA 1X6NA 3G6JF 2O5YL 4UINH 3MLXH 1YN7B 2BNUA 4UIMA 2UY7A 3PDOA 3SDXB 3NFPB 1R6VA 2I07A 3T4AA 3HE7B 2UYLB 1MCKA 4HJJH 4LSRL 3K1DA 2G60L 2UZIH 4D8PB 2A74B 5EOQH 4J8RB 4EUPB 5M7QA 5E99H 1P4IH 3CFCH 2G2RA 4EVNA 1JHKH 1HCFX 4FFWC 3T0EC 1SJXA